data_2E3O
# 
_entry.id   2E3O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2E3O         
RCSB  RCSB026184   
WWPDB D_1000026184 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2E3M . unspecified 
PDB 2E3N . unspecified 
PDB 2E3P . unspecified 
PDB 2E3Q . unspecified 
PDB 2E3R . unspecified 
PDB 2E3S . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2E3O 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-28 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kudo, N.'      1 
'Kumagai, K.'   2 
'Wakatsuki, S.' 3 
'Nishijima, M.' 4 
'Hanada, K.'    5 
'Kato, R.'      6 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for specific lipid recognition by CERT responsible for nonvesicular trafficking of ceramide.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            105 
_citation.page_first                488 
_citation.page_last                 493 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18184806 
_citation.pdbx_database_id_DOI      10.1073/pnas.0709191105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kudo, N.'      1 
primary 'Kumagai, K.'   2 
primary 'Tomishige, N.' 3 
primary 'Yamaji, T.'    4 
primary 'Wakatsuki, S.' 5 
primary 'Nishijima, M.' 6 
primary 'Hanada, K.'    7 
primary 'Kato, R.'      8 
# 
_cell.entry_id           2E3O 
_cell.length_a           55.958 
_cell.length_b           57.068 
_cell.length_c           88.661 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2E3O 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Lipid-transfer protein CERT'                             28931.764 1   ? ? 
'CERT START DOMAIN (RESIDUES 347-598)' ? 
2 non-polymer syn 'N-((E,2S,3R)-1,3-DIHYDROXYOCTADEC-4-EN-2-YL)PALMITAMIDE' 537.901   1   ? ? ? ? 
3 non-polymer syn 'DIMETHYL SULFOXIDE'                                      78.133    2   ? ? ? ? 
4 water       nat water                                                     18.015    225 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Goodpasture-antigen binding protein, GPBP, CDNA FLJ34532 fis, clone HLUNG2008235, highly similar to Homo sapiens goodpasture antigen-binding protein (COL4A3BP)mRNA
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SNSLHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHA
VKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVC
NFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRF
TSYVQEKTAGKPILF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNSLHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHA
VKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVC
NFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRF
TSYVQEKTAGKPILF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   SER n 
1 4   LEU n 
1 5   HIS n 
1 6   TRP n 
1 7   PRO n 
1 8   THR n 
1 9   SER n 
1 10  LEU n 
1 11  PRO n 
1 12  SER n 
1 13  GLY n 
1 14  ASP n 
1 15  ALA n 
1 16  PHE n 
1 17  SER n 
1 18  SER n 
1 19  VAL n 
1 20  GLY n 
1 21  THR n 
1 22  HIS n 
1 23  ARG n 
1 24  PHE n 
1 25  VAL n 
1 26  GLN n 
1 27  LYS n 
1 28  VAL n 
1 29  GLU n 
1 30  GLU n 
1 31  MET n 
1 32  VAL n 
1 33  GLN n 
1 34  ASN n 
1 35  HIS n 
1 36  MET n 
1 37  THR n 
1 38  TYR n 
1 39  SER n 
1 40  LEU n 
1 41  GLN n 
1 42  ASP n 
1 43  VAL n 
1 44  GLY n 
1 45  GLY n 
1 46  ASP n 
1 47  ALA n 
1 48  ASN n 
1 49  TRP n 
1 50  GLN n 
1 51  LEU n 
1 52  VAL n 
1 53  VAL n 
1 54  GLU n 
1 55  GLU n 
1 56  GLY n 
1 57  GLU n 
1 58  MET n 
1 59  LYS n 
1 60  VAL n 
1 61  TYR n 
1 62  ARG n 
1 63  ARG n 
1 64  GLU n 
1 65  VAL n 
1 66  GLU n 
1 67  GLU n 
1 68  ASN n 
1 69  GLY n 
1 70  ILE n 
1 71  VAL n 
1 72  LEU n 
1 73  ASP n 
1 74  PRO n 
1 75  LEU n 
1 76  LYS n 
1 77  ALA n 
1 78  THR n 
1 79  HIS n 
1 80  ALA n 
1 81  VAL n 
1 82  LYS n 
1 83  GLY n 
1 84  VAL n 
1 85  THR n 
1 86  GLY n 
1 87  HIS n 
1 88  GLU n 
1 89  VAL n 
1 90  CYS n 
1 91  ASN n 
1 92  TYR n 
1 93  PHE n 
1 94  TRP n 
1 95  ASN n 
1 96  VAL n 
1 97  ASP n 
1 98  VAL n 
1 99  ARG n 
1 100 ASN n 
1 101 ASP n 
1 102 TRP n 
1 103 GLU n 
1 104 THR n 
1 105 THR n 
1 106 ILE n 
1 107 GLU n 
1 108 ASN n 
1 109 PHE n 
1 110 HIS n 
1 111 VAL n 
1 112 VAL n 
1 113 GLU n 
1 114 THR n 
1 115 LEU n 
1 116 ALA n 
1 117 ASP n 
1 118 ASN n 
1 119 ALA n 
1 120 ILE n 
1 121 ILE n 
1 122 ILE n 
1 123 TYR n 
1 124 GLN n 
1 125 THR n 
1 126 HIS n 
1 127 LYS n 
1 128 ARG n 
1 129 VAL n 
1 130 TRP n 
1 131 PRO n 
1 132 ALA n 
1 133 SER n 
1 134 GLN n 
1 135 ARG n 
1 136 ASP n 
1 137 VAL n 
1 138 LEU n 
1 139 TYR n 
1 140 LEU n 
1 141 SER n 
1 142 VAL n 
1 143 ILE n 
1 144 ARG n 
1 145 LYS n 
1 146 ILE n 
1 147 PRO n 
1 148 ALA n 
1 149 LEU n 
1 150 THR n 
1 151 GLU n 
1 152 ASN n 
1 153 ASP n 
1 154 PRO n 
1 155 GLU n 
1 156 THR n 
1 157 TRP n 
1 158 ILE n 
1 159 VAL n 
1 160 CYS n 
1 161 ASN n 
1 162 PHE n 
1 163 SER n 
1 164 VAL n 
1 165 ASP n 
1 166 HIS n 
1 167 ASP n 
1 168 SER n 
1 169 ALA n 
1 170 PRO n 
1 171 LEU n 
1 172 ASN n 
1 173 ASN n 
1 174 ARG n 
1 175 CYS n 
1 176 VAL n 
1 177 ARG n 
1 178 ALA n 
1 179 LYS n 
1 180 ILE n 
1 181 ASN n 
1 182 VAL n 
1 183 ALA n 
1 184 MET n 
1 185 ILE n 
1 186 CYS n 
1 187 GLN n 
1 188 THR n 
1 189 LEU n 
1 190 VAL n 
1 191 SER n 
1 192 PRO n 
1 193 PRO n 
1 194 GLU n 
1 195 GLY n 
1 196 ASN n 
1 197 GLN n 
1 198 GLU n 
1 199 ILE n 
1 200 SER n 
1 201 ARG n 
1 202 ASP n 
1 203 ASN n 
1 204 ILE n 
1 205 LEU n 
1 206 CYS n 
1 207 LYS n 
1 208 ILE n 
1 209 THR n 
1 210 TYR n 
1 211 VAL n 
1 212 ALA n 
1 213 ASN n 
1 214 VAL n 
1 215 ASN n 
1 216 PRO n 
1 217 GLY n 
1 218 GLY n 
1 219 TRP n 
1 220 ALA n 
1 221 PRO n 
1 222 ALA n 
1 223 SER n 
1 224 VAL n 
1 225 LEU n 
1 226 ARG n 
1 227 ALA n 
1 228 VAL n 
1 229 ALA n 
1 230 LYS n 
1 231 ARG n 
1 232 GLU n 
1 233 TYR n 
1 234 PRO n 
1 235 LYS n 
1 236 PHE n 
1 237 LEU n 
1 238 LYS n 
1 239 ARG n 
1 240 PHE n 
1 241 THR n 
1 242 SER n 
1 243 TYR n 
1 244 VAL n 
1 245 GLN n 
1 246 GLU n 
1 247 LYS n 
1 248 THR n 
1 249 ALA n 
1 250 GLY n 
1 251 LYS n 
1 252 PRO n 
1 253 ILE n 
1 254 LEU n 
1 255 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 CERT 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               DH5alpha 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pGEX-5X1 (MODIFIED)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q53YV2_HUMAN 
_struct_ref.pdbx_db_accession          Q53YV2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;LHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKG
VTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFS
VDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSY
VQEKTAGKPILF
;
_struct_ref.pdbx_align_begin           347 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2E3O 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 255 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q53YV2 
_struct_ref_seq.db_align_beg                  347 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  598 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       347 
_struct_ref_seq.pdbx_auth_seq_align_end       598 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2E3O SER A 1 ? UNP Q53YV2 ? ? 'EXPRESSION TAG' 344 1 
1 2E3O ASN A 2 ? UNP Q53YV2 ? ? 'EXPRESSION TAG' 345 2 
1 2E3O SER A 3 ? UNP Q53YV2 ? ? 'EXPRESSION TAG' 346 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
16C non-polymer         . 'N-((E,2S,3R)-1,3-DIHYDROXYOCTADEC-4-EN-2-YL)PALMITAMIDE' 
;C16-CERAMIDE, N-PALMITOYL-D-ERYTHRO-SPHINGOSINE, (2S,3R,4E)-2-PALMITOYLAMINOOCTADEC-4-ENE-1,3-DIOL, (2S,3R,4E)-2-PALMITOYLAMINO-1,3-OCTADEC-4-ENEDIOL
;
'C34 H67 N O3'   537.901 
ALA 'L-peptide linking' y ALANINE                                                   ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                  ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                           ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                  ? 'C3 H7 N O2 S'   121.158 
DMS non-polymer         . 'DIMETHYL SULFOXIDE'                                      ? 'C2 H6 O S'      78.133  
GLN 'L-peptide linking' y GLUTAMINE                                                 ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                           ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                   ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                 ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                     ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                   ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                    ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                             ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                   ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                    ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                 ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                  ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                    ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2E3O 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.45 
_exptl_crystal.density_percent_sol   49.70 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-12-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-6A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-6A 
_diffrn_source.pdbx_wavelength             1.0000 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     2E3O 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.550 
_reflns.number_obs                   41548 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.55 
_reflns_shell.d_res_low              1.61 
_reflns_shell.percent_possible_all   95.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2E3O 
_refine.ls_number_reflns_obs                     39436 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.00 
_refine.ls_d_res_high                            1.55 
_refine.ls_percent_reflns_obs                    99.1 
_refine.ls_R_factor_obs                          0.201 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2 
_refine.ls_R_factor_R_free                       0.218 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2111 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.951 
_refine.B_iso_mean                               19.94 
_refine.aniso_B[1][1]                            0.52000 
_refine.aniso_B[2][2]                            0.17000 
_refine.aniso_B[3][3]                            -0.70000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.085 
_refine.pdbx_overall_ESU_R_Free                  0.082 
_refine.overall_SU_ML                            0.053 
_refine.overall_SU_B                             1.413 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1956 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         46 
_refine_hist.number_atoms_solvent             225 
_refine_hist.number_atoms_total               2227 
_refine_hist.d_res_high                       1.55 
_refine_hist.d_res_low                        48.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.022  ? 2042 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.228  1.953  ? 2763 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.783  5.000  ? 229  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.203 24.000 ? 100  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.776 15.000 ? 375  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       14.743 15.000 ? 16   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.084  0.200  ? 320  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 1487 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.201  0.200  ? 951  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.305  0.200  ? 1380 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.167  0.200  ? 172  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.104  0.200  ? 23   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.183  0.200  ? 14   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.741  1.500  ? 1209 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.200  2.000  ? 1952 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.847  3.000  ? 942  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.810  4.500  ? 811  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.55 
_refine_ls_shell.d_res_low                        1.59 
_refine_ls_shell.number_reflns_R_work             2656 
_refine_ls_shell.R_factor_R_work                  0.244 
_refine_ls_shell.percent_reflns_obs               92.23 
_refine_ls_shell.R_factor_R_free                  0.266 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             145 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2E3O 
_struct.title                     'Crystal structure of CERT START domain in complex with C16-ceramide (P212121)' 
_struct.pdbx_descriptor           'Lipid-transfer protein CERT' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2E3O 
_struct_keywords.pdbx_keywords   'LIPID TRANSPORT' 
_struct_keywords.text            'LIPID TRANSFER PROTEIN, CERT, CERAMIDE TRANSFER, LIPID TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PHE A 24  ? SER A 39  ? PHE A 367 SER A 382 1 ? 16 
HELX_P HELX_P2 2 THR A 85  ? ASN A 95  ? THR A 428 ASN A 438 1 ? 11 
HELX_P HELX_P3 3 VAL A 98  ? GLU A 103 ? VAL A 441 GLU A 446 1 ? 6  
HELX_P HELX_P4 4 SER A 200 ? ASP A 202 ? SER A 543 ASP A 545 5 ? 3  
HELX_P HELX_P5 5 PRO A 221 ? ALA A 249 ? PRO A 564 ALA A 592 1 ? 29 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TRP 
_struct_mon_prot_cis.label_seq_id           130 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TRP 
_struct_mon_prot_cis.auth_seq_id            473 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    131 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     474 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       3.63 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 8 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? parallel      
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 49  ? GLU A 55  ? TRP A 392 GLU A 398 
A 2 MET A 58  ? ARG A 63  ? MET A 401 ARG A 406 
A 3 LEU A 75  ? LYS A 82  ? LEU A 418 LYS A 425 
A 4 ILE A 204 ? ASN A 215 ? ILE A 547 ASN A 558 
A 5 LYS A 179 ? VAL A 190 ? LYS A 522 VAL A 533 
A 6 THR A 156 ? SER A 163 ? THR A 499 SER A 506 
A 7 ARG A 135 ? ILE A 146 ? ARG A 478 ILE A 489 
A 8 ALA A 119 ? HIS A 126 ? ALA A 462 HIS A 469 
A 9 ILE A 106 ? ALA A 116 ? ILE A 449 ALA A 459 
B 1 TRP A 49  ? GLU A 55  ? TRP A 392 GLU A 398 
B 2 MET A 58  ? ARG A 63  ? MET A 401 ARG A 406 
B 3 LEU A 75  ? LYS A 82  ? LEU A 418 LYS A 425 
B 4 ILE A 204 ? ASN A 215 ? ILE A 547 ASN A 558 
B 5 LYS A 179 ? VAL A 190 ? LYS A 522 VAL A 533 
B 6 THR A 156 ? SER A 163 ? THR A 499 SER A 506 
B 7 ARG A 135 ? ILE A 146 ? ARG A 478 ILE A 489 
B 8 VAL A 176 ? ARG A 177 ? VAL A 519 ARG A 520 
C 1 GLU A 66  ? GLU A 67  ? GLU A 409 GLU A 410 
C 2 ILE A 70  ? VAL A 71  ? ILE A 413 VAL A 414 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 52  ? N VAL A 395 O VAL A 60  ? O VAL A 403 
A 2 3 N TYR A 61  ? N TYR A 404 O LYS A 76  ? O LYS A 419 
A 3 4 N ALA A 77  ? N ALA A 420 O TYR A 210 ? O TYR A 553 
A 4 5 O ASN A 215 ? O ASN A 558 N LYS A 179 ? N LYS A 522 
A 5 6 O CYS A 186 ? O CYS A 529 N TRP A 157 ? N TRP A 500 
A 6 7 O THR A 156 ? O THR A 499 N ILE A 146 ? N ILE A 489 
A 7 8 O TYR A 139 ? O TYR A 482 N ILE A 122 ? N ILE A 465 
A 8 9 O THR A 125 ? O THR A 468 N GLU A 107 ? N GLU A 450 
B 1 2 N VAL A 52  ? N VAL A 395 O VAL A 60  ? O VAL A 403 
B 2 3 N TYR A 61  ? N TYR A 404 O LYS A 76  ? O LYS A 419 
B 3 4 N ALA A 77  ? N ALA A 420 O TYR A 210 ? O TYR A 553 
B 4 5 O ASN A 215 ? O ASN A 558 N LYS A 179 ? N LYS A 522 
B 5 6 O CYS A 186 ? O CYS A 529 N TRP A 157 ? N TRP A 500 
B 6 7 O THR A 156 ? O THR A 499 N ILE A 146 ? N ILE A 489 
B 7 8 N ASP A 136 ? N ASP A 479 O VAL A 176 ? O VAL A 519 
C 1 2 N GLU A 67  ? N GLU A 410 O ILE A 70  ? O ILE A 413 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE 16C A 600' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE DMS A 701' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE DMS A 702' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 PHE A 93  ? PHE A 436 . ? 1_555 ? 
2  AC1 17 ARG A 99  ? ARG A 442 . ? 1_555 ? 
3  AC1 17 GLU A 103 ? GLU A 446 . ? 1_555 ? 
4  AC1 17 GLN A 124 ? GLN A 467 . ? 1_555 ? 
5  AC1 17 HIS A 126 ? HIS A 469 . ? 1_555 ? 
6  AC1 17 VAL A 129 ? VAL A 472 . ? 1_555 ? 
7  AC1 17 ALA A 132 ? ALA A 475 . ? 1_555 ? 
8  AC1 17 TYR A 139 ? TYR A 482 . ? 1_555 ? 
9  AC1 17 ASN A 161 ? ASN A 504 . ? 1_555 ? 
10 AC1 17 VAL A 182 ? VAL A 525 . ? 1_555 ? 
11 AC1 17 TYR A 210 ? TYR A 553 . ? 1_555 ? 
12 AC1 17 LEU A 225 ? LEU A 568 . ? 1_555 ? 
13 AC1 17 VAL A 228 ? VAL A 571 . ? 1_555 ? 
14 AC1 17 GLU A 232 ? GLU A 575 . ? 1_555 ? 
15 AC1 17 TYR A 233 ? TYR A 576 . ? 1_555 ? 
16 AC1 17 PHE A 236 ? PHE A 579 . ? 1_555 ? 
17 AC1 17 HOH E .   ? HOH A 766 . ? 1_555 ? 
18 AC2 5  GLN A 41  ? GLN A 384 . ? 1_555 ? 
19 AC2 5  ASP A 42  ? ASP A 385 . ? 1_555 ? 
20 AC2 5  VAL A 43  ? VAL A 386 . ? 1_555 ? 
21 AC2 5  TYR A 61  ? TYR A 404 . ? 1_555 ? 
22 AC2 5  LYS A 76  ? LYS A 419 . ? 1_555 ? 
23 AC3 6  ILE A 185 ? ILE A 528 . ? 1_555 ? 
24 AC3 6  GLN A 187 ? GLN A 530 . ? 1_555 ? 
25 AC3 6  LYS A 207 ? LYS A 550 . ? 1_555 ? 
26 AC3 6  ILE A 208 ? ILE A 551 . ? 1_555 ? 
27 AC3 6  THR A 209 ? THR A 552 . ? 1_555 ? 
28 AC3 6  HOH E .   ? HOH A 788 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2E3O 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2E3O 
_atom_sites.fract_transf_matrix[1][1]   0.017871 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017523 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011279 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . HIS A 1 22  ? 33.727 0.558   16.858  1.00 22.35 ? 365 HIS A N   1 
ATOM   2    C CA  . HIS A 1 22  ? 34.449 0.323   15.578  1.00 21.33 ? 365 HIS A CA  1 
ATOM   3    C C   . HIS A 1 22  ? 34.844 1.650   14.913  1.00 21.03 ? 365 HIS A C   1 
ATOM   4    O O   . HIS A 1 22  ? 34.366 2.718   15.303  1.00 20.85 ? 365 HIS A O   1 
ATOM   5    C CB  . HIS A 1 22  ? 33.617 -0.570  14.637  1.00 21.67 ? 365 HIS A CB  1 
ATOM   6    C CG  . HIS A 1 22  ? 32.368 0.076   14.116  1.00 21.72 ? 365 HIS A CG  1 
ATOM   7    N ND1 . HIS A 1 22  ? 31.119 -0.180  14.639  1.00 21.61 ? 365 HIS A ND1 1 
ATOM   8    C CD2 . HIS A 1 22  ? 32.178 0.953   13.103  1.00 19.35 ? 365 HIS A CD2 1 
ATOM   9    C CE1 . HIS A 1 22  ? 30.214 0.524   13.978  1.00 19.49 ? 365 HIS A CE1 1 
ATOM   10   N NE2 . HIS A 1 22  ? 30.834 1.226   13.045  1.00 22.98 ? 365 HIS A NE2 1 
ATOM   11   N N   . ARG A 1 23  ? 35.707 1.567   13.906  1.00 19.91 ? 366 ARG A N   1 
ATOM   12   C CA  . ARG A 1 23  ? 36.327 2.744   13.301  1.00 19.74 ? 366 ARG A CA  1 
ATOM   13   C C   . ARG A 1 23  ? 35.367 3.626   12.506  1.00 19.25 ? 366 ARG A C   1 
ATOM   14   O O   . ARG A 1 23  ? 35.724 4.741   12.139  1.00 19.55 ? 366 ARG A O   1 
ATOM   15   C CB  . ARG A 1 23  ? 37.499 2.324   12.408  1.00 19.65 ? 366 ARG A CB  1 
ATOM   16   C CG  . ARG A 1 23  ? 37.095 1.523   11.173  1.00 19.54 ? 366 ARG A CG  1 
ATOM   17   C CD  . ARG A 1 23  ? 38.306 0.843   10.552  1.00 20.51 ? 366 ARG A CD  1 
ATOM   18   N NE  . ARG A 1 23  ? 38.003 0.099   9.333   1.00 20.96 ? 366 ARG A NE  1 
ATOM   19   C CZ  . ARG A 1 23  ? 37.498 -1.134  9.304   1.00 19.02 ? 366 ARG A CZ  1 
ATOM   20   N NH1 . ARG A 1 23  ? 37.217 -1.773  10.438  1.00 19.64 ? 366 ARG A NH1 1 
ATOM   21   N NH2 . ARG A 1 23  ? 37.271 -1.729  8.135   1.00 19.02 ? 366 ARG A NH2 1 
ATOM   22   N N   . PHE A 1 24  ? 34.171 3.115   12.222  1.00 18.79 ? 367 PHE A N   1 
ATOM   23   C CA  . PHE A 1 24  ? 33.190 3.864   11.438  1.00 18.55 ? 367 PHE A CA  1 
ATOM   24   C C   . PHE A 1 24  ? 32.050 4.461   12.269  1.00 19.17 ? 367 PHE A C   1 
ATOM   25   O O   . PHE A 1 24  ? 31.105 5.022   11.698  1.00 19.02 ? 367 PHE A O   1 
ATOM   26   C CB  . PHE A 1 24  ? 32.616 2.984   10.320  1.00 18.25 ? 367 PHE A CB  1 
ATOM   27   C CG  . PHE A 1 24  ? 33.530 2.828   9.132   1.00 17.67 ? 367 PHE A CG  1 
ATOM   28   C CD1 . PHE A 1 24  ? 33.743 3.897   8.264   1.00 17.84 ? 367 PHE A CD1 1 
ATOM   29   C CD2 . PHE A 1 24  ? 34.154 1.611   8.861   1.00 18.01 ? 367 PHE A CD2 1 
ATOM   30   C CE1 . PHE A 1 24  ? 34.573 3.762   7.150   1.00 16.49 ? 367 PHE A CE1 1 
ATOM   31   C CE2 . PHE A 1 24  ? 34.984 1.464   7.746   1.00 16.87 ? 367 PHE A CE2 1 
ATOM   32   C CZ  . PHE A 1 24  ? 35.198 2.550   6.892   1.00 17.61 ? 367 PHE A CZ  1 
ATOM   33   N N   . VAL A 1 25  ? 32.128 4.349   13.602  1.00 19.58 ? 368 VAL A N   1 
ATOM   34   C CA  . VAL A 1 25  ? 31.048 4.833   14.476  1.00 19.82 ? 368 VAL A CA  1 
ATOM   35   C C   . VAL A 1 25  ? 30.680 6.306   14.237  1.00 19.88 ? 368 VAL A C   1 
ATOM   36   O O   . VAL A 1 25  ? 29.503 6.634   14.132  1.00 20.09 ? 368 VAL A O   1 
ATOM   37   C CB  . VAL A 1 25  ? 31.316 4.559   15.991  1.00 19.81 ? 368 VAL A CB  1 
ATOM   38   C CG1 . VAL A 1 25  ? 30.350 5.359   16.882  1.00 20.91 ? 368 VAL A CG1 1 
ATOM   39   C CG2 . VAL A 1 25  ? 31.182 3.089   16.286  1.00 21.28 ? 368 VAL A CG2 1 
ATOM   40   N N   . GLN A 1 26  ? 31.676 7.186   14.136  1.00 20.52 ? 369 GLN A N   1 
ATOM   41   C CA  . GLN A 1 26  ? 31.379 8.611   13.938  1.00 20.67 ? 369 GLN A CA  1 
ATOM   42   C C   . GLN A 1 26  ? 30.746 8.879   12.565  1.00 19.77 ? 369 GLN A C   1 
ATOM   43   O O   . GLN A 1 26  ? 29.795 9.662   12.441  1.00 19.75 ? 369 GLN A O   1 
ATOM   44   C CB  . GLN A 1 26  ? 32.626 9.481   14.171  1.00 21.83 ? 369 GLN A CB  1 
ATOM   45   C CG  . GLN A 1 26  ? 32.360 10.990  14.137  1.00 24.55 ? 369 GLN A CG  1 
ATOM   46   C CD  . GLN A 1 26  ? 31.185 11.446  15.014  1.00 28.19 ? 369 GLN A CD  1 
ATOM   47   O OE1 . GLN A 1 26  ? 31.011 10.993  16.153  1.00 30.91 ? 369 GLN A OE1 1 
ATOM   48   N NE2 . GLN A 1 26  ? 30.380 12.358  14.483  1.00 29.80 ? 369 GLN A NE2 1 
ATOM   49   N N   . LYS A 1 27  ? 31.265 8.196   11.554  1.00 18.85 ? 370 LYS A N   1 
ATOM   50   C CA  . LYS A 1 27  ? 30.731 8.257   10.208  1.00 18.45 ? 370 LYS A CA  1 
ATOM   51   C C   . LYS A 1 27  ? 29.268 7.786   10.160  1.00 17.39 ? 370 LYS A C   1 
ATOM   52   O O   . LYS A 1 27  ? 28.430 8.419   9.511   1.00 17.53 ? 370 LYS A O   1 
ATOM   53   C CB  . LYS A 1 27  ? 31.606 7.420   9.272   1.00 18.83 ? 370 LYS A CB  1 
ATOM   54   C CG  . LYS A 1 27  ? 31.166 7.433   7.832   1.00 21.39 ? 370 LYS A CG  1 
ATOM   55   C CD  . LYS A 1 27  ? 31.172 8.839   7.257   1.00 22.51 ? 370 LYS A CD  1 
ATOM   56   C CE  . LYS A 1 27  ? 30.832 8.837   5.771   1.00 24.83 ? 370 LYS A CE  1 
ATOM   57   N NZ  . LYS A 1 27  ? 31.016 10.205  5.217   1.00 24.64 ? 370 LYS A NZ  1 
ATOM   58   N N   . VAL A 1 28  ? 28.964 6.687   10.849  1.00 16.50 ? 371 VAL A N   1 
ATOM   59   C CA  . VAL A 1 28  ? 27.590 6.193   10.945  1.00 16.13 ? 371 VAL A CA  1 
ATOM   60   C C   . VAL A 1 28  ? 26.675 7.241   11.578  1.00 15.97 ? 371 VAL A C   1 
ATOM   61   O O   . VAL A 1 28  ? 25.611 7.525   11.054  1.00 16.56 ? 371 VAL A O   1 
ATOM   62   C CB  . VAL A 1 28  ? 27.508 4.855   11.732  1.00 15.40 ? 371 VAL A CB  1 
ATOM   63   C CG1 . VAL A 1 28  ? 26.053 4.499   12.088  1.00 15.19 ? 371 VAL A CG1 1 
ATOM   64   C CG2 . VAL A 1 28  ? 28.168 3.721   10.935  1.00 15.36 ? 371 VAL A CG2 1 
ATOM   65   N N   . GLU A 1 29  ? 27.095 7.824   12.701  1.00 16.46 ? 372 GLU A N   1 
ATOM   66   C CA  . GLU A 1 29  ? 26.274 8.832   13.368  1.00 16.73 ? 372 GLU A CA  1 
ATOM   67   C C   . GLU A 1 29  ? 25.983 10.047  12.482  1.00 16.22 ? 372 GLU A C   1 
ATOM   68   O O   . GLU A 1 29  ? 24.857 10.575  12.464  1.00 16.53 ? 372 GLU A O   1 
ATOM   69   C CB  A GLU A 1 29  ? 26.868 9.225   14.725  0.50 17.06 ? 372 GLU A CB  1 
ATOM   70   C CB  B GLU A 1 29  ? 26.971 9.299   14.652  0.50 17.05 ? 372 GLU A CB  1 
ATOM   71   C CG  A GLU A 1 29  ? 26.729 8.126   15.774  0.50 18.72 ? 372 GLU A CG  1 
ATOM   72   C CG  B GLU A 1 29  ? 26.088 10.139  15.565  0.50 18.78 ? 372 GLU A CG  1 
ATOM   73   C CD  A GLU A 1 29  ? 25.335 7.493   15.800  0.50 20.70 ? 372 GLU A CD  1 
ATOM   74   C CD  B GLU A 1 29  ? 24.988 9.324   16.219  0.50 20.20 ? 372 GLU A CD  1 
ATOM   75   O OE1 A GLU A 1 29  ? 24.350 8.209   16.087  0.50 21.40 ? 372 GLU A OE1 1 
ATOM   76   O OE1 B GLU A 1 29  ? 23.860 9.842   16.351  0.50 22.82 ? 372 GLU A OE1 1 
ATOM   77   O OE2 A GLU A 1 29  ? 25.221 6.277   15.526  0.50 22.07 ? 372 GLU A OE2 1 
ATOM   78   O OE2 B GLU A 1 29  ? 25.245 8.162   16.601  0.50 21.31 ? 372 GLU A OE2 1 
ATOM   79   N N   . GLU A 1 30  ? 27.001 10.491  11.751  1.00 16.03 ? 373 GLU A N   1 
ATOM   80   C CA  . GLU A 1 30  ? 26.836 11.603  10.845  1.00 16.62 ? 373 GLU A CA  1 
ATOM   81   C C   . GLU A 1 30  ? 25.852 11.250  9.733   1.00 16.38 ? 373 GLU A C   1 
ATOM   82   O O   . GLU A 1 30  ? 24.981 12.052  9.397   1.00 15.98 ? 373 GLU A O   1 
ATOM   83   C CB  . GLU A 1 30  ? 28.187 12.020  10.273  1.00 17.41 ? 373 GLU A CB  1 
ATOM   84   C CG  . GLU A 1 30  ? 29.033 12.782  11.301  1.00 19.76 ? 373 GLU A CG  1 
ATOM   85   C CD  . GLU A 1 30  ? 30.521 12.781  10.987  1.00 23.29 ? 373 GLU A CD  1 
ATOM   86   O OE1 . GLU A 1 30  ? 30.913 12.329  9.889   1.00 22.28 ? 373 GLU A OE1 1 
ATOM   87   O OE2 . GLU A 1 30  ? 31.295 13.257  11.852  1.00 24.14 ? 373 GLU A OE2 1 
ATOM   88   N N   . MET A 1 31  ? 25.977 10.042  9.187   1.00 15.77 ? 374 MET A N   1 
ATOM   89   C CA  . MET A 1 31  ? 25.097 9.631   8.097   1.00 15.76 ? 374 MET A CA  1 
ATOM   90   C C   . MET A 1 31  ? 23.652 9.480   8.574   1.00 15.48 ? 374 MET A C   1 
ATOM   91   O O   . MET A 1 31  ? 22.727 9.970   7.923   1.00 16.05 ? 374 MET A O   1 
ATOM   92   C CB  A MET A 1 31  ? 25.619 8.370   7.391   0.70 15.68 ? 374 MET A CB  1 
ATOM   93   C CB  B MET A 1 31  ? 25.592 8.308   7.506   0.30 15.74 ? 374 MET A CB  1 
ATOM   94   C CG  A MET A 1 31  ? 27.027 8.528   6.784   0.70 16.15 ? 374 MET A CG  1 
ATOM   95   C CG  B MET A 1 31  ? 24.869 7.872   6.246   0.30 16.39 ? 374 MET A CG  1 
ATOM   96   S SD  A MET A 1 31  ? 27.259 9.816   5.527   0.70 18.07 ? 374 MET A SD  1 
ATOM   97   S SD  B MET A 1 31  ? 25.166 8.933   4.816   0.30 17.59 ? 374 MET A SD  1 
ATOM   98   C CE  A MET A 1 31  ? 26.416 9.064   4.139   0.70 17.07 ? 374 MET A CE  1 
ATOM   99   C CE  B MET A 1 31  ? 26.935 8.790   4.568   0.30 17.80 ? 374 MET A CE  1 
ATOM   100  N N   . VAL A 1 32  ? 23.456 8.844   9.726   1.00 15.36 ? 375 VAL A N   1 
ATOM   101  C CA  . VAL A 1 32  ? 22.118 8.700   10.310  1.00 15.59 ? 375 VAL A CA  1 
ATOM   102  C C   . VAL A 1 32  ? 21.487 10.052  10.636  1.00 15.68 ? 375 VAL A C   1 
ATOM   103  O O   . VAL A 1 32  ? 20.319 10.293  10.323  1.00 15.64 ? 375 VAL A O   1 
ATOM   104  C CB  . VAL A 1 32  ? 22.142 7.776   11.569  1.00 16.19 ? 375 VAL A CB  1 
ATOM   105  C CG1 . VAL A 1 32  ? 20.803 7.797   12.284  1.00 17.16 ? 375 VAL A CG1 1 
ATOM   106  C CG2 . VAL A 1 32  ? 22.529 6.355   11.178  1.00 16.68 ? 375 VAL A CG2 1 
ATOM   107  N N   . GLN A 1 33  ? 22.260 10.939  11.262  1.00 16.05 ? 376 GLN A N   1 
ATOM   108  C CA  . GLN A 1 33  ? 21.727 12.244  11.637  1.00 17.20 ? 376 GLN A CA  1 
ATOM   109  C C   . GLN A 1 33  ? 21.354 13.071  10.412  1.00 16.52 ? 376 GLN A C   1 
ATOM   110  O O   . GLN A 1 33  ? 20.324 13.760  10.407  1.00 16.59 ? 376 GLN A O   1 
ATOM   111  C CB  . GLN A 1 33  ? 22.722 13.014  12.511  1.00 17.79 ? 376 GLN A CB  1 
ATOM   112  C CG  . GLN A 1 33  ? 22.156 14.337  13.046  1.00 22.24 ? 376 GLN A CG  1 
ATOM   113  C CD  . GLN A 1 33  ? 20.862 14.133  13.832  1.00 26.59 ? 376 GLN A CD  1 
ATOM   114  O OE1 . GLN A 1 33  ? 20.877 13.599  14.942  1.00 30.81 ? 376 GLN A OE1 1 
ATOM   115  N NE2 . GLN A 1 33  ? 19.735 14.544  13.247  1.00 26.58 ? 376 GLN A NE2 1 
ATOM   116  N N   . ASN A 1 34  ? 22.166 12.990  9.362   1.00 15.83 ? 377 ASN A N   1 
ATOM   117  C CA  . ASN A 1 34  ? 21.865 13.728  8.140   1.00 16.35 ? 377 ASN A CA  1 
ATOM   118  C C   . ASN A 1 34  ? 20.559 13.259  7.510   1.00 15.70 ? 377 ASN A C   1 
ATOM   119  O O   . ASN A 1 34  ? 19.754 14.070  7.037   1.00 15.45 ? 377 ASN A O   1 
ATOM   120  C CB  A ASN A 1 34  ? 23.021 13.666  7.145   0.60 16.33 ? 377 ASN A CB  1 
ATOM   121  C CB  B ASN A 1 34  ? 23.009 13.573  7.144   0.40 16.41 ? 377 ASN A CB  1 
ATOM   122  C CG  A ASN A 1 34  ? 24.105 14.679  7.457   0.60 18.42 ? 377 ASN A CG  1 
ATOM   123  C CG  B ASN A 1 34  ? 23.029 14.670  6.114   0.40 18.28 ? 377 ASN A CG  1 
ATOM   124  O OD1 A ASN A 1 34  ? 23.942 15.535  8.331   0.60 20.85 ? 377 ASN A OD1 1 
ATOM   125  O OD1 B ASN A 1 34  ? 22.498 14.517  5.015   0.40 20.51 ? 377 ASN A OD1 1 
ATOM   126  N ND2 A ASN A 1 34  ? 25.218 14.589  6.740   0.60 21.36 ? 377 ASN A ND2 1 
ATOM   127  N ND2 B ASN A 1 34  ? 23.630 15.798  6.469   0.40 20.32 ? 377 ASN A ND2 1 
ATOM   128  N N   . HIS A 1 35  ? 20.318 11.948  7.547   1.00 14.94 ? 378 HIS A N   1 
ATOM   129  C CA  . HIS A 1 35  ? 19.051 11.432  7.055   1.00 14.51 ? 378 HIS A CA  1 
ATOM   130  C C   . HIS A 1 35  ? 17.866 11.896  7.901   1.00 14.73 ? 378 HIS A C   1 
ATOM   131  O O   . HIS A 1 35  ? 16.836 12.300  7.365   1.00 14.58 ? 378 HIS A O   1 
ATOM   132  C CB  . HIS A 1 35  ? 19.080 9.904   6.932   1.00 13.44 ? 378 HIS A CB  1 
ATOM   133  C CG  . HIS A 1 35  ? 19.792 9.432   5.708   1.00 12.22 ? 378 HIS A CG  1 
ATOM   134  N ND1 . HIS A 1 35  ? 19.347 9.731   4.440   1.00 13.55 ? 378 HIS A ND1 1 
ATOM   135  C CD2 . HIS A 1 35  ? 20.927 8.708   5.548   1.00 12.54 ? 378 HIS A CD2 1 
ATOM   136  C CE1 . HIS A 1 35  ? 20.170 9.205   3.550   1.00 13.56 ? 378 HIS A CE1 1 
ATOM   137  N NE2 . HIS A 1 35  ? 21.137 8.578   4.196   1.00 13.40 ? 378 HIS A NE2 1 
ATOM   138  N N   . MET A 1 36  ? 18.022 11.871  9.220   1.00 15.20 ? 379 MET A N   1 
ATOM   139  C CA  . MET A 1 36  ? 16.925 12.288  10.089  1.00 16.61 ? 379 MET A CA  1 
ATOM   140  C C   . MET A 1 36  ? 16.627 13.772  9.954   1.00 17.23 ? 379 MET A C   1 
ATOM   141  O O   . MET A 1 36  ? 15.483 14.178  10.096  1.00 18.42 ? 379 MET A O   1 
ATOM   142  C CB  . MET A 1 36  ? 17.199 11.921  11.551  1.00 16.72 ? 379 MET A CB  1 
ATOM   143  C CG  . MET A 1 36  ? 17.287 10.421  11.793  1.00 17.07 ? 379 MET A CG  1 
ATOM   144  S SD  . MET A 1 36  ? 15.795 9.513   11.278  1.00 18.91 ? 379 MET A SD  1 
ATOM   145  C CE  . MET A 1 36  ? 14.593 10.166  12.446  1.00 19.80 ? 379 MET A CE  1 
ATOM   146  N N   . THR A 1 37  ? 17.660 14.564  9.662   1.00 18.04 ? 380 THR A N   1 
ATOM   147  C CA  . THR A 1 37  ? 17.508 16.024  9.506   1.00 19.22 ? 380 THR A CA  1 
ATOM   148  C C   . THR A 1 37  ? 16.953 16.418  8.150   1.00 19.66 ? 380 THR A C   1 
ATOM   149  O O   . THR A 1 37  ? 16.134 17.344  8.059   1.00 20.93 ? 380 THR A O   1 
ATOM   150  C CB  . THR A 1 37  ? 18.853 16.758  9.725   1.00 19.44 ? 380 THR A CB  1 
ATOM   151  O OG1 . THR A 1 37  ? 19.323 16.479  11.045  1.00 21.21 ? 380 THR A OG1 1 
ATOM   152  C CG2 . THR A 1 37  ? 18.687 18.285  9.585   1.00 19.87 ? 380 THR A CG2 1 
ATOM   153  N N   . TYR A 1 38  ? 17.393 15.726  7.101   1.00 18.95 ? 381 TYR A N   1 
ATOM   154  C CA  . TYR A 1 38  ? 17.102 16.163  5.744   1.00 18.50 ? 381 TYR A CA  1 
ATOM   155  C C   . TYR A 1 38  ? 16.169 15.264  4.949   1.00 18.04 ? 381 TYR A C   1 
ATOM   156  O O   . TYR A 1 38  ? 15.366 15.760  4.174   1.00 17.58 ? 381 TYR A O   1 
ATOM   157  C CB  . TYR A 1 38  ? 18.390 16.396  4.952   1.00 19.51 ? 381 TYR A CB  1 
ATOM   158  C CG  . TYR A 1 38  ? 19.247 17.515  5.501   1.00 21.02 ? 381 TYR A CG  1 
ATOM   159  C CD1 . TYR A 1 38  ? 18.886 18.849  5.311   1.00 21.97 ? 381 TYR A CD1 1 
ATOM   160  C CD2 . TYR A 1 38  ? 20.410 17.238  6.212   1.00 22.11 ? 381 TYR A CD2 1 
ATOM   161  C CE1 . TYR A 1 38  ? 19.673 19.877  5.815   1.00 23.28 ? 381 TYR A CE1 1 
ATOM   162  C CE2 . TYR A 1 38  ? 21.204 18.260  6.722   1.00 23.84 ? 381 TYR A CE2 1 
ATOM   163  C CZ  . TYR A 1 38  ? 20.823 19.575  6.519   1.00 22.72 ? 381 TYR A CZ  1 
ATOM   164  O OH  . TYR A 1 38  ? 21.602 20.600  7.015   1.00 24.40 ? 381 TYR A OH  1 
ATOM   165  N N   . SER A 1 39  ? 16.287 13.950  5.124   1.00 16.97 ? 382 SER A N   1 
ATOM   166  C CA  . SER A 1 39  ? 15.552 13.016  4.262   1.00 16.78 ? 382 SER A CA  1 
ATOM   167  C C   . SER A 1 39  ? 14.048 12.965  4.524   1.00 17.03 ? 382 SER A C   1 
ATOM   168  O O   . SER A 1 39  ? 13.283 12.502  3.683   1.00 17.01 ? 382 SER A O   1 
ATOM   169  C CB  . SER A 1 39  ? 16.179 11.621  4.336   1.00 15.92 ? 382 SER A CB  1 
ATOM   170  O OG  . SER A 1 39  ? 17.508 11.678  3.847   1.00 14.80 ? 382 SER A OG  1 
ATOM   171  N N   . LEU A 1 40  ? 13.627 13.427  5.699   1.00 17.79 ? 383 LEU A N   1 
ATOM   172  C CA  . LEU A 1 40  ? 12.211 13.431  6.032   1.00 18.74 ? 383 LEU A CA  1 
ATOM   173  C C   . LEU A 1 40  ? 11.533 14.776  5.721   1.00 19.55 ? 383 LEU A C   1 
ATOM   174  O O   . LEU A 1 40  ? 10.322 14.921  5.931   1.00 20.85 ? 383 LEU A O   1 
ATOM   175  C CB  . LEU A 1 40  ? 11.994 12.995  7.491   1.00 18.90 ? 383 LEU A CB  1 
ATOM   176  C CG  . LEU A 1 40  ? 12.475 11.572  7.840   1.00 18.54 ? 383 LEU A CG  1 
ATOM   177  C CD1 . LEU A 1 40  ? 12.174 11.231  9.291   1.00 20.61 ? 383 LEU A CD1 1 
ATOM   178  C CD2 . LEU A 1 40  ? 11.863 10.528  6.914   1.00 19.95 ? 383 LEU A CD2 1 
ATOM   179  N N   . GLN A 1 41  ? 12.308 15.723  5.185   1.00 19.99 ? 384 GLN A N   1 
ATOM   180  C CA  . GLN A 1 41  ? 11.765 17.019  4.747   1.00 21.04 ? 384 GLN A CA  1 
ATOM   181  C C   . GLN A 1 41  ? 10.887 16.837  3.509   1.00 20.32 ? 384 GLN A C   1 
ATOM   182  O O   . GLN A 1 41  ? 11.263 16.146  2.562   1.00 20.49 ? 384 GLN A O   1 
ATOM   183  C CB  . GLN A 1 41  ? 12.888 18.042  4.498   1.00 20.66 ? 384 GLN A CB  1 
ATOM   184  C CG  . GLN A 1 41  ? 13.573 18.506  5.781   1.00 22.80 ? 384 GLN A CG  1 
ATOM   185  C CD  . GLN A 1 41  ? 14.741 19.460  5.555   1.00 23.79 ? 384 GLN A CD  1 
ATOM   186  O OE1 . GLN A 1 41  ? 15.137 19.738  4.419   1.00 29.60 ? 384 GLN A OE1 1 
ATOM   187  N NE2 . GLN A 1 41  ? 15.306 19.958  6.648   1.00 27.07 ? 384 GLN A NE2 1 
ATOM   188  N N   . ASP A 1 42  ? 9.704  17.442  3.527   1.00 20.01 ? 385 ASP A N   1 
ATOM   189  C CA  . ASP A 1 42  ? 8.761  17.331  2.423   1.00 20.27 ? 385 ASP A CA  1 
ATOM   190  C C   . ASP A 1 42  ? 9.345  18.019  1.184   1.00 19.52 ? 385 ASP A C   1 
ATOM   191  O O   . ASP A 1 42  ? 9.726  19.194  1.250   1.00 20.49 ? 385 ASP A O   1 
ATOM   192  C CB  . ASP A 1 42  ? 7.433  17.979  2.843   1.00 20.71 ? 385 ASP A CB  1 
ATOM   193  C CG  . ASP A 1 42  ? 6.294  17.739  1.855   1.00 22.99 ? 385 ASP A CG  1 
ATOM   194  O OD1 . ASP A 1 42  ? 6.510  17.203  0.750   1.00 23.07 ? 385 ASP A OD1 1 
ATOM   195  O OD2 . ASP A 1 42  ? 5.143  18.105  2.203   1.00 27.59 ? 385 ASP A OD2 1 
ATOM   196  N N   . VAL A 1 43  ? 9.448  17.282  0.078   1.00 19.01 ? 386 VAL A N   1 
ATOM   197  C CA  . VAL A 1 43  ? 9.931  17.859  -1.187  1.00 18.44 ? 386 VAL A CA  1 
ATOM   198  C C   . VAL A 1 43  ? 8.787  18.292  -2.107  1.00 18.48 ? 386 VAL A C   1 
ATOM   199  O O   . VAL A 1 43  ? 9.033  18.794  -3.206  1.00 18.13 ? 386 VAL A O   1 
ATOM   200  C CB  . VAL A 1 43  ? 10.873 16.897  -1.973  1.00 18.02 ? 386 VAL A CB  1 
ATOM   201  C CG1 . VAL A 1 43  ? 12.094 16.525  -1.136  1.00 19.45 ? 386 VAL A CG1 1 
ATOM   202  C CG2 . VAL A 1 43  ? 10.127 15.654  -2.489  1.00 17.71 ? 386 VAL A CG2 1 
ATOM   203  N N   . GLY A 1 44  ? 7.549  18.080  -1.653  1.00 18.32 ? 387 GLY A N   1 
ATOM   204  C CA  . GLY A 1 44  ? 6.344  18.327  -2.445  1.00 18.76 ? 387 GLY A CA  1 
ATOM   205  C C   . GLY A 1 44  ? 6.180  19.736  -2.982  1.00 18.58 ? 387 GLY A C   1 
ATOM   206  O O   . GLY A 1 44  ? 5.580  19.931  -4.041  1.00 19.19 ? 387 GLY A O   1 
ATOM   207  N N   . GLY A 1 45  ? 6.736  20.707  -2.276  1.00 18.37 ? 388 GLY A N   1 
ATOM   208  C CA  . GLY A 1 45  ? 6.640  22.105  -2.688  1.00 18.45 ? 388 GLY A CA  1 
ATOM   209  C C   . GLY A 1 45  ? 7.816  22.592  -3.520  1.00 18.24 ? 388 GLY A C   1 
ATOM   210  O O   . GLY A 1 45  ? 7.859  23.758  -3.899  1.00 17.76 ? 388 GLY A O   1 
ATOM   211  N N   . ASP A 1 46  ? 8.776  21.704  -3.791  1.00 17.49 ? 389 ASP A N   1 
ATOM   212  C CA  . ASP A 1 46  ? 10.000 22.049  -4.525  1.00 17.49 ? 389 ASP A CA  1 
ATOM   213  C C   . ASP A 1 46  ? 9.827  21.718  -6.014  1.00 17.58 ? 389 ASP A C   1 
ATOM   214  O O   . ASP A 1 46  ? 9.640  20.554  -6.385  1.00 16.85 ? 389 ASP A O   1 
ATOM   215  C CB  . ASP A 1 46  ? 11.181 21.276  -3.914  1.00 17.89 ? 389 ASP A CB  1 
ATOM   216  C CG  . ASP A 1 46  ? 12.530 21.674  -4.494  1.00 18.80 ? 389 ASP A CG  1 
ATOM   217  O OD1 . ASP A 1 46  ? 12.585 22.222  -5.615  1.00 20.48 ? 389 ASP A OD1 1 
ATOM   218  O OD2 . ASP A 1 46  ? 13.552 21.411  -3.820  1.00 21.33 ? 389 ASP A OD2 1 
ATOM   219  N N   . ALA A 1 47  ? 9.893  22.741  -6.867  1.00 17.83 ? 390 ALA A N   1 
ATOM   220  C CA  . ALA A 1 47  ? 9.639  22.557  -8.296  1.00 18.83 ? 390 ALA A CA  1 
ATOM   221  C C   . ALA A 1 47  ? 10.657 21.617  -8.948  1.00 19.26 ? 390 ALA A C   1 
ATOM   222  O O   . ALA A 1 47  ? 10.368 20.995  -9.971  1.00 20.67 ? 390 ALA A O   1 
ATOM   223  C CB  . ALA A 1 47  ? 9.622  23.907  -9.013  1.00 19.22 ? 390 ALA A CB  1 
ATOM   224  N N   . ASN A 1 48  ? 11.834 21.515  -8.339  1.00 19.04 ? 391 ASN A N   1 
ATOM   225  C CA  . ASN A 1 48  ? 12.906 20.655  -8.862  1.00 18.95 ? 391 ASN A CA  1 
ATOM   226  C C   . ASN A 1 48  ? 12.668 19.169  -8.643  1.00 18.76 ? 391 ASN A C   1 
ATOM   227  O O   . ASN A 1 48  ? 13.273 18.323  -9.325  1.00 18.42 ? 391 ASN A O   1 
ATOM   228  C CB  . ASN A 1 48  ? 14.257 21.052  -8.267  1.00 18.96 ? 391 ASN A CB  1 
ATOM   229  C CG  . ASN A 1 48  ? 14.712 22.435  -8.719  1.00 21.49 ? 391 ASN A CG  1 
ATOM   230  O OD1 . ASN A 1 48  ? 15.301 23.179  -7.944  1.00 26.01 ? 391 ASN A OD1 1 
ATOM   231  N ND2 . ASN A 1 48  ? 14.416 22.783  -9.965  1.00 22.92 ? 391 ASN A ND2 1 
ATOM   232  N N   . TRP A 1 49  ? 11.816 18.856  -7.672  1.00 17.52 ? 392 TRP A N   1 
ATOM   233  C CA  . TRP A 1 49  ? 11.474 17.471  -7.380  1.00 17.52 ? 392 TRP A CA  1 
ATOM   234  C C   . TRP A 1 49  ? 10.192 17.130  -8.103  1.00 18.26 ? 392 TRP A C   1 
ATOM   235  O O   . TRP A 1 49  ? 9.179  17.826  -7.950  1.00 19.42 ? 392 TRP A O   1 
ATOM   236  C CB  . TRP A 1 49  ? 11.305 17.254  -5.880  1.00 16.42 ? 392 TRP A CB  1 
ATOM   237  C CG  . TRP A 1 49  ? 12.596 17.075  -5.155  1.00 15.99 ? 392 TRP A CG  1 
ATOM   238  C CD1 . TRP A 1 49  ? 13.374 18.054  -4.593  1.00 14.99 ? 392 TRP A CD1 1 
ATOM   239  C CD2 . TRP A 1 49  ? 13.276 15.839  -4.923  1.00 14.65 ? 392 TRP A CD2 1 
ATOM   240  N NE1 . TRP A 1 49  ? 14.495 17.495  -4.018  1.00 15.92 ? 392 TRP A NE1 1 
ATOM   241  C CE2 . TRP A 1 49  ? 14.455 16.138  -4.201  1.00 15.18 ? 392 TRP A CE2 1 
ATOM   242  C CE3 . TRP A 1 49  ? 13.001 14.507  -5.253  1.00 14.80 ? 392 TRP A CE3 1 
ATOM   243  C CZ2 . TRP A 1 49  ? 15.368 15.149  -3.803  1.00 15.47 ? 392 TRP A CZ2 1 
ATOM   244  C CZ3 . TRP A 1 49  ? 13.905 13.518  -4.850  1.00 15.15 ? 392 TRP A CZ3 1 
ATOM   245  C CH2 . TRP A 1 49  ? 15.073 13.849  -4.134  1.00 15.15 ? 392 TRP A CH2 1 
ATOM   246  N N   . GLN A 1 50  ? 10.242 16.079  -8.910  1.00 18.09 ? 393 GLN A N   1 
ATOM   247  C CA  . GLN A 1 50  ? 9.114  15.709  -9.751  1.00 19.26 ? 393 GLN A CA  1 
ATOM   248  C C   . GLN A 1 50  ? 8.592  14.342  -9.363  1.00 18.32 ? 393 GLN A C   1 
ATOM   249  O O   . GLN A 1 50  ? 9.375  13.407  -9.154  1.00 17.52 ? 393 GLN A O   1 
ATOM   250  C CB  . GLN A 1 50  ? 9.545  15.671  -11.223 1.00 19.92 ? 393 GLN A CB  1 
ATOM   251  C CG  . GLN A 1 50  ? 10.109 16.990  -11.767 1.00 22.55 ? 393 GLN A CG  1 
ATOM   252  C CD  . GLN A 1 50  ? 10.702 16.849  -13.168 1.00 23.21 ? 393 GLN A CD  1 
ATOM   253  O OE1 . GLN A 1 50  ? 11.909 17.041  -13.370 1.00 28.23 ? 393 GLN A OE1 1 
ATOM   254  N NE2 . GLN A 1 50  ? 9.857  16.516  -14.141 1.00 28.45 ? 393 GLN A NE2 1 
ATOM   255  N N   . LEU A 1 51  ? 7.273  14.218  -9.286  1.00 17.96 ? 394 LEU A N   1 
ATOM   256  C CA  . LEU A 1 51  ? 6.658  12.916  -9.129  1.00 17.93 ? 394 LEU A CA  1 
ATOM   257  C C   . LEU A 1 51  ? 6.850  12.121  -10.421 1.00 18.50 ? 394 LEU A C   1 
ATOM   258  O O   . LEU A 1 51  ? 6.437  12.568  -11.495 1.00 19.15 ? 394 LEU A O   1 
ATOM   259  C CB  . LEU A 1 51  ? 5.165  13.058  -8.806  1.00 18.35 ? 394 LEU A CB  1 
ATOM   260  C CG  . LEU A 1 51  ? 4.394  11.742  -8.703  1.00 19.00 ? 394 LEU A CG  1 
ATOM   261  C CD1 . LEU A 1 51  ? 4.752  10.990  -7.421  1.00 19.98 ? 394 LEU A CD1 1 
ATOM   262  C CD2 . LEU A 1 51  ? 2.888  12.025  -8.778  1.00 20.53 ? 394 LEU A CD2 1 
ATOM   263  N N   . VAL A 1 52  ? 7.485  10.955  -10.335 1.00 17.80 ? 395 VAL A N   1 
ATOM   264  C CA  . VAL A 1 52  ? 7.699  10.181  -11.564 1.00 18.18 ? 395 VAL A CA  1 
ATOM   265  C C   . VAL A 1 52  ? 6.820  8.935   -11.642 1.00 18.77 ? 395 VAL A C   1 
ATOM   266  O O   . VAL A 1 52  ? 6.443  8.508   -12.739 1.00 18.89 ? 395 VAL A O   1 
ATOM   267  C CB  A VAL A 1 52  ? 9.186  9.856   -11.836 0.65 18.78 ? 395 VAL A CB  1 
ATOM   268  C CB  B VAL A 1 52  ? 9.229  9.886   -11.829 0.35 18.58 ? 395 VAL A CB  1 
ATOM   269  C CG1 A VAL A 1 52  ? 9.975  11.138  -12.115 0.65 18.65 ? 395 VAL A CG1 1 
ATOM   270  C CG1 B VAL A 1 52  ? 10.093 10.174  -10.600 0.35 17.63 ? 395 VAL A CG1 1 
ATOM   271  C CG2 A VAL A 1 52  ? 9.789  9.087   -10.681 0.65 16.33 ? 395 VAL A CG2 1 
ATOM   272  C CG2 B VAL A 1 52  ? 9.465  8.468   -12.329 0.35 18.42 ? 395 VAL A CG2 1 
ATOM   273  N N   . VAL A 1 53  ? 6.466  8.368   -10.489 1.00 18.18 ? 396 VAL A N   1 
ATOM   274  C CA  . VAL A 1 53  ? 5.678  7.139   -10.432 1.00 19.23 ? 396 VAL A CA  1 
ATOM   275  C C   . VAL A 1 53  ? 4.738  7.207   -9.232  1.00 19.45 ? 396 VAL A C   1 
ATOM   276  O O   . VAL A 1 53  ? 5.149  7.602   -8.139  1.00 18.87 ? 396 VAL A O   1 
ATOM   277  C CB  . VAL A 1 53  ? 6.590  5.869   -10.312 1.00 19.46 ? 396 VAL A CB  1 
ATOM   278  C CG1 . VAL A 1 53  ? 5.762  4.608   -10.124 1.00 20.51 ? 396 VAL A CG1 1 
ATOM   279  C CG2 . VAL A 1 53  ? 7.484  5.716   -11.537 1.00 20.73 ? 396 VAL A CG2 1 
ATOM   280  N N   . GLU A 1 54  ? 3.479  6.827   -9.435  1.00 20.25 ? 397 GLU A N   1 
ATOM   281  C CA  . GLU A 1 54  ? 2.545  6.696   -8.329  1.00 21.41 ? 397 GLU A CA  1 
ATOM   282  C C   . GLU A 1 54  ? 1.665  5.468   -8.540  1.00 21.87 ? 397 GLU A C   1 
ATOM   283  O O   . GLU A 1 54  ? 1.077  5.293   -9.608  1.00 22.16 ? 397 GLU A O   1 
ATOM   284  C CB  . GLU A 1 54  ? 1.693  7.956   -8.191  1.00 21.89 ? 397 GLU A CB  1 
ATOM   285  C CG  . GLU A 1 54  ? 0.725  7.912   -7.031  1.00 24.89 ? 397 GLU A CG  1 
ATOM   286  C CD  . GLU A 1 54  ? -0.015 9.217   -6.828  1.00 28.57 ? 397 GLU A CD  1 
ATOM   287  O OE1 . GLU A 1 54  ? -0.231 9.952   -7.820  1.00 30.81 ? 397 GLU A OE1 1 
ATOM   288  O OE2 . GLU A 1 54  ? -0.388 9.504   -5.668  1.00 31.96 ? 397 GLU A OE2 1 
ATOM   289  N N   . GLU A 1 55  ? 1.602  4.611   -7.525  1.00 22.09 ? 398 GLU A N   1 
ATOM   290  C CA  . GLU A 1 55  ? 0.775  3.407   -7.565  1.00 23.12 ? 398 GLU A CA  1 
ATOM   291  C C   . GLU A 1 55  ? 0.392  3.036   -6.148  1.00 22.74 ? 398 GLU A C   1 
ATOM   292  O O   . GLU A 1 55  ? 1.263  2.771   -5.310  1.00 22.20 ? 398 GLU A O   1 
ATOM   293  C CB  . GLU A 1 55  ? 1.515  2.242   -8.227  1.00 22.99 ? 398 GLU A CB  1 
ATOM   294  C CG  . GLU A 1 55  ? 0.653  0.998   -8.458  1.00 25.72 ? 398 GLU A CG  1 
ATOM   295  C CD  . GLU A 1 55  ? 1.473  -0.249  -8.792  1.00 25.97 ? 398 GLU A CD  1 
ATOM   296  O OE1 . GLU A 1 55  ? 2.548  -0.130  -9.421  1.00 30.54 ? 398 GLU A OE1 1 
ATOM   297  O OE2 . GLU A 1 55  ? 1.035  -1.363  -8.426  1.00 31.26 ? 398 GLU A OE2 1 
ATOM   298  N N   . GLY A 1 56  ? -0.912 3.007   -5.885  1.00 22.95 ? 399 GLY A N   1 
ATOM   299  C CA  . GLY A 1 56  ? -1.402 2.762   -4.537  1.00 22.74 ? 399 GLY A CA  1 
ATOM   300  C C   . GLY A 1 56  ? -0.819 3.811   -3.610  1.00 22.64 ? 399 GLY A C   1 
ATOM   301  O O   . GLY A 1 56  ? -0.858 5.008   -3.913  1.00 22.78 ? 399 GLY A O   1 
ATOM   302  N N   . GLU A 1 57  ? -0.250 3.363   -2.494  1.00 21.85 ? 400 GLU A N   1 
ATOM   303  C CA  . GLU A 1 57  ? 0.311  4.289   -1.512  1.00 21.54 ? 400 GLU A CA  1 
ATOM   304  C C   . GLU A 1 57  ? 1.772  4.637   -1.802  1.00 20.61 ? 400 GLU A C   1 
ATOM   305  O O   . GLU A 1 57  ? 2.390  5.412   -1.065  1.00 20.04 ? 400 GLU A O   1 
ATOM   306  C CB  . GLU A 1 57  ? 0.175  3.735   -0.089  1.00 22.35 ? 400 GLU A CB  1 
ATOM   307  C CG  . GLU A 1 57  ? -1.272 3.580   0.391   1.00 25.09 ? 400 GLU A CG  1 
ATOM   308  C CD  . GLU A 1 57  ? -2.096 4.846   0.242   1.00 29.35 ? 400 GLU A CD  1 
ATOM   309  O OE1 . GLU A 1 57  ? -1.579 5.953   0.521   1.00 31.60 ? 400 GLU A OE1 1 
ATOM   310  O OE2 . GLU A 1 57  ? -3.277 4.732   -0.152  1.00 33.46 ? 400 GLU A OE2 1 
ATOM   311  N N   . MET A 1 58  ? 2.306  4.094   -2.891  1.00 19.10 ? 401 MET A N   1 
ATOM   312  C CA  . MET A 1 58  ? 3.697  4.347   -3.261  1.00 19.17 ? 401 MET A CA  1 
ATOM   313  C C   . MET A 1 58  ? 3.841  5.568   -4.162  1.00 18.01 ? 401 MET A C   1 
ATOM   314  O O   . MET A 1 58  ? 3.209  5.651   -5.214  1.00 18.10 ? 401 MET A O   1 
ATOM   315  C CB  . MET A 1 58  ? 4.304  3.128   -3.945  1.00 18.32 ? 401 MET A CB  1 
ATOM   316  C CG  . MET A 1 58  ? 5.754  3.325   -4.338  1.00 20.12 ? 401 MET A CG  1 
ATOM   317  S SD  . MET A 1 58  ? 6.434  1.954   -5.268  1.00 22.93 ? 401 MET A SD  1 
ATOM   318  C CE  . MET A 1 58  ? 5.451  2.013   -6.756  1.00 26.14 ? 401 MET A CE  1 
ATOM   319  N N   . LYS A 1 59  ? 4.692  6.504   -3.756  1.00 17.26 ? 402 LYS A N   1 
ATOM   320  C CA  . LYS A 1 59  ? 5.007  7.667   -4.583  1.00 17.33 ? 402 LYS A CA  1 
ATOM   321  C C   . LYS A 1 59  ? 6.518  7.770   -4.725  1.00 15.78 ? 402 LYS A C   1 
ATOM   322  O O   . LYS A 1 59  ? 7.252  7.742   -3.723  1.00 15.51 ? 402 LYS A O   1 
ATOM   323  C CB  . LYS A 1 59  ? 4.440  8.951   -3.980  1.00 17.55 ? 402 LYS A CB  1 
ATOM   324  C CG  . LYS A 1 59  ? 2.907  8.963   -3.865  1.00 19.61 ? 402 LYS A CG  1 
ATOM   325  C CD  . LYS A 1 59  ? 2.417  10.262  -3.246  1.00 20.64 ? 402 LYS A CD  1 
ATOM   326  C CE  . LYS A 1 59  ? 1.029  10.110  -2.629  1.00 26.64 ? 402 LYS A CE  1 
ATOM   327  N NZ  . LYS A 1 59  ? 1.021  9.224   -1.410  1.00 28.55 ? 402 LYS A NZ  1 
ATOM   328  N N   . VAL A 1 60  ? 6.978  7.888   -5.968  1.00 14.38 ? 403 VAL A N   1 
ATOM   329  C CA  . VAL A 1 60  ? 8.406  7.982   -6.261  1.00 13.86 ? 403 VAL A CA  1 
ATOM   330  C C   . VAL A 1 60  ? 8.692  9.313   -6.934  1.00 13.45 ? 403 VAL A C   1 
ATOM   331  O O   . VAL A 1 60  ? 8.045  9.658   -7.930  1.00 12.53 ? 403 VAL A O   1 
ATOM   332  C CB  . VAL A 1 60  ? 8.871  6.822   -7.179  1.00 13.82 ? 403 VAL A CB  1 
ATOM   333  C CG1 . VAL A 1 60  ? 10.371 6.883   -7.435  1.00 15.37 ? 403 VAL A CG1 1 
ATOM   334  C CG2 . VAL A 1 60  ? 8.475  5.471   -6.588  1.00 14.12 ? 403 VAL A CG2 1 
ATOM   335  N N   . TYR A 1 61  ? 9.654  10.044  -6.370  1.00 12.79 ? 404 TYR A N   1 
ATOM   336  C CA  . TYR A 1 61  ? 10.062 11.365  -6.820  1.00 13.69 ? 404 TYR A CA  1 
ATOM   337  C C   . TYR A 1 61  ? 11.521 11.357  -7.221  1.00 13.98 ? 404 TYR A C   1 
ATOM   338  O O   . TYR A 1 61  ? 12.330 10.572  -6.705  1.00 13.17 ? 404 TYR A O   1 
ATOM   339  C CB  . TYR A 1 61  ? 9.913  12.406  -5.705  1.00 14.40 ? 404 TYR A CB  1 
ATOM   340  C CG  . TYR A 1 61  ? 8.559  12.461  -5.064  1.00 15.46 ? 404 TYR A CG  1 
ATOM   341  C CD1 . TYR A 1 61  ? 7.609  13.397  -5.479  1.00 14.61 ? 404 TYR A CD1 1 
ATOM   342  C CD2 . TYR A 1 61  ? 8.232  11.592  -4.025  1.00 16.07 ? 404 TYR A CD2 1 
ATOM   343  C CE1 . TYR A 1 61  ? 6.353  13.455  -4.874  1.00 16.56 ? 404 TYR A CE1 1 
ATOM   344  C CE2 . TYR A 1 61  ? 6.989  11.627  -3.421  1.00 16.95 ? 404 TYR A CE2 1 
ATOM   345  C CZ  . TYR A 1 61  ? 6.054  12.561  -3.851  1.00 16.54 ? 404 TYR A CZ  1 
ATOM   346  O OH  . TYR A 1 61  ? 4.823  12.598  -3.235  1.00 18.93 ? 404 TYR A OH  1 
ATOM   347  N N   . ARG A 1 62  ? 11.875 12.263  -8.123  1.00 13.91 ? 405 ARG A N   1 
ATOM   348  C CA  . ARG A 1 62  ? 13.258 12.403  -8.539  1.00 14.78 ? 405 ARG A CA  1 
ATOM   349  C C   . ARG A 1 62  ? 13.580 13.857  -8.868  1.00 14.69 ? 405 ARG A C   1 
ATOM   350  O O   . ARG A 1 62  ? 12.708 14.600  -9.343  1.00 14.24 ? 405 ARG A O   1 
ATOM   351  C CB  A ARG A 1 62  ? 13.658 11.425  -9.657  0.35 15.27 ? 405 ARG A CB  1 
ATOM   352  C CB  B ARG A 1 62  ? 13.429 11.523  -9.786  0.65 15.38 ? 405 ARG A CB  1 
ATOM   353  C CG  A ARG A 1 62  ? 13.368 11.892  -11.057 0.35 16.20 ? 405 ARG A CG  1 
ATOM   354  C CG  B ARG A 1 62  ? 14.738 11.632  -10.518 0.65 15.47 ? 405 ARG A CG  1 
ATOM   355  C CD  A ARG A 1 62  ? 14.537 11.590  -11.984 0.35 19.21 ? 405 ARG A CD  1 
ATOM   356  C CD  B ARG A 1 62  ? 14.881 10.491  -11.521 0.65 16.21 ? 405 ARG A CD  1 
ATOM   357  N NE  A ARG A 1 62  ? 14.610 10.180  -12.353 0.35 21.33 ? 405 ARG A NE  1 
ATOM   358  N NE  B ARG A 1 62  ? 13.853 10.446  -12.575 0.65 15.45 ? 405 ARG A NE  1 
ATOM   359  C CZ  A ARG A 1 62  ? 14.243 9.690   -13.535 0.35 21.86 ? 405 ARG A CZ  1 
ATOM   360  C CZ  B ARG A 1 62  ? 13.793 9.489   -13.505 0.65 15.19 ? 405 ARG A CZ  1 
ATOM   361  N NH1 A ARG A 1 62  ? 14.353 8.391   -13.771 0.35 21.60 ? 405 ARG A NH1 1 
ATOM   362  N NH1 B ARG A 1 62  ? 14.699 8.519   -13.509 0.65 13.73 ? 405 ARG A NH1 1 
ATOM   363  N NH2 A ARG A 1 62  ? 13.773 10.495  -14.482 0.35 22.94 ? 405 ARG A NH2 1 
ATOM   364  N NH2 B ARG A 1 62  ? 12.846 9.497   -14.440 0.65 16.04 ? 405 ARG A NH2 1 
ATOM   365  N N   . ARG A 1 63  ? 14.809 14.263  -8.557  1.00 14.68 ? 406 ARG A N   1 
ATOM   366  C CA  . ARG A 1 63  ? 15.331 15.554  -8.966  1.00 16.52 ? 406 ARG A CA  1 
ATOM   367  C C   . ARG A 1 63  ? 16.394 15.283  -10.008 1.00 17.78 ? 406 ARG A C   1 
ATOM   368  O O   . ARG A 1 63  ? 17.363 14.591  -9.727  1.00 17.42 ? 406 ARG A O   1 
ATOM   369  C CB  . ARG A 1 63  ? 15.936 16.271  -7.766  1.00 16.70 ? 406 ARG A CB  1 
ATOM   370  C CG  . ARG A 1 63  ? 16.528 17.641  -8.088  1.00 18.96 ? 406 ARG A CG  1 
ATOM   371  C CD  . ARG A 1 63  ? 16.699 18.463  -6.826  1.00 23.28 ? 406 ARG A CD  1 
ATOM   372  N NE  . ARG A 1 63  ? 17.890 18.077  -6.085  1.00 26.54 ? 406 ARG A NE  1 
ATOM   373  C CZ  . ARG A 1 63  ? 19.094 18.618  -6.267  1.00 28.49 ? 406 ARG A CZ  1 
ATOM   374  N NH1 . ARG A 1 63  ? 19.266 19.575  -7.173  1.00 30.10 ? 406 ARG A NH1 1 
ATOM   375  N NH2 . ARG A 1 63  ? 20.128 18.198  -5.546  1.00 29.86 ? 406 ARG A NH2 1 
ATOM   376  N N   . GLU A 1 64  ? 16.219 15.823  -11.211 1.00 19.00 ? 407 GLU A N   1 
ATOM   377  C CA  . GLU A 1 64  ? 17.204 15.582  -12.261 1.00 20.88 ? 407 GLU A CA  1 
ATOM   378  C C   . GLU A 1 64  ? 18.463 16.425  -12.029 1.00 20.69 ? 407 GLU A C   1 
ATOM   379  O O   . GLU A 1 64  ? 18.398 17.651  -11.916 1.00 21.74 ? 407 GLU A O   1 
ATOM   380  C CB  . GLU A 1 64  ? 16.586 15.751  -13.663 1.00 21.02 ? 407 GLU A CB  1 
ATOM   381  C CG  . GLU A 1 64  ? 15.555 14.645  -13.974 1.00 23.02 ? 407 GLU A CG  1 
ATOM   382  C CD  . GLU A 1 64  ? 15.200 14.489  -15.456 1.00 23.86 ? 407 GLU A CD  1 
ATOM   383  O OE1 . GLU A 1 64  ? 15.769 15.205  -16.311 1.00 28.53 ? 407 GLU A OE1 1 
ATOM   384  O OE2 . GLU A 1 64  ? 14.350 13.623  -15.760 1.00 28.24 ? 407 GLU A OE2 1 
ATOM   385  N N   . VAL A 1 65  ? 19.599 15.742  -11.897 1.00 19.88 ? 408 VAL A N   1 
ATOM   386  C CA  . VAL A 1 65  ? 20.894 16.389  -11.653 1.00 20.12 ? 408 VAL A CA  1 
ATOM   387  C C   . VAL A 1 65  ? 21.951 15.683  -12.500 1.00 20.73 ? 408 VAL A C   1 
ATOM   388  O O   . VAL A 1 65  ? 22.128 14.474  -12.402 1.00 19.59 ? 408 VAL A O   1 
ATOM   389  C CB  . VAL A 1 65  ? 21.327 16.315  -10.159 1.00 19.47 ? 408 VAL A CB  1 
ATOM   390  C CG1 . VAL A 1 65  ? 22.771 16.857  -9.972  1.00 20.20 ? 408 VAL A CG1 1 
ATOM   391  C CG2 . VAL A 1 65  ? 20.350 17.066  -9.264  1.00 19.61 ? 408 VAL A CG2 1 
ATOM   392  N N   . GLU A 1 66  ? 22.644 16.448  -13.336 1.00 22.32 ? 409 GLU A N   1 
ATOM   393  C CA  . GLU A 1 66  ? 23.712 15.909  -14.164 1.00 24.75 ? 409 GLU A CA  1 
ATOM   394  C C   . GLU A 1 66  ? 24.852 16.909  -14.123 1.00 24.87 ? 409 GLU A C   1 
ATOM   395  O O   . GLU A 1 66  ? 24.666 18.081  -14.473 1.00 25.61 ? 409 GLU A O   1 
ATOM   396  C CB  . GLU A 1 66  ? 23.214 15.683  -15.595 1.00 24.40 ? 409 GLU A CB  1 
ATOM   397  C CG  . GLU A 1 66  ? 24.176 14.932  -16.494 1.00 27.37 ? 409 GLU A CG  1 
ATOM   398  C CD  . GLU A 1 66  ? 23.684 14.825  -17.933 1.00 27.89 ? 409 GLU A CD  1 
ATOM   399  O OE1 . GLU A 1 66  ? 22.462 14.651  -18.151 1.00 32.63 ? 409 GLU A OE1 1 
ATOM   400  O OE2 . GLU A 1 66  ? 24.531 14.912  -18.850 1.00 32.91 ? 409 GLU A OE2 1 
ATOM   401  N N   . GLU A 1 67  ? 26.006 16.446  -13.652 1.00 25.11 ? 410 GLU A N   1 
ATOM   402  C CA  . GLU A 1 67  ? 27.207 17.273  -13.524 1.00 26.00 ? 410 GLU A CA  1 
ATOM   403  C C   . GLU A 1 67  ? 28.370 16.605  -14.245 1.00 25.87 ? 410 GLU A C   1 
ATOM   404  O O   . GLU A 1 67  ? 28.695 15.445  -13.975 1.00 25.56 ? 410 GLU A O   1 
ATOM   405  C CB  . GLU A 1 67  ? 27.553 17.476  -12.049 1.00 26.16 ? 410 GLU A CB  1 
ATOM   406  C CG  . GLU A 1 67  ? 26.586 18.388  -11.300 1.00 27.14 ? 410 GLU A CG  1 
ATOM   407  C CD  . GLU A 1 67  ? 26.789 18.373  -9.789  1.00 27.22 ? 410 GLU A CD  1 
ATOM   408  O OE1 . GLU A 1 67  ? 27.833 17.873  -9.313  1.00 30.13 ? 410 GLU A OE1 1 
ATOM   409  O OE2 . GLU A 1 67  ? 25.896 18.872  -9.071  1.00 28.96 ? 410 GLU A OE2 1 
ATOM   410  N N   . ASN A 1 68  ? 28.996 17.344  -15.161 1.00 26.07 ? 411 ASN A N   1 
ATOM   411  C CA  . ASN A 1 68  ? 30.073 16.810  -16.007 1.00 26.43 ? 411 ASN A CA  1 
ATOM   412  C C   . ASN A 1 68  ? 29.654 15.508  -16.707 1.00 25.78 ? 411 ASN A C   1 
ATOM   413  O O   . ASN A 1 68  ? 30.431 14.554  -16.819 1.00 26.08 ? 411 ASN A O   1 
ATOM   414  C CB  . ASN A 1 68  ? 31.375 16.637  -15.205 1.00 26.53 ? 411 ASN A CB  1 
ATOM   415  C CG  . ASN A 1 68  ? 31.726 17.874  -14.380 1.00 27.70 ? 411 ASN A CG  1 
ATOM   416  O OD1 . ASN A 1 68  ? 31.632 19.004  -14.863 1.00 28.76 ? 411 ASN A OD1 1 
ATOM   417  N ND2 . ASN A 1 68  ? 32.113 17.659  -13.127 1.00 27.62 ? 411 ASN A ND2 1 
ATOM   418  N N   . GLY A 1 69  ? 28.404 15.479  -17.164 1.00 25.28 ? 412 GLY A N   1 
ATOM   419  C CA  . GLY A 1 69  ? 27.869 14.336  -17.896 1.00 24.52 ? 412 GLY A CA  1 
ATOM   420  C C   . GLY A 1 69  ? 27.384 13.172  -17.053 1.00 23.93 ? 412 GLY A C   1 
ATOM   421  O O   . GLY A 1 69  ? 26.742 12.256  -17.583 1.00 24.30 ? 412 GLY A O   1 
ATOM   422  N N   . ILE A 1 70  ? 27.694 13.209  -15.753 1.00 22.75 ? 413 ILE A N   1 
ATOM   423  C CA  . ILE A 1 70  ? 27.379 12.139  -14.792 1.00 21.33 ? 413 ILE A CA  1 
ATOM   424  C C   . ILE A 1 70  ? 25.991 12.372  -14.185 1.00 19.97 ? 413 ILE A C   1 
ATOM   425  O O   . ILE A 1 70  ? 25.760 13.400  -13.560 1.00 18.79 ? 413 ILE A O   1 
ATOM   426  C CB  . ILE A 1 70  ? 28.414 12.104  -13.623 1.00 21.66 ? 413 ILE A CB  1 
ATOM   427  C CG1 . ILE A 1 70  ? 29.869 12.114  -14.139 1.00 23.03 ? 413 ILE A CG1 1 
ATOM   428  C CG2 . ILE A 1 70  ? 28.134 10.931  -12.667 1.00 22.44 ? 413 ILE A CG2 1 
ATOM   429  C CD1 . ILE A 1 70  ? 30.411 10.759  -14.560 1.00 25.84 ? 413 ILE A CD1 1 
ATOM   430  N N   . VAL A 1 71  ? 25.080 11.415  -14.372 1.00 18.69 ? 414 VAL A N   1 
ATOM   431  C CA  . VAL A 1 71  ? 23.719 11.511  -13.827 1.00 17.72 ? 414 VAL A CA  1 
ATOM   432  C C   . VAL A 1 71  ? 23.712 11.141  -12.348 1.00 16.84 ? 414 VAL A C   1 
ATOM   433  O O   . VAL A 1 71  ? 24.082 10.031  -11.981 1.00 16.17 ? 414 VAL A O   1 
ATOM   434  C CB  . VAL A 1 71  ? 22.719 10.611  -14.603 1.00 17.60 ? 414 VAL A CB  1 
ATOM   435  C CG1 . VAL A 1 71  ? 21.341 10.581  -13.919 1.00 19.25 ? 414 VAL A CG1 1 
ATOM   436  C CG2 . VAL A 1 71  ? 22.591 11.091  -16.041 1.00 19.34 ? 414 VAL A CG2 1 
ATOM   437  N N   . LEU A 1 72  ? 23.289 12.088  -11.513 1.00 15.70 ? 415 LEU A N   1 
ATOM   438  C CA  . LEU A 1 72  ? 23.290 11.920  -10.057 1.00 15.44 ? 415 LEU A CA  1 
ATOM   439  C C   . LEU A 1 72  ? 21.890 11.857  -9.455  1.00 15.38 ? 415 LEU A C   1 
ATOM   440  O O   . LEU A 1 72  ? 21.733 11.540  -8.274  1.00 16.29 ? 415 LEU A O   1 
ATOM   441  C CB  . LEU A 1 72  ? 24.084 13.054  -9.410  1.00 16.14 ? 415 LEU A CB  1 
ATOM   442  C CG  . LEU A 1 72  ? 25.564 13.128  -9.819  1.00 17.49 ? 415 LEU A CG  1 
ATOM   443  C CD1 . LEU A 1 72  ? 26.201 14.426  -9.333  1.00 19.73 ? 415 LEU A CD1 1 
ATOM   444  C CD2 . LEU A 1 72  ? 26.364 11.930  -9.324  1.00 19.71 ? 415 LEU A CD2 1 
ATOM   445  N N   . ASP A 1 73  ? 20.889 12.160  -10.277 1.00 13.98 ? 416 ASP A N   1 
ATOM   446  C CA  . ASP A 1 73  ? 19.482 12.226  -9.879  1.00 13.88 ? 416 ASP A CA  1 
ATOM   447  C C   . ASP A 1 73  ? 19.124 11.681  -8.495  1.00 13.06 ? 416 ASP A C   1 
ATOM   448  O O   . ASP A 1 73  ? 18.881 10.480  -8.353  1.00 13.81 ? 416 ASP A O   1 
ATOM   449  C CB  . ASP A 1 73  ? 18.626 11.463  -10.878 1.00 13.86 ? 416 ASP A CB  1 
ATOM   450  C CG  . ASP A 1 73  ? 18.638 12.064  -12.275 1.00 14.01 ? 416 ASP A CG  1 
ATOM   451  O OD1 . ASP A 1 73  ? 19.382 13.030  -12.555 1.00 15.42 ? 416 ASP A OD1 1 
ATOM   452  O OD2 . ASP A 1 73  ? 17.890 11.510  -13.099 1.00 17.44 ? 416 ASP A OD2 1 
ATOM   453  N N   . PRO A 1 74  ? 19.039 12.553  -7.483  1.00 13.29 ? 417 PRO A N   1 
ATOM   454  C CA  . PRO A 1 74  ? 18.471 12.082  -6.214  1.00 13.00 ? 417 PRO A CA  1 
ATOM   455  C C   . PRO A 1 74  ? 17.069 11.490  -6.376  1.00 13.13 ? 417 PRO A C   1 
ATOM   456  O O   . PRO A 1 74  ? 16.233 12.029  -7.126  1.00 13.05 ? 417 PRO A O   1 
ATOM   457  C CB  . PRO A 1 74  ? 18.405 13.353  -5.375  1.00 13.64 ? 417 PRO A CB  1 
ATOM   458  C CG  . PRO A 1 74  ? 19.508 14.214  -5.912  1.00 14.02 ? 417 PRO A CG  1 
ATOM   459  C CD  . PRO A 1 74  ? 19.506 13.950  -7.398  1.00 13.80 ? 417 PRO A CD  1 
ATOM   460  N N   . LEU A 1 75  ? 16.820 10.384  -5.672  1.00 12.53 ? 418 LEU A N   1 
ATOM   461  C CA  . LEU A 1 75  ? 15.541 9.689   -5.702  1.00 12.91 ? 418 LEU A CA  1 
ATOM   462  C C   . LEU A 1 75  ? 14.974 9.649   -4.283  1.00 12.61 ? 418 LEU A C   1 
ATOM   463  O O   . LEU A 1 75  ? 15.704 9.416   -3.324  1.00 11.97 ? 418 LEU A O   1 
ATOM   464  C CB  . LEU A 1 75  ? 15.731 8.276   -6.247  1.00 14.45 ? 418 LEU A CB  1 
ATOM   465  C CG  . LEU A 1 75  ? 14.399 7.535   -6.394  1.00 16.00 ? 418 LEU A CG  1 
ATOM   466  C CD1 . LEU A 1 75  ? 14.155 7.026   -7.814  1.00 18.53 ? 418 LEU A CD1 1 
ATOM   467  C CD2 . LEU A 1 75  ? 14.180 6.457   -5.325  1.00 17.45 ? 418 LEU A CD2 1 
ATOM   468  N N   . LYS A 1 76  ? 13.676 9.892   -4.161  1.00 12.01 ? 419 LYS A N   1 
ATOM   469  C CA  . LYS A 1 76  ? 12.996 9.797   -2.867  1.00 11.96 ? 419 LYS A CA  1 
ATOM   470  C C   . LYS A 1 76  ? 11.661 9.131   -3.097  1.00 12.33 ? 419 LYS A C   1 
ATOM   471  O O   . LYS A 1 76  ? 10.915 9.524   -3.993  1.00 12.41 ? 419 LYS A O   1 
ATOM   472  C CB  . LYS A 1 76  ? 12.793 11.174  -2.218  1.00 12.64 ? 419 LYS A CB  1 
ATOM   473  C CG  . LYS A 1 76  ? 11.964 11.103  -0.941  1.00 13.90 ? 419 LYS A CG  1 
ATOM   474  C CD  . LYS A 1 76  ? 12.012 12.401  -0.154  1.00 15.16 ? 419 LYS A CD  1 
ATOM   475  C CE  . LYS A 1 76  ? 11.291 12.235  1.180   1.00 17.05 ? 419 LYS A CE  1 
ATOM   476  N NZ  . LYS A 1 76  ? 11.293 13.464  2.032   1.00 17.92 ? 419 LYS A NZ  1 
ATOM   477  N N   . ALA A 1 77  ? 11.356 8.128   -2.287  1.00 11.38 ? 420 ALA A N   1 
ATOM   478  C CA  . ALA A 1 77  ? 10.048 7.481   -2.352  1.00 12.53 ? 420 ALA A CA  1 
ATOM   479  C C   . ALA A 1 77  ? 9.381  7.457   -0.994  1.00 13.11 ? 420 ALA A C   1 
ATOM   480  O O   . ALA A 1 77  ? 10.057 7.400   0.038   1.00 13.11 ? 420 ALA A O   1 
ATOM   481  C CB  . ALA A 1 77  ? 10.161 6.076   -2.926  1.00 13.00 ? 420 ALA A CB  1 
ATOM   482  N N   . THR A 1 78  ? 8.056  7.525   -0.999  1.00 13.45 ? 421 THR A N   1 
ATOM   483  C CA  . THR A 1 78  ? 7.275  7.288   0.211   1.00 13.83 ? 421 THR A CA  1 
ATOM   484  C C   . THR A 1 78  ? 6.312  6.123   -0.021  1.00 14.27 ? 421 THR A C   1 
ATOM   485  O O   . THR A 1 78  ? 5.868  5.875   -1.145  1.00 14.61 ? 421 THR A O   1 
ATOM   486  C CB  . THR A 1 78  ? 6.509  8.553   0.688   1.00 14.09 ? 421 THR A CB  1 
ATOM   487  O OG1 . THR A 1 78  ? 5.620  9.018   -0.346  1.00 15.26 ? 421 THR A OG1 1 
ATOM   488  C CG2 . THR A 1 78  ? 7.490  9.685   1.053   1.00 15.20 ? 421 THR A CG2 1 
ATOM   489  N N   . HIS A 1 79  ? 6.007  5.399   1.045   1.00 14.14 ? 422 HIS A N   1 
ATOM   490  C CA  . HIS A 1 79  ? 5.067  4.285   0.961   1.00 14.77 ? 422 HIS A CA  1 
ATOM   491  C C   . HIS A 1 79  ? 4.369  4.166   2.305   1.00 15.31 ? 422 HIS A C   1 
ATOM   492  O O   . HIS A 1 79  ? 4.822  4.719   3.315   1.00 16.12 ? 422 HIS A O   1 
ATOM   493  C CB  . HIS A 1 79  ? 5.810  2.989   0.617   1.00 14.91 ? 422 HIS A CB  1 
ATOM   494  C CG  . HIS A 1 79  ? 4.995  1.981   -0.142  1.00 16.29 ? 422 HIS A CG  1 
ATOM   495  N ND1 . HIS A 1 79  ? 3.616  1.987   -0.175  1.00 19.62 ? 422 HIS A ND1 1 
ATOM   496  C CD2 . HIS A 1 79  ? 5.382  0.921   -0.886  1.00 18.63 ? 422 HIS A CD2 1 
ATOM   497  C CE1 . HIS A 1 79  ? 3.192  0.978   -0.916  1.00 19.06 ? 422 HIS A CE1 1 
ATOM   498  N NE2 . HIS A 1 79  ? 4.244  0.309   -1.350  1.00 18.56 ? 422 HIS A NE2 1 
ATOM   499  N N   . ALA A 1 80  ? 3.229  3.490   2.299   1.00 15.77 ? 423 ALA A N   1 
ATOM   500  C CA  . ALA A 1 80  ? 2.510  3.182   3.522   1.00 16.27 ? 423 ALA A CA  1 
ATOM   501  C C   . ALA A 1 80  ? 2.065  1.732   3.378   1.00 17.02 ? 423 ALA A C   1 
ATOM   502  O O   . ALA A 1 80  ? 1.277  1.393   2.479   1.00 18.58 ? 423 ALA A O   1 
ATOM   503  C CB  . ALA A 1 80  ? 1.327  4.109   3.699   1.00 16.07 ? 423 ALA A CB  1 
ATOM   504  N N   . VAL A 1 81  ? 2.619  0.879   4.233   1.00 16.60 ? 424 VAL A N   1 
ATOM   505  C CA  . VAL A 1 81  ? 2.491  -0.564  4.086   1.00 16.32 ? 424 VAL A CA  1 
ATOM   506  C C   . VAL A 1 81  ? 1.735  -1.152  5.267   1.00 16.58 ? 424 VAL A C   1 
ATOM   507  O O   . VAL A 1 81  ? 2.219  -1.143  6.403   1.00 15.75 ? 424 VAL A O   1 
ATOM   508  C CB  . VAL A 1 81  ? 3.871  -1.247  3.939   1.00 16.73 ? 424 VAL A CB  1 
ATOM   509  C CG1 . VAL A 1 81  ? 3.733  -2.754  3.739   1.00 17.05 ? 424 VAL A CG1 1 
ATOM   510  C CG2 . VAL A 1 81  ? 4.644  -0.635  2.773   1.00 16.95 ? 424 VAL A CG2 1 
ATOM   511  N N   . LYS A 1 82  ? 0.542  -1.672  4.984   1.00 16.45 ? 425 LYS A N   1 
ATOM   512  C CA  . LYS A 1 82  ? -0.298 -2.268  6.026   1.00 17.33 ? 425 LYS A CA  1 
ATOM   513  C C   . LYS A 1 82  ? 0.278  -3.552  6.606   1.00 16.61 ? 425 LYS A C   1 
ATOM   514  O O   . LYS A 1 82  ? 0.848  -4.376  5.901   1.00 16.80 ? 425 LYS A O   1 
ATOM   515  C CB  A LYS A 1 82  ? -1.697 -2.554  5.456   0.65 16.75 ? 425 LYS A CB  1 
ATOM   516  C CB  B LYS A 1 82  ? -1.738 -2.473  5.530   0.35 16.92 ? 425 LYS A CB  1 
ATOM   517  C CG  A LYS A 1 82  ? -2.434 -1.320  4.973   0.65 18.26 ? 425 LYS A CG  1 
ATOM   518  C CG  B LYS A 1 82  ? -2.728 -1.462  6.106   0.35 18.31 ? 425 LYS A CG  1 
ATOM   519  C CD  A LYS A 1 82  ? -3.775 -1.673  4.336   0.65 19.54 ? 425 LYS A CD  1 
ATOM   520  C CD  B LYS A 1 82  ? -3.373 -1.982  7.391   0.35 18.53 ? 425 LYS A CD  1 
ATOM   521  C CE  A LYS A 1 82  ? -4.526 -0.425  3.900   0.65 22.39 ? 425 LYS A CE  1 
ATOM   522  C CE  B LYS A 1 82  ? -3.458 -0.920  8.494   0.35 18.18 ? 425 LYS A CE  1 
ATOM   523  N NZ  A LYS A 1 82  ? -3.694 0.502   3.066   0.65 24.60 ? 425 LYS A NZ  1 
ATOM   524  N NZ  B LYS A 1 82  ? -4.393 0.211   8.239   0.35 19.04 ? 425 LYS A NZ  1 
ATOM   525  N N   . GLY A 1 83  ? 0.137  -3.695  7.925   1.00 16.86 ? 426 GLY A N   1 
ATOM   526  C CA  . GLY A 1 83  ? 0.337  -4.972  8.583   1.00 16.39 ? 426 GLY A CA  1 
ATOM   527  C C   . GLY A 1 83  ? 1.755  -5.388  8.890   1.00 16.28 ? 426 GLY A C   1 
ATOM   528  O O   . GLY A 1 83  ? 2.004  -6.562  9.164   1.00 16.37 ? 426 GLY A O   1 
ATOM   529  N N   . VAL A 1 84  ? 2.685  -4.426  8.837   1.00 15.24 ? 427 VAL A N   1 
ATOM   530  C CA  . VAL A 1 84  ? 4.100  -4.658  9.151   1.00 14.97 ? 427 VAL A CA  1 
ATOM   531  C C   . VAL A 1 84  ? 4.591  -3.486  9.997   1.00 14.10 ? 427 VAL A C   1 
ATOM   532  O O   . VAL A 1 84  ? 4.028  -2.388  9.930   1.00 14.39 ? 427 VAL A O   1 
ATOM   533  C CB  . VAL A 1 84  ? 4.980  -4.788  7.882   1.00 15.28 ? 427 VAL A CB  1 
ATOM   534  C CG1 . VAL A 1 84  ? 4.416  -5.853  6.957   1.00 14.80 ? 427 VAL A CG1 1 
ATOM   535  C CG2 . VAL A 1 84  ? 5.083  -3.450  7.140   1.00 15.24 ? 427 VAL A CG2 1 
ATOM   536  N N   . THR A 1 85  ? 5.602  -3.738  10.822  1.00 13.59 ? 428 THR A N   1 
ATOM   537  C CA  . THR A 1 85  ? 6.189  -2.648  11.594  1.00 13.32 ? 428 THR A CA  1 
ATOM   538  C C   . THR A 1 85  ? 7.477  -2.179  10.943  1.00 13.28 ? 428 THR A C   1 
ATOM   539  O O   . THR A 1 85  ? 8.111  -2.918  10.162  1.00 13.00 ? 428 THR A O   1 
ATOM   540  C CB  . THR A 1 85  ? 6.531  -3.084  13.027  1.00 13.10 ? 428 THR A CB  1 
ATOM   541  O OG1 . THR A 1 85  ? 7.568  -4.067  12.975  1.00 14.35 ? 428 THR A OG1 1 
ATOM   542  C CG2 . THR A 1 85  ? 5.291  -3.664  13.721  1.00 13.74 ? 428 THR A CG2 1 
ATOM   543  N N   . GLY A 1 86  ? 7.887  -0.966  11.310  1.00 12.53 ? 429 GLY A N   1 
ATOM   544  C CA  . GLY A 1 86  ? 9.211  -0.459  10.932  1.00 12.91 ? 429 GLY A CA  1 
ATOM   545  C C   . GLY A 1 86  ? 10.373 -1.351  11.349  1.00 12.15 ? 429 GLY A C   1 
ATOM   546  O O   . GLY A 1 86  ? 11.326 -1.541  10.601  1.00 12.31 ? 429 GLY A O   1 
ATOM   547  N N   . HIS A 1 87  ? 10.302 -1.930  12.552  1.00 12.58 ? 430 HIS A N   1 
ATOM   548  C CA  . HIS A 1 87  ? 11.340 -2.857  12.993  1.00 13.01 ? 430 HIS A CA  1 
ATOM   549  C C   . HIS A 1 87  ? 11.428 -4.052  12.039  1.00 12.89 ? 430 HIS A C   1 
ATOM   550  O O   . HIS A 1 87  ? 12.517 -4.460  11.624  1.00 13.12 ? 430 HIS A O   1 
ATOM   551  C CB  . HIS A 1 87  ? 11.037 -3.321  14.421  1.00 13.49 ? 430 HIS A CB  1 
ATOM   552  C CG  . HIS A 1 87  ? 12.169 -4.037  15.085  1.00 14.24 ? 430 HIS A CG  1 
ATOM   553  N ND1 . HIS A 1 87  ? 12.123 -4.414  16.414  1.00 16.59 ? 430 HIS A ND1 1 
ATOM   554  C CD2 . HIS A 1 87  ? 13.365 -4.465  14.613  1.00 15.08 ? 430 HIS A CD2 1 
ATOM   555  C CE1 . HIS A 1 87  ? 13.248 -5.031  16.729  1.00 17.18 ? 430 HIS A CE1 1 
ATOM   556  N NE2 . HIS A 1 87  ? 14.020 -5.073  15.658  1.00 17.39 ? 430 HIS A NE2 1 
ATOM   557  N N   . GLU A 1 88  ? 10.266 -4.597  11.674  1.00 12.58 ? 431 GLU A N   1 
ATOM   558  C CA  . GLU A 1 88  ? 10.225 -5.719  10.733  1.00 13.14 ? 431 GLU A CA  1 
ATOM   559  C C   . GLU A 1 88  ? 10.774 -5.343  9.356   1.00 12.64 ? 431 GLU A C   1 
ATOM   560  O O   . GLU A 1 88  ? 11.632 -6.037  8.817   1.00 12.97 ? 431 GLU A O   1 
ATOM   561  C CB  . GLU A 1 88  ? 8.804  -6.265  10.602  1.00 12.94 ? 431 GLU A CB  1 
ATOM   562  C CG  . GLU A 1 88  ? 8.366  -7.088  11.840  1.00 14.11 ? 431 GLU A CG  1 
ATOM   563  C CD  . GLU A 1 88  ? 6.862  -7.345  11.917  1.00 14.05 ? 431 GLU A CD  1 
ATOM   564  O OE1 . GLU A 1 88  ? 6.067  -6.688  11.209  1.00 15.35 ? 431 GLU A OE1 1 
ATOM   565  O OE2 . GLU A 1 88  ? 6.472  -8.216  12.737  1.00 16.66 ? 431 GLU A OE2 1 
ATOM   566  N N   . VAL A 1 89  ? 10.288 -4.232  8.812   1.00 12.50 ? 432 VAL A N   1 
ATOM   567  C CA  . VAL A 1 89  ? 10.762 -3.763  7.504   1.00 12.02 ? 432 VAL A CA  1 
ATOM   568  C C   . VAL A 1 89  ? 12.280 -3.571  7.493   1.00 12.47 ? 432 VAL A C   1 
ATOM   569  O O   . VAL A 1 89  ? 12.976 -4.074  6.617   1.00 12.53 ? 432 VAL A O   1 
ATOM   570  C CB  . VAL A 1 89  ? 10.035 -2.493  7.082   1.00 11.73 ? 432 VAL A CB  1 
ATOM   571  C CG1 . VAL A 1 89  ? 10.717 -1.854  5.862   1.00 12.22 ? 432 VAL A CG1 1 
ATOM   572  C CG2 . VAL A 1 89  ? 8.570  -2.808  6.784   1.00 12.93 ? 432 VAL A CG2 1 
ATOM   573  N N   . CYS A 1 90  ? 12.799 -2.859  8.488   1.00 12.44 ? 433 CYS A N   1 
ATOM   574  C CA  . CYS A 1 90  ? 14.241 -2.668  8.550   1.00 13.09 ? 433 CYS A CA  1 
ATOM   575  C C   . CYS A 1 90  ? 15.022 -3.968  8.728   1.00 12.56 ? 433 CYS A C   1 
ATOM   576  O O   . CYS A 1 90  ? 16.070 -4.151  8.109   1.00 13.53 ? 433 CYS A O   1 
ATOM   577  C CB  . CYS A 1 90  ? 14.586 -1.644  9.626   1.00 13.61 ? 433 CYS A CB  1 
ATOM   578  S SG  . CYS A 1 90  ? 14.184 0.026   9.095   1.00 15.00 ? 433 CYS A SG  1 
ATOM   579  N N   . ASN A 1 91  ? 14.517 -4.876  9.567   1.00 13.10 ? 434 ASN A N   1 
ATOM   580  C CA  . ASN A 1 91  ? 15.162 -6.179  9.721   1.00 13.87 ? 434 ASN A CA  1 
ATOM   581  C C   . ASN A 1 91  ? 15.289 -6.901  8.380   1.00 13.66 ? 434 ASN A C   1 
ATOM   582  O O   . ASN A 1 91  ? 16.362 -7.384  8.049   1.00 13.90 ? 434 ASN A O   1 
ATOM   583  C CB  . ASN A 1 91  ? 14.392 -7.068  10.700  1.00 13.78 ? 434 ASN A CB  1 
ATOM   584  C CG  . ASN A 1 91  ? 14.791 -6.837  12.147  1.00 16.27 ? 434 ASN A CG  1 
ATOM   585  O OD1 . ASN A 1 91  ? 15.737 -6.100  12.450  1.00 18.83 ? 434 ASN A OD1 1 
ATOM   586  N ND2 . ASN A 1 91  ? 14.083 -7.497  13.054  1.00 17.52 ? 434 ASN A ND2 1 
ATOM   587  N N   . TYR A 1 92  ? 14.197 -6.961  7.610   1.00 13.68 ? 435 TYR A N   1 
ATOM   588  C CA  . TYR A 1 92  ? 14.226 -7.663  6.322   1.00 14.18 ? 435 TYR A CA  1 
ATOM   589  C C   . TYR A 1 92  ? 15.100 -6.959  5.283   1.00 13.82 ? 435 TYR A C   1 
ATOM   590  O O   . TYR A 1 92  ? 15.709 -7.607  4.427   1.00 13.83 ? 435 TYR A O   1 
ATOM   591  C CB  . TYR A 1 92  ? 12.807 -7.909  5.789   1.00 14.99 ? 435 TYR A CB  1 
ATOM   592  C CG  . TYR A 1 92  ? 12.160 -9.087  6.478   1.00 16.51 ? 435 TYR A CG  1 
ATOM   593  C CD1 . TYR A 1 92  ? 12.412 -10.390 6.051   1.00 17.18 ? 435 TYR A CD1 1 
ATOM   594  C CD2 . TYR A 1 92  ? 11.325 -8.893  7.561   1.00 17.70 ? 435 TYR A CD2 1 
ATOM   595  C CE1 . TYR A 1 92  ? 11.833 -11.475 6.690   1.00 19.36 ? 435 TYR A CE1 1 
ATOM   596  C CE2 . TYR A 1 92  ? 10.735 -9.975  8.215   1.00 18.99 ? 435 TYR A CE2 1 
ATOM   597  C CZ  . TYR A 1 92  ? 11.002 -11.253 7.771   1.00 19.13 ? 435 TYR A CZ  1 
ATOM   598  O OH  . TYR A 1 92  ? 10.418 -12.321 8.413   1.00 20.99 ? 435 TYR A OH  1 
ATOM   599  N N   . PHE A 1 93  ? 15.154 -5.635  5.357   1.00 12.76 ? 436 PHE A N   1 
ATOM   600  C CA  . PHE A 1 93  ? 15.989 -4.877  4.425   1.00 12.38 ? 436 PHE A CA  1 
ATOM   601  C C   . PHE A 1 93  ? 17.470 -5.062  4.722   1.00 12.61 ? 436 PHE A C   1 
ATOM   602  O O   . PHE A 1 93  ? 18.302 -5.111  3.802   1.00 12.10 ? 436 PHE A O   1 
ATOM   603  C CB  . PHE A 1 93  ? 15.601 -3.397  4.463   1.00 11.98 ? 436 PHE A CB  1 
ATOM   604  C CG  . PHE A 1 93  ? 16.291 -2.559  3.426   1.00 12.10 ? 436 PHE A CG  1 
ATOM   605  C CD1 . PHE A 1 93  ? 16.083 -2.785  2.056   1.00 12.16 ? 436 PHE A CD1 1 
ATOM   606  C CD2 . PHE A 1 93  ? 17.151 -1.530  3.812   1.00 13.43 ? 436 PHE A CD2 1 
ATOM   607  C CE1 . PHE A 1 93  ? 16.709 -1.978  1.096   1.00 13.21 ? 436 PHE A CE1 1 
ATOM   608  C CE2 . PHE A 1 93  ? 17.786 -0.720  2.857   1.00 11.97 ? 436 PHE A CE2 1 
ATOM   609  C CZ  . PHE A 1 93  ? 17.563 -0.946  1.494   1.00 11.96 ? 436 PHE A CZ  1 
ATOM   610  N N   . TRP A 1 94  ? 17.807 -5.173  6.006   1.00 12.25 ? 437 TRP A N   1 
ATOM   611  C CA  . TRP A 1 94  ? 19.193 -5.248  6.430   1.00 12.94 ? 437 TRP A CA  1 
ATOM   612  C C   . TRP A 1 94  ? 19.771 -6.667  6.439   1.00 13.24 ? 437 TRP A C   1 
ATOM   613  O O   . TRP A 1 94  ? 20.954 -6.877  6.172   1.00 14.04 ? 437 TRP A O   1 
ATOM   614  C CB  . TRP A 1 94  ? 19.331 -4.628  7.833   1.00 13.52 ? 437 TRP A CB  1 
ATOM   615  C CG  . TRP A 1 94  ? 20.728 -4.621  8.356   1.00 13.18 ? 437 TRP A CG  1 
ATOM   616  C CD1 . TRP A 1 94  ? 21.709 -3.704  8.082   1.00 13.28 ? 437 TRP A CD1 1 
ATOM   617  C CD2 . TRP A 1 94  ? 21.317 -5.571  9.257   1.00 13.34 ? 437 TRP A CD2 1 
ATOM   618  N NE1 . TRP A 1 94  ? 22.865 -4.020  8.748   1.00 13.45 ? 437 TRP A NE1 1 
ATOM   619  C CE2 . TRP A 1 94  ? 22.658 -5.165  9.475   1.00 13.79 ? 437 TRP A CE2 1 
ATOM   620  C CE3 . TRP A 1 94  ? 20.843 -6.730  9.895   1.00 14.82 ? 437 TRP A CE3 1 
ATOM   621  C CZ2 . TRP A 1 94  ? 23.527 -5.868  10.310  1.00 14.99 ? 437 TRP A CZ2 1 
ATOM   622  C CZ3 . TRP A 1 94  ? 21.715 -7.433  10.721  1.00 15.72 ? 437 TRP A CZ3 1 
ATOM   623  C CH2 . TRP A 1 94  ? 23.042 -7.000  10.913  1.00 15.15 ? 437 TRP A CH2 1 
ATOM   624  N N   . ASN A 1 95  ? 18.934 -7.641  6.796   1.00 14.17 ? 438 ASN A N   1 
ATOM   625  C CA  . ASN A 1 95  ? 19.401 -9.009  7.008   1.00 15.36 ? 438 ASN A CA  1 
ATOM   626  C C   . ASN A 1 95  ? 19.896 -9.686  5.725   1.00 15.12 ? 438 ASN A C   1 
ATOM   627  O O   . ASN A 1 95  ? 19.094 -9.990  4.834   1.00 15.38 ? 438 ASN A O   1 
ATOM   628  C CB  . ASN A 1 95  ? 18.288 -9.840  7.663   1.00 15.87 ? 438 ASN A CB  1 
ATOM   629  C CG  . ASN A 1 95  ? 18.765 -11.203 8.127   1.00 18.94 ? 438 ASN A CG  1 
ATOM   630  O OD1 . ASN A 1 95  ? 19.787 -11.706 7.678   1.00 21.91 ? 438 ASN A OD1 1 
ATOM   631  N ND2 . ASN A 1 95  ? 18.012 -11.807 9.041   1.00 24.93 ? 438 ASN A ND2 1 
ATOM   632  N N   . VAL A 1 96  ? 21.206 -9.933  5.645   1.00 15.46 ? 439 VAL A N   1 
ATOM   633  C CA  . VAL A 1 96  ? 21.798 -10.491 4.406   1.00 16.38 ? 439 VAL A CA  1 
ATOM   634  C C   . VAL A 1 96  ? 21.289 -11.901 4.104   1.00 17.04 ? 439 VAL A C   1 
ATOM   635  O O   . VAL A 1 96  ? 21.296 -12.324 2.950   1.00 17.46 ? 439 VAL A O   1 
ATOM   636  C CB  . VAL A 1 96  ? 23.364 -10.482 4.386   1.00 16.30 ? 439 VAL A CB  1 
ATOM   637  C CG1 . VAL A 1 96  ? 23.911 -9.059  4.297   1.00 17.06 ? 439 VAL A CG1 1 
ATOM   638  C CG2 . VAL A 1 96  ? 23.952 -11.232 5.589   1.00 17.39 ? 439 VAL A CG2 1 
ATOM   639  N N   . ASP A 1 97  ? 20.822 -12.605 5.136   1.00 18.22 ? 440 ASP A N   1 
ATOM   640  C CA  . ASP A 1 97  ? 20.343 -13.980 4.970   1.00 19.54 ? 440 ASP A CA  1 
ATOM   641  C C   . ASP A 1 97  ? 19.089 -14.076 4.092   1.00 19.14 ? 440 ASP A C   1 
ATOM   642  O O   . ASP A 1 97  ? 18.811 -15.139 3.525   1.00 20.15 ? 440 ASP A O   1 
ATOM   643  C CB  . ASP A 1 97  ? 20.082 -14.626 6.336   1.00 20.49 ? 440 ASP A CB  1 
ATOM   644  C CG  . ASP A 1 97  ? 21.356 -14.853 7.142   1.00 23.58 ? 440 ASP A CG  1 
ATOM   645  O OD1 . ASP A 1 97  ? 22.470 -14.810 6.569   1.00 26.99 ? 440 ASP A OD1 1 
ATOM   646  O OD2 . ASP A 1 97  ? 21.236 -15.086 8.364   1.00 27.78 ? 440 ASP A OD2 1 
ATOM   647  N N   . VAL A 1 98  ? 18.329 -12.983 3.995   1.00 17.89 ? 441 VAL A N   1 
ATOM   648  C CA  . VAL A 1 98  ? 17.109 -12.939 3.169   1.00 17.60 ? 441 VAL A CA  1 
ATOM   649  C C   . VAL A 1 98  ? 17.257 -12.061 1.910   1.00 16.88 ? 441 VAL A C   1 
ATOM   650  O O   . VAL A 1 98  ? 16.296 -11.882 1.159   1.00 16.41 ? 441 VAL A O   1 
ATOM   651  C CB  . VAL A 1 98  ? 15.847 -12.503 3.977   1.00 17.57 ? 441 VAL A CB  1 
ATOM   652  C CG1 . VAL A 1 98  ? 15.555 -13.493 5.099   1.00 18.87 ? 441 VAL A CG1 1 
ATOM   653  C CG2 . VAL A 1 98  ? 15.985 -11.073 4.535   1.00 16.91 ? 441 VAL A CG2 1 
ATOM   654  N N   . ARG A 1 99  ? 18.460 -11.527 1.689   1.00 16.94 ? 442 ARG A N   1 
ATOM   655  C CA  . ARG A 1 99  ? 18.697 -10.589 0.584   1.00 16.90 ? 442 ARG A CA  1 
ATOM   656  C C   . ARG A 1 99  ? 18.255 -11.134 -0.773  1.00 17.02 ? 442 ARG A C   1 
ATOM   657  O O   . ARG A 1 99  ? 17.561 -10.441 -1.526  1.00 16.87 ? 442 ARG A O   1 
ATOM   658  C CB  . ARG A 1 99  ? 20.169 -10.180 0.523   1.00 16.93 ? 442 ARG A CB  1 
ATOM   659  C CG  . ARG A 1 99  ? 20.499 -9.164  -0.579  1.00 16.41 ? 442 ARG A CG  1 
ATOM   660  C CD  . ARG A 1 99  ? 19.788 -7.829  -0.368  1.00 17.22 ? 442 ARG A CD  1 
ATOM   661  N NE  . ARG A 1 99  ? 19.857 -7.352  1.014   1.00 20.51 ? 442 ARG A NE  1 
ATOM   662  C CZ  . ARG A 1 99  ? 20.888 -6.703  1.545   1.00 19.48 ? 442 ARG A CZ  1 
ATOM   663  N NH1 . ARG A 1 99  ? 21.981 -6.448  0.835   1.00 21.72 ? 442 ARG A NH1 1 
ATOM   664  N NH2 . ARG A 1 99  ? 20.822 -6.311  2.808   1.00 21.47 ? 442 ARG A NH2 1 
ATOM   665  N N   . ASN A 1 100 ? 18.652 -12.368 -1.081  1.00 17.46 ? 443 ASN A N   1 
ATOM   666  C CA  . ASN A 1 100 ? 18.340 -12.933 -2.399  1.00 18.14 ? 443 ASN A CA  1 
ATOM   667  C C   . ASN A 1 100 ? 16.868 -13.273 -2.590  1.00 18.70 ? 443 ASN A C   1 
ATOM   668  O O   . ASN A 1 100 ? 16.438 -13.545 -3.713  1.00 19.14 ? 443 ASN A O   1 
ATOM   669  C CB  . ASN A 1 100 ? 19.238 -14.133 -2.727  1.00 18.34 ? 443 ASN A CB  1 
ATOM   670  C CG  . ASN A 1 100 ? 20.686 -13.737 -2.971  1.00 19.92 ? 443 ASN A CG  1 
ATOM   671  O OD1 . ASN A 1 100 ? 21.612 -14.448 -2.560  1.00 24.00 ? 443 ASN A OD1 1 
ATOM   672  N ND2 . ASN A 1 100 ? 20.896 -12.614 -3.651  1.00 20.68 ? 443 ASN A ND2 1 
ATOM   673  N N   . ASP A 1 101 ? 16.092 -13.237 -1.506  1.00 19.07 ? 444 ASP A N   1 
ATOM   674  C CA  . ASP A 1 101 ? 14.649 -13.482 -1.590  1.00 19.65 ? 444 ASP A CA  1 
ATOM   675  C C   . ASP A 1 101 ? 13.891 -12.324 -2.237  1.00 19.22 ? 444 ASP A C   1 
ATOM   676  O O   . ASP A 1 101 ? 12.783 -12.517 -2.759  1.00 20.22 ? 444 ASP A O   1 
ATOM   677  C CB  . ASP A 1 101 ? 14.049 -13.775 -0.213  1.00 20.78 ? 444 ASP A CB  1 
ATOM   678  C CG  . ASP A 1 101 ? 14.492 -15.114 0.358   1.00 23.36 ? 444 ASP A CG  1 
ATOM   679  O OD1 . ASP A 1 101 ? 14.963 -15.984 -0.408  1.00 27.32 ? 444 ASP A OD1 1 
ATOM   680  O OD2 . ASP A 1 101 ? 14.362 -15.286 1.588   1.00 28.42 ? 444 ASP A OD2 1 
ATOM   681  N N   . TRP A 1 102 ? 14.469 -11.120 -2.196  1.00 17.89 ? 445 TRP A N   1 
ATOM   682  C CA  . TRP A 1 102 ? 13.791 -9.942  -2.757  1.00 16.65 ? 445 TRP A CA  1 
ATOM   683  C C   . TRP A 1 102 ? 14.626 -9.130  -3.746  1.00 16.42 ? 445 TRP A C   1 
ATOM   684  O O   . TRP A 1 102 ? 14.066 -8.553  -4.672  1.00 16.52 ? 445 TRP A O   1 
ATOM   685  C CB  . TRP A 1 102 ? 13.225 -9.012  -1.661  1.00 16.30 ? 445 TRP A CB  1 
ATOM   686  C CG  . TRP A 1 102 ? 14.242 -8.464  -0.681  1.00 15.42 ? 445 TRP A CG  1 
ATOM   687  C CD1 . TRP A 1 102 ? 14.553 -8.979  0.550   1.00 15.31 ? 445 TRP A CD1 1 
ATOM   688  C CD2 . TRP A 1 102 ? 15.059 -7.292  -0.843  1.00 14.20 ? 445 TRP A CD2 1 
ATOM   689  N NE1 . TRP A 1 102 ? 15.517 -8.203  1.158   1.00 15.16 ? 445 TRP A NE1 1 
ATOM   690  C CE2 . TRP A 1 102 ? 15.841 -7.164  0.325   1.00 14.59 ? 445 TRP A CE2 1 
ATOM   691  C CE3 . TRP A 1 102 ? 15.205 -6.339  -1.864  1.00 14.17 ? 445 TRP A CE3 1 
ATOM   692  C CZ2 . TRP A 1 102 ? 16.765 -6.124  0.500   1.00 13.16 ? 445 TRP A CZ2 1 
ATOM   693  C CZ3 . TRP A 1 102 ? 16.129 -5.311  -1.693  1.00 14.88 ? 445 TRP A CZ3 1 
ATOM   694  C CH2 . TRP A 1 102 ? 16.888 -5.209  -0.519  1.00 13.88 ? 445 TRP A CH2 1 
ATOM   695  N N   . GLU A 1 103 ? 15.941 -9.066  -3.540  1.00 16.13 ? 446 GLU A N   1 
ATOM   696  C CA  . GLU A 1 103 ? 16.813 -8.247  -4.398  1.00 16.28 ? 446 GLU A CA  1 
ATOM   697  C C   . GLU A 1 103 ? 16.917 -8.882  -5.785  1.00 16.72 ? 446 GLU A C   1 
ATOM   698  O O   . GLU A 1 103 ? 17.100 -10.100 -5.900  1.00 17.66 ? 446 GLU A O   1 
ATOM   699  C CB  . GLU A 1 103 ? 18.196 -8.071  -3.751  1.00 16.54 ? 446 GLU A CB  1 
ATOM   700  C CG  . GLU A 1 103 ? 19.230 -7.289  -4.590  1.00 17.29 ? 446 GLU A CG  1 
ATOM   701  C CD  . GLU A 1 103 ? 18.844 -5.836  -4.831  1.00 18.88 ? 446 GLU A CD  1 
ATOM   702  O OE1 . GLU A 1 103 ? 19.084 -4.994  -3.930  1.00 18.78 ? 446 GLU A OE1 1 
ATOM   703  O OE2 . GLU A 1 103 ? 18.324 -5.528  -5.931  1.00 17.07 ? 446 GLU A OE2 1 
ATOM   704  N N   . THR A 1 104 ? 16.793 -8.062  -6.831  1.00 15.78 ? 447 THR A N   1 
ATOM   705  C CA  . THR A 1 104 ? 16.854 -8.572  -8.209  1.00 16.13 ? 447 THR A CA  1 
ATOM   706  C C   . THR A 1 104 ? 17.904 -7.914  -9.102  1.00 15.64 ? 447 THR A C   1 
ATOM   707  O O   . THR A 1 104 ? 18.023 -8.276  -10.276 1.00 16.17 ? 447 THR A O   1 
ATOM   708  C CB  . THR A 1 104 ? 15.500 -8.420  -8.922  1.00 16.15 ? 447 THR A CB  1 
ATOM   709  O OG1 . THR A 1 104 ? 15.184 -7.029  -9.021  1.00 16.04 ? 447 THR A OG1 1 
ATOM   710  C CG2 . THR A 1 104 ? 14.400 -9.161  -8.176  1.00 16.97 ? 447 THR A CG2 1 
ATOM   711  N N   . THR A 1 105 ? 18.666 -6.960  -8.575  1.00 15.56 ? 448 THR A N   1 
ATOM   712  C CA  . THR A 1 105 ? 19.579 -6.181  -9.416  1.00 14.85 ? 448 THR A CA  1 
ATOM   713  C C   . THR A 1 105 ? 21.058 -6.574  -9.280  1.00 14.61 ? 448 THR A C   1 
ATOM   714  O O   . THR A 1 105 ? 21.945 -5.906  -9.837  1.00 14.31 ? 448 THR A O   1 
ATOM   715  C CB  . THR A 1 105 ? 19.461 -4.657  -9.153  1.00 14.84 ? 448 THR A CB  1 
ATOM   716  O OG1 . THR A 1 105 ? 19.960 -4.347  -7.843  1.00 16.60 ? 448 THR A OG1 1 
ATOM   717  C CG2 . THR A 1 105 ? 18.028 -4.171  -9.314  1.00 16.60 ? 448 THR A CG2 1 
ATOM   718  N N   . ILE A 1 106 ? 21.331 -7.644  -8.529  1.00 15.12 ? 449 ILE A N   1 
ATOM   719  C CA  . ILE A 1 106 ? 22.703 -8.049  -8.284  1.00 15.56 ? 449 ILE A CA  1 
ATOM   720  C C   . ILE A 1 106 ? 23.062 -9.393  -8.925  1.00 15.84 ? 449 ILE A C   1 
ATOM   721  O O   . ILE A 1 106 ? 22.199 -10.265 -9.113  1.00 16.10 ? 449 ILE A O   1 
ATOM   722  C CB  . ILE A 1 106 ? 23.068 -8.078  -6.771  1.00 15.69 ? 449 ILE A CB  1 
ATOM   723  C CG1 . ILE A 1 106 ? 22.255 -9.130  -6.025  1.00 16.38 ? 449 ILE A CG1 1 
ATOM   724  C CG2 . ILE A 1 106 ? 22.882 -6.692  -6.146  1.00 15.68 ? 449 ILE A CG2 1 
ATOM   725  C CD1 . ILE A 1 106 ? 22.747 -9.391  -4.611  1.00 16.54 ? 449 ILE A CD1 1 
ATOM   726  N N   . GLU A 1 107 ? 24.340 -9.533  -9.257  1.00 16.72 ? 450 GLU A N   1 
ATOM   727  C CA  . GLU A 1 107 ? 24.877 -10.815 -9.705  1.00 17.99 ? 450 GLU A CA  1 
ATOM   728  C C   . GLU A 1 107 ? 25.412 -11.617 -8.521  1.00 18.05 ? 450 GLU A C   1 
ATOM   729  O O   . GLU A 1 107 ? 25.335 -12.843 -8.513  1.00 18.91 ? 450 GLU A O   1 
ATOM   730  C CB  . GLU A 1 107 ? 25.984 -10.614 -10.736 1.00 18.73 ? 450 GLU A CB  1 
ATOM   731  C CG  . GLU A 1 107 ? 25.507 -10.039 -12.073 1.00 21.76 ? 450 GLU A CG  1 
ATOM   732  C CD  . GLU A 1 107 ? 24.637 -10.990 -12.891 1.00 25.46 ? 450 GLU A CD  1 
ATOM   733  O OE1 . GLU A 1 107 ? 24.281 -12.094 -12.414 1.00 26.78 ? 450 GLU A OE1 1 
ATOM   734  O OE2 . GLU A 1 107 ? 24.313 -10.623 -14.040 1.00 27.72 ? 450 GLU A OE2 1 
ATOM   735  N N   . ASN A 1 108 ? 25.944 -10.913 -7.525  1.00 17.91 ? 451 ASN A N   1 
ATOM   736  C CA  . ASN A 1 108 ? 26.480 -11.542 -6.323  1.00 17.42 ? 451 ASN A CA  1 
ATOM   737  C C   . ASN A 1 108 ? 26.685 -10.504 -5.233  1.00 17.19 ? 451 ASN A C   1 
ATOM   738  O O   . ASN A 1 108 ? 26.806 -9.319  -5.516  1.00 16.05 ? 451 ASN A O   1 
ATOM   739  C CB  . ASN A 1 108 ? 27.833 -12.195 -6.622  1.00 18.20 ? 451 ASN A CB  1 
ATOM   740  C CG  . ASN A 1 108 ? 28.851 -11.206 -7.144  1.00 20.19 ? 451 ASN A CG  1 
ATOM   741  O OD1 . ASN A 1 108 ? 28.810 -10.825 -8.311  1.00 23.40 ? 451 ASN A OD1 1 
ATOM   742  N ND2 . ASN A 1 108 ? 29.775 -10.790 -6.285  1.00 25.75 ? 451 ASN A ND2 1 
ATOM   743  N N   . PHE A 1 109 ? 26.734 -10.957 -3.984  1.00 16.76 ? 452 PHE A N   1 
ATOM   744  C CA  . PHE A 1 109 ? 27.190 -10.101 -2.886  1.00 16.62 ? 452 PHE A CA  1 
ATOM   745  C C   . PHE A 1 109 ? 27.860 -10.960 -1.832  1.00 16.61 ? 452 PHE A C   1 
ATOM   746  O O   . PHE A 1 109 ? 27.613 -12.162 -1.751  1.00 17.17 ? 452 PHE A O   1 
ATOM   747  C CB  . PHE A 1 109 ? 26.030 -9.302  -2.255  1.00 16.82 ? 452 PHE A CB  1 
ATOM   748  C CG  . PHE A 1 109 ? 25.212 -10.081 -1.256  1.00 17.51 ? 452 PHE A CG  1 
ATOM   749  C CD1 . PHE A 1 109 ? 25.456 -9.960  0.110   1.00 19.80 ? 452 PHE A CD1 1 
ATOM   750  C CD2 . PHE A 1 109 ? 24.192 -10.926 -1.679  1.00 18.38 ? 452 PHE A CD2 1 
ATOM   751  C CE1 . PHE A 1 109 ? 24.697 -10.672 1.034   1.00 20.17 ? 452 PHE A CE1 1 
ATOM   752  C CE2 . PHE A 1 109 ? 23.416 -11.639 -0.766  1.00 19.72 ? 452 PHE A CE2 1 
ATOM   753  C CZ  . PHE A 1 109 ? 23.676 -11.515 0.599   1.00 20.31 ? 452 PHE A CZ  1 
ATOM   754  N N   . HIS A 1 110 ? 28.690 -10.329 -1.013  1.00 16.44 ? 453 HIS A N   1 
ATOM   755  C CA  . HIS A 1 110 ? 29.162 -10.983 0.206   1.00 16.63 ? 453 HIS A CA  1 
ATOM   756  C C   . HIS A 1 110 ? 29.512 -9.962  1.285   1.00 16.66 ? 453 HIS A C   1 
ATOM   757  O O   . HIS A 1 110 ? 29.783 -8.783  1.004   1.00 16.23 ? 453 HIS A O   1 
ATOM   758  C CB  . HIS A 1 110 ? 30.345 -11.909 -0.083  1.00 17.73 ? 453 HIS A CB  1 
ATOM   759  C CG  . HIS A 1 110 ? 31.581 -11.185 -0.509  1.00 18.22 ? 453 HIS A CG  1 
ATOM   760  N ND1 . HIS A 1 110 ? 31.848 -10.879 -1.826  1.00 22.34 ? 453 HIS A ND1 1 
ATOM   761  C CD2 . HIS A 1 110 ? 32.627 -10.708 0.208   1.00 21.81 ? 453 HIS A CD2 1 
ATOM   762  C CE1 . HIS A 1 110 ? 33.005 -10.245 -1.902  1.00 22.17 ? 453 HIS A CE1 1 
ATOM   763  N NE2 . HIS A 1 110 ? 33.491 -10.116 -0.681  1.00 23.24 ? 453 HIS A NE2 1 
ATOM   764  N N   . VAL A 1 111 ? 29.514 -10.430 2.526   1.00 15.90 ? 454 VAL A N   1 
ATOM   765  C CA  . VAL A 1 111 ? 29.884 -9.592  3.658   1.00 16.55 ? 454 VAL A CA  1 
ATOM   766  C C   . VAL A 1 111 ? 31.406 -9.594  3.796   1.00 16.72 ? 454 VAL A C   1 
ATOM   767  O O   . VAL A 1 111 ? 32.026 -10.653 4.006   1.00 17.59 ? 454 VAL A O   1 
ATOM   768  C CB  . VAL A 1 111 ? 29.187 -10.069 4.959   1.00 16.46 ? 454 VAL A CB  1 
ATOM   769  C CG1 . VAL A 1 111 ? 29.659 -9.248  6.160   1.00 16.51 ? 454 VAL A CG1 1 
ATOM   770  C CG2 . VAL A 1 111 ? 27.651 -9.997  4.808   1.00 16.31 ? 454 VAL A CG2 1 
ATOM   771  N N   . VAL A 1 112 ? 31.999 -8.412  3.641   1.00 16.27 ? 455 VAL A N   1 
ATOM   772  C CA  . VAL A 1 112 ? 33.441 -8.202  3.748   1.00 17.09 ? 455 VAL A CA  1 
ATOM   773  C C   . VAL A 1 112 ? 33.898 -8.214  5.215   1.00 17.11 ? 455 VAL A C   1 
ATOM   774  O O   . VAL A 1 112 ? 34.946 -8.779  5.549   1.00 18.28 ? 455 VAL A O   1 
ATOM   775  C CB  . VAL A 1 112 ? 33.859 -6.863  3.069   1.00 16.87 ? 455 VAL A CB  1 
ATOM   776  C CG1 . VAL A 1 112 ? 35.349 -6.576  3.248   1.00 17.15 ? 455 VAL A CG1 1 
ATOM   777  C CG2 . VAL A 1 112 ? 33.505 -6.884  1.586   1.00 17.38 ? 455 VAL A CG2 1 
ATOM   778  N N   . GLU A 1 113 ? 33.103 -7.586  6.081   1.00 16.92 ? 456 GLU A N   1 
ATOM   779  C CA  . GLU A 1 113 ? 33.466 -7.396  7.483   1.00 17.16 ? 456 GLU A CA  1 
ATOM   780  C C   . GLU A 1 113 ? 32.222 -7.166  8.326   1.00 17.32 ? 456 GLU A C   1 
ATOM   781  O O   . GLU A 1 113 ? 31.282 -6.493  7.892   1.00 16.74 ? 456 GLU A O   1 
ATOM   782  C CB  . GLU A 1 113 ? 34.414 -6.196  7.623   1.00 16.79 ? 456 GLU A CB  1 
ATOM   783  C CG  . GLU A 1 113 ? 34.934 -5.956  9.057   1.00 18.27 ? 456 GLU A CG  1 
ATOM   784  C CD  . GLU A 1 113 ? 35.909 -4.797  9.159   1.00 18.88 ? 456 GLU A CD  1 
ATOM   785  O OE1 . GLU A 1 113 ? 36.238 -4.169  8.124   1.00 20.36 ? 456 GLU A OE1 1 
ATOM   786  O OE2 . GLU A 1 113 ? 36.363 -4.509  10.295  1.00 18.90 ? 456 GLU A OE2 1 
ATOM   787  N N   . THR A 1 114 ? 32.215 -7.738  9.531   1.00 17.28 ? 457 THR A N   1 
ATOM   788  C CA  . THR A 1 114 ? 31.206 -7.415  10.531  1.00 17.53 ? 457 THR A CA  1 
ATOM   789  C C   . THR A 1 114 ? 31.823 -6.421  11.511  1.00 17.79 ? 457 THR A C   1 
ATOM   790  O O   . THR A 1 114 ? 32.843 -6.713  12.152  1.00 18.24 ? 457 THR A O   1 
ATOM   791  C CB  . THR A 1 114 ? 30.683 -8.683  11.260  1.00 17.68 ? 457 THR A CB  1 
ATOM   792  O OG1 . THR A 1 114 ? 30.057 -9.558  10.312  1.00 19.18 ? 457 THR A OG1 1 
ATOM   793  C CG2 . THR A 1 114 ? 29.688 -8.319  12.348  1.00 19.12 ? 457 THR A CG2 1 
ATOM   794  N N   . LEU A 1 115 ? 31.225 -5.232  11.598  1.00 17.11 ? 458 LEU A N   1 
ATOM   795  C CA  . LEU A 1 115 ? 31.739 -4.159  12.451  1.00 17.27 ? 458 LEU A CA  1 
ATOM   796  C C   . LEU A 1 115 ? 31.159 -4.217  13.857  1.00 17.79 ? 458 LEU A C   1 
ATOM   797  O O   . LEU A 1 115 ? 31.844 -3.887  14.833  1.00 18.94 ? 458 LEU A O   1 
ATOM   798  C CB  . LEU A 1 115 ? 31.426 -2.790  11.833  1.00 17.10 ? 458 LEU A CB  1 
ATOM   799  C CG  . LEU A 1 115 ? 32.123 -2.483  10.510  1.00 17.24 ? 458 LEU A CG  1 
ATOM   800  C CD1 . LEU A 1 115 ? 31.467 -1.278  9.851   1.00 16.10 ? 458 LEU A CD1 1 
ATOM   801  C CD2 . LEU A 1 115 ? 33.634 -2.253  10.707  1.00 17.96 ? 458 LEU A CD2 1 
ATOM   802  N N   . ALA A 1 116 ? 29.900 -4.639  13.937  1.00 17.61 ? 459 ALA A N   1 
ATOM   803  C CA  . ALA A 1 116 ? 29.110 -4.696  15.167  1.00 17.72 ? 459 ALA A CA  1 
ATOM   804  C C   . ALA A 1 116 ? 27.869 -5.541  14.872  1.00 17.98 ? 459 ALA A C   1 
ATOM   805  O O   . ALA A 1 116 ? 27.629 -5.905  13.709  1.00 17.91 ? 459 ALA A O   1 
ATOM   806  C CB  . ALA A 1 116 ? 28.702 -3.289  15.625  1.00 18.29 ? 459 ALA A CB  1 
ATOM   807  N N   . ASP A 1 117 ? 27.078 -5.833  15.905  1.00 18.33 ? 460 ASP A N   1 
ATOM   808  C CA  . ASP A 1 117 ? 25.848 -6.608  15.751  1.00 19.36 ? 460 ASP A CA  1 
ATOM   809  C C   . ASP A 1 117 ? 24.864 -5.979  14.761  1.00 18.47 ? 460 ASP A C   1 
ATOM   810  O O   . ASP A 1 117 ? 23.977 -6.659  14.251  1.00 19.86 ? 460 ASP A O   1 
ATOM   811  C CB  . ASP A 1 117 ? 25.138 -6.811  17.102  1.00 20.59 ? 460 ASP A CB  1 
ATOM   812  C CG  . ASP A 1 117 ? 25.758 -7.920  17.939  1.00 24.80 ? 460 ASP A CG  1 
ATOM   813  O OD1 . ASP A 1 117 ? 26.829 -8.449  17.570  1.00 30.05 ? 460 ASP A OD1 1 
ATOM   814  O OD2 . ASP A 1 117 ? 25.158 -8.273  18.978  1.00 30.87 ? 460 ASP A OD2 1 
ATOM   815  N N   . ASN A 1 118 ? 25.027 -4.686  14.502  1.00 16.70 ? 461 ASN A N   1 
ATOM   816  C CA  . ASN A 1 118 ? 24.083 -3.963  13.660  1.00 16.14 ? 461 ASN A CA  1 
ATOM   817  C C   . ASN A 1 118 ? 24.740 -3.263  12.478  1.00 15.17 ? 461 ASN A C   1 
ATOM   818  O O   . ASN A 1 118 ? 24.098 -2.433  11.832  1.00 14.26 ? 461 ASN A O   1 
ATOM   819  C CB  . ASN A 1 118 ? 23.322 -2.935  14.492  1.00 16.27 ? 461 ASN A CB  1 
ATOM   820  C CG  . ASN A 1 118 ? 24.196 -1.745  14.909  1.00 17.88 ? 461 ASN A CG  1 
ATOM   821  O OD1 . ASN A 1 118 ? 25.405 -1.891  15.150  1.00 20.80 ? 461 ASN A OD1 1 
ATOM   822  N ND2 . ASN A 1 118 ? 23.587 -0.557  14.982  1.00 20.06 ? 461 ASN A ND2 1 
ATOM   823  N N   . ALA A 1 119 ? 26.004 -3.580  12.206  1.00 14.48 ? 462 ALA A N   1 
ATOM   824  C CA  . ALA A 1 119 ? 26.773 -2.869  11.184  1.00 14.21 ? 462 ALA A CA  1 
ATOM   825  C C   . ALA A 1 119 ? 27.716 -3.816  10.481  1.00 14.63 ? 462 ALA A C   1 
ATOM   826  O O   . ALA A 1 119 ? 28.564 -4.453  11.117  1.00 14.49 ? 462 ALA A O   1 
ATOM   827  C CB  . ALA A 1 119 ? 27.565 -1.708  11.813  1.00 14.38 ? 462 ALA A CB  1 
ATOM   828  N N   . ILE A 1 120 ? 27.563 -3.909  9.163   1.00 14.20 ? 463 ILE A N   1 
ATOM   829  C CA  . ILE A 1 120 ? 28.410 -4.746  8.312   1.00 13.70 ? 463 ILE A CA  1 
ATOM   830  C C   . ILE A 1 120 ? 28.887 -3.980  7.082   1.00 13.35 ? 463 ILE A C   1 
ATOM   831  O O   . ILE A 1 120 ? 28.335 -2.927  6.751   1.00 13.36 ? 463 ILE A O   1 
ATOM   832  C CB  . ILE A 1 120 ? 27.672 -6.016  7.846   1.00 14.00 ? 463 ILE A CB  1 
ATOM   833  C CG1 . ILE A 1 120 ? 26.384 -5.650  7.087   1.00 14.11 ? 463 ILE A CG1 1 
ATOM   834  C CG2 . ILE A 1 120 ? 27.401 -6.927  9.049   1.00 14.88 ? 463 ILE A CG2 1 
ATOM   835  C CD1 . ILE A 1 120 ? 25.529 -6.845  6.675   1.00 14.23 ? 463 ILE A CD1 1 
ATOM   836  N N   . ILE A 1 121 ? 29.926 -4.492  6.429   1.00 12.64 ? 464 ILE A N   1 
ATOM   837  C CA  . ILE A 1 121 ? 30.375 -3.935  5.156   1.00 13.14 ? 464 ILE A CA  1 
ATOM   838  C C   . ILE A 1 121 ? 30.124 -4.999  4.093   1.00 13.44 ? 464 ILE A C   1 
ATOM   839  O O   . ILE A 1 121 ? 30.519 -6.160  4.258   1.00 14.00 ? 464 ILE A O   1 
ATOM   840  C CB  . ILE A 1 121 ? 31.865 -3.485  5.196   1.00 13.34 ? 464 ILE A CB  1 
ATOM   841  C CG1 . ILE A 1 121 ? 32.050 -2.366  6.233   1.00 13.71 ? 464 ILE A CG1 1 
ATOM   842  C CG2 . ILE A 1 121 ? 32.357 -3.095  3.782   1.00 13.84 ? 464 ILE A CG2 1 
ATOM   843  C CD1 . ILE A 1 121 ? 33.501 -1.929  6.459   1.00 13.61 ? 464 ILE A CD1 1 
ATOM   844  N N   . ILE A 1 122 ? 29.452 -4.589  3.019   1.00 13.07 ? 465 ILE A N   1 
ATOM   845  C CA  . ILE A 1 122 ? 29.028 -5.488  1.949   1.00 13.70 ? 465 ILE A CA  1 
ATOM   846  C C   . ILE A 1 122 ? 29.647 -5.083  0.629   1.00 14.16 ? 465 ILE A C   1 
ATOM   847  O O   . ILE A 1 122 ? 29.695 -3.899  0.302   1.00 13.97 ? 465 ILE A O   1 
ATOM   848  C CB  . ILE A 1 122 ? 27.481 -5.488  1.803   1.00 13.24 ? 465 ILE A CB  1 
ATOM   849  C CG1 . ILE A 1 122 ? 26.805 -6.036  3.070   1.00 14.22 ? 465 ILE A CG1 1 
ATOM   850  C CG2 . ILE A 1 122 ? 27.025 -6.238  0.535   1.00 14.17 ? 465 ILE A CG2 1 
ATOM   851  C CD1 . ILE A 1 122 ? 25.294 -5.803  3.085   1.00 14.12 ? 465 ILE A CD1 1 
ATOM   852  N N   . TYR A 1 123 ? 30.116 -6.083  -0.123  1.00 14.09 ? 466 TYR A N   1 
ATOM   853  C CA  . TYR A 1 123 ? 30.546 -5.895  -1.503  1.00 14.98 ? 466 TYR A CA  1 
ATOM   854  C C   . TYR A 1 123 ? 29.519 -6.572  -2.395  1.00 14.83 ? 466 TYR A C   1 
ATOM   855  O O   . TYR A 1 123 ? 29.112 -7.718  -2.144  1.00 15.12 ? 466 TYR A O   1 
ATOM   856  C CB  . TYR A 1 123 ? 31.913 -6.553  -1.766  1.00 15.08 ? 466 TYR A CB  1 
ATOM   857  C CG  . TYR A 1 123 ? 32.279 -6.470  -3.231  1.00 16.00 ? 466 TYR A CG  1 
ATOM   858  C CD1 . TYR A 1 123 ? 32.787 -5.289  -3.772  1.00 14.63 ? 466 TYR A CD1 1 
ATOM   859  C CD2 . TYR A 1 123 ? 32.076 -7.560  -4.085  1.00 16.12 ? 466 TYR A CD2 1 
ATOM   860  C CE1 . TYR A 1 123 ? 33.099 -5.197  -5.127  1.00 16.32 ? 466 TYR A CE1 1 
ATOM   861  C CE2 . TYR A 1 123 ? 32.387 -7.478  -5.433  1.00 16.91 ? 466 TYR A CE2 1 
ATOM   862  C CZ  . TYR A 1 123 ? 32.897 -6.302  -5.948  1.00 17.19 ? 466 TYR A CZ  1 
ATOM   863  O OH  . TYR A 1 123 ? 33.202 -6.236  -7.299  1.00 19.36 ? 466 TYR A OH  1 
ATOM   864  N N   . GLN A 1 124 ? 29.097 -5.880  -3.451  1.00 14.37 ? 467 GLN A N   1 
ATOM   865  C CA  . GLN A 1 124 ? 28.240 -6.531  -4.429  1.00 14.94 ? 467 GLN A CA  1 
ATOM   866  C C   . GLN A 1 124 ? 28.526 -6.061  -5.843  1.00 14.96 ? 467 GLN A C   1 
ATOM   867  O O   . GLN A 1 124 ? 28.979 -4.938  -6.050  1.00 14.42 ? 467 GLN A O   1 
ATOM   868  C CB  . GLN A 1 124 ? 26.757 -6.380  -4.082  1.00 15.77 ? 467 GLN A CB  1 
ATOM   869  C CG  . GLN A 1 124 ? 26.211 -4.988  -4.197  1.00 15.71 ? 467 GLN A CG  1 
ATOM   870  C CD  . GLN A 1 124 ? 24.934 -4.793  -3.405  1.00 15.62 ? 467 GLN A CD  1 
ATOM   871  O OE1 . GLN A 1 124 ? 24.720 -5.440  -2.372  1.00 15.13 ? 467 GLN A OE1 1 
ATOM   872  N NE2 . GLN A 1 124 ? 24.092 -3.884  -3.868  1.00 15.42 ? 467 GLN A NE2 1 
ATOM   873  N N   . THR A 1 125 ? 28.280 -6.948  -6.803  1.00 15.27 ? 468 THR A N   1 
ATOM   874  C CA  . THR A 1 125 ? 28.328 -6.576  -8.206  1.00 15.99 ? 468 THR A CA  1 
ATOM   875  C C   . THR A 1 125 ? 26.908 -6.579  -8.731  1.00 15.43 ? 468 THR A C   1 
ATOM   876  O O   . THR A 1 125 ? 26.116 -7.476  -8.434  1.00 15.41 ? 468 THR A O   1 
ATOM   877  C CB  A THR A 1 125 ? 29.208 -7.566  -9.001  0.65 15.72 ? 468 THR A CB  1 
ATOM   878  C CB  B THR A 1 125 ? 29.175 -7.539  -9.049  0.35 15.69 ? 468 THR A CB  1 
ATOM   879  O OG1 A THR A 1 125 ? 30.506 -7.642  -8.389  0.65 16.83 ? 468 THR A OG1 1 
ATOM   880  O OG1 B THR A 1 125 ? 28.374 -8.656  -9.440  0.35 16.45 ? 468 THR A OG1 1 
ATOM   881  C CG2 A THR A 1 125 ? 29.379 -7.108  -10.425 0.65 16.52 ? 468 THR A CG2 1 
ATOM   882  C CG2 B THR A 1 125 ? 30.388 -8.019  -8.266  0.35 16.14 ? 468 THR A CG2 1 
ATOM   883  N N   . HIS A 1 126 ? 26.571 -5.553  -9.506  1.00 15.31 ? 469 HIS A N   1 
ATOM   884  C CA  . HIS A 1 126 ? 25.237 -5.440  -10.062 1.00 15.55 ? 469 HIS A CA  1 
ATOM   885  C C   . HIS A 1 126 ? 25.149 -6.069  -11.442 1.00 15.68 ? 469 HIS A C   1 
ATOM   886  O O   . HIS A 1 126 ? 26.172 -6.260  -12.100 1.00 15.97 ? 469 HIS A O   1 
ATOM   887  C CB  . HIS A 1 126 ? 24.779 -3.976  -10.071 1.00 15.73 ? 469 HIS A CB  1 
ATOM   888  C CG  . HIS A 1 126 ? 24.317 -3.514  -8.728  1.00 15.88 ? 469 HIS A CG  1 
ATOM   889  N ND1 . HIS A 1 126 ? 23.015 -3.657  -8.304  1.00 16.13 ? 469 HIS A ND1 1 
ATOM   890  C CD2 . HIS A 1 126 ? 25.001 -2.989  -7.683  1.00 16.78 ? 469 HIS A CD2 1 
ATOM   891  C CE1 . HIS A 1 126 ? 22.908 -3.207  -7.065  1.00 17.14 ? 469 HIS A CE1 1 
ATOM   892  N NE2 . HIS A 1 126 ? 24.101 -2.805  -6.661  1.00 16.86 ? 469 HIS A NE2 1 
ATOM   893  N N   . LYS A 1 127 ? 23.932 -6.411  -11.858 1.00 15.74 ? 470 LYS A N   1 
ATOM   894  C CA  . LYS A 1 127 ? 23.693 -6.888  -13.219 1.00 16.55 ? 470 LYS A CA  1 
ATOM   895  C C   . LYS A 1 127 ? 24.121 -5.781  -14.179 1.00 17.36 ? 470 LYS A C   1 
ATOM   896  O O   . LYS A 1 127 ? 23.942 -4.602  -13.898 1.00 16.63 ? 470 LYS A O   1 
ATOM   897  C CB  . LYS A 1 127 ? 22.219 -7.249  -13.414 1.00 16.95 ? 470 LYS A CB  1 
ATOM   898  C CG  . LYS A 1 127 ? 21.805 -8.488  -12.641 1.00 17.66 ? 470 LYS A CG  1 
ATOM   899  C CD  . LYS A 1 127 ? 20.328 -8.768  -12.825 1.00 19.14 ? 470 LYS A CD  1 
ATOM   900  C CE  . LYS A 1 127 ? 19.895 -9.982  -12.017 1.00 20.37 ? 470 LYS A CE  1 
ATOM   901  N NZ  . LYS A 1 127 ? 18.436 -10.228 -12.216 1.00 22.01 ? 470 LYS A NZ  1 
ATOM   902  N N   . ARG A 1 128 ? 24.735 -6.167  -15.291 1.00 18.49 ? 471 ARG A N   1 
ATOM   903  C CA  . ARG A 1 128 ? 25.178 -5.192  -16.281 1.00 20.18 ? 471 ARG A CA  1 
ATOM   904  C C   . ARG A 1 128 ? 23.964 -4.556  -16.955 1.00 19.97 ? 471 ARG A C   1 
ATOM   905  O O   . ARG A 1 128 ? 23.018 -5.254  -17.320 1.00 20.93 ? 471 ARG A O   1 
ATOM   906  C CB  . ARG A 1 128 ? 26.083 -5.873  -17.311 1.00 20.26 ? 471 ARG A CB  1 
ATOM   907  C CG  . ARG A 1 128 ? 26.784 -4.928  -18.282 1.00 22.25 ? 471 ARG A CG  1 
ATOM   908  C CD  . ARG A 1 128 ? 27.672 -5.699  -19.268 1.00 23.56 ? 471 ARG A CD  1 
ATOM   909  N NE  . ARG A 1 128 ? 28.959 -6.104  -18.695 1.00 31.27 ? 471 ARG A NE  1 
ATOM   910  C CZ  . ARG A 1 128 ? 29.219 -7.307  -18.182 1.00 33.11 ? 471 ARG A CZ  1 
ATOM   911  N NH1 . ARG A 1 128 ? 28.278 -8.250  -18.155 1.00 35.36 ? 471 ARG A NH1 1 
ATOM   912  N NH2 . ARG A 1 128 ? 30.426 -7.569  -17.690 1.00 34.48 ? 471 ARG A NH2 1 
ATOM   913  N N   . VAL A 1 129 ? 23.987 -3.232  -17.086 1.00 19.63 ? 472 VAL A N   1 
ATOM   914  C CA  . VAL A 1 129 ? 22.961 -2.514  -17.832 1.00 19.65 ? 472 VAL A CA  1 
ATOM   915  C C   . VAL A 1 129 ? 23.599 -2.015  -19.120 1.00 18.45 ? 472 VAL A C   1 
ATOM   916  O O   . VAL A 1 129 ? 24.449 -1.108  -19.113 1.00 18.85 ? 472 VAL A O   1 
ATOM   917  C CB  . VAL A 1 129 ? 22.338 -1.342  -17.034 1.00 19.69 ? 472 VAL A CB  1 
ATOM   918  C CG1 . VAL A 1 129 ? 21.299 -0.614  -17.881 1.00 21.64 ? 472 VAL A CG1 1 
ATOM   919  C CG2 . VAL A 1 129 ? 21.687 -1.849  -15.752 1.00 20.52 ? 472 VAL A CG2 1 
ATOM   920  N N   . TRP A 1 130 ? 23.187 -2.632  -20.220 1.00 18.29 ? 473 TRP A N   1 
ATOM   921  C CA  . TRP A 1 130 ? 23.699 -2.280  -21.544 1.00 17.37 ? 473 TRP A CA  1 
ATOM   922  C C   . TRP A 1 130 ? 23.328 -0.822  -21.862 1.00 16.87 ? 473 TRP A C   1 
ATOM   923  O O   . TRP A 1 130 ? 22.200 -0.388  -21.580 1.00 17.02 ? 473 TRP A O   1 
ATOM   924  C CB  . TRP A 1 130 ? 23.110 -3.239  -22.584 1.00 17.43 ? 473 TRP A CB  1 
ATOM   925  C CG  . TRP A 1 130 ? 23.567 -2.996  -23.992 1.00 17.71 ? 473 TRP A CG  1 
ATOM   926  C CD1 . TRP A 1 130 ? 24.671 -3.533  -24.600 1.00 17.80 ? 473 TRP A CD1 1 
ATOM   927  C CD2 . TRP A 1 130 ? 22.928 -2.172  -24.973 1.00 17.14 ? 473 TRP A CD2 1 
ATOM   928  N NE1 . TRP A 1 130 ? 24.765 -3.074  -25.899 1.00 17.00 ? 473 TRP A NE1 1 
ATOM   929  C CE2 . TRP A 1 130 ? 23.705 -2.241  -26.152 1.00 17.29 ? 473 TRP A CE2 1 
ATOM   930  C CE3 . TRP A 1 130 ? 21.777 -1.368  -24.968 1.00 16.61 ? 473 TRP A CE3 1 
ATOM   931  C CZ2 . TRP A 1 130 ? 23.365 -1.538  -27.316 1.00 16.41 ? 473 TRP A CZ2 1 
ATOM   932  C CZ3 . TRP A 1 130 ? 21.440 -0.669  -26.127 1.00 17.48 ? 473 TRP A CZ3 1 
ATOM   933  C CH2 . TRP A 1 130 ? 22.235 -0.762  -27.283 1.00 17.28 ? 473 TRP A CH2 1 
ATOM   934  N N   . PRO A 1 131 ? 24.243 -0.069  -22.496 1.00 16.40 ? 474 PRO A N   1 
ATOM   935  C CA  . PRO A 1 131 ? 25.564 -0.432  -23.019 1.00 16.19 ? 474 PRO A CA  1 
ATOM   936  C C   . PRO A 1 131 ? 26.719 -0.110  -22.066 1.00 16.26 ? 474 PRO A C   1 
ATOM   937  O O   . PRO A 1 131 ? 27.880 -0.186  -22.470 1.00 16.85 ? 474 PRO A O   1 
ATOM   938  C CB  . PRO A 1 131 ? 25.668 0.472   -24.255 1.00 16.04 ? 474 PRO A CB  1 
ATOM   939  C CG  . PRO A 1 131 ? 25.019 1.741   -23.776 1.00 15.72 ? 474 PRO A CG  1 
ATOM   940  C CD  . PRO A 1 131 ? 23.911 1.332   -22.828 1.00 16.56 ? 474 PRO A CD  1 
ATOM   941  N N   . ALA A 1 132 ? 26.404 0.254   -20.824 1.00 16.05 ? 475 ALA A N   1 
ATOM   942  C CA  . ALA A 1 132 ? 27.435 0.679   -19.882 1.00 16.21 ? 475 ALA A CA  1 
ATOM   943  C C   . ALA A 1 132 ? 28.202 -0.496  -19.267 1.00 16.46 ? 475 ALA A C   1 
ATOM   944  O O   . ALA A 1 132 ? 27.743 -1.648  -19.289 1.00 15.83 ? 475 ALA A O   1 
ATOM   945  C CB  . ALA A 1 132 ? 26.831 1.556   -18.784 1.00 16.41 ? 475 ALA A CB  1 
ATOM   946  N N   . SER A 1 133 ? 29.365 -0.186  -18.708 1.00 16.90 ? 476 SER A N   1 
ATOM   947  C CA  . SER A 1 133 ? 30.153 -1.159  -17.963 1.00 17.41 ? 476 SER A CA  1 
ATOM   948  C C   . SER A 1 133 ? 29.379 -1.610  -16.731 1.00 17.14 ? 476 SER A C   1 
ATOM   949  O O   . SER A 1 133 ? 28.565 -0.855  -16.191 1.00 17.03 ? 476 SER A O   1 
ATOM   950  C CB  . SER A 1 133 ? 31.478 -0.540  -17.522 1.00 18.03 ? 476 SER A CB  1 
ATOM   951  O OG  . SER A 1 133 ? 32.261 -0.160  -18.646 1.00 21.27 ? 476 SER A OG  1 
ATOM   952  N N   . GLN A 1 134 ? 29.634 -2.840  -16.299 1.00 16.41 ? 477 GLN A N   1 
ATOM   953  C CA  . GLN A 1 134 ? 29.064 -3.357  -15.065 1.00 16.16 ? 477 GLN A CA  1 
ATOM   954  C C   . GLN A 1 134 ? 29.499 -2.499  -13.877 1.00 15.33 ? 477 GLN A C   1 
ATOM   955  O O   . GLN A 1 134 ? 30.634 -2.028  -13.827 1.00 15.60 ? 477 GLN A O   1 
ATOM   956  C CB  . GLN A 1 134 ? 29.528 -4.789  -14.866 1.00 16.78 ? 477 GLN A CB  1 
ATOM   957  C CG  . GLN A 1 134 ? 28.788 -5.520  -13.780 1.00 17.97 ? 477 GLN A CG  1 
ATOM   958  C CD  . GLN A 1 134 ? 29.145 -6.974  -13.743 1.00 21.74 ? 477 GLN A CD  1 
ATOM   959  O OE1 . GLN A 1 134 ? 30.283 -7.358  -14.039 1.00 24.42 ? 477 GLN A OE1 1 
ATOM   960  N NE2 . GLN A 1 134 ? 28.179 -7.801  -13.378 1.00 22.47 ? 477 GLN A NE2 1 
ATOM   961  N N   . ARG A 1 135 ? 28.580 -2.282  -12.936 1.00 15.01 ? 478 ARG A N   1 
ATOM   962  C CA  . ARG A 1 135 ? 28.887 -1.542  -11.717 1.00 14.43 ? 478 ARG A CA  1 
ATOM   963  C C   . ARG A 1 135 ? 29.030 -2.461  -10.513 1.00 14.63 ? 478 ARG A C   1 
ATOM   964  O O   . ARG A 1 135 ? 28.305 -3.449  -10.396 1.00 15.80 ? 478 ARG A O   1 
ATOM   965  C CB  . ARG A 1 135 ? 27.785 -0.517  -11.427 1.00 14.43 ? 478 ARG A CB  1 
ATOM   966  C CG  . ARG A 1 135 ? 28.121 0.890   -11.879 1.00 15.08 ? 478 ARG A CG  1 
ATOM   967  C CD  . ARG A 1 135 ? 28.348 1.012   -13.379 1.00 14.92 ? 478 ARG A CD  1 
ATOM   968  N NE  . ARG A 1 135 ? 28.671 2.391   -13.709 1.00 15.95 ? 478 ARG A NE  1 
ATOM   969  C CZ  . ARG A 1 135 ? 29.025 2.808   -14.917 1.00 16.98 ? 478 ARG A CZ  1 
ATOM   970  N NH1 . ARG A 1 135 ? 29.096 1.944   -15.933 1.00 16.63 ? 478 ARG A NH1 1 
ATOM   971  N NH2 . ARG A 1 135 ? 29.300 4.092   -15.107 1.00 16.22 ? 478 ARG A NH2 1 
ATOM   972  N N   . ASP A 1 136 ? 29.978 -2.130  -9.637  1.00 14.33 ? 479 ASP A N   1 
ATOM   973  C CA  . ASP A 1 136 ? 30.019 -2.742  -8.310  1.00 14.50 ? 479 ASP A CA  1 
ATOM   974  C C   . ASP A 1 136 ? 29.923 -1.667  -7.230  1.00 14.45 ? 479 ASP A C   1 
ATOM   975  O O   . ASP A 1 136 ? 29.993 -0.472  -7.529  1.00 14.62 ? 479 ASP A O   1 
ATOM   976  C CB  . ASP A 1 136 ? 31.198 -3.732  -8.136  1.00 15.17 ? 479 ASP A CB  1 
ATOM   977  C CG  . ASP A 1 136 ? 32.577 -3.078  -8.201  1.00 15.66 ? 479 ASP A CG  1 
ATOM   978  O OD1 . ASP A 1 136 ? 32.700 -1.852  -8.358  1.00 16.85 ? 479 ASP A OD1 1 
ATOM   979  O OD2 . ASP A 1 136 ? 33.581 -3.819  -8.094  1.00 16.56 ? 479 ASP A OD2 1 
ATOM   980  N N   . VAL A 1 137 ? 29.705 -2.094  -5.989  1.00 13.82 ? 480 VAL A N   1 
ATOM   981  C CA  . VAL A 1 137 ? 29.524 -1.172  -4.870  1.00 13.49 ? 480 VAL A CA  1 
ATOM   982  C C   . VAL A 1 137 ? 30.044 -1.844  -3.601  1.00 13.75 ? 480 VAL A C   1 
ATOM   983  O O   . VAL A 1 137 ? 29.946 -3.065  -3.451  1.00 14.40 ? 480 VAL A O   1 
ATOM   984  C CB  A VAL A 1 137 ? 28.044 -0.681  -4.762  0.65 14.18 ? 480 VAL A CB  1 
ATOM   985  C CB  B VAL A 1 137 ? 28.021 -0.821  -4.615  0.35 13.89 ? 480 VAL A CB  1 
ATOM   986  C CG1 A VAL A 1 137 ? 27.108 -1.819  -4.446  0.65 13.46 ? 480 VAL A CG1 1 
ATOM   987  C CG1 B VAL A 1 137 ? 27.894 0.483   -3.839  0.35 13.81 ? 480 VAL A CG1 1 
ATOM   988  C CG2 A VAL A 1 137 ? 27.898 0.447   -3.750  0.65 14.15 ? 480 VAL A CG2 1 
ATOM   989  C CG2 B VAL A 1 137 ? 27.229 -0.720  -5.905  0.35 13.59 ? 480 VAL A CG2 1 
ATOM   990  N N   . LEU A 1 138 ? 30.570 -1.024  -2.700  1.00 12.92 ? 481 LEU A N   1 
ATOM   991  C CA  . LEU A 1 138 ? 31.146 -1.462  -1.435  1.00 12.90 ? 481 LEU A CA  1 
ATOM   992  C C   . LEU A 1 138 ? 30.617 -0.496  -0.378  1.00 12.31 ? 481 LEU A C   1 
ATOM   993  O O   . LEU A 1 138 ? 30.936 0.690   -0.399  1.00 12.19 ? 481 LEU A O   1 
ATOM   994  C CB  . LEU A 1 138 ? 32.668 -1.394  -1.531  1.00 13.07 ? 481 LEU A CB  1 
ATOM   995  C CG  . LEU A 1 138 ? 33.470 -1.748  -0.282  1.00 13.06 ? 481 LEU A CG  1 
ATOM   996  C CD1 . LEU A 1 138 ? 33.235 -3.210  0.131   1.00 15.08 ? 481 LEU A CD1 1 
ATOM   997  C CD2 . LEU A 1 138 ? 34.943 -1.439  -0.505  1.00 14.02 ? 481 LEU A CD2 1 
ATOM   998  N N   . TYR A 1 139 ? 29.790 -1.011  0.528   1.00 11.78 ? 482 TYR A N   1 
ATOM   999  C CA  . TYR A 1 139 ? 29.044 -0.140  1.422   1.00 11.90 ? 482 TYR A CA  1 
ATOM   1000 C C   . TYR A 1 139 ? 28.896 -0.673  2.826   1.00 12.30 ? 482 TYR A C   1 
ATOM   1001 O O   . TYR A 1 139 ? 28.838 -1.885  3.045   1.00 13.00 ? 482 TYR A O   1 
ATOM   1002 C CB  . TYR A 1 139 ? 27.679 0.232   0.818   1.00 11.98 ? 482 TYR A CB  1 
ATOM   1003 C CG  . TYR A 1 139 ? 26.742 -0.924  0.590   1.00 11.59 ? 482 TYR A CG  1 
ATOM   1004 C CD1 . TYR A 1 139 ? 25.771 -1.242  1.533   1.00 11.52 ? 482 TYR A CD1 1 
ATOM   1005 C CD2 . TYR A 1 139 ? 26.817 -1.706  -0.569  1.00 11.54 ? 482 TYR A CD2 1 
ATOM   1006 C CE1 . TYR A 1 139 ? 24.896 -2.305  1.352   1.00 11.68 ? 482 TYR A CE1 1 
ATOM   1007 C CE2 . TYR A 1 139 ? 25.931 -2.769  -0.769  1.00 11.44 ? 482 TYR A CE2 1 
ATOM   1008 C CZ  . TYR A 1 139 ? 24.992 -3.076  0.203   1.00 11.85 ? 482 TYR A CZ  1 
ATOM   1009 O OH  . TYR A 1 139 ? 24.116 -4.122  0.000   1.00 13.06 ? 482 TYR A OH  1 
ATOM   1010 N N   . LEU A 1 140 ? 28.903 0.254   3.777   1.00 11.23 ? 483 LEU A N   1 
ATOM   1011 C CA  . LEU A 1 140 ? 28.550 -0.039  5.144   1.00 11.69 ? 483 LEU A CA  1 
ATOM   1012 C C   . LEU A 1 140 ? 27.017 -0.046  5.240   1.00 11.51 ? 483 LEU A C   1 
ATOM   1013 O O   . LEU A 1 140 ? 26.341 0.887   4.785   1.00 11.22 ? 483 LEU A O   1 
ATOM   1014 C CB  . LEU A 1 140 ? 29.180 1.009   6.067   1.00 11.38 ? 483 LEU A CB  1 
ATOM   1015 C CG  . LEU A 1 140 ? 29.135 0.769   7.581   1.00 12.80 ? 483 LEU A CG  1 
ATOM   1016 C CD1 . LEU A 1 140 ? 30.184 1.614   8.253   1.00 13.50 ? 483 LEU A CD1 1 
ATOM   1017 C CD2 . LEU A 1 140 ? 27.782 1.050   8.207   1.00 14.44 ? 483 LEU A CD2 1 
ATOM   1018 N N   . SER A 1 141 ? 26.469 -1.114  5.813   1.00 11.53 ? 484 SER A N   1 
ATOM   1019 C CA  . SER A 1 141 ? 25.036 -1.230  6.014   1.00 11.32 ? 484 SER A CA  1 
ATOM   1020 C C   . SER A 1 141 ? 24.764 -1.295  7.508   1.00 11.35 ? 484 SER A C   1 
ATOM   1021 O O   . SER A 1 141 ? 25.224 -2.216  8.173   1.00 11.40 ? 484 SER A O   1 
ATOM   1022 C CB  . SER A 1 141 ? 24.515 -2.496  5.321   1.00 11.53 ? 484 SER A CB  1 
ATOM   1023 O OG  . SER A 1 141 ? 23.111 -2.603  5.437   1.00 11.05 ? 484 SER A OG  1 
ATOM   1024 N N   . VAL A 1 142 ? 24.035 -0.316  8.032   1.00 11.26 ? 485 VAL A N   1 
ATOM   1025 C CA  . VAL A 1 142 ? 23.787 -0.233  9.475   1.00 11.40 ? 485 VAL A CA  1 
ATOM   1026 C C   . VAL A 1 142 ? 22.290 -0.108  9.733   1.00 11.56 ? 485 VAL A C   1 
ATOM   1027 O O   . VAL A 1 142 ? 21.599 0.595   8.993   1.00 11.49 ? 485 VAL A O   1 
ATOM   1028 C CB  . VAL A 1 142 ? 24.609 0.943   10.112  1.00 11.50 ? 485 VAL A CB  1 
ATOM   1029 C CG1 . VAL A 1 142 ? 24.311 2.306   9.434   1.00 12.40 ? 485 VAL A CG1 1 
ATOM   1030 C CG2 . VAL A 1 142 ? 24.431 1.007   11.638  1.00 12.95 ? 485 VAL A CG2 1 
ATOM   1031 N N   . ILE A 1 143 ? 21.802 -0.819  10.754  1.00 11.30 ? 486 ILE A N   1 
ATOM   1032 C CA  . ILE A 1 143 ? 20.416 -0.745  11.205  1.00 11.94 ? 486 ILE A CA  1 
ATOM   1033 C C   . ILE A 1 143 ? 20.380 -0.112  12.605  1.00 12.67 ? 486 ILE A C   1 
ATOM   1034 O O   . ILE A 1 143 ? 21.124 -0.520  13.495  1.00 12.83 ? 486 ILE A O   1 
ATOM   1035 C CB  . ILE A 1 143 ? 19.721 -2.142  11.154  1.00 12.12 ? 486 ILE A CB  1 
ATOM   1036 C CG1 A ILE A 1 143 ? 18.254 -2.016  11.585  0.70 11.48 ? 486 ILE A CG1 1 
ATOM   1037 C CG1 B ILE A 1 143 ? 18.314 -2.093  11.758  0.30 12.31 ? 486 ILE A CG1 1 
ATOM   1038 C CG2 . ILE A 1 143 ? 20.520 -3.215  11.931  1.00 12.84 ? 486 ILE A CG2 1 
ATOM   1039 C CD1 A ILE A 1 143 ? 17.435 -3.268  11.383  0.70 10.47 ? 486 ILE A CD1 1 
ATOM   1040 C CD1 B ILE A 1 143 ? 17.408 -1.060  11.170  0.30 13.02 ? 486 ILE A CD1 1 
ATOM   1041 N N   . ARG A 1 144 ? 19.537 0.903   12.771  1.00 13.13 ? 487 ARG A N   1 
ATOM   1042 C CA  . ARG A 1 144 ? 19.494 1.667   14.019  1.00 14.24 ? 487 ARG A CA  1 
ATOM   1043 C C   . ARG A 1 144 ? 18.073 1.983   14.409  1.00 14.19 ? 487 ARG A C   1 
ATOM   1044 O O   . ARG A 1 144 ? 17.249 2.304   13.552  1.00 13.42 ? 487 ARG A O   1 
ATOM   1045 C CB  A ARG A 1 144 ? 20.294 2.966   13.902  0.50 14.62 ? 487 ARG A CB  1 
ATOM   1046 C CB  B ARG A 1 144 ? 20.270 2.982   13.864  0.50 14.32 ? 487 ARG A CB  1 
ATOM   1047 C CG  A ARG A 1 144 ? 21.693 2.913   14.509  0.50 17.95 ? 487 ARG A CG  1 
ATOM   1048 C CG  B ARG A 1 144 ? 21.786 2.849   13.636  0.50 15.85 ? 487 ARG A CG  1 
ATOM   1049 C CD  A ARG A 1 144 ? 21.702 3.290   15.999  0.50 20.92 ? 487 ARG A CD  1 
ATOM   1050 C CD  B ARG A 1 144 ? 22.569 2.972   14.951  0.50 18.34 ? 487 ARG A CD  1 
ATOM   1051 N NE  A ARG A 1 144 ? 21.117 4.609   16.262  0.50 24.13 ? 487 ARG A NE  1 
ATOM   1052 N NE  B ARG A 1 144 ? 22.296 4.251   15.603  0.50 20.26 ? 487 ARG A NE  1 
ATOM   1053 C CZ  A ARG A 1 144 ? 21.699 5.777   15.985  0.50 24.78 ? 487 ARG A CZ  1 
ATOM   1054 C CZ  B ARG A 1 144 ? 23.174 5.236   15.771  0.50 21.52 ? 487 ARG A CZ  1 
ATOM   1055 N NH1 A ARG A 1 144 ? 22.901 5.826   15.416  0.50 25.52 ? 487 ARG A NH1 1 
ATOM   1056 N NH1 B ARG A 1 144 ? 24.427 5.105   15.358  0.50 22.07 ? 487 ARG A NH1 1 
ATOM   1057 N NH2 A ARG A 1 144 ? 21.069 6.909   16.268  0.50 25.74 ? 487 ARG A NH2 1 
ATOM   1058 N NH2 B ARG A 1 144 ? 22.789 6.360   16.369  0.50 24.03 ? 487 ARG A NH2 1 
ATOM   1059 N N   . LYS A 1 145 ? 17.796 1.903   15.714  1.00 14.70 ? 488 LYS A N   1 
ATOM   1060 C CA  . LYS A 1 145 ? 16.549 2.412   16.262  1.00 16.39 ? 488 LYS A CA  1 
ATOM   1061 C C   . LYS A 1 145 ? 16.811 3.787   16.849  1.00 16.58 ? 488 LYS A C   1 
ATOM   1062 O O   . LYS A 1 145 ? 17.769 3.976   17.606  1.00 17.22 ? 488 LYS A O   1 
ATOM   1063 C CB  . LYS A 1 145 ? 16.011 1.483   17.351  1.00 16.25 ? 488 LYS A CB  1 
ATOM   1064 C CG  . LYS A 1 145 ? 14.675 1.941   17.955  1.00 18.21 ? 488 LYS A CG  1 
ATOM   1065 C CD  A LYS A 1 145 ? 14.114 0.942   18.977  0.60 18.59 ? 488 LYS A CD  1 
ATOM   1066 C CD  B LYS A 1 145 ? 14.371 1.190   19.245  0.40 20.01 ? 488 LYS A CD  1 
ATOM   1067 C CE  A LYS A 1 145 ? 14.718 1.133   20.358  0.60 22.41 ? 488 LYS A CE  1 
ATOM   1068 C CE  B LYS A 1 145 ? 14.556 2.082   20.458  0.40 20.66 ? 488 LYS A CE  1 
ATOM   1069 N NZ  A LYS A 1 145 ? 13.880 0.496   21.419  0.60 23.01 ? 488 LYS A NZ  1 
ATOM   1070 N NZ  B LYS A 1 145 ? 13.375 2.964   20.649  0.40 22.66 ? 488 LYS A NZ  1 
ATOM   1071 N N   . ILE A 1 146 ? 15.961 4.737   16.483  1.00 17.32 ? 489 ILE A N   1 
ATOM   1072 C CA  . ILE A 1 146 ? 16.034 6.092   17.030  1.00 18.67 ? 489 ILE A CA  1 
ATOM   1073 C C   . ILE A 1 146 ? 14.822 6.249   17.943  1.00 19.41 ? 489 ILE A C   1 
ATOM   1074 O O   . ILE A 1 146 ? 13.702 6.410   17.451  1.00 18.85 ? 489 ILE A O   1 
ATOM   1075 C CB  . ILE A 1 146 ? 16.041 7.167   15.908  1.00 18.73 ? 489 ILE A CB  1 
ATOM   1076 C CG1 A ILE A 1 146 ? 17.199 6.869   14.953  0.60 19.87 ? 489 ILE A CG1 1 
ATOM   1077 C CG1 B ILE A 1 146 ? 17.046 6.838   14.783  0.40 19.10 ? 489 ILE A CG1 1 
ATOM   1078 C CG2 . ILE A 1 146 ? 16.205 8.584   16.504  1.00 19.37 ? 489 ILE A CG2 1 
ATOM   1079 C CD1 A ILE A 1 146 ? 17.247 7.725   13.746  0.60 21.46 ? 489 ILE A CD1 1 
ATOM   1080 C CD1 B ILE A 1 146 ? 18.501 6.664   15.212  0.40 18.90 ? 489 ILE A CD1 1 
ATOM   1081 N N   . PRO A 1 147 ? 15.032 6.167   19.279  1.00 20.49 ? 490 PRO A N   1 
ATOM   1082 C CA  . PRO A 1 147 ? 13.894 6.214   20.202  1.00 21.29 ? 490 PRO A CA  1 
ATOM   1083 C C   . PRO A 1 147 ? 13.129 7.526   20.158  1.00 22.17 ? 490 PRO A C   1 
ATOM   1084 O O   . PRO A 1 147 ? 13.702 8.575   19.857  1.00 22.48 ? 490 PRO A O   1 
ATOM   1085 C CB  . PRO A 1 147 ? 14.544 6.059   21.584  1.00 21.55 ? 490 PRO A CB  1 
ATOM   1086 C CG  . PRO A 1 147 ? 15.894 5.470   21.328  1.00 21.81 ? 490 PRO A CG  1 
ATOM   1087 C CD  . PRO A 1 147 ? 16.316 6.009   19.993  1.00 20.53 ? 490 PRO A CD  1 
ATOM   1088 N N   . ALA A 1 148 ? 11.835 7.445   20.461  1.00 23.80 ? 491 ALA A N   1 
ATOM   1089 C CA  . ALA A 1 148 ? 10.999 8.621   20.633  1.00 25.70 ? 491 ALA A CA  1 
ATOM   1090 C C   . ALA A 1 148 ? 11.497 9.377   21.856  1.00 27.08 ? 491 ALA A C   1 
ATOM   1091 O O   . ALA A 1 148 ? 11.776 8.764   22.889  1.00 27.48 ? 491 ALA A O   1 
ATOM   1092 C CB  . ALA A 1 148 ? 9.557  8.200   20.829  1.00 25.65 ? 491 ALA A CB  1 
ATOM   1093 N N   . LEU A 1 149 ? 11.633 10.692  21.721  1.00 28.76 ? 492 LEU A N   1 
ATOM   1094 C CA  . LEU A 1 149 ? 12.099 11.543  22.822  1.00 30.74 ? 492 LEU A CA  1 
ATOM   1095 C C   . LEU A 1 149 ? 10.929 12.093  23.636  1.00 31.89 ? 492 LEU A C   1 
ATOM   1096 O O   . LEU A 1 149 ? 11.074 12.382  24.833  1.00 32.41 ? 492 LEU A O   1 
ATOM   1097 C CB  . LEU A 1 149 ? 12.998 12.672  22.297  1.00 30.82 ? 492 LEU A CB  1 
ATOM   1098 C CG  . LEU A 1 149 ? 14.346 12.244  21.697  1.00 31.91 ? 492 LEU A CG  1 
ATOM   1099 C CD1 . LEU A 1 149 ? 15.109 13.440  21.148  1.00 33.17 ? 492 LEU A CD1 1 
ATOM   1100 C CD2 . LEU A 1 149 ? 15.198 11.481  22.708  1.00 32.69 ? 492 LEU A CD2 1 
ATOM   1101 N N   . THR A 1 150 ? 9.774  12.223  22.982  1.00 32.85 ? 493 THR A N   1 
ATOM   1102 C CA  . THR A 1 150 ? 8.533  12.654  23.632  1.00 33.65 ? 493 THR A CA  1 
ATOM   1103 C C   . THR A 1 150 ? 7.393  11.670  23.343  1.00 33.81 ? 493 THR A C   1 
ATOM   1104 O O   . THR A 1 150 ? 7.540  10.759  22.520  1.00 33.81 ? 493 THR A O   1 
ATOM   1105 C CB  . THR A 1 150 ? 8.110  14.073  23.178  1.00 33.87 ? 493 THR A CB  1 
ATOM   1106 O OG1 . THR A 1 150 ? 7.702  14.041  21.805  1.00 35.11 ? 493 THR A OG1 1 
ATOM   1107 C CG2 . THR A 1 150 ? 9.250  15.072  23.345  1.00 34.27 ? 493 THR A CG2 1 
ATOM   1108 N N   . GLU A 1 151 ? 6.260  11.863  24.018  1.00 33.88 ? 494 GLU A N   1 
ATOM   1109 C CA  . GLU A 1 151 ? 5.063  11.047  23.805  1.00 34.07 ? 494 GLU A CA  1 
ATOM   1110 C C   . GLU A 1 151 ? 4.614  11.069  22.340  1.00 33.02 ? 494 GLU A C   1 
ATOM   1111 O O   . GLU A 1 151 ? 4.224  10.033  21.790  1.00 33.34 ? 494 GLU A O   1 
ATOM   1112 C CB  . GLU A 1 151 ? 3.917  11.526  24.712  1.00 34.15 ? 494 GLU A CB  1 
ATOM   1113 C CG  . GLU A 1 151 ? 2.686  10.605  24.715  1.00 35.64 ? 494 GLU A CG  1 
ATOM   1114 C CD  . GLU A 1 151 ? 1.515  11.153  25.527  1.00 35.79 ? 494 GLU A CD  1 
ATOM   1115 O OE1 . GLU A 1 151 ? 1.740  11.936  26.481  1.00 38.87 ? 494 GLU A OE1 1 
ATOM   1116 O OE2 . GLU A 1 151 ? 0.359  10.785  25.214  1.00 38.14 ? 494 GLU A OE2 1 
ATOM   1117 N N   . ASN A 1 152 ? 4.686  12.245  21.720  1.00 31.90 ? 495 ASN A N   1 
ATOM   1118 C CA  . ASN A 1 152 ? 4.235  12.431  20.335  1.00 31.09 ? 495 ASN A CA  1 
ATOM   1119 C C   . ASN A 1 152 ? 5.314  12.250  19.261  1.00 30.06 ? 495 ASN A C   1 
ATOM   1120 O O   . ASN A 1 152 ? 5.006  12.234  18.067  1.00 30.49 ? 495 ASN A O   1 
ATOM   1121 C CB  . ASN A 1 152 ? 3.536  13.785  20.171  1.00 31.15 ? 495 ASN A CB  1 
ATOM   1122 C CG  . ASN A 1 152 ? 2.169  13.826  20.845  1.00 32.02 ? 495 ASN A CG  1 
ATOM   1123 O OD1 . ASN A 1 152 ? 1.437  12.833  20.863  1.00 33.64 ? 495 ASN A OD1 1 
ATOM   1124 N ND2 . ASN A 1 152 ? 1.817  14.983  21.393  1.00 33.27 ? 495 ASN A ND2 1 
ATOM   1125 N N   . ASP A 1 153 ? 6.570  12.134  19.681  1.00 28.39 ? 496 ASP A N   1 
ATOM   1126 C CA  . ASP A 1 153 ? 7.681  11.874  18.765  1.00 27.19 ? 496 ASP A CA  1 
ATOM   1127 C C   . ASP A 1 153 ? 7.519  10.430  18.284  1.00 25.38 ? 496 ASP A C   1 
ATOM   1128 O O   . ASP A 1 153 ? 7.338  9.535   19.103  1.00 25.81 ? 496 ASP A O   1 
ATOM   1129 C CB  . ASP A 1 153 ? 9.008  12.049  19.526  1.00 27.27 ? 496 ASP A CB  1 
ATOM   1130 C CG  . ASP A 1 153 ? 10.235 12.118  18.615  1.00 29.14 ? 496 ASP A CG  1 
ATOM   1131 O OD1 . ASP A 1 153 ? 10.106 12.462  17.420  1.00 30.57 ? 496 ASP A OD1 1 
ATOM   1132 O OD2 . ASP A 1 153 ? 11.350 11.845  19.126  1.00 30.38 ? 496 ASP A OD2 1 
ATOM   1133 N N   . PRO A 1 154 ? 7.532  10.195  16.957  1.00 23.80 ? 497 PRO A N   1 
ATOM   1134 C CA  . PRO A 1 154 ? 7.520  8.801   16.522  1.00 22.36 ? 497 PRO A CA  1 
ATOM   1135 C C   . PRO A 1 154 ? 8.890  8.154   16.716  1.00 21.18 ? 497 PRO A C   1 
ATOM   1136 O O   . PRO A 1 154 ? 9.910  8.819   16.536  1.00 21.65 ? 497 PRO A O   1 
ATOM   1137 C CB  . PRO A 1 154 ? 7.216  8.905   15.019  1.00 22.63 ? 497 PRO A CB  1 
ATOM   1138 C CG  . PRO A 1 154 ? 7.735  10.230  14.620  1.00 22.62 ? 497 PRO A CG  1 
ATOM   1139 C CD  . PRO A 1 154 ? 7.531  11.137  15.818  1.00 23.84 ? 497 PRO A CD  1 
ATOM   1140 N N   . GLU A 1 155 ? 8.904  6.884   17.091  1.00 19.28 ? 498 GLU A N   1 
ATOM   1141 C CA  . GLU A 1 155 ? 10.121 6.078   17.059  1.00 17.79 ? 498 GLU A CA  1 
ATOM   1142 C C   . GLU A 1 155 ? 10.447 5.845   15.595  1.00 17.11 ? 498 GLU A C   1 
ATOM   1143 O O   . GLU A 1 155 ? 9.544  5.664   14.778  1.00 17.02 ? 498 GLU A O   1 
ATOM   1144 C CB  . GLU A 1 155 ? 9.876  4.745   17.754  1.00 18.21 ? 498 GLU A CB  1 
ATOM   1145 C CG  . GLU A 1 155 ? 11.015 3.764   17.703  1.00 19.65 ? 498 GLU A CG  1 
ATOM   1146 C CD  . GLU A 1 155 ? 10.695 2.523   18.489  1.00 22.03 ? 498 GLU A CD  1 
ATOM   1147 O OE1 . GLU A 1 155 ? 10.811 2.574   19.735  1.00 23.65 ? 498 GLU A OE1 1 
ATOM   1148 O OE2 . GLU A 1 155 ? 10.325 1.504   17.870  1.00 19.84 ? 498 GLU A OE2 1 
ATOM   1149 N N   . THR A 1 156 ? 11.735 5.843   15.272  1.00 15.46 ? 499 THR A N   1 
ATOM   1150 C CA  . THR A 1 156 ? 12.170 5.594   13.898  1.00 14.94 ? 499 THR A CA  1 
ATOM   1151 C C   . THR A 1 156 ? 13.116 4.407   13.855  1.00 14.57 ? 499 THR A C   1 
ATOM   1152 O O   . THR A 1 156 ? 14.016 4.283   14.691  1.00 15.42 ? 499 THR A O   1 
ATOM   1153 C CB  . THR A 1 156 ? 12.883 6.819   13.305  1.00 14.55 ? 499 THR A CB  1 
ATOM   1154 O OG1 . THR A 1 156 ? 12.042 7.964   13.456  1.00 15.51 ? 499 THR A OG1 1 
ATOM   1155 C CG2 . THR A 1 156 ? 13.179 6.616   11.812  1.00 15.95 ? 499 THR A CG2 1 
ATOM   1156 N N   . TRP A 1 157 ? 12.882 3.518   12.887  1.00 12.93 ? 500 TRP A N   1 
ATOM   1157 C CA  . TRP A 1 157 ? 13.854 2.493   12.517  1.00 12.93 ? 500 TRP A CA  1 
ATOM   1158 C C   . TRP A 1 157 ? 14.450 2.908   11.181  1.00 12.54 ? 500 TRP A C   1 
ATOM   1159 O O   . TRP A 1 157 ? 13.727 3.299   10.252  1.00 12.95 ? 500 TRP A O   1 
ATOM   1160 C CB  . TRP A 1 157 ? 13.193 1.119   12.444  1.00 12.95 ? 500 TRP A CB  1 
ATOM   1161 C CG  . TRP A 1 157 ? 13.106 0.452   13.782  1.00 12.91 ? 500 TRP A CG  1 
ATOM   1162 C CD1 . TRP A 1 157 ? 12.068 0.525   14.662  1.00 14.50 ? 500 TRP A CD1 1 
ATOM   1163 C CD2 . TRP A 1 157 ? 14.091 -0.395  14.386  1.00 12.73 ? 500 TRP A CD2 1 
ATOM   1164 N NE1 . TRP A 1 157 ? 12.350 -0.213  15.785  1.00 14.04 ? 500 TRP A NE1 1 
ATOM   1165 C CE2 . TRP A 1 157 ? 13.581 -0.796  15.642  1.00 14.15 ? 500 TRP A CE2 1 
ATOM   1166 C CE3 . TRP A 1 157 ? 15.351 -0.854  13.990  1.00 14.46 ? 500 TRP A CE3 1 
ATOM   1167 C CZ2 . TRP A 1 157 ? 14.291 -1.646  16.506  1.00 13.92 ? 500 TRP A CZ2 1 
ATOM   1168 C CZ3 . TRP A 1 157 ? 16.064 -1.699  14.850  1.00 15.24 ? 500 TRP A CZ3 1 
ATOM   1169 C CH2 . TRP A 1 157 ? 15.527 -2.082  16.099  1.00 14.12 ? 500 TRP A CH2 1 
ATOM   1170 N N   . ILE A 1 158 ? 15.771 2.862   11.100  1.00 11.46 ? 501 ILE A N   1 
ATOM   1171 C CA  . ILE A 1 158 ? 16.458 3.269   9.879   1.00 12.19 ? 501 ILE A CA  1 
ATOM   1172 C C   . ILE A 1 158 ? 17.559 2.292   9.494   1.00 12.27 ? 501 ILE A C   1 
ATOM   1173 O O   . ILE A 1 158 ? 18.301 1.813   10.350  1.00 12.23 ? 501 ILE A O   1 
ATOM   1174 C CB  . ILE A 1 158 ? 17.019 4.709   9.998   1.00 12.20 ? 501 ILE A CB  1 
ATOM   1175 C CG1 . ILE A 1 158 ? 17.637 5.173   8.671   1.00 12.14 ? 501 ILE A CG1 1 
ATOM   1176 C CG2 . ILE A 1 158 ? 18.029 4.833   11.172  1.00 14.54 ? 501 ILE A CG2 1 
ATOM   1177 C CD1 . ILE A 1 158 ? 18.080 6.635   8.657   1.00 13.22 ? 501 ILE A CD1 1 
ATOM   1178 N N   . VAL A 1 159 ? 17.662 2.002   8.201   1.00 11.43 ? 502 VAL A N   1 
ATOM   1179 C CA  . VAL A 1 159 ? 18.819 1.313   7.655   1.00 11.09 ? 502 VAL A CA  1 
ATOM   1180 C C   . VAL A 1 159 ? 19.523 2.278   6.713   1.00 11.37 ? 502 VAL A C   1 
ATOM   1181 O O   . VAL A 1 159 ? 18.890 2.854   5.823   1.00 11.07 ? 502 VAL A O   1 
ATOM   1182 C CB  . VAL A 1 159 ? 18.418 0.027   6.875   1.00 10.12 ? 502 VAL A CB  1 
ATOM   1183 C CG1 . VAL A 1 159 ? 19.635 -0.619  6.220   1.00 10.94 ? 502 VAL A CG1 1 
ATOM   1184 C CG2 . VAL A 1 159 ? 17.762 -0.974  7.806   1.00 10.75 ? 502 VAL A CG2 1 
ATOM   1185 N N   . CYS A 1 160 ? 20.819 2.474   6.920   1.00 11.49 ? 503 CYS A N   1 
ATOM   1186 C CA  . CYS A 1 160 ? 21.608 3.314   6.039   1.00 11.60 ? 503 CYS A CA  1 
ATOM   1187 C C   . CYS A 1 160 ? 22.674 2.472   5.363   1.00 11.48 ? 503 CYS A C   1 
ATOM   1188 O O   . CYS A 1 160 ? 23.428 1.764   6.044   1.00 11.89 ? 503 CYS A O   1 
ATOM   1189 C CB  A CYS A 1 160 ? 22.346 4.384   6.844   0.50 12.10 ? 503 CYS A CB  1 
ATOM   1190 C CB  B CYS A 1 160 ? 22.221 4.486   6.788   0.50 12.09 ? 503 CYS A CB  1 
ATOM   1191 S SG  A CYS A 1 160 ? 21.356 5.598   7.686   0.50 12.64 ? 503 CYS A SG  1 
ATOM   1192 S SG  B CYS A 1 160 ? 23.006 5.628   5.657   0.50 13.67 ? 503 CYS A SG  1 
ATOM   1193 N N   . ASN A 1 161 ? 22.729 2.564   4.031   1.00 10.86 ? 504 ASN A N   1 
ATOM   1194 C CA  . ASN A 1 161 ? 23.741 1.887   3.212   1.00 10.74 ? 504 ASN A CA  1 
ATOM   1195 C C   . ASN A 1 161 ? 24.546 2.981   2.536   1.00 10.91 ? 504 ASN A C   1 
ATOM   1196 O O   . ASN A 1 161 ? 24.010 3.733   1.709   1.00 11.01 ? 504 ASN A O   1 
ATOM   1197 C CB  . ASN A 1 161 ? 23.073 1.031   2.124   1.00 10.90 ? 504 ASN A CB  1 
ATOM   1198 C CG  . ASN A 1 161 ? 22.278 -0.133  2.682   1.00 11.91 ? 504 ASN A CG  1 
ATOM   1199 O OD1 . ASN A 1 161 ? 21.383 -0.680  2.011   1.00 15.45 ? 504 ASN A OD1 1 
ATOM   1200 N ND2 . ASN A 1 161 ? 22.602 -0.534  3.896   1.00 9.63  ? 504 ASN A ND2 1 
ATOM   1201 N N   . PHE A 1 162 ? 25.821 3.104   2.898   1.00 10.24 ? 505 PHE A N   1 
ATOM   1202 C CA  . PHE A 1 162 ? 26.650 4.153   2.307   1.00 10.42 ? 505 PHE A CA  1 
ATOM   1203 C C   . PHE A 1 162 ? 28.054 3.657   1.998   1.00 10.79 ? 505 PHE A C   1 
ATOM   1204 O O   . PHE A 1 162 ? 28.649 2.879   2.753   1.00 10.52 ? 505 PHE A O   1 
ATOM   1205 C CB  . PHE A 1 162 ? 26.669 5.414   3.187   1.00 11.03 ? 505 PHE A CB  1 
ATOM   1206 C CG  . PHE A 1 162 ? 27.256 5.206   4.563   1.00 10.58 ? 505 PHE A CG  1 
ATOM   1207 C CD1 . PHE A 1 162 ? 28.613 5.408   4.795   1.00 11.77 ? 505 PHE A CD1 1 
ATOM   1208 C CD2 . PHE A 1 162 ? 26.447 4.838   5.628   1.00 10.77 ? 505 PHE A CD2 1 
ATOM   1209 C CE1 . PHE A 1 162 ? 29.156 5.213   6.083   1.00 13.14 ? 505 PHE A CE1 1 
ATOM   1210 C CE2 . PHE A 1 162 ? 26.988 4.667   6.911   1.00 11.98 ? 505 PHE A CE2 1 
ATOM   1211 C CZ  . PHE A 1 162 ? 28.332 4.838   7.129   1.00 12.81 ? 505 PHE A CZ  1 
ATOM   1212 N N   . SER A 1 163 ? 28.591 4.132   0.885   1.00 10.73 ? 506 SER A N   1 
ATOM   1213 C CA  . SER A 1 163 ? 29.877 3.645   0.429   1.00 11.37 ? 506 SER A CA  1 
ATOM   1214 C C   . SER A 1 163 ? 30.995 3.923   1.424   1.00 11.91 ? 506 SER A C   1 
ATOM   1215 O O   . SER A 1 163 ? 31.086 5.013   2.001   1.00 12.45 ? 506 SER A O   1 
ATOM   1216 C CB  . SER A 1 163 ? 30.215 4.243   -0.936  1.00 10.94 ? 506 SER A CB  1 
ATOM   1217 O OG  . SER A 1 163 ? 29.353 3.718   -1.927  1.00 11.55 ? 506 SER A OG  1 
ATOM   1218 N N   . VAL A 1 164 ? 31.834 2.907   1.620   1.00 12.96 ? 507 VAL A N   1 
ATOM   1219 C CA  . VAL A 1 164 ? 33.067 3.036   2.398   1.00 13.24 ? 507 VAL A CA  1 
ATOM   1220 C C   . VAL A 1 164 ? 34.183 2.319   1.654   1.00 14.21 ? 507 VAL A C   1 
ATOM   1221 O O   . VAL A 1 164 ? 33.920 1.493   0.768   1.00 14.72 ? 507 VAL A O   1 
ATOM   1222 C CB  . VAL A 1 164 ? 32.945 2.483   3.847   1.00 13.69 ? 507 VAL A CB  1 
ATOM   1223 C CG1 . VAL A 1 164 ? 31.898 3.262   4.650   1.00 13.30 ? 507 VAL A CG1 1 
ATOM   1224 C CG2 . VAL A 1 164 ? 32.649 0.982   3.860   1.00 12.69 ? 507 VAL A CG2 1 
ATOM   1225 N N   . ASP A 1 165 ? 35.424 2.646   2.010   1.00 15.17 ? 508 ASP A N   1 
ATOM   1226 C CA  . ASP A 1 165 ? 36.574 1.956   1.437   1.00 16.52 ? 508 ASP A CA  1 
ATOM   1227 C C   . ASP A 1 165 ? 36.991 0.780   2.301   1.00 17.29 ? 508 ASP A C   1 
ATOM   1228 O O   . ASP A 1 165 ? 36.887 0.829   3.531   1.00 18.20 ? 508 ASP A O   1 
ATOM   1229 C CB  . ASP A 1 165 ? 37.767 2.898   1.316   1.00 16.87 ? 508 ASP A CB  1 
ATOM   1230 C CG  . ASP A 1 165 ? 37.462 4.136   0.510   1.00 18.21 ? 508 ASP A CG  1 
ATOM   1231 O OD1 . ASP A 1 165 ? 36.643 4.062   -0.426  1.00 21.51 ? 508 ASP A OD1 1 
ATOM   1232 O OD2 . ASP A 1 165 ? 38.073 5.178   0.810   1.00 23.08 ? 508 ASP A OD2 1 
ATOM   1233 N N   . HIS A 1 166 ? 37.490 -0.267  1.652   1.00 17.87 ? 509 HIS A N   1 
ATOM   1234 C CA  . HIS A 1 166 ? 38.010 -1.421  2.376   1.00 19.06 ? 509 HIS A CA  1 
ATOM   1235 C C   . HIS A 1 166 ? 39.109 -2.100  1.562   1.00 20.44 ? 509 HIS A C   1 
ATOM   1236 O O   . HIS A 1 166 ? 38.911 -2.420  0.390   1.00 20.64 ? 509 HIS A O   1 
ATOM   1237 C CB  . HIS A 1 166 ? 36.893 -2.413  2.715   1.00 18.63 ? 509 HIS A CB  1 
ATOM   1238 C CG  . HIS A 1 166 ? 37.308 -3.466  3.696   1.00 18.64 ? 509 HIS A CG  1 
ATOM   1239 N ND1 . HIS A 1 166 ? 36.815 -3.531  4.982   1.00 21.06 ? 509 HIS A ND1 1 
ATOM   1240 C CD2 . HIS A 1 166 ? 38.197 -4.480  3.583   1.00 19.19 ? 509 HIS A CD2 1 
ATOM   1241 C CE1 . HIS A 1 166 ? 37.373 -4.552  5.613   1.00 18.85 ? 509 HIS A CE1 1 
ATOM   1242 N NE2 . HIS A 1 166 ? 38.214 -5.142  4.786   1.00 20.86 ? 509 HIS A NE2 1 
ATOM   1243 N N   . ASP A 1 167 ? 40.262 -2.316  2.200   1.00 22.24 ? 510 ASP A N   1 
ATOM   1244 C CA  . ASP A 1 167 ? 41.422 -2.940  1.546   1.00 24.10 ? 510 ASP A CA  1 
ATOM   1245 C C   . ASP A 1 167 ? 41.163 -4.314  0.906   1.00 24.30 ? 510 ASP A C   1 
ATOM   1246 O O   . ASP A 1 167 ? 41.834 -4.688  -0.069  1.00 24.38 ? 510 ASP A O   1 
ATOM   1247 C CB  . ASP A 1 167 ? 42.592 -3.037  2.533   1.00 25.17 ? 510 ASP A CB  1 
ATOM   1248 C CG  . ASP A 1 167 ? 43.256 -1.693  2.805   1.00 27.85 ? 510 ASP A CG  1 
ATOM   1249 O OD1 . ASP A 1 167 ? 42.927 -0.683  2.135   1.00 32.30 ? 510 ASP A OD1 1 
ATOM   1250 O OD2 . ASP A 1 167 ? 44.131 -1.642  3.702   1.00 32.19 ? 510 ASP A OD2 1 
ATOM   1251 N N   . SER A 1 168 ? 40.199 -5.058  1.444   1.00 24.12 ? 511 SER A N   1 
ATOM   1252 C CA  . SER A 1 168 ? 39.828 -6.374  0.917   1.00 24.65 ? 511 SER A CA  1 
ATOM   1253 C C   . SER A 1 168 ? 38.943 -6.312  -0.323  1.00 24.64 ? 511 SER A C   1 
ATOM   1254 O O   . SER A 1 168 ? 38.714 -7.335  -0.986  1.00 25.11 ? 511 SER A O   1 
ATOM   1255 C CB  . SER A 1 168 ? 39.147 -7.216  1.996   1.00 24.80 ? 511 SER A CB  1 
ATOM   1256 O OG  . SER A 1 168 ? 40.023 -7.424  3.093   1.00 25.50 ? 511 SER A OG  1 
ATOM   1257 N N   . ALA A 1 169 ? 38.438 -5.117  -0.627  1.00 24.14 ? 512 ALA A N   1 
ATOM   1258 C CA  . ALA A 1 169 ? 37.639 -4.897  -1.831  1.00 24.20 ? 512 ALA A CA  1 
ATOM   1259 C C   . ALA A 1 169 ? 38.169 -3.698  -2.616  1.00 24.14 ? 512 ALA A C   1 
ATOM   1260 O O   . ALA A 1 169 ? 37.494 -2.665  -2.713  1.00 23.50 ? 512 ALA A O   1 
ATOM   1261 C CB  . ALA A 1 169 ? 36.171 -4.708  -1.477  1.00 24.22 ? 512 ALA A CB  1 
ATOM   1262 N N   . PRO A 1 170 ? 39.375 -3.833  -3.203  1.00 24.41 ? 513 PRO A N   1 
ATOM   1263 C CA  . PRO A 1 170 ? 39.916 -2.725  -3.972  1.00 24.45 ? 513 PRO A CA  1 
ATOM   1264 C C   . PRO A 1 170 ? 39.134 -2.593  -5.272  1.00 24.49 ? 513 PRO A C   1 
ATOM   1265 O O   . PRO A 1 170 ? 38.292 -3.445  -5.573  1.00 24.36 ? 513 PRO A O   1 
ATOM   1266 C CB  . PRO A 1 170 ? 41.352 -3.179  -4.267  1.00 24.62 ? 513 PRO A CB  1 
ATOM   1267 C CG  . PRO A 1 170 ? 41.258 -4.656  -4.302  1.00 24.85 ? 513 PRO A CG  1 
ATOM   1268 C CD  . PRO A 1 170 ? 40.272 -5.005  -3.228  1.00 24.62 ? 513 PRO A CD  1 
ATOM   1269 N N   . LEU A 1 171 ? 39.409 -1.538  -6.027  1.00 25.05 ? 514 LEU A N   1 
ATOM   1270 C CA  . LEU A 1 171 ? 38.863 -1.406  -7.373  1.00 25.84 ? 514 LEU A CA  1 
ATOM   1271 C C   . LEU A 1 171 ? 39.337 -2.566  -8.221  1.00 26.63 ? 514 LEU A C   1 
ATOM   1272 O O   . LEU A 1 171 ? 40.443 -3.068  -8.022  1.00 26.97 ? 514 LEU A O   1 
ATOM   1273 C CB  . LEU A 1 171 ? 39.320 -0.101  -8.017  1.00 25.46 ? 514 LEU A CB  1 
ATOM   1274 C CG  . LEU A 1 171 ? 38.862 1.200   -7.362  1.00 25.80 ? 514 LEU A CG  1 
ATOM   1275 C CD1 . LEU A 1 171 ? 39.470 2.378   -8.087  1.00 25.65 ? 514 LEU A CD1 1 
ATOM   1276 C CD2 . LEU A 1 171 ? 37.347 1.288   -7.371  1.00 25.83 ? 514 LEU A CD2 1 
ATOM   1277 N N   . ASN A 1 172 ? 38.501 -3.002  -9.155  1.00 27.44 ? 515 ASN A N   1 
ATOM   1278 C CA  . ASN A 1 172 ? 38.926 -4.012  -10.119 1.00 28.28 ? 515 ASN A CA  1 
ATOM   1279 C C   . ASN A 1 172 ? 38.756 -3.501  -11.545 1.00 28.68 ? 515 ASN A C   1 
ATOM   1280 O O   . ASN A 1 172 ? 38.126 -2.460  -11.764 1.00 28.90 ? 515 ASN A O   1 
ATOM   1281 C CB  . ASN A 1 172 ? 38.173 -5.321  -9.906  1.00 28.55 ? 515 ASN A CB  1 
ATOM   1282 C CG  . ASN A 1 172 ? 36.682 -5.159  -10.061 1.00 28.65 ? 515 ASN A CG  1 
ATOM   1283 O OD1 . ASN A 1 172 ? 36.181 -4.982  -11.169 1.00 30.57 ? 515 ASN A OD1 1 
ATOM   1284 N ND2 . ASN A 1 172 ? 35.962 -5.213  -8.947  1.00 28.25 ? 515 ASN A ND2 1 
ATOM   1285 N N   . ASN A 1 173 ? 39.317 -4.228  -12.506 1.00 29.01 ? 516 ASN A N   1 
ATOM   1286 C CA  . ASN A 1 173 ? 39.265 -3.801  -13.905 1.00 29.10 ? 516 ASN A CA  1 
ATOM   1287 C C   . ASN A 1 173 ? 37.999 -4.219  -14.658 1.00 28.63 ? 516 ASN A C   1 
ATOM   1288 O O   . ASN A 1 173 ? 37.813 -3.844  -15.817 1.00 29.46 ? 516 ASN A O   1 
ATOM   1289 C CB  A ASN A 1 173 ? 40.529 -4.247  -14.656 0.60 29.43 ? 516 ASN A CB  1 
ATOM   1290 C CB  B ASN A 1 173 ? 40.526 -4.255  -14.665 0.40 29.06 ? 516 ASN A CB  1 
ATOM   1291 C CG  A ASN A 1 173 ? 41.738 -3.375  -14.339 0.60 30.29 ? 516 ASN A CG  1 
ATOM   1292 C CG  B ASN A 1 173 ? 40.774 -5.762  -14.580 0.40 29.04 ? 516 ASN A CG  1 
ATOM   1293 O OD1 A ASN A 1 173 ? 41.608 -2.171  -14.100 0.60 31.87 ? 516 ASN A OD1 1 
ATOM   1294 O OD1 B ASN A 1 173 ? 39.868 -6.553  -14.313 0.40 29.03 ? 516 ASN A OD1 1 
ATOM   1295 N ND2 A ASN A 1 173 ? 42.922 -3.981  -14.340 0.60 31.74 ? 516 ASN A ND2 1 
ATOM   1296 N ND2 B ASN A 1 173 ? 42.018 -6.161  -14.825 0.40 29.52 ? 516 ASN A ND2 1 
ATOM   1297 N N   . ARG A 1 174 ? 37.132 -4.992  -14.006 1.00 27.91 ? 517 ARG A N   1 
ATOM   1298 C CA  . ARG A 1 174 ? 35.918 -5.479  -14.663 1.00 27.20 ? 517 ARG A CA  1 
ATOM   1299 C C   . ARG A 1 174 ? 34.680 -4.605  -14.414 1.00 25.13 ? 517 ARG A C   1 
ATOM   1300 O O   . ARG A 1 174 ? 33.763 -4.586  -15.236 1.00 25.11 ? 517 ARG A O   1 
ATOM   1301 C CB  . ARG A 1 174 ? 35.647 -6.958  -14.336 1.00 27.79 ? 517 ARG A CB  1 
ATOM   1302 C CG  . ARG A 1 174 ? 35.205 -7.259  -12.914 1.00 29.34 ? 517 ARG A CG  1 
ATOM   1303 C CD  . ARG A 1 174 ? 34.840 -8.730  -12.761 1.00 29.88 ? 517 ARG A CD  1 
ATOM   1304 N NE  . ARG A 1 174 ? 33.982 -8.980  -11.601 1.00 33.50 ? 517 ARG A NE  1 
ATOM   1305 C CZ  . ARG A 1 174 ? 32.675 -9.228  -11.663 1.00 34.54 ? 517 ARG A CZ  1 
ATOM   1306 N NH1 . ARG A 1 174 ? 32.037 -9.258  -12.829 1.00 33.53 ? 517 ARG A NH1 1 
ATOM   1307 N NH2 . ARG A 1 174 ? 31.997 -9.455  -10.545 1.00 36.26 ? 517 ARG A NH2 1 
ATOM   1308 N N   . CYS A 1 175 ? 34.674 -3.876  -13.297 1.00 22.86 ? 518 CYS A N   1 
ATOM   1309 C CA  . CYS A 1 175 ? 33.524 -3.043  -12.912 1.00 21.16 ? 518 CYS A CA  1 
ATOM   1310 C C   . CYS A 1 175 ? 33.900 -1.598  -12.658 1.00 20.08 ? 518 CYS A C   1 
ATOM   1311 O O   . CYS A 1 175 ? 35.022 -1.298  -12.250 1.00 20.74 ? 518 CYS A O   1 
ATOM   1312 C CB  A CYS A 1 175 ? 32.868 -3.604  -11.654 0.65 21.42 ? 518 CYS A CB  1 
ATOM   1313 C CB  B CYS A 1 175 ? 32.870 -3.584  -11.641 0.35 21.26 ? 518 CYS A CB  1 
ATOM   1314 S SG  A CYS A 1 175 ? 32.116 -5.211  -11.863 0.65 21.54 ? 518 CYS A SG  1 
ATOM   1315 S SG  B CYS A 1 175 ? 32.664 -5.358  -11.568 0.35 20.34 ? 518 CYS A SG  1 
ATOM   1316 N N   . VAL A 1 176 ? 32.935 -0.706  -12.869 1.00 18.25 ? 519 VAL A N   1 
ATOM   1317 C CA  . VAL A 1 176 ? 33.048 0.670   -12.401 1.00 17.47 ? 519 VAL A CA  1 
ATOM   1318 C C   . VAL A 1 176 ? 32.430 0.742   -11.006 1.00 16.36 ? 519 VAL A C   1 
ATOM   1319 O O   . VAL A 1 176 ? 31.312 0.276   -10.789 1.00 16.65 ? 519 VAL A O   1 
ATOM   1320 C CB  . VAL A 1 176 ? 32.356 1.663   -13.367 1.00 17.31 ? 519 VAL A CB  1 
ATOM   1321 C CG1 . VAL A 1 176 ? 32.305 3.059   -12.781 1.00 17.17 ? 519 VAL A CG1 1 
ATOM   1322 C CG2 . VAL A 1 176 ? 33.072 1.691   -14.723 1.00 16.88 ? 519 VAL A CG2 1 
ATOM   1323 N N   . ARG A 1 177 ? 33.165 1.331   -10.068 1.00 15.64 ? 520 ARG A N   1 
ATOM   1324 C CA  . ARG A 1 177 ? 32.719 1.403   -8.677  1.00 14.72 ? 520 ARG A CA  1 
ATOM   1325 C C   . ARG A 1 177 ? 31.751 2.567   -8.472  1.00 14.52 ? 520 ARG A C   1 
ATOM   1326 O O   . ARG A 1 177 ? 32.147 3.731   -8.519  1.00 15.30 ? 520 ARG A O   1 
ATOM   1327 C CB  . ARG A 1 177 ? 33.947 1.524   -7.767  1.00 15.19 ? 520 ARG A CB  1 
ATOM   1328 C CG  . ARG A 1 177 ? 33.712 1.593   -6.260  1.00 15.60 ? 520 ARG A CG  1 
ATOM   1329 C CD  . ARG A 1 177 ? 33.319 0.278   -5.605  1.00 17.22 ? 520 ARG A CD  1 
ATOM   1330 N NE  . ARG A 1 177 ? 33.970 -0.931  -6.143  1.00 16.08 ? 520 ARG A NE  1 
ATOM   1331 C CZ  . ARG A 1 177 ? 35.034 -1.545  -5.614  1.00 18.26 ? 520 ARG A CZ  1 
ATOM   1332 N NH1 . ARG A 1 177 ? 35.628 -1.080  -4.525  1.00 16.70 ? 520 ARG A NH1 1 
ATOM   1333 N NH2 . ARG A 1 177 ? 35.505 -2.651  -6.186  1.00 16.25 ? 520 ARG A NH2 1 
ATOM   1334 N N   . ALA A 1 178 ? 30.479 2.238   -8.273  1.00 13.56 ? 521 ALA A N   1 
ATOM   1335 C CA  . ALA A 1 178 ? 29.488 3.246   -7.923  1.00 13.68 ? 521 ALA A CA  1 
ATOM   1336 C C   . ALA A 1 178 ? 29.692 3.675   -6.479  1.00 13.72 ? 521 ALA A C   1 
ATOM   1337 O O   . ALA A 1 178 ? 30.292 2.957   -5.672  1.00 14.26 ? 521 ALA A O   1 
ATOM   1338 C CB  . ALA A 1 178 ? 28.084 2.694   -8.114  1.00 13.81 ? 521 ALA A CB  1 
ATOM   1339 N N   . LYS A 1 179 ? 29.185 4.852   -6.153  1.00 13.65 ? 522 LYS A N   1 
ATOM   1340 C CA  . LYS A 1 179 ? 29.190 5.342   -4.786  1.00 13.64 ? 522 LYS A CA  1 
ATOM   1341 C C   . LYS A 1 179 ? 27.752 5.646   -4.401  1.00 13.78 ? 522 LYS A C   1 
ATOM   1342 O O   . LYS A 1 179 ? 27.036 6.335   -5.134  1.00 14.10 ? 522 LYS A O   1 
ATOM   1343 C CB  . LYS A 1 179 ? 30.048 6.606   -4.668  1.00 15.03 ? 522 LYS A CB  1 
ATOM   1344 C CG  . LYS A 1 179 ? 31.532 6.394   -5.025  1.00 15.42 ? 522 LYS A CG  1 
ATOM   1345 C CD  . LYS A 1 179 ? 32.272 5.524   -3.995  1.00 17.73 ? 522 LYS A CD  1 
ATOM   1346 C CE  . LYS A 1 179 ? 33.695 5.172   -4.447  1.00 18.58 ? 522 LYS A CE  1 
ATOM   1347 N NZ  . LYS A 1 179 ? 34.602 6.359   -4.347  1.00 20.75 ? 522 LYS A NZ  1 
ATOM   1348 N N   . ILE A 1 180 ? 27.327 5.147   -3.246  1.00 12.28 ? 523 ILE A N   1 
ATOM   1349 C CA  . ILE A 1 180 ? 25.920 5.282   -2.845  1.00 11.75 ? 523 ILE A CA  1 
ATOM   1350 C C   . ILE A 1 180 ? 25.713 5.870   -1.461  1.00 11.08 ? 523 ILE A C   1 
ATOM   1351 O O   . ILE A 1 180 ? 26.575 5.779   -0.579  1.00 11.45 ? 523 ILE A O   1 
ATOM   1352 C CB  . ILE A 1 180 ? 25.147 3.927   -2.933  1.00 11.21 ? 523 ILE A CB  1 
ATOM   1353 C CG1 . ILE A 1 180 ? 25.585 2.960   -1.815  1.00 11.58 ? 523 ILE A CG1 1 
ATOM   1354 C CG2 . ILE A 1 180 ? 25.332 3.290   -4.322  1.00 12.26 ? 523 ILE A CG2 1 
ATOM   1355 C CD1 . ILE A 1 180 ? 24.772 1.660   -1.767  1.00 12.71 ? 523 ILE A CD1 1 
ATOM   1356 N N   . ASN A 1 181 ? 24.556 6.496   -1.294  1.00 10.72 ? 524 ASN A N   1 
ATOM   1357 C CA  . ASN A 1 181 ? 24.030 6.833   0.013   1.00 11.21 ? 524 ASN A CA  1 
ATOM   1358 C C   . ASN A 1 181 ? 22.535 6.563   -0.049  1.00 10.87 ? 524 ASN A C   1 
ATOM   1359 O O   . ASN A 1 181 ? 21.795 7.314   -0.692  1.00 11.19 ? 524 ASN A O   1 
ATOM   1360 C CB  . ASN A 1 181 ? 24.292 8.291   0.362   1.00 11.64 ? 524 ASN A CB  1 
ATOM   1361 C CG  . ASN A 1 181 ? 23.725 8.674   1.717   1.00 12.75 ? 524 ASN A CG  1 
ATOM   1362 O OD1 . ASN A 1 181 ? 23.173 7.847   2.438   1.00 15.36 ? 524 ASN A OD1 1 
ATOM   1363 N ND2 . ASN A 1 181 ? 23.892 9.941   2.082   1.00 19.36 ? 524 ASN A ND2 1 
ATOM   1364 N N   . VAL A 1 182 ? 22.112 5.479   0.601   1.00 10.51 ? 525 VAL A N   1 
ATOM   1365 C CA  . VAL A 1 182 ? 20.730 5.018   0.573   1.00 10.98 ? 525 VAL A CA  1 
ATOM   1366 C C   . VAL A 1 182 ? 20.230 4.904   2.009   1.00 10.81 ? 525 VAL A C   1 
ATOM   1367 O O   . VAL A 1 182 ? 20.981 4.501   2.897   1.00 10.65 ? 525 VAL A O   1 
ATOM   1368 C CB  . VAL A 1 182 ? 20.656 3.632   -0.116  1.00 11.01 ? 525 VAL A CB  1 
ATOM   1369 C CG1 . VAL A 1 182 ? 19.284 2.976   0.052   1.00 11.95 ? 525 VAL A CG1 1 
ATOM   1370 C CG2 . VAL A 1 182 ? 20.988 3.763   -1.606  1.00 11.87 ? 525 VAL A CG2 1 
ATOM   1371 N N   . ALA A 1 183 ? 18.968 5.246   2.245   1.00 10.33 ? 526 ALA A N   1 
ATOM   1372 C CA  . ALA A 1 183 ? 18.362 4.965   3.549   1.00 10.06 ? 526 ALA A CA  1 
ATOM   1373 C C   . ALA A 1 183 ? 16.929 4.509   3.407   1.00 11.03 ? 526 ALA A C   1 
ATOM   1374 O O   . ALA A 1 183 ? 16.183 5.016   2.562   1.00 10.71 ? 526 ALA A O   1 
ATOM   1375 C CB  . ALA A 1 183 ? 18.432 6.179   4.490   1.00 10.39 ? 526 ALA A CB  1 
ATOM   1376 N N   . MET A 1 184 ? 16.554 3.578   4.279   1.00 11.10 ? 527 MET A N   1 
ATOM   1377 C CA  . MET A 1 184 ? 15.177 3.189   4.438   1.00 12.32 ? 527 MET A CA  1 
ATOM   1378 C C   . MET A 1 184 ? 14.763 3.608   5.835   1.00 11.73 ? 527 MET A C   1 
ATOM   1379 O O   . MET A 1 184 ? 15.339 3.154   6.812   1.00 11.47 ? 527 MET A O   1 
ATOM   1380 C CB  . MET A 1 184 ? 15.042 1.698   4.231   1.00 12.48 ? 527 MET A CB  1 
ATOM   1381 C CG  A MET A 1 184 ? 13.559 1.447   4.077   0.50 14.09 ? 527 MET A CG  1 
ATOM   1382 C CG  B MET A 1 184 ? 13.758 1.039   4.642   0.50 12.98 ? 527 MET A CG  1 
ATOM   1383 S SD  A MET A 1 184 ? 13.055 -0.215  3.761   0.50 14.47 ? 527 MET A SD  1 
ATOM   1384 S SD  B MET A 1 184 ? 12.625 1.028   3.251   0.50 11.26 ? 527 MET A SD  1 
ATOM   1385 C CE  A MET A 1 184 ? 13.521 -0.380  2.042   0.50 13.59 ? 527 MET A CE  1 
ATOM   1386 C CE  B MET A 1 184 ? 13.468 -0.020  2.065   0.50 11.83 ? 527 MET A CE  1 
ATOM   1387 N N   . ILE A 1 185 ? 13.774 4.489   5.903   1.00 11.84 ? 528 ILE A N   1 
ATOM   1388 C CA  . ILE A 1 185 ? 13.429 5.157   7.151   1.00 12.18 ? 528 ILE A CA  1 
ATOM   1389 C C   . ILE A 1 185 ? 11.967 4.846   7.446   1.00 12.61 ? 528 ILE A C   1 
ATOM   1390 O O   . ILE A 1 185 ? 11.083 5.146   6.633   1.00 12.74 ? 528 ILE A O   1 
ATOM   1391 C CB  . ILE A 1 185 ? 13.641 6.677   7.043   1.00 12.29 ? 528 ILE A CB  1 
ATOM   1392 C CG1 . ILE A 1 185 ? 15.038 6.976   6.499   1.00 13.17 ? 528 ILE A CG1 1 
ATOM   1393 C CG2 . ILE A 1 185 ? 13.444 7.345   8.399   1.00 13.15 ? 528 ILE A CG2 1 
ATOM   1394 C CD1 . ILE A 1 185 ? 15.286 8.442   6.152   1.00 12.45 ? 528 ILE A CD1 1 
ATOM   1395 N N   . CYS A 1 186 ? 11.707 4.253   8.614   1.00 12.20 ? 529 CYS A N   1 
ATOM   1396 C CA  . CYS A 1 186 ? 10.362 3.741   8.919   1.00 13.30 ? 529 CYS A CA  1 
ATOM   1397 C C   . CYS A 1 186 ? 9.814  4.244   10.234  1.00 13.36 ? 529 CYS A C   1 
ATOM   1398 O O   . CYS A 1 186 ? 10.497 4.193   11.259  1.00 13.18 ? 529 CYS A O   1 
ATOM   1399 C CB  . CYS A 1 186 ? 10.365 2.216   8.975   1.00 13.20 ? 529 CYS A CB  1 
ATOM   1400 S SG  . CYS A 1 186 ? 10.933 1.419   7.453   1.00 14.85 ? 529 CYS A SG  1 
ATOM   1401 N N   . GLN A 1 187 ? 8.559  4.689   10.199  1.00 13.52 ? 530 GLN A N   1 
ATOM   1402 C CA  . GLN A 1 187 ? 7.817  5.065   11.403  1.00 14.58 ? 530 GLN A CA  1 
ATOM   1403 C C   . GLN A 1 187 ? 6.487  4.337   11.369  1.00 15.11 ? 530 GLN A C   1 
ATOM   1404 O O   . GLN A 1 187 ? 5.874  4.203   10.309  1.00 15.96 ? 530 GLN A O   1 
ATOM   1405 C CB  . GLN A 1 187 ? 7.630  6.571   11.456  1.00 13.73 ? 530 GLN A CB  1 
ATOM   1406 C CG  . GLN A 1 187 ? 8.958  7.275   11.704  1.00 14.52 ? 530 GLN A CG  1 
ATOM   1407 C CD  . GLN A 1 187 ? 8.914  8.778   11.542  1.00 16.33 ? 530 GLN A CD  1 
ATOM   1408 O OE1 . GLN A 1 187 ? 7.935  9.351   11.052  1.00 18.53 ? 530 GLN A OE1 1 
ATOM   1409 N NE2 . GLN A 1 187 ? 9.990  9.435   11.971  1.00 16.39 ? 530 GLN A NE2 1 
ATOM   1410 N N   . THR A 1 188 ? 6.041  3.869   12.524  1.00 14.97 ? 531 THR A N   1 
ATOM   1411 C CA  . THR A 1 188 ? 4.926  2.934   12.565  1.00 15.78 ? 531 THR A CA  1 
ATOM   1412 C C   . THR A 1 188 ? 3.739  3.581   13.270  1.00 17.16 ? 531 THR A C   1 
ATOM   1413 O O   . THR A 1 188 ? 3.882  4.150   14.359  1.00 17.64 ? 531 THR A O   1 
ATOM   1414 C CB  . THR A 1 188 ? 5.358  1.617   13.261  1.00 15.46 ? 531 THR A CB  1 
ATOM   1415 O OG1 . THR A 1 188 ? 6.528  1.093   12.609  1.00 16.21 ? 531 THR A OG1 1 
ATOM   1416 C CG2 . THR A 1 188 ? 4.257  0.560   13.216  1.00 16.01 ? 531 THR A CG2 1 
ATOM   1417 N N   . LEU A 1 189 ? 2.580  3.516   12.620  1.00 18.52 ? 532 LEU A N   1 
ATOM   1418 C CA  . LEU A 1 189 ? 1.321  4.001   13.188  1.00 20.41 ? 532 LEU A CA  1 
ATOM   1419 C C   . LEU A 1 189 ? 0.477  2.823   13.653  1.00 21.72 ? 532 LEU A C   1 
ATOM   1420 O O   . LEU A 1 189 ? 0.236  1.871   12.895  1.00 21.00 ? 532 LEU A O   1 
ATOM   1421 C CB  . LEU A 1 189 ? 0.552  4.831   12.151  1.00 20.98 ? 532 LEU A CB  1 
ATOM   1422 C CG  . LEU A 1 189 ? 1.200  6.121   11.622  1.00 22.15 ? 532 LEU A CG  1 
ATOM   1423 C CD1 . LEU A 1 189 ? 0.359  6.700   10.490  1.00 22.92 ? 532 LEU A CD1 1 
ATOM   1424 C CD2 . LEU A 1 189 ? 1.418  7.164   12.709  1.00 24.96 ? 532 LEU A CD2 1 
ATOM   1425 N N   . VAL A 1 190 ? 0.038  2.880   14.908  1.00 23.18 ? 533 VAL A N   1 
ATOM   1426 C CA  . VAL A 1 190 ? -0.802 1.823   15.464  1.00 25.45 ? 533 VAL A CA  1 
ATOM   1427 C C   . VAL A 1 190 ? -2.151 2.405   15.877  1.00 27.48 ? 533 VAL A C   1 
ATOM   1428 O O   . VAL A 1 190 ? -2.213 3.339   16.682  1.00 27.32 ? 533 VAL A O   1 
ATOM   1429 C CB  . VAL A 1 190 ? -0.130 1.122   16.678  1.00 25.55 ? 533 VAL A CB  1 
ATOM   1430 C CG1 . VAL A 1 190 ? -1.032 0.026   17.243  1.00 25.69 ? 533 VAL A CG1 1 
ATOM   1431 C CG2 . VAL A 1 190 ? 1.214  0.538   16.296  1.00 24.62 ? 533 VAL A CG2 1 
ATOM   1432 N N   . SER A 1 191 ? -3.225 1.860   15.313  1.00 29.71 ? 534 SER A N   1 
ATOM   1433 C CA  . SER A 1 191 ? -4.567 2.269   15.709  1.00 32.33 ? 534 SER A CA  1 
ATOM   1434 C C   . SER A 1 191 ? -5.039 1.440   16.912  1.00 33.96 ? 534 SER A C   1 
ATOM   1435 O O   . SER A 1 191 ? -4.905 0.209   16.912  1.00 34.25 ? 534 SER A O   1 
ATOM   1436 C CB  . SER A 1 191 ? -5.550 2.159   14.538  1.00 32.46 ? 534 SER A CB  1 
ATOM   1437 O OG  . SER A 1 191 ? -5.622 0.830   14.050  1.00 33.51 ? 534 SER A OG  1 
ATOM   1438 N N   . PRO A 1 192 ? -5.561 2.117   17.955  1.00 35.68 ? 535 PRO A N   1 
ATOM   1439 C CA  . PRO A 1 192 ? -6.163 1.456   19.119  1.00 36.79 ? 535 PRO A CA  1 
ATOM   1440 C C   . PRO A 1 192 ? -7.157 0.358   18.728  1.00 37.65 ? 535 PRO A C   1 
ATOM   1441 O O   . PRO A 1 192 ? -8.045 0.603   17.906  1.00 37.89 ? 535 PRO A O   1 
ATOM   1442 C CB  . PRO A 1 192 ? -6.899 2.599   19.842  1.00 36.85 ? 535 PRO A CB  1 
ATOM   1443 C CG  . PRO A 1 192 ? -6.798 3.802   18.942  1.00 36.73 ? 535 PRO A CG  1 
ATOM   1444 C CD  . PRO A 1 192 ? -5.586 3.582   18.099  1.00 35.82 ? 535 PRO A CD  1 
ATOM   1445 N N   . PRO A 1 193 ? -6.999 -0.852  19.305  1.00 38.50 ? 536 PRO A N   1 
ATOM   1446 C CA  . PRO A 1 193 ? -7.871 -1.984  18.991  1.00 38.83 ? 536 PRO A CA  1 
ATOM   1447 C C   . PRO A 1 193 ? -9.231 -1.888  19.685  1.00 39.20 ? 536 PRO A C   1 
ATOM   1448 O O   . PRO A 1 193 ? -9.345 -1.265  20.743  1.00 39.69 ? 536 PRO A O   1 
ATOM   1449 C CB  . PRO A 1 193 ? -7.086 -3.185  19.523  1.00 38.86 ? 536 PRO A CB  1 
ATOM   1450 C CG  . PRO A 1 193 ? -6.291 -2.642  20.653  1.00 38.91 ? 536 PRO A CG  1 
ATOM   1451 C CD  . PRO A 1 193 ? -5.968 -1.210  20.301  1.00 38.62 ? 536 PRO A CD  1 
ATOM   1452 N N   . GLN A 1 197 ? -8.566 -6.348  22.571  1.00 39.60 ? 540 GLN A N   1 
ATOM   1453 C CA  . GLN A 1 197 ? -7.611 -6.152  23.661  1.00 39.48 ? 540 GLN A CA  1 
ATOM   1454 C C   . GLN A 1 197 ? -6.167 -6.183  23.156  1.00 39.03 ? 540 GLN A C   1 
ATOM   1455 O O   . GLN A 1 197 ? -5.341 -5.372  23.581  1.00 39.00 ? 540 GLN A O   1 
ATOM   1456 C CB  . GLN A 1 197 ? -7.834 -7.187  24.775  1.00 39.98 ? 540 GLN A CB  1 
ATOM   1457 C CG  . GLN A 1 197 ? -6.916 -7.044  26.003  1.00 41.02 ? 540 GLN A CG  1 
ATOM   1458 C CD  . GLN A 1 197 ? -7.119 -5.743  26.779  1.00 42.80 ? 540 GLN A CD  1 
ATOM   1459 O OE1 . GLN A 1 197 ? -8.228 -5.203  26.847  1.00 43.36 ? 540 GLN A OE1 1 
ATOM   1460 N NE2 . GLN A 1 197 ? -6.039 -5.241  27.378  1.00 42.70 ? 540 GLN A NE2 1 
ATOM   1461 N N   . GLU A 1 198 ? -5.865 -7.108  22.248  1.00 38.02 ? 541 GLU A N   1 
ATOM   1462 C CA  . GLU A 1 198 ? -4.535 -7.166  21.655  1.00 37.41 ? 541 GLU A CA  1 
ATOM   1463 C C   . GLU A 1 198 ? -4.495 -6.470  20.287  1.00 36.19 ? 541 GLU A C   1 
ATOM   1464 O O   . GLU A 1 198 ? -5.528 -6.285  19.644  1.00 36.02 ? 541 GLU A O   1 
ATOM   1465 C CB  . GLU A 1 198 ? -4.013 -8.609  21.594  1.00 37.47 ? 541 GLU A CB  1 
ATOM   1466 C CG  . GLU A 1 198 ? -4.319 -9.384  20.326  1.00 38.43 ? 541 GLU A CG  1 
ATOM   1467 C CD  . GLU A 1 198 ? -3.389 -10.576 20.143  1.00 38.52 ? 541 GLU A CD  1 
ATOM   1468 O OE1 . GLU A 1 198 ? -3.223 -11.370 21.099  1.00 39.88 ? 541 GLU A OE1 1 
ATOM   1469 O OE2 . GLU A 1 198 ? -2.824 -10.719 19.038  1.00 40.94 ? 541 GLU A OE2 1 
ATOM   1470 N N   . ILE A 1 199 ? -3.295 -6.078  19.866  1.00 34.83 ? 542 ILE A N   1 
ATOM   1471 C CA  . ILE A 1 199 ? -3.099 -5.396  18.591  1.00 33.47 ? 542 ILE A CA  1 
ATOM   1472 C C   . ILE A 1 199 ? -3.068 -6.416  17.455  1.00 32.62 ? 542 ILE A C   1 
ATOM   1473 O O   . ILE A 1 199 ? -2.363 -7.425  17.535  1.00 33.05 ? 542 ILE A O   1 
ATOM   1474 C CB  . ILE A 1 199 ? -1.785 -4.560  18.578  1.00 33.51 ? 542 ILE A CB  1 
ATOM   1475 C CG1 A ILE A 1 199 ? -1.759 -3.598  19.769  0.65 33.83 ? 542 ILE A CG1 1 
ATOM   1476 C CG1 B ILE A 1 199 ? -1.682 -3.642  19.809  0.35 33.62 ? 542 ILE A CG1 1 
ATOM   1477 C CG2 . ILE A 1 199 ? -1.636 -3.793  17.252  1.00 32.99 ? 542 ILE A CG2 1 
ATOM   1478 C CD1 A ILE A 1 199 ? -0.374 -3.134  20.164  0.65 33.83 ? 542 ILE A CD1 1 
ATOM   1479 C CD1 B ILE A 1 199 ? -2.593 -2.423  19.795  0.35 33.57 ? 542 ILE A CD1 1 
ATOM   1480 N N   . SER A 1 200 ? -3.841 -6.140  16.409  1.00 31.27 ? 543 SER A N   1 
ATOM   1481 C CA  . SER A 1 200 ? -3.871 -6.955  15.195  1.00 29.98 ? 543 SER A CA  1 
ATOM   1482 C C   . SER A 1 200 ? -2.952 -6.324  14.143  1.00 28.57 ? 543 SER A C   1 
ATOM   1483 O O   . SER A 1 200 ? -2.684 -5.127  14.201  1.00 28.49 ? 543 SER A O   1 
ATOM   1484 C CB  . SER A 1 200 ? -5.307 -7.008  14.662  1.00 30.17 ? 543 SER A CB  1 
ATOM   1485 O OG  . SER A 1 200 ? -5.375 -7.585  13.370  1.00 31.62 ? 543 SER A OG  1 
ATOM   1486 N N   . ARG A 1 201 ? -2.474 -7.116  13.188  1.00 27.27 ? 544 ARG A N   1 
ATOM   1487 C CA  . ARG A 1 201 ? -1.722 -6.545  12.057  1.00 26.02 ? 544 ARG A CA  1 
ATOM   1488 C C   . ARG A 1 201 ? -2.617 -5.652  11.196  1.00 26.46 ? 544 ARG A C   1 
ATOM   1489 O O   . ARG A 1 201 ? -2.135 -4.753  10.513  1.00 26.04 ? 544 ARG A O   1 
ATOM   1490 C CB  . ARG A 1 201 ? -1.037 -7.624  11.224  1.00 25.58 ? 544 ARG A CB  1 
ATOM   1491 C CG  . ARG A 1 201 ? 0.184  -8.204  11.907  1.00 23.10 ? 544 ARG A CG  1 
ATOM   1492 C CD  . ARG A 1 201 ? 0.918  -9.190  11.038  1.00 19.99 ? 544 ARG A CD  1 
ATOM   1493 N NE  . ARG A 1 201 ? 2.087  -9.763  11.699  1.00 19.46 ? 544 ARG A NE  1 
ATOM   1494 C CZ  . ARG A 1 201 ? 3.291  -9.185  11.760  1.00 18.37 ? 544 ARG A CZ  1 
ATOM   1495 N NH1 . ARG A 1 201 ? 3.504  -8.001  11.176  1.00 17.55 ? 544 ARG A NH1 1 
ATOM   1496 N NH2 . ARG A 1 201 ? 4.287  -9.801  12.385  1.00 18.20 ? 544 ARG A NH2 1 
ATOM   1497 N N   . ASP A 1 202 ? -3.925 -5.897  11.247  1.00 26.98 ? 545 ASP A N   1 
ATOM   1498 C CA  . ASP A 1 202 ? -4.912 -4.987  10.665  1.00 27.70 ? 545 ASP A CA  1 
ATOM   1499 C C   . ASP A 1 202 ? -4.849 -3.572  11.254  1.00 27.30 ? 545 ASP A C   1 
ATOM   1500 O O   . ASP A 1 202 ? -5.317 -2.624  10.626  1.00 27.91 ? 545 ASP A O   1 
ATOM   1501 C CB  . ASP A 1 202 ? -6.336 -5.545  10.838  1.00 28.49 ? 545 ASP A CB  1 
ATOM   1502 C CG  . ASP A 1 202 ? -6.568 -6.826  10.052  1.00 31.23 ? 545 ASP A CG  1 
ATOM   1503 O OD1 . ASP A 1 202 ? -5.754 -7.143  9.156   1.00 34.78 ? 545 ASP A OD1 1 
ATOM   1504 O OD2 . ASP A 1 202 ? -7.577 -7.517  10.328  1.00 34.99 ? 545 ASP A OD2 1 
ATOM   1505 N N   . ASN A 1 203 ? -4.280 -3.441  12.455  1.00 26.59 ? 546 ASN A N   1 
ATOM   1506 C CA  . ASN A 1 203 ? -4.210 -2.160  13.163  1.00 25.90 ? 546 ASN A CA  1 
ATOM   1507 C C   . ASN A 1 203 ? -2.905 -1.401  12.950  1.00 24.43 ? 546 ASN A C   1 
ATOM   1508 O O   . ASN A 1 203 ? -2.722 -0.321  13.513  1.00 24.16 ? 546 ASN A O   1 
ATOM   1509 C CB  . ASN A 1 203 ? -4.368 -2.347  14.681  1.00 26.83 ? 546 ASN A CB  1 
ATOM   1510 C CG  . ASN A 1 203 ? -5.651 -3.054  15.072  1.00 28.98 ? 546 ASN A CG  1 
ATOM   1511 O OD1 . ASN A 1 203 ? -5.631 -3.941  15.928  1.00 31.82 ? 546 ASN A OD1 1 
ATOM   1512 N ND2 . ASN A 1 203 ? -6.772 -2.653  14.474  1.00 30.71 ? 546 ASN A ND2 1 
ATOM   1513 N N   . ILE A 1 204 ? -1.988 -1.965  12.169  1.00 22.70 ? 547 ILE A N   1 
ATOM   1514 C CA  . ILE A 1 204 ? -0.659 -1.356  12.048  1.00 21.45 ? 547 ILE A CA  1 
ATOM   1515 C C   . ILE A 1 204 ? -0.336 -0.935  10.620  1.00 20.54 ? 547 ILE A C   1 
ATOM   1516 O O   . ILE A 1 204 ? -0.698 -1.618  9.657   1.00 21.07 ? 547 ILE A O   1 
ATOM   1517 C CB  . ILE A 1 204 ? 0.470  -2.237  12.657  1.00 21.56 ? 547 ILE A CB  1 
ATOM   1518 C CG1 . ILE A 1 204 ? 0.735  -3.490  11.825  1.00 21.70 ? 547 ILE A CG1 1 
ATOM   1519 C CG2 . ILE A 1 204 ? 0.131  -2.607  14.103  1.00 21.83 ? 547 ILE A CG2 1 
ATOM   1520 C CD1 . ILE A 1 204 ? 1.932  -4.312  12.301  1.00 21.68 ? 547 ILE A CD1 1 
ATOM   1521 N N   . LEU A 1 205 ? 0.348  0.200   10.511  1.00 19.43 ? 548 LEU A N   1 
ATOM   1522 C CA  . LEU A 1 205 ? 0.727  0.752   9.216   1.00 18.24 ? 548 LEU A CA  1 
ATOM   1523 C C   . LEU A 1 205 ? 2.139  1.303   9.301   1.00 17.56 ? 548 LEU A C   1 
ATOM   1524 O O   . LEU A 1 205 ? 2.454  2.106   10.179  1.00 17.89 ? 548 LEU A O   1 
ATOM   1525 C CB  . LEU A 1 205 ? -0.235 1.860   8.813   1.00 18.16 ? 548 LEU A CB  1 
ATOM   1526 C CG  . LEU A 1 205 ? -0.010 2.504   7.442   1.00 18.94 ? 548 LEU A CG  1 
ATOM   1527 C CD1 . LEU A 1 205 ? -0.392 1.520   6.346   1.00 19.83 ? 548 LEU A CD1 1 
ATOM   1528 C CD2 . LEU A 1 205 ? -0.825 3.778   7.327   1.00 21.31 ? 548 LEU A CD2 1 
ATOM   1529 N N   . CYS A 1 206 ? 2.991  0.856   8.387   1.00 16.77 ? 549 CYS A N   1 
ATOM   1530 C CA  . CYS A 1 206 ? 4.364  1.316   8.375   1.00 15.51 ? 549 CYS A CA  1 
ATOM   1531 C C   . CYS A 1 206 ? 4.556  2.392   7.315   1.00 15.45 ? 549 CYS A C   1 
ATOM   1532 O O   . CYS A 1 206 ? 4.383  2.134   6.115   1.00 15.54 ? 549 CYS A O   1 
ATOM   1533 C CB  . CYS A 1 206 ? 5.304  0.145   8.120   1.00 15.51 ? 549 CYS A CB  1 
ATOM   1534 S SG  . CYS A 1 206 ? 7.040  0.619   8.198   1.00 16.26 ? 549 CYS A SG  1 
ATOM   1535 N N   . LYS A 1 207 ? 4.904  3.589   7.776   1.00 14.79 ? 550 LYS A N   1 
ATOM   1536 C CA  . LYS A 1 207 ? 5.181  4.721   6.904   1.00 14.81 ? 550 LYS A CA  1 
ATOM   1537 C C   . LYS A 1 207 ? 6.661  4.718   6.569   1.00 14.33 ? 550 LYS A C   1 
ATOM   1538 O O   . LYS A 1 207 ? 7.517  4.804   7.466   1.00 14.02 ? 550 LYS A O   1 
ATOM   1539 C CB  A LYS A 1 207 ? 4.768  6.040   7.554   0.50 15.05 ? 550 LYS A CB  1 
ATOM   1540 C CB  B LYS A 1 207 ? 4.788  6.027   7.597   0.50 14.80 ? 550 LYS A CB  1 
ATOM   1541 C CG  A LYS A 1 207 ? 3.254  6.270   7.606   0.50 17.33 ? 550 LYS A CG  1 
ATOM   1542 C CG  B LYS A 1 207 ? 3.357  6.031   8.163   0.50 15.99 ? 550 LYS A CG  1 
ATOM   1543 C CD  A LYS A 1 207 ? 2.936  7.651   8.162   0.50 20.76 ? 550 LYS A CD  1 
ATOM   1544 C CD  B LYS A 1 207 ? 2.318  6.178   7.064   0.50 17.98 ? 550 LYS A CD  1 
ATOM   1545 C CE  A LYS A 1 207 ? 3.230  8.756   7.154   0.50 22.54 ? 550 LYS A CE  1 
ATOM   1546 C CE  B LYS A 1 207 ? 2.265  7.613   6.556   0.50 19.50 ? 550 LYS A CE  1 
ATOM   1547 N NZ  A LYS A 1 207 ? 3.519  10.049  7.833   0.50 23.60 ? 550 LYS A NZ  1 
ATOM   1548 N NZ  B LYS A 1 207 ? 0.908  7.983   6.075   0.50 21.49 ? 550 LYS A NZ  1 
ATOM   1549 N N   . ILE A 1 208 ? 6.953  4.591   5.276   1.00 13.61 ? 551 ILE A N   1 
ATOM   1550 C CA  . ILE A 1 208 ? 8.318  4.414   4.788   1.00 13.49 ? 551 ILE A CA  1 
ATOM   1551 C C   . ILE A 1 208 ? 8.758  5.600   3.958   1.00 13.30 ? 551 ILE A C   1 
ATOM   1552 O O   . ILE A 1 208 ? 8.043  6.036   3.064   1.00 13.03 ? 551 ILE A O   1 
ATOM   1553 C CB  . ILE A 1 208 ? 8.430  3.149   3.890   1.00 14.12 ? 551 ILE A CB  1 
ATOM   1554 C CG1 . ILE A 1 208 ? 8.089  1.891   4.686   1.00 13.53 ? 551 ILE A CG1 1 
ATOM   1555 C CG2 . ILE A 1 208 ? 9.833  3.041   3.277   1.00 15.07 ? 551 ILE A CG2 1 
ATOM   1556 C CD1 . ILE A 1 208 ? 8.139  0.578   3.877   1.00 14.42 ? 551 ILE A CD1 1 
ATOM   1557 N N   . THR A 1 209 ? 9.948  6.112   4.256   1.00 11.54 ? 552 THR A N   1 
ATOM   1558 C CA  . THR A 1 209 ? 10.647 6.996   3.336   1.00 12.04 ? 552 THR A CA  1 
ATOM   1559 C C   . THR A 1 209 ? 11.916 6.293   2.887   1.00 11.44 ? 552 THR A C   1 
ATOM   1560 O O   . THR A 1 209 ? 12.703 5.833   3.705   1.00 11.19 ? 552 THR A O   1 
ATOM   1561 C CB  . THR A 1 209 ? 10.996 8.341   3.995   1.00 11.72 ? 552 THR A CB  1 
ATOM   1562 O OG1 . THR A 1 209 ? 9.793  9.079   4.238   1.00 13.81 ? 552 THR A OG1 1 
ATOM   1563 C CG2 . THR A 1 209 ? 11.921 9.161   3.084   1.00 13.26 ? 552 THR A CG2 1 
ATOM   1564 N N   . TYR A 1 210 ? 12.095 6.197   1.577   1.00 10.64 ? 553 TYR A N   1 
ATOM   1565 C CA  . TYR A 1 210 ? 13.290 5.587   1.009   1.00 10.00 ? 553 TYR A CA  1 
ATOM   1566 C C   . TYR A 1 210 ? 14.005 6.635   0.166   1.00 10.38 ? 553 TYR A C   1 
ATOM   1567 O O   . TYR A 1 210 ? 13.391 7.260   -0.702  1.00 11.25 ? 553 TYR A O   1 
ATOM   1568 C CB  . TYR A 1 210 ? 12.898 4.363   0.155   1.00 10.13 ? 553 TYR A CB  1 
ATOM   1569 C CG  . TYR A 1 210 ? 14.037 3.755   -0.616  1.00 10.47 ? 553 TYR A CG  1 
ATOM   1570 C CD1 . TYR A 1 210 ? 14.826 2.761   -0.040  1.00 10.64 ? 553 TYR A CD1 1 
ATOM   1571 C CD2 . TYR A 1 210 ? 14.365 4.195   -1.907  1.00 11.05 ? 553 TYR A CD2 1 
ATOM   1572 C CE1 . TYR A 1 210 ? 15.885 2.199   -0.724  1.00 10.86 ? 553 TYR A CE1 1 
ATOM   1573 C CE2 . TYR A 1 210 ? 15.420 3.641   -2.604  1.00 10.86 ? 553 TYR A CE2 1 
ATOM   1574 C CZ  . TYR A 1 210 ? 16.184 2.638   -2.014  1.00 10.83 ? 553 TYR A CZ  1 
ATOM   1575 O OH  . TYR A 1 210 ? 17.232 2.083   -2.719  1.00 12.79 ? 553 TYR A OH  1 
ATOM   1576 N N   . VAL A 1 211 ? 15.290 6.859   0.429   1.00 9.88  ? 554 VAL A N   1 
ATOM   1577 C CA  . VAL A 1 211 ? 16.078 7.794   -0.384  1.00 10.16 ? 554 VAL A CA  1 
ATOM   1578 C C   . VAL A 1 211 ? 17.293 7.096   -0.976  1.00 9.65  ? 554 VAL A C   1 
ATOM   1579 O O   . VAL A 1 211 ? 17.919 6.264   -0.316  1.00 10.26 ? 554 VAL A O   1 
ATOM   1580 C CB  . VAL A 1 211 ? 16.509 9.045   0.410   1.00 10.86 ? 554 VAL A CB  1 
ATOM   1581 C CG1 . VAL A 1 211 ? 15.297 9.933   0.667   1.00 12.51 ? 554 VAL A CG1 1 
ATOM   1582 C CG2 . VAL A 1 211 ? 17.185 8.671   1.719   1.00 12.54 ? 554 VAL A CG2 1 
ATOM   1583 N N   . ALA A 1 212 ? 17.614 7.439   -2.216  1.00 10.23 ? 555 ALA A N   1 
ATOM   1584 C CA  . ALA A 1 212 ? 18.805 6.891   -2.854  1.00 10.18 ? 555 ALA A CA  1 
ATOM   1585 C C   . ALA A 1 212 ? 19.524 7.986   -3.601  1.00 11.02 ? 555 ALA A C   1 
ATOM   1586 O O   . ALA A 1 212 ? 18.918 8.641   -4.464  1.00 11.13 ? 555 ALA A O   1 
ATOM   1587 C CB  . ALA A 1 212 ? 18.448 5.753   -3.773  1.00 10.64 ? 555 ALA A CB  1 
ATOM   1588 N N   . ASN A 1 213 ? 20.791 8.195   -3.236  1.00 10.92 ? 556 ASN A N   1 
ATOM   1589 C CA  . ASN A 1 213 ? 21.676 9.120   -3.933  1.00 11.71 ? 556 ASN A CA  1 
ATOM   1590 C C   . ASN A 1 213 ? 22.844 8.288   -4.451  1.00 12.02 ? 556 ASN A C   1 
ATOM   1591 O O   . ASN A 1 213 ? 23.669 7.814   -3.675  1.00 12.98 ? 556 ASN A O   1 
ATOM   1592 C CB  . ASN A 1 213 ? 22.141 10.253  -3.002  1.00 12.48 ? 556 ASN A CB  1 
ATOM   1593 C CG  . ASN A 1 213 ? 21.049 11.272  -2.738  1.00 14.55 ? 556 ASN A CG  1 
ATOM   1594 O OD1 . ASN A 1 213 ? 21.119 12.421  -3.201  1.00 19.72 ? 556 ASN A OD1 1 
ATOM   1595 N ND2 . ASN A 1 213 ? 20.028 10.862  -2.019  1.00 13.48 ? 556 ASN A ND2 1 
ATOM   1596 N N   . VAL A 1 214 ? 22.863 8.090   -5.767  1.00 12.70 ? 557 VAL A N   1 
ATOM   1597 C CA  . VAL A 1 214 ? 23.795 7.186   -6.424  1.00 13.11 ? 557 VAL A CA  1 
ATOM   1598 C C   . VAL A 1 214 ? 24.660 7.953   -7.410  1.00 13.69 ? 557 VAL A C   1 
ATOM   1599 O O   . VAL A 1 214 ? 24.135 8.684   -8.263  1.00 13.97 ? 557 VAL A O   1 
ATOM   1600 C CB  . VAL A 1 214 ? 23.031 6.069   -7.151  1.00 13.73 ? 557 VAL A CB  1 
ATOM   1601 C CG1 . VAL A 1 214 ? 23.962 5.190   -7.974  1.00 13.47 ? 557 VAL A CG1 1 
ATOM   1602 C CG2 . VAL A 1 214 ? 22.253 5.249   -6.146  1.00 13.24 ? 557 VAL A CG2 1 
ATOM   1603 N N   . ASN A 1 215 ? 25.972 7.808   -7.261  1.00 13.34 ? 558 ASN A N   1 
ATOM   1604 C CA  . ASN A 1 215 ? 26.915 8.258   -8.269  1.00 13.71 ? 558 ASN A CA  1 
ATOM   1605 C C   . ASN A 1 215 ? 27.346 7.018   -9.051  1.00 13.87 ? 558 ASN A C   1 
ATOM   1606 O O   . ASN A 1 215 ? 27.969 6.132   -8.480  1.00 13.76 ? 558 ASN A O   1 
ATOM   1607 C CB  . ASN A 1 215 ? 28.128 8.935   -7.614  1.00 13.65 ? 558 ASN A CB  1 
ATOM   1608 C CG  . ASN A 1 215 ? 29.060 9.567   -8.629  1.00 16.10 ? 558 ASN A CG  1 
ATOM   1609 O OD1 . ASN A 1 215 ? 29.291 9.018   -9.710  1.00 16.39 ? 558 ASN A OD1 1 
ATOM   1610 N ND2 . ASN A 1 215 ? 29.583 10.748  -8.298  1.00 19.64 ? 558 ASN A ND2 1 
ATOM   1611 N N   . PRO A 1 216 ? 26.993 6.929   -10.351 1.00 14.14 ? 559 PRO A N   1 
ATOM   1612 C CA  . PRO A 1 216 ? 27.359 5.741   -11.135 1.00 15.17 ? 559 PRO A CA  1 
ATOM   1613 C C   . PRO A 1 216 ? 28.861 5.514   -11.300 1.00 15.90 ? 559 PRO A C   1 
ATOM   1614 O O   . PRO A 1 216 ? 29.250 4.460   -11.794 1.00 16.30 ? 559 PRO A O   1 
ATOM   1615 C CB  . PRO A 1 216 ? 26.690 5.964   -12.506 1.00 15.53 ? 559 PRO A CB  1 
ATOM   1616 C CG  . PRO A 1 216 ? 25.783 7.098   -12.343 1.00 16.33 ? 559 PRO A CG  1 
ATOM   1617 C CD  . PRO A 1 216 ? 26.211 7.900   -11.139 1.00 14.70 ? 559 PRO A CD  1 
ATOM   1618 N N   . GLY A 1 217 ? 29.684 6.489   -10.912 1.00 17.00 ? 560 GLY A N   1 
ATOM   1619 C CA  . GLY A 1 217 ? 31.140 6.283   -10.824 1.00 18.83 ? 560 GLY A CA  1 
ATOM   1620 C C   . GLY A 1 217 ? 31.859 6.461   -12.144 1.00 19.74 ? 560 GLY A C   1 
ATOM   1621 O O   . GLY A 1 217 ? 33.067 6.206   -12.252 1.00 20.53 ? 560 GLY A O   1 
ATOM   1622 N N   . GLY A 1 218 ? 31.110 6.879   -13.154 1.00 20.48 ? 561 GLY A N   1 
ATOM   1623 C CA  . GLY A 1 218 ? 31.664 7.147   -14.466 1.00 21.76 ? 561 GLY A CA  1 
ATOM   1624 C C   . GLY A 1 218 ? 30.516 7.411   -15.411 1.00 22.20 ? 561 GLY A C   1 
ATOM   1625 O O   . GLY A 1 218 ? 29.336 7.362   -15.010 1.00 22.00 ? 561 GLY A O   1 
ATOM   1626 N N   . TRP A 1 219 ? 30.857 7.695   -16.666 1.00 22.95 ? 562 TRP A N   1 
ATOM   1627 C CA  . TRP A 1 219 ? 29.848 7.987   -17.670 1.00 23.14 ? 562 TRP A CA  1 
ATOM   1628 C C   . TRP A 1 219 ? 28.962 6.783   -17.962 1.00 22.15 ? 562 TRP A C   1 
ATOM   1629 O O   . TRP A 1 219 ? 29.393 5.626   -17.977 1.00 22.39 ? 562 TRP A O   1 
ATOM   1630 C CB  . TRP A 1 219 ? 30.473 8.510   -18.967 1.00 24.12 ? 562 TRP A CB  1 
ATOM   1631 C CG  . TRP A 1 219 ? 29.444 8.987   -19.972 1.00 25.44 ? 562 TRP A CG  1 
ATOM   1632 C CD1 . TRP A 1 219 ? 28.859 10.224  -20.029 1.00 26.91 ? 562 TRP A CD1 1 
ATOM   1633 C CD2 . TRP A 1 219 ? 28.866 8.222   -21.039 1.00 26.13 ? 562 TRP A CD2 1 
ATOM   1634 N NE1 . TRP A 1 219 ? 27.962 10.278  -21.077 1.00 26.80 ? 562 TRP A NE1 1 
ATOM   1635 C CE2 . TRP A 1 219 ? 27.947 9.062   -21.708 1.00 26.52 ? 562 TRP A CE2 1 
ATOM   1636 C CE3 . TRP A 1 219 ? 29.033 6.903   -21.492 1.00 26.17 ? 562 TRP A CE3 1 
ATOM   1637 C CZ2 . TRP A 1 219 ? 27.206 8.632   -22.817 1.00 26.48 ? 562 TRP A CZ2 1 
ATOM   1638 C CZ3 . TRP A 1 219 ? 28.293 6.477   -22.597 1.00 26.06 ? 562 TRP A CZ3 1 
ATOM   1639 C CH2 . TRP A 1 219 ? 27.388 7.338   -23.237 1.00 26.28 ? 562 TRP A CH2 1 
ATOM   1640 N N   . ALA A 1 220 ? 27.700 7.103   -18.158 1.00 21.22 ? 563 ALA A N   1 
ATOM   1641 C CA  . ALA A 1 220 ? 26.713 6.164   -18.632 1.00 20.37 ? 563 ALA A CA  1 
ATOM   1642 C C   . ALA A 1 220 ? 25.641 6.998   -19.338 1.00 20.04 ? 563 ALA A C   1 
ATOM   1643 O O   . ALA A 1 220 ? 25.440 8.169   -18.993 1.00 20.09 ? 563 ALA A O   1 
ATOM   1644 C CB  . ALA A 1 220 ? 26.150 5.389   -17.474 1.00 20.96 ? 563 ALA A CB  1 
ATOM   1645 N N   . PRO A 1 221 ? 24.964 6.416   -20.345 1.00 19.17 ? 564 PRO A N   1 
ATOM   1646 C CA  . PRO A 1 221 ? 23.990 7.203   -21.110 1.00 18.54 ? 564 PRO A CA  1 
ATOM   1647 C C   . PRO A 1 221 ? 22.839 7.646   -20.218 1.00 17.53 ? 564 PRO A C   1 
ATOM   1648 O O   . PRO A 1 221 ? 22.200 6.813   -19.564 1.00 17.24 ? 564 PRO A O   1 
ATOM   1649 C CB  . PRO A 1 221 ? 23.501 6.230   -22.195 1.00 18.49 ? 564 PRO A CB  1 
ATOM   1650 C CG  . PRO A 1 221 ? 24.449 5.089   -22.176 1.00 19.98 ? 564 PRO A CG  1 
ATOM   1651 C CD  . PRO A 1 221 ? 25.060 5.024   -20.818 1.00 19.22 ? 564 PRO A CD  1 
ATOM   1652 N N   . ALA A 1 222 ? 22.569 8.945   -20.206 1.00 17.26 ? 565 ALA A N   1 
ATOM   1653 C CA  . ALA A 1 222 ? 21.588 9.521   -19.294 1.00 16.60 ? 565 ALA A CA  1 
ATOM   1654 C C   . ALA A 1 222 ? 20.195 8.923   -19.476 1.00 16.55 ? 565 ALA A C   1 
ATOM   1655 O O   . ALA A 1 222 ? 19.527 8.575   -18.504 1.00 16.28 ? 565 ALA A O   1 
ATOM   1656 C CB  . ALA A 1 222 ? 21.546 11.041  -19.441 1.00 17.26 ? 565 ALA A CB  1 
ATOM   1657 N N   . SER A 1 223 ? 19.754 8.786   -20.722 1.00 15.89 ? 566 SER A N   1 
ATOM   1658 C CA  . SER A 1 223 ? 18.397 8.302   -20.968 1.00 16.31 ? 566 SER A CA  1 
ATOM   1659 C C   . SER A 1 223 ? 18.232 6.860   -20.471 1.00 16.25 ? 566 SER A C   1 
ATOM   1660 O O   . SER A 1 223 ? 17.182 6.513   -19.948 1.00 16.45 ? 566 SER A O   1 
ATOM   1661 C CB  . SER A 1 223 ? 18.001 8.438   -22.444 1.00 17.36 ? 566 SER A CB  1 
ATOM   1662 O OG  . SER A 1 223 ? 18.776 7.572   -23.261 1.00 17.33 ? 566 SER A OG  1 
ATOM   1663 N N   . VAL A 1 224 ? 19.278 6.047   -20.638 1.00 15.57 ? 567 VAL A N   1 
ATOM   1664 C CA  . VAL A 1 224 ? 19.276 4.654   -20.168 1.00 15.39 ? 567 VAL A CA  1 
ATOM   1665 C C   . VAL A 1 224 ? 19.219 4.614   -18.638 1.00 15.41 ? 567 VAL A C   1 
ATOM   1666 O O   . VAL A 1 224 ? 18.349 3.942   -18.069 1.00 15.88 ? 567 VAL A O   1 
ATOM   1667 C CB  . VAL A 1 224 ? 20.509 3.865   -20.687 1.00 14.87 ? 567 VAL A CB  1 
ATOM   1668 C CG1 . VAL A 1 224 ? 20.534 2.441   -20.125 1.00 16.71 ? 567 VAL A CG1 1 
ATOM   1669 C CG2 . VAL A 1 224 ? 20.503 3.825   -22.212 1.00 15.63 ? 567 VAL A CG2 1 
ATOM   1670 N N   . LEU A 1 225 ? 20.120 5.349   -17.989 1.00 15.37 ? 568 LEU A N   1 
ATOM   1671 C CA  . LEU A 1 225 ? 20.135 5.409   -16.519 1.00 15.66 ? 568 LEU A CA  1 
ATOM   1672 C C   . LEU A 1 225 ? 18.788 5.830   -15.975 1.00 15.55 ? 568 LEU A C   1 
ATOM   1673 O O   . LEU A 1 225 ? 18.282 5.230   -15.019 1.00 15.16 ? 568 LEU A O   1 
ATOM   1674 C CB  . LEU A 1 225 ? 21.193 6.393   -16.040 1.00 15.64 ? 568 LEU A CB  1 
ATOM   1675 C CG  A LEU A 1 225 ? 22.520 5.679   -15.778 0.65 17.49 ? 568 LEU A CG  1 
ATOM   1676 C CG  B LEU A 1 225 ? 22.660 6.050   -15.825 0.35 16.95 ? 568 LEU A CG  1 
ATOM   1677 C CD1 A LEU A 1 225 ? 22.963 4.862   -16.983 0.65 19.53 ? 568 LEU A CD1 1 
ATOM   1678 C CD1 B LEU A 1 225 ? 23.517 7.183   -16.353 0.35 17.62 ? 568 LEU A CD1 1 
ATOM   1679 C CD2 A LEU A 1 225 ? 23.594 6.676   -15.356 0.65 17.11 ? 568 LEU A CD2 1 
ATOM   1680 C CD2 B LEU A 1 225 ? 22.901 5.850   -14.345 0.35 17.69 ? 568 LEU A CD2 1 
ATOM   1681 N N   . ARG A 1 226 ? 18.193 6.852   -16.580 1.00 15.25 ? 569 ARG A N   1 
ATOM   1682 C CA  . ARG A 1 226 ? 16.928 7.370   -16.057 1.00 15.42 ? 569 ARG A CA  1 
ATOM   1683 C C   . ARG A 1 226 ? 15.765 6.404   -16.267 1.00 15.77 ? 569 ARG A C   1 
ATOM   1684 O O   . ARG A 1 226 ? 14.892 6.266   -15.408 1.00 15.73 ? 569 ARG A O   1 
ATOM   1685 C CB  . ARG A 1 226 ? 16.650 8.762   -16.621 1.00 15.49 ? 569 ARG A CB  1 
ATOM   1686 C CG  . ARG A 1 226 ? 17.568 9.767   -15.975 1.00 16.45 ? 569 ARG A CG  1 
ATOM   1687 C CD  A ARG A 1 226 ? 17.811 10.949  -16.893 0.20 17.46 ? 569 ARG A CD  1 
ATOM   1688 C CD  B ARG A 1 226 ? 17.475 11.124  -16.607 0.80 15.67 ? 569 ARG A CD  1 
ATOM   1689 N NE  A ARG A 1 226 ? 19.037 11.676  -16.567 0.20 18.62 ? 569 ARG A NE  1 
ATOM   1690 N NE  B ARG A 1 226 ? 18.171 12.080  -15.767 0.80 13.48 ? 569 ARG A NE  1 
ATOM   1691 C CZ  A ARG A 1 226 ? 19.086 12.767  -15.809 0.20 18.66 ? 569 ARG A CZ  1 
ATOM   1692 C CZ  B ARG A 1 226 ? 18.861 13.128  -16.208 0.80 13.15 ? 569 ARG A CZ  1 
ATOM   1693 N NH1 A ARG A 1 226 ? 17.978 13.257  -15.282 0.20 18.93 ? 569 ARG A NH1 1 
ATOM   1694 N NH1 B ARG A 1 226 ? 18.948 13.377  -17.507 0.80 14.51 ? 569 ARG A NH1 1 
ATOM   1695 N NH2 A ARG A 1 226 ? 20.242 13.367  -15.569 0.20 19.14 ? 569 ARG A NH2 1 
ATOM   1696 N NH2 B ARG A 1 226 ? 19.462 13.935  -15.340 0.80 12.65 ? 569 ARG A NH2 1 
ATOM   1697 N N   . ALA A 1 227 ? 15.769 5.698   -17.390 1.00 15.98 ? 570 ALA A N   1 
ATOM   1698 C CA  . ALA A 1 227 ? 14.718 4.728   -17.663 1.00 15.92 ? 570 ALA A CA  1 
ATOM   1699 C C   . ALA A 1 227 ? 14.837 3.543   -16.714 1.00 15.98 ? 570 ALA A C   1 
ATOM   1700 O O   . ALA A 1 227 ? 13.828 3.041   -16.207 1.00 15.54 ? 570 ALA A O   1 
ATOM   1701 C CB  . ALA A 1 227 ? 14.792 4.262   -19.123 1.00 16.16 ? 570 ALA A CB  1 
ATOM   1702 N N   . VAL A 1 228 ? 16.071 3.125   -16.454 1.00 15.43 ? 571 VAL A N   1 
ATOM   1703 C CA  . VAL A 1 228 ? 16.335 1.996   -15.557 1.00 16.04 ? 571 VAL A CA  1 
ATOM   1704 C C   . VAL A 1 228 ? 15.930 2.355   -14.123 1.00 15.45 ? 571 VAL A C   1 
ATOM   1705 O O   . VAL A 1 228 ? 15.268 1.563   -13.446 1.00 15.61 ? 571 VAL A O   1 
ATOM   1706 C CB  . VAL A 1 228 ? 17.799 1.551   -15.635 1.00 16.31 ? 571 VAL A CB  1 
ATOM   1707 C CG1 . VAL A 1 228 ? 18.111 0.520   -14.536 1.00 16.81 ? 571 VAL A CG1 1 
ATOM   1708 C CG2 . VAL A 1 228 ? 18.085 0.977   -17.020 1.00 17.85 ? 571 VAL A CG2 1 
ATOM   1709 N N   . ALA A 1 229 ? 16.274 3.563   -13.683 1.00 14.86 ? 572 ALA A N   1 
ATOM   1710 C CA  . ALA A 1 229 ? 15.884 4.007   -12.338 1.00 14.57 ? 572 ALA A CA  1 
ATOM   1711 C C   . ALA A 1 229 ? 14.360 4.064   -12.206 1.00 14.98 ? 572 ALA A C   1 
ATOM   1712 O O   . ALA A 1 229 ? 13.782 3.628   -11.200 1.00 13.84 ? 572 ALA A O   1 
ATOM   1713 C CB  . ALA A 1 229 ? 16.517 5.354   -12.006 1.00 15.03 ? 572 ALA A CB  1 
ATOM   1714 N N   . LYS A 1 230 ? 13.694 4.598   -13.229 1.00 15.17 ? 573 LYS A N   1 
ATOM   1715 C CA  . LYS A 1 230 ? 12.244 4.762   -13.187 1.00 15.72 ? 573 LYS A CA  1 
ATOM   1716 C C   . LYS A 1 230 ? 11.542 3.409   -13.109 1.00 15.48 ? 573 LYS A C   1 
ATOM   1717 O O   . LYS A 1 230 ? 10.497 3.290   -12.466 1.00 16.68 ? 573 LYS A O   1 
ATOM   1718 C CB  . LYS A 1 230 ? 11.763 5.579   -14.401 1.00 15.87 ? 573 LYS A CB  1 
ATOM   1719 C CG  . LYS A 1 230 ? 10.265 5.829   -14.438 1.00 16.95 ? 573 LYS A CG  1 
ATOM   1720 C CD  . LYS A 1 230 ? 9.903  6.847   -15.516 1.00 18.00 ? 573 LYS A CD  1 
ATOM   1721 C CE  . LYS A 1 230 ? 8.399  7.011   -15.601 1.00 21.23 ? 573 LYS A CE  1 
ATOM   1722 N NZ  . LYS A 1 230 ? 8.009  7.980   -16.675 1.00 24.10 ? 573 LYS A NZ  1 
ATOM   1723 N N   . ARG A 1 231 ? 12.137 2.402   -13.749 1.00 15.24 ? 574 ARG A N   1 
ATOM   1724 C CA  . ARG A 1 231 ? 11.610 1.040   -13.705 1.00 15.71 ? 574 ARG A CA  1 
ATOM   1725 C C   . ARG A 1 231 ? 11.959 0.339   -12.391 1.00 15.54 ? 574 ARG A C   1 
ATOM   1726 O O   . ARG A 1 231 ? 11.088 -0.244  -11.729 1.00 15.11 ? 574 ARG A O   1 
ATOM   1727 C CB  . ARG A 1 231 ? 12.159 0.216   -14.874 1.00 16.69 ? 574 ARG A CB  1 
ATOM   1728 C CG  . ARG A 1 231 ? 11.622 -1.197  -14.947 1.00 20.27 ? 574 ARG A CG  1 
ATOM   1729 C CD  . ARG A 1 231 ? 12.224 -1.930  -16.137 1.00 25.44 ? 574 ARG A CD  1 
ATOM   1730 N NE  . ARG A 1 231 ? 13.599 -2.350  -15.870 1.00 28.64 ? 574 ARG A NE  1 
ATOM   1731 C CZ  . ARG A 1 231 ? 14.676 -1.919  -16.521 1.00 30.20 ? 574 ARG A CZ  1 
ATOM   1732 N NH1 . ARG A 1 231 ? 14.567 -1.046  -17.519 1.00 32.22 ? 574 ARG A NH1 1 
ATOM   1733 N NH2 . ARG A 1 231 ? 15.871 -2.380  -16.178 1.00 30.88 ? 574 ARG A NH2 1 
ATOM   1734 N N   . GLU A 1 232 ? 13.235 0.388   -12.022 1.00 14.84 ? 575 GLU A N   1 
ATOM   1735 C CA  . GLU A 1 232 ? 13.745 -0.495  -10.975 1.00 15.12 ? 575 GLU A CA  1 
ATOM   1736 C C   . GLU A 1 232 ? 13.409 -0.070  -9.560  1.00 14.94 ? 575 GLU A C   1 
ATOM   1737 O O   . GLU A 1 232 ? 13.195 -0.931  -8.700  1.00 14.52 ? 575 GLU A O   1 
ATOM   1738 C CB  . GLU A 1 232 ? 15.258 -0.711  -11.116 1.00 15.36 ? 575 GLU A CB  1 
ATOM   1739 C CG  . GLU A 1 232 ? 15.672 -1.462  -12.388 1.00 16.84 ? 575 GLU A CG  1 
ATOM   1740 C CD  . GLU A 1 232 ? 15.116 -2.871  -12.473 1.00 19.00 ? 575 GLU A CD  1 
ATOM   1741 O OE1 . GLU A 1 232 ? 15.029 -3.562  -11.428 1.00 18.25 ? 575 GLU A OE1 1 
ATOM   1742 O OE2 . GLU A 1 232 ? 14.768 -3.303  -13.598 1.00 21.14 ? 575 GLU A OE2 1 
ATOM   1743 N N   . TYR A 1 233 ? 13.359 1.232   -9.293  1.00 14.45 ? 576 TYR A N   1 
ATOM   1744 C CA  . TYR A 1 233 ? 13.052 1.645   -7.923  1.00 14.20 ? 576 TYR A CA  1 
ATOM   1745 C C   . TYR A 1 233 ? 11.628 1.293   -7.481  1.00 14.43 ? 576 TYR A C   1 
ATOM   1746 O O   . TYR A 1 233 ? 11.469 0.703   -6.425  1.00 14.01 ? 576 TYR A O   1 
ATOM   1747 C CB  . TYR A 1 233 ? 13.368 3.120   -7.677  1.00 13.93 ? 576 TYR A CB  1 
ATOM   1748 C CG  . TYR A 1 233 ? 14.840 3.411   -7.508  1.00 13.79 ? 576 TYR A CG  1 
ATOM   1749 C CD1 . TYR A 1 233 ? 15.554 4.092   -8.496  1.00 14.98 ? 576 TYR A CD1 1 
ATOM   1750 C CD2 . TYR A 1 233 ? 15.519 3.010   -6.358  1.00 12.69 ? 576 TYR A CD2 1 
ATOM   1751 C CE1 . TYR A 1 233 ? 16.902 4.382   -8.327  1.00 15.58 ? 576 TYR A CE1 1 
ATOM   1752 C CE2 . TYR A 1 233 ? 16.864 3.276   -6.185  1.00 14.66 ? 576 TYR A CE2 1 
ATOM   1753 C CZ  . TYR A 1 233 ? 17.556 3.962   -7.174  1.00 15.92 ? 576 TYR A CZ  1 
ATOM   1754 O OH  . TYR A 1 233 ? 18.885 4.236   -6.970  1.00 16.16 ? 576 TYR A OH  1 
ATOM   1755 N N   . PRO A 1 234 ? 10.587 1.628   -8.280  1.00 14.62 ? 577 PRO A N   1 
ATOM   1756 C CA  . PRO A 1 234 ? 9.247  1.163   -7.907  1.00 14.85 ? 577 PRO A CA  1 
ATOM   1757 C C   . PRO A 1 234 ? 9.126  -0.354  -7.905  1.00 14.73 ? 577 PRO A C   1 
ATOM   1758 O O   . PRO A 1 234 ? 8.419  -0.914  -7.064  1.00 15.00 ? 577 PRO A O   1 
ATOM   1759 C CB  . PRO A 1 234 ? 8.331  1.780   -8.975  1.00 15.29 ? 577 PRO A CB  1 
ATOM   1760 C CG  . PRO A 1 234 ? 9.202  2.224   -10.033 1.00 16.13 ? 577 PRO A CG  1 
ATOM   1761 C CD  . PRO A 1 234 ? 10.552 2.486   -9.480  1.00 14.52 ? 577 PRO A CD  1 
ATOM   1762 N N   . LYS A 1 235 ? 9.823  -1.028  -8.817  1.00 14.73 ? 578 LYS A N   1 
ATOM   1763 C CA  . LYS A 1 235 ? 9.721  -2.486  -8.868  1.00 15.00 ? 578 LYS A CA  1 
ATOM   1764 C C   . LYS A 1 235 ? 10.240 -3.061  -7.555  1.00 14.70 ? 578 LYS A C   1 
ATOM   1765 O O   . LYS A 1 235 ? 9.637  -3.974  -6.978  1.00 14.79 ? 578 LYS A O   1 
ATOM   1766 C CB  A LYS A 1 235 ? 10.519 -3.034  -10.055 0.65 15.40 ? 578 LYS A CB  1 
ATOM   1767 C CB  B LYS A 1 235 ? 10.486 -3.061  -10.056 0.35 15.22 ? 578 LYS A CB  1 
ATOM   1768 C CG  A LYS A 1 235 ? 10.612 -4.556  -10.132 0.65 16.33 ? 578 LYS A CG  1 
ATOM   1769 C CG  B LYS A 1 235 ? 10.095 -4.495  -10.392 0.35 16.09 ? 578 LYS A CG  1 
ATOM   1770 C CD  A LYS A 1 235 ? 11.512 -4.990  -11.288 0.65 16.72 ? 578 LYS A CD  1 
ATOM   1771 C CD  B LYS A 1 235 ? 11.103 -5.150  -11.324 0.35 16.67 ? 578 LYS A CD  1 
ATOM   1772 C CE  A LYS A 1 235 ? 11.411 -6.496  -11.529 0.65 19.15 ? 578 LYS A CE  1 
ATOM   1773 C CE  B LYS A 1 235 ? 10.958 -4.685  -12.766 0.35 17.38 ? 578 LYS A CE  1 
ATOM   1774 N NZ  A LYS A 1 235 ? 12.572 -7.118  -12.236 0.65 21.43 ? 578 LYS A NZ  1 
ATOM   1775 N NZ  B LYS A 1 235 ? 12.037 -5.264  -13.628 0.35 17.92 ? 578 LYS A NZ  1 
ATOM   1776 N N   . PHE A 1 236 ? 11.358 -2.513  -7.091  1.00 13.96 ? 579 PHE A N   1 
ATOM   1777 C CA  . PHE A 1 236 ? 11.943 -2.915  -5.817  1.00 13.87 ? 579 PHE A CA  1 
ATOM   1778 C C   . PHE A 1 236 ? 11.001 -2.610  -4.658  1.00 14.00 ? 579 PHE A C   1 
ATOM   1779 O O   . PHE A 1 236 ? 10.763 -3.473  -3.802  1.00 14.45 ? 579 PHE A O   1 
ATOM   1780 C CB  . PHE A 1 236 ? 13.295 -2.205  -5.618  1.00 13.66 ? 579 PHE A CB  1 
ATOM   1781 C CG  . PHE A 1 236 ? 13.593 -1.843  -4.180  1.00 13.21 ? 579 PHE A CG  1 
ATOM   1782 C CD1 . PHE A 1 236 ? 13.868 -2.839  -3.226  1.00 13.10 ? 579 PHE A CD1 1 
ATOM   1783 C CD2 . PHE A 1 236 ? 13.611 -0.511  -3.791  1.00 14.06 ? 579 PHE A CD2 1 
ATOM   1784 C CE1 . PHE A 1 236 ? 14.118 -2.487  -1.892  1.00 13.29 ? 579 PHE A CE1 1 
ATOM   1785 C CE2 . PHE A 1 236 ? 13.882 -0.159  -2.471  1.00 13.97 ? 579 PHE A CE2 1 
ATOM   1786 C CZ  . PHE A 1 236 ? 14.132 -1.134  -1.529  1.00 13.39 ? 579 PHE A CZ  1 
ATOM   1787 N N   . LEU A 1 237 ? 10.481 -1.385  -4.601  1.00 14.23 ? 580 LEU A N   1 
ATOM   1788 C CA  . LEU A 1 237 ? 9.689  -0.989  -3.441  1.00 14.82 ? 580 LEU A CA  1 
ATOM   1789 C C   . LEU A 1 237 ? 8.469  -1.882  -3.322  1.00 15.27 ? 580 LEU A C   1 
ATOM   1790 O O   . LEU A 1 237 ? 8.137  -2.325  -2.225  1.00 14.91 ? 580 LEU A O   1 
ATOM   1791 C CB  . LEU A 1 237 ? 9.290  0.478   -3.500  1.00 15.70 ? 580 LEU A CB  1 
ATOM   1792 C CG  . LEU A 1 237 ? 10.444 1.452   -3.273  1.00 17.87 ? 580 LEU A CG  1 
ATOM   1793 C CD1 . LEU A 1 237 ? 10.132 2.804   -3.891  1.00 20.70 ? 580 LEU A CD1 1 
ATOM   1794 C CD2 . LEU A 1 237 ? 10.797 1.601   -1.782  1.00 20.80 ? 580 LEU A CD2 1 
ATOM   1795 N N   . LYS A 1 238 ? 7.834  -2.180  -4.457  1.00 15.35 ? 581 LYS A N   1 
ATOM   1796 C CA  . LYS A 1 238 ? 6.657  -3.049  -4.475  1.00 16.58 ? 581 LYS A CA  1 
ATOM   1797 C C   . LYS A 1 238 ? 7.032  -4.476  -4.083  1.00 16.11 ? 581 LYS A C   1 
ATOM   1798 O O   . LYS A 1 238 ? 6.365  -5.082  -3.234  1.00 16.22 ? 581 LYS A O   1 
ATOM   1799 C CB  A LYS A 1 238 ? 6.044  -3.071  -5.873  0.65 16.52 ? 581 LYS A CB  1 
ATOM   1800 C CB  B LYS A 1 238 ? 5.950  -2.999  -5.830  0.35 16.52 ? 581 LYS A CB  1 
ATOM   1801 C CG  A LYS A 1 238 ? 5.186  -1.870  -6.208  0.65 18.37 ? 581 LYS A CG  1 
ATOM   1802 C CG  B LYS A 1 238 ? 4.534  -3.578  -5.808  0.35 17.66 ? 581 LYS A CG  1 
ATOM   1803 C CD  A LYS A 1 238 ? 4.704  -1.925  -7.664  0.65 18.59 ? 581 LYS A CD  1 
ATOM   1804 C CD  B LYS A 1 238 ? 3.590  -2.862  -6.767  0.35 20.16 ? 581 LYS A CD  1 
ATOM   1805 C CE  A LYS A 1 238 ? 5.757  -1.364  -8.623  0.65 20.93 ? 581 LYS A CE  1 
ATOM   1806 C CE  B LYS A 1 238 ? 3.792  -3.270  -8.219  0.35 21.03 ? 581 LYS A CE  1 
ATOM   1807 N NZ  A LYS A 1 238 ? 5.571  -1.743  -10.056 0.65 25.29 ? 581 LYS A NZ  1 
ATOM   1808 N NZ  B LYS A 1 238 ? 4.857  -2.474  -8.884  0.35 22.51 ? 581 LYS A NZ  1 
ATOM   1809 N N   . ARG A 1 239 ? 8.100  -5.006  -4.676  1.00 15.56 ? 582 ARG A N   1 
ATOM   1810 C CA  . ARG A 1 239 ? 8.513  -6.385  -4.419  1.00 15.46 ? 582 ARG A CA  1 
ATOM   1811 C C   . ARG A 1 239 ? 8.971  -6.580  -2.975  1.00 14.96 ? 582 ARG A C   1 
ATOM   1812 O O   . ARG A 1 239 ? 8.494  -7.497  -2.281  1.00 15.65 ? 582 ARG A O   1 
ATOM   1813 C CB  . ARG A 1 239 ? 9.594  -6.833  -5.399  1.00 15.51 ? 582 ARG A CB  1 
ATOM   1814 C CG  . ARG A 1 239 ? 10.112 -8.238  -5.156  1.00 16.75 ? 582 ARG A CG  1 
ATOM   1815 C CD  . ARG A 1 239 ? 11.060 -8.648  -6.269  1.00 19.28 ? 582 ARG A CD  1 
ATOM   1816 N NE  . ARG A 1 239 ? 11.810 -9.868  -5.984  1.00 22.16 ? 582 ARG A NE  1 
ATOM   1817 C CZ  . ARG A 1 239 ? 11.369 -11.095 -6.254  1.00 24.66 ? 582 ARG A CZ  1 
ATOM   1818 N NH1 . ARG A 1 239 ? 10.170 -11.266 -6.800  1.00 25.74 ? 582 ARG A NH1 1 
ATOM   1819 N NH2 . ARG A 1 239 ? 12.126 -12.149 -5.973  1.00 25.96 ? 582 ARG A NH2 1 
ATOM   1820 N N   . PHE A 1 240 ? 9.881  -5.711  -2.527  1.00 14.52 ? 583 PHE A N   1 
ATOM   1821 C CA  . PHE A 1 240 ? 10.383 -5.788  -1.162  1.00 13.75 ? 583 PHE A CA  1 
ATOM   1822 C C   . PHE A 1 240 ? 9.273  -5.622  -0.123  1.00 14.04 ? 583 PHE A C   1 
ATOM   1823 O O   . PHE A 1 240 ? 9.207  -6.417  0.811   1.00 14.33 ? 583 PHE A O   1 
ATOM   1824 C CB  . PHE A 1 240 ? 11.519 -4.784  -0.912  1.00 13.32 ? 583 PHE A CB  1 
ATOM   1825 C CG  . PHE A 1 240 ? 11.864 -4.641  0.535   1.00 13.72 ? 583 PHE A CG  1 
ATOM   1826 C CD1 . PHE A 1 240 ? 12.560 -5.649  1.189   1.00 12.80 ? 583 PHE A CD1 1 
ATOM   1827 C CD2 . PHE A 1 240 ? 11.456 -3.522  1.253   1.00 13.12 ? 583 PHE A CD2 1 
ATOM   1828 C CE1 . PHE A 1 240 ? 12.856 -5.543  2.545   1.00 14.10 ? 583 PHE A CE1 1 
ATOM   1829 C CE2 . PHE A 1 240 ? 11.746 -3.412  2.619   1.00 12.46 ? 583 PHE A CE2 1 
ATOM   1830 C CZ  . PHE A 1 240 ? 12.450 -4.424  3.248   1.00 12.60 ? 583 PHE A CZ  1 
ATOM   1831 N N   . THR A 1 241 ? 8.409  -4.614  -0.251  1.00 13.74 ? 584 THR A N   1 
ATOM   1832 C CA  . THR A 1 241 ? 7.376  -4.430  0.780   1.00 14.47 ? 584 THR A CA  1 
ATOM   1833 C C   . THR A 1 241 ? 6.378  -5.581  0.786   1.00 15.15 ? 584 THR A C   1 
ATOM   1834 O O   . THR A 1 241 ? 5.970  -6.029  1.860   1.00 15.75 ? 584 THR A O   1 
ATOM   1835 C CB  . THR A 1 241 ? 6.645  -3.090  0.697   1.00 14.82 ? 584 THR A CB  1 
ATOM   1836 O OG1 . THR A 1 241 ? 6.020  -2.953  -0.581  1.00 15.88 ? 584 THR A OG1 1 
ATOM   1837 C CG2 . THR A 1 241 ? 7.636  -1.938  0.925   1.00 15.22 ? 584 THR A CG2 1 
ATOM   1838 N N   . SER A 1 242 ? 6.032  -6.091  -0.399  1.00 15.50 ? 585 SER A N   1 
ATOM   1839 C CA  . SER A 1 242 ? 5.131  -7.253  -0.482  1.00 16.14 ? 585 SER A CA  1 
ATOM   1840 C C   . SER A 1 242 ? 5.775  -8.485  0.154   1.00 16.05 ? 585 SER A C   1 
ATOM   1841 O O   . SER A 1 242 ? 5.083  -9.285  0.800   1.00 16.40 ? 585 SER A O   1 
ATOM   1842 C CB  A SER A 1 242 ? 4.759  -7.546  -1.937  0.33 15.89 ? 585 SER A CB  1 
ATOM   1843 C CB  B SER A 1 242 ? 4.719  -7.530  -1.932  0.33 16.09 ? 585 SER A CB  1 
ATOM   1844 C CB  C SER A 1 242 ? 4.738  -7.540  -1.937  0.33 16.11 ? 585 SER A CB  1 
ATOM   1845 O OG  A SER A 1 242 ? 4.024  -6.476  -2.497  0.33 15.11 ? 585 SER A OG  1 
ATOM   1846 O OG  B SER A 1 242 ? 5.819  -7.970  -2.705  0.33 16.98 ? 585 SER A OG  1 
ATOM   1847 O OG  C SER A 1 242 ? 3.863  -8.655  -2.024  0.33 17.24 ? 585 SER A OG  1 
ATOM   1848 N N   . TYR A 1 243 ? 7.088  -8.627  -0.019  1.00 15.96 ? 586 TYR A N   1 
ATOM   1849 C CA  . TYR A 1 243 ? 7.862  -9.697  0.602   1.00 16.34 ? 586 TYR A CA  1 
ATOM   1850 C C   . TYR A 1 243 ? 7.793  -9.630  2.133   1.00 16.91 ? 586 TYR A C   1 
ATOM   1851 O O   . TYR A 1 243 ? 7.612  -10.656 2.805   1.00 17.43 ? 586 TYR A O   1 
ATOM   1852 C CB  . TYR A 1 243 ? 9.322  -9.655  0.118   1.00 17.10 ? 586 TYR A CB  1 
ATOM   1853 C CG  . TYR A 1 243 ? 10.244 -10.603 0.847   1.00 18.22 ? 586 TYR A CG  1 
ATOM   1854 C CD1 . TYR A 1 243 ? 10.225 -11.970 0.577   1.00 18.77 ? 586 TYR A CD1 1 
ATOM   1855 C CD2 . TYR A 1 243 ? 11.111 -10.139 1.845   1.00 20.19 ? 586 TYR A CD2 1 
ATOM   1856 C CE1 . TYR A 1 243 ? 11.069 -12.844 1.242   1.00 20.67 ? 586 TYR A CE1 1 
ATOM   1857 C CE2 . TYR A 1 243 ? 11.953 -11.006 2.518   1.00 21.60 ? 586 TYR A CE2 1 
ATOM   1858 C CZ  . TYR A 1 243 ? 11.924 -12.358 2.222   1.00 21.31 ? 586 TYR A CZ  1 
ATOM   1859 O OH  . TYR A 1 243 ? 12.750 -13.238 2.890   1.00 25.61 ? 586 TYR A OH  1 
ATOM   1860 N N   . VAL A 1 244 ? 7.954  -8.430  2.689   1.00 16.59 ? 587 VAL A N   1 
ATOM   1861 C CA  . VAL A 1 244 ? 7.871  -8.276  4.149   1.00 16.25 ? 587 VAL A CA  1 
ATOM   1862 C C   . VAL A 1 244 ? 6.475  -8.655  4.639   1.00 16.98 ? 587 VAL A C   1 
ATOM   1863 O O   . VAL A 1 244 ? 6.342  -9.363  5.640   1.00 16.41 ? 587 VAL A O   1 
ATOM   1864 C CB  . VAL A 1 244 ? 8.282  -6.850  4.627   1.00 16.22 ? 587 VAL A CB  1 
ATOM   1865 C CG1 . VAL A 1 244 ? 8.112  -6.718  6.154   1.00 16.44 ? 587 VAL A CG1 1 
ATOM   1866 C CG2 . VAL A 1 244 ? 9.719  -6.553  4.223   1.00 16.37 ? 587 VAL A CG2 1 
ATOM   1867 N N   . GLN A 1 245 ? 5.447  -8.207  3.922   1.00 16.72 ? 588 GLN A N   1 
ATOM   1868 C CA  . GLN A 1 245 ? 4.068  -8.575  4.242   1.00 17.62 ? 588 GLN A CA  1 
ATOM   1869 C C   . GLN A 1 245 ? 3.906  -10.093 4.233   1.00 18.27 ? 588 GLN A C   1 
ATOM   1870 O O   . GLN A 1 245 ? 3.325  -10.663 5.158   1.00 17.78 ? 588 GLN A O   1 
ATOM   1871 C CB  . GLN A 1 245 ? 3.087  -7.924  3.267   1.00 17.55 ? 588 GLN A CB  1 
ATOM   1872 C CG  . GLN A 1 245 ? 2.843  -6.451  3.540   1.00 18.52 ? 588 GLN A CG  1 
ATOM   1873 C CD  . GLN A 1 245 ? 1.923  -5.800  2.531   1.00 18.52 ? 588 GLN A CD  1 
ATOM   1874 O OE1 . GLN A 1 245 ? 2.002  -6.077  1.328   1.00 21.83 ? 588 GLN A OE1 1 
ATOM   1875 N NE2 . GLN A 1 245 ? 1.047  -4.923  3.007   1.00 19.36 ? 588 GLN A NE2 1 
ATOM   1876 N N   . GLU A 1 246 ? 4.432  -10.743 3.200   1.00 18.85 ? 589 GLU A N   1 
ATOM   1877 C CA  . GLU A 1 246 ? 4.320  -12.198 3.065   1.00 20.12 ? 589 GLU A CA  1 
ATOM   1878 C C   . GLU A 1 246 ? 5.020  -12.943 4.200   1.00 20.39 ? 589 GLU A C   1 
ATOM   1879 O O   . GLU A 1 246 ? 4.501  -13.938 4.723   1.00 19.98 ? 589 GLU A O   1 
ATOM   1880 C CB  . GLU A 1 246 ? 4.894  -12.627 1.712   1.00 20.66 ? 589 GLU A CB  1 
ATOM   1881 C CG  . GLU A 1 246 ? 4.929  -14.124 1.490   1.00 23.49 ? 589 GLU A CG  1 
ATOM   1882 C CD  . GLU A 1 246 ? 5.636  -14.499 0.210   1.00 27.30 ? 589 GLU A CD  1 
ATOM   1883 O OE1 . GLU A 1 246 ? 5.079  -14.200 -0.876  1.00 30.14 ? 589 GLU A OE1 1 
ATOM   1884 O OE2 . GLU A 1 246 ? 6.736  -15.100 0.294   1.00 28.48 ? 589 GLU A OE2 1 
ATOM   1885 N N   . LYS A 1 247 ? 6.191  -12.453 4.592   1.00 20.54 ? 590 LYS A N   1 
ATOM   1886 C CA  . LYS A 1 247 ? 7.009  -13.147 5.581   1.00 21.20 ? 590 LYS A CA  1 
ATOM   1887 C C   . LYS A 1 247 ? 6.557  -12.909 7.015   1.00 21.01 ? 590 LYS A C   1 
ATOM   1888 O O   . LYS A 1 247 ? 6.937  -13.660 7.917   1.00 21.86 ? 590 LYS A O   1 
ATOM   1889 C CB  . LYS A 1 247 ? 8.504  -12.827 5.410   1.00 21.61 ? 590 LYS A CB  1 
ATOM   1890 C CG  A LYS A 1 247 ? 9.145  -13.395 4.151   0.65 22.75 ? 590 LYS A CG  1 
ATOM   1891 C CG  B LYS A 1 247 ? 9.242  -13.856 4.549   0.35 22.31 ? 590 LYS A CG  1 
ATOM   1892 C CD  A LYS A 1 247 ? 9.118  -14.919 4.128   0.65 24.55 ? 590 LYS A CD  1 
ATOM   1893 C CD  B LYS A 1 247 ? 10.580 -14.268 5.160   0.35 23.67 ? 590 LYS A CD  1 
ATOM   1894 C CE  A LYS A 1 247 ? 9.511  -15.455 2.766   0.65 26.04 ? 590 LYS A CE  1 
ATOM   1895 C CE  B LYS A 1 247 ? 10.399 -15.052 6.457   0.35 23.78 ? 590 LYS A CE  1 
ATOM   1896 N NZ  A LYS A 1 247 ? 8.554  -16.490 2.286   0.65 27.32 ? 590 LYS A NZ  1 
ATOM   1897 N NZ  B LYS A 1 247 ? 11.559 -14.918 7.386   0.35 23.78 ? 590 LYS A NZ  1 
ATOM   1898 N N   . THR A 1 248 ? 5.757  -11.865 7.218   1.00 20.69 ? 591 THR A N   1 
ATOM   1899 C CA  . THR A 1 248 ? 5.283  -11.507 8.558   1.00 20.50 ? 591 THR A CA  1 
ATOM   1900 C C   . THR A 1 248 ? 3.815  -11.878 8.777   1.00 21.16 ? 591 THR A C   1 
ATOM   1901 O O   . THR A 1 248 ? 3.360  -11.942 9.918   1.00 21.36 ? 591 THR A O   1 
ATOM   1902 C CB  . THR A 1 248 ? 5.475  -9.991  8.872   1.00 20.39 ? 591 THR A CB  1 
ATOM   1903 O OG1 . THR A 1 248 ? 4.751  -9.210  7.917   1.00 18.41 ? 591 THR A OG1 1 
ATOM   1904 C CG2 . THR A 1 248 ? 6.954  -9.603  8.858   1.00 20.36 ? 591 THR A CG2 1 
ATOM   1905 N N   . ALA A 1 249 ? 3.075  -12.113 7.689   1.00 21.54 ? 592 ALA A N   1 
ATOM   1906 C CA  . ALA A 1 249 ? 1.665  -12.476 7.764   1.00 22.17 ? 592 ALA A CA  1 
ATOM   1907 C C   . ALA A 1 249 ? 1.473  -13.680 8.673   1.00 22.58 ? 592 ALA A C   1 
ATOM   1908 O O   . ALA A 1 249 ? 2.224  -14.658 8.595   1.00 22.57 ? 592 ALA A O   1 
ATOM   1909 C CB  . ALA A 1 249 ? 1.109  -12.780 6.368   1.00 22.05 ? 592 ALA A CB  1 
ATOM   1910 N N   . GLY A 1 250 ? 0.481  -13.583 9.549   1.00 23.41 ? 593 GLY A N   1 
ATOM   1911 C CA  . GLY A 1 250 ? 0.135  -14.682 10.455  1.00 24.25 ? 593 GLY A CA  1 
ATOM   1912 C C   . GLY A 1 250 ? 1.087  -14.899 11.620  1.00 24.81 ? 593 GLY A C   1 
ATOM   1913 O O   . GLY A 1 250 ? 0.889  -15.811 12.423  1.00 25.39 ? 593 GLY A O   1 
ATOM   1914 N N   . LYS A 1 251 ? 2.113  -14.056 11.726  1.00 24.74 ? 594 LYS A N   1 
ATOM   1915 C CA  . LYS A 1 251 ? 3.144  -14.208 12.753  1.00 24.82 ? 594 LYS A CA  1 
ATOM   1916 C C   . LYS A 1 251 ? 3.012  -13.152 13.860  1.00 24.22 ? 594 LYS A C   1 
ATOM   1917 O O   . LYS A 1 251 ? 2.435  -12.081 13.624  1.00 24.20 ? 594 LYS A O   1 
ATOM   1918 C CB  . LYS A 1 251 ? 4.531  -14.162 12.106  1.00 25.37 ? 594 LYS A CB  1 
ATOM   1919 C CG  . LYS A 1 251 ? 4.794  -15.348 11.190  1.00 27.43 ? 594 LYS A CG  1 
ATOM   1920 C CD  . LYS A 1 251 ? 6.234  -15.383 10.724  1.00 30.80 ? 594 LYS A CD  1 
ATOM   1921 C CE  . LYS A 1 251 ? 6.461  -16.566 9.787   1.00 33.16 ? 594 LYS A CE  1 
ATOM   1922 N NZ  . LYS A 1 251 ? 7.651  -16.374 8.905   1.00 35.69 ? 594 LYS A NZ  1 
ATOM   1923 N N   . PRO A 1 252 ? 3.524  -13.459 15.078  1.00 23.91 ? 595 PRO A N   1 
ATOM   1924 C CA  . PRO A 1 252 ? 3.501  -12.472 16.164  1.00 23.20 ? 595 PRO A CA  1 
ATOM   1925 C C   . PRO A 1 252 ? 4.199  -11.190 15.710  1.00 21.94 ? 595 PRO A C   1 
ATOM   1926 O O   . PRO A 1 252 ? 5.199  -11.255 14.985  1.00 22.24 ? 595 PRO A O   1 
ATOM   1927 C CB  . PRO A 1 252 ? 4.319  -13.146 17.275  1.00 23.58 ? 595 PRO A CB  1 
ATOM   1928 C CG  . PRO A 1 252 ? 4.187  -14.614 17.006  1.00 24.12 ? 595 PRO A CG  1 
ATOM   1929 C CD  . PRO A 1 252 ? 4.161  -14.724 15.501  1.00 23.94 ? 595 PRO A CD  1 
ATOM   1930 N N   . ILE A 1 253 ? 3.676  -10.045 16.133  1.00 20.65 ? 596 ILE A N   1 
ATOM   1931 C CA  . ILE A 1 253 ? 4.226  -8.757  15.698  1.00 18.97 ? 596 ILE A CA  1 
ATOM   1932 C C   . ILE A 1 253 ? 5.495  -8.405  16.456  1.00 18.83 ? 596 ILE A C   1 
ATOM   1933 O O   . ILE A 1 253 ? 5.516  -8.415  17.694  1.00 18.63 ? 596 ILE A O   1 
ATOM   1934 C CB  . ILE A 1 253 ? 3.204  -7.615  15.837  1.00 18.50 ? 596 ILE A CB  1 
ATOM   1935 C CG1 . ILE A 1 253 ? 1.909  -7.953  15.089  1.00 19.38 ? 596 ILE A CG1 1 
ATOM   1936 C CG2 . ILE A 1 253 ? 3.776  -6.298  15.300  1.00 18.18 ? 596 ILE A CG2 1 
ATOM   1937 C CD1 . ILE A 1 253 ? 0.739  -7.062  15.448  1.00 19.32 ? 596 ILE A CD1 1 
ATOM   1938 N N   . LEU A 1 254 ? 6.548  -8.095  15.704  1.00 17.93 ? 597 LEU A N   1 
ATOM   1939 C CA  . LEU A 1 254 ? 7.786  -7.595  16.280  1.00 17.83 ? 597 LEU A CA  1 
ATOM   1940 C C   . LEU A 1 254 ? 7.801  -6.073  16.165  1.00 17.57 ? 597 LEU A C   1 
ATOM   1941 O O   . LEU A 1 254 ? 8.056  -5.519  15.086  1.00 17.53 ? 597 LEU A O   1 
ATOM   1942 C CB  . LEU A 1 254 ? 9.002  -8.218  15.580  1.00 17.66 ? 597 LEU A CB  1 
ATOM   1943 C CG  . LEU A 1 254 ? 10.377 -7.700  16.015  1.00 18.27 ? 597 LEU A CG  1 
ATOM   1944 C CD1 . LEU A 1 254 ? 10.723 -8.144  17.432  1.00 19.27 ? 597 LEU A CD1 1 
ATOM   1945 C CD2 . LEU A 1 254 ? 11.470 -8.123  15.038  1.00 19.44 ? 597 LEU A CD2 1 
ATOM   1946 N N   . PHE A 1 255 ? 7.495  -5.391  17.267  1.00 17.64 ? 598 PHE A N   1 
ATOM   1947 C CA  . PHE A 1 255 ? 7.503  -3.935  17.282  1.00 17.68 ? 598 PHE A CA  1 
ATOM   1948 C C   . PHE A 1 255 ? 8.933  -3.432  17.451  1.00 17.86 ? 598 PHE A C   1 
ATOM   1949 O O   . PHE A 1 255 ? 9.809  -4.163  17.922  1.00 17.92 ? 598 PHE A O   1 
ATOM   1950 C CB  . PHE A 1 255 ? 6.608  -3.382  18.397  1.00 17.45 ? 598 PHE A CB  1 
ATOM   1951 C CG  . PHE A 1 255 ? 5.142  -3.603  18.154  1.00 17.29 ? 598 PHE A CG  1 
ATOM   1952 C CD1 . PHE A 1 255 ? 4.492  -4.713  18.697  1.00 17.55 ? 598 PHE A CD1 1 
ATOM   1953 C CD2 . PHE A 1 255 ? 4.412  -2.713  17.358  1.00 18.46 ? 598 PHE A CD2 1 
ATOM   1954 C CE1 . PHE A 1 255 ? 3.127  -4.920  18.468  1.00 19.41 ? 598 PHE A CE1 1 
ATOM   1955 C CE2 . PHE A 1 255 ? 3.044  -2.923  17.119  1.00 18.49 ? 598 PHE A CE2 1 
ATOM   1956 C CZ  . PHE A 1 255 ? 2.404  -4.023  17.672  1.00 19.28 ? 598 PHE A CZ  1 
HETATM 1957 O O19 . 16C B 2 .   ? 18.332 -0.234  -1.854  1.00 13.58 ? 600 16C A O19 1 
HETATM 1958 C C19 . 16C B 2 .   ? 18.269 -1.288  -2.487  1.00 17.34 ? 600 16C A C19 1 
HETATM 1959 N N2  . 16C B 2 .   ? 19.074 -2.341  -2.291  1.00 18.36 ? 600 16C A N2  1 
HETATM 1960 C C2  . 16C B 2 .   ? 20.150 -2.410  -1.303  1.00 18.71 ? 600 16C A C2  1 
HETATM 1961 C C1  . 16C B 2 .   ? 20.683 -3.840  -1.172  1.00 19.16 ? 600 16C A C1  1 
HETATM 1962 O O1  . 16C B 2 .   ? 21.214 -4.301  -2.423  1.00 19.49 ? 600 16C A O1  1 
HETATM 1963 C C3  . 16C B 2 .   ? 21.269 -1.399  -1.575  1.00 19.15 ? 600 16C A C3  1 
HETATM 1964 C C4  . 16C B 2 .   ? 21.444 -1.193  -3.077  1.00 21.22 ? 600 16C A C4  1 
HETATM 1965 C C5  . 16C B 2 .   ? 21.371 -0.009  -3.685  1.00 22.74 ? 600 16C A C5  1 
HETATM 1966 C C6  . 16C B 2 .   ? 21.528 0.029   -5.195  1.00 24.97 ? 600 16C A C6  1 
HETATM 1967 C C7  . 16C B 2 .   ? 22.707 0.885   -5.623  1.00 26.81 ? 600 16C A C7  1 
HETATM 1968 C C8  . 16C B 2 .   ? 22.758 1.044   -7.139  1.00 27.59 ? 600 16C A C8  1 
HETATM 1969 C C9  . 16C B 2 .   ? 24.153 0.650   -7.619  1.00 29.34 ? 600 16C A C9  1 
HETATM 1970 C C10 . 16C B 2 .   ? 24.573 1.305   -8.934  1.00 30.78 ? 600 16C A C10 1 
HETATM 1971 C C11 . 16C B 2 .   ? 23.578 1.081   -10.065 1.00 31.77 ? 600 16C A C11 1 
HETATM 1972 C C12 . 16C B 2 .   ? 23.517 -0.353  -10.589 1.00 31.83 ? 600 16C A C12 1 
HETATM 1973 C C13 . 16C B 2 .   ? 22.107 -0.636  -11.103 1.00 31.62 ? 600 16C A C13 1 
HETATM 1974 C C14 . 16C B 2 .   ? 21.945 -2.037  -11.678 1.00 30.35 ? 600 16C A C14 1 
HETATM 1975 C C15 . 16C B 2 .   ? 20.506 -2.226  -12.135 1.00 31.12 ? 600 16C A C15 1 
HETATM 1976 C C16 . 16C B 2 .   ? 20.303 -3.566  -12.823 1.00 30.78 ? 600 16C A C16 1 
HETATM 1977 C C17 . 16C B 2 .   ? 18.848 -3.776  -13.216 1.00 31.70 ? 600 16C A C17 1 
HETATM 1978 C C18 . 16C B 2 .   ? 18.686 -5.082  -13.967 1.00 31.56 ? 600 16C A C18 1 
HETATM 1979 O O3  . 16C B 2 .   ? 20.895 -0.190  -0.904  1.00 16.05 ? 600 16C A O3  1 
HETATM 1980 C C20 . 16C B 2 .   ? 17.240 -1.468  -3.580  1.00 18.75 ? 600 16C A C20 1 
HETATM 1981 C C21 . 16C B 2 .   ? 17.713 -0.738  -4.835  1.00 19.57 ? 600 16C A C21 1 
HETATM 1982 C C22 . 16C B 2 .   ? 16.951 -1.254  -6.051  1.00 23.76 ? 600 16C A C22 1 
HETATM 1983 C C23 . 16C B 2 .   ? 16.988 -0.272  -7.211  1.00 24.99 ? 600 16C A C23 1 
HETATM 1984 C C24 . 16C B 2 .   ? 18.369 -0.208  -7.834  1.00 26.25 ? 600 16C A C24 1 
HETATM 1985 C C25 . 16C B 2 .   ? 18.269 0.275   -9.273  1.00 27.09 ? 600 16C A C25 1 
HETATM 1986 C C26 . 16C B 2 .   ? 19.238 1.418   -9.523  1.00 28.35 ? 600 16C A C26 1 
HETATM 1987 C C27 . 16C B 2 .   ? 19.185 1.804   -10.993 1.00 28.91 ? 600 16C A C27 1 
HETATM 1988 C C28 . 16C B 2 .   ? 19.997 3.065   -11.256 1.00 30.16 ? 600 16C A C28 1 
HETATM 1989 C C29 . 16C B 2 .   ? 20.044 3.409   -12.747 1.00 31.48 ? 600 16C A C29 1 
HETATM 1990 C C30 . 16C B 2 .   ? 20.957 2.491   -13.566 1.00 33.05 ? 600 16C A C30 1 
HETATM 1991 C C31 . 16C B 2 .   ? 22.422 2.605   -13.157 1.00 34.07 ? 600 16C A C31 1 
HETATM 1992 C C32 . 16C B 2 .   ? 23.337 1.805   -14.076 1.00 35.01 ? 600 16C A C32 1 
HETATM 1993 C C33 . 16C B 2 .   ? 24.703 2.477   -14.175 1.00 36.51 ? 600 16C A C33 1 
HETATM 1994 C C34 . 16C B 2 .   ? 25.320 2.209   -15.543 1.00 36.90 ? 600 16C A C34 1 
HETATM 1995 S S   . DMS C 3 .   ? 7.800  13.517  0.136   1.00 20.98 ? 701 DMS A S   1 
HETATM 1996 O O   . DMS C 3 .   ? 9.151  14.577  0.535   1.00 20.42 ? 701 DMS A O   1 
HETATM 1997 C C1  . DMS C 3 .   ? 6.715  13.513  1.586   1.00 20.00 ? 701 DMS A C1  1 
HETATM 1998 C C2  . DMS C 3 .   ? 6.669  14.401  -0.967  1.00 20.62 ? 701 DMS A C2  1 
HETATM 1999 S S   . DMS D 3 .   ? 7.782  8.212   7.260   1.00 21.95 ? 702 DMS A S   1 
HETATM 2000 O O   . DMS D 3 .   ? 7.738  8.082   5.495   1.00 21.63 ? 702 DMS A O   1 
HETATM 2001 C C1  . DMS D 3 .   ? 9.428  7.714   7.799   1.00 21.61 ? 702 DMS A C1  1 
HETATM 2002 C C2  . DMS D 3 .   ? 7.884  9.967   7.698   1.00 22.23 ? 702 DMS A C2  1 
HETATM 2003 O O   . HOH E 4 .   ? 30.913 1.899   -3.251  1.00 13.64 ? 703 HOH A O   1 
HETATM 2004 O O   . HOH E 4 .   ? 8.479  -0.925  14.753  1.00 15.24 ? 704 HOH A O   1 
HETATM 2005 O O   . HOH E 4 .   ? 20.263 8.608   -7.086  1.00 16.22 ? 705 HOH A O   1 
HETATM 2006 O O   . HOH E 4 .   ? 18.038 -8.218  3.026   1.00 14.65 ? 706 HOH A O   1 
HETATM 2007 O O   . HOH E 4 .   ? 37.648 -0.036  -1.267  1.00 18.57 ? 707 HOH A O   1 
HETATM 2008 O O   . HOH E 4 .   ? 13.550 -5.927  -5.301  1.00 18.17 ? 708 HOH A O   1 
HETATM 2009 O O   . HOH E 4 .   ? 22.809 -8.909  7.865   1.00 21.04 ? 709 HOH A O   1 
HETATM 2010 O O   . HOH E 4 .   ? 19.692 -10.269 -7.988  1.00 16.11 ? 710 HOH A O   1 
HETATM 2011 O O   . HOH E 4 .   ? 8.857  1.702   15.572  1.00 15.75 ? 711 HOH A O   1 
HETATM 2012 O O   . HOH E 4 .   ? 25.774 -2.469  -13.729 1.00 17.38 ? 712 HOH A O   1 
HETATM 2013 O O   . HOH E 4 .   ? 33.339 2.286   -1.906  1.00 14.17 ? 713 HOH A O   1 
HETATM 2014 O O   . HOH E 4 .   ? 17.267 8.821   -12.402 1.00 17.58 ? 714 HOH A O   1 
HETATM 2015 O O   . HOH E 4 .   ? 20.258 9.438   0.235   1.00 18.74 ? 715 HOH A O   1 
HETATM 2016 O O   . HOH E 4 .   ? 22.357 -5.078  4.723   1.00 16.95 ? 716 HOH A O   1 
HETATM 2017 O O   . HOH E 4 .   ? 34.044 4.492   -0.665  1.00 18.25 ? 717 HOH A O   1 
HETATM 2018 O O   . HOH E 4 .   ? 14.474 -3.450  -8.723  1.00 16.83 ? 718 HOH A O   1 
HETATM 2019 O O   . HOH E 4 .   ? 9.115  2.217   12.863  1.00 13.72 ? 719 HOH A O   1 
HETATM 2020 O O   . HOH E 4 .   ? 14.911 8.024   -20.091 1.00 24.23 ? 720 HOH A O   1 
HETATM 2021 O O   . HOH E 4 .   ? 7.631  -5.457  -8.232  1.00 19.64 ? 721 HOH A O   1 
HETATM 2022 O O   . HOH E 4 .   ? 22.970 6.110   4.112   1.00 24.29 ? 722 HOH A O   1 
HETATM 2023 O O   . HOH E 4 .   ? 9.489  11.924  3.958   1.00 21.48 ? 723 HOH A O   1 
HETATM 2024 O O   . HOH E 4 .   ? 17.345 11.536  -2.375  1.00 16.70 ? 724 HOH A O   1 
HETATM 2025 O O   . HOH E 4 .   ? 12.928 -5.795  -8.033  1.00 18.27 ? 725 HOH A O   1 
HETATM 2026 O O   . HOH E 4 .   ? 25.868 -1.219  -16.364 1.00 20.39 ? 726 HOH A O   1 
HETATM 2027 O O   . HOH E 4 .   ? 19.495 6.462   -8.661  1.00 19.03 ? 727 HOH A O   1 
HETATM 2028 O O   . HOH E 4 .   ? 7.339  4.054   15.067  1.00 14.42 ? 728 HOH A O   1 
HETATM 2029 O O   . HOH E 4 .   ? 33.925 7.116   11.780  1.00 22.10 ? 729 HOH A O   1 
HETATM 2030 O O   . HOH E 4 .   ? 16.580 -5.626  15.010  1.00 23.05 ? 730 HOH A O   1 
HETATM 2031 O O   . HOH E 4 .   ? 22.566 8.252   -10.411 1.00 23.28 ? 731 HOH A O   1 
HETATM 2032 O O   . HOH E 4 .   ? 21.076 6.941   -24.638 1.00 18.95 ? 732 HOH A O   1 
HETATM 2033 O O   . HOH E 4 .   ? 15.805 -4.853  -6.402  1.00 20.82 ? 733 HOH A O   1 
HETATM 2034 O O   . HOH E 4 .   ? 17.642 8.401   -9.702  1.00 18.44 ? 734 HOH A O   1 
HETATM 2035 O O   . HOH E 4 .   ? 8.570  21.191  -0.076  1.00 20.86 ? 735 HOH A O   1 
HETATM 2036 O O   . HOH E 4 .   ? -0.435 -1.959  2.210   1.00 23.73 ? 736 HOH A O   1 
HETATM 2037 O O   . HOH E 4 .   ? 2.047  -8.789  7.426   1.00 19.61 ? 737 HOH A O   1 
HETATM 2038 O O   . HOH E 4 .   ? 35.882 2.363   -10.823 1.00 23.66 ? 738 HOH A O   1 
HETATM 2039 O O   . HOH E 4 .   ? 37.001 -0.972  13.219  1.00 23.38 ? 739 HOH A O   1 
HETATM 2040 O O   . HOH E 4 .   ? 20.164 -3.262  2.623   1.00 21.72 ? 740 HOH A O   1 
HETATM 2041 O O   . HOH E 4 .   ? 6.223  5.653   16.988  1.00 29.21 ? 741 HOH A O   1 
HETATM 2042 O O   . HOH E 4 .   ? 3.350  7.692   -0.150  1.00 24.83 ? 742 HOH A O   1 
HETATM 2043 O O   . HOH E 4 .   ? 2.234  -15.224 3.929   1.00 21.75 ? 743 HOH A O   1 
HETATM 2044 O O   . HOH E 4 .   ? 26.458 -4.848  -27.527 1.00 29.15 ? 744 HOH A O   1 
HETATM 2045 O O   . HOH E 4 .   ? 35.718 -1.624  -9.320  1.00 23.30 ? 745 HOH A O   1 
HETATM 2046 O O   . HOH E 4 .   ? 35.714 1.338   -3.020  1.00 19.47 ? 746 HOH A O   1 
HETATM 2047 O O   . HOH E 4 .   ? 23.240 10.928  5.112   1.00 21.97 ? 747 HOH A O   1 
HETATM 2048 O O   . HOH E 4 .   ? 3.529  -8.782  19.530  1.00 21.81 ? 748 HOH A O   1 
HETATM 2049 O O   . HOH E 4 .   ? 34.591 -9.364  10.289  1.00 25.47 ? 749 HOH A O   1 
HETATM 2050 O O   . HOH E 4 .   ? 35.398 -5.601  12.526  1.00 23.51 ? 750 HOH A O   1 
HETATM 2051 O O   . HOH E 4 .   ? 26.509 -14.013 -4.142  1.00 24.49 ? 751 HOH A O   1 
HETATM 2052 O O   . HOH E 4 .   ? 12.682 9.436   15.612  1.00 24.21 ? 752 HOH A O   1 
HETATM 2053 O O   . HOH E 4 .   ? 34.350 7.048   -1.664  1.00 22.87 ? 753 HOH A O   1 
HETATM 2054 O O   . HOH E 4 .   ? 15.129 -6.242  -11.625 1.00 20.22 ? 754 HOH A O   1 
HETATM 2055 O O   . HOH E 4 .   ? 17.461 5.454   -24.130 1.00 22.75 ? 755 HOH A O   1 
HETATM 2056 O O   . HOH E 4 .   ? 12.259 12.778  -13.952 1.00 36.44 ? 756 HOH A O   1 
HETATM 2057 O O   . HOH E 4 .   ? 28.772 -13.161 2.915   1.00 26.44 ? 757 HOH A O   1 
HETATM 2058 O O   . HOH E 4 .   ? 20.503 -13.872 0.650   1.00 25.37 ? 758 HOH A O   1 
HETATM 2059 O O   . HOH E 4 .   ? 10.909 -0.946  18.418  1.00 24.30 ? 759 HOH A O   1 
HETATM 2060 O O   . HOH E 4 .   ? 30.301 2.547   -18.527 1.00 25.77 ? 760 HOH A O   1 
HETATM 2061 O O   . HOH E 4 .   ? 14.158 17.815  -11.802 1.00 25.54 ? 761 HOH A O   1 
HETATM 2062 O O   . HOH E 4 .   ? 20.786 10.161  -23.023 1.00 22.84 ? 762 HOH A O   1 
HETATM 2063 O O   . HOH E 4 .   ? 27.788 7.989   0.567   1.00 29.43 ? 763 HOH A O   1 
HETATM 2064 O O   . HOH E 4 .   ? 25.972 10.980  -5.485  1.00 22.09 ? 764 HOH A O   1 
HETATM 2065 O O   . HOH E 4 .   ? 25.110 -8.986  -15.798 1.00 24.19 ? 765 HOH A O   1 
HETATM 2066 O O   . HOH E 4 .   ? 22.484 -6.800  -1.916  1.00 26.41 ? 766 HOH A O   1 
HETATM 2067 O O   . HOH E 4 .   ? 28.124 -5.169  18.554  1.00 31.36 ? 767 HOH A O   1 
HETATM 2068 O O   . HOH E 4 .   ? 31.768 -11.289 9.018   1.00 33.96 ? 768 HOH A O   1 
HETATM 2069 O O   . HOH E 4 .   ? 14.815 -11.789 -5.548  1.00 23.60 ? 769 HOH A O   1 
HETATM 2070 O O   . HOH E 4 .   ? 23.154 11.401  -6.055  1.00 20.41 ? 770 HOH A O   1 
HETATM 2071 O O   . HOH E 4 .   ? 19.860 0.598   17.503  1.00 29.54 ? 771 HOH A O   1 
HETATM 2072 O O   . HOH E 4 .   ? 8.412  -0.522  -12.653 1.00 27.97 ? 772 HOH A O   1 
HETATM 2073 O O   . HOH E 4 .   ? 10.364 25.479  -5.403  1.00 26.74 ? 773 HOH A O   1 
HETATM 2074 O O   . HOH E 4 .   ? 38.032 -0.067  5.926   1.00 26.90 ? 774 HOH A O   1 
HETATM 2075 O O   . HOH E 4 .   ? 10.823 4.788   21.344  1.00 27.88 ? 775 HOH A O   1 
HETATM 2076 O O   . HOH E 4 .   ? 18.693 16.758  -3.465  1.00 27.87 ? 776 HOH A O   1 
HETATM 2077 O O   . HOH E 4 .   ? 6.364  -4.231  -10.241 1.00 36.91 ? 777 HOH A O   1 
HETATM 2078 O O   . HOH E 4 .   ? 30.226 7.586   1.539   1.00 30.27 ? 778 HOH A O   1 
HETATM 2079 O O   . HOH E 4 .   ? 11.415 3.292   -17.433 1.00 21.13 ? 779 HOH A O   1 
HETATM 2080 O O   . HOH E 4 .   ? 3.868  16.691  -0.353  1.00 35.85 ? 780 HOH A O   1 
HETATM 2081 O O   . HOH E 4 .   ? 19.346 14.578  -1.984  1.00 20.86 ? 781 HOH A O   1 
HETATM 2082 O O   . HOH E 4 .   ? 19.399 -11.591 -5.615  1.00 25.58 ? 782 HOH A O   1 
HETATM 2083 O O   . HOH E 4 .   ? 4.443  -15.550 7.288   1.00 27.90 ? 783 HOH A O   1 
HETATM 2084 O O   . HOH E 4 .   ? 1.326  -18.277 11.760  1.00 37.38 ? 784 HOH A O   1 
HETATM 2085 O O   . HOH E 4 .   ? 3.348  -3.674  -2.268  1.00 35.12 ? 785 HOH A O   1 
HETATM 2086 O O   . HOH E 4 .   ? 4.809  11.551  -0.594  1.00 24.62 ? 786 HOH A O   1 
HETATM 2087 O O   . HOH E 4 .   ? 18.341 13.115  1.789   1.00 25.47 ? 787 HOH A O   1 
HETATM 2088 O O   . HOH E 4 .   ? 5.509  7.596   4.217   1.00 23.42 ? 788 HOH A O   1 
HETATM 2089 O O   . HOH E 4 .   ? 33.480 11.978  9.273   1.00 27.11 ? 789 HOH A O   1 
HETATM 2090 O O   . HOH E 4 .   ? 31.422 -4.546  -17.673 1.00 31.80 ? 790 HOH A O   1 
HETATM 2091 O O   . HOH E 4 .   ? 25.369 12.527  4.574   1.00 27.55 ? 791 HOH A O   1 
HETATM 2092 O O   . HOH E 4 .   ? 23.661 10.350  -22.774 1.00 29.08 ? 792 HOH A O   1 
HETATM 2093 O O   . HOH E 4 .   ? 33.958 -8.694  -8.479  1.00 30.51 ? 793 HOH A O   1 
HETATM 2094 O O   . HOH E 4 .   ? 11.902 -9.351  11.827  1.00 30.54 ? 794 HOH A O   1 
HETATM 2095 O O   . HOH E 4 .   ? 4.883  6.876   -14.250 1.00 34.79 ? 795 HOH A O   1 
HETATM 2096 O O   . HOH E 4 .   ? 8.042  2.643   -13.541 1.00 26.25 ? 796 HOH A O   1 
HETATM 2097 O O   . HOH E 4 .   ? 33.399 11.763  6.245   1.00 32.80 ? 797 HOH A O   1 
HETATM 2098 O O   . HOH E 4 .   ? 14.231 15.188  7.762   1.00 26.36 ? 798 HOH A O   1 
HETATM 2099 O O   . HOH E 4 .   ? 18.018 -11.799 -9.775  1.00 26.45 ? 799 HOH A O   1 
HETATM 2100 O O   . HOH E 4 .   ? 19.559 -1.394  -21.419 1.00 32.77 ? 800 HOH A O   1 
HETATM 2101 O O   . HOH E 4 .   ? 7.805  17.640  -5.439  1.00 25.87 ? 801 HOH A O   1 
HETATM 2102 O O   . HOH E 4 .   ? 2.310  -9.892  0.082   1.00 29.00 ? 802 HOH A O   1 
HETATM 2103 O O   . HOH E 4 .   ? 13.039 8.076   -17.568 1.00 29.61 ? 803 HOH A O   1 
HETATM 2104 O O   . HOH E 4 .   ? 10.490 12.251  12.319  1.00 29.00 ? 804 HOH A O   1 
HETATM 2105 O O   . HOH E 4 .   ? 26.087 9.553   -3.165  1.00 39.93 ? 805 HOH A O   1 
HETATM 2106 O O   . HOH E 4 .   ? 13.529 13.827  11.923  1.00 30.25 ? 806 HOH A O   1 
HETATM 2107 O O   . HOH E 4 .   ? -0.524 7.436   -3.231  1.00 37.42 ? 807 HOH A O   1 
HETATM 2108 O O   . HOH E 4 .   ? 34.130 5.263   -9.544  1.00 32.71 ? 808 HOH A O   1 
HETATM 2109 O O   . HOH E 4 .   ? 37.154 3.238   -4.303  1.00 29.28 ? 809 HOH A O   1 
HETATM 2110 O O   . HOH E 4 .   ? 17.969 11.808  -19.940 1.00 29.42 ? 810 HOH A O   1 
HETATM 2111 O O   . HOH E 4 .   ? -2.777 2.118   11.672  1.00 29.85 ? 811 HOH A O   1 
HETATM 2112 O O   . HOH E 4 .   ? 2.054  0.004   -4.893  1.00 31.19 ? 812 HOH A O   1 
HETATM 2113 O O   . HOH E 4 .   ? 30.219 15.252  -11.733 1.00 32.94 ? 813 HOH A O   1 
HETATM 2114 O O   . HOH E 4 .   ? 21.375 19.296  -13.874 1.00 36.26 ? 814 HOH A O   1 
HETATM 2115 O O   . HOH E 4 .   ? 18.586 2.610   20.132  1.00 36.33 ? 815 HOH A O   1 
HETATM 2116 O O   . HOH E 4 .   ? 16.328 9.347   20.116  1.00 30.23 ? 816 HOH A O   1 
HETATM 2117 O O   . HOH E 4 .   ? 34.253 8.631   -5.984  1.00 25.05 ? 817 HOH A O   1 
HETATM 2118 O O   . HOH E 4 .   ? 33.794 13.380  12.495  1.00 33.31 ? 818 HOH A O   1 
HETATM 2119 O O   . HOH E 4 .   ? 41.303 0.296   -4.731  1.00 31.28 ? 819 HOH A O   1 
HETATM 2120 O O   . HOH E 4 .   ? 4.403  18.450  4.763   1.00 32.76 ? 820 HOH A O   1 
HETATM 2121 O O   . HOH E 4 .   ? 25.510 -14.986 -6.831  1.00 29.39 ? 821 HOH A O   1 
HETATM 2122 O O   . HOH E 4 .   ? 15.765 22.070  -5.350  1.00 34.77 ? 822 HOH A O   1 
HETATM 2123 O O   . HOH E 4 .   ? 40.381 -1.542  5.187   1.00 33.85 ? 823 HOH A O   1 
HETATM 2124 O O   . HOH E 4 .   ? 19.964 16.621  -16.147 1.00 35.36 ? 824 HOH A O   1 
HETATM 2125 O O   . HOH E 4 .   ? 0.721  -0.509  0.496   1.00 33.87 ? 825 HOH A O   1 
HETATM 2126 O O   . HOH E 4 .   ? 16.037 -17.348 2.444   1.00 40.59 ? 826 HOH A O   1 
HETATM 2127 O O   . HOH E 4 .   ? 5.100  8.871   11.023  1.00 33.31 ? 827 HOH A O   1 
HETATM 2128 O O   . HOH E 4 .   ? 6.597  20.498  -6.767  1.00 31.27 ? 828 HOH A O   1 
HETATM 2129 O O   . HOH E 4 .   ? 21.054 -4.485  -20.094 1.00 30.74 ? 829 HOH A O   1 
HETATM 2130 O O   . HOH E 4 .   ? 25.327 14.859  10.703  1.00 30.55 ? 830 HOH A O   1 
HETATM 2131 O O   . HOH E 4 .   ? 7.271  9.961   -14.928 1.00 35.61 ? 831 HOH A O   1 
HETATM 2132 O O   . HOH E 4 .   ? 37.358 -6.077  -6.166  1.00 35.64 ? 832 HOH A O   1 
HETATM 2133 O O   . HOH E 4 .   ? 7.657  -10.041 -3.180  1.00 28.77 ? 833 HOH A O   1 
HETATM 2134 O O   . HOH E 4 .   ? 17.034 13.408  -0.622  1.00 22.64 ? 834 HOH A O   1 
HETATM 2135 O O   . HOH E 4 .   ? 14.925 6.865   -24.450 1.00 30.21 ? 835 HOH A O   1 
HETATM 2136 O O   . HOH E 4 .   ? 11.467 5.764   -18.771 1.00 30.15 ? 836 HOH A O   1 
HETATM 2137 O O   . HOH E 4 .   ? 40.297 0.701   -0.820  1.00 35.62 ? 837 HOH A O   1 
HETATM 2138 O O   . HOH E 4 .   ? 1.476  -10.050 18.177  1.00 25.28 ? 838 HOH A O   1 
HETATM 2139 O O   . HOH E 4 .   ? 33.600 7.913   -8.529  1.00 32.37 ? 839 HOH A O   1 
HETATM 2140 O O   . HOH E 4 .   ? 27.016 -3.387  -21.430 1.00 32.42 ? 840 HOH A O   1 
HETATM 2141 O O   . HOH E 4 .   ? 12.581 25.617  -4.033  1.00 36.41 ? 841 HOH A O   1 
HETATM 2142 O O   . HOH E 4 .   ? 20.932 11.948  1.405   1.00 27.29 ? 842 HOH A O   1 
HETATM 2143 O O   . HOH E 4 .   ? 8.146  -10.609 12.620  1.00 28.63 ? 843 HOH A O   1 
HETATM 2144 O O   . HOH E 4 .   ? 13.814 15.205  1.811   1.00 27.21 ? 844 HOH A O   1 
HETATM 2145 O O   . HOH E 4 .   ? 34.752 6.492   15.143  1.00 35.62 ? 845 HOH A O   1 
HETATM 2146 O O   . HOH E 4 .   ? 15.439 10.759  -20.028 1.00 28.79 ? 846 HOH A O   1 
HETATM 2147 O O   . HOH E 4 .   ? 36.981 5.363   -2.698  1.00 26.43 ? 847 HOH A O   1 
HETATM 2148 O O   . HOH E 4 .   ? -2.816 4.355   -7.752  1.00 37.69 ? 848 HOH A O   1 
HETATM 2149 O O   . HOH E 4 .   ? 28.359 12.210  -5.974  1.00 29.10 ? 849 HOH A O   1 
HETATM 2150 O O   . HOH E 4 .   ? 16.435 -8.261  -12.965 1.00 29.17 ? 850 HOH A O   1 
HETATM 2151 O O   . HOH E 4 .   ? -0.304 0.623   -1.910  1.00 29.59 ? 851 HOH A O   1 
HETATM 2152 O O   . HOH E 4 .   ? 25.687 9.840   -17.035 1.00 34.34 ? 852 HOH A O   1 
HETATM 2153 O O   . HOH E 4 .   ? 8.667  -7.710  -9.377  1.00 27.59 ? 853 HOH A O   1 
HETATM 2154 O O   . HOH E 4 .   ? 5.748  -6.818  -6.571  1.00 26.90 ? 854 HOH A O   1 
HETATM 2155 O O   . HOH E 4 .   ? 35.833 -3.059  14.205  1.00 38.92 ? 855 HOH A O   1 
HETATM 2156 O O   . HOH E 4 .   ? 28.582 -15.055 -2.878  1.00 28.80 ? 856 HOH A O   1 
HETATM 2157 O O   . HOH E 4 .   ? 36.505 4.381   -8.904  1.00 26.98 ? 857 HOH A O   1 
HETATM 2158 O O   . HOH E 4 .   ? 6.157  8.094   21.197  1.00 29.44 ? 858 HOH A O   1 
HETATM 2159 O O   . HOH E 4 .   ? 36.713 5.011   -6.278  1.00 28.60 ? 859 HOH A O   1 
HETATM 2160 O O   . HOH E 4 .   ? 12.868 -2.275  19.859  1.00 32.34 ? 860 HOH A O   1 
HETATM 2161 O O   . HOH E 4 .   ? 9.070  2.629   -16.236 1.00 35.19 ? 861 HOH A O   1 
HETATM 2162 O O   . HOH E 4 .   ? 21.005 6.375   -10.886 1.00 35.91 ? 862 HOH A O   1 
HETATM 2163 O O   . HOH E 4 .   ? 17.459 20.181  -10.129 1.00 45.04 ? 863 HOH A O   1 
HETATM 2164 O O   . HOH E 4 .   ? 16.155 3.658   -22.387 1.00 33.06 ? 864 HOH A O   1 
HETATM 2165 O O   . HOH E 4 .   ? 21.255 12.596  4.003   1.00 36.70 ? 865 HOH A O   1 
HETATM 2166 O O   . HOH E 4 .   ? 16.681 11.637  18.084  1.00 37.96 ? 866 HOH A O   1 
HETATM 2167 O O   . HOH E 4 .   ? 32.041 -3.665  17.438  1.00 36.54 ? 867 HOH A O   1 
HETATM 2168 O O   . HOH E 4 .   ? 29.727 10.211  -4.694  1.00 39.46 ? 868 HOH A O   1 
HETATM 2169 O O   . HOH E 4 .   ? 5.877  -11.544 -1.864  1.00 35.70 ? 869 HOH A O   1 
HETATM 2170 O O   . HOH E 4 .   ? 20.862 -17.054 -1.819  1.00 33.77 ? 870 HOH A O   1 
HETATM 2171 O O   . HOH E 4 .   ? -2.391 -10.192 13.528  1.00 39.40 ? 871 HOH A O   1 
HETATM 2172 O O   . HOH E 4 .   ? 2.818  6.266   -12.223 1.00 30.78 ? 872 HOH A O   1 
HETATM 2173 O O   . HOH E 4 .   ? 15.148 -8.299  15.898  1.00 32.70 ? 873 HOH A O   1 
HETATM 2174 O O   . HOH E 4 .   ? 35.875 -10.262 1.316   1.00 39.15 ? 874 HOH A O   1 
HETATM 2175 O O   . HOH E 4 .   ? 32.664 -7.673  15.279  1.00 41.27 ? 875 HOH A O   1 
HETATM 2176 O O   . HOH E 4 .   ? 6.256  -9.278  -5.606  1.00 30.29 ? 876 HOH A O   1 
HETATM 2177 O O   . HOH E 4 .   ? 23.060 -12.845 -5.628  1.00 41.14 ? 877 HOH A O   1 
HETATM 2178 O O   . HOH E 4 .   ? 23.193 13.819  -4.792  1.00 37.17 ? 878 HOH A O   1 
HETATM 2179 O O   . HOH E 4 .   ? 10.716 21.073  3.000   1.00 33.12 ? 879 HOH A O   1 
HETATM 2180 O O   . HOH E 4 .   ? 13.588 11.556  -18.012 1.00 33.90 ? 880 HOH A O   1 
HETATM 2181 O O   . HOH E 4 .   ? 8.671  6.497   -18.960 1.00 37.55 ? 881 HOH A O   1 
HETATM 2182 O O   . HOH E 4 .   ? 40.820 1.089   2.082   1.00 38.70 ? 882 HOH A O   1 
HETATM 2183 O O   . HOH E 4 .   ? 7.404  -12.667 14.426  1.00 35.23 ? 883 HOH A O   1 
HETATM 2184 O O   . HOH E 4 .   ? 8.012  -9.648  -7.696  1.00 30.90 ? 884 HOH A O   1 
HETATM 2185 O O   . HOH E 4 .   ? 39.136 -4.771  10.424  1.00 38.20 ? 885 HOH A O   1 
HETATM 2186 O O   . HOH E 4 .   ? 40.033 3.022   -4.109  1.00 36.38 ? 886 HOH A O   1 
HETATM 2187 O O   . HOH E 4 .   ? 15.517 15.682  -0.035  1.00 34.71 ? 887 HOH A O   1 
HETATM 2188 O O   . HOH E 4 .   ? 12.685 14.884  -12.114 1.00 33.96 ? 888 HOH A O   1 
HETATM 2189 O O   . HOH E 4 .   ? 16.619 11.859  15.098  1.00 35.25 ? 889 HOH A O   1 
HETATM 2190 O O   . HOH E 4 .   ? 7.811  19.839  -10.663 1.00 37.71 ? 890 HOH A O   1 
HETATM 2191 O O   . HOH E 4 .   ? 13.530 10.723  17.726  1.00 39.48 ? 891 HOH A O   1 
HETATM 2192 O O   . HOH E 4 .   ? 21.278 -14.558 -6.626  1.00 40.70 ? 892 HOH A O   1 
HETATM 2193 O O   . HOH E 4 .   ? 27.229 -10.120 10.647  1.00 31.61 ? 893 HOH A O   1 
HETATM 2194 O O   . HOH E 4 .   ? 8.083  -7.651  -12.137 1.00 36.04 ? 894 HOH A O   1 
HETATM 2195 O O   . HOH E 4 .   ? -1.406 -11.517 9.568   1.00 36.79 ? 895 HOH A O   1 
HETATM 2196 O O   . HOH E 4 .   ? 3.481  -1.435  -3.256  1.00 32.83 ? 896 HOH A O   1 
HETATM 2197 O O   . HOH E 4 .   ? 37.655 0.324   -11.177 1.00 36.89 ? 897 HOH A O   1 
HETATM 2198 O O   . HOH E 4 .   ? 27.473 5.013   15.309  1.00 36.51 ? 898 HOH A O   1 
HETATM 2199 O O   . HOH E 4 .   ? 33.345 -11.475 7.150   1.00 42.89 ? 899 HOH A O   1 
HETATM 2200 O O   . HOH E 4 .   ? 19.358 12.721  -21.894 1.00 32.48 ? 900 HOH A O   1 
HETATM 2201 O O   . HOH E 4 .   ? 2.842  -3.321  -0.071  1.00 38.78 ? 901 HOH A O   1 
HETATM 2202 O O   . HOH E 4 .   ? 14.955 18.818  10.313  1.00 40.40 ? 902 HOH A O   1 
HETATM 2203 O O   . HOH E 4 .   ? 34.396 -4.550  15.187  1.00 40.06 ? 903 HOH A O   1 
HETATM 2204 O O   . HOH E 4 .   ? 7.104  5.647   19.458  1.00 40.17 ? 904 HOH A O   1 
HETATM 2205 O O   . HOH E 4 .   ? 29.908 12.144  7.442   1.00 26.85 ? 905 HOH A O   1 
HETATM 2206 O O   . HOH E 4 .   ? 37.074 1.813   -19.598 1.00 46.74 ? 906 HOH A O   1 
HETATM 2207 O O   . HOH E 4 .   ? 19.155 -4.368  15.456  1.00 34.81 ? 907 HOH A O   1 
HETATM 2208 O O   . HOH E 4 .   ? 20.539 -6.266  14.071  1.00 36.85 ? 908 HOH A O   1 
HETATM 2209 O O   . HOH E 4 .   ? 19.633 6.033   18.431  1.00 39.46 ? 909 HOH A O   1 
HETATM 2210 O O   . HOH E 4 .   ? 33.497 1.374   19.404  1.00 36.99 ? 910 HOH A O   1 
HETATM 2211 O O   . HOH E 4 .   ? 28.243 2.627   18.984  1.00 43.42 ? 911 HOH A O   1 
HETATM 2212 O O   . HOH E 4 .   ? 21.891 17.622  11.251  1.00 42.20 ? 912 HOH A O   1 
HETATM 2213 O O   . HOH E 4 .   ? 9.246  -1.680  17.062  1.00 31.32 ? 913 HOH A O   1 
HETATM 2214 O O   . HOH E 4 .   ? 14.743 -11.093 8.838   1.00 47.80 ? 914 HOH A O   1 
HETATM 2215 O O   . HOH E 4 .   ? 11.341 -7.882  -9.302  1.00 35.50 ? 915 HOH A O   1 
HETATM 2216 O O   . HOH E 4 .   ? 24.285 -14.081 -3.553  1.00 47.74 ? 916 HOH A O   1 
HETATM 2217 O O   . HOH E 4 .   ? 27.369 0.890   14.319  1.00 37.18 ? 917 HOH A O   1 
HETATM 2218 O O   . HOH E 4 .   ? 13.407 15.796  18.565  1.00 41.05 ? 918 HOH A O   1 
HETATM 2219 O O   . HOH E 4 .   ? 4.885  6.230   18.623  1.00 45.60 ? 919 HOH A O   1 
HETATM 2220 O O   . HOH E 4 .   ? 36.442 -7.639  -4.050  1.00 48.10 ? 920 HOH A O   1 
HETATM 2221 O O   . HOH E 4 .   ? 35.696 -1.088  -16.124 1.00 45.27 ? 921 HOH A O   1 
HETATM 2222 O O   . HOH E 4 .   ? 36.351 3.488   -13.223 1.00 33.61 ? 922 HOH A O   1 
HETATM 2223 O O   . HOH E 4 .   ? 2.444  -13.353 -0.913  1.00 41.59 ? 923 HOH A O   1 
HETATM 2224 O O   . HOH E 4 .   ? 7.798  -10.352 18.822  1.00 40.79 ? 924 HOH A O   1 
HETATM 2225 O O   . HOH E 4 .   ? 40.897 -3.580  6.743   1.00 42.92 ? 925 HOH A O   1 
HETATM 2226 O O   . HOH E 4 .   ? 28.387 -2.744  -23.758 1.00 41.69 ? 926 HOH A O   1 
HETATM 2227 O O   . HOH E 4 .   ? 38.359 5.964   12.877  1.00 40.16 ? 927 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   344 ?   ?   ?   A . n 
A 1 2   ASN 2   345 ?   ?   ?   A . n 
A 1 3   SER 3   346 ?   ?   ?   A . n 
A 1 4   LEU 4   347 ?   ?   ?   A . n 
A 1 5   HIS 5   348 ?   ?   ?   A . n 
A 1 6   TRP 6   349 ?   ?   ?   A . n 
A 1 7   PRO 7   350 ?   ?   ?   A . n 
A 1 8   THR 8   351 ?   ?   ?   A . n 
A 1 9   SER 9   352 ?   ?   ?   A . n 
A 1 10  LEU 10  353 ?   ?   ?   A . n 
A 1 11  PRO 11  354 ?   ?   ?   A . n 
A 1 12  SER 12  355 ?   ?   ?   A . n 
A 1 13  GLY 13  356 ?   ?   ?   A . n 
A 1 14  ASP 14  357 ?   ?   ?   A . n 
A 1 15  ALA 15  358 ?   ?   ?   A . n 
A 1 16  PHE 16  359 ?   ?   ?   A . n 
A 1 17  SER 17  360 ?   ?   ?   A . n 
A 1 18  SER 18  361 ?   ?   ?   A . n 
A 1 19  VAL 19  362 ?   ?   ?   A . n 
A 1 20  GLY 20  363 ?   ?   ?   A . n 
A 1 21  THR 21  364 ?   ?   ?   A . n 
A 1 22  HIS 22  365 365 HIS HIS A . n 
A 1 23  ARG 23  366 366 ARG ARG A . n 
A 1 24  PHE 24  367 367 PHE PHE A . n 
A 1 25  VAL 25  368 368 VAL VAL A . n 
A 1 26  GLN 26  369 369 GLN GLN A . n 
A 1 27  LYS 27  370 370 LYS LYS A . n 
A 1 28  VAL 28  371 371 VAL VAL A . n 
A 1 29  GLU 29  372 372 GLU GLU A . n 
A 1 30  GLU 30  373 373 GLU GLU A . n 
A 1 31  MET 31  374 374 MET MET A . n 
A 1 32  VAL 32  375 375 VAL VAL A . n 
A 1 33  GLN 33  376 376 GLN GLN A . n 
A 1 34  ASN 34  377 377 ASN ASN A . n 
A 1 35  HIS 35  378 378 HIS HIS A . n 
A 1 36  MET 36  379 379 MET MET A . n 
A 1 37  THR 37  380 380 THR THR A . n 
A 1 38  TYR 38  381 381 TYR TYR A . n 
A 1 39  SER 39  382 382 SER SER A . n 
A 1 40  LEU 40  383 383 LEU LEU A . n 
A 1 41  GLN 41  384 384 GLN GLN A . n 
A 1 42  ASP 42  385 385 ASP ASP A . n 
A 1 43  VAL 43  386 386 VAL VAL A . n 
A 1 44  GLY 44  387 387 GLY GLY A . n 
A 1 45  GLY 45  388 388 GLY GLY A . n 
A 1 46  ASP 46  389 389 ASP ASP A . n 
A 1 47  ALA 47  390 390 ALA ALA A . n 
A 1 48  ASN 48  391 391 ASN ASN A . n 
A 1 49  TRP 49  392 392 TRP TRP A . n 
A 1 50  GLN 50  393 393 GLN GLN A . n 
A 1 51  LEU 51  394 394 LEU LEU A . n 
A 1 52  VAL 52  395 395 VAL VAL A . n 
A 1 53  VAL 53  396 396 VAL VAL A . n 
A 1 54  GLU 54  397 397 GLU GLU A . n 
A 1 55  GLU 55  398 398 GLU GLU A . n 
A 1 56  GLY 56  399 399 GLY GLY A . n 
A 1 57  GLU 57  400 400 GLU GLU A . n 
A 1 58  MET 58  401 401 MET MET A . n 
A 1 59  LYS 59  402 402 LYS LYS A . n 
A 1 60  VAL 60  403 403 VAL VAL A . n 
A 1 61  TYR 61  404 404 TYR TYR A . n 
A 1 62  ARG 62  405 405 ARG ARG A . n 
A 1 63  ARG 63  406 406 ARG ARG A . n 
A 1 64  GLU 64  407 407 GLU GLU A . n 
A 1 65  VAL 65  408 408 VAL VAL A . n 
A 1 66  GLU 66  409 409 GLU GLU A . n 
A 1 67  GLU 67  410 410 GLU GLU A . n 
A 1 68  ASN 68  411 411 ASN ASN A . n 
A 1 69  GLY 69  412 412 GLY GLY A . n 
A 1 70  ILE 70  413 413 ILE ILE A . n 
A 1 71  VAL 71  414 414 VAL VAL A . n 
A 1 72  LEU 72  415 415 LEU LEU A . n 
A 1 73  ASP 73  416 416 ASP ASP A . n 
A 1 74  PRO 74  417 417 PRO PRO A . n 
A 1 75  LEU 75  418 418 LEU LEU A . n 
A 1 76  LYS 76  419 419 LYS LYS A . n 
A 1 77  ALA 77  420 420 ALA ALA A . n 
A 1 78  THR 78  421 421 THR THR A . n 
A 1 79  HIS 79  422 422 HIS HIS A . n 
A 1 80  ALA 80  423 423 ALA ALA A . n 
A 1 81  VAL 81  424 424 VAL VAL A . n 
A 1 82  LYS 82  425 425 LYS LYS A . n 
A 1 83  GLY 83  426 426 GLY GLY A . n 
A 1 84  VAL 84  427 427 VAL VAL A . n 
A 1 85  THR 85  428 428 THR THR A . n 
A 1 86  GLY 86  429 429 GLY GLY A . n 
A 1 87  HIS 87  430 430 HIS HIS A . n 
A 1 88  GLU 88  431 431 GLU GLU A . n 
A 1 89  VAL 89  432 432 VAL VAL A . n 
A 1 90  CYS 90  433 433 CYS CYS A . n 
A 1 91  ASN 91  434 434 ASN ASN A . n 
A 1 92  TYR 92  435 435 TYR TYR A . n 
A 1 93  PHE 93  436 436 PHE PHE A . n 
A 1 94  TRP 94  437 437 TRP TRP A . n 
A 1 95  ASN 95  438 438 ASN ASN A . n 
A 1 96  VAL 96  439 439 VAL VAL A . n 
A 1 97  ASP 97  440 440 ASP ASP A . n 
A 1 98  VAL 98  441 441 VAL VAL A . n 
A 1 99  ARG 99  442 442 ARG ARG A . n 
A 1 100 ASN 100 443 443 ASN ASN A . n 
A 1 101 ASP 101 444 444 ASP ASP A . n 
A 1 102 TRP 102 445 445 TRP TRP A . n 
A 1 103 GLU 103 446 446 GLU GLU A . n 
A 1 104 THR 104 447 447 THR THR A . n 
A 1 105 THR 105 448 448 THR THR A . n 
A 1 106 ILE 106 449 449 ILE ILE A . n 
A 1 107 GLU 107 450 450 GLU GLU A . n 
A 1 108 ASN 108 451 451 ASN ASN A . n 
A 1 109 PHE 109 452 452 PHE PHE A . n 
A 1 110 HIS 110 453 453 HIS HIS A . n 
A 1 111 VAL 111 454 454 VAL VAL A . n 
A 1 112 VAL 112 455 455 VAL VAL A . n 
A 1 113 GLU 113 456 456 GLU GLU A . n 
A 1 114 THR 114 457 457 THR THR A . n 
A 1 115 LEU 115 458 458 LEU LEU A . n 
A 1 116 ALA 116 459 459 ALA ALA A . n 
A 1 117 ASP 117 460 460 ASP ASP A . n 
A 1 118 ASN 118 461 461 ASN ASN A . n 
A 1 119 ALA 119 462 462 ALA ALA A . n 
A 1 120 ILE 120 463 463 ILE ILE A . n 
A 1 121 ILE 121 464 464 ILE ILE A . n 
A 1 122 ILE 122 465 465 ILE ILE A . n 
A 1 123 TYR 123 466 466 TYR TYR A . n 
A 1 124 GLN 124 467 467 GLN GLN A . n 
A 1 125 THR 125 468 468 THR THR A . n 
A 1 126 HIS 126 469 469 HIS HIS A . n 
A 1 127 LYS 127 470 470 LYS LYS A . n 
A 1 128 ARG 128 471 471 ARG ARG A . n 
A 1 129 VAL 129 472 472 VAL VAL A . n 
A 1 130 TRP 130 473 473 TRP TRP A . n 
A 1 131 PRO 131 474 474 PRO PRO A . n 
A 1 132 ALA 132 475 475 ALA ALA A . n 
A 1 133 SER 133 476 476 SER SER A . n 
A 1 134 GLN 134 477 477 GLN GLN A . n 
A 1 135 ARG 135 478 478 ARG ARG A . n 
A 1 136 ASP 136 479 479 ASP ASP A . n 
A 1 137 VAL 137 480 480 VAL VAL A . n 
A 1 138 LEU 138 481 481 LEU LEU A . n 
A 1 139 TYR 139 482 482 TYR TYR A . n 
A 1 140 LEU 140 483 483 LEU LEU A . n 
A 1 141 SER 141 484 484 SER SER A . n 
A 1 142 VAL 142 485 485 VAL VAL A . n 
A 1 143 ILE 143 486 486 ILE ILE A . n 
A 1 144 ARG 144 487 487 ARG ARG A . n 
A 1 145 LYS 145 488 488 LYS LYS A . n 
A 1 146 ILE 146 489 489 ILE ILE A . n 
A 1 147 PRO 147 490 490 PRO PRO A . n 
A 1 148 ALA 148 491 491 ALA ALA A . n 
A 1 149 LEU 149 492 492 LEU LEU A . n 
A 1 150 THR 150 493 493 THR THR A . n 
A 1 151 GLU 151 494 494 GLU GLU A . n 
A 1 152 ASN 152 495 495 ASN ASN A . n 
A 1 153 ASP 153 496 496 ASP ASP A . n 
A 1 154 PRO 154 497 497 PRO PRO A . n 
A 1 155 GLU 155 498 498 GLU GLU A . n 
A 1 156 THR 156 499 499 THR THR A . n 
A 1 157 TRP 157 500 500 TRP TRP A . n 
A 1 158 ILE 158 501 501 ILE ILE A . n 
A 1 159 VAL 159 502 502 VAL VAL A . n 
A 1 160 CYS 160 503 503 CYS CYS A . n 
A 1 161 ASN 161 504 504 ASN ASN A . n 
A 1 162 PHE 162 505 505 PHE PHE A . n 
A 1 163 SER 163 506 506 SER SER A . n 
A 1 164 VAL 164 507 507 VAL VAL A . n 
A 1 165 ASP 165 508 508 ASP ASP A . n 
A 1 166 HIS 166 509 509 HIS HIS A . n 
A 1 167 ASP 167 510 510 ASP ASP A . n 
A 1 168 SER 168 511 511 SER SER A . n 
A 1 169 ALA 169 512 512 ALA ALA A . n 
A 1 170 PRO 170 513 513 PRO PRO A . n 
A 1 171 LEU 171 514 514 LEU LEU A . n 
A 1 172 ASN 172 515 515 ASN ASN A . n 
A 1 173 ASN 173 516 516 ASN ASN A . n 
A 1 174 ARG 174 517 517 ARG ARG A . n 
A 1 175 CYS 175 518 518 CYS CYS A . n 
A 1 176 VAL 176 519 519 VAL VAL A . n 
A 1 177 ARG 177 520 520 ARG ARG A . n 
A 1 178 ALA 178 521 521 ALA ALA A . n 
A 1 179 LYS 179 522 522 LYS LYS A . n 
A 1 180 ILE 180 523 523 ILE ILE A . n 
A 1 181 ASN 181 524 524 ASN ASN A . n 
A 1 182 VAL 182 525 525 VAL VAL A . n 
A 1 183 ALA 183 526 526 ALA ALA A . n 
A 1 184 MET 184 527 527 MET MET A . n 
A 1 185 ILE 185 528 528 ILE ILE A . n 
A 1 186 CYS 186 529 529 CYS CYS A . n 
A 1 187 GLN 187 530 530 GLN GLN A . n 
A 1 188 THR 188 531 531 THR THR A . n 
A 1 189 LEU 189 532 532 LEU LEU A . n 
A 1 190 VAL 190 533 533 VAL VAL A . n 
A 1 191 SER 191 534 534 SER SER A . n 
A 1 192 PRO 192 535 535 PRO PRO A . n 
A 1 193 PRO 193 536 536 PRO PRO A . n 
A 1 194 GLU 194 537 ?   ?   ?   A . n 
A 1 195 GLY 195 538 ?   ?   ?   A . n 
A 1 196 ASN 196 539 ?   ?   ?   A . n 
A 1 197 GLN 197 540 540 GLN GLN A . n 
A 1 198 GLU 198 541 541 GLU GLU A . n 
A 1 199 ILE 199 542 542 ILE ILE A . n 
A 1 200 SER 200 543 543 SER SER A . n 
A 1 201 ARG 201 544 544 ARG ARG A . n 
A 1 202 ASP 202 545 545 ASP ASP A . n 
A 1 203 ASN 203 546 546 ASN ASN A . n 
A 1 204 ILE 204 547 547 ILE ILE A . n 
A 1 205 LEU 205 548 548 LEU LEU A . n 
A 1 206 CYS 206 549 549 CYS CYS A . n 
A 1 207 LYS 207 550 550 LYS LYS A . n 
A 1 208 ILE 208 551 551 ILE ILE A . n 
A 1 209 THR 209 552 552 THR THR A . n 
A 1 210 TYR 210 553 553 TYR TYR A . n 
A 1 211 VAL 211 554 554 VAL VAL A . n 
A 1 212 ALA 212 555 555 ALA ALA A . n 
A 1 213 ASN 213 556 556 ASN ASN A . n 
A 1 214 VAL 214 557 557 VAL VAL A . n 
A 1 215 ASN 215 558 558 ASN ASN A . n 
A 1 216 PRO 216 559 559 PRO PRO A . n 
A 1 217 GLY 217 560 560 GLY GLY A . n 
A 1 218 GLY 218 561 561 GLY GLY A . n 
A 1 219 TRP 219 562 562 TRP TRP A . n 
A 1 220 ALA 220 563 563 ALA ALA A . n 
A 1 221 PRO 221 564 564 PRO PRO A . n 
A 1 222 ALA 222 565 565 ALA ALA A . n 
A 1 223 SER 223 566 566 SER SER A . n 
A 1 224 VAL 224 567 567 VAL VAL A . n 
A 1 225 LEU 225 568 568 LEU LEU A . n 
A 1 226 ARG 226 569 569 ARG ARG A . n 
A 1 227 ALA 227 570 570 ALA ALA A . n 
A 1 228 VAL 228 571 571 VAL VAL A . n 
A 1 229 ALA 229 572 572 ALA ALA A . n 
A 1 230 LYS 230 573 573 LYS LYS A . n 
A 1 231 ARG 231 574 574 ARG ARG A . n 
A 1 232 GLU 232 575 575 GLU GLU A . n 
A 1 233 TYR 233 576 576 TYR TYR A . n 
A 1 234 PRO 234 577 577 PRO PRO A . n 
A 1 235 LYS 235 578 578 LYS LYS A . n 
A 1 236 PHE 236 579 579 PHE PHE A . n 
A 1 237 LEU 237 580 580 LEU LEU A . n 
A 1 238 LYS 238 581 581 LYS LYS A . n 
A 1 239 ARG 239 582 582 ARG ARG A . n 
A 1 240 PHE 240 583 583 PHE PHE A . n 
A 1 241 THR 241 584 584 THR THR A . n 
A 1 242 SER 242 585 585 SER SER A . n 
A 1 243 TYR 243 586 586 TYR TYR A . n 
A 1 244 VAL 244 587 587 VAL VAL A . n 
A 1 245 GLN 245 588 588 GLN GLN A . n 
A 1 246 GLU 246 589 589 GLU GLU A . n 
A 1 247 LYS 247 590 590 LYS LYS A . n 
A 1 248 THR 248 591 591 THR THR A . n 
A 1 249 ALA 249 592 592 ALA ALA A . n 
A 1 250 GLY 250 593 593 GLY GLY A . n 
A 1 251 LYS 251 594 594 LYS LYS A . n 
A 1 252 PRO 252 595 595 PRO PRO A . n 
A 1 253 ILE 253 596 596 ILE ILE A . n 
A 1 254 LEU 254 597 597 LEU LEU A . n 
A 1 255 PHE 255 598 598 PHE PHE A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-12-18 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOLREP    phasing           .        ? 1 
REFMAC    refinement        5.2.0005 ? 2 
HKL-2000  'data collection' .        ? 3 
HKL-2000  'data reduction'  .        ? 4 
SCALEPACK 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 SG A CYS 503 ? B O A HOH 722 ? ? 1.62 
2 1 C  A PHE 598 ? ? O A HOH 913 ? ? 1.82 
3 1 O  A HOH 741 ? ? O A HOH 919 ? ? 2.19 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASP 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     416 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -10.84 
_pdbx_validate_torsion.psi             96.10 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 344 ? A SER 1   
2  1 Y 1 A ASN 345 ? A ASN 2   
3  1 Y 1 A SER 346 ? A SER 3   
4  1 Y 1 A LEU 347 ? A LEU 4   
5  1 Y 1 A HIS 348 ? A HIS 5   
6  1 Y 1 A TRP 349 ? A TRP 6   
7  1 Y 1 A PRO 350 ? A PRO 7   
8  1 Y 1 A THR 351 ? A THR 8   
9  1 Y 1 A SER 352 ? A SER 9   
10 1 Y 1 A LEU 353 ? A LEU 10  
11 1 Y 1 A PRO 354 ? A PRO 11  
12 1 Y 1 A SER 355 ? A SER 12  
13 1 Y 1 A GLY 356 ? A GLY 13  
14 1 Y 1 A ASP 357 ? A ASP 14  
15 1 Y 1 A ALA 358 ? A ALA 15  
16 1 Y 1 A PHE 359 ? A PHE 16  
17 1 Y 1 A SER 360 ? A SER 17  
18 1 Y 1 A SER 361 ? A SER 18  
19 1 Y 1 A VAL 362 ? A VAL 19  
20 1 Y 1 A GLY 363 ? A GLY 20  
21 1 Y 1 A THR 364 ? A THR 21  
22 1 Y 1 A GLU 537 ? A GLU 194 
23 1 Y 1 A GLY 538 ? A GLY 195 
24 1 Y 1 A ASN 539 ? A ASN 196 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'N-((E,2S,3R)-1,3-DIHYDROXYOCTADEC-4-EN-2-YL)PALMITAMIDE' 16C 
3 'DIMETHYL SULFOXIDE'                                      DMS 
4 water                                                     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 16C 1   600 600 16C 16C A . 
C 3 DMS 1   701 701 DMS DMS A . 
D 3 DMS 1   702 702 DMS DMS A . 
E 4 HOH 1   703 1   HOH HOH A . 
E 4 HOH 2   704 2   HOH HOH A . 
E 4 HOH 3   705 3   HOH HOH A . 
E 4 HOH 4   706 4   HOH HOH A . 
E 4 HOH 5   707 5   HOH HOH A . 
E 4 HOH 6   708 6   HOH HOH A . 
E 4 HOH 7   709 7   HOH HOH A . 
E 4 HOH 8   710 8   HOH HOH A . 
E 4 HOH 9   711 9   HOH HOH A . 
E 4 HOH 10  712 10  HOH HOH A . 
E 4 HOH 11  713 11  HOH HOH A . 
E 4 HOH 12  714 12  HOH HOH A . 
E 4 HOH 13  715 13  HOH HOH A . 
E 4 HOH 14  716 14  HOH HOH A . 
E 4 HOH 15  717 15  HOH HOH A . 
E 4 HOH 16  718 16  HOH HOH A . 
E 4 HOH 17  719 17  HOH HOH A . 
E 4 HOH 18  720 18  HOH HOH A . 
E 4 HOH 19  721 19  HOH HOH A . 
E 4 HOH 20  722 20  HOH HOH A . 
E 4 HOH 21  723 21  HOH HOH A . 
E 4 HOH 22  724 22  HOH HOH A . 
E 4 HOH 23  725 23  HOH HOH A . 
E 4 HOH 24  726 24  HOH HOH A . 
E 4 HOH 25  727 25  HOH HOH A . 
E 4 HOH 26  728 26  HOH HOH A . 
E 4 HOH 27  729 27  HOH HOH A . 
E 4 HOH 28  730 28  HOH HOH A . 
E 4 HOH 29  731 29  HOH HOH A . 
E 4 HOH 30  732 30  HOH HOH A . 
E 4 HOH 31  733 31  HOH HOH A . 
E 4 HOH 32  734 32  HOH HOH A . 
E 4 HOH 33  735 33  HOH HOH A . 
E 4 HOH 34  736 34  HOH HOH A . 
E 4 HOH 35  737 35  HOH HOH A . 
E 4 HOH 36  738 36  HOH HOH A . 
E 4 HOH 37  739 37  HOH HOH A . 
E 4 HOH 38  740 38  HOH HOH A . 
E 4 HOH 39  741 39  HOH HOH A . 
E 4 HOH 40  742 40  HOH HOH A . 
E 4 HOH 41  743 41  HOH HOH A . 
E 4 HOH 42  744 42  HOH HOH A . 
E 4 HOH 43  745 43  HOH HOH A . 
E 4 HOH 44  746 44  HOH HOH A . 
E 4 HOH 45  747 45  HOH HOH A . 
E 4 HOH 46  748 46  HOH HOH A . 
E 4 HOH 47  749 47  HOH HOH A . 
E 4 HOH 48  750 48  HOH HOH A . 
E 4 HOH 49  751 49  HOH HOH A . 
E 4 HOH 50  752 50  HOH HOH A . 
E 4 HOH 51  753 51  HOH HOH A . 
E 4 HOH 52  754 52  HOH HOH A . 
E 4 HOH 53  755 53  HOH HOH A . 
E 4 HOH 54  756 54  HOH HOH A . 
E 4 HOH 55  757 55  HOH HOH A . 
E 4 HOH 56  758 56  HOH HOH A . 
E 4 HOH 57  759 57  HOH HOH A . 
E 4 HOH 58  760 58  HOH HOH A . 
E 4 HOH 59  761 59  HOH HOH A . 
E 4 HOH 60  762 60  HOH HOH A . 
E 4 HOH 61  763 61  HOH HOH A . 
E 4 HOH 62  764 62  HOH HOH A . 
E 4 HOH 63  765 63  HOH HOH A . 
E 4 HOH 64  766 64  HOH HOH A . 
E 4 HOH 65  767 65  HOH HOH A . 
E 4 HOH 66  768 66  HOH HOH A . 
E 4 HOH 67  769 67  HOH HOH A . 
E 4 HOH 68  770 68  HOH HOH A . 
E 4 HOH 69  771 69  HOH HOH A . 
E 4 HOH 70  772 70  HOH HOH A . 
E 4 HOH 71  773 71  HOH HOH A . 
E 4 HOH 72  774 72  HOH HOH A . 
E 4 HOH 73  775 73  HOH HOH A . 
E 4 HOH 74  776 74  HOH HOH A . 
E 4 HOH 75  777 75  HOH HOH A . 
E 4 HOH 76  778 76  HOH HOH A . 
E 4 HOH 77  779 77  HOH HOH A . 
E 4 HOH 78  780 78  HOH HOH A . 
E 4 HOH 79  781 79  HOH HOH A . 
E 4 HOH 80  782 80  HOH HOH A . 
E 4 HOH 81  783 81  HOH HOH A . 
E 4 HOH 82  784 82  HOH HOH A . 
E 4 HOH 83  785 83  HOH HOH A . 
E 4 HOH 84  786 84  HOH HOH A . 
E 4 HOH 85  787 85  HOH HOH A . 
E 4 HOH 86  788 86  HOH HOH A . 
E 4 HOH 87  789 87  HOH HOH A . 
E 4 HOH 88  790 88  HOH HOH A . 
E 4 HOH 89  791 89  HOH HOH A . 
E 4 HOH 90  792 90  HOH HOH A . 
E 4 HOH 91  793 91  HOH HOH A . 
E 4 HOH 92  794 92  HOH HOH A . 
E 4 HOH 93  795 93  HOH HOH A . 
E 4 HOH 94  796 94  HOH HOH A . 
E 4 HOH 95  797 95  HOH HOH A . 
E 4 HOH 96  798 96  HOH HOH A . 
E 4 HOH 97  799 97  HOH HOH A . 
E 4 HOH 98  800 98  HOH HOH A . 
E 4 HOH 99  801 99  HOH HOH A . 
E 4 HOH 100 802 100 HOH HOH A . 
E 4 HOH 101 803 101 HOH HOH A . 
E 4 HOH 102 804 102 HOH HOH A . 
E 4 HOH 103 805 103 HOH HOH A . 
E 4 HOH 104 806 104 HOH HOH A . 
E 4 HOH 105 807 105 HOH HOH A . 
E 4 HOH 106 808 106 HOH HOH A . 
E 4 HOH 107 809 107 HOH HOH A . 
E 4 HOH 108 810 108 HOH HOH A . 
E 4 HOH 109 811 109 HOH HOH A . 
E 4 HOH 110 812 110 HOH HOH A . 
E 4 HOH 111 813 111 HOH HOH A . 
E 4 HOH 112 814 112 HOH HOH A . 
E 4 HOH 113 815 113 HOH HOH A . 
E 4 HOH 114 816 114 HOH HOH A . 
E 4 HOH 115 817 115 HOH HOH A . 
E 4 HOH 116 818 116 HOH HOH A . 
E 4 HOH 117 819 117 HOH HOH A . 
E 4 HOH 118 820 118 HOH HOH A . 
E 4 HOH 119 821 119 HOH HOH A . 
E 4 HOH 120 822 120 HOH HOH A . 
E 4 HOH 121 823 121 HOH HOH A . 
E 4 HOH 122 824 122 HOH HOH A . 
E 4 HOH 123 825 123 HOH HOH A . 
E 4 HOH 124 826 124 HOH HOH A . 
E 4 HOH 125 827 125 HOH HOH A . 
E 4 HOH 126 828 126 HOH HOH A . 
E 4 HOH 127 829 127 HOH HOH A . 
E 4 HOH 128 830 128 HOH HOH A . 
E 4 HOH 129 831 129 HOH HOH A . 
E 4 HOH 130 832 130 HOH HOH A . 
E 4 HOH 131 833 131 HOH HOH A . 
E 4 HOH 132 834 132 HOH HOH A . 
E 4 HOH 133 835 133 HOH HOH A . 
E 4 HOH 134 836 134 HOH HOH A . 
E 4 HOH 135 837 135 HOH HOH A . 
E 4 HOH 136 838 136 HOH HOH A . 
E 4 HOH 137 839 137 HOH HOH A . 
E 4 HOH 138 840 138 HOH HOH A . 
E 4 HOH 139 841 139 HOH HOH A . 
E 4 HOH 140 842 140 HOH HOH A . 
E 4 HOH 141 843 141 HOH HOH A . 
E 4 HOH 142 844 142 HOH HOH A . 
E 4 HOH 143 845 143 HOH HOH A . 
E 4 HOH 144 846 144 HOH HOH A . 
E 4 HOH 145 847 145 HOH HOH A . 
E 4 HOH 146 848 146 HOH HOH A . 
E 4 HOH 147 849 147 HOH HOH A . 
E 4 HOH 148 850 148 HOH HOH A . 
E 4 HOH 149 851 149 HOH HOH A . 
E 4 HOH 150 852 150 HOH HOH A . 
E 4 HOH 151 853 151 HOH HOH A . 
E 4 HOH 152 854 152 HOH HOH A . 
E 4 HOH 153 855 153 HOH HOH A . 
E 4 HOH 154 856 154 HOH HOH A . 
E 4 HOH 155 857 155 HOH HOH A . 
E 4 HOH 156 858 156 HOH HOH A . 
E 4 HOH 157 859 157 HOH HOH A . 
E 4 HOH 158 860 158 HOH HOH A . 
E 4 HOH 159 861 159 HOH HOH A . 
E 4 HOH 160 862 160 HOH HOH A . 
E 4 HOH 161 863 161 HOH HOH A . 
E 4 HOH 162 864 162 HOH HOH A . 
E 4 HOH 163 865 163 HOH HOH A . 
E 4 HOH 164 866 164 HOH HOH A . 
E 4 HOH 165 867 165 HOH HOH A . 
E 4 HOH 166 868 166 HOH HOH A . 
E 4 HOH 167 869 167 HOH HOH A . 
E 4 HOH 168 870 168 HOH HOH A . 
E 4 HOH 169 871 169 HOH HOH A . 
E 4 HOH 170 872 170 HOH HOH A . 
E 4 HOH 171 873 171 HOH HOH A . 
E 4 HOH 172 874 172 HOH HOH A . 
E 4 HOH 173 875 173 HOH HOH A . 
E 4 HOH 174 876 174 HOH HOH A . 
E 4 HOH 175 877 175 HOH HOH A . 
E 4 HOH 176 878 176 HOH HOH A . 
E 4 HOH 177 879 177 HOH HOH A . 
E 4 HOH 178 880 178 HOH HOH A . 
E 4 HOH 179 881 179 HOH HOH A . 
E 4 HOH 180 882 180 HOH HOH A . 
E 4 HOH 181 883 181 HOH HOH A . 
E 4 HOH 182 884 182 HOH HOH A . 
E 4 HOH 183 885 183 HOH HOH A . 
E 4 HOH 184 886 184 HOH HOH A . 
E 4 HOH 185 887 185 HOH HOH A . 
E 4 HOH 186 888 186 HOH HOH A . 
E 4 HOH 187 889 187 HOH HOH A . 
E 4 HOH 188 890 188 HOH HOH A . 
E 4 HOH 189 891 189 HOH HOH A . 
E 4 HOH 190 892 190 HOH HOH A . 
E 4 HOH 191 893 191 HOH HOH A . 
E 4 HOH 192 894 192 HOH HOH A . 
E 4 HOH 193 895 193 HOH HOH A . 
E 4 HOH 194 896 194 HOH HOH A . 
E 4 HOH 195 897 195 HOH HOH A . 
E 4 HOH 196 898 196 HOH HOH A . 
E 4 HOH 197 899 197 HOH HOH A . 
E 4 HOH 198 900 198 HOH HOH A . 
E 4 HOH 199 901 199 HOH HOH A . 
E 4 HOH 200 902 200 HOH HOH A . 
E 4 HOH 201 903 201 HOH HOH A . 
E 4 HOH 202 904 203 HOH HOH A . 
E 4 HOH 203 905 204 HOH HOH A . 
E 4 HOH 204 906 205 HOH HOH A . 
E 4 HOH 205 907 206 HOH HOH A . 
E 4 HOH 206 908 207 HOH HOH A . 
E 4 HOH 207 909 208 HOH HOH A . 
E 4 HOH 208 910 209 HOH HOH A . 
E 4 HOH 209 911 210 HOH HOH A . 
E 4 HOH 210 912 212 HOH HOH A . 
E 4 HOH 211 913 213 HOH HOH A . 
E 4 HOH 212 914 214 HOH HOH A . 
E 4 HOH 213 915 215 HOH HOH A . 
E 4 HOH 214 916 216 HOH HOH A . 
E 4 HOH 215 917 217 HOH HOH A . 
E 4 HOH 216 918 218 HOH HOH A . 
E 4 HOH 217 919 219 HOH HOH A . 
E 4 HOH 218 920 220 HOH HOH A . 
E 4 HOH 219 921 221 HOH HOH A . 
E 4 HOH 220 922 222 HOH HOH A . 
E 4 HOH 221 923 223 HOH HOH A . 
E 4 HOH 222 924 224 HOH HOH A . 
E 4 HOH 223 925 225 HOH HOH A . 
E 4 HOH 224 926 226 HOH HOH A . 
E 4 HOH 225 927 227 HOH HOH A . 
#