data_2E3S
# 
_entry.id   2E3S 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2E3S         
RCSB  RCSB026188   
WWPDB D_1000026188 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2E3M . unspecified 
PDB 2E3N . unspecified 
PDB 2E3O . unspecified 
PDB 2E3P . unspecified 
PDB 2E3Q . unspecified 
PDB 2E3R . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2E3S 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-28 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kudo, N.'      1 
'Kumagai, K.'   2 
'Wakatsuki, S.' 3 
'Nishijima, M.' 4 
'Hanada, K.'    5 
'Kato, R.'      6 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for specific lipid recognition by CERT responsible for nonvesicular trafficking of ceramide.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            105 
_citation.page_first                488 
_citation.page_last                 493 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18184806 
_citation.pdbx_database_id_DOI      10.1073/pnas.0709191105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kudo, N.'      1 
primary 'Kumagai, K.'   2 
primary 'Tomishige, N.' 3 
primary 'Yamaji, T.'    4 
primary 'Wakatsuki, S.' 5 
primary 'Nishijima, M.' 6 
primary 'Hanada, K.'    7 
primary 'Kato, R.'      8 
# 
_cell.entry_id           2E3S 
_cell.length_a           41.243 
_cell.length_b           75.646 
_cell.length_c           42.327 
_cell.angle_alpha        90.00 
_cell.angle_beta         108.44 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2E3S 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Lipid-transfer protein CERT' 28931.764 1  ? ? 'CERT START DOMAIN (RESIDUES 347-598)' ? 
2 water   nat water                         18.015    54 ? ? ?                                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Goodpasture-antigen binding protein, GPBP, CDNA FLJ34532 fis, clone HLUNG2008235, highly similar to Homo sapiens goodpasture antigen-binding protein (COL4A3BP)mRNA
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SNSLHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHA
VKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVC
NFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRF
TSYVQEKTAGKPILF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNSLHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHA
VKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVC
NFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRF
TSYVQEKTAGKPILF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   SER n 
1 4   LEU n 
1 5   HIS n 
1 6   TRP n 
1 7   PRO n 
1 8   THR n 
1 9   SER n 
1 10  LEU n 
1 11  PRO n 
1 12  SER n 
1 13  GLY n 
1 14  ASP n 
1 15  ALA n 
1 16  PHE n 
1 17  SER n 
1 18  SER n 
1 19  VAL n 
1 20  GLY n 
1 21  THR n 
1 22  HIS n 
1 23  ARG n 
1 24  PHE n 
1 25  VAL n 
1 26  GLN n 
1 27  LYS n 
1 28  VAL n 
1 29  GLU n 
1 30  GLU n 
1 31  MET n 
1 32  VAL n 
1 33  GLN n 
1 34  ASN n 
1 35  HIS n 
1 36  MET n 
1 37  THR n 
1 38  TYR n 
1 39  SER n 
1 40  LEU n 
1 41  GLN n 
1 42  ASP n 
1 43  VAL n 
1 44  GLY n 
1 45  GLY n 
1 46  ASP n 
1 47  ALA n 
1 48  ASN n 
1 49  TRP n 
1 50  GLN n 
1 51  LEU n 
1 52  VAL n 
1 53  VAL n 
1 54  GLU n 
1 55  GLU n 
1 56  GLY n 
1 57  GLU n 
1 58  MET n 
1 59  LYS n 
1 60  VAL n 
1 61  TYR n 
1 62  ARG n 
1 63  ARG n 
1 64  GLU n 
1 65  VAL n 
1 66  GLU n 
1 67  GLU n 
1 68  ASN n 
1 69  GLY n 
1 70  ILE n 
1 71  VAL n 
1 72  LEU n 
1 73  ASP n 
1 74  PRO n 
1 75  LEU n 
1 76  LYS n 
1 77  ALA n 
1 78  THR n 
1 79  HIS n 
1 80  ALA n 
1 81  VAL n 
1 82  LYS n 
1 83  GLY n 
1 84  VAL n 
1 85  THR n 
1 86  GLY n 
1 87  HIS n 
1 88  GLU n 
1 89  VAL n 
1 90  CYS n 
1 91  ASN n 
1 92  TYR n 
1 93  PHE n 
1 94  TRP n 
1 95  ASN n 
1 96  VAL n 
1 97  ASP n 
1 98  VAL n 
1 99  ARG n 
1 100 ASN n 
1 101 ASP n 
1 102 TRP n 
1 103 GLU n 
1 104 THR n 
1 105 THR n 
1 106 ILE n 
1 107 GLU n 
1 108 ASN n 
1 109 PHE n 
1 110 HIS n 
1 111 VAL n 
1 112 VAL n 
1 113 GLU n 
1 114 THR n 
1 115 LEU n 
1 116 ALA n 
1 117 ASP n 
1 118 ASN n 
1 119 ALA n 
1 120 ILE n 
1 121 ILE n 
1 122 ILE n 
1 123 TYR n 
1 124 GLN n 
1 125 THR n 
1 126 HIS n 
1 127 LYS n 
1 128 ARG n 
1 129 VAL n 
1 130 TRP n 
1 131 PRO n 
1 132 ALA n 
1 133 SER n 
1 134 GLN n 
1 135 ARG n 
1 136 ASP n 
1 137 VAL n 
1 138 LEU n 
1 139 TYR n 
1 140 LEU n 
1 141 SER n 
1 142 VAL n 
1 143 ILE n 
1 144 ARG n 
1 145 LYS n 
1 146 ILE n 
1 147 PRO n 
1 148 ALA n 
1 149 LEU n 
1 150 THR n 
1 151 GLU n 
1 152 ASN n 
1 153 ASP n 
1 154 PRO n 
1 155 GLU n 
1 156 THR n 
1 157 TRP n 
1 158 ILE n 
1 159 VAL n 
1 160 CYS n 
1 161 ASN n 
1 162 PHE n 
1 163 SER n 
1 164 VAL n 
1 165 ASP n 
1 166 HIS n 
1 167 ASP n 
1 168 SER n 
1 169 ALA n 
1 170 PRO n 
1 171 LEU n 
1 172 ASN n 
1 173 ASN n 
1 174 ARG n 
1 175 CYS n 
1 176 VAL n 
1 177 ARG n 
1 178 ALA n 
1 179 LYS n 
1 180 ILE n 
1 181 ASN n 
1 182 VAL n 
1 183 ALA n 
1 184 MET n 
1 185 ILE n 
1 186 CYS n 
1 187 GLN n 
1 188 THR n 
1 189 LEU n 
1 190 VAL n 
1 191 SER n 
1 192 PRO n 
1 193 PRO n 
1 194 GLU n 
1 195 GLY n 
1 196 ASN n 
1 197 GLN n 
1 198 GLU n 
1 199 ILE n 
1 200 SER n 
1 201 ARG n 
1 202 ASP n 
1 203 ASN n 
1 204 ILE n 
1 205 LEU n 
1 206 CYS n 
1 207 LYS n 
1 208 ILE n 
1 209 THR n 
1 210 TYR n 
1 211 VAL n 
1 212 ALA n 
1 213 ASN n 
1 214 VAL n 
1 215 ASN n 
1 216 PRO n 
1 217 GLY n 
1 218 GLY n 
1 219 TRP n 
1 220 ALA n 
1 221 PRO n 
1 222 ALA n 
1 223 SER n 
1 224 VAL n 
1 225 LEU n 
1 226 ARG n 
1 227 ALA n 
1 228 VAL n 
1 229 ALA n 
1 230 LYS n 
1 231 ARG n 
1 232 GLU n 
1 233 TYR n 
1 234 PRO n 
1 235 LYS n 
1 236 PHE n 
1 237 LEU n 
1 238 LYS n 
1 239 ARG n 
1 240 PHE n 
1 241 THR n 
1 242 SER n 
1 243 TYR n 
1 244 VAL n 
1 245 GLN n 
1 246 GLU n 
1 247 LYS n 
1 248 THR n 
1 249 ALA n 
1 250 GLY n 
1 251 LYS n 
1 252 PRO n 
1 253 ILE n 
1 254 LEU n 
1 255 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 CERT 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               DH5alpha 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pGEX-5X1 (MODIFIED)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q53YV2_HUMAN 
_struct_ref.pdbx_db_accession          Q53YV2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;LHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKG
VTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFS
VDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSY
VQEKTAGKPILF
;
_struct_ref.pdbx_align_begin           347 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2E3S 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 255 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q53YV2 
_struct_ref_seq.db_align_beg                  347 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  598 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       347 
_struct_ref_seq.pdbx_auth_seq_align_end       598 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2E3S SER A 1 ? UNP Q53YV2 ? ? 'EXPRESSION TAG' 344 1 
1 2E3S ASN A 2 ? UNP Q53YV2 ? ? 'EXPRESSION TAG' 345 2 
1 2E3S SER A 3 ? UNP Q53YV2 ? ? 'EXPRESSION TAG' 346 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2E3S 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.16 
_exptl_crystal.density_percent_sol   43.16 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2005-03-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9796 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE AR-NW12A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   AR-NW12A 
_diffrn_source.pdbx_wavelength             0.9796 
_diffrn_source.pdbx_wavelength_list        0.9796 
# 
_reflns.entry_id                     2E3S 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.940 
_reflns.number_obs                   17894 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.95 
_reflns_shell.d_res_low              2.02 
_reflns_shell.percent_possible_all   83.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2E3S 
_refine.ls_number_reflns_obs                     16960 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.16 
_refine.ls_d_res_high                            1.94 
_refine.ls_percent_reflns_obs                    97.4 
_refine.ls_R_factor_obs                          0.234 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.233 
_refine.ls_R_factor_R_free                       0.259 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  916 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.938 
_refine.correlation_coeff_Fo_to_Fc_free          0.926 
_refine.B_iso_mean                               30.67 
_refine.aniso_B[1][1]                            0.84000 
_refine.aniso_B[2][2]                            -0.62000 
_refine.aniso_B[3][3]                            -0.51000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -0.46000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.205 
_refine.pdbx_overall_ESU_R_Free                  0.171 
_refine.overall_SU_ML                            0.120 
_refine.overall_SU_B                             4.150 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1806 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             54 
_refine_hist.number_atoms_total               1860 
_refine_hist.d_res_high                       1.94 
_refine_hist.d_res_low                        40.16 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.022  ? 1843 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.115  1.929  ? 2503 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.936  5.000  ? 221  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.376 24.176 ? 91   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.629 15.000 ? 317  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.835 15.000 ? 13   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.073  0.200  ? 285  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 1390 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.182  0.200  ? 716  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.296  0.200  ? 1236 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.106  0.200  ? 76   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.171  0.200  ? 34   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.073  0.200  ? 4    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.700  1.500  ? 1157 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.135  2.000  ? 1821 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.363  3.000  ? 794  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.150  4.500  ? 682  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.94 
_refine_ls_shell.d_res_low                        1.99 
_refine_ls_shell.number_reflns_R_work             928 
_refine_ls_shell.R_factor_R_work                  0.288 
_refine_ls_shell.percent_reflns_obs               71.85 
_refine_ls_shell.R_factor_R_free                  0.299 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             47 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2E3S 
_struct.title                     'Crystal structure of CERT START domain co-crystallized with C24-ceramide (P21)' 
_struct.pdbx_descriptor           'Lipid-transfer protein CERT' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2E3S 
_struct_keywords.pdbx_keywords   'LIPID TRANSPORT' 
_struct_keywords.text            'LIPID TRANSFER PROTEIN, CERT, CERAMIDE TRANSFER, LIPID TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PHE A 24  ? SER A 39  ? PHE A 367 SER A 382 1 ? 16 
HELX_P HELX_P2 2 THR A 85  ? ASN A 95  ? THR A 428 ASN A 438 1 ? 11 
HELX_P HELX_P3 3 VAL A 98  ? GLU A 103 ? VAL A 441 GLU A 446 1 ? 6  
HELX_P HELX_P4 4 SER A 200 ? ASP A 202 ? SER A 543 ASP A 545 5 ? 3  
HELX_P HELX_P5 5 PRO A 221 ? ALA A 249 ? PRO A 564 ALA A 592 1 ? 29 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 8 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? parallel      
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 50  ? GLU A 55  ? GLN A 393 GLU A 398 
A 2 MET A 58  ? ARG A 62  ? MET A 401 ARG A 405 
A 3 LEU A 75  ? LYS A 82  ? LEU A 418 LYS A 425 
A 4 ILE A 204 ? ASN A 215 ? ILE A 547 ASN A 558 
A 5 LYS A 179 ? VAL A 190 ? LYS A 522 VAL A 533 
A 6 THR A 156 ? SER A 163 ? THR A 499 SER A 506 
A 7 ARG A 135 ? ILE A 146 ? ARG A 478 ILE A 489 
A 8 ALA A 119 ? HIS A 126 ? ALA A 462 HIS A 469 
A 9 ILE A 106 ? ALA A 116 ? ILE A 449 ALA A 459 
B 1 GLN A 50  ? GLU A 55  ? GLN A 393 GLU A 398 
B 2 MET A 58  ? ARG A 62  ? MET A 401 ARG A 405 
B 3 LEU A 75  ? LYS A 82  ? LEU A 418 LYS A 425 
B 4 ILE A 204 ? ASN A 215 ? ILE A 547 ASN A 558 
B 5 LYS A 179 ? VAL A 190 ? LYS A 522 VAL A 533 
B 6 THR A 156 ? SER A 163 ? THR A 499 SER A 506 
B 7 ARG A 135 ? ILE A 146 ? ARG A 478 ILE A 489 
B 8 VAL A 176 ? ARG A 177 ? VAL A 519 ARG A 520 
C 1 GLU A 66  ? GLU A 67  ? GLU A 409 GLU A 410 
C 2 ILE A 70  ? VAL A 71  ? ILE A 413 VAL A 414 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 53  ? N VAL A 396 O VAL A 60  ? O VAL A 403 
A 2 3 N TYR A 61  ? N TYR A 404 O LYS A 76  ? O LYS A 419 
A 3 4 N HIS A 79  ? N HIS A 422 O ILE A 208 ? O ILE A 551 
A 4 5 O ASN A 215 ? O ASN A 558 N LYS A 179 ? N LYS A 522 
A 5 6 O CYS A 186 ? O CYS A 529 N TRP A 157 ? N TRP A 500 
A 6 7 O THR A 156 ? O THR A 499 N ILE A 146 ? N ILE A 489 
A 7 8 O SER A 141 ? O SER A 484 N ILE A 120 ? N ILE A 463 
A 8 9 O THR A 125 ? O THR A 468 N ASN A 108 ? N ASN A 451 
B 1 2 N VAL A 53  ? N VAL A 396 O VAL A 60  ? O VAL A 403 
B 2 3 N TYR A 61  ? N TYR A 404 O LYS A 76  ? O LYS A 419 
B 3 4 N HIS A 79  ? N HIS A 422 O ILE A 208 ? O ILE A 551 
B 4 5 O ASN A 215 ? O ASN A 558 N LYS A 179 ? N LYS A 522 
B 5 6 O CYS A 186 ? O CYS A 529 N TRP A 157 ? N TRP A 500 
B 6 7 O THR A 156 ? O THR A 499 N ILE A 146 ? N ILE A 489 
B 7 8 N ASP A 136 ? N ASP A 479 O VAL A 176 ? O VAL A 519 
C 1 2 N GLU A 67  ? N GLU A 410 O ILE A 70  ? O ILE A 413 
# 
_database_PDB_matrix.entry_id          2E3S 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2E3S 
_atom_sites.fract_transf_matrix[1][1]   0.024247 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.008084 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013219 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.024904 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . HIS A 1 22  ? 38.982 -15.064 13.928  1.00 27.28 ? 365 HIS A N   1 
ATOM   2    C CA  . HIS A 1 22  ? 37.861 -15.182 12.942  1.00 26.79 ? 365 HIS A CA  1 
ATOM   3    C C   . HIS A 1 22  ? 38.363 -15.682 11.573  1.00 26.48 ? 365 HIS A C   1 
ATOM   4    O O   . HIS A 1 22  ? 39.574 -15.754 11.333  1.00 25.76 ? 365 HIS A O   1 
ATOM   5    C CB  . HIS A 1 22  ? 37.114 -13.847 12.810  1.00 27.05 ? 365 HIS A CB  1 
ATOM   6    C CG  . HIS A 1 22  ? 37.956 -12.732 12.270  1.00 27.64 ? 365 HIS A CG  1 
ATOM   7    N ND1 . HIS A 1 22  ? 38.159 -12.540 10.921  1.00 28.68 ? 365 HIS A ND1 1 
ATOM   8    C CD2 . HIS A 1 22  ? 38.647 -11.751 12.898  1.00 28.64 ? 365 HIS A CD2 1 
ATOM   9    C CE1 . HIS A 1 22  ? 38.946 -11.494 10.739  1.00 28.88 ? 365 HIS A CE1 1 
ATOM   10   N NE2 . HIS A 1 22  ? 39.253 -10.994 11.922  1.00 29.70 ? 365 HIS A NE2 1 
ATOM   11   N N   . ARG A 1 23  ? 37.421 -16.004 10.687  1.00 26.28 ? 366 ARG A N   1 
ATOM   12   C CA  . ARG A 1 23  ? 37.723 -16.626 9.387   1.00 26.46 ? 366 ARG A CA  1 
ATOM   13   C C   . ARG A 1 23  ? 38.466 -15.744 8.366   1.00 26.50 ? 366 ARG A C   1 
ATOM   14   O O   . ARG A 1 23  ? 39.049 -16.266 7.415   1.00 26.51 ? 366 ARG A O   1 
ATOM   15   C CB  . ARG A 1 23  ? 36.449 -17.213 8.759   1.00 26.27 ? 366 ARG A CB  1 
ATOM   16   C CG  . ARG A 1 23  ? 35.417 -16.176 8.320   1.00 26.46 ? 366 ARG A CG  1 
ATOM   17   C CD  . ARG A 1 23  ? 34.087 -16.811 7.987   1.00 26.29 ? 366 ARG A CD  1 
ATOM   18   N NE  . ARG A 1 23  ? 33.103 -15.837 7.507   1.00 26.01 ? 366 ARG A NE  1 
ATOM   19   C CZ  . ARG A 1 23  ? 32.309 -15.117 8.295   1.00 25.92 ? 366 ARG A CZ  1 
ATOM   20   N NH1 . ARG A 1 23  ? 32.374 -15.249 9.611   1.00 26.46 ? 366 ARG A NH1 1 
ATOM   21   N NH2 . ARG A 1 23  ? 31.446 -14.262 7.768   1.00 26.11 ? 366 ARG A NH2 1 
ATOM   22   N N   . PHE A 1 24  ? 38.459 -14.424 8.565   1.00 26.54 ? 367 PHE A N   1 
ATOM   23   C CA  . PHE A 1 24  ? 39.092 -13.493 7.615   1.00 26.66 ? 367 PHE A CA  1 
ATOM   24   C C   . PHE A 1 24  ? 40.462 -12.984 8.046   1.00 27.55 ? 367 PHE A C   1 
ATOM   25   O O   . PHE A 1 24  ? 41.023 -12.079 7.406   1.00 27.18 ? 367 PHE A O   1 
ATOM   26   C CB  . PHE A 1 24  ? 38.199 -12.282 7.379   1.00 26.50 ? 367 PHE A CB  1 
ATOM   27   C CG  . PHE A 1 24  ? 36.996 -12.557 6.533   1.00 24.91 ? 367 PHE A CG  1 
ATOM   28   C CD1 . PHE A 1 24  ? 37.114 -12.698 5.156   1.00 24.71 ? 367 PHE A CD1 1 
ATOM   29   C CD2 . PHE A 1 24  ? 35.740 -12.642 7.106   1.00 24.24 ? 367 PHE A CD2 1 
ATOM   30   C CE1 . PHE A 1 24  ? 35.995 -12.934 4.371   1.00 23.48 ? 367 PHE A CE1 1 
ATOM   31   C CE2 . PHE A 1 24  ? 34.619 -12.874 6.328   1.00 23.53 ? 367 PHE A CE2 1 
ATOM   32   C CZ  . PHE A 1 24  ? 34.746 -13.016 4.959   1.00 24.21 ? 367 PHE A CZ  1 
ATOM   33   N N   . VAL A 1 25  ? 41.002 -13.554 9.123   1.00 28.07 ? 368 VAL A N   1 
ATOM   34   C CA  . VAL A 1 25  ? 42.245 -13.049 9.709   1.00 28.90 ? 368 VAL A CA  1 
ATOM   35   C C   . VAL A 1 25  ? 43.425 -13.037 8.711   1.00 29.04 ? 368 VAL A C   1 
ATOM   36   O O   . VAL A 1 25  ? 44.179 -12.067 8.650   1.00 29.16 ? 368 VAL A O   1 
ATOM   37   C CB  . VAL A 1 25  ? 42.570 -13.756 11.068  1.00 28.98 ? 368 VAL A CB  1 
ATOM   38   C CG1 . VAL A 1 25  ? 42.927 -15.236 10.866  1.00 29.29 ? 368 VAL A CG1 1 
ATOM   39   C CG2 . VAL A 1 25  ? 43.671 -13.029 11.819  1.00 30.07 ? 368 VAL A CG2 1 
ATOM   40   N N   . GLN A 1 26  ? 43.551 -14.088 7.903   1.00 29.25 ? 369 GLN A N   1 
ATOM   41   C CA  . GLN A 1 26  ? 44.627 -14.177 6.912   1.00 29.43 ? 369 GLN A CA  1 
ATOM   42   C C   . GLN A 1 26  ? 44.440 -13.158 5.786   1.00 29.09 ? 369 GLN A C   1 
ATOM   43   O O   . GLN A 1 26  ? 45.403 -12.542 5.331   1.00 29.14 ? 369 GLN A O   1 
ATOM   44   C CB  . GLN A 1 26  ? 44.707 -15.588 6.323   1.00 29.66 ? 369 GLN A CB  1 
ATOM   45   C CG  . GLN A 1 26  ? 45.245 -16.670 7.271   1.00 30.22 ? 369 GLN A CG  1 
ATOM   46   C CD  . GLN A 1 26  ? 45.033 -18.075 6.712   1.00 30.40 ? 369 GLN A CD  1 
ATOM   47   O OE1 . GLN A 1 26  ? 44.799 -18.256 5.513   1.00 31.64 ? 369 GLN A OE1 1 
ATOM   48   N NE2 . GLN A 1 26  ? 45.105 -19.069 7.578   1.00 30.69 ? 369 GLN A NE2 1 
ATOM   49   N N   . LYS A 1 27  ? 43.196 -12.998 5.343   1.00 28.89 ? 370 LYS A N   1 
ATOM   50   C CA  . LYS A 1 27  ? 42.842 -12.025 4.319   1.00 28.92 ? 370 LYS A CA  1 
ATOM   51   C C   . LYS A 1 27  ? 43.089 -10.591 4.818   1.00 28.76 ? 370 LYS A C   1 
ATOM   52   O O   . LYS A 1 27  ? 43.614 -9.761  4.075   1.00 28.80 ? 370 LYS A O   1 
ATOM   53   C CB  . LYS A 1 27  ? 41.381 -12.218 3.892   1.00 28.97 ? 370 LYS A CB  1 
ATOM   54   C CG  . LYS A 1 27  ? 40.848 -11.220 2.849   1.00 29.77 ? 370 LYS A CG  1 
ATOM   55   C CD  . LYS A 1 27  ? 41.617 -11.271 1.543   1.00 31.62 ? 370 LYS A CD  1 
ATOM   56   C CE  . LYS A 1 27  ? 40.872 -10.545 0.435   1.00 32.09 ? 370 LYS A CE  1 
ATOM   57   N NZ  . LYS A 1 27  ? 41.714 -10.462 -0.785  1.00 33.60 ? 370 LYS A NZ  1 
ATOM   58   N N   . VAL A 1 28  ? 42.715 -10.319 6.071   1.00 28.51 ? 371 VAL A N   1 
ATOM   59   C CA  . VAL A 1 28  ? 42.970 -9.013  6.704   1.00 28.31 ? 371 VAL A CA  1 
ATOM   60   C C   . VAL A 1 28  ? 44.466 -8.736  6.759   1.00 28.28 ? 371 VAL A C   1 
ATOM   61   O O   . VAL A 1 28  ? 44.917 -7.659  6.377   1.00 28.52 ? 371 VAL A O   1 
ATOM   62   C CB  . VAL A 1 28  ? 42.360 -8.910  8.130   1.00 27.92 ? 371 VAL A CB  1 
ATOM   63   C CG1 . VAL A 1 28  ? 42.935 -7.705  8.887   1.00 28.06 ? 371 VAL A CG1 1 
ATOM   64   C CG2 . VAL A 1 28  ? 40.841 -8.813  8.064   1.00 28.10 ? 371 VAL A CG2 1 
ATOM   65   N N   . GLU A 1 29  ? 45.237 -9.718  7.213   1.00 28.70 ? 372 GLU A N   1 
ATOM   66   C CA  . GLU A 1 29  ? 46.684 -9.556  7.334   1.00 29.40 ? 372 GLU A CA  1 
ATOM   67   C C   . GLU A 1 29  ? 47.359 -9.253  5.995   1.00 28.93 ? 372 GLU A C   1 
ATOM   68   O O   . GLU A 1 29  ? 48.288 -8.461  5.935   1.00 28.74 ? 372 GLU A O   1 
ATOM   69   C CB  . GLU A 1 29  ? 47.310 -10.791 7.990   1.00 29.78 ? 372 GLU A CB  1 
ATOM   70   C CG  . GLU A 1 29  ? 48.704 -10.557 8.567   1.00 33.14 ? 372 GLU A CG  1 
ATOM   71   C CD  . GLU A 1 29  ? 48.728 -9.529  9.697   1.00 36.37 ? 372 GLU A CD  1 
ATOM   72   O OE1 . GLU A 1 29  ? 47.704 -9.365  10.402  1.00 38.34 ? 372 GLU A OE1 1 
ATOM   73   O OE2 . GLU A 1 29  ? 49.779 -8.883  9.877   1.00 37.83 ? 372 GLU A OE2 1 
ATOM   74   N N   . GLU A 1 30  ? 46.876 -9.888  4.932   1.00 29.07 ? 373 GLU A N   1 
ATOM   75   C CA  . GLU A 1 30  ? 47.426 -9.715  3.586   1.00 29.44 ? 373 GLU A CA  1 
ATOM   76   C C   . GLU A 1 30  ? 47.087 -8.341  3.015   1.00 28.38 ? 373 GLU A C   1 
ATOM   77   O O   . GLU A 1 30  ? 47.944 -7.688  2.421   1.00 28.07 ? 373 GLU A O   1 
ATOM   78   C CB  . GLU A 1 30  ? 46.917 -10.835 2.670   1.00 29.64 ? 373 GLU A CB  1 
ATOM   79   C CG  . GLU A 1 30  ? 46.799 -10.494 1.186   1.00 31.23 ? 373 GLU A CG  1 
ATOM   80   C CD  . GLU A 1 30  ? 46.076 -11.588 0.419   1.00 31.93 ? 373 GLU A CD  1 
ATOM   81   O OE1 . GLU A 1 30  ? 45.041 -11.294 -0.228  1.00 35.21 ? 373 GLU A OE1 1 
ATOM   82   O OE2 . GLU A 1 30  ? 46.531 -12.752 0.499   1.00 34.95 ? 373 GLU A OE2 1 
ATOM   83   N N   . MET A 1 31  ? 45.839 -7.911  3.200   1.00 27.92 ? 374 MET A N   1 
ATOM   84   C CA  . MET A 1 31  ? 45.403 -6.594  2.742   1.00 27.54 ? 374 MET A CA  1 
ATOM   85   C C   . MET A 1 31  ? 46.141 -5.483  3.486   1.00 27.45 ? 374 MET A C   1 
ATOM   86   O O   . MET A 1 31  ? 46.578 -4.517  2.868   1.00 27.39 ? 374 MET A O   1 
ATOM   87   C CB  . MET A 1 31  ? 43.885 -6.434  2.868   1.00 27.21 ? 374 MET A CB  1 
ATOM   88   C CG  . MET A 1 31  ? 43.074 -7.442  2.034   1.00 27.35 ? 374 MET A CG  1 
ATOM   89   S SD  . MET A 1 31  ? 43.280 -7.261  0.244   1.00 25.55 ? 374 MET A SD  1 
ATOM   90   C CE  . MET A 1 31  ? 42.311 -5.795  -0.021  1.00 27.78 ? 374 MET A CE  1 
ATOM   91   N N   . VAL A 1 32  ? 46.296 -5.640  4.802   1.00 27.50 ? 375 VAL A N   1 
ATOM   92   C CA  . VAL A 1 32  ? 47.023 -4.676  5.631   1.00 27.93 ? 375 VAL A CA  1 
ATOM   93   C C   . VAL A 1 32  ? 48.492 -4.629  5.213   1.00 28.31 ? 375 VAL A C   1 
ATOM   94   O O   . VAL A 1 32  ? 49.066 -3.550  5.070   1.00 28.08 ? 375 VAL A O   1 
ATOM   95   C CB  . VAL A 1 32  ? 46.877 -4.989  7.157   1.00 27.71 ? 375 VAL A CB  1 
ATOM   96   C CG1 . VAL A 1 32  ? 47.858 -4.174  7.983   1.00 27.68 ? 375 VAL A CG1 1 
ATOM   97   C CG2 . VAL A 1 32  ? 45.457 -4.722  7.621   1.00 28.13 ? 375 VAL A CG2 1 
ATOM   98   N N   . GLN A 1 33  ? 49.075 -5.805  4.982   1.00 29.06 ? 376 GLN A N   1 
ATOM   99   C CA  . GLN A 1 33  ? 50.469 -5.922  4.553   1.00 29.90 ? 376 GLN A CA  1 
ATOM   100  C C   . GLN A 1 33  ? 50.703 -5.322  3.162   1.00 29.71 ? 376 GLN A C   1 
ATOM   101  O O   . GLN A 1 33  ? 51.706 -4.646  2.933   1.00 29.39 ? 376 GLN A O   1 
ATOM   102  C CB  . GLN A 1 33  ? 50.931 -7.384  4.592   1.00 30.16 ? 376 GLN A CB  1 
ATOM   103  C CG  . GLN A 1 33  ? 52.438 -7.553  4.569   1.00 33.27 ? 376 GLN A CG  1 
ATOM   104  C CD  . GLN A 1 33  ? 53.135 -6.710  5.627   1.00 37.33 ? 376 GLN A CD  1 
ATOM   105  O OE1 . GLN A 1 33  ? 52.806 -6.779  6.815   1.00 40.09 ? 376 GLN A OE1 1 
ATOM   106  N NE2 . GLN A 1 33  ? 54.101 -5.902  5.198   1.00 38.63 ? 376 GLN A NE2 1 
ATOM   107  N N   . ASN A 1 34  ? 49.767 -5.578  2.249   1.00 29.63 ? 377 ASN A N   1 
ATOM   108  C CA  . ASN A 1 34  ? 49.756 -4.971  0.918   1.00 29.87 ? 377 ASN A CA  1 
ATOM   109  C C   . ASN A 1 34  ? 49.761 -3.435  0.990   1.00 29.25 ? 377 ASN A C   1 
ATOM   110  O O   . ASN A 1 34  ? 50.511 -2.781  0.268   1.00 29.08 ? 377 ASN A O   1 
ATOM   111  C CB  . ASN A 1 34  ? 48.546 -5.496  0.123   1.00 30.45 ? 377 ASN A CB  1 
ATOM   112  C CG  . ASN A 1 34  ? 48.471 -4.947  -1.299  1.00 33.04 ? 377 ASN A CG  1 
ATOM   113  O OD1 . ASN A 1 34  ? 48.175 -3.765  -1.515  1.00 36.75 ? 377 ASN A OD1 1 
ATOM   114  N ND2 . ASN A 1 34  ? 48.695 -5.820  -2.280  1.00 35.45 ? 377 ASN A ND2 1 
ATOM   115  N N   . HIS A 1 35  ? 48.938 -2.867  1.869   1.00 28.68 ? 378 HIS A N   1 
ATOM   116  C CA  . HIS A 1 35  ? 48.889 -1.410  2.030   1.00 28.62 ? 378 HIS A CA  1 
ATOM   117  C C   . HIS A 1 35  ? 50.176 -0.828  2.613   1.00 28.94 ? 378 HIS A C   1 
ATOM   118  O O   . HIS A 1 35  ? 50.650 0.211   2.162   1.00 29.13 ? 378 HIS A O   1 
ATOM   119  C CB  . HIS A 1 35  ? 47.687 -0.984  2.875   1.00 28.20 ? 378 HIS A CB  1 
ATOM   120  C CG  . HIS A 1 35  ? 46.385 -1.038  2.139   1.00 27.90 ? 378 HIS A CG  1 
ATOM   121  N ND1 . HIS A 1 35  ? 46.138 -0.288  1.009   1.00 28.10 ? 378 HIS A ND1 1 
ATOM   122  C CD2 . HIS A 1 35  ? 45.252 -1.735  2.382   1.00 27.19 ? 378 HIS A CD2 1 
ATOM   123  C CE1 . HIS A 1 35  ? 44.915 -0.538  0.575   1.00 27.88 ? 378 HIS A CE1 1 
ATOM   124  N NE2 . HIS A 1 35  ? 44.354 -1.408  1.394   1.00 26.59 ? 378 HIS A NE2 1 
ATOM   125  N N   . MET A 1 36  ? 50.741 -1.498  3.612   1.00 29.37 ? 379 MET A N   1 
ATOM   126  C CA  . MET A 1 36  ? 51.978 -1.027  4.239   1.00 30.11 ? 379 MET A CA  1 
ATOM   127  C C   . MET A 1 36  ? 53.181 -1.088  3.284   1.00 31.18 ? 379 MET A C   1 
ATOM   128  O O   . MET A 1 36  ? 54.045 -0.204  3.318   1.00 31.15 ? 379 MET A O   1 
ATOM   129  C CB  . MET A 1 36  ? 52.256 -1.774  5.551   1.00 29.74 ? 379 MET A CB  1 
ATOM   130  C CG  . MET A 1 36  ? 51.194 -1.538  6.649   1.00 27.72 ? 379 MET A CG  1 
ATOM   131  S SD  . MET A 1 36  ? 50.967 0.190   7.145   1.00 22.74 ? 379 MET A SD  1 
ATOM   132  C CE  . MET A 1 36  ? 52.564 0.506   7.877   1.00 25.15 ? 379 MET A CE  1 
ATOM   133  N N   . THR A 1 37  ? 53.213 -2.107  2.424   1.00 32.08 ? 380 THR A N   1 
ATOM   134  C CA  . THR A 1 37  ? 54.291 -2.249  1.432   1.00 33.56 ? 380 THR A CA  1 
ATOM   135  C C   . THR A 1 37  ? 54.100 -1.397  0.165   1.00 33.92 ? 380 THR A C   1 
ATOM   136  O O   . THR A 1 37  ? 55.083 -0.901  -0.382  1.00 34.31 ? 380 THR A O   1 
ATOM   137  C CB  . THR A 1 37  ? 54.583 -3.739  1.039   1.00 33.66 ? 380 THR A CB  1 
ATOM   138  O OG1 . THR A 1 37  ? 53.495 -4.282  0.281   1.00 34.74 ? 380 THR A OG1 1 
ATOM   139  C CG2 . THR A 1 37  ? 54.815 -4.604  2.270   1.00 34.04 ? 380 THR A CG2 1 
ATOM   140  N N   . TYR A 1 38  ? 52.857 -1.229  -0.295  1.00 34.66 ? 381 TYR A N   1 
ATOM   141  C CA  . TYR A 1 38  ? 52.583 -0.515  -1.562  1.00 35.19 ? 381 TYR A CA  1 
ATOM   142  C C   . TYR A 1 38  ? 51.973 0.884   -1.438  1.00 35.18 ? 381 TYR A C   1 
ATOM   143  O O   . TYR A 1 38  ? 52.295 1.775   -2.230  1.00 34.96 ? 381 TYR A O   1 
ATOM   144  C CB  . TYR A 1 38  ? 51.689 -1.350  -2.489  1.00 35.99 ? 381 TYR A CB  1 
ATOM   145  C CG  . TYR A 1 38  ? 52.334 -2.618  -2.998  1.00 36.91 ? 381 TYR A CG  1 
ATOM   146  C CD1 . TYR A 1 38  ? 53.201 -2.593  -4.088  1.00 37.55 ? 381 TYR A CD1 1 
ATOM   147  C CD2 . TYR A 1 38  ? 52.075 -3.844  -2.390  1.00 37.93 ? 381 TYR A CD2 1 
ATOM   148  C CE1 . TYR A 1 38  ? 53.797 -3.757  -4.559  1.00 37.82 ? 381 TYR A CE1 1 
ATOM   149  C CE2 . TYR A 1 38  ? 52.664 -5.013  -2.849  1.00 37.76 ? 381 TYR A CE2 1 
ATOM   150  C CZ  . TYR A 1 38  ? 53.525 -4.962  -3.934  1.00 38.22 ? 381 TYR A CZ  1 
ATOM   151  O OH  . TYR A 1 38  ? 54.115 -6.121  -4.395  1.00 38.24 ? 381 TYR A OH  1 
ATOM   152  N N   . SER A 1 39  ? 51.084 1.076   -0.468  1.00 34.99 ? 382 SER A N   1 
ATOM   153  C CA  . SER A 1 39  ? 50.286 2.306   -0.414  1.00 35.07 ? 382 SER A CA  1 
ATOM   154  C C   . SER A 1 39  ? 51.011 3.515   0.181   1.00 35.33 ? 382 SER A C   1 
ATOM   155  O O   . SER A 1 39  ? 50.543 4.644   0.034   1.00 35.44 ? 382 SER A O   1 
ATOM   156  C CB  . SER A 1 39  ? 48.960 2.065   0.313   1.00 34.76 ? 382 SER A CB  1 
ATOM   157  O OG  . SER A 1 39  ? 48.237 1.010   -0.294  1.00 34.20 ? 382 SER A OG  1 
ATOM   158  N N   . LEU A 1 40  ? 52.141 3.286   0.843   1.00 35.71 ? 383 LEU A N   1 
ATOM   159  C CA  . LEU A 1 40  ? 52.892 4.384   1.458   1.00 36.45 ? 383 LEU A CA  1 
ATOM   160  C C   . LEU A 1 40  ? 54.020 4.944   0.581   1.00 36.93 ? 383 LEU A C   1 
ATOM   161  O O   . LEU A 1 40  ? 54.648 5.938   0.943   1.00 36.92 ? 383 LEU A O   1 
ATOM   162  C CB  . LEU A 1 40  ? 53.426 3.985   2.842   1.00 36.39 ? 383 LEU A CB  1 
ATOM   163  C CG  . LEU A 1 40  ? 52.405 3.696   3.946   1.00 36.16 ? 383 LEU A CG  1 
ATOM   164  C CD1 . LEU A 1 40  ? 53.116 3.397   5.259   1.00 36.74 ? 383 LEU A CD1 1 
ATOM   165  C CD2 . LEU A 1 40  ? 51.434 4.856   4.124   1.00 36.47 ? 383 LEU A CD2 1 
ATOM   166  N N   . GLN A 1 41  ? 54.265 4.314   -0.567  1.00 37.70 ? 384 GLN A N   1 
ATOM   167  C CA  . GLN A 1 41  ? 55.281 4.789   -1.517  1.00 38.46 ? 384 GLN A CA  1 
ATOM   168  C C   . GLN A 1 41  ? 54.940 6.199   -2.014  1.00 38.50 ? 384 GLN A C   1 
ATOM   169  O O   . GLN A 1 41  ? 53.769 6.521   -2.229  1.00 38.11 ? 384 GLN A O   1 
ATOM   170  C CB  . GLN A 1 41  ? 55.396 3.833   -2.708  1.00 38.47 ? 384 GLN A CB  1 
ATOM   171  C CG  . GLN A 1 41  ? 55.941 2.448   -2.383  1.00 39.27 ? 384 GLN A CG  1 
ATOM   172  C CD  . GLN A 1 41  ? 55.936 1.521   -3.594  1.00 39.70 ? 384 GLN A CD  1 
ATOM   173  O OE1 . GLN A 1 41  ? 56.423 1.876   -4.674  1.00 41.82 ? 384 GLN A OE1 1 
ATOM   174  N NE2 . GLN A 1 41  ? 55.390 0.326   -3.417  1.00 41.18 ? 384 GLN A NE2 1 
ATOM   175  N N   . ASP A 1 42  ? 55.958 7.041   -2.183  1.00 38.91 ? 385 ASP A N   1 
ATOM   176  C CA  . ASP A 1 42  ? 55.738 8.409   -2.659  1.00 39.33 ? 385 ASP A CA  1 
ATOM   177  C C   . ASP A 1 42  ? 55.263 8.413   -4.112  1.00 39.18 ? 385 ASP A C   1 
ATOM   178  O O   . ASP A 1 42  ? 55.941 7.886   -4.994  1.00 39.39 ? 385 ASP A O   1 
ATOM   179  C CB  . ASP A 1 42  ? 56.999 9.271   -2.491  1.00 39.81 ? 385 ASP A CB  1 
ATOM   180  C CG  . ASP A 1 42  ? 56.918 10.584  -3.268  1.00 40.65 ? 385 ASP A CG  1 
ATOM   181  O OD1 . ASP A 1 42  ? 56.501 11.605  -2.681  1.00 42.21 ? 385 ASP A OD1 1 
ATOM   182  O OD2 . ASP A 1 42  ? 57.245 10.584  -4.474  1.00 42.38 ? 385 ASP A OD2 1 
ATOM   183  N N   . VAL A 1 43  ? 54.092 9.001   -4.350  1.00 39.06 ? 386 VAL A N   1 
ATOM   184  C CA  . VAL A 1 43  ? 53.550 9.114   -5.709  1.00 38.85 ? 386 VAL A CA  1 
ATOM   185  C C   . VAL A 1 43  ? 53.808 10.491  -6.312  1.00 38.68 ? 386 VAL A C   1 
ATOM   186  O O   . VAL A 1 43  ? 53.576 10.705  -7.503  1.00 38.47 ? 386 VAL A O   1 
ATOM   187  C CB  . VAL A 1 43  ? 52.032 8.782   -5.781  1.00 38.81 ? 386 VAL A CB  1 
ATOM   188  C CG1 . VAL A 1 43  ? 51.779 7.325   -5.405  1.00 39.42 ? 386 VAL A CG1 1 
ATOM   189  C CG2 . VAL A 1 43  ? 51.222 9.726   -4.904  1.00 38.81 ? 386 VAL A CG2 1 
ATOM   190  N N   . GLY A 1 44  ? 54.280 11.417  -5.477  1.00 38.82 ? 387 GLY A N   1 
ATOM   191  C CA  . GLY A 1 44  ? 54.562 12.793  -5.889  1.00 38.92 ? 387 GLY A CA  1 
ATOM   192  C C   . GLY A 1 44  ? 55.625 12.876  -6.969  1.00 38.91 ? 387 GLY A C   1 
ATOM   193  O O   . GLY A 1 44  ? 55.564 13.742  -7.843  1.00 39.06 ? 387 GLY A O   1 
ATOM   194  N N   . GLY A 1 45  ? 56.591 11.963  -6.902  1.00 38.81 ? 388 GLY A N   1 
ATOM   195  C CA  . GLY A 1 45  ? 57.633 11.847  -7.914  1.00 38.90 ? 388 GLY A CA  1 
ATOM   196  C C   . GLY A 1 45  ? 57.297 10.853  -9.012  1.00 38.77 ? 388 GLY A C   1 
ATOM   197  O O   . GLY A 1 45  ? 57.945 10.846  -10.065 1.00 39.13 ? 388 GLY A O   1 
ATOM   198  N N   . ASP A 1 46  ? 56.278 10.025  -8.769  1.00 38.21 ? 389 ASP A N   1 
ATOM   199  C CA  . ASP A 1 46  ? 55.869 8.968   -9.701  1.00 37.55 ? 389 ASP A CA  1 
ATOM   200  C C   . ASP A 1 46  ? 55.072 9.542   -10.870 1.00 36.70 ? 389 ASP A C   1 
ATOM   201  O O   . ASP A 1 46  ? 53.988 10.101  -10.689 1.00 36.55 ? 389 ASP A O   1 
ATOM   202  C CB  . ASP A 1 46  ? 55.070 7.876   -8.973  1.00 37.84 ? 389 ASP A CB  1 
ATOM   203  C CG  . ASP A 1 46  ? 54.839 6.632   -9.829  1.00 38.56 ? 389 ASP A CG  1 
ATOM   204  O OD1 . ASP A 1 46  ? 54.606 6.753   -11.051 1.00 39.66 ? 389 ASP A OD1 1 
ATOM   205  O OD2 . ASP A 1 46  ? 54.880 5.517   -9.267  1.00 39.87 ? 389 ASP A OD2 1 
ATOM   206  N N   . ALA A 1 47  ? 55.626 9.379   -12.068 1.00 35.63 ? 390 ALA A N   1 
ATOM   207  C CA  . ALA A 1 47  ? 55.081 9.972   -13.282 1.00 34.39 ? 390 ALA A CA  1 
ATOM   208  C C   . ALA A 1 47  ? 53.824 9.280   -13.814 1.00 33.60 ? 390 ALA A C   1 
ATOM   209  O O   . ALA A 1 47  ? 53.138 9.818   -14.687 1.00 33.26 ? 390 ALA A O   1 
ATOM   210  C CB  . ALA A 1 47  ? 56.151 10.020  -14.353 1.00 34.69 ? 390 ALA A CB  1 
ATOM   211  N N   . ASN A 1 48  ? 53.522 8.092   -13.301 1.00 32.50 ? 391 ASN A N   1 
ATOM   212  C CA  . ASN A 1 48  ? 52.281 7.415   -13.672 1.00 31.85 ? 391 ASN A CA  1 
ATOM   213  C C   . ASN A 1 48  ? 51.050 7.976   -12.961 1.00 31.09 ? 391 ASN A C   1 
ATOM   214  O O   . ASN A 1 48  ? 49.925 7.741   -13.392 1.00 31.45 ? 391 ASN A O   1 
ATOM   215  C CB  . ASN A 1 48  ? 52.399 5.905   -13.477 1.00 31.98 ? 391 ASN A CB  1 
ATOM   216  C CG  . ASN A 1 48  ? 53.256 5.248   -14.545 1.00 32.55 ? 391 ASN A CG  1 
ATOM   217  O OD1 . ASN A 1 48  ? 54.294 4.665   -14.239 1.00 33.02 ? 391 ASN A OD1 1 
ATOM   218  N ND2 . ASN A 1 48  ? 52.836 5.361   -15.810 1.00 31.99 ? 391 ASN A ND2 1 
ATOM   219  N N   . TRP A 1 49  ? 51.277 8.728   -11.886 1.00 30.06 ? 392 TRP A N   1 
ATOM   220  C CA  . TRP A 1 49  ? 50.206 9.380   -11.138 1.00 29.42 ? 392 TRP A CA  1 
ATOM   221  C C   . TRP A 1 49  ? 50.111 10.862  -11.492 1.00 29.18 ? 392 TRP A C   1 
ATOM   222  O O   . TRP A 1 49  ? 51.127 11.504  -11.778 1.00 29.38 ? 392 TRP A O   1 
ATOM   223  C CB  . TRP A 1 49  ? 50.446 9.244   -9.636  1.00 29.09 ? 392 TRP A CB  1 
ATOM   224  C CG  . TRP A 1 49  ? 50.300 7.842   -9.126  1.00 28.87 ? 392 TRP A CG  1 
ATOM   225  C CD1 . TRP A 1 49  ? 51.199 6.819   -9.263  1.00 28.95 ? 392 TRP A CD1 1 
ATOM   226  C CD2 . TRP A 1 49  ? 49.183 7.304   -8.412  1.00 28.42 ? 392 TRP A CD2 1 
ATOM   227  N NE1 . TRP A 1 49  ? 50.709 5.675   -8.667  1.00 29.01 ? 392 TRP A NE1 1 
ATOM   228  C CE2 . TRP A 1 49  ? 49.476 5.947   -8.133  1.00 29.20 ? 392 TRP A CE2 1 
ATOM   229  C CE3 . TRP A 1 49  ? 47.966 7.837   -7.969  1.00 27.62 ? 392 TRP A CE3 1 
ATOM   230  C CZ2 . TRP A 1 49  ? 48.586 5.112   -7.436  1.00 29.16 ? 392 TRP A CZ2 1 
ATOM   231  C CZ3 . TRP A 1 49  ? 47.085 7.008   -7.275  1.00 28.62 ? 392 TRP A CZ3 1 
ATOM   232  C CH2 . TRP A 1 49  ? 47.401 5.661   -7.017  1.00 27.91 ? 392 TRP A CH2 1 
ATOM   233  N N   . GLN A 1 50  ? 48.892 11.394  -11.446 1.00 28.54 ? 393 GLN A N   1 
ATOM   234  C CA  . GLN A 1 50  ? 48.642 12.816  -11.682 1.00 28.63 ? 393 GLN A CA  1 
ATOM   235  C C   . GLN A 1 50  ? 48.067 13.465  -10.426 1.00 27.34 ? 393 GLN A C   1 
ATOM   236  O O   . GLN A 1 50  ? 47.088 12.970  -9.867  1.00 26.75 ? 393 GLN A O   1 
ATOM   237  C CB  . GLN A 1 50  ? 47.664 13.009  -12.853 1.00 28.65 ? 393 GLN A CB  1 
ATOM   238  C CG  . GLN A 1 50  ? 47.514 14.476  -13.281 1.00 30.41 ? 393 GLN A CG  1 
ATOM   239  C CD  . GLN A 1 50  ? 46.487 14.715  -14.384 1.00 31.12 ? 393 GLN A CD  1 
ATOM   240  O OE1 . GLN A 1 50  ? 45.611 13.889  -14.647 1.00 34.87 ? 393 GLN A OE1 1 
ATOM   241  N NE2 . GLN A 1 50  ? 46.579 15.879  -15.016 1.00 34.28 ? 393 GLN A NE2 1 
ATOM   242  N N   . LEU A 1 51  ? 48.678 14.566  -9.987  1.00 26.26 ? 394 LEU A N   1 
ATOM   243  C CA  . LEU A 1 51  ? 48.102 15.377  -8.910  1.00 25.61 ? 394 LEU A CA  1 
ATOM   244  C C   . LEU A 1 51  ? 46.876 16.105  -9.472  1.00 25.42 ? 394 LEU A C   1 
ATOM   245  O O   . LEU A 1 51  ? 47.008 17.012  -10.289 1.00 25.39 ? 394 LEU A O   1 
ATOM   246  C CB  . LEU A 1 51  ? 49.143 16.359  -8.355  1.00 25.34 ? 394 LEU A CB  1 
ATOM   247  C CG  . LEU A 1 51  ? 48.796 17.350  -7.229  1.00 25.82 ? 394 LEU A CG  1 
ATOM   248  C CD1 . LEU A 1 51  ? 48.177 16.673  -5.997  1.00 23.22 ? 394 LEU A CD1 1 
ATOM   249  C CD2 . LEU A 1 51  ? 50.039 18.132  -6.834  1.00 24.77 ? 394 LEU A CD2 1 
ATOM   250  N N   . VAL A 1 52  ? 45.689 15.690  -9.052  1.00 24.68 ? 395 VAL A N   1 
ATOM   251  C CA  . VAL A 1 52  ? 44.459 16.229  -9.630  1.00 24.80 ? 395 VAL A CA  1 
ATOM   252  C C   . VAL A 1 52  ? 43.790 17.325  -8.791  1.00 24.92 ? 395 VAL A C   1 
ATOM   253  O O   . VAL A 1 52  ? 43.174 18.236  -9.344  1.00 24.86 ? 395 VAL A O   1 
ATOM   254  C CB  . VAL A 1 52  ? 43.441 15.127  -10.019 1.00 24.62 ? 395 VAL A CB  1 
ATOM   255  C CG1 . VAL A 1 52  ? 43.988 14.280  -11.183 1.00 25.24 ? 395 VAL A CG1 1 
ATOM   256  C CG2 . VAL A 1 52  ? 43.064 14.248  -8.826  1.00 24.42 ? 395 VAL A CG2 1 
ATOM   257  N N   . VAL A 1 53  ? 43.911 17.236  -7.467  1.00 24.93 ? 396 VAL A N   1 
ATOM   258  C CA  . VAL A 1 53  ? 43.354 18.251  -6.570  1.00 25.17 ? 396 VAL A CA  1 
ATOM   259  C C   . VAL A 1 53  ? 44.371 18.592  -5.486  1.00 25.58 ? 396 VAL A C   1 
ATOM   260  O O   . VAL A 1 53  ? 45.045 17.709  -4.949  1.00 25.47 ? 396 VAL A O   1 
ATOM   261  C CB  . VAL A 1 53  ? 42.010 17.793  -5.910  1.00 25.07 ? 396 VAL A CB  1 
ATOM   262  C CG1 . VAL A 1 53  ? 41.464 18.865  -4.956  1.00 25.00 ? 396 VAL A CG1 1 
ATOM   263  C CG2 . VAL A 1 53  ? 40.960 17.459  -6.957  1.00 24.82 ? 396 VAL A CG2 1 
ATOM   264  N N   . GLU A 1 54  ? 44.496 19.882  -5.191  1.00 25.95 ? 397 GLU A N   1 
ATOM   265  C CA  . GLU A 1 54  ? 45.245 20.337  -4.028  1.00 26.61 ? 397 GLU A CA  1 
ATOM   266  C C   . GLU A 1 54  ? 44.463 21.435  -3.307  1.00 27.09 ? 397 GLU A C   1 
ATOM   267  O O   . GLU A 1 54  ? 43.996 22.391  -3.932  1.00 26.66 ? 397 GLU A O   1 
ATOM   268  C CB  . GLU A 1 54  ? 46.636 20.839  -4.417  1.00 26.16 ? 397 GLU A CB  1 
ATOM   269  C CG  . GLU A 1 54  ? 47.487 21.272  -3.221  1.00 26.79 ? 397 GLU A CG  1 
ATOM   270  C CD  . GLU A 1 54  ? 48.905 21.668  -3.592  1.00 26.67 ? 397 GLU A CD  1 
ATOM   271  O OE1 . GLU A 1 54  ? 49.326 21.403  -4.736  1.00 26.48 ? 397 GLU A OE1 1 
ATOM   272  O OE2 . GLU A 1 54  ? 49.603 22.245  -2.727  1.00 27.14 ? 397 GLU A OE2 1 
ATOM   273  N N   . GLU A 1 55  ? 44.314 21.271  -1.995  1.00 27.66 ? 398 GLU A N   1 
ATOM   274  C CA  . GLU A 1 55  ? 43.729 22.298  -1.136  1.00 28.44 ? 398 GLU A CA  1 
ATOM   275  C C   . GLU A 1 55  ? 44.354 22.198  0.238   1.00 28.14 ? 398 GLU A C   1 
ATOM   276  O O   . GLU A 1 55  ? 44.267 21.154  0.896   1.00 27.63 ? 398 GLU A O   1 
ATOM   277  C CB  . GLU A 1 55  ? 42.212 22.142  -1.018  1.00 28.54 ? 398 GLU A CB  1 
ATOM   278  C CG  . GLU A 1 55  ? 41.585 23.213  -0.104  1.00 30.01 ? 398 GLU A CG  1 
ATOM   279  C CD  . GLU A 1 55  ? 40.077 23.160  -0.050  1.00 30.70 ? 398 GLU A CD  1 
ATOM   280  O OE1 . GLU A 1 55  ? 39.467 22.409  -0.841  1.00 34.52 ? 398 GLU A OE1 1 
ATOM   281  O OE2 . GLU A 1 55  ? 39.494 23.872  0.802   1.00 34.54 ? 398 GLU A OE2 1 
ATOM   282  N N   . GLY A 1 56  ? 44.975 23.293  0.667   1.00 27.99 ? 399 GLY A N   1 
ATOM   283  C CA  . GLY A 1 56  ? 45.702 23.334  1.930   1.00 27.52 ? 399 GLY A CA  1 
ATOM   284  C C   . GLY A 1 56  ? 46.822 22.315  1.949   1.00 27.07 ? 399 GLY A C   1 
ATOM   285  O O   . GLY A 1 56  ? 47.695 22.319  1.077   1.00 26.92 ? 399 GLY A O   1 
ATOM   286  N N   . GLU A 1 57  ? 46.775 21.428  2.940   1.00 26.51 ? 400 GLU A N   1 
ATOM   287  C CA  . GLU A 1 57  ? 47.795 20.393  3.123   1.00 26.23 ? 400 GLU A CA  1 
ATOM   288  C C   . GLU A 1 57  ? 47.400 19.094  2.427   1.00 25.23 ? 400 GLU A C   1 
ATOM   289  O O   . GLU A 1 57  ? 48.141 18.111  2.473   1.00 25.24 ? 400 GLU A O   1 
ATOM   290  C CB  . GLU A 1 57  ? 48.034 20.129  4.622   1.00 26.62 ? 400 GLU A CB  1 
ATOM   291  C CG  . GLU A 1 57  ? 48.478 21.357  5.434   1.00 29.30 ? 400 GLU A CG  1 
ATOM   292  C CD  . GLU A 1 57  ? 47.353 22.374  5.650   1.00 33.41 ? 400 GLU A CD  1 
ATOM   293  O OE1 . GLU A 1 57  ? 46.156 22.003  5.541   1.00 35.94 ? 400 GLU A OE1 1 
ATOM   294  O OE2 . GLU A 1 57  ? 47.666 23.556  5.925   1.00 36.17 ? 400 GLU A OE2 1 
ATOM   295  N N   . MET A 1 58  ? 46.231 19.101  1.787   1.00 24.59 ? 401 MET A N   1 
ATOM   296  C CA  . MET A 1 58  ? 45.702 17.923  1.105   1.00 23.52 ? 401 MET A CA  1 
ATOM   297  C C   . MET A 1 58  ? 46.113 17.902  -0.377  1.00 23.47 ? 401 MET A C   1 
ATOM   298  O O   . MET A 1 58  ? 45.971 18.898  -1.086  1.00 22.36 ? 401 MET A O   1 
ATOM   299  C CB  . MET A 1 58  ? 44.178 17.868  1.255   1.00 23.43 ? 401 MET A CB  1 
ATOM   300  C CG  . MET A 1 58  ? 43.508 16.674  0.586   1.00 23.34 ? 401 MET A CG  1 
ATOM   301  S SD  . MET A 1 58  ? 41.710 16.682  0.674   1.00 22.74 ? 401 MET A SD  1 
ATOM   302  C CE  . MET A 1 58  ? 41.328 18.246  -0.113  1.00 25.89 ? 401 MET A CE  1 
ATOM   303  N N   . LYS A 1 59  ? 46.639 16.761  -0.822  1.00 23.03 ? 402 LYS A N   1 
ATOM   304  C CA  . LYS A 1 59  ? 46.953 16.538  -2.233  1.00 22.77 ? 402 LYS A CA  1 
ATOM   305  C C   . LYS A 1 59  ? 46.307 15.229  -2.662  1.00 22.76 ? 402 LYS A C   1 
ATOM   306  O O   . LYS A 1 59  ? 46.504 14.203  -2.008  1.00 22.12 ? 402 LYS A O   1 
ATOM   307  C CB  . LYS A 1 59  ? 48.462 16.466  -2.450  1.00 23.00 ? 402 LYS A CB  1 
ATOM   308  C CG  . LYS A 1 59  ? 49.186 17.800  -2.345  1.00 24.10 ? 402 LYS A CG  1 
ATOM   309  C CD  . LYS A 1 59  ? 50.683 17.624  -2.506  1.00 25.76 ? 402 LYS A CD  1 
ATOM   310  C CE  . LYS A 1 59  ? 51.389 18.970  -2.571  1.00 28.62 ? 402 LYS A CE  1 
ATOM   311  N NZ  . LYS A 1 59  ? 52.728 18.843  -3.213  1.00 29.68 ? 402 LYS A NZ  1 
ATOM   312  N N   . VAL A 1 60  ? 45.525 15.274  -3.740  1.00 22.32 ? 403 VAL A N   1 
ATOM   313  C CA  . VAL A 1 60  ? 44.827 14.088  -4.248  1.00 22.44 ? 403 VAL A CA  1 
ATOM   314  C C   . VAL A 1 60  ? 45.384 13.696  -5.625  1.00 22.66 ? 403 VAL A C   1 
ATOM   315  O O   . VAL A 1 60  ? 45.397 14.504  -6.558  1.00 21.84 ? 403 VAL A O   1 
ATOM   316  C CB  . VAL A 1 60  ? 43.286 14.301  -4.314  1.00 22.43 ? 403 VAL A CB  1 
ATOM   317  C CG1 . VAL A 1 60  ? 42.556 13.007  -4.711  1.00 22.50 ? 403 VAL A CG1 1 
ATOM   318  C CG2 . VAL A 1 60  ? 42.747 14.820  -2.975  1.00 22.37 ? 403 VAL A CG2 1 
ATOM   319  N N   . TYR A 1 61  ? 45.847 12.456  -5.726  1.00 23.07 ? 404 TYR A N   1 
ATOM   320  C CA  . TYR A 1 61  ? 46.454 11.936  -6.943  1.00 23.69 ? 404 TYR A CA  1 
ATOM   321  C C   . TYR A 1 61  ? 45.611 10.803  -7.509  1.00 24.55 ? 404 TYR A C   1 
ATOM   322  O O   . TYR A 1 61  ? 44.950 10.083  -6.758  1.00 24.15 ? 404 TYR A O   1 
ATOM   323  C CB  . TYR A 1 61  ? 47.829 11.355  -6.644  1.00 23.53 ? 404 TYR A CB  1 
ATOM   324  C CG  . TYR A 1 61  ? 48.826 12.269  -5.984  1.00 23.54 ? 404 TYR A CG  1 
ATOM   325  C CD1 . TYR A 1 61  ? 49.869 12.831  -6.716  1.00 24.14 ? 404 TYR A CD1 1 
ATOM   326  C CD2 . TYR A 1 61  ? 48.761 12.533  -4.615  1.00 23.24 ? 404 TYR A CD2 1 
ATOM   327  C CE1 . TYR A 1 61  ? 50.810 13.656  -6.109  1.00 22.96 ? 404 TYR A CE1 1 
ATOM   328  C CE2 . TYR A 1 61  ? 49.686 13.355  -4.003  1.00 22.79 ? 404 TYR A CE2 1 
ATOM   329  C CZ  . TYR A 1 61  ? 50.708 13.911  -4.752  1.00 23.16 ? 404 TYR A CZ  1 
ATOM   330  O OH  . TYR A 1 61  ? 51.624 14.716  -4.134  1.00 23.28 ? 404 TYR A OH  1 
ATOM   331  N N   . ARG A 1 62  ? 45.643 10.634  -8.831  1.00 25.25 ? 405 ARG A N   1 
ATOM   332  C CA  . ARG A 1 62  ? 45.106 9.425   -9.425  1.00 26.39 ? 405 ARG A CA  1 
ATOM   333  C C   . ARG A 1 62  ? 45.954 8.886   -10.580 1.00 27.29 ? 405 ARG A C   1 
ATOM   334  O O   . ARG A 1 62  ? 46.759 9.606   -11.183 1.00 26.81 ? 405 ARG A O   1 
ATOM   335  C CB  . ARG A 1 62  ? 43.641 9.597   -9.834  1.00 26.72 ? 405 ARG A CB  1 
ATOM   336  C CG  . ARG A 1 62  ? 43.418 10.310  -11.141 1.00 27.12 ? 405 ARG A CG  1 
ATOM   337  C CD  . ARG A 1 62  ? 41.972 10.165  -11.558 1.00 28.38 ? 405 ARG A CD  1 
ATOM   338  N NE  . ARG A 1 62  ? 41.569 11.281  -12.402 1.00 29.18 ? 405 ARG A NE  1 
ATOM   339  C CZ  . ARG A 1 62  ? 40.371 11.859  -12.378 1.00 28.77 ? 405 ARG A CZ  1 
ATOM   340  N NH1 . ARG A 1 62  ? 40.136 12.881  -13.192 1.00 28.28 ? 405 ARG A NH1 1 
ATOM   341  N NH2 . ARG A 1 62  ? 39.417 11.434  -11.546 1.00 25.30 ? 405 ARG A NH2 1 
ATOM   342  N N   . ARG A 1 63  ? 45.766 7.599   -10.848 1.00 28.23 ? 406 ARG A N   1 
ATOM   343  C CA  . ARG A 1 63  ? 46.371 6.917   -11.975 1.00 29.65 ? 406 ARG A CA  1 
ATOM   344  C C   . ARG A 1 63  ? 45.208 6.477   -12.847 1.00 30.18 ? 406 ARG A C   1 
ATOM   345  O O   . ARG A 1 63  ? 44.334 5.752   -12.383 1.00 30.07 ? 406 ARG A O   1 
ATOM   346  C CB  . ARG A 1 63  ? 47.148 5.696   -11.486 1.00 29.71 ? 406 ARG A CB  1 
ATOM   347  C CG  . ARG A 1 63  ? 48.044 5.064   -12.526 1.00 32.60 ? 406 ARG A CG  1 
ATOM   348  C CD  . ARG A 1 63  ? 48.465 3.655   -12.120 1.00 36.57 ? 406 ARG A CD  1 
ATOM   349  N NE  . ARG A 1 63  ? 49.665 3.202   -12.824 1.00 39.54 ? 406 ARG A NE  1 
ATOM   350  C CZ  . ARG A 1 63  ? 49.734 2.896   -14.121 1.00 41.14 ? 406 ARG A CZ  1 
ATOM   351  N NH1 . ARG A 1 63  ? 48.664 2.990   -14.906 1.00 42.25 ? 406 ARG A NH1 1 
ATOM   352  N NH2 . ARG A 1 63  ? 50.889 2.495   -14.639 1.00 41.30 ? 406 ARG A NH2 1 
ATOM   353  N N   . GLU A 1 64  ? 45.166 6.946   -14.091 1.00 30.94 ? 407 GLU A N   1 
ATOM   354  C CA  . GLU A 1 64  ? 44.081 6.560   -14.980 1.00 31.88 ? 407 GLU A CA  1 
ATOM   355  C C   . GLU A 1 64  ? 44.279 5.133   -15.490 1.00 32.41 ? 407 GLU A C   1 
ATOM   356  O O   . GLU A 1 64  ? 45.257 4.827   -16.170 1.00 32.29 ? 407 GLU A O   1 
ATOM   357  C CB  . GLU A 1 64  ? 43.895 7.568   -16.118 1.00 32.32 ? 407 GLU A CB  1 
ATOM   358  C CG  . GLU A 1 64  ? 43.160 8.828   -15.680 1.00 33.24 ? 407 GLU A CG  1 
ATOM   359  C CD  . GLU A 1 64  ? 42.693 9.684   -16.848 1.00 36.10 ? 407 GLU A CD  1 
ATOM   360  O OE1 . GLU A 1 64  ? 43.024 9.354   -18.006 1.00 36.32 ? 407 GLU A OE1 1 
ATOM   361  O OE2 . GLU A 1 64  ? 41.986 10.683  -16.605 1.00 36.97 ? 407 GLU A OE2 1 
ATOM   362  N N   . VAL A 1 65  ? 43.352 4.261   -15.106 1.00 33.10 ? 408 VAL A N   1 
ATOM   363  C CA  . VAL A 1 65  ? 43.418 2.842   -15.424 1.00 33.91 ? 408 VAL A CA  1 
ATOM   364  C C   . VAL A 1 65  ? 42.039 2.375   -15.873 1.00 34.83 ? 408 VAL A C   1 
ATOM   365  O O   . VAL A 1 65  ? 41.025 2.679   -15.234 1.00 34.38 ? 408 VAL A O   1 
ATOM   366  C CB  . VAL A 1 65  ? 43.900 1.990   -14.207 1.00 33.87 ? 408 VAL A CB  1 
ATOM   367  C CG1 . VAL A 1 65  ? 43.904 0.492   -14.533 1.00 33.51 ? 408 VAL A CG1 1 
ATOM   368  C CG2 . VAL A 1 65  ? 45.285 2.421   -13.755 1.00 33.51 ? 408 VAL A CG2 1 
ATOM   369  N N   . GLU A 1 66  ? 42.020 1.656   -16.991 1.00 35.99 ? 409 GLU A N   1 
ATOM   370  C CA  . GLU A 1 66  ? 40.829 0.976   -17.477 1.00 37.44 ? 409 GLU A CA  1 
ATOM   371  C C   . GLU A 1 66  ? 41.159 -0.481  -17.740 1.00 38.09 ? 409 GLU A C   1 
ATOM   372  O O   . GLU A 1 66  ? 42.196 -0.792  -18.329 1.00 38.23 ? 409 GLU A O   1 
ATOM   373  C CB  . GLU A 1 66  ? 40.334 1.603   -18.772 1.00 37.59 ? 409 GLU A CB  1 
ATOM   374  C CG  . GLU A 1 66  ? 39.590 2.900   -18.602 1.00 38.78 ? 409 GLU A CG  1 
ATOM   375  C CD  . GLU A 1 66  ? 39.084 3.428   -19.921 1.00 40.47 ? 409 GLU A CD  1 
ATOM   376  O OE1 . GLU A 1 66  ? 38.760 2.594   -20.799 1.00 40.40 ? 409 GLU A OE1 1 
ATOM   377  O OE2 . GLU A 1 66  ? 39.015 4.669   -20.078 1.00 40.89 ? 409 GLU A OE2 1 
ATOM   378  N N   . GLU A 1 67  ? 40.281 -1.370  -17.286 1.00 39.10 ? 410 GLU A N   1 
ATOM   379  C CA  . GLU A 1 67  ? 40.421 -2.797  -17.557 1.00 40.27 ? 410 GLU A CA  1 
ATOM   380  C C   . GLU A 1 67  ? 39.113 -3.318  -18.137 1.00 40.40 ? 410 GLU A C   1 
ATOM   381  O O   . GLU A 1 67  ? 38.056 -3.221  -17.501 1.00 40.58 ? 410 GLU A O   1 
ATOM   382  C CB  . GLU A 1 67  ? 40.870 -3.568  -16.304 1.00 40.20 ? 410 GLU A CB  1 
ATOM   383  C CG  . GLU A 1 67  ? 42.377 -3.405  -16.011 1.00 41.39 ? 410 GLU A CG  1 
ATOM   384  C CD  . GLU A 1 67  ? 42.818 -3.848  -14.612 1.00 41.59 ? 410 GLU A CD  1 
ATOM   385  O OE1 . GLU A 1 67  ? 42.032 -4.495  -13.884 1.00 43.35 ? 410 GLU A OE1 1 
ATOM   386  O OE2 . GLU A 1 67  ? 43.977 -3.548  -14.242 1.00 43.85 ? 410 GLU A OE2 1 
ATOM   387  N N   . ASN A 1 68  ? 39.203 -3.836  -19.365 1.00 40.68 ? 411 ASN A N   1 
ATOM   388  C CA  . ASN A 1 68  ? 38.043 -4.286  -20.161 1.00 40.71 ? 411 ASN A CA  1 
ATOM   389  C C   . ASN A 1 68  ? 36.979 -3.201  -20.335 1.00 40.02 ? 411 ASN A C   1 
ATOM   390  O O   . ASN A 1 68  ? 35.774 -3.453  -20.216 1.00 40.40 ? 411 ASN A O   1 
ATOM   391  C CB  . ASN A 1 68  ? 37.445 -5.582  -19.595 1.00 41.05 ? 411 ASN A CB  1 
ATOM   392  C CG  . ASN A 1 68  ? 38.480 -6.684  -19.445 1.00 42.21 ? 411 ASN A CG  1 
ATOM   393  O OD1 . ASN A 1 68  ? 39.290 -6.925  -20.346 1.00 43.98 ? 411 ASN A OD1 1 
ATOM   394  N ND2 . ASN A 1 68  ? 38.459 -7.360  -18.299 1.00 43.18 ? 411 ASN A ND2 1 
ATOM   395  N N   . GLY A 1 69  ? 37.447 -1.988  -20.606 1.00 39.31 ? 412 GLY A N   1 
ATOM   396  C CA  . GLY A 1 69  ? 36.574 -0.842  -20.827 1.00 38.09 ? 412 GLY A CA  1 
ATOM   397  C C   . GLY A 1 69  ? 35.970 -0.192  -19.597 1.00 37.18 ? 412 GLY A C   1 
ATOM   398  O O   . GLY A 1 69  ? 35.104 0.666   -19.730 1.00 37.21 ? 412 GLY A O   1 
ATOM   399  N N   . ILE A 1 70  ? 36.429 -0.590  -18.407 1.00 36.22 ? 413 ILE A N   1 
ATOM   400  C CA  . ILE A 1 70  ? 35.888 -0.083  -17.140 1.00 35.21 ? 413 ILE A CA  1 
ATOM   401  C C   . ILE A 1 70  ? 36.927 0.764   -16.388 1.00 34.06 ? 413 ILE A C   1 
ATOM   402  O O   . ILE A 1 70  ? 38.079 0.348   -16.229 1.00 33.73 ? 413 ILE A O   1 
ATOM   403  C CB  . ILE A 1 70  ? 35.363 -1.248  -16.233 1.00 35.57 ? 413 ILE A CB  1 
ATOM   404  C CG1 . ILE A 1 70  ? 34.279 -2.077  -16.953 1.00 36.08 ? 413 ILE A CG1 1 
ATOM   405  C CG2 . ILE A 1 70  ? 34.868 -0.734  -14.879 1.00 36.10 ? 413 ILE A CG2 1 
ATOM   406  C CD1 . ILE A 1 70  ? 33.078 -1.269  -17.465 1.00 37.52 ? 413 ILE A CD1 1 
ATOM   407  N N   . VAL A 1 71  ? 36.502 1.946   -15.944 1.00 32.74 ? 414 VAL A N   1 
ATOM   408  C CA  . VAL A 1 71  ? 37.359 2.898   -15.226 1.00 31.48 ? 414 VAL A CA  1 
ATOM   409  C C   . VAL A 1 71  ? 37.635 2.398   -13.802 1.00 30.49 ? 414 VAL A C   1 
ATOM   410  O O   . VAL A 1 71  ? 36.710 2.234   -12.997 1.00 30.17 ? 414 VAL A O   1 
ATOM   411  C CB  . VAL A 1 71  ? 36.733 4.317   -15.199 1.00 31.59 ? 414 VAL A CB  1 
ATOM   412  C CG1 . VAL A 1 71  ? 37.542 5.266   -14.318 1.00 31.07 ? 414 VAL A CG1 1 
ATOM   413  C CG2 . VAL A 1 71  ? 36.619 4.884   -16.621 1.00 31.57 ? 414 VAL A CG2 1 
ATOM   414  N N   . LEU A 1 72  ? 38.911 2.154   -13.513 1.00 29.39 ? 415 LEU A N   1 
ATOM   415  C CA  . LEU A 1 72  ? 39.339 1.599   -12.225 1.00 28.40 ? 415 LEU A CA  1 
ATOM   416  C C   . LEU A 1 72  ? 40.286 2.534   -11.456 1.00 27.75 ? 415 LEU A C   1 
ATOM   417  O O   . LEU A 1 72  ? 40.691 2.228   -10.326 1.00 28.11 ? 415 LEU A O   1 
ATOM   418  C CB  . LEU A 1 72  ? 40.001 0.232   -12.429 1.00 28.43 ? 415 LEU A CB  1 
ATOM   419  C CG  . LEU A 1 72  ? 39.192 -0.949  -12.994 1.00 29.10 ? 415 LEU A CG  1 
ATOM   420  C CD1 . LEU A 1 72  ? 39.999 -2.218  -12.862 1.00 29.29 ? 415 LEU A CD1 1 
ATOM   421  C CD2 . LEU A 1 72  ? 37.841 -1.125  -12.305 1.00 30.13 ? 415 LEU A CD2 1 
ATOM   422  N N   . ASP A 1 73  ? 40.623 3.659   -12.080 1.00 25.94 ? 416 ASP A N   1 
ATOM   423  C CA  . ASP A 1 73  ? 41.478 4.710   -11.515 1.00 24.78 ? 416 ASP A CA  1 
ATOM   424  C C   . ASP A 1 73  ? 41.795 4.594   -10.014 1.00 23.60 ? 416 ASP A C   1 
ATOM   425  O O   . ASP A 1 73  ? 41.006 5.051   -9.185  1.00 22.78 ? 416 ASP A O   1 
ATOM   426  C CB  . ASP A 1 73  ? 40.836 6.077   -11.770 1.00 24.60 ? 416 ASP A CB  1 
ATOM   427  C CG  . ASP A 1 73  ? 40.705 6.412   -13.254 1.00 25.57 ? 416 ASP A CG  1 
ATOM   428  O OD1 . ASP A 1 73  ? 41.000 5.545   -14.117 1.00 24.87 ? 416 ASP A OD1 1 
ATOM   429  O OD2 . ASP A 1 73  ? 40.293 7.557   -13.542 1.00 24.88 ? 416 ASP A OD2 1 
ATOM   430  N N   . PRO A 1 74  ? 42.937 3.969   -9.660  1.00 23.06 ? 417 PRO A N   1 
ATOM   431  C CA  . PRO A 1 74  ? 43.407 4.085   -8.269  1.00 22.63 ? 417 PRO A CA  1 
ATOM   432  C C   . PRO A 1 74  ? 43.509 5.554   -7.858  1.00 22.36 ? 417 PRO A C   1 
ATOM   433  O O   . PRO A 1 74  ? 43.921 6.395   -8.666  1.00 22.28 ? 417 PRO A O   1 
ATOM   434  C CB  . PRO A 1 74  ? 44.804 3.452   -8.307  1.00 22.73 ? 417 PRO A CB  1 
ATOM   435  C CG  . PRO A 1 74  ? 44.763 2.506   -9.473  1.00 23.28 ? 417 PRO A CG  1 
ATOM   436  C CD  . PRO A 1 74  ? 43.822 3.126   -10.483 1.00 22.90 ? 417 PRO A CD  1 
ATOM   437  N N   . LEU A 1 75  ? 43.107 5.848   -6.623  1.00 21.83 ? 418 LEU A N   1 
ATOM   438  C CA  . LEU A 1 75  ? 43.194 7.190   -6.057  1.00 21.63 ? 418 LEU A CA  1 
ATOM   439  C C   . LEU A 1 75  ? 44.065 7.151   -4.799  1.00 21.04 ? 418 LEU A C   1 
ATOM   440  O O   . LEU A 1 75  ? 44.022 6.191   -4.023  1.00 20.40 ? 418 LEU A O   1 
ATOM   441  C CB  . LEU A 1 75  ? 41.791 7.722   -5.732  1.00 21.63 ? 418 LEU A CB  1 
ATOM   442  C CG  . LEU A 1 75  ? 41.697 9.165   -5.225  1.00 23.59 ? 418 LEU A CG  1 
ATOM   443  C CD1 . LEU A 1 75  ? 40.510 9.898   -5.851  1.00 24.92 ? 418 LEU A CD1 1 
ATOM   444  C CD2 . LEU A 1 75  ? 41.648 9.238   -3.695  1.00 25.06 ? 418 LEU A CD2 1 
ATOM   445  N N   . LYS A 1 76  ? 44.888 8.174   -4.625  1.00 20.59 ? 419 LYS A N   1 
ATOM   446  C CA  . LYS A 1 76  ? 45.685 8.292   -3.413  1.00 20.74 ? 419 LYS A CA  1 
ATOM   447  C C   . LYS A 1 76  ? 45.713 9.752   -2.996  1.00 20.54 ? 419 LYS A C   1 
ATOM   448  O O   . LYS A 1 76  ? 45.947 10.632  -3.823  1.00 20.00 ? 419 LYS A O   1 
ATOM   449  C CB  . LYS A 1 76  ? 47.107 7.743   -3.602  1.00 20.23 ? 419 LYS A CB  1 
ATOM   450  C CG  . LYS A 1 76  ? 48.038 8.050   -2.421  1.00 21.72 ? 419 LYS A CG  1 
ATOM   451  C CD  . LYS A 1 76  ? 49.313 7.230   -2.426  1.00 22.64 ? 419 LYS A CD  1 
ATOM   452  C CE  . LYS A 1 76  ? 50.314 7.832   -1.433  1.00 25.42 ? 419 LYS A CE  1 
ATOM   453  N NZ  . LYS A 1 76  ? 51.428 6.904   -1.122  1.00 28.47 ? 419 LYS A NZ  1 
ATOM   454  N N   . ALA A 1 77  ? 45.449 9.993   -1.714  1.00 19.66 ? 420 ALA A N   1 
ATOM   455  C CA  . ALA A 1 77  ? 45.508 11.330  -1.158  1.00 19.62 ? 420 ALA A CA  1 
ATOM   456  C C   . ALA A 1 77  ? 46.461 11.339  0.017   1.00 19.72 ? 420 ALA A C   1 
ATOM   457  O O   . ALA A 1 77  ? 46.529 10.369  0.780   1.00 18.89 ? 420 ALA A O   1 
ATOM   458  C CB  . ALA A 1 77  ? 44.129 11.778  -0.709  1.00 19.33 ? 420 ALA A CB  1 
ATOM   459  N N   . THR A 1 78  ? 47.197 12.436  0.156   1.00 19.79 ? 421 THR A N   1 
ATOM   460  C CA  . THR A 1 78  ? 47.995 12.665  1.347   1.00 20.48 ? 421 THR A CA  1 
ATOM   461  C C   . THR A 1 78  ? 47.459 13.919  2.020   1.00 20.94 ? 421 THR A C   1 
ATOM   462  O O   . THR A 1 78  ? 46.879 14.797  1.362   1.00 21.03 ? 421 THR A O   1 
ATOM   463  C CB  . THR A 1 78  ? 49.496 12.835  1.035   1.00 20.49 ? 421 THR A CB  1 
ATOM   464  O OG1 . THR A 1 78  ? 49.675 13.873  0.061   1.00 20.81 ? 421 THR A OG1 1 
ATOM   465  C CG2 . THR A 1 78  ? 50.102 11.533  0.512   1.00 21.54 ? 421 THR A CG2 1 
ATOM   466  N N   . HIS A 1 79  ? 47.643 13.997  3.334   1.00 21.22 ? 422 HIS A N   1 
ATOM   467  C CA  . HIS A 1 79  ? 47.145 15.118  4.107   1.00 21.81 ? 422 HIS A CA  1 
ATOM   468  C C   . HIS A 1 79  ? 47.941 15.197  5.399   1.00 22.09 ? 422 HIS A C   1 
ATOM   469  O O   . HIS A 1 79  ? 48.531 14.215  5.830   1.00 22.35 ? 422 HIS A O   1 
ATOM   470  C CB  . HIS A 1 79  ? 45.657 14.932  4.427   1.00 21.66 ? 422 HIS A CB  1 
ATOM   471  C CG  . HIS A 1 79  ? 44.928 16.214  4.701   1.00 22.93 ? 422 HIS A CG  1 
ATOM   472  N ND1 . HIS A 1 79  ? 43.555 16.311  4.644   1.00 24.49 ? 422 HIS A ND1 1 
ATOM   473  C CD2 . HIS A 1 79  ? 45.378 17.454  5.003   1.00 23.24 ? 422 HIS A CD2 1 
ATOM   474  C CE1 . HIS A 1 79  ? 43.188 17.548  4.928   1.00 23.71 ? 422 HIS A CE1 1 
ATOM   475  N NE2 . HIS A 1 79  ? 44.277 18.263  5.146   1.00 25.29 ? 422 HIS A NE2 1 
ATOM   476  N N   . ALA A 1 80  ? 47.961 16.382  5.994   1.00 22.72 ? 423 ALA A N   1 
ATOM   477  C CA  . ALA A 1 80  ? 48.629 16.618  7.271   1.00 23.49 ? 423 ALA A CA  1 
ATOM   478  C C   . ALA A 1 80  ? 47.674 17.461  8.106   1.00 23.93 ? 423 ALA A C   1 
ATOM   479  O O   . ALA A 1 80  ? 47.260 18.550  7.680   1.00 24.05 ? 423 ALA A O   1 
ATOM   480  C CB  . ALA A 1 80  ? 49.952 17.334  7.048   1.00 23.67 ? 423 ALA A CB  1 
ATOM   481  N N   . VAL A 1 81  ? 47.284 16.928  9.265   1.00 24.19 ? 424 VAL A N   1 
ATOM   482  C CA  . VAL A 1 81  ? 46.214 17.509  10.083  1.00 24.31 ? 424 VAL A CA  1 
ATOM   483  C C   . VAL A 1 81  ? 46.749 17.815  11.482  1.00 24.74 ? 424 VAL A C   1 
ATOM   484  O O   . VAL A 1 81  ? 47.097 16.903  12.236  1.00 24.26 ? 424 VAL A O   1 
ATOM   485  C CB  . VAL A 1 81  ? 44.984 16.561  10.176  1.00 24.46 ? 424 VAL A CB  1 
ATOM   486  C CG1 . VAL A 1 81  ? 43.838 17.219  10.939  1.00 24.82 ? 424 VAL A CG1 1 
ATOM   487  C CG2 . VAL A 1 81  ? 44.510 16.148  8.783   1.00 23.81 ? 424 VAL A CG2 1 
ATOM   488  N N   . LYS A 1 82  ? 46.828 19.104  11.814  1.00 25.08 ? 425 LYS A N   1 
ATOM   489  C CA  . LYS A 1 82  ? 47.384 19.542  13.103  1.00 25.84 ? 425 LYS A CA  1 
ATOM   490  C C   . LYS A 1 82  ? 46.436 19.202  14.240  1.00 25.26 ? 425 LYS A C   1 
ATOM   491  O O   . LYS A 1 82  ? 45.225 19.228  14.060  1.00 24.97 ? 425 LYS A O   1 
ATOM   492  C CB  . LYS A 1 82  ? 47.651 21.057  13.096  1.00 25.90 ? 425 LYS A CB  1 
ATOM   493  C CG  . LYS A 1 82  ? 48.773 21.493  12.163  1.00 27.69 ? 425 LYS A CG  1 
ATOM   494  C CD  . LYS A 1 82  ? 48.761 22.998  11.912  1.00 27.61 ? 425 LYS A CD  1 
ATOM   495  C CE  . LYS A 1 82  ? 50.136 23.484  11.462  1.00 31.70 ? 425 LYS A CE  1 
ATOM   496  N NZ  . LYS A 1 82  ? 50.648 22.730  10.271  1.00 34.30 ? 425 LYS A NZ  1 
ATOM   497  N N   . GLY A 1 83  ? 46.992 18.890  15.410  1.00 25.73 ? 426 GLY A N   1 
ATOM   498  C CA  . GLY A 1 83  ? 46.183 18.742  16.631  1.00 25.77 ? 426 GLY A CA  1 
ATOM   499  C C   . GLY A 1 83  ? 45.357 17.473  16.797  1.00 25.86 ? 426 GLY A C   1 
ATOM   500  O O   . GLY A 1 83  ? 44.490 17.411  17.676  1.00 26.40 ? 426 GLY A O   1 
ATOM   501  N N   . VAL A 1 84  ? 45.599 16.470  15.953  1.00 25.37 ? 427 VAL A N   1 
ATOM   502  C CA  . VAL A 1 84  ? 44.974 15.139  16.122  1.00 24.54 ? 427 VAL A CA  1 
ATOM   503  C C   . VAL A 1 84  ? 46.027 14.033  15.996  1.00 23.97 ? 427 VAL A C   1 
ATOM   504  O O   . VAL A 1 84  ? 47.101 14.266  15.434  1.00 24.24 ? 427 VAL A O   1 
ATOM   505  C CB  . VAL A 1 84  ? 43.812 14.876  15.115  1.00 24.53 ? 427 VAL A CB  1 
ATOM   506  C CG1 . VAL A 1 84  ? 42.713 15.938  15.227  1.00 24.59 ? 427 VAL A CG1 1 
ATOM   507  C CG2 . VAL A 1 84  ? 44.335 14.753  13.673  1.00 24.04 ? 427 VAL A CG2 1 
ATOM   508  N N   . THR A 1 85  ? 45.731 12.844  16.529  1.00 23.06 ? 428 THR A N   1 
ATOM   509  C CA  . THR A 1 85  ? 46.611 11.686  16.368  1.00 22.42 ? 428 THR A CA  1 
ATOM   510  C C   . THR A 1 85  ? 46.053 10.726  15.317  1.00 22.22 ? 428 THR A C   1 
ATOM   511  O O   . THR A 1 85  ? 44.874 10.804  14.960  1.00 22.18 ? 428 THR A O   1 
ATOM   512  C CB  . THR A 1 85  ? 46.811 10.884  17.687  1.00 22.76 ? 428 THR A CB  1 
ATOM   513  O OG1 . THR A 1 85  ? 45.584 10.247  18.051  1.00 21.34 ? 428 THR A OG1 1 
ATOM   514  C CG2 . THR A 1 85  ? 47.284 11.787  18.838  1.00 22.20 ? 428 THR A CG2 1 
ATOM   515  N N   . GLY A 1 86  ? 46.905 9.824   14.837  1.00 22.21 ? 429 GLY A N   1 
ATOM   516  C CA  . GLY A 1 86  ? 46.490 8.735   13.933  1.00 22.09 ? 429 GLY A CA  1 
ATOM   517  C C   . GLY A 1 86  ? 45.453 7.817   14.564  1.00 22.13 ? 429 GLY A C   1 
ATOM   518  O O   . GLY A 1 86  ? 44.491 7.411   13.909  1.00 21.94 ? 429 GLY A O   1 
ATOM   519  N N   . HIS A 1 87  ? 45.640 7.503   15.846  1.00 21.84 ? 430 HIS A N   1 
ATOM   520  C CA  . HIS A 1 87  ? 44.658 6.712   16.600  1.00 21.78 ? 430 HIS A CA  1 
ATOM   521  C C   . HIS A 1 87  ? 43.266 7.358   16.581  1.00 21.46 ? 430 HIS A C   1 
ATOM   522  O O   . HIS A 1 87  ? 42.262 6.685   16.325  1.00 21.22 ? 430 HIS A O   1 
ATOM   523  C CB  . HIS A 1 87  ? 45.121 6.520   18.045  1.00 22.10 ? 430 HIS A CB  1 
ATOM   524  C CG  . HIS A 1 87  ? 44.367 5.461   18.792  1.00 22.47 ? 430 HIS A CG  1 
ATOM   525  N ND1 . HIS A 1 87  ? 44.755 5.016   20.037  1.00 23.27 ? 430 HIS A ND1 1 
ATOM   526  C CD2 . HIS A 1 87  ? 43.277 4.730   18.456  1.00 23.54 ? 430 HIS A CD2 1 
ATOM   527  C CE1 . HIS A 1 87  ? 43.920 4.076   20.448  1.00 24.34 ? 430 HIS A CE1 1 
ATOM   528  N NE2 . HIS A 1 87  ? 43.016 3.881   19.505  1.00 24.40 ? 430 HIS A NE2 1 
ATOM   529  N N   . GLU A 1 88  ? 43.217 8.661   16.854  1.00 20.89 ? 431 GLU A N   1 
ATOM   530  C CA  . GLU A 1 88  ? 41.973 9.415   16.853  1.00 20.68 ? 431 GLU A CA  1 
ATOM   531  C C   . GLU A 1 88  ? 41.322 9.405   15.475  1.00 20.23 ? 431 GLU A C   1 
ATOM   532  O O   . GLU A 1 88  ? 40.130 9.115   15.347  1.00 19.92 ? 431 GLU A O   1 
ATOM   533  C CB  . GLU A 1 88  ? 42.216 10.855  17.333  1.00 20.83 ? 431 GLU A CB  1 
ATOM   534  C CG  . GLU A 1 88  ? 42.390 10.957  18.848  1.00 20.89 ? 431 GLU A CG  1 
ATOM   535  C CD  . GLU A 1 88  ? 42.877 12.320  19.334  1.00 22.15 ? 431 GLU A CD  1 
ATOM   536  O OE1 . GLU A 1 88  ? 43.376 13.141  18.525  1.00 21.96 ? 431 GLU A OE1 1 
ATOM   537  O OE2 . GLU A 1 88  ? 42.765 12.565  20.555  1.00 22.40 ? 431 GLU A OE2 1 
ATOM   538  N N   . VAL A 1 89  ? 42.110 9.708   14.448  1.00 19.75 ? 432 VAL A N   1 
ATOM   539  C CA  . VAL A 1 89  ? 41.590 9.764   13.080  1.00 19.79 ? 432 VAL A CA  1 
ATOM   540  C C   . VAL A 1 89  ? 41.016 8.405   12.666  1.00 19.89 ? 432 VAL A C   1 
ATOM   541  O O   . VAL A 1 89  ? 39.902 8.330   12.159  1.00 20.18 ? 432 VAL A O   1 
ATOM   542  C CB  . VAL A 1 89  ? 42.656 10.255  12.084  1.00 19.46 ? 432 VAL A CB  1 
ATOM   543  C CG1 . VAL A 1 89  ? 42.188 10.054  10.641  1.00 19.84 ? 432 VAL A CG1 1 
ATOM   544  C CG2 . VAL A 1 89  ? 42.950 11.726  12.334  1.00 19.46 ? 432 VAL A CG2 1 
ATOM   545  N N   . CYS A 1 90  ? 41.775 7.341   12.911  1.00 20.51 ? 433 CYS A N   1 
ATOM   546  C CA  . CYS A 1 90  ? 41.332 5.994   12.573  1.00 21.27 ? 433 CYS A CA  1 
ATOM   547  C C   . CYS A 1 90  ? 40.104 5.565   13.379  1.00 21.52 ? 433 CYS A C   1 
ATOM   548  O O   . CYS A 1 90  ? 39.185 4.974   12.822  1.00 20.86 ? 433 CYS A O   1 
ATOM   549  C CB  . CYS A 1 90  ? 42.487 5.002   12.707  1.00 21.31 ? 433 CYS A CB  1 
ATOM   550  S SG  . CYS A 1 90  ? 43.655 5.128   11.334  1.00 22.27 ? 433 CYS A SG  1 
ATOM   551  N N   . ASN A 1 91  ? 40.076 5.873   14.677  1.00 22.09 ? 434 ASN A N   1 
ATOM   552  C CA  . ASN A 1 91  ? 38.875 5.606   15.487  1.00 22.65 ? 434 ASN A CA  1 
ATOM   553  C C   . ASN A 1 91  ? 37.604 6.204   14.899  1.00 22.59 ? 434 ASN A C   1 
ATOM   554  O O   . ASN A 1 91  ? 36.599 5.512   14.760  1.00 22.32 ? 434 ASN A O   1 
ATOM   555  C CB  . ASN A 1 91  ? 39.040 6.087   16.931  1.00 23.04 ? 434 ASN A CB  1 
ATOM   556  C CG  . ASN A 1 91  ? 39.747 5.082   17.806  1.00 24.02 ? 434 ASN A CG  1 
ATOM   557  O OD1 . ASN A 1 91  ? 39.968 3.934   17.415  1.00 25.86 ? 434 ASN A OD1 1 
ATOM   558  N ND2 . ASN A 1 91  ? 40.102 5.508   19.012  1.00 25.29 ? 434 ASN A ND2 1 
ATOM   559  N N   . TYR A 1 92  ? 37.657 7.485   14.550  1.00 22.81 ? 435 TYR A N   1 
ATOM   560  C CA  . TYR A 1 92  ? 36.497 8.180   13.993  1.00 23.45 ? 435 TYR A CA  1 
ATOM   561  C C   . TYR A 1 92  ? 36.107 7.681   12.596  1.00 23.00 ? 435 TYR A C   1 
ATOM   562  O O   . TYR A 1 92  ? 34.927 7.685   12.245  1.00 22.84 ? 435 TYR A O   1 
ATOM   563  C CB  . TYR A 1 92  ? 36.714 9.700   14.000  1.00 24.35 ? 435 TYR A CB  1 
ATOM   564  C CG  . TYR A 1 92  ? 36.491 10.329  15.366  1.00 25.76 ? 435 TYR A CG  1 
ATOM   565  C CD1 . TYR A 1 92  ? 35.196 10.590  15.837  1.00 27.63 ? 435 TYR A CD1 1 
ATOM   566  C CD2 . TYR A 1 92  ? 37.563 10.651  16.187  1.00 25.48 ? 435 TYR A CD2 1 
ATOM   567  C CE1 . TYR A 1 92  ? 34.984 11.164  17.104  1.00 28.18 ? 435 TYR A CE1 1 
ATOM   568  C CE2 . TYR A 1 92  ? 37.360 11.223  17.457  1.00 26.91 ? 435 TYR A CE2 1 
ATOM   569  C CZ  . TYR A 1 92  ? 36.074 11.477  17.901  1.00 27.02 ? 435 TYR A CZ  1 
ATOM   570  O OH  . TYR A 1 92  ? 35.882 12.049  19.150  1.00 28.23 ? 435 TYR A OH  1 
ATOM   571  N N   . PHE A 1 93  ? 37.099 7.252   11.815  1.00 22.72 ? 436 PHE A N   1 
ATOM   572  C CA  . PHE A 1 93  ? 36.856 6.707   10.478  1.00 22.30 ? 436 PHE A CA  1 
ATOM   573  C C   . PHE A 1 93  ? 36.208 5.325   10.520  1.00 22.43 ? 436 PHE A C   1 
ATOM   574  O O   . PHE A 1 93  ? 35.375 5.000   9.662   1.00 22.33 ? 436 PHE A O   1 
ATOM   575  C CB  . PHE A 1 93  ? 38.152 6.652   9.670   1.00 22.27 ? 436 PHE A CB  1 
ATOM   576  C CG  . PHE A 1 93  ? 37.961 6.215   8.236   1.00 21.99 ? 436 PHE A CG  1 
ATOM   577  C CD1 . PHE A 1 93  ? 37.185 6.969   7.353   1.00 21.05 ? 436 PHE A CD1 1 
ATOM   578  C CD2 . PHE A 1 93  ? 38.552 5.046   7.773   1.00 20.44 ? 436 PHE A CD2 1 
ATOM   579  C CE1 . PHE A 1 93  ? 37.015 6.569   6.020   1.00 21.15 ? 436 PHE A CE1 1 
ATOM   580  C CE2 . PHE A 1 93  ? 38.386 4.631   6.448   1.00 20.73 ? 436 PHE A CE2 1 
ATOM   581  C CZ  . PHE A 1 93  ? 37.617 5.396   5.569   1.00 20.90 ? 436 PHE A CZ  1 
ATOM   582  N N   . TRP A 1 94  ? 36.601 4.526   11.513  1.00 22.08 ? 437 TRP A N   1 
ATOM   583  C CA  . TRP A 1 94  ? 36.138 3.145   11.666  1.00 22.35 ? 437 TRP A CA  1 
ATOM   584  C C   . TRP A 1 94  ? 34.819 3.025   12.428  1.00 23.20 ? 437 TRP A C   1 
ATOM   585  O O   . TRP A 1 94  ? 33.953 2.227   12.059  1.00 22.65 ? 437 TRP A O   1 
ATOM   586  C CB  . TRP A 1 94  ? 37.210 2.303   12.367  1.00 22.03 ? 437 TRP A CB  1 
ATOM   587  C CG  . TRP A 1 94  ? 36.834 0.855   12.529  1.00 22.00 ? 437 TRP A CG  1 
ATOM   588  C CD1 . TRP A 1 94  ? 36.877 -0.117  11.564  1.00 22.14 ? 437 TRP A CD1 1 
ATOM   589  C CD2 . TRP A 1 94  ? 36.338 0.222   13.716  1.00 21.23 ? 437 TRP A CD2 1 
ATOM   590  N NE1 . TRP A 1 94  ? 36.448 -1.317  12.083  1.00 22.05 ? 437 TRP A NE1 1 
ATOM   591  C CE2 . TRP A 1 94  ? 36.109 -1.137  13.401  1.00 21.66 ? 437 TRP A CE2 1 
ATOM   592  C CE3 . TRP A 1 94  ? 36.067 0.671   15.020  1.00 20.54 ? 437 TRP A CE3 1 
ATOM   593  C CZ2 . TRP A 1 94  ? 35.624 -2.055  14.342  1.00 20.96 ? 437 TRP A CZ2 1 
ATOM   594  C CZ3 . TRP A 1 94  ? 35.594 -0.245  15.957  1.00 21.78 ? 437 TRP A CZ3 1 
ATOM   595  C CH2 . TRP A 1 94  ? 35.380 -1.594  15.611  1.00 21.65 ? 437 TRP A CH2 1 
ATOM   596  N N   . ASN A 1 95  ? 34.681 3.809   13.497  1.00 24.36 ? 438 ASN A N   1 
ATOM   597  C CA  . ASN A 1 95  ? 33.561 3.676   14.435  1.00 26.20 ? 438 ASN A CA  1 
ATOM   598  C C   . ASN A 1 95  ? 32.208 3.994   13.792  1.00 26.48 ? 438 ASN A C   1 
ATOM   599  O O   . ASN A 1 95  ? 31.931 5.141   13.465  1.00 26.37 ? 438 ASN A O   1 
ATOM   600  C CB  . ASN A 1 95  ? 33.808 4.556   15.675  1.00 26.73 ? 438 ASN A CB  1 
ATOM   601  C CG  . ASN A 1 95  ? 32.761 4.370   16.759  1.00 28.96 ? 438 ASN A CG  1 
ATOM   602  O OD1 . ASN A 1 95  ? 32.014 3.385   16.777  1.00 31.51 ? 438 ASN A OD1 1 
ATOM   603  N ND2 . ASN A 1 95  ? 32.708 5.328   17.682  1.00 32.59 ? 438 ASN A ND2 1 
ATOM   604  N N   . VAL A 1 96  ? 31.379 2.962   13.608  1.00 27.54 ? 439 VAL A N   1 
ATOM   605  C CA  . VAL A 1 96  ? 30.037 3.119   13.012  1.00 28.36 ? 439 VAL A CA  1 
ATOM   606  C C   . VAL A 1 96  ? 29.083 3.952   13.874  1.00 29.54 ? 439 VAL A C   1 
ATOM   607  O O   . VAL A 1 96  ? 28.126 4.534   13.361  1.00 29.26 ? 439 VAL A O   1 
ATOM   608  C CB  . VAL A 1 96  ? 29.352 1.754   12.686  1.00 28.34 ? 439 VAL A CB  1 
ATOM   609  C CG1 . VAL A 1 96  ? 30.086 1.027   11.558  1.00 27.53 ? 439 VAL A CG1 1 
ATOM   610  C CG2 . VAL A 1 96  ? 29.210 0.877   13.941  1.00 28.11 ? 439 VAL A CG2 1 
ATOM   611  N N   . ASP A 1 97  ? 29.353 4.002   15.177  1.00 30.85 ? 440 ASP A N   1 
ATOM   612  C CA  . ASP A 1 97  ? 28.532 4.768   16.116  1.00 32.35 ? 440 ASP A CA  1 
ATOM   613  C C   . ASP A 1 97  ? 28.481 6.252   15.762  1.00 32.97 ? 440 ASP A C   1 
ATOM   614  O O   . ASP A 1 97  ? 27.521 6.936   16.120  1.00 33.27 ? 440 ASP A O   1 
ATOM   615  C CB  . ASP A 1 97  ? 29.035 4.598   17.557  1.00 32.45 ? 440 ASP A CB  1 
ATOM   616  C CG  . ASP A 1 97  ? 29.063 3.145   18.014  1.00 33.74 ? 440 ASP A CG  1 
ATOM   617  O OD1 . ASP A 1 97  ? 28.283 2.319   17.498  1.00 35.10 ? 440 ASP A OD1 1 
ATOM   618  O OD2 . ASP A 1 97  ? 29.875 2.825   18.912  1.00 37.65 ? 440 ASP A OD2 1 
ATOM   619  N N   . VAL A 1 98  ? 29.508 6.744   15.064  1.00 33.91 ? 441 VAL A N   1 
ATOM   620  C CA  . VAL A 1 98  ? 29.592 8.163   14.682  1.00 35.07 ? 441 VAL A CA  1 
ATOM   621  C C   . VAL A 1 98  ? 29.539 8.420   13.169  1.00 35.91 ? 441 VAL A C   1 
ATOM   622  O O   . VAL A 1 98  ? 29.763 9.546   12.717  1.00 36.13 ? 441 VAL A O   1 
ATOM   623  C CB  . VAL A 1 98  ? 30.857 8.872   15.284  1.00 35.01 ? 441 VAL A CB  1 
ATOM   624  C CG1 . VAL A 1 98  ? 30.780 8.926   16.793  1.00 35.22 ? 441 VAL A CG1 1 
ATOM   625  C CG2 . VAL A 1 98  ? 32.148 8.195   14.834  1.00 35.03 ? 441 VAL A CG2 1 
ATOM   626  N N   . ARG A 1 99  ? 29.234 7.382   12.396  1.00 36.94 ? 442 ARG A N   1 
ATOM   627  C CA  . ARG A 1 99  ? 29.241 7.465   10.932  1.00 37.94 ? 442 ARG A CA  1 
ATOM   628  C C   . ARG A 1 99  ? 28.359 8.587   10.382  1.00 38.54 ? 442 ARG A C   1 
ATOM   629  O O   . ARG A 1 99  ? 28.786 9.348   9.514   1.00 38.55 ? 442 ARG A O   1 
ATOM   630  C CB  . ARG A 1 99  ? 28.845 6.115   10.316  1.00 37.96 ? 442 ARG A CB  1 
ATOM   631  C CG  . ARG A 1 99  ? 28.880 6.054   8.777   1.00 38.75 ? 442 ARG A CG  1 
ATOM   632  C CD  . ARG A 1 99  ? 30.282 6.276   8.198   1.00 39.43 ? 442 ARG A CD  1 
ATOM   633  N NE  . ARG A 1 99  ? 31.317 5.623   8.997   1.00 41.24 ? 442 ARG A NE  1 
ATOM   634  C CZ  . ARG A 1 99  ? 31.738 4.371   8.825   1.00 40.73 ? 442 ARG A CZ  1 
ATOM   635  N NH1 . ARG A 1 99  ? 31.226 3.610   7.865   1.00 40.27 ? 442 ARG A NH1 1 
ATOM   636  N NH2 . ARG A 1 99  ? 32.678 3.884   9.622   1.00 39.48 ? 442 ARG A NH2 1 
ATOM   637  N N   . ASN A 1 100 ? 27.141 8.693   10.907  1.00 39.60 ? 443 ASN A N   1 
ATOM   638  C CA  . ASN A 1 100 ? 26.168 9.690   10.443  1.00 40.44 ? 443 ASN A CA  1 
ATOM   639  C C   . ASN A 1 100 ? 26.595 11.140  10.661  1.00 40.88 ? 443 ASN A C   1 
ATOM   640  O O   . ASN A 1 100 ? 26.144 12.035  9.946   1.00 40.97 ? 443 ASN A O   1 
ATOM   641  C CB  . ASN A 1 100 ? 24.800 9.436   11.087  1.00 40.67 ? 443 ASN A CB  1 
ATOM   642  C CG  . ASN A 1 100 ? 24.302 8.008   10.870  1.00 41.13 ? 443 ASN A CG  1 
ATOM   643  O OD1 . ASN A 1 100 ? 23.772 7.378   11.789  1.00 41.71 ? 443 ASN A OD1 1 
ATOM   644  N ND2 . ASN A 1 100 ? 24.479 7.492   9.654   1.00 41.61 ? 443 ASN A ND2 1 
ATOM   645  N N   . ASP A 1 101 ? 27.478 11.361  11.636  1.00 41.36 ? 444 ASP A N   1 
ATOM   646  C CA  . ASP A 1 101 ? 27.921 12.708  12.000  1.00 41.50 ? 444 ASP A CA  1 
ATOM   647  C C   . ASP A 1 101 ? 28.848 13.360  10.967  1.00 41.21 ? 444 ASP A C   1 
ATOM   648  O O   . ASP A 1 101 ? 28.973 14.587  10.938  1.00 41.36 ? 444 ASP A O   1 
ATOM   649  C CB  . ASP A 1 101 ? 28.564 12.708  13.397  1.00 42.02 ? 444 ASP A CB  1 
ATOM   650  C CG  . ASP A 1 101 ? 27.636 12.154  14.473  1.00 43.08 ? 444 ASP A CG  1 
ATOM   651  O OD1 . ASP A 1 101 ? 26.405 12.364  14.381  1.00 45.20 ? 444 ASP A OD1 1 
ATOM   652  O OD2 . ASP A 1 101 ? 28.134 11.500  15.414  1.00 44.70 ? 444 ASP A OD2 1 
ATOM   653  N N   . TRP A 1 102 ? 29.480 12.553  10.116  1.00 40.48 ? 445 TRP A N   1 
ATOM   654  C CA  . TRP A 1 102 ? 30.395 13.081  9.105   1.00 40.02 ? 445 TRP A CA  1 
ATOM   655  C C   . TRP A 1 102 ? 30.115 12.610  7.676   1.00 40.44 ? 445 TRP A C   1 
ATOM   656  O O   . TRP A 1 102 ? 30.454 13.311  6.715   1.00 40.45 ? 445 TRP A O   1 
ATOM   657  C CB  . TRP A 1 102 ? 31.863 12.805  9.483   1.00 39.18 ? 445 TRP A CB  1 
ATOM   658  C CG  . TRP A 1 102 ? 32.233 11.342  9.574   1.00 37.95 ? 445 TRP A CG  1 
ATOM   659  C CD1 . TRP A 1 102 ? 32.205 10.559  10.692  1.00 37.09 ? 445 TRP A CD1 1 
ATOM   660  C CD2 . TRP A 1 102 ? 32.696 10.500  8.507   1.00 36.66 ? 445 TRP A CD2 1 
ATOM   661  N NE1 . TRP A 1 102 ? 32.618 9.283   10.388  1.00 36.82 ? 445 TRP A NE1 1 
ATOM   662  C CE2 . TRP A 1 102 ? 32.928 9.220   9.055   1.00 36.43 ? 445 TRP A CE2 1 
ATOM   663  C CE3 . TRP A 1 102 ? 32.939 10.703  7.141   1.00 36.65 ? 445 TRP A CE3 1 
ATOM   664  C CZ2 . TRP A 1 102 ? 33.384 8.140   8.282   1.00 37.20 ? 445 TRP A CZ2 1 
ATOM   665  C CZ3 . TRP A 1 102 ? 33.393 9.630   6.374   1.00 37.04 ? 445 TRP A CZ3 1 
ATOM   666  C CH2 . TRP A 1 102 ? 33.612 8.368   6.948   1.00 36.89 ? 445 TRP A CH2 1 
ATOM   667  N N   . GLU A 1 103 ? 29.513 11.428  7.544   1.00 40.88 ? 446 GLU A N   1 
ATOM   668  C CA  . GLU A 1 103 ? 29.290 10.804  6.238   1.00 41.57 ? 446 GLU A CA  1 
ATOM   669  C C   . GLU A 1 103 ? 28.191 11.497  5.424   1.00 41.81 ? 446 GLU A C   1 
ATOM   670  O O   . GLU A 1 103 ? 27.122 11.805  5.951   1.00 41.77 ? 446 GLU A O   1 
ATOM   671  C CB  . GLU A 1 103 ? 28.976 9.313   6.406   1.00 41.76 ? 446 GLU A CB  1 
ATOM   672  C CG  . GLU A 1 103 ? 28.622 8.598   5.113   1.00 42.73 ? 446 GLU A CG  1 
ATOM   673  C CD  . GLU A 1 103 ? 29.794 8.495   4.159   1.00 44.29 ? 446 GLU A CD  1 
ATOM   674  O OE1 . GLU A 1 103 ? 30.783 7.807   4.504   1.00 45.45 ? 446 GLU A OE1 1 
ATOM   675  O OE2 . GLU A 1 103 ? 29.721 9.094   3.061   1.00 44.51 ? 446 GLU A OE2 1 
ATOM   676  N N   . THR A 1 104 ? 28.461 11.710  4.137   1.00 42.12 ? 447 THR A N   1 
ATOM   677  C CA  . THR A 1 104 ? 27.562 12.469  3.264   1.00 42.61 ? 447 THR A CA  1 
ATOM   678  C C   . THR A 1 104 ? 26.951 11.658  2.104   1.00 42.77 ? 447 THR A C   1 
ATOM   679  O O   . THR A 1 104 ? 25.879 12.010  1.607   1.00 43.04 ? 447 THR A O   1 
ATOM   680  C CB  . THR A 1 104 ? 28.258 13.764  2.734   1.00 42.56 ? 447 THR A CB  1 
ATOM   681  O OG1 . THR A 1 104 ? 27.280 14.771  2.454   1.00 43.21 ? 447 THR A OG1 1 
ATOM   682  C CG2 . THR A 1 104 ? 29.088 13.496  1.483   1.00 42.60 ? 447 THR A CG2 1 
ATOM   683  N N   . THR A 1 105 ? 27.616 10.578  1.692   1.00 42.84 ? 448 THR A N   1 
ATOM   684  C CA  . THR A 1 105 ? 27.218 9.831   0.486   1.00 42.82 ? 448 THR A CA  1 
ATOM   685  C C   . THR A 1 105 ? 26.362 8.576   0.725   1.00 42.59 ? 448 THR A C   1 
ATOM   686  O O   . THR A 1 105 ? 26.028 7.872   -0.229  1.00 42.56 ? 448 THR A O   1 
ATOM   687  C CB  . THR A 1 105 ? 28.448 9.415   -0.366  1.00 42.93 ? 448 THR A CB  1 
ATOM   688  O OG1 . THR A 1 105 ? 29.297 8.546   0.395   1.00 43.47 ? 448 THR A OG1 1 
ATOM   689  C CG2 . THR A 1 105 ? 29.239 10.626  -0.828  1.00 43.16 ? 448 THR A CG2 1 
ATOM   690  N N   . ILE A 1 106 ? 26.001 8.302   1.978   1.00 42.36 ? 449 ILE A N   1 
ATOM   691  C CA  . ILE A 1 106 ? 25.337 7.036   2.328   1.00 42.28 ? 449 ILE A CA  1 
ATOM   692  C C   . ILE A 1 106 ? 23.833 7.178   2.599   1.00 42.29 ? 449 ILE A C   1 
ATOM   693  O O   . ILE A 1 106 ? 23.411 8.051   3.359   1.00 42.33 ? 449 ILE A O   1 
ATOM   694  C CB  . ILE A 1 106 ? 26.054 6.334   3.517   1.00 42.32 ? 449 ILE A CB  1 
ATOM   695  C CG1 . ILE A 1 106 ? 27.414 5.787   3.065   1.00 42.04 ? 449 ILE A CG1 1 
ATOM   696  C CG2 . ILE A 1 106 ? 25.202 5.208   4.104   1.00 42.45 ? 449 ILE A CG2 1 
ATOM   697  C CD1 . ILE A 1 106 ? 28.295 5.292   4.202   1.00 42.12 ? 449 ILE A CD1 1 
ATOM   698  N N   . GLU A 1 107 ? 23.040 6.310   1.967   1.00 42.18 ? 450 GLU A N   1 
ATOM   699  C CA  . GLU A 1 107 ? 21.590 6.250   2.192   1.00 42.14 ? 450 GLU A CA  1 
ATOM   700  C C   . GLU A 1 107 ? 21.288 5.472   3.475   1.00 41.41 ? 450 GLU A C   1 
ATOM   701  O O   . GLU A 1 107 ? 20.762 6.030   4.440   1.00 41.32 ? 450 GLU A O   1 
ATOM   702  C CB  . GLU A 1 107 ? 20.882 5.617   0.984   1.00 42.15 ? 450 GLU A CB  1 
ATOM   703  C CG  . GLU A 1 107 ? 19.352 5.701   1.007   1.00 43.09 ? 450 GLU A CG  1 
ATOM   704  C CD  . GLU A 1 107 ? 18.694 4.831   -0.058  1.00 43.39 ? 450 GLU A CD  1 
ATOM   705  O OE1 . GLU A 1 107 ? 18.881 3.593   -0.025  1.00 44.76 ? 450 GLU A OE1 1 
ATOM   706  O OE2 . GLU A 1 107 ? 17.982 5.381   -0.928  1.00 45.37 ? 450 GLU A OE2 1 
ATOM   707  N N   . ASN A 1 108 ? 21.627 4.184   3.470   1.00 40.87 ? 451 ASN A N   1 
ATOM   708  C CA  . ASN A 1 108 ? 21.475 3.303   4.628   1.00 40.15 ? 451 ASN A CA  1 
ATOM   709  C C   . ASN A 1 108 ? 22.723 2.448   4.798   1.00 39.30 ? 451 ASN A C   1 
ATOM   710  O O   . ASN A 1 108 ? 23.454 2.217   3.830   1.00 39.05 ? 451 ASN A O   1 
ATOM   711  C CB  . ASN A 1 108 ? 20.271 2.369   4.452   1.00 40.52 ? 451 ASN A CB  1 
ATOM   712  C CG  . ASN A 1 108 ? 18.957 3.114   4.308   1.00 41.61 ? 451 ASN A CG  1 
ATOM   713  O OD1 . ASN A 1 108 ? 18.274 2.996   3.286   1.00 43.08 ? 451 ASN A OD1 1 
ATOM   714  N ND2 . ASN A 1 108 ? 18.592 3.882   5.330   1.00 42.33 ? 451 ASN A ND2 1 
ATOM   715  N N   . PHE A 1 109 ? 22.955 1.981   6.024   1.00 38.27 ? 452 PHE A N   1 
ATOM   716  C CA  . PHE A 1 109 ? 24.002 0.996   6.304   1.00 37.30 ? 452 PHE A CA  1 
ATOM   717  C C   . PHE A 1 109 ? 23.682 0.208   7.569   1.00 36.51 ? 452 PHE A C   1 
ATOM   718  O O   . PHE A 1 109 ? 22.986 0.701   8.459   1.00 36.42 ? 452 PHE A O   1 
ATOM   719  C CB  . PHE A 1 109 ? 25.396 1.656   6.405   1.00 37.43 ? 452 PHE A CB  1 
ATOM   720  C CG  . PHE A 1 109 ? 25.743 2.174   7.777   1.00 37.30 ? 452 PHE A CG  1 
ATOM   721  C CD1 . PHE A 1 109 ? 26.359 1.346   8.714   1.00 37.62 ? 452 PHE A CD1 1 
ATOM   722  C CD2 . PHE A 1 109 ? 25.469 3.490   8.128   1.00 37.87 ? 452 PHE A CD2 1 
ATOM   723  C CE1 . PHE A 1 109 ? 26.684 1.820   9.984   1.00 37.54 ? 452 PHE A CE1 1 
ATOM   724  C CE2 . PHE A 1 109 ? 25.790 3.974   9.395   1.00 37.59 ? 452 PHE A CE2 1 
ATOM   725  C CZ  . PHE A 1 109 ? 26.399 3.137   10.323  1.00 37.63 ? 452 PHE A CZ  1 
ATOM   726  N N   . HIS A 1 110 ? 24.192 -1.017  7.649   1.00 35.35 ? 453 HIS A N   1 
ATOM   727  C CA  . HIS A 1 110 ? 24.121 -1.776  8.893   1.00 34.34 ? 453 HIS A CA  1 
ATOM   728  C C   . HIS A 1 110 ? 25.285 -2.739  9.024   1.00 33.58 ? 453 HIS A C   1 
ATOM   729  O O   . HIS A 1 110 ? 25.869 -3.150  8.027   1.00 33.32 ? 453 HIS A O   1 
ATOM   730  C CB  . HIS A 1 110 ? 22.777 -2.509  9.037   1.00 34.41 ? 453 HIS A CB  1 
ATOM   731  C CG  . HIS A 1 110 ? 22.564 -3.609  8.041   1.00 33.67 ? 453 HIS A CG  1 
ATOM   732  N ND1 . HIS A 1 110 ? 22.889 -4.923  8.301   1.00 33.83 ? 453 HIS A ND1 1 
ATOM   733  C CD2 . HIS A 1 110 ? 22.043 -3.590  6.792   1.00 32.88 ? 453 HIS A CD2 1 
ATOM   734  C CE1 . HIS A 1 110 ? 22.586 -5.665  7.251   1.00 32.69 ? 453 HIS A CE1 1 
ATOM   735  N NE2 . HIS A 1 110 ? 22.072 -4.880  6.321   1.00 33.16 ? 453 HIS A NE2 1 
ATOM   736  N N   . VAL A 1 111 ? 25.611 -3.080  10.267  1.00 32.77 ? 454 VAL A N   1 
ATOM   737  C CA  . VAL A 1 111 ? 26.642 -4.053  10.575  1.00 32.05 ? 454 VAL A CA  1 
ATOM   738  C C   . VAL A 1 111 ? 26.038 -5.459  10.450  1.00 31.95 ? 454 VAL A C   1 
ATOM   739  O O   . VAL A 1 111 ? 25.183 -5.861  11.243  1.00 31.75 ? 454 VAL A O   1 
ATOM   740  C CB  . VAL A 1 111 ? 27.252 -3.806  11.980  1.00 32.06 ? 454 VAL A CB  1 
ATOM   741  C CG1 . VAL A 1 111 ? 28.286 -4.874  12.332  1.00 31.78 ? 454 VAL A CG1 1 
ATOM   742  C CG2 . VAL A 1 111 ? 27.886 -2.415  12.050  1.00 31.73 ? 454 VAL A CG2 1 
ATOM   743  N N   . VAL A 1 112 ? 26.483 -6.175  9.421   1.00 31.39 ? 455 VAL A N   1 
ATOM   744  C CA  . VAL A 1 112 ? 26.031 -7.526  9.117   1.00 30.98 ? 455 VAL A CA  1 
ATOM   745  C C   . VAL A 1 112 ? 26.521 -8.543  10.151  1.00 30.77 ? 455 VAL A C   1 
ATOM   746  O O   . VAL A 1 112 ? 25.785 -9.461  10.538  1.00 30.70 ? 455 VAL A O   1 
ATOM   747  C CB  . VAL A 1 112 ? 26.526 -7.942  7.711   1.00 31.08 ? 455 VAL A CB  1 
ATOM   748  C CG1 . VAL A 1 112 ? 26.285 -9.420  7.451   1.00 31.35 ? 455 VAL A CG1 1 
ATOM   749  C CG2 . VAL A 1 112 ? 25.858 -7.091  6.643   1.00 31.31 ? 455 VAL A CG2 1 
ATOM   750  N N   . GLU A 1 113 ? 27.770 -8.380  10.582  1.00 30.07 ? 456 GLU A N   1 
ATOM   751  C CA  . GLU A 1 113 ? 28.406 -9.309  11.499  1.00 29.90 ? 456 GLU A CA  1 
ATOM   752  C C   . GLU A 1 113 ? 29.546 -8.620  12.223  1.00 29.63 ? 456 GLU A C   1 
ATOM   753  O O   . GLU A 1 113 ? 30.260 -7.797  11.639  1.00 29.53 ? 456 GLU A O   1 
ATOM   754  C CB  . GLU A 1 113 ? 28.953 -10.522 10.731  1.00 30.04 ? 456 GLU A CB  1 
ATOM   755  C CG  . GLU A 1 113 ? 29.577 -11.618 11.596  1.00 29.65 ? 456 GLU A CG  1 
ATOM   756  C CD  . GLU A 1 113 ? 30.134 -12.770 10.777  1.00 29.69 ? 456 GLU A CD  1 
ATOM   757  O OE1 . GLU A 1 113 ? 29.893 -12.802 9.556   1.00 30.42 ? 456 GLU A OE1 1 
ATOM   758  O OE2 . GLU A 1 113 ? 30.829 -13.636 11.345  1.00 28.94 ? 456 GLU A OE2 1 
ATOM   759  N N   . THR A 1 114 ? 29.714 -8.965  13.493  1.00 29.10 ? 457 THR A N   1 
ATOM   760  C CA  . THR A 1 114 ? 30.880 -8.545  14.247  1.00 29.07 ? 457 THR A CA  1 
ATOM   761  C C   . THR A 1 114 ? 31.847 -9.718  14.303  1.00 28.74 ? 457 THR A C   1 
ATOM   762  O O   . THR A 1 114 ? 31.531 -10.781 14.838  1.00 28.51 ? 457 THR A O   1 
ATOM   763  C CB  . THR A 1 114 ? 30.487 -8.019  15.656  1.00 29.20 ? 457 THR A CB  1 
ATOM   764  O OG1 . THR A 1 114 ? 29.559 -6.942  15.503  1.00 29.93 ? 457 THR A OG1 1 
ATOM   765  C CG2 . THR A 1 114 ? 31.703 -7.504  16.428  1.00 28.95 ? 457 THR A CG2 1 
ATOM   766  N N   . LEU A 1 115 ? 33.021 -9.526  13.712  1.00 28.32 ? 458 LEU A N   1 
ATOM   767  C CA  . LEU A 1 115 ? 34.027 -10.576 13.648  1.00 28.11 ? 458 LEU A CA  1 
ATOM   768  C C   . LEU A 1 115 ? 34.905 -10.562 14.893  1.00 27.89 ? 458 LEU A C   1 
ATOM   769  O O   . LEU A 1 115 ? 35.249 -11.612 15.429  1.00 27.82 ? 458 LEU A O   1 
ATOM   770  C CB  . LEU A 1 115 ? 34.885 -10.427 12.381  1.00 28.05 ? 458 LEU A CB  1 
ATOM   771  C CG  . LEU A 1 115 ? 34.194 -10.561 11.013  1.00 28.15 ? 458 LEU A CG  1 
ATOM   772  C CD1 . LEU A 1 115 ? 35.096 -10.058 9.910   1.00 28.15 ? 458 LEU A CD1 1 
ATOM   773  C CD2 . LEU A 1 115 ? 33.795 -12.005 10.747  1.00 28.82 ? 458 LEU A CD2 1 
ATOM   774  N N   . ALA A 1 116 ? 35.263 -9.361  15.341  1.00 27.94 ? 459 ALA A N   1 
ATOM   775  C CA  . ALA A 1 116 ? 36.119 -9.163  16.511  1.00 27.84 ? 459 ALA A CA  1 
ATOM   776  C C   . ALA A 1 116 ? 35.892 -7.750  17.036  1.00 28.09 ? 459 ALA A C   1 
ATOM   777  O O   . ALA A 1 116 ? 35.089 -7.003  16.474  1.00 28.52 ? 459 ALA A O   1 
ATOM   778  C CB  . ALA A 1 116 ? 37.581 -9.377  16.149  1.00 27.80 ? 459 ALA A CB  1 
ATOM   779  N N   . ASP A 1 117 ? 36.585 -7.384  18.114  1.00 28.26 ? 460 ASP A N   1 
ATOM   780  C CA  . ASP A 1 117 ? 36.475 -6.033  18.670  1.00 28.43 ? 460 ASP A CA  1 
ATOM   781  C C   . ASP A 1 117 ? 36.854 -4.965  17.636  1.00 27.69 ? 460 ASP A C   1 
ATOM   782  O O   . ASP A 1 117 ? 36.303 -3.869  17.642  1.00 28.10 ? 460 ASP A O   1 
ATOM   783  C CB  . ASP A 1 117 ? 37.352 -5.890  19.918  1.00 29.11 ? 460 ASP A CB  1 
ATOM   784  C CG  . ASP A 1 117 ? 36.758 -6.580  21.144  1.00 31.18 ? 460 ASP A CG  1 
ATOM   785  O OD1 . ASP A 1 117 ? 35.622 -7.108  21.073  1.00 32.80 ? 460 ASP A OD1 1 
ATOM   786  O OD2 . ASP A 1 117 ? 37.439 -6.582  22.195  1.00 34.48 ? 460 ASP A OD2 1 
ATOM   787  N N   . ASN A 1 118 ? 37.780 -5.311  16.744  1.00 26.59 ? 461 ASN A N   1 
ATOM   788  C CA  . ASN A 1 118 ? 38.338 -4.380  15.769  1.00 25.58 ? 461 ASN A CA  1 
ATOM   789  C C   . ASN A 1 118 ? 37.955 -4.684  14.318  1.00 24.81 ? 461 ASN A C   1 
ATOM   790  O O   . ASN A 1 118 ? 38.517 -4.087  13.403  1.00 24.12 ? 461 ASN A O   1 
ATOM   791  C CB  . ASN A 1 118 ? 39.867 -4.368  15.891  1.00 25.43 ? 461 ASN A CB  1 
ATOM   792  C CG  . ASN A 1 118 ? 40.510 -5.640  15.355  1.00 26.71 ? 461 ASN A CG  1 
ATOM   793  O OD1 . ASN A 1 118 ? 39.911 -6.716  15.387  1.00 27.15 ? 461 ASN A OD1 1 
ATOM   794  N ND2 . ASN A 1 118 ? 41.737 -5.520  14.854  1.00 27.22 ? 461 ASN A ND2 1 
ATOM   795  N N   . ALA A 1 119 ? 37.025 -5.615  14.111  1.00 24.26 ? 462 ALA A N   1 
ATOM   796  C CA  . ALA A 1 119 ? 36.659 -6.053  12.754  1.00 24.24 ? 462 ALA A CA  1 
ATOM   797  C C   . ALA A 1 119 ? 35.170 -6.355  12.611  1.00 24.12 ? 462 ALA A C   1 
ATOM   798  O O   . ALA A 1 119 ? 34.618 -7.160  13.362  1.00 24.46 ? 462 ALA A O   1 
ATOM   799  C CB  . ALA A 1 119 ? 37.495 -7.275  12.344  1.00 23.94 ? 462 ALA A CB  1 
ATOM   800  N N   . ILE A 1 120 ? 34.542 -5.724  11.619  1.00 23.98 ? 463 ILE A N   1 
ATOM   801  C CA  . ILE A 1 120 ? 33.115 -5.867  11.349  1.00 24.18 ? 463 ILE A CA  1 
ATOM   802  C C   . ILE A 1 120 ? 32.860 -5.987  9.845   1.00 24.14 ? 463 ILE A C   1 
ATOM   803  O O   . ILE A 1 120 ? 33.726 -5.645  9.039   1.00 23.83 ? 463 ILE A O   1 
ATOM   804  C CB  . ILE A 1 120 ? 32.314 -4.656  11.900  1.00 24.20 ? 463 ILE A CB  1 
ATOM   805  C CG1 . ILE A 1 120 ? 32.950 -3.333  11.440  1.00 23.78 ? 463 ILE A CG1 1 
ATOM   806  C CG2 . ILE A 1 120 ? 32.224 -4.721  13.445  1.00 24.61 ? 463 ILE A CG2 1 
ATOM   807  C CD1 . ILE A 1 120 ? 32.112 -2.104  11.741  1.00 24.54 ? 463 ILE A CD1 1 
ATOM   808  N N   . ILE A 1 121 ? 31.681 -6.486  9.476   1.00 24.21 ? 464 ILE A N   1 
ATOM   809  C CA  . ILE A 1 121 ? 31.249 -6.490  8.077   1.00 23.91 ? 464 ILE A CA  1 
ATOM   810  C C   . ILE A 1 121 ? 30.043 -5.570  7.929   1.00 24.48 ? 464 ILE A C   1 
ATOM   811  O O   . ILE A 1 121 ? 29.051 -5.690  8.657   1.00 24.18 ? 464 ILE A O   1 
ATOM   812  C CB  . ILE A 1 121 ? 30.972 -7.918  7.529   1.00 24.14 ? 464 ILE A CB  1 
ATOM   813  C CG1 . ILE A 1 121 ? 32.269 -8.745  7.516   1.00 24.34 ? 464 ILE A CG1 1 
ATOM   814  C CG2 . ILE A 1 121 ? 30.358 -7.848  6.118   1.00 23.47 ? 464 ILE A CG2 1 
ATOM   815  C CD1 . ILE A 1 121 ? 32.069 -10.252 7.382   1.00 23.61 ? 464 ILE A CD1 1 
ATOM   816  N N   . ILE A 1 122 ? 30.154 -4.639  6.989   1.00 24.88 ? 465 ILE A N   1 
ATOM   817  C CA  . ILE A 1 122 ? 29.138 -3.617  6.788   1.00 25.75 ? 465 ILE A CA  1 
ATOM   818  C C   . ILE A 1 122 ? 28.475 -3.801  5.428   1.00 26.38 ? 465 ILE A C   1 
ATOM   819  O O   . ILE A 1 122 ? 29.155 -4.015  4.427   1.00 26.21 ? 465 ILE A O   1 
ATOM   820  C CB  . ILE A 1 122 ? 29.743 -2.188  6.904   1.00 25.23 ? 465 ILE A CB  1 
ATOM   821  C CG1 . ILE A 1 122 ? 30.308 -1.950  8.314   1.00 26.05 ? 465 ILE A CG1 1 
ATOM   822  C CG2 . ILE A 1 122 ? 28.708 -1.113  6.558   1.00 25.61 ? 465 ILE A CG2 1 
ATOM   823  C CD1 . ILE A 1 122 ? 31.103 -0.655  8.445   1.00 25.31 ? 465 ILE A CD1 1 
ATOM   824  N N   . TYR A 1 123 ? 27.147 -3.763  5.414   1.00 27.53 ? 466 TYR A N   1 
ATOM   825  C CA  . TYR A 1 123 ? 26.403 -3.567  4.174   1.00 29.20 ? 466 TYR A CA  1 
ATOM   826  C C   . TYR A 1 123 ? 25.976 -2.109  4.158   1.00 30.05 ? 466 TYR A C   1 
ATOM   827  O O   . TYR A 1 123 ? 25.556 -1.580  5.183   1.00 29.86 ? 466 TYR A O   1 
ATOM   828  C CB  . TYR A 1 123 ? 25.166 -4.481  4.083   1.00 29.28 ? 466 TYR A CB  1 
ATOM   829  C CG  . TYR A 1 123 ? 24.315 -4.204  2.853   1.00 29.66 ? 466 TYR A CG  1 
ATOM   830  C CD1 . TYR A 1 123 ? 24.641 -4.763  1.621   1.00 29.67 ? 466 TYR A CD1 1 
ATOM   831  C CD2 . TYR A 1 123 ? 23.203 -3.362  2.923   1.00 29.94 ? 466 TYR A CD2 1 
ATOM   832  C CE1 . TYR A 1 123 ? 23.875 -4.504  0.489   1.00 30.78 ? 466 TYR A CE1 1 
ATOM   833  C CE2 . TYR A 1 123 ? 22.430 -3.090  1.797   1.00 31.05 ? 466 TYR A CE2 1 
ATOM   834  C CZ  . TYR A 1 123 ? 22.772 -3.666  0.584   1.00 30.47 ? 466 TYR A CZ  1 
ATOM   835  O OH  . TYR A 1 123 ? 22.018 -3.402  -0.534  1.00 31.11 ? 466 TYR A OH  1 
ATOM   836  N N   . GLN A 1 124 ? 26.105 -1.461  3.004   1.00 31.43 ? 467 GLN A N   1 
ATOM   837  C CA  . GLN A 1 124 ? 25.622 -0.094  2.844   1.00 33.07 ? 467 GLN A CA  1 
ATOM   838  C C   . GLN A 1 124 ? 25.191 0.211   1.415   1.00 34.43 ? 467 GLN A C   1 
ATOM   839  O O   . GLN A 1 124 ? 25.722 -0.345  0.445   1.00 34.08 ? 467 GLN A O   1 
ATOM   840  C CB  . GLN A 1 124 ? 26.648 0.943   3.341   1.00 32.95 ? 467 GLN A CB  1 
ATOM   841  C CG  . GLN A 1 124 ? 27.890 1.095   2.490   1.00 33.06 ? 467 GLN A CG  1 
ATOM   842  C CD  . GLN A 1 124 ? 28.942 2.012   3.101   1.00 32.64 ? 467 GLN A CD  1 
ATOM   843  O OE1 . GLN A 1 124 ? 29.143 2.040   4.313   1.00 31.83 ? 467 GLN A OE1 1 
ATOM   844  N NE2 . GLN A 1 124 ? 29.637 2.741   2.253   1.00 32.27 ? 467 GLN A NE2 1 
ATOM   845  N N   . THR A 1 125 ? 24.212 1.103   1.313   1.00 36.14 ? 468 THR A N   1 
ATOM   846  C CA  . THR A 1 125 ? 23.741 1.622   0.045   1.00 37.99 ? 468 THR A CA  1 
ATOM   847  C C   . THR A 1 125 ? 24.127 3.089   -0.039  1.00 39.17 ? 468 THR A C   1 
ATOM   848  O O   . THR A 1 125 ? 24.109 3.806   0.965   1.00 39.26 ? 468 THR A O   1 
ATOM   849  C CB  . THR A 1 125 ? 22.213 1.505   -0.074  1.00 37.89 ? 468 THR A CB  1 
ATOM   850  O OG1 . THR A 1 125 ? 21.598 2.193   1.022   1.00 38.73 ? 468 THR A OG1 1 
ATOM   851  C CG2 . THR A 1 125 ? 21.784 0.048   -0.050  1.00 38.04 ? 468 THR A CG2 1 
ATOM   852  N N   . HIS A 1 126 ? 24.477 3.531   -1.240  1.00 40.65 ? 469 HIS A N   1 
ATOM   853  C CA  . HIS A 1 126 ? 24.870 4.912   -1.445  1.00 42.37 ? 469 HIS A CA  1 
ATOM   854  C C   . HIS A 1 126 ? 23.763 5.760   -2.051  1.00 43.50 ? 469 HIS A C   1 
ATOM   855  O O   . HIS A 1 126 ? 22.919 5.265   -2.805  1.00 43.39 ? 469 HIS A O   1 
ATOM   856  C CB  . HIS A 1 126 ? 26.124 4.985   -2.311  1.00 42.51 ? 469 HIS A CB  1 
ATOM   857  C CG  . HIS A 1 126 ? 27.351 4.479   -1.625  1.00 43.14 ? 469 HIS A CG  1 
ATOM   858  N ND1 . HIS A 1 126 ? 28.109 5.265   -0.785  1.00 43.67 ? 469 HIS A ND1 1 
ATOM   859  C CD2 . HIS A 1 126 ? 27.942 3.262   -1.640  1.00 43.43 ? 469 HIS A CD2 1 
ATOM   860  C CE1 . HIS A 1 126 ? 29.120 4.555   -0.318  1.00 44.21 ? 469 HIS A CE1 1 
ATOM   861  N NE2 . HIS A 1 126 ? 29.042 3.337   -0.822  1.00 43.69 ? 469 HIS A NE2 1 
ATOM   862  N N   . LYS A 1 127 ? 23.780 7.044   -1.700  1.00 44.80 ? 470 LYS A N   1 
ATOM   863  C CA  . LYS A 1 127 ? 22.920 8.037   -2.324  1.00 46.17 ? 470 LYS A CA  1 
ATOM   864  C C   . LYS A 1 127 ? 23.172 8.047   -3.830  1.00 47.21 ? 470 LYS A C   1 
ATOM   865  O O   . LYS A 1 127 ? 24.315 7.907   -4.281  1.00 47.22 ? 470 LYS A O   1 
ATOM   866  C CB  . LYS A 1 127 ? 23.187 9.419   -1.729  1.00 46.16 ? 470 LYS A CB  1 
ATOM   867  C CG  . LYS A 1 127 ? 22.519 9.654   -0.384  1.00 46.28 ? 470 LYS A CG  1 
ATOM   868  C CD  . LYS A 1 127 ? 23.154 10.829  0.346   1.00 46.46 ? 470 LYS A CD  1 
ATOM   869  C CE  . LYS A 1 127 ? 22.317 11.296  1.536   1.00 46.77 ? 470 LYS A CE  1 
ATOM   870  N NZ  . LYS A 1 127 ? 21.788 10.174  2.362   1.00 46.56 ? 470 LYS A NZ  1 
ATOM   871  N N   . ARG A 1 128 ? 22.095 8.200   -4.595  1.00 48.35 ? 471 ARG A N   1 
ATOM   872  C CA  . ARG A 1 128 ? 22.150 8.124   -6.052  1.00 49.53 ? 471 ARG A CA  1 
ATOM   873  C C   . ARG A 1 128 ? 22.977 9.255   -6.664  1.00 49.74 ? 471 ARG A C   1 
ATOM   874  O O   . ARG A 1 128 ? 22.711 10.436  -6.426  1.00 49.91 ? 471 ARG A O   1 
ATOM   875  C CB  . ARG A 1 128 ? 20.730 8.104   -6.629  1.00 49.72 ? 471 ARG A CB  1 
ATOM   876  C CG  . ARG A 1 128 ? 20.646 7.725   -8.094  1.00 51.35 ? 471 ARG A CG  1 
ATOM   877  C CD  . ARG A 1 128 ? 19.319 7.053   -8.391  1.00 53.58 ? 471 ARG A CD  1 
ATOM   878  N NE  . ARG A 1 128 ? 18.837 7.366   -9.733  1.00 55.93 ? 471 ARG A NE  1 
ATOM   879  C CZ  . ARG A 1 128 ? 17.749 6.838   -10.290 1.00 56.55 ? 471 ARG A CZ  1 
ATOM   880  N NH1 . ARG A 1 128 ? 17.016 5.950   -9.625  1.00 56.73 ? 471 ARG A NH1 1 
ATOM   881  N NH2 . ARG A 1 128 ? 17.394 7.200   -11.520 1.00 56.70 ? 471 ARG A NH2 1 
ATOM   882  N N   . VAL A 1 129 ? 23.995 8.870   -7.433  1.00 50.13 ? 472 VAL A N   1 
ATOM   883  C CA  . VAL A 1 129 ? 24.858 9.814   -8.143  1.00 50.30 ? 472 VAL A CA  1 
ATOM   884  C C   . VAL A 1 129 ? 24.798 9.536   -9.648  1.00 50.28 ? 472 VAL A C   1 
ATOM   885  O O   . VAL A 1 129 ? 23.788 9.808   -10.300 1.00 50.45 ? 472 VAL A O   1 
ATOM   886  C CB  . VAL A 1 129 ? 26.335 9.736   -7.659  1.00 50.24 ? 472 VAL A CB  1 
ATOM   887  C CG1 . VAL A 1 129 ? 27.201 10.727  -8.424  1.00 50.45 ? 472 VAL A CG1 1 
ATOM   888  C CG2 . VAL A 1 129 ? 26.436 9.998   -6.161  1.00 50.43 ? 472 VAL A CG2 1 
ATOM   889  N N   . SER A 1 133 ? 22.083 4.326   -11.565 1.00 45.57 ? 476 SER A N   1 
ATOM   890  C CA  . SER A 1 133 ? 21.443 3.414   -10.622 1.00 45.41 ? 476 SER A CA  1 
ATOM   891  C C   . SER A 1 133 ? 22.155 3.435   -9.272  1.00 44.96 ? 476 SER A C   1 
ATOM   892  O O   . SER A 1 133 ? 23.297 3.877   -9.165  1.00 45.08 ? 476 SER A O   1 
ATOM   893  C CB  . SER A 1 133 ? 21.403 1.981   -11.182 1.00 45.75 ? 476 SER A CB  1 
ATOM   894  O OG  . SER A 1 133 ? 22.703 1.508   -11.511 1.00 46.08 ? 476 SER A OG  1 
ATOM   895  N N   . GLN A 1 134 ? 21.469 2.956   -8.244  1.00 44.28 ? 477 GLN A N   1 
ATOM   896  C CA  . GLN A 1 134 ? 22.037 2.921   -6.908  1.00 43.50 ? 477 GLN A CA  1 
ATOM   897  C C   . GLN A 1 134 ? 23.155 1.886   -6.797  1.00 42.49 ? 477 GLN A C   1 
ATOM   898  O O   . GLN A 1 134 ? 23.083 0.805   -7.387  1.00 42.40 ? 477 GLN A O   1 
ATOM   899  C CB  . GLN A 1 134 ? 20.944 2.645   -5.881  1.00 43.87 ? 477 GLN A CB  1 
ATOM   900  C CG  . GLN A 1 134 ? 21.318 3.050   -4.470  1.00 44.91 ? 477 GLN A CG  1 
ATOM   901  C CD  . GLN A 1 134 ? 20.119 3.425   -3.626  1.00 47.04 ? 477 GLN A CD  1 
ATOM   902  O OE1 . GLN A 1 134 ? 19.117 3.948   -4.132  1.00 47.99 ? 477 GLN A OE1 1 
ATOM   903  N NE2 . GLN A 1 134 ? 20.217 3.174   -2.327  1.00 46.76 ? 477 GLN A NE2 1 
ATOM   904  N N   . ARG A 1 135 ? 24.196 2.241   -6.050  1.00 41.20 ? 478 ARG A N   1 
ATOM   905  C CA  . ARG A 1 135 ? 25.279 1.317   -5.736  1.00 39.49 ? 478 ARG A CA  1 
ATOM   906  C C   . ARG A 1 135 ? 25.103 0.793   -4.325  1.00 37.74 ? 478 ARG A C   1 
ATOM   907  O O   . ARG A 1 135 ? 24.709 1.539   -3.430  1.00 37.77 ? 478 ARG A O   1 
ATOM   908  C CB  . ARG A 1 135 ? 26.638 2.019   -5.849  1.00 39.95 ? 478 ARG A CB  1 
ATOM   909  C CG  . ARG A 1 135 ? 27.365 1.810   -7.169  1.00 41.04 ? 478 ARG A CG  1 
ATOM   910  C CD  . ARG A 1 135 ? 26.654 2.494   -8.322  1.00 43.33 ? 478 ARG A CD  1 
ATOM   911  N NE  . ARG A 1 135 ? 27.166 2.047   -9.614  1.00 44.63 ? 478 ARG A NE  1 
ATOM   912  C CZ  . ARG A 1 135 ? 26.453 2.024   -10.737 1.00 45.58 ? 478 ARG A CZ  1 
ATOM   913  N NH1 . ARG A 1 135 ? 25.182 2.407   -10.733 1.00 45.96 ? 478 ARG A NH1 1 
ATOM   914  N NH2 . ARG A 1 135 ? 27.011 1.602   -11.864 1.00 45.83 ? 478 ARG A NH2 1 
ATOM   915  N N   . ASP A 1 136 ? 25.373 -0.491  -4.126  1.00 35.63 ? 479 ASP A N   1 
ATOM   916  C CA  . ASP A 1 136 ? 25.586 -0.987  -2.765  1.00 33.47 ? 479 ASP A CA  1 
ATOM   917  C C   . ASP A 1 136 ? 26.978 -1.587  -2.607  1.00 31.85 ? 479 ASP A C   1 
ATOM   918  O O   . ASP A 1 136 ? 27.666 -1.851  -3.592  1.00 31.18 ? 479 ASP A O   1 
ATOM   919  C CB  . ASP A 1 136 ? 24.464 -1.926  -2.278  1.00 33.30 ? 479 ASP A CB  1 
ATOM   920  C CG  . ASP A 1 136 ? 24.377 -3.235  -3.054  1.00 33.33 ? 479 ASP A CG  1 
ATOM   921  O OD1 . ASP A 1 136 ? 25.183 -3.481  -3.971  1.00 32.82 ? 479 ASP A OD1 1 
ATOM   922  O OD2 . ASP A 1 136 ? 23.477 -4.041  -2.729  1.00 33.87 ? 479 ASP A OD2 1 
ATOM   923  N N   . VAL A 1 137 ? 27.397 -1.772  -1.361  1.00 30.06 ? 480 VAL A N   1 
ATOM   924  C CA  . VAL A 1 137 ? 28.712 -2.324  -1.087  1.00 28.54 ? 480 VAL A CA  1 
ATOM   925  C C   . VAL A 1 137 ? 28.641 -3.176  0.177   1.00 27.43 ? 480 VAL A C   1 
ATOM   926  O O   . VAL A 1 137 ? 27.854 -2.903  1.091   1.00 27.57 ? 480 VAL A O   1 
ATOM   927  C CB  . VAL A 1 137 ? 29.821 -1.200  -1.046  1.00 28.72 ? 480 VAL A CB  1 
ATOM   928  C CG1 . VAL A 1 137 ? 29.615 -0.265  0.119   1.00 28.75 ? 480 VAL A CG1 1 
ATOM   929  C CG2 . VAL A 1 137 ? 31.235 -1.787  -1.034  1.00 27.88 ? 480 VAL A CG2 1 
ATOM   930  N N   . LEU A 1 138 ? 29.422 -4.245  0.184   1.00 25.67 ? 481 LEU A N   1 
ATOM   931  C CA  . LEU A 1 138 ? 29.481 -5.160  1.304   1.00 24.50 ? 481 LEU A CA  1 
ATOM   932  C C   . LEU A 1 138 ? 30.955 -5.390  1.590   1.00 23.27 ? 481 LEU A C   1 
ATOM   933  O O   . LEU A 1 138 ? 31.668 -5.992  0.781   1.00 23.34 ? 481 LEU A O   1 
ATOM   934  C CB  . LEU A 1 138 ? 28.762 -6.475  0.959   1.00 24.20 ? 481 LEU A CB  1 
ATOM   935  C CG  . LEU A 1 138 ? 28.804 -7.608  1.991   1.00 25.20 ? 481 LEU A CG  1 
ATOM   936  C CD1 . LEU A 1 138 ? 27.996 -7.256  3.246   1.00 25.08 ? 481 LEU A CD1 1 
ATOM   937  C CD2 . LEU A 1 138 ? 28.324 -8.928  1.374   1.00 24.16 ? 481 LEU A CD2 1 
ATOM   938  N N   . TYR A 1 139 ? 31.415 -4.908  2.739   1.00 22.37 ? 482 TYR A N   1 
ATOM   939  C CA  . TYR A 1 139 ? 32.844 -4.863  2.992   1.00 21.52 ? 482 TYR A CA  1 
ATOM   940  C C   . TYR A 1 139 ? 33.215 -5.165  4.430   1.00 20.92 ? 482 TYR A C   1 
ATOM   941  O O   . TYR A 1 139 ? 32.459 -4.863  5.353   1.00 20.87 ? 482 TYR A O   1 
ATOM   942  C CB  . TYR A 1 139 ? 33.437 -3.508  2.556   1.00 21.56 ? 482 TYR A CB  1 
ATOM   943  C CG  . TYR A 1 139 ? 32.922 -2.294  3.305   1.00 21.87 ? 482 TYR A CG  1 
ATOM   944  C CD1 . TYR A 1 139 ? 33.641 -1.740  4.368   1.00 21.42 ? 482 TYR A CD1 1 
ATOM   945  C CD2 . TYR A 1 139 ? 31.730 -1.684  2.933   1.00 23.14 ? 482 TYR A CD2 1 
ATOM   946  C CE1 . TYR A 1 139 ? 33.168 -0.615  5.051   1.00 22.42 ? 482 TYR A CE1 1 
ATOM   947  C CE2 . TYR A 1 139 ? 31.246 -0.571  3.601   1.00 22.32 ? 482 TYR A CE2 1 
ATOM   948  C CZ  . TYR A 1 139 ? 31.966 -0.035  4.655   1.00 22.95 ? 482 TYR A CZ  1 
ATOM   949  O OH  . TYR A 1 139 ? 31.474 1.075   5.303   1.00 22.92 ? 482 TYR A OH  1 
ATOM   950  N N   . LEU A 1 140 ? 34.386 -5.771  4.594   1.00 20.27 ? 483 LEU A N   1 
ATOM   951  C CA  . LEU A 1 140 ? 34.997 -5.942  5.908   1.00 20.13 ? 483 LEU A CA  1 
ATOM   952  C C   . LEU A 1 140 ? 35.720 -4.649  6.262   1.00 19.82 ? 483 LEU A C   1 
ATOM   953  O O   . LEU A 1 140 ? 36.489 -4.125  5.459   1.00 19.76 ? 483 LEU A O   1 
ATOM   954  C CB  . LEU A 1 140 ? 35.979 -7.115  5.898   1.00 20.20 ? 483 LEU A CB  1 
ATOM   955  C CG  . LEU A 1 140 ? 36.512 -7.678  7.224   1.00 21.34 ? 483 LEU A CG  1 
ATOM   956  C CD1 . LEU A 1 140 ? 37.025 -9.077  7.004   1.00 21.76 ? 483 LEU A CD1 1 
ATOM   957  C CD2 . LEU A 1 140 ? 37.616 -6.830  7.825   1.00 21.91 ? 483 LEU A CD2 1 
ATOM   958  N N   . SER A 1 141 ? 35.473 -4.152  7.467   1.00 19.50 ? 484 SER A N   1 
ATOM   959  C CA  . SER A 1 141 ? 36.120 -2.945  7.956   1.00 19.37 ? 484 SER A CA  1 
ATOM   960  C C   . SER A 1 141 ? 36.896 -3.281  9.217   1.00 19.30 ? 484 SER A C   1 
ATOM   961  O O   . SER A 1 141 ? 36.307 -3.701  10.207  1.00 18.77 ? 484 SER A O   1 
ATOM   962  C CB  . SER A 1 141 ? 35.070 -1.869  8.254   1.00 19.46 ? 484 SER A CB  1 
ATOM   963  O OG  . SER A 1 141 ? 35.688 -0.665  8.664   1.00 20.10 ? 484 SER A OG  1 
ATOM   964  N N   . VAL A 1 142 ? 38.216 -3.109  9.165   1.00 19.17 ? 485 VAL A N   1 
ATOM   965  C CA  . VAL A 1 142 ? 39.091 -3.474  10.278  1.00 19.69 ? 485 VAL A CA  1 
ATOM   966  C C   . VAL A 1 142 ? 40.007 -2.325  10.668  1.00 19.99 ? 485 VAL A C   1 
ATOM   967  O O   . VAL A 1 142 ? 40.537 -1.622  9.803   1.00 20.12 ? 485 VAL A O   1 
ATOM   968  C CB  . VAL A 1 142 ? 39.925 -4.753  9.967   1.00 19.86 ? 485 VAL A CB  1 
ATOM   969  C CG1 . VAL A 1 142 ? 40.735 -4.603  8.661   1.00 19.73 ? 485 VAL A CG1 1 
ATOM   970  C CG2 . VAL A 1 142 ? 40.833 -5.138  11.161  1.00 19.76 ? 485 VAL A CG2 1 
ATOM   971  N N   . ILE A 1 143 ? 40.178 -2.135  11.974  1.00 19.86 ? 486 ILE A N   1 
ATOM   972  C CA  . ILE A 1 143 ? 41.109 -1.145  12.492  1.00 20.35 ? 486 ILE A CA  1 
ATOM   973  C C   . ILE A 1 143 ? 42.279 -1.845  13.208  1.00 20.90 ? 486 ILE A C   1 
ATOM   974  O O   . ILE A 1 143 ? 42.068 -2.717  14.049  1.00 20.15 ? 486 ILE A O   1 
ATOM   975  C CB  . ILE A 1 143 ? 40.392 -0.077  13.390  1.00 20.11 ? 486 ILE A CB  1 
ATOM   976  C CG1 . ILE A 1 143 ? 41.395 0.981   13.884  1.00 19.58 ? 486 ILE A CG1 1 
ATOM   977  C CG2 . ILE A 1 143 ? 39.620 -0.739  14.547  1.00 19.67 ? 486 ILE A CG2 1 
ATOM   978  C CD1 . ILE A 1 143 ? 40.743 2.215   14.506  1.00 20.63 ? 486 ILE A CD1 1 
ATOM   979  N N   . ARG A 1 144 ? 43.505 -1.486  12.832  1.00 21.94 ? 487 ARG A N   1 
ATOM   980  C CA  . ARG A 1 144 ? 44.705 -2.123  13.386  1.00 24.23 ? 487 ARG A CA  1 
ATOM   981  C C   . ARG A 1 144 ? 45.796 -1.110  13.714  1.00 24.12 ? 487 ARG A C   1 
ATOM   982  O O   . ARG A 1 144 ? 45.973 -0.115  13.004  1.00 23.21 ? 487 ARG A O   1 
ATOM   983  C CB  . ARG A 1 144 ? 45.275 -3.177  12.416  1.00 23.90 ? 487 ARG A CB  1 
ATOM   984  C CG  . ARG A 1 144 ? 44.575 -4.548  12.480  1.00 26.75 ? 487 ARG A CG  1 
ATOM   985  C CD  . ARG A 1 144 ? 45.506 -5.750  12.180  1.00 27.28 ? 487 ARG A CD  1 
ATOM   986  N NE  . ARG A 1 144 ? 46.891 -5.559  12.626  1.00 34.17 ? 487 ARG A NE  1 
ATOM   987  C CZ  . ARG A 1 144 ? 47.306 -5.582  13.896  1.00 35.67 ? 487 ARG A CZ  1 
ATOM   988  N NH1 . ARG A 1 144 ? 46.446 -5.785  14.891  1.00 38.00 ? 487 ARG A NH1 1 
ATOM   989  N NH2 . ARG A 1 144 ? 48.591 -5.391  14.172  1.00 35.96 ? 487 ARG A NH2 1 
ATOM   990  N N   . LYS A 1 145 ? 46.531 -1.382  14.789  1.00 24.76 ? 488 LYS A N   1 
ATOM   991  C CA  . LYS A 1 145 ? 47.757 -0.653  15.076  1.00 25.71 ? 488 LYS A CA  1 
ATOM   992  C C   . LYS A 1 145 ? 48.949 -1.491  14.635  1.00 25.86 ? 488 LYS A C   1 
ATOM   993  O O   . LYS A 1 145 ? 49.086 -2.662  15.022  1.00 25.36 ? 488 LYS A O   1 
ATOM   994  C CB  . LYS A 1 145 ? 47.862 -0.274  16.560  1.00 25.63 ? 488 LYS A CB  1 
ATOM   995  C CG  . LYS A 1 145 ? 49.074 0.605   16.865  1.00 26.45 ? 488 LYS A CG  1 
ATOM   996  C CD  . LYS A 1 145 ? 49.263 0.864   18.362  1.00 27.27 ? 488 LYS A CD  1 
ATOM   997  C CE  . LYS A 1 145 ? 49.395 -0.425  19.179  1.00 30.49 ? 488 LYS A CE  1 
ATOM   998  N NZ  . LYS A 1 145 ? 50.467 -1.323  18.662  1.00 33.21 ? 488 LYS A NZ  1 
ATOM   999  N N   . ILE A 1 146 ? 49.789 -0.887  13.797  1.00 26.35 ? 489 ILE A N   1 
ATOM   1000 C CA  . ILE A 1 146 ? 51.004 -1.527  13.302  1.00 27.07 ? 489 ILE A CA  1 
ATOM   1001 C C   . ILE A 1 146 ? 52.182 -1.017  14.140  1.00 27.63 ? 489 ILE A C   1 
ATOM   1002 O O   . ILE A 1 146 ? 52.531 0.168   14.066  1.00 27.04 ? 489 ILE A O   1 
ATOM   1003 C CB  . ILE A 1 146 ? 51.231 -1.251  11.781  1.00 27.11 ? 489 ILE A CB  1 
ATOM   1004 C CG1 . ILE A 1 146 ? 50.035 -1.731  10.940  1.00 27.50 ? 489 ILE A CG1 1 
ATOM   1005 C CG2 . ILE A 1 146 ? 52.556 -1.864  11.284  1.00 27.25 ? 489 ILE A CG2 1 
ATOM   1006 C CD1 . ILE A 1 146 ? 49.626 -3.194  11.153  1.00 28.30 ? 489 ILE A CD1 1 
ATOM   1007 N N   . PRO A 1 147 ? 52.775 -1.907  14.961  1.00 28.26 ? 490 PRO A N   1 
ATOM   1008 C CA  . PRO A 1 147 ? 53.919 -1.557  15.798  1.00 28.83 ? 490 PRO A CA  1 
ATOM   1009 C C   . PRO A 1 147 ? 55.086 -0.986  14.995  1.00 29.22 ? 490 PRO A C   1 
ATOM   1010 O O   . PRO A 1 147 ? 55.332 -1.407  13.862  1.00 28.91 ? 490 PRO A O   1 
ATOM   1011 C CB  . PRO A 1 147 ? 54.324 -2.905  16.412  1.00 28.93 ? 490 PRO A CB  1 
ATOM   1012 C CG  . PRO A 1 147 ? 53.064 -3.686  16.444  1.00 29.27 ? 490 PRO A CG  1 
ATOM   1013 C CD  . PRO A 1 147 ? 52.371 -3.314  15.159  1.00 28.47 ? 490 PRO A CD  1 
ATOM   1014 N N   . ALA A 1 148 ? 55.780 -0.017  15.582  1.00 29.72 ? 491 ALA A N   1 
ATOM   1015 C CA  . ALA A 1 148 ? 57.041 0.467   15.031  1.00 30.50 ? 491 ALA A CA  1 
ATOM   1016 C C   . ALA A 1 148 ? 58.138 -0.573  15.290  1.00 30.77 ? 491 ALA A C   1 
ATOM   1017 O O   . ALA A 1 148 ? 58.134 -1.233  16.330  1.00 30.88 ? 491 ALA A O   1 
ATOM   1018 C CB  . ALA A 1 148 ? 57.399 1.796   15.658  1.00 30.41 ? 491 ALA A CB  1 
ATOM   1019 N N   . LEU A 1 149 ? 59.068 -0.734  14.349  1.00 31.48 ? 492 LEU A N   1 
ATOM   1020 C CA  . LEU A 1 149 ? 60.175 -1.688  14.546  1.00 31.97 ? 492 LEU A CA  1 
ATOM   1021 C C   . LEU A 1 149 ? 61.176 -1.217  15.612  1.00 32.35 ? 492 LEU A C   1 
ATOM   1022 O O   . LEU A 1 149 ? 61.826 -2.041  16.266  1.00 32.51 ? 492 LEU A O   1 
ATOM   1023 C CB  . LEU A 1 149 ? 60.881 -2.017  13.225  1.00 32.16 ? 492 LEU A CB  1 
ATOM   1024 C CG  . LEU A 1 149 ? 60.127 -2.861  12.184  1.00 32.44 ? 492 LEU A CG  1 
ATOM   1025 C CD1 . LEU A 1 149 ? 61.026 -3.165  10.989  1.00 32.97 ? 492 LEU A CD1 1 
ATOM   1026 C CD2 . LEU A 1 149 ? 59.556 -4.160  12.767  1.00 31.70 ? 492 LEU A CD2 1 
ATOM   1027 N N   . THR A 1 150 ? 61.292 0.103   15.772  1.00 32.56 ? 493 THR A N   1 
ATOM   1028 C CA  . THR A 1 150 ? 62.077 0.719   16.853  1.00 32.99 ? 493 THR A CA  1 
ATOM   1029 C C   . THR A 1 150 ? 61.335 1.929   17.414  1.00 33.08 ? 493 THR A C   1 
ATOM   1030 O O   . THR A 1 150 ? 60.383 2.421   16.802  1.00 32.90 ? 493 THR A O   1 
ATOM   1031 C CB  . THR A 1 150 ? 63.472 1.218   16.390  1.00 32.92 ? 493 THR A CB  1 
ATOM   1032 O OG1 . THR A 1 150 ? 63.314 2.344   15.519  1.00 33.66 ? 493 THR A OG1 1 
ATOM   1033 C CG2 . THR A 1 150 ? 64.276 0.119   15.688  1.00 33.40 ? 493 THR A CG2 1 
ATOM   1034 N N   . GLU A 1 151 ? 61.795 2.426   18.561  1.00 33.19 ? 494 GLU A N   1 
ATOM   1035 C CA  . GLU A 1 151 ? 61.210 3.617   19.174  1.00 33.58 ? 494 GLU A CA  1 
ATOM   1036 C C   . GLU A 1 151 ? 61.639 4.915   18.481  1.00 33.81 ? 494 GLU A C   1 
ATOM   1037 O O   . GLU A 1 151 ? 61.184 6.004   18.841  1.00 33.84 ? 494 GLU A O   1 
ATOM   1038 C CB  . GLU A 1 151 ? 61.482 3.637   20.685  1.00 33.74 ? 494 GLU A CB  1 
ATOM   1039 C CG  . GLU A 1 151 ? 60.813 2.464   21.407  1.00 33.83 ? 494 GLU A CG  1 
ATOM   1040 C CD  . GLU A 1 151 ? 60.876 2.547   22.919  1.00 33.90 ? 494 GLU A CD  1 
ATOM   1041 O OE1 . GLU A 1 151 ? 61.947 2.866   23.466  1.00 35.05 ? 494 GLU A OE1 1 
ATOM   1042 O OE2 . GLU A 1 151 ? 59.852 2.260   23.566  1.00 34.70 ? 494 GLU A OE2 1 
ATOM   1043 N N   . ASN A 1 152 ? 62.498 4.778   17.474  1.00 34.20 ? 495 ASN A N   1 
ATOM   1044 C CA  . ASN A 1 152 ? 62.909 5.881   16.602  1.00 34.63 ? 495 ASN A CA  1 
ATOM   1045 C C   . ASN A 1 152 ? 61.961 6.040   15.412  1.00 34.79 ? 495 ASN A C   1 
ATOM   1046 O O   . ASN A 1 152 ? 62.082 6.988   14.628  1.00 34.85 ? 495 ASN A O   1 
ATOM   1047 C CB  . ASN A 1 152 ? 64.329 5.630   16.082  1.00 34.82 ? 495 ASN A CB  1 
ATOM   1048 C CG  . ASN A 1 152 ? 65.306 5.265   17.188  1.00 35.64 ? 495 ASN A CG  1 
ATOM   1049 O OD1 . ASN A 1 152 ? 65.553 6.057   18.101  1.00 36.98 ? 495 ASN A OD1 1 
ATOM   1050 N ND2 . ASN A 1 152 ? 65.877 4.066   17.102  1.00 35.00 ? 495 ASN A ND2 1 
ATOM   1051 N N   . ASP A 1 153 ? 61.019 5.105   15.289  1.00 34.84 ? 496 ASP A N   1 
ATOM   1052 C CA  . ASP A 1 153 ? 60.074 5.067   14.169  1.00 34.91 ? 496 ASP A CA  1 
ATOM   1053 C C   . ASP A 1 153 ? 58.648 5.385   14.616  1.00 34.35 ? 496 ASP A C   1 
ATOM   1054 O O   . ASP A 1 153 ? 58.312 5.206   15.786  1.00 34.77 ? 496 ASP A O   1 
ATOM   1055 C CB  . ASP A 1 153 ? 60.121 3.690   13.501  1.00 35.17 ? 496 ASP A CB  1 
ATOM   1056 C CG  . ASP A 1 153 ? 61.470 3.389   12.896  1.00 36.50 ? 496 ASP A CG  1 
ATOM   1057 O OD1 . ASP A 1 153 ? 62.016 4.281   12.210  1.00 37.95 ? 496 ASP A OD1 1 
ATOM   1058 O OD2 . ASP A 1 153 ? 61.988 2.269   13.111  1.00 38.13 ? 496 ASP A OD2 1 
ATOM   1059 N N   . PRO A 1 154 ? 57.795 5.863   13.691  1.00 33.81 ? 497 PRO A N   1 
ATOM   1060 C CA  . PRO A 1 154 ? 56.416 6.103   14.130  1.00 32.92 ? 497 PRO A CA  1 
ATOM   1061 C C   . PRO A 1 154 ? 55.589 4.816   14.141  1.00 31.73 ? 497 PRO A C   1 
ATOM   1062 O O   . PRO A 1 154 ? 55.883 3.894   13.383  1.00 31.86 ? 497 PRO A O   1 
ATOM   1063 C CB  . PRO A 1 154 ? 55.878 7.087   13.084  1.00 33.11 ? 497 PRO A CB  1 
ATOM   1064 C CG  . PRO A 1 154 ? 56.710 6.862   11.860  1.00 33.23 ? 497 PRO A CG  1 
ATOM   1065 C CD  . PRO A 1 154 ? 58.005 6.208   12.270  1.00 34.03 ? 497 PRO A CD  1 
ATOM   1066 N N   . GLU A 1 155 ? 54.589 4.745   15.014  1.00 30.28 ? 498 GLU A N   1 
ATOM   1067 C CA  . GLU A 1 155 ? 53.601 3.669   14.952  1.00 29.29 ? 498 GLU A CA  1 
ATOM   1068 C C   . GLU A 1 155 ? 52.584 4.044   13.878  1.00 27.70 ? 498 GLU A C   1 
ATOM   1069 O O   . GLU A 1 155 ? 52.396 5.224   13.585  1.00 26.99 ? 498 GLU A O   1 
ATOM   1070 C CB  . GLU A 1 155 ? 52.894 3.467   16.301  1.00 29.31 ? 498 GLU A CB  1 
ATOM   1071 C CG  . GLU A 1 155 ? 53.731 2.695   17.333  1.00 30.09 ? 498 GLU A CG  1 
ATOM   1072 C CD  . GLU A 1 155 ? 52.931 2.261   18.555  1.00 30.22 ? 498 GLU A CD  1 
ATOM   1073 O OE1 . GLU A 1 155 ? 52.035 3.013   19.000  1.00 31.40 ? 498 GLU A OE1 1 
ATOM   1074 O OE2 . GLU A 1 155 ? 53.208 1.160   19.074  1.00 31.93 ? 498 GLU A OE2 1 
ATOM   1075 N N   . THR A 1 156 ? 51.937 3.044   13.294  1.00 26.10 ? 499 THR A N   1 
ATOM   1076 C CA  . THR A 1 156 ? 50.946 3.305   12.253  1.00 24.70 ? 499 THR A CA  1 
ATOM   1077 C C   . THR A 1 156 ? 49.583 2.762   12.660  1.00 23.76 ? 499 THR A C   1 
ATOM   1078 O O   . THR A 1 156 ? 49.481 1.625   13.116  1.00 23.92 ? 499 THR A O   1 
ATOM   1079 C CB  . THR A 1 156 ? 51.382 2.706   10.892  1.00 24.61 ? 499 THR A CB  1 
ATOM   1080 O OG1 . THR A 1 156 ? 52.747 3.045   10.643  1.00 24.27 ? 499 THR A OG1 1 
ATOM   1081 C CG2 . THR A 1 156 ? 50.527 3.265   9.761   1.00 24.13 ? 499 THR A CG2 1 
ATOM   1082 N N   . TRP A 1 157 ? 48.556 3.601   12.536  1.00 22.57 ? 500 TRP A N   1 
ATOM   1083 C CA  . TRP A 1 157 ? 47.175 3.160   12.642  1.00 21.82 ? 500 TRP A CA  1 
ATOM   1084 C C   . TRP A 1 157 ? 46.603 3.062   11.233  1.00 21.02 ? 500 TRP A C   1 
ATOM   1085 O O   . TRP A 1 157 ? 46.829 3.955   10.403  1.00 20.35 ? 500 TRP A O   1 
ATOM   1086 C CB  . TRP A 1 157 ? 46.352 4.115   13.510  1.00 22.25 ? 500 TRP A CB  1 
ATOM   1087 C CG  . TRP A 1 157 ? 46.582 3.881   14.978  1.00 22.79 ? 500 TRP A CG  1 
ATOM   1088 C CD1 . TRP A 1 157 ? 47.562 4.430   15.755  1.00 23.91 ? 500 TRP A CD1 1 
ATOM   1089 C CD2 . TRP A 1 157 ? 45.829 3.016   15.830  1.00 23.82 ? 500 TRP A CD2 1 
ATOM   1090 N NE1 . TRP A 1 157 ? 47.460 3.965   17.052  1.00 23.25 ? 500 TRP A NE1 1 
ATOM   1091 C CE2 . TRP A 1 157 ? 46.406 3.091   17.121  1.00 23.94 ? 500 TRP A CE2 1 
ATOM   1092 C CE3 . TRP A 1 157 ? 44.716 2.189   15.632  1.00 24.82 ? 500 TRP A CE3 1 
ATOM   1093 C CZ2 . TRP A 1 157 ? 45.905 2.368   18.208  1.00 23.60 ? 500 TRP A CZ2 1 
ATOM   1094 C CZ3 . TRP A 1 157 ? 44.221 1.465   16.720  1.00 24.35 ? 500 TRP A CZ3 1 
ATOM   1095 C CH2 . TRP A 1 157 ? 44.819 1.562   17.987  1.00 23.98 ? 500 TRP A CH2 1 
ATOM   1096 N N   . ILE A 1 158 ? 45.897 1.966   10.966  1.00 20.32 ? 501 ILE A N   1 
ATOM   1097 C CA  . ILE A 1 158 ? 45.271 1.733   9.655   1.00 19.45 ? 501 ILE A CA  1 
ATOM   1098 C C   . ILE A 1 158 ? 43.829 1.229   9.781   1.00 19.68 ? 501 ILE A C   1 
ATOM   1099 O O   . ILE A 1 158 ? 43.519 0.399   10.633  1.00 18.79 ? 501 ILE A O   1 
ATOM   1100 C CB  . ILE A 1 158 ? 46.114 0.772   8.770   1.00 19.36 ? 501 ILE A CB  1 
ATOM   1101 C CG1 . ILE A 1 158 ? 45.461 0.571   7.384   1.00 18.04 ? 501 ILE A CG1 1 
ATOM   1102 C CG2 . ILE A 1 158 ? 46.354 -0.573  9.497   1.00 19.80 ? 501 ILE A CG2 1 
ATOM   1103 C CD1 . ILE A 1 158 ? 46.361 -0.101  6.328   1.00 19.32 ? 501 ILE A CD1 1 
ATOM   1104 N N   . VAL A 1 159 ? 42.948 1.766   8.940   1.00 19.77 ? 502 VAL A N   1 
ATOM   1105 C CA  . VAL A 1 159 ? 41.628 1.189   8.747   1.00 20.36 ? 502 VAL A CA  1 
ATOM   1106 C C   . VAL A 1 159 ? 41.599 0.675   7.313   1.00 21.13 ? 502 VAL A C   1 
ATOM   1107 O O   . VAL A 1 159 ? 41.894 1.420   6.375   1.00 20.60 ? 502 VAL A O   1 
ATOM   1108 C CB  . VAL A 1 159 ? 40.489 2.200   9.003   1.00 20.35 ? 502 VAL A CB  1 
ATOM   1109 C CG1 . VAL A 1 159 ? 39.117 1.554   8.753   1.00 20.17 ? 502 VAL A CG1 1 
ATOM   1110 C CG2 . VAL A 1 159 ? 40.557 2.733   10.434  1.00 20.75 ? 502 VAL A CG2 1 
ATOM   1111 N N   . CYS A 1 160 ? 41.313 -0.611  7.157   1.00 22.57 ? 503 CYS A N   1 
ATOM   1112 C CA  . CYS A 1 160 ? 41.186 -1.207  5.830   1.00 22.72 ? 503 CYS A CA  1 
ATOM   1113 C C   . CYS A 1 160 ? 39.742 -1.640  5.626   1.00 21.80 ? 503 CYS A C   1 
ATOM   1114 O O   . CYS A 1 160 ? 39.181 -2.366  6.452   1.00 21.16 ? 503 CYS A O   1 
ATOM   1115 C CB  . CYS A 1 160 ? 42.160 -2.382  5.642   1.00 23.20 ? 503 CYS A CB  1 
ATOM   1116 S SG  . CYS A 1 160 ? 42.236 -2.970  3.913   1.00 28.11 ? 503 CYS A SG  1 
ATOM   1117 N N   . ASN A 1 161 ? 39.140 -1.132  4.549   1.00 21.25 ? 504 ASN A N   1 
ATOM   1118 C CA  . ASN A 1 161 ? 37.790 -1.486  4.135   1.00 20.97 ? 504 ASN A CA  1 
ATOM   1119 C C   . ASN A 1 161 ? 37.869 -2.196  2.785   1.00 21.01 ? 504 ASN A C   1 
ATOM   1120 O O   . ASN A 1 161 ? 38.265 -1.586  1.791   1.00 20.82 ? 504 ASN A O   1 
ATOM   1121 C CB  . ASN A 1 161 ? 36.907 -0.235  4.005   1.00 20.85 ? 504 ASN A CB  1 
ATOM   1122 C CG  . ASN A 1 161 ? 36.755 0.533   5.315   1.00 21.00 ? 504 ASN A CG  1 
ATOM   1123 O OD1 . ASN A 1 161 ? 36.863 -0.031  6.398   1.00 20.54 ? 504 ASN A OD1 1 
ATOM   1124 N ND2 . ASN A 1 161 ? 36.492 1.828   5.211   1.00 20.87 ? 504 ASN A ND2 1 
ATOM   1125 N N   . PHE A 1 162 ? 37.511 -3.478  2.757   1.00 20.65 ? 505 PHE A N   1 
ATOM   1126 C CA  . PHE A 1 162 ? 37.586 -4.272  1.526   1.00 20.79 ? 505 PHE A CA  1 
ATOM   1127 C C   . PHE A 1 162 ? 36.387 -5.195  1.310   1.00 20.51 ? 505 PHE A C   1 
ATOM   1128 O O   . PHE A 1 162 ? 35.899 -5.835  2.241   1.00 20.34 ? 505 PHE A O   1 
ATOM   1129 C CB  . PHE A 1 162 ? 38.923 -5.040  1.414   1.00 20.72 ? 505 PHE A CB  1 
ATOM   1130 C CG  . PHE A 1 162 ? 39.176 -6.049  2.521   1.00 21.57 ? 505 PHE A CG  1 
ATOM   1131 C CD1 . PHE A 1 162 ? 38.813 -7.389  2.361   1.00 22.49 ? 505 PHE A CD1 1 
ATOM   1132 C CD2 . PHE A 1 162 ? 39.820 -5.669  3.698   1.00 20.98 ? 505 PHE A CD2 1 
ATOM   1133 C CE1 . PHE A 1 162 ? 39.056 -8.328  3.366   1.00 23.19 ? 505 PHE A CE1 1 
ATOM   1134 C CE2 . PHE A 1 162 ? 40.075 -6.601  4.713   1.00 22.39 ? 505 PHE A CE2 1 
ATOM   1135 C CZ  . PHE A 1 162 ? 39.694 -7.937  4.550   1.00 22.43 ? 505 PHE A CZ  1 
ATOM   1136 N N   . SER A 1 163 ? 35.926 -5.264  0.067   1.00 20.43 ? 506 SER A N   1 
ATOM   1137 C CA  . SER A 1 163 ? 34.761 -6.069  -0.271  1.00 20.92 ? 506 SER A CA  1 
ATOM   1138 C C   . SER A 1 163 ? 34.940 -7.555  0.088   1.00 20.95 ? 506 SER A C   1 
ATOM   1139 O O   . SER A 1 163 ? 35.981 -8.159  -0.178  1.00 20.60 ? 506 SER A O   1 
ATOM   1140 C CB  . SER A 1 163 ? 34.414 -5.897  -1.758  1.00 20.81 ? 506 SER A CB  1 
ATOM   1141 O OG  . SER A 1 163 ? 33.921 -4.584  -1.987  1.00 20.03 ? 506 SER A OG  1 
ATOM   1142 N N   . VAL A 1 164 ? 33.919 -8.115  0.725   1.00 21.94 ? 507 VAL A N   1 
ATOM   1143 C CA  . VAL A 1 164 ? 33.846 -9.550  1.011   1.00 22.84 ? 507 VAL A CA  1 
ATOM   1144 C C   . VAL A 1 164 ? 32.452 -10.045 0.648   1.00 23.90 ? 507 VAL A C   1 
ATOM   1145 O O   . VAL A 1 164 ? 31.547 -9.245  0.432   1.00 24.18 ? 507 VAL A O   1 
ATOM   1146 C CB  . VAL A 1 164 ? 34.128 -9.886  2.512   1.00 22.39 ? 507 VAL A CB  1 
ATOM   1147 C CG1 . VAL A 1 164 ? 35.528 -9.437  2.933   1.00 22.07 ? 507 VAL A CG1 1 
ATOM   1148 C CG2 . VAL A 1 164 ? 33.057 -9.301  3.430   1.00 22.24 ? 507 VAL A CG2 1 
ATOM   1149 N N   . ASP A 1 165 ? 32.288 -11.363 0.579   1.00 25.53 ? 508 ASP A N   1 
ATOM   1150 C CA  . ASP A 1 165 ? 30.969 -11.970 0.415   1.00 26.94 ? 508 ASP A CA  1 
ATOM   1151 C C   . ASP A 1 165 ? 30.360 -12.337 1.770   1.00 27.73 ? 508 ASP A C   1 
ATOM   1152 O O   . ASP A 1 165 ? 31.078 -12.674 2.711   1.00 27.33 ? 508 ASP A O   1 
ATOM   1153 C CB  . ASP A 1 165 ? 31.067 -13.231 -0.451  1.00 27.37 ? 508 ASP A CB  1 
ATOM   1154 C CG  . ASP A 1 165 ? 31.518 -12.940 -1.873  1.00 28.83 ? 508 ASP A CG  1 
ATOM   1155 O OD1 . ASP A 1 165 ? 31.237 -11.837 -2.394  1.00 30.52 ? 508 ASP A OD1 1 
ATOM   1156 O OD2 . ASP A 1 165 ? 32.152 -13.832 -2.476  1.00 31.32 ? 508 ASP A OD2 1 
ATOM   1157 N N   . HIS A 1 166 ? 29.033 -12.276 1.853   1.00 29.18 ? 509 HIS A N   1 
ATOM   1158 C CA  . HIS A 1 166 ? 28.302 -12.750 3.025   1.00 30.72 ? 509 HIS A CA  1 
ATOM   1159 C C   . HIS A 1 166 ? 26.950 -13.312 2.612   1.00 31.43 ? 509 HIS A C   1 
ATOM   1160 O O   . HIS A 1 166 ? 26.216 -12.680 1.844   1.00 31.60 ? 509 HIS A O   1 
ATOM   1161 C CB  . HIS A 1 166 ? 28.129 -11.643 4.073   1.00 30.78 ? 509 HIS A CB  1 
ATOM   1162 C CG  . HIS A 1 166 ? 27.706 -12.157 5.414   1.00 32.14 ? 509 HIS A CG  1 
ATOM   1163 N ND1 . HIS A 1 166 ? 28.596 -12.391 6.440   1.00 33.44 ? 509 HIS A ND1 1 
ATOM   1164 C CD2 . HIS A 1 166 ? 26.488 -12.507 5.888   1.00 32.35 ? 509 HIS A CD2 1 
ATOM   1165 C CE1 . HIS A 1 166 ? 27.943 -12.856 7.490   1.00 32.92 ? 509 HIS A CE1 1 
ATOM   1166 N NE2 . HIS A 1 166 ? 26.662 -12.933 7.182   1.00 33.92 ? 509 HIS A NE2 1 
ATOM   1167 N N   . ASP A 1 167 ? 26.636 -14.503 3.122   1.00 32.55 ? 510 ASP A N   1 
ATOM   1168 C CA  . ASP A 1 167 ? 25.397 -15.216 2.780   1.00 33.56 ? 510 ASP A CA  1 
ATOM   1169 C C   . ASP A 1 167 ? 24.130 -14.423 3.101   1.00 34.20 ? 510 ASP A C   1 
ATOM   1170 O O   . ASP A 1 167 ? 23.111 -14.590 2.434   1.00 34.47 ? 510 ASP A O   1 
ATOM   1171 C CB  . ASP A 1 167 ? 25.352 -16.590 3.461   1.00 33.71 ? 510 ASP A CB  1 
ATOM   1172 C CG  . ASP A 1 167 ? 26.271 -17.613 2.795   1.00 34.45 ? 510 ASP A CG  1 
ATOM   1173 O OD1 . ASP A 1 167 ? 26.786 -17.350 1.685   1.00 33.94 ? 510 ASP A OD1 1 
ATOM   1174 O OD2 . ASP A 1 167 ? 26.475 -18.694 3.384   1.00 36.49 ? 510 ASP A OD2 1 
ATOM   1175 N N   . SER A 1 168 ? 24.204 -13.557 4.109   1.00 34.82 ? 511 SER A N   1 
ATOM   1176 C CA  . SER A 1 168 ? 23.064 -12.737 4.518   1.00 35.75 ? 511 SER A CA  1 
ATOM   1177 C C   . SER A 1 168 ? 22.896 -11.477 3.668   1.00 36.29 ? 511 SER A C   1 
ATOM   1178 O O   . SER A 1 168 ? 21.883 -10.790 3.767   1.00 36.49 ? 511 SER A O   1 
ATOM   1179 C CB  . SER A 1 168 ? 23.161 -12.377 6.001   1.00 35.79 ? 511 SER A CB  1 
ATOM   1180 O OG  . SER A 1 168 ? 23.357 -13.540 6.788   1.00 36.47 ? 511 SER A OG  1 
ATOM   1181 N N   . ALA A 1 169 ? 23.890 -11.178 2.834   1.00 37.14 ? 512 ALA A N   1 
ATOM   1182 C CA  . ALA A 1 169 ? 23.799 -10.065 1.896   1.00 37.87 ? 512 ALA A CA  1 
ATOM   1183 C C   . ALA A 1 169 ? 24.169 -10.516 0.479   1.00 38.64 ? 512 ALA A C   1 
ATOM   1184 O O   . ALA A 1 169 ? 25.285 -10.254 0.011   1.00 38.58 ? 512 ALA A O   1 
ATOM   1185 C CB  . ALA A 1 169 ? 24.674 -8.896  2.351   1.00 37.65 ? 512 ALA A CB  1 
ATOM   1186 N N   . PRO A 1 170 ? 23.231 -11.203 -0.211  1.00 39.30 ? 513 PRO A N   1 
ATOM   1187 C CA  . PRO A 1 170 ? 23.495 -11.593 -1.595  1.00 39.75 ? 513 PRO A CA  1 
ATOM   1188 C C   . PRO A 1 170 ? 23.277 -10.411 -2.531  1.00 40.36 ? 513 PRO A C   1 
ATOM   1189 O O   . PRO A 1 170 ? 22.778 -9.366  -2.099  1.00 40.06 ? 513 PRO A O   1 
ATOM   1190 C CB  . PRO A 1 170 ? 22.442 -12.673 -1.856  1.00 39.75 ? 513 PRO A CB  1 
ATOM   1191 C CG  . PRO A 1 170 ? 21.293 -12.285 -0.987  1.00 39.60 ? 513 PRO A CG  1 
ATOM   1192 C CD  . PRO A 1 170 ? 21.893 -11.642 0.239   1.00 39.31 ? 513 PRO A CD  1 
ATOM   1193 N N   . LEU A 1 171 ? 23.653 -10.573 -3.797  1.00 41.26 ? 514 LEU A N   1 
ATOM   1194 C CA  . LEU A 1 171 ? 23.365 -9.560  -4.809  1.00 42.30 ? 514 LEU A CA  1 
ATOM   1195 C C   . LEU A 1 171 ? 21.852 -9.366  -4.914  1.00 43.05 ? 514 LEU A C   1 
ATOM   1196 O O   . LEU A 1 171 ? 21.088 -10.335 -4.869  1.00 43.27 ? 514 LEU A O   1 
ATOM   1197 C CB  . LEU A 1 171 ? 23.946 -9.960  -6.172  1.00 42.30 ? 514 LEU A CB  1 
ATOM   1198 C CG  . LEU A 1 171 ? 25.439 -10.292 -6.308  1.00 42.22 ? 514 LEU A CG  1 
ATOM   1199 C CD1 . LEU A 1 171 ? 25.741 -10.812 -7.707  1.00 42.01 ? 514 LEU A CD1 1 
ATOM   1200 C CD2 . LEU A 1 171 ? 26.326 -9.097  -5.977  1.00 41.92 ? 514 LEU A CD2 1 
ATOM   1201 N N   . ASN A 1 172 ? 21.424 -8.113  -5.019  1.00 43.87 ? 515 ASN A N   1 
ATOM   1202 C CA  . ASN A 1 172 ? 20.010 -7.808  -5.211  1.00 44.66 ? 515 ASN A CA  1 
ATOM   1203 C C   . ASN A 1 172 ? 19.773 -7.141  -6.563  1.00 45.01 ? 515 ASN A C   1 
ATOM   1204 O O   . ASN A 1 172 ? 20.730 -6.778  -7.251  1.00 45.01 ? 515 ASN A O   1 
ATOM   1205 C CB  . ASN A 1 172 ? 19.460 -6.964  -4.052  1.00 44.67 ? 515 ASN A CB  1 
ATOM   1206 C CG  . ASN A 1 172 ? 20.148 -5.618  -3.920  1.00 45.54 ? 515 ASN A CG  1 
ATOM   1207 O OD1 . ASN A 1 172 ? 20.138 -4.807  -4.847  1.00 46.29 ? 515 ASN A OD1 1 
ATOM   1208 N ND2 . ASN A 1 172 ? 20.732 -5.364  -2.752  1.00 45.55 ? 515 ASN A ND2 1 
ATOM   1209 N N   . ASN A 1 173 ? 18.504 -6.985  -6.937  1.00 45.43 ? 516 ASN A N   1 
ATOM   1210 C CA  . ASN A 1 173 ? 18.139 -6.440  -8.246  1.00 45.70 ? 516 ASN A CA  1 
ATOM   1211 C C   . ASN A 1 173 ? 18.037 -4.917  -8.288  1.00 45.56 ? 516 ASN A C   1 
ATOM   1212 O O   . ASN A 1 173 ? 18.145 -4.316  -9.361  1.00 45.78 ? 516 ASN A O   1 
ATOM   1213 C CB  . ASN A 1 173 ? 16.833 -7.071  -8.745  1.00 46.13 ? 516 ASN A CB  1 
ATOM   1214 C CG  . ASN A 1 173 ? 16.993 -8.537  -9.115  1.00 46.95 ? 516 ASN A CG  1 
ATOM   1215 O OD1 . ASN A 1 173 ? 17.969 -8.932  -9.765  1.00 48.32 ? 516 ASN A OD1 1 
ATOM   1216 N ND2 . ASN A 1 173 ? 16.028 -9.353  -8.710  1.00 48.10 ? 516 ASN A ND2 1 
ATOM   1217 N N   . ARG A 1 174 ? 17.838 -4.299  -7.123  1.00 45.41 ? 517 ARG A N   1 
ATOM   1218 C CA  . ARG A 1 174 ? 17.688 -2.841  -7.024  1.00 45.26 ? 517 ARG A CA  1 
ATOM   1219 C C   . ARG A 1 174 ? 19.023 -2.080  -7.026  1.00 44.65 ? 517 ARG A C   1 
ATOM   1220 O O   . ARG A 1 174 ? 19.091 -0.934  -7.481  1.00 44.80 ? 517 ARG A O   1 
ATOM   1221 C CB  . ARG A 1 174 ? 16.827 -2.449  -5.806  1.00 45.37 ? 517 ARG A CB  1 
ATOM   1222 C CG  . ARG A 1 174 ? 17.341 -2.952  -4.456  1.00 46.21 ? 517 ARG A CG  1 
ATOM   1223 C CD  . ARG A 1 174 ? 16.282 -2.827  -3.354  1.00 45.91 ? 517 ARG A CD  1 
ATOM   1224 N NE  . ARG A 1 174 ? 16.810 -3.233  -2.049  1.00 47.06 ? 517 ARG A NE  1 
ATOM   1225 C CZ  . ARG A 1 174 ? 16.873 -4.492  -1.611  1.00 47.72 ? 517 ARG A CZ  1 
ATOM   1226 N NH1 . ARG A 1 174 ? 16.440 -5.496  -2.369  1.00 48.29 ? 517 ARG A NH1 1 
ATOM   1227 N NH2 . ARG A 1 174 ? 17.373 -4.750  -0.409  1.00 47.70 ? 517 ARG A NH2 1 
ATOM   1228 N N   . CYS A 1 175 ? 20.079 -2.718  -6.533  1.00 43.68 ? 518 CYS A N   1 
ATOM   1229 C CA  . CYS A 1 175 ? 21.380 -2.062  -6.442  1.00 42.74 ? 518 CYS A CA  1 
ATOM   1230 C C   . CYS A 1 175 ? 22.462 -2.711  -7.287  1.00 41.60 ? 518 CYS A C   1 
ATOM   1231 O O   . CYS A 1 175 ? 22.414 -3.903  -7.591  1.00 41.53 ? 518 CYS A O   1 
ATOM   1232 C CB  . CYS A 1 175 ? 21.839 -1.971  -4.987  1.00 42.89 ? 518 CYS A CB  1 
ATOM   1233 S SG  . CYS A 1 175 ? 21.019 -0.681  -4.047  1.00 44.21 ? 518 CYS A SG  1 
ATOM   1234 N N   . VAL A 1 176 ? 23.435 -1.891  -7.667  1.00 40.36 ? 519 VAL A N   1 
ATOM   1235 C CA  . VAL A 1 176 ? 24.635 -2.347  -8.349  1.00 39.03 ? 519 VAL A CA  1 
ATOM   1236 C C   . VAL A 1 176 ? 25.754 -2.515  -7.309  1.00 37.85 ? 519 VAL A C   1 
ATOM   1237 O O   . VAL A 1 176 ? 26.089 -1.567  -6.595  1.00 37.80 ? 519 VAL A O   1 
ATOM   1238 C CB  . VAL A 1 176 ? 25.048 -1.344  -9.443  1.00 39.03 ? 519 VAL A CB  1 
ATOM   1239 C CG1 . VAL A 1 176 ? 26.436 -1.639  -9.935  1.00 39.34 ? 519 VAL A CG1 1 
ATOM   1240 C CG2 . VAL A 1 176 ? 24.055 -1.386  -10.600 1.00 39.26 ? 519 VAL A CG2 1 
ATOM   1241 N N   . ARG A 1 177 ? 26.316 -3.720  -7.226  1.00 36.24 ? 520 ARG A N   1 
ATOM   1242 C CA  . ARG A 1 177 ? 27.319 -4.048  -6.211  1.00 34.75 ? 520 ARG A CA  1 
ATOM   1243 C C   . ARG A 1 177 ? 28.731 -3.574  -6.587  1.00 33.60 ? 520 ARG A C   1 
ATOM   1244 O O   . ARG A 1 177 ? 29.387 -4.152  -7.452  1.00 33.39 ? 520 ARG A O   1 
ATOM   1245 C CB  . ARG A 1 177 ? 27.294 -5.556  -5.912  1.00 34.74 ? 520 ARG A CB  1 
ATOM   1246 C CG  . ARG A 1 177 ? 28.229 -6.046  -4.789  1.00 34.69 ? 520 ARG A CG  1 
ATOM   1247 C CD  . ARG A 1 177 ? 27.785 -5.649  -3.379  1.00 34.24 ? 520 ARG A CD  1 
ATOM   1248 N NE  . ARG A 1 177 ? 26.345 -5.795  -3.138  1.00 34.21 ? 520 ARG A NE  1 
ATOM   1249 C CZ  . ARG A 1 177 ? 25.760 -6.846  -2.566  1.00 34.11 ? 520 ARG A CZ  1 
ATOM   1250 N NH1 . ARG A 1 177 ? 26.470 -7.890  -2.163  1.00 35.11 ? 520 ARG A NH1 1 
ATOM   1251 N NH2 . ARG A 1 177 ? 24.446 -6.850  -2.394  1.00 34.75 ? 520 ARG A NH2 1 
ATOM   1252 N N   . ALA A 1 178 ? 29.182 -2.513  -5.925  1.00 32.27 ? 521 ALA A N   1 
ATOM   1253 C CA  . ALA A 1 178 ? 30.557 -2.016  -6.077  1.00 30.78 ? 521 ALA A CA  1 
ATOM   1254 C C   . ALA A 1 178 ? 31.553 -2.917  -5.345  1.00 29.93 ? 521 ALA A C   1 
ATOM   1255 O O   . ALA A 1 178 ? 31.193 -3.587  -4.371  1.00 29.76 ? 521 ALA A O   1 
ATOM   1256 C CB  . ALA A 1 178 ? 30.657 -0.587  -5.564  1.00 30.73 ? 521 ALA A CB  1 
ATOM   1257 N N   . LYS A 1 179 ? 32.799 -2.933  -5.818  1.00 28.71 ? 522 LYS A N   1 
ATOM   1258 C CA  . LYS A 1 179 ? 33.879 -3.672  -5.159  1.00 27.56 ? 522 LYS A CA  1 
ATOM   1259 C C   . LYS A 1 179 ? 35.017 -2.725  -4.768  1.00 26.52 ? 522 LYS A C   1 
ATOM   1260 O O   . LYS A 1 179 ? 35.598 -2.057  -5.623  1.00 26.07 ? 522 LYS A O   1 
ATOM   1261 C CB  . LYS A 1 179 ? 34.391 -4.815  -6.048  1.00 28.23 ? 522 LYS A CB  1 
ATOM   1262 C CG  . LYS A 1 179 ? 33.329 -5.869  -6.424  1.00 28.98 ? 522 LYS A CG  1 
ATOM   1263 C CD  . LYS A 1 179 ? 32.569 -6.384  -5.195  1.00 31.14 ? 522 LYS A CD  1 
ATOM   1264 C CE  . LYS A 1 179 ? 31.693 -7.583  -5.506  1.00 31.07 ? 522 LYS A CE  1 
ATOM   1265 N NZ  . LYS A 1 179 ? 32.528 -8.804  -5.701  1.00 33.35 ? 522 LYS A NZ  1 
ATOM   1266 N N   . ILE A 1 180 ? 35.335 -2.685  -3.472  1.00 24.95 ? 523 ILE A N   1 
ATOM   1267 C CA  . ILE A 1 180 ? 36.258 -1.685  -2.927  1.00 23.51 ? 523 ILE A CA  1 
ATOM   1268 C C   . ILE A 1 180 ? 37.485 -2.279  -2.226  1.00 22.76 ? 523 ILE A C   1 
ATOM   1269 O O   . ILE A 1 180 ? 37.452 -3.401  -1.709  1.00 22.60 ? 523 ILE A O   1 
ATOM   1270 C CB  . ILE A 1 180 ? 35.531 -0.677  -1.968  1.00 23.51 ? 523 ILE A CB  1 
ATOM   1271 C CG1 . ILE A 1 180 ? 35.130 -1.339  -0.644  1.00 23.50 ? 523 ILE A CG1 1 
ATOM   1272 C CG2 . ILE A 1 180 ? 34.308 -0.048  -2.646  1.00 23.08 ? 523 ILE A CG2 1 
ATOM   1273 C CD1 . ILE A 1 180 ? 34.829 -0.344  0.485   1.00 23.73 ? 523 ILE A CD1 1 
ATOM   1274 N N   . ASN A 1 181 ? 38.574 -1.524  -2.259  1.00 21.93 ? 524 ASN A N   1 
ATOM   1275 C CA  . ASN A 1 181 ? 39.738 -1.747  -1.411  1.00 21.39 ? 524 ASN A CA  1 
ATOM   1276 C C   . ASN A 1 181 ? 40.177 -0.340  -1.030  1.00 20.16 ? 524 ASN A C   1 
ATOM   1277 O O   . ASN A 1 181 ? 40.740 0.390   -1.855  1.00 19.27 ? 524 ASN A O   1 
ATOM   1278 C CB  . ASN A 1 181 ? 40.846 -2.508  -2.161  1.00 22.06 ? 524 ASN A CB  1 
ATOM   1279 C CG  . ASN A 1 181 ? 42.138 -2.663  -1.337  1.00 24.29 ? 524 ASN A CG  1 
ATOM   1280 O OD1 . ASN A 1 181 ? 42.158 -2.439  -0.126  1.00 26.61 ? 524 ASN A OD1 1 
ATOM   1281 N ND2 . ASN A 1 181 ? 43.221 -3.056  -2.008  1.00 26.57 ? 524 ASN A ND2 1 
ATOM   1282 N N   . VAL A 1 182 ? 39.871 0.038   0.210   1.00 19.00 ? 525 VAL A N   1 
ATOM   1283 C CA  . VAL A 1 182 ? 40.075 1.397   0.702   1.00 18.01 ? 525 VAL A CA  1 
ATOM   1284 C C   . VAL A 1 182 ? 40.910 1.319   1.989   1.00 17.98 ? 525 VAL A C   1 
ATOM   1285 O O   . VAL A 1 182 ? 40.693 0.424   2.818   1.00 17.04 ? 525 VAL A O   1 
ATOM   1286 C CB  . VAL A 1 182 ? 38.709 2.123   0.948   1.00 18.36 ? 525 VAL A CB  1 
ATOM   1287 C CG1 . VAL A 1 182 ? 38.862 3.342   1.855   1.00 18.30 ? 525 VAL A CG1 1 
ATOM   1288 C CG2 . VAL A 1 182 ? 38.070 2.551   -0.373  1.00 17.24 ? 525 VAL A CG2 1 
ATOM   1289 N N   . ALA A 1 183 ? 41.870 2.232   2.137   1.00 17.96 ? 526 ALA A N   1 
ATOM   1290 C CA  . ALA A 1 183 ? 42.644 2.330   3.386   1.00 17.91 ? 526 ALA A CA  1 
ATOM   1291 C C   . ALA A 1 183 ? 42.865 3.766   3.833   1.00 18.67 ? 526 ALA A C   1 
ATOM   1292 O O   . ALA A 1 183 ? 43.119 4.653   3.008   1.00 18.07 ? 526 ALA A O   1 
ATOM   1293 C CB  . ALA A 1 183 ? 43.975 1.608   3.255   1.00 18.00 ? 526 ALA A CB  1 
ATOM   1294 N N   . MET A 1 184 ? 42.756 3.981   5.145   1.00 18.63 ? 527 MET A N   1 
ATOM   1295 C CA  . MET A 1 184 ? 43.099 5.245   5.785   1.00 19.33 ? 527 MET A CA  1 
ATOM   1296 C C   . MET A 1 184 ? 44.299 4.916   6.678   1.00 19.21 ? 527 MET A C   1 
ATOM   1297 O O   . MET A 1 184 ? 44.162 4.151   7.629   1.00 18.84 ? 527 MET A O   1 
ATOM   1298 C CB  . MET A 1 184 ? 41.909 5.749   6.618   1.00 19.51 ? 527 MET A CB  1 
ATOM   1299 C CG  . MET A 1 184 ? 42.164 6.990   7.481   1.00 21.53 ? 527 MET A CG  1 
ATOM   1300 S SD  . MET A 1 184 ? 42.015 8.547   6.593   1.00 21.90 ? 527 MET A SD  1 
ATOM   1301 C CE  . MET A 1 184 ? 40.241 8.626   6.326   1.00 22.07 ? 527 MET A CE  1 
ATOM   1302 N N   . ILE A 1 185 ? 45.466 5.468   6.345   1.00 18.78 ? 528 ILE A N   1 
ATOM   1303 C CA  . ILE A 1 185 ? 46.719 5.115   7.010   1.00 19.57 ? 528 ILE A CA  1 
ATOM   1304 C C   . ILE A 1 185 ? 47.312 6.347   7.694   1.00 20.15 ? 528 ILE A C   1 
ATOM   1305 O O   . ILE A 1 185 ? 47.601 7.346   7.032   1.00 19.76 ? 528 ILE A O   1 
ATOM   1306 C CB  . ILE A 1 185 ? 47.752 4.532   6.009   1.00 19.30 ? 528 ILE A CB  1 
ATOM   1307 C CG1 . ILE A 1 185 ? 47.108 3.451   5.124   1.00 19.71 ? 528 ILE A CG1 1 
ATOM   1308 C CG2 . ILE A 1 185 ? 48.987 4.004   6.758   1.00 19.60 ? 528 ILE A CG2 1 
ATOM   1309 C CD1 . ILE A 1 185 ? 47.934 3.082   3.887   1.00 19.77 ? 528 ILE A CD1 1 
ATOM   1310 N N   . CYS A 1 186 ? 47.489 6.279   9.016   1.00 21.02 ? 529 CYS A N   1 
ATOM   1311 C CA  . CYS A 1 186 ? 47.889 7.464   9.775   1.00 22.06 ? 529 CYS A CA  1 
ATOM   1312 C C   . CYS A 1 186 ? 49.082 7.220   10.687  1.00 23.12 ? 529 CYS A C   1 
ATOM   1313 O O   . CYS A 1 186 ? 49.160 6.183   11.355  1.00 22.18 ? 529 CYS A O   1 
ATOM   1314 C CB  . CYS A 1 186 ? 46.725 7.991   10.615  1.00 21.90 ? 529 CYS A CB  1 
ATOM   1315 S SG  . CYS A 1 186 ? 45.188 8.240   9.744   1.00 22.98 ? 529 CYS A SG  1 
ATOM   1316 N N   . GLN A 1 187 ? 50.002 8.187   10.696  1.00 24.15 ? 530 GLN A N   1 
ATOM   1317 C CA  . GLN A 1 187 ? 51.137 8.202   11.626  1.00 26.01 ? 530 GLN A CA  1 
ATOM   1318 C C   . GLN A 1 187 ? 51.163 9.541   12.347  1.00 26.84 ? 530 GLN A C   1 
ATOM   1319 O O   . GLN A 1 187 ? 50.742 10.568  11.797  1.00 26.63 ? 530 GLN A O   1 
ATOM   1320 C CB  . GLN A 1 187 ? 52.455 7.941   10.896  1.00 25.77 ? 530 GLN A CB  1 
ATOM   1321 C CG  . GLN A 1 187 ? 52.508 6.558   10.256  1.00 26.20 ? 530 GLN A CG  1 
ATOM   1322 C CD  . GLN A 1 187 ? 53.735 6.323   9.390   1.00 27.05 ? 530 GLN A CD  1 
ATOM   1323 O OE1 . GLN A 1 187 ? 54.336 7.261   8.863   1.00 30.02 ? 530 GLN A OE1 1 
ATOM   1324 N NE2 . GLN A 1 187 ? 54.102 5.057   9.225   1.00 28.21 ? 530 GLN A NE2 1 
ATOM   1325 N N   . THR A 1 188 ? 51.623 9.529   13.594  1.00 28.06 ? 531 THR A N   1 
ATOM   1326 C CA  . THR A 1 188 ? 51.589 10.731  14.414  1.00 29.52 ? 531 THR A CA  1 
ATOM   1327 C C   . THR A 1 188 ? 53.015 11.200  14.674  1.00 30.44 ? 531 THR A C   1 
ATOM   1328 O O   . THR A 1 188 ? 53.890 10.408  15.029  1.00 30.41 ? 531 THR A O   1 
ATOM   1329 C CB  . THR A 1 188 ? 50.812 10.504  15.732  1.00 29.61 ? 531 THR A CB  1 
ATOM   1330 O OG1 . THR A 1 188 ? 49.535 9.938   15.429  1.00 30.89 ? 531 THR A OG1 1 
ATOM   1331 C CG2 . THR A 1 188 ? 50.597 11.822  16.495  1.00 29.90 ? 531 THR A CG2 1 
ATOM   1332 N N   . LEU A 1 189 ? 53.235 12.489  14.449  1.00 31.90 ? 532 LEU A N   1 
ATOM   1333 C CA  . LEU A 1 189 ? 54.511 13.126  14.708  1.00 33.54 ? 532 LEU A CA  1 
ATOM   1334 C C   . LEU A 1 189 ? 54.341 13.966  15.968  1.00 34.15 ? 532 LEU A C   1 
ATOM   1335 O O   . LEU A 1 189 ? 53.466 14.831  16.029  1.00 34.05 ? 532 LEU A O   1 
ATOM   1336 C CB  . LEU A 1 189 ? 54.921 14.001  13.511  1.00 33.58 ? 532 LEU A CB  1 
ATOM   1337 C CG  . LEU A 1 189 ? 55.581 13.381  12.261  1.00 34.66 ? 532 LEU A CG  1 
ATOM   1338 C CD1 . LEU A 1 189 ? 54.898 12.110  11.751  1.00 35.89 ? 532 LEU A CD1 1 
ATOM   1339 C CD2 . LEU A 1 189 ? 55.660 14.414  11.134  1.00 34.34 ? 532 LEU A CD2 1 
ATOM   1340 N N   . VAL A 1 190 ? 55.157 13.681  16.980  1.00 35.48 ? 533 VAL A N   1 
ATOM   1341 C CA  . VAL A 1 190 ? 55.103 14.401  18.250  1.00 36.72 ? 533 VAL A CA  1 
ATOM   1342 C C   . VAL A 1 190 ? 56.428 15.127  18.505  1.00 37.50 ? 533 VAL A C   1 
ATOM   1343 O O   . VAL A 1 190 ? 57.498 14.511  18.489  1.00 37.85 ? 533 VAL A O   1 
ATOM   1344 C CB  . VAL A 1 190 ? 54.790 13.460  19.444  1.00 36.82 ? 533 VAL A CB  1 
ATOM   1345 C CG1 . VAL A 1 190 ? 54.548 14.271  20.711  1.00 37.12 ? 533 VAL A CG1 1 
ATOM   1346 C CG2 . VAL A 1 190 ? 53.581 12.581  19.157  1.00 37.00 ? 533 VAL A CG2 1 
ATOM   1347 N N   . SER A 1 191 ? 56.338 16.436  18.731  1.00 38.37 ? 534 SER A N   1 
ATOM   1348 C CA  . SER A 1 191 ? 57.494 17.268  19.056  1.00 39.11 ? 534 SER A CA  1 
ATOM   1349 C C   . SER A 1 191 ? 57.489 17.639  20.539  1.00 39.17 ? 534 SER A C   1 
ATOM   1350 O O   . SER A 1 191 ? 57.992 16.884  21.376  1.00 39.65 ? 534 SER A O   1 
ATOM   1351 C CB  . SER A 1 191 ? 57.495 18.536  18.204  1.00 38.97 ? 534 SER A CB  1 
ATOM   1352 O OG  . SER A 1 191 ? 56.433 19.397  18.581  1.00 40.48 ? 534 SER A OG  1 
ATOM   1353 N N   . ILE A 1 199 ? 52.943 18.401  27.040  1.00 41.37 ? 542 ILE A N   1 
ATOM   1354 C CA  . ILE A 1 199 ? 52.553 18.027  25.679  1.00 41.25 ? 542 ILE A CA  1 
ATOM   1355 C C   . ILE A 1 199 ? 51.066 18.327  25.418  1.00 40.77 ? 542 ILE A C   1 
ATOM   1356 O O   . ILE A 1 199 ? 50.186 17.825  26.121  1.00 40.94 ? 542 ILE A O   1 
ATOM   1357 C CB  . ILE A 1 199 ? 52.946 16.543  25.348  1.00 41.45 ? 542 ILE A CB  1 
ATOM   1358 C CG1 . ILE A 1 199 ? 53.090 16.337  23.840  1.00 41.95 ? 542 ILE A CG1 1 
ATOM   1359 C CG2 . ILE A 1 199 ? 51.983 15.521  25.981  1.00 42.03 ? 542 ILE A CG2 1 
ATOM   1360 C CD1 . ILE A 1 199 ? 54.408 16.858  23.286  1.00 42.67 ? 542 ILE A CD1 1 
ATOM   1361 N N   . SER A 1 200 ? 50.799 19.172  24.425  1.00 39.95 ? 543 SER A N   1 
ATOM   1362 C CA  . SER A 1 200 ? 49.432 19.558  24.078  1.00 39.25 ? 543 SER A CA  1 
ATOM   1363 C C   . SER A 1 200 ? 49.118 19.240  22.613  1.00 38.64 ? 543 SER A C   1 
ATOM   1364 O O   . SER A 1 200 ? 49.935 18.645  21.914  1.00 38.73 ? 543 SER A O   1 
ATOM   1365 C CB  . SER A 1 200 ? 49.207 21.049  24.363  1.00 39.28 ? 543 SER A CB  1 
ATOM   1366 O OG  . SER A 1 200 ? 49.802 21.861  23.365  1.00 38.91 ? 543 SER A OG  1 
ATOM   1367 N N   . ARG A 1 201 ? 47.936 19.655  22.162  1.00 38.10 ? 544 ARG A N   1 
ATOM   1368 C CA  . ARG A 1 201 ? 47.485 19.458  20.778  1.00 37.45 ? 544 ARG A CA  1 
ATOM   1369 C C   . ARG A 1 201 ? 48.308 20.288  19.790  1.00 37.55 ? 544 ARG A C   1 
ATOM   1370 O O   . ARG A 1 201 ? 48.368 19.980  18.592  1.00 37.32 ? 544 ARG A O   1 
ATOM   1371 C CB  . ARG A 1 201 ? 46.006 19.828  20.659  1.00 37.27 ? 544 ARG A CB  1 
ATOM   1372 C CG  . ARG A 1 201 ? 45.069 18.988  21.531  1.00 36.40 ? 544 ARG A CG  1 
ATOM   1373 C CD  . ARG A 1 201 ? 44.184 18.102  20.691  1.00 33.40 ? 544 ARG A CD  1 
ATOM   1374 N NE  . ARG A 1 201 ? 43.480 17.081  21.469  1.00 31.63 ? 544 ARG A NE  1 
ATOM   1375 C CZ  . ARG A 1 201 ? 43.188 15.871  20.999  1.00 30.22 ? 544 ARG A CZ  1 
ATOM   1376 N NH1 . ARG A 1 201 ? 43.560 15.542  19.765  1.00 27.93 ? 544 ARG A NH1 1 
ATOM   1377 N NH2 . ARG A 1 201 ? 42.544 14.989  21.755  1.00 27.92 ? 544 ARG A NH2 1 
ATOM   1378 N N   . ASP A 1 202 ? 48.938 21.340  20.306  1.00 37.41 ? 545 ASP A N   1 
ATOM   1379 C CA  . ASP A 1 202 ? 49.798 22.222  19.518  1.00 37.27 ? 545 ASP A CA  1 
ATOM   1380 C C   . ASP A 1 202 ? 51.039 21.529  19.001  1.00 36.45 ? 545 ASP A C   1 
ATOM   1381 O O   . ASP A 1 202 ? 51.658 21.987  18.043  1.00 36.62 ? 545 ASP A O   1 
ATOM   1382 C CB  . ASP A 1 202 ? 50.227 23.425  20.358  1.00 37.75 ? 545 ASP A CB  1 
ATOM   1383 C CG  . ASP A 1 202 ? 49.511 24.691  19.965  1.00 39.30 ? 545 ASP A CG  1 
ATOM   1384 O OD1 . ASP A 1 202 ? 48.321 24.614  19.593  1.00 41.23 ? 545 ASP A OD1 1 
ATOM   1385 O OD2 . ASP A 1 202 ? 50.148 25.767  20.019  1.00 42.30 ? 545 ASP A OD2 1 
ATOM   1386 N N   . ASN A 1 203 ? 51.391 20.421  19.640  1.00 35.56 ? 546 ASN A N   1 
ATOM   1387 C CA  . ASN A 1 203 ? 52.657 19.750  19.399  1.00 34.58 ? 546 ASN A CA  1 
ATOM   1388 C C   . ASN A 1 203 ? 52.532 18.437  18.630  1.00 33.33 ? 546 ASN A C   1 
ATOM   1389 O O   . ASN A 1 203 ? 53.511 17.706  18.481  1.00 33.52 ? 546 ASN A O   1 
ATOM   1390 C CB  . ASN A 1 203 ? 53.357 19.522  20.737  1.00 35.00 ? 546 ASN A CB  1 
ATOM   1391 C CG  . ASN A 1 203 ? 53.331 20.762  21.617  1.00 36.10 ? 546 ASN A CG  1 
ATOM   1392 O OD1 . ASN A 1 203 ? 53.788 21.833  21.214  1.00 37.46 ? 546 ASN A OD1 1 
ATOM   1393 N ND2 . ASN A 1 203 ? 52.775 20.627  22.814  1.00 36.51 ? 546 ASN A ND2 1 
ATOM   1394 N N   . ILE A 1 204 ? 51.332 18.141  18.142  1.00 31.85 ? 547 ILE A N   1 
ATOM   1395 C CA  . ILE A 1 204 ? 51.100 16.889  17.410  1.00 30.43 ? 547 ILE A CA  1 
ATOM   1396 C C   . ILE A 1 204 ? 50.589 17.131  15.985  1.00 29.28 ? 547 ILE A C   1 
ATOM   1397 O O   . ILE A 1 204 ? 49.824 18.060  15.742  1.00 28.97 ? 547 ILE A O   1 
ATOM   1398 C CB  . ILE A 1 204 ? 50.164 15.914  18.188  1.00 30.22 ? 547 ILE A CB  1 
ATOM   1399 C CG1 . ILE A 1 204 ? 48.759 16.505  18.349  1.00 30.27 ? 547 ILE A CG1 1 
ATOM   1400 C CG2 . ILE A 1 204 ? 50.778 15.547  19.558  1.00 30.27 ? 547 ILE A CG2 1 
ATOM   1401 C CD1 . ILE A 1 204 ? 47.716 15.513  18.810  1.00 30.43 ? 547 ILE A CD1 1 
ATOM   1402 N N   . LEU A 1 205 ? 51.043 16.291  15.056  1.00 28.42 ? 548 LEU A N   1 
ATOM   1403 C CA  . LEU A 1 205 ? 50.590 16.336  13.663  1.00 27.73 ? 548 LEU A CA  1 
ATOM   1404 C C   . LEU A 1 205 ? 50.324 14.924  13.132  1.00 26.93 ? 548 LEU A C   1 
ATOM   1405 O O   . LEU A 1 205 ? 51.150 14.021  13.290  1.00 27.27 ? 548 LEU A O   1 
ATOM   1406 C CB  . LEU A 1 205 ? 51.627 17.042  12.782  1.00 27.96 ? 548 LEU A CB  1 
ATOM   1407 C CG  . LEU A 1 205 ? 51.318 17.201  11.283  1.00 27.86 ? 548 LEU A CG  1 
ATOM   1408 C CD1 . LEU A 1 205 ? 50.247 18.241  11.066  1.00 27.50 ? 548 LEU A CD1 1 
ATOM   1409 C CD2 . LEU A 1 205 ? 52.589 17.595  10.532  1.00 28.18 ? 548 LEU A CD2 1 
ATOM   1410 N N   . CYS A 1 206 ? 49.165 14.738  12.510  1.00 25.94 ? 549 CYS A N   1 
ATOM   1411 C CA  . CYS A 1 206 ? 48.808 13.440  11.949  1.00 25.02 ? 549 CYS A CA  1 
ATOM   1412 C C   . CYS A 1 206 ? 49.016 13.470  10.445  1.00 24.34 ? 549 CYS A C   1 
ATOM   1413 O O   . CYS A 1 206 ? 48.408 14.283  9.751   1.00 24.19 ? 549 CYS A O   1 
ATOM   1414 C CB  . CYS A 1 206 ? 47.362 13.079  12.283  1.00 25.04 ? 549 CYS A CB  1 
ATOM   1415 S SG  . CYS A 1 206 ? 46.838 11.458  11.647  1.00 25.57 ? 549 CYS A SG  1 
ATOM   1416 N N   . LYS A 1 207 ? 49.912 12.607  9.971   1.00 23.87 ? 550 LYS A N   1 
ATOM   1417 C CA  . LYS A 1 207 ? 50.215 12.458  8.554   1.00 23.41 ? 550 LYS A CA  1 
ATOM   1418 C C   . LYS A 1 207 ? 49.330 11.350  8.009   1.00 22.60 ? 550 LYS A C   1 
ATOM   1419 O O   . LYS A 1 207 ? 49.390 10.214  8.480   1.00 21.63 ? 550 LYS A O   1 
ATOM   1420 C CB  . LYS A 1 207 ? 51.689 12.093  8.348   1.00 23.84 ? 550 LYS A CB  1 
ATOM   1421 C CG  . LYS A 1 207 ? 52.691 13.171  8.784   1.00 26.10 ? 550 LYS A CG  1 
ATOM   1422 C CD  . LYS A 1 207 ? 52.711 14.364  7.832   1.00 31.03 ? 550 LYS A CD  1 
ATOM   1423 C CE  . LYS A 1 207 ? 53.575 14.088  6.594   1.00 32.27 ? 550 LYS A CE  1 
ATOM   1424 N NZ  . LYS A 1 207 ? 53.247 15.024  5.468   1.00 35.87 ? 550 LYS A NZ  1 
ATOM   1425 N N   . ILE A 1 208 ? 48.504 11.693  7.024   1.00 21.71 ? 551 ILE A N   1 
ATOM   1426 C CA  . ILE A 1 208 ? 47.502 10.768  6.516   1.00 20.75 ? 551 ILE A CA  1 
ATOM   1427 C C   . ILE A 1 208 ? 47.802 10.342  5.079   1.00 20.51 ? 551 ILE A C   1 
ATOM   1428 O O   . ILE A 1 208 ? 48.161 11.170  4.241   1.00 20.37 ? 551 ILE A O   1 
ATOM   1429 C CB  . ILE A 1 208 ? 46.094 11.394  6.570   1.00 20.82 ? 551 ILE A CB  1 
ATOM   1430 C CG1 . ILE A 1 208 ? 45.672 11.656  8.021   1.00 20.73 ? 551 ILE A CG1 1 
ATOM   1431 C CG2 . ILE A 1 208 ? 45.069 10.494  5.861   1.00 20.37 ? 551 ILE A CG2 1 
ATOM   1432 C CD1 . ILE A 1 208 ? 44.384 12.429  8.162   1.00 21.28 ? 551 ILE A CD1 1 
ATOM   1433 N N   . THR A 1 209 ? 47.664 9.048   4.814   1.00 19.94 ? 552 THR A N   1 
ATOM   1434 C CA  . THR A 1 209 ? 47.588 8.531   3.448   1.00 19.60 ? 552 THR A CA  1 
ATOM   1435 C C   . THR A 1 209 ? 46.259 7.799   3.274   1.00 19.49 ? 552 THR A C   1 
ATOM   1436 O O   . THR A 1 209 ? 45.942 6.869   4.016   1.00 18.87 ? 552 THR A O   1 
ATOM   1437 C CB  . THR A 1 209 ? 48.773 7.600   3.112   1.00 19.62 ? 552 THR A CB  1 
ATOM   1438 O OG1 . THR A 1 209 ? 49.978 8.371   3.058   1.00 18.82 ? 552 THR A OG1 1 
ATOM   1439 C CG2 . THR A 1 209 ? 48.568 6.909   1.755   1.00 20.43 ? 552 THR A CG2 1 
ATOM   1440 N N   . TYR A 1 210 ? 45.480 8.228   2.290   1.00 19.15 ? 553 TYR A N   1 
ATOM   1441 C CA  . TYR A 1 210 ? 44.206 7.588   2.003   1.00 19.19 ? 553 TYR A CA  1 
ATOM   1442 C C   . TYR A 1 210 ? 44.309 6.982   0.608   1.00 19.77 ? 553 TYR A C   1 
ATOM   1443 O O   . TYR A 1 210 ? 44.735 7.651   -0.333  1.00 19.38 ? 553 TYR A O   1 
ATOM   1444 C CB  . TYR A 1 210 ? 43.064 8.609   2.083   1.00 19.08 ? 553 TYR A CB  1 
ATOM   1445 C CG  . TYR A 1 210 ? 41.721 8.081   1.642   1.00 19.10 ? 553 TYR A CG  1 
ATOM   1446 C CD1 . TYR A 1 210 ? 40.891 7.407   2.531   1.00 18.86 ? 553 TYR A CD1 1 
ATOM   1447 C CD2 . TYR A 1 210 ? 41.279 8.258   0.329   1.00 19.50 ? 553 TYR A CD2 1 
ATOM   1448 C CE1 . TYR A 1 210 ? 39.646 6.918   2.128   1.00 20.57 ? 553 TYR A CE1 1 
ATOM   1449 C CE2 . TYR A 1 210 ? 40.048 7.767   -0.090  1.00 20.57 ? 553 TYR A CE2 1 
ATOM   1450 C CZ  . TYR A 1 210 ? 39.231 7.102   0.816   1.00 20.18 ? 553 TYR A CZ  1 
ATOM   1451 O OH  . TYR A 1 210 ? 38.006 6.617   0.398   1.00 20.36 ? 553 TYR A OH  1 
ATOM   1452 N N   . VAL A 1 211 ? 43.957 5.708   0.486   1.00 19.72 ? 554 VAL A N   1 
ATOM   1453 C CA  . VAL A 1 211 ? 43.954 5.056   -0.821  1.00 20.15 ? 554 VAL A CA  1 
ATOM   1454 C C   . VAL A 1 211 ? 42.576 4.457   -1.106  1.00 20.21 ? 554 VAL A C   1 
ATOM   1455 O O   . VAL A 1 211 ? 41.942 3.900   -0.211  1.00 19.95 ? 554 VAL A O   1 
ATOM   1456 C CB  . VAL A 1 211 ? 45.128 4.022   -0.982  1.00 20.20 ? 554 VAL A CB  1 
ATOM   1457 C CG1 . VAL A 1 211 ? 46.470 4.749   -1.054  1.00 20.76 ? 554 VAL A CG1 1 
ATOM   1458 C CG2 . VAL A 1 211 ? 45.154 3.002   0.154   1.00 20.35 ? 554 VAL A CG2 1 
ATOM   1459 N N   . ALA A 1 212 ? 42.106 4.608   -2.343  1.00 20.65 ? 555 ALA A N   1 
ATOM   1460 C CA  . ALA A 1 212 ? 40.843 4.019   -2.771  1.00 21.13 ? 555 ALA A CA  1 
ATOM   1461 C C   . ALA A 1 212 ? 40.998 3.354   -4.139  1.00 22.08 ? 555 ALA A C   1 
ATOM   1462 O O   . ALA A 1 212 ? 41.450 3.983   -5.093  1.00 21.74 ? 555 ALA A O   1 
ATOM   1463 C CB  . ALA A 1 212 ? 39.745 5.075   -2.805  1.00 20.67 ? 555 ALA A CB  1 
ATOM   1464 N N   . ASN A 1 213 ? 40.672 2.065   -4.200  1.00 23.10 ? 556 ASN A N   1 
ATOM   1465 C CA  . ASN A 1 213 ? 40.623 1.320   -5.447  1.00 24.66 ? 556 ASN A CA  1 
ATOM   1466 C C   . ASN A 1 213 ? 39.210 0.770   -5.549  1.00 25.55 ? 556 ASN A C   1 
ATOM   1467 O O   . ASN A 1 213 ? 38.858 -0.221  -4.902  1.00 25.25 ? 556 ASN A O   1 
ATOM   1468 C CB  . ASN A 1 213 ? 41.662 0.187   -5.473  1.00 24.73 ? 556 ASN A CB  1 
ATOM   1469 C CG  . ASN A 1 213 ? 43.082 0.687   -5.720  1.00 25.99 ? 556 ASN A CG  1 
ATOM   1470 O OD1 . ASN A 1 213 ? 43.633 0.512   -6.807  1.00 27.89 ? 556 ASN A OD1 1 
ATOM   1471 N ND2 . ASN A 1 213 ? 43.681 1.297   -4.713  1.00 26.14 ? 556 ASN A ND2 1 
ATOM   1472 N N   . VAL A 1 214 ? 38.395 1.458   -6.340  1.00 26.92 ? 557 VAL A N   1 
ATOM   1473 C CA  . VAL A 1 214 ? 36.972 1.200   -6.393  1.00 28.57 ? 557 VAL A CA  1 
ATOM   1474 C C   . VAL A 1 214 ? 36.542 0.800   -7.793  1.00 30.02 ? 557 VAL A C   1 
ATOM   1475 O O   . VAL A 1 214 ? 36.906 1.429   -8.793  1.00 29.70 ? 557 VAL A O   1 
ATOM   1476 C CB  . VAL A 1 214 ? 36.153 2.419   -5.901  1.00 28.55 ? 557 VAL A CB  1 
ATOM   1477 C CG1 . VAL A 1 214 ? 34.667 2.231   -6.179  1.00 29.16 ? 557 VAL A CG1 1 
ATOM   1478 C CG2 . VAL A 1 214 ? 36.390 2.655   -4.407  1.00 28.04 ? 557 VAL A CG2 1 
ATOM   1479 N N   . ASN A 1 215 ? 35.771 -0.272  -7.846  1.00 31.63 ? 558 ASN A N   1 
ATOM   1480 C CA  . ASN A 1 215 ? 35.134 -0.678  -9.067  1.00 33.77 ? 558 ASN A CA  1 
ATOM   1481 C C   . ASN A 1 215 ? 33.620 -0.744  -8.843  1.00 34.79 ? 558 ASN A C   1 
ATOM   1482 O O   . ASN A 1 215 ? 33.146 -1.605  -8.108  1.00 34.67 ? 558 ASN A O   1 
ATOM   1483 C CB  . ASN A 1 215 ? 35.756 -2.001  -9.528  1.00 33.86 ? 558 ASN A CB  1 
ATOM   1484 C CG  . ASN A 1 215 ? 34.750 -2.954  -10.111 1.00 36.02 ? 558 ASN A CG  1 
ATOM   1485 O OD1 . ASN A 1 215 ? 34.357 -3.924  -9.454  1.00 40.27 ? 558 ASN A OD1 1 
ATOM   1486 N ND2 . ASN A 1 215 ? 34.327 -2.699  -11.346 1.00 35.75 ? 558 ASN A ND2 1 
ATOM   1487 N N   . PRO A 1 216 ? 32.859 0.216   -9.415  1.00 36.09 ? 559 PRO A N   1 
ATOM   1488 C CA  . PRO A 1 216 ? 31.408 -0.007  -9.484  1.00 37.16 ? 559 PRO A CA  1 
ATOM   1489 C C   . PRO A 1 216 ? 31.105 -1.153  -10.448 1.00 37.93 ? 559 PRO A C   1 
ATOM   1490 O O   . PRO A 1 216 ? 32.006 -1.619  -11.157 1.00 38.48 ? 559 PRO A O   1 
ATOM   1491 C CB  . PRO A 1 216 ? 30.863 1.319   -10.023 1.00 37.43 ? 559 PRO A CB  1 
ATOM   1492 C CG  . PRO A 1 216 ? 32.023 1.990   -10.688 1.00 36.89 ? 559 PRO A CG  1 
ATOM   1493 C CD  . PRO A 1 216 ? 33.256 1.521   -9.980  1.00 36.30 ? 559 PRO A CD  1 
ATOM   1494 N N   . GLY A 1 217 ? 29.860 -1.614  -10.466 1.00 38.77 ? 560 GLY A N   1 
ATOM   1495 C CA  . GLY A 1 217 ? 29.458 -2.685  -11.380 1.00 39.48 ? 560 GLY A CA  1 
ATOM   1496 C C   . GLY A 1 217 ? 28.730 -2.156  -12.603 1.00 39.78 ? 560 GLY A C   1 
ATOM   1497 O O   . GLY A 1 217 ? 27.789 -1.366  -12.497 1.00 40.19 ? 560 GLY A O   1 
ATOM   1498 N N   . GLY A 1 218 ? 29.161 -2.587  -13.778 1.00 39.85 ? 561 GLY A N   1 
ATOM   1499 C CA  . GLY A 1 218 ? 28.523 -2.126  -15.004 1.00 39.53 ? 561 GLY A CA  1 
ATOM   1500 C C   . GLY A 1 218 ? 29.111 -0.833  -15.532 1.00 38.66 ? 561 GLY A C   1 
ATOM   1501 O O   . GLY A 1 218 ? 30.324 -0.668  -15.560 1.00 39.47 ? 561 GLY A O   1 
ATOM   1502 N N   . TRP A 1 219 ? 28.250 0.102   -15.921 1.00 37.90 ? 562 TRP A N   1 
ATOM   1503 C CA  . TRP A 1 219 ? 28.662 1.130   -16.873 1.00 36.81 ? 562 TRP A CA  1 
ATOM   1504 C C   . TRP A 1 219 ? 28.237 2.565   -16.561 1.00 36.17 ? 562 TRP A C   1 
ATOM   1505 O O   . TRP A 1 219 ? 27.107 2.819   -16.135 1.00 36.13 ? 562 TRP A O   1 
ATOM   1506 C CB  . TRP A 1 219 ? 28.168 0.730   -18.270 1.00 36.55 ? 562 TRP A CB  1 
ATOM   1507 C CG  . TRP A 1 219 ? 28.842 1.460   -19.377 1.00 36.09 ? 562 TRP A CG  1 
ATOM   1508 C CD1 . TRP A 1 219 ? 29.941 1.055   -20.073 1.00 35.65 ? 562 TRP A CD1 1 
ATOM   1509 C CD2 . TRP A 1 219 ? 28.465 2.729   -19.918 1.00 35.60 ? 562 TRP A CD2 1 
ATOM   1510 N NE1 . TRP A 1 219 ? 30.280 1.997   -21.010 1.00 35.60 ? 562 TRP A NE1 1 
ATOM   1511 C CE2 . TRP A 1 219 ? 29.387 3.034   -20.941 1.00 35.89 ? 562 TRP A CE2 1 
ATOM   1512 C CE3 . TRP A 1 219 ? 27.436 3.641   -19.639 1.00 35.26 ? 562 TRP A CE3 1 
ATOM   1513 C CZ2 . TRP A 1 219 ? 29.309 4.211   -21.690 1.00 35.69 ? 562 TRP A CZ2 1 
ATOM   1514 C CZ3 . TRP A 1 219 ? 27.364 4.814   -20.380 1.00 35.01 ? 562 TRP A CZ3 1 
ATOM   1515 C CH2 . TRP A 1 219 ? 28.295 5.087   -21.392 1.00 35.54 ? 562 TRP A CH2 1 
ATOM   1516 N N   . ALA A 1 220 ? 29.169 3.491   -16.796 1.00 35.39 ? 563 ALA A N   1 
ATOM   1517 C CA  . ALA A 1 220 ? 28.919 4.933   -16.795 1.00 34.61 ? 563 ALA A CA  1 
ATOM   1518 C C   . ALA A 1 220 ? 29.988 5.609   -17.658 1.00 34.23 ? 563 ALA A C   1 
ATOM   1519 O O   . ALA A 1 220 ? 31.066 5.046   -17.841 1.00 33.90 ? 563 ALA A O   1 
ATOM   1520 C CB  . ALA A 1 220 ? 28.935 5.485   -15.378 1.00 35.10 ? 563 ALA A CB  1 
ATOM   1521 N N   . PRO A 1 221 ? 29.703 6.814   -18.203 1.00 33.94 ? 564 PRO A N   1 
ATOM   1522 C CA  . PRO A 1 221 ? 30.741 7.452   -19.017 1.00 33.80 ? 564 PRO A CA  1 
ATOM   1523 C C   . PRO A 1 221 ? 31.994 7.765   -18.195 1.00 33.81 ? 564 PRO A C   1 
ATOM   1524 O O   . PRO A 1 221 ? 31.887 8.265   -17.073 1.00 33.53 ? 564 PRO A O   1 
ATOM   1525 C CB  . PRO A 1 221 ? 30.077 8.749   -19.501 1.00 33.91 ? 564 PRO A CB  1 
ATOM   1526 C CG  . PRO A 1 221 ? 28.610 8.539   -19.314 1.00 33.59 ? 564 PRO A CG  1 
ATOM   1527 C CD  . PRO A 1 221 ? 28.483 7.639   -18.128 1.00 33.99 ? 564 PRO A CD  1 
ATOM   1528 N N   . ALA A 1 222 ? 33.160 7.454   -18.762 1.00 33.60 ? 565 ALA A N   1 
ATOM   1529 C CA  . ALA A 1 222 ? 34.449 7.686   -18.116 1.00 33.93 ? 565 ALA A CA  1 
ATOM   1530 C C   . ALA A 1 222 ? 34.592 9.132   -17.638 1.00 34.12 ? 565 ALA A C   1 
ATOM   1531 O O   . ALA A 1 222 ? 34.929 9.378   -16.475 1.00 34.17 ? 565 ALA A O   1 
ATOM   1532 C CB  . ALA A 1 222 ? 35.580 7.319   -19.055 1.00 33.75 ? 565 ALA A CB  1 
ATOM   1533 N N   . SER A 1 223 ? 34.309 10.075  -18.535 1.00 34.17 ? 566 SER A N   1 
ATOM   1534 C CA  . SER A 1 223 ? 34.343 11.506  -18.227 1.00 34.16 ? 566 SER A CA  1 
ATOM   1535 C C   . SER A 1 223 ? 33.570 11.850  -16.948 1.00 34.00 ? 566 SER A C   1 
ATOM   1536 O O   . SER A 1 223 ? 34.065 12.590  -16.089 1.00 34.25 ? 566 SER A O   1 
ATOM   1537 C CB  . SER A 1 223 ? 33.780 12.304  -19.410 1.00 34.35 ? 566 SER A CB  1 
ATOM   1538 O OG  . SER A 1 223 ? 32.371 12.153  -19.498 1.00 34.55 ? 566 SER A OG  1 
ATOM   1539 N N   . VAL A 1 224 ? 32.365 11.295  -16.832 1.00 33.64 ? 567 VAL A N   1 
ATOM   1540 C CA  . VAL A 1 224 ? 31.477 11.515  -15.691 1.00 33.31 ? 567 VAL A CA  1 
ATOM   1541 C C   . VAL A 1 224 ? 32.013 10.872  -14.397 1.00 32.87 ? 567 VAL A C   1 
ATOM   1542 O O   . VAL A 1 224 ? 32.026 11.513  -13.351 1.00 32.82 ? 567 VAL A O   1 
ATOM   1543 C CB  . VAL A 1 224 ? 30.029 11.023  -15.998 1.00 33.47 ? 567 VAL A CB  1 
ATOM   1544 C CG1 . VAL A 1 224 ? 29.082 11.317  -14.840 1.00 33.84 ? 567 VAL A CG1 1 
ATOM   1545 C CG2 . VAL A 1 224 ? 29.499 11.680  -17.268 1.00 34.52 ? 567 VAL A CG2 1 
ATOM   1546 N N   . LEU A 1 225 ? 32.459 9.618   -14.480 1.00 32.30 ? 568 LEU A N   1 
ATOM   1547 C CA  . LEU A 1 225 ? 33.002 8.899   -13.320 1.00 31.73 ? 568 LEU A CA  1 
ATOM   1548 C C   . LEU A 1 225 ? 34.236 9.595   -12.756 1.00 31.21 ? 568 LEU A C   1 
ATOM   1549 O O   . LEU A 1 225 ? 34.436 9.645   -11.541 1.00 31.19 ? 568 LEU A O   1 
ATOM   1550 C CB  . LEU A 1 225 ? 33.328 7.438   -13.682 1.00 31.83 ? 568 LEU A CB  1 
ATOM   1551 C CG  . LEU A 1 225 ? 32.159 6.459   -13.878 1.00 31.88 ? 568 LEU A CG  1 
ATOM   1552 C CD1 . LEU A 1 225 ? 32.647 5.145   -14.478 1.00 31.31 ? 568 LEU A CD1 1 
ATOM   1553 C CD2 . LEU A 1 225 ? 31.394 6.206   -12.578 1.00 31.66 ? 568 LEU A CD2 1 
ATOM   1554 N N   . ARG A 1 226 ? 35.047 10.150  -13.651 1.00 30.61 ? 569 ARG A N   1 
ATOM   1555 C CA  . ARG A 1 226 ? 36.258 10.869  -13.266 1.00 30.06 ? 569 ARG A CA  1 
ATOM   1556 C C   . ARG A 1 226 ? 35.969 12.250  -12.672 1.00 29.92 ? 569 ARG A C   1 
ATOM   1557 O O   . ARG A 1 226 ? 36.658 12.681  -11.739 1.00 29.52 ? 569 ARG A O   1 
ATOM   1558 C CB  . ARG A 1 226 ? 37.228 10.935  -14.445 1.00 29.81 ? 569 ARG A CB  1 
ATOM   1559 C CG  . ARG A 1 226 ? 37.992 9.629   -14.605 1.00 29.79 ? 569 ARG A CG  1 
ATOM   1560 C CD  . ARG A 1 226 ? 38.636 9.418   -15.966 1.00 28.45 ? 569 ARG A CD  1 
ATOM   1561 N NE  . ARG A 1 226 ? 39.367 8.150   -15.957 1.00 27.59 ? 569 ARG A NE  1 
ATOM   1562 C CZ  . ARG A 1 226 ? 39.678 7.421   -17.027 1.00 27.73 ? 569 ARG A CZ  1 
ATOM   1563 N NH1 . ARG A 1 226 ? 39.332 7.821   -18.247 1.00 27.66 ? 569 ARG A NH1 1 
ATOM   1564 N NH2 . ARG A 1 226 ? 40.337 6.280   -16.869 1.00 26.34 ? 569 ARG A NH2 1 
ATOM   1565 N N   . ALA A 1 227 ? 34.945 12.924  -13.199 1.00 29.57 ? 570 ALA A N   1 
ATOM   1566 C CA  . ALA A 1 227 ? 34.495 14.209  -12.658 1.00 29.38 ? 570 ALA A CA  1 
ATOM   1567 C C   . ALA A 1 227 ? 33.899 14.059  -11.258 1.00 29.24 ? 570 ALA A C   1 
ATOM   1568 O O   . ALA A 1 227 ? 34.165 14.885  -10.375 1.00 29.30 ? 570 ALA A O   1 
ATOM   1569 C CB  . ALA A 1 227 ? 33.490 14.881  -13.609 1.00 29.37 ? 570 ALA A CB  1 
ATOM   1570 N N   . VAL A 1 228 ? 33.105 13.006  -11.055 1.00 28.88 ? 571 VAL A N   1 
ATOM   1571 C CA  . VAL A 1 228 ? 32.494 12.741  -9.747  1.00 28.80 ? 571 VAL A CA  1 
ATOM   1572 C C   . VAL A 1 228 ? 33.560 12.405  -8.690  1.00 28.51 ? 571 VAL A C   1 
ATOM   1573 O O   . VAL A 1 228 ? 33.524 12.941  -7.581  1.00 28.58 ? 571 VAL A O   1 
ATOM   1574 C CB  . VAL A 1 228 ? 31.405 11.633  -9.803  1.00 28.88 ? 571 VAL A CB  1 
ATOM   1575 C CG1 . VAL A 1 228 ? 30.828 11.375  -8.414  1.00 28.80 ? 571 VAL A CG1 1 
ATOM   1576 C CG2 . VAL A 1 228 ? 30.276 12.024  -10.758 1.00 29.05 ? 571 VAL A CG2 1 
ATOM   1577 N N   . ALA A 1 229 ? 34.501 11.532  -9.048  1.00 28.17 ? 572 ALA A N   1 
ATOM   1578 C CA  . ALA A 1 229 ? 35.617 11.165  -8.164  1.00 28.19 ? 572 ALA A CA  1 
ATOM   1579 C C   . ALA A 1 229 ? 36.457 12.378  -7.735  1.00 28.23 ? 572 ALA A C   1 
ATOM   1580 O O   . ALA A 1 229 ? 36.779 12.520  -6.555  1.00 27.64 ? 572 ALA A O   1 
ATOM   1581 C CB  . ALA A 1 229 ? 36.494 10.105  -8.820  1.00 28.08 ? 572 ALA A CB  1 
ATOM   1582 N N   . LYS A 1 230 ? 36.790 13.250  -8.691  1.00 28.53 ? 573 LYS A N   1 
ATOM   1583 C CA  . LYS A 1 230 ? 37.532 14.494  -8.417  1.00 29.35 ? 573 LYS A CA  1 
ATOM   1584 C C   . LYS A 1 230 ? 36.820 15.392  -7.413  1.00 29.04 ? 573 LYS A C   1 
ATOM   1585 O O   . LYS A 1 230 ? 37.467 16.130  -6.681  1.00 28.38 ? 573 LYS A O   1 
ATOM   1586 C CB  . LYS A 1 230 ? 37.777 15.297  -9.701  1.00 29.40 ? 573 LYS A CB  1 
ATOM   1587 C CG  . LYS A 1 230 ? 39.223 15.350  -10.174 1.00 30.80 ? 573 LYS A CG  1 
ATOM   1588 C CD  . LYS A 1 230 ? 39.400 16.425  -11.251 1.00 30.89 ? 573 LYS A CD  1 
ATOM   1589 C CE  . LYS A 1 230 ? 40.556 16.090  -12.182 1.00 34.32 ? 573 LYS A CE  1 
ATOM   1590 N NZ  . LYS A 1 230 ? 41.007 17.230  -13.052 1.00 35.42 ? 573 LYS A NZ  1 
ATOM   1591 N N   . ARG A 1 231 ? 35.492 15.328  -7.398  1.00 29.26 ? 574 ARG A N   1 
ATOM   1592 C CA  . ARG A 1 231 ? 34.675 16.130  -6.488  1.00 30.40 ? 574 ARG A CA  1 
ATOM   1593 C C   . ARG A 1 231 ? 34.551 15.485  -5.109  1.00 29.71 ? 574 ARG A C   1 
ATOM   1594 O O   . ARG A 1 231 ? 34.877 16.106  -4.093  1.00 29.33 ? 574 ARG A O   1 
ATOM   1595 C CB  . ARG A 1 231 ? 33.273 16.350  -7.081  1.00 30.09 ? 574 ARG A CB  1 
ATOM   1596 C CG  . ARG A 1 231 ? 32.359 17.223  -6.224  1.00 32.10 ? 574 ARG A CG  1 
ATOM   1597 C CD  . ARG A 1 231 ? 30.970 17.398  -6.840  1.00 32.71 ? 574 ARG A CD  1 
ATOM   1598 N NE  . ARG A 1 231 ? 30.117 16.228  -6.629  1.00 37.30 ? 574 ARG A NE  1 
ATOM   1599 C CZ  . ARG A 1 231 ? 29.727 15.392  -7.589  1.00 38.58 ? 574 ARG A CZ  1 
ATOM   1600 N NH1 . ARG A 1 231 ? 30.102 15.590  -8.850  1.00 39.87 ? 574 ARG A NH1 1 
ATOM   1601 N NH2 . ARG A 1 231 ? 28.952 14.357  -7.288  1.00 39.49 ? 574 ARG A NH2 1 
ATOM   1602 N N   . GLU A 1 232 ? 34.077 14.239  -5.095  1.00 29.55 ? 575 GLU A N   1 
ATOM   1603 C CA  . GLU A 1 232 ? 33.645 13.574  -3.863  1.00 29.54 ? 575 GLU A CA  1 
ATOM   1604 C C   . GLU A 1 232 ? 34.769 13.186  -2.908  1.00 28.90 ? 575 GLU A C   1 
ATOM   1605 O O   . GLU A 1 232 ? 34.611 13.322  -1.699  1.00 28.64 ? 575 GLU A O   1 
ATOM   1606 C CB  . GLU A 1 232 ? 32.745 12.365  -4.165  1.00 29.80 ? 575 GLU A CB  1 
ATOM   1607 C CG  . GLU A 1 232 ? 31.338 12.726  -4.694  1.00 31.88 ? 575 GLU A CG  1 
ATOM   1608 C CD  . GLU A 1 232 ? 30.572 13.708  -3.799  1.00 34.76 ? 575 GLU A CD  1 
ATOM   1609 O OE1 . GLU A 1 232 ? 30.292 13.371  -2.625  1.00 35.32 ? 575 GLU A OE1 1 
ATOM   1610 O OE2 . GLU A 1 232 ? 30.238 14.818  -4.280  1.00 36.56 ? 575 GLU A OE2 1 
ATOM   1611 N N   . TYR A 1 233 ? 35.898 12.717  -3.434  1.00 28.35 ? 576 TYR A N   1 
ATOM   1612 C CA  . TYR A 1 233 ? 37.026 12.353  -2.562  1.00 27.95 ? 576 TYR A CA  1 
ATOM   1613 C C   . TYR A 1 233 ? 37.630 13.511  -1.753  1.00 27.78 ? 576 TYR A C   1 
ATOM   1614 O O   . TYR A 1 233 ? 37.728 13.408  -0.527  1.00 27.62 ? 576 TYR A O   1 
ATOM   1615 C CB  . TYR A 1 233 ? 38.096 11.560  -3.325  1.00 28.11 ? 576 TYR A CB  1 
ATOM   1616 C CG  . TYR A 1 233 ? 37.665 10.136  -3.596  1.00 27.75 ? 576 TYR A CG  1 
ATOM   1617 C CD1 . TYR A 1 233 ? 37.022 9.796   -4.787  1.00 27.46 ? 576 TYR A CD1 1 
ATOM   1618 C CD2 . TYR A 1 233 ? 37.870 9.133   -2.646  1.00 28.15 ? 576 TYR A CD2 1 
ATOM   1619 C CE1 . TYR A 1 233 ? 36.614 8.482   -5.041  1.00 28.22 ? 576 TYR A CE1 1 
ATOM   1620 C CE2 . TYR A 1 233 ? 37.467 7.816   -2.886  1.00 28.14 ? 576 TYR A CE2 1 
ATOM   1621 C CZ  . TYR A 1 233 ? 36.841 7.500   -4.087  1.00 28.86 ? 576 TYR A CZ  1 
ATOM   1622 O OH  . TYR A 1 233 ? 36.436 6.209   -4.334  1.00 29.52 ? 576 TYR A OH  1 
ATOM   1623 N N   . PRO A 1 234 ? 38.025 14.621  -2.419  1.00 27.60 ? 577 PRO A N   1 
ATOM   1624 C CA  . PRO A 1 234 ? 38.533 15.762  -1.632  1.00 27.44 ? 577 PRO A CA  1 
ATOM   1625 C C   . PRO A 1 234 ? 37.494 16.346  -0.666  1.00 27.17 ? 577 PRO A C   1 
ATOM   1626 O O   . PRO A 1 234 ? 37.851 16.737  0.445   1.00 27.16 ? 577 PRO A O   1 
ATOM   1627 C CB  . PRO A 1 234 ? 38.915 16.794  -2.705  1.00 27.32 ? 577 PRO A CB  1 
ATOM   1628 C CG  . PRO A 1 234 ? 39.118 15.981  -3.955  1.00 27.61 ? 577 PRO A CG  1 
ATOM   1629 C CD  . PRO A 1 234 ? 38.071 14.911  -3.867  1.00 27.46 ? 577 PRO A CD  1 
ATOM   1630 N N   . LYS A 1 235 ? 36.232 16.389  -1.091  1.00 26.93 ? 578 LYS A N   1 
ATOM   1631 C CA  . LYS A 1 235 ? 35.123 16.856  -0.253  1.00 27.07 ? 578 LYS A CA  1 
ATOM   1632 C C   . LYS A 1 235 ? 34.984 16.014  1.015   1.00 26.60 ? 578 LYS A C   1 
ATOM   1633 O O   . LYS A 1 235 ? 34.915 16.558  2.125   1.00 26.28 ? 578 LYS A O   1 
ATOM   1634 C CB  . LYS A 1 235 ? 33.815 16.854  -1.051  1.00 27.33 ? 578 LYS A CB  1 
ATOM   1635 C CG  . LYS A 1 235 ? 32.567 17.281  -0.268  1.00 29.57 ? 578 LYS A CG  1 
ATOM   1636 C CD  . LYS A 1 235 ? 31.422 17.599  -1.222  1.00 32.28 ? 578 LYS A CD  1 
ATOM   1637 C CE  . LYS A 1 235 ? 30.225 18.197  -0.502  1.00 34.57 ? 578 LYS A CE  1 
ATOM   1638 N NZ  . LYS A 1 235 ? 29.342 17.145  0.073   1.00 35.60 ? 578 LYS A NZ  1 
ATOM   1639 N N   . PHE A 1 236 ? 34.946 14.693  0.837   1.00 25.86 ? 579 PHE A N   1 
ATOM   1640 C CA  . PHE A 1 236 ? 34.934 13.745  1.949   1.00 25.94 ? 579 PHE A CA  1 
ATOM   1641 C C   . PHE A 1 236 ? 36.094 13.985  2.914   1.00 25.66 ? 579 PHE A C   1 
ATOM   1642 O O   . PHE A 1 236 ? 35.870 14.159  4.115   1.00 25.41 ? 579 PHE A O   1 
ATOM   1643 C CB  . PHE A 1 236 ? 34.917 12.287  1.433   1.00 25.87 ? 579 PHE A CB  1 
ATOM   1644 C CG  . PHE A 1 236 ? 35.763 11.327  2.246   1.00 26.24 ? 579 PHE A CG  1 
ATOM   1645 C CD1 . PHE A 1 236 ? 35.454 11.038  3.580   1.00 25.79 ? 579 PHE A CD1 1 
ATOM   1646 C CD2 . PHE A 1 236 ? 36.872 10.706  1.668   1.00 26.46 ? 579 PHE A CD2 1 
ATOM   1647 C CE1 . PHE A 1 236 ? 36.242 10.158  4.329   1.00 25.65 ? 579 PHE A CE1 1 
ATOM   1648 C CE2 . PHE A 1 236 ? 37.665 9.814   2.409   1.00 26.62 ? 579 PHE A CE2 1 
ATOM   1649 C CZ  . PHE A 1 236 ? 37.348 9.540   3.740   1.00 25.54 ? 579 PHE A CZ  1 
ATOM   1650 N N   . LEU A 1 237 ? 37.319 14.015  2.380   1.00 25.73 ? 580 LEU A N   1 
ATOM   1651 C CA  . LEU A 1 237 ? 38.533 14.101  3.193   1.00 26.14 ? 580 LEU A CA  1 
ATOM   1652 C C   . LEU A 1 237 ? 38.621 15.394  3.986   1.00 26.22 ? 580 LEU A C   1 
ATOM   1653 O O   . LEU A 1 237 ? 39.027 15.380  5.149   1.00 25.59 ? 580 LEU A O   1 
ATOM   1654 C CB  . LEU A 1 237 ? 39.783 13.966  2.327   1.00 26.53 ? 580 LEU A CB  1 
ATOM   1655 C CG  . LEU A 1 237 ? 40.112 12.583  1.777   1.00 27.97 ? 580 LEU A CG  1 
ATOM   1656 C CD1 . LEU A 1 237 ? 41.007 12.727  0.551   1.00 28.40 ? 580 LEU A CD1 1 
ATOM   1657 C CD2 . LEU A 1 237 ? 40.764 11.707  2.853   1.00 29.85 ? 580 LEU A CD2 1 
ATOM   1658 N N   . LYS A 1 238 ? 38.250 16.498  3.335   1.00 26.48 ? 581 LYS A N   1 
ATOM   1659 C CA  . LYS A 1 238 ? 38.223 17.817  3.955   1.00 27.43 ? 581 LYS A CA  1 
ATOM   1660 C C   . LYS A 1 238 ? 37.240 17.851  5.121   1.00 27.08 ? 581 LYS A C   1 
ATOM   1661 O O   . LYS A 1 238 ? 37.583 18.295  6.217   1.00 27.57 ? 581 LYS A O   1 
ATOM   1662 C CB  . LYS A 1 238 ? 37.857 18.883  2.915   1.00 27.65 ? 581 LYS A CB  1 
ATOM   1663 C CG  . LYS A 1 238 ? 38.097 20.304  3.393   1.00 30.92 ? 581 LYS A CG  1 
ATOM   1664 C CD  . LYS A 1 238 ? 37.434 21.338  2.486   1.00 33.72 ? 581 LYS A CD  1 
ATOM   1665 C CE  . LYS A 1 238 ? 37.435 22.713  3.155   1.00 35.91 ? 581 LYS A CE  1 
ATOM   1666 N NZ  . LYS A 1 238 ? 36.527 22.762  4.352   1.00 38.52 ? 581 LYS A NZ  1 
ATOM   1667 N N   . ARG A 1 239 ? 36.029 17.360  4.875   1.00 27.09 ? 582 ARG A N   1 
ATOM   1668 C CA  . ARG A 1 239 ? 34.976 17.300  5.881   1.00 27.39 ? 582 ARG A CA  1 
ATOM   1669 C C   . ARG A 1 239 ? 35.315 16.356  7.042   1.00 26.97 ? 582 ARG A C   1 
ATOM   1670 O O   . ARG A 1 239 ? 35.118 16.708  8.204   1.00 26.41 ? 582 ARG A O   1 
ATOM   1671 C CB  . ARG A 1 239 ? 33.655 16.891  5.227   1.00 27.73 ? 582 ARG A CB  1 
ATOM   1672 C CG  . ARG A 1 239 ? 32.476 16.776  6.185   1.00 30.23 ? 582 ARG A CG  1 
ATOM   1673 C CD  . ARG A 1 239 ? 31.172 16.567  5.433   1.00 34.65 ? 582 ARG A CD  1 
ATOM   1674 N NE  . ARG A 1 239 ? 30.100 16.096  6.313   1.00 36.96 ? 582 ARG A NE  1 
ATOM   1675 C CZ  . ARG A 1 239 ? 29.359 16.878  7.095   1.00 38.37 ? 582 ARG A CZ  1 
ATOM   1676 N NH1 . ARG A 1 239 ? 29.558 18.192  7.125   1.00 38.91 ? 582 ARG A NH1 1 
ATOM   1677 N NH2 . ARG A 1 239 ? 28.414 16.339  7.853   1.00 38.46 ? 582 ARG A NH2 1 
ATOM   1678 N N   . PHE A 1 240 ? 35.812 15.163  6.719   1.00 26.60 ? 583 PHE A N   1 
ATOM   1679 C CA  . PHE A 1 240 ? 36.145 14.174  7.737   1.00 26.43 ? 583 PHE A CA  1 
ATOM   1680 C C   . PHE A 1 240 ? 37.285 14.624  8.658   1.00 26.59 ? 583 PHE A C   1 
ATOM   1681 O O   . PHE A 1 240 ? 37.178 14.492  9.876   1.00 26.66 ? 583 PHE A O   1 
ATOM   1682 C CB  . PHE A 1 240 ? 36.463 12.797  7.128   1.00 26.08 ? 583 PHE A CB  1 
ATOM   1683 C CG  . PHE A 1 240 ? 36.969 11.808  8.140   1.00 24.90 ? 583 PHE A CG  1 
ATOM   1684 C CD1 . PHE A 1 240 ? 36.098 11.246  9.074   1.00 23.52 ? 583 PHE A CD1 1 
ATOM   1685 C CD2 . PHE A 1 240 ? 38.324 11.491  8.208   1.00 23.54 ? 583 PHE A CD2 1 
ATOM   1686 C CE1 . PHE A 1 240 ? 36.565 10.361  10.040  1.00 23.92 ? 583 PHE A CE1 1 
ATOM   1687 C CE2 . PHE A 1 240 ? 38.798 10.605  9.171   1.00 22.54 ? 583 PHE A CE2 1 
ATOM   1688 C CZ  . PHE A 1 240 ? 37.919 10.047  10.088  1.00 22.63 ? 583 PHE A CZ  1 
ATOM   1689 N N   . THR A 1 241 ? 38.365 15.151  8.083   1.00 26.57 ? 584 THR A N   1 
ATOM   1690 C CA  . THR A 1 241 ? 39.479 15.644  8.890   1.00 26.84 ? 584 THR A CA  1 
ATOM   1691 C C   . THR A 1 241 ? 39.100 16.865  9.744   1.00 27.09 ? 584 THR A C   1 
ATOM   1692 O O   . THR A 1 241 ? 39.577 16.998  10.870  1.00 26.93 ? 584 THR A O   1 
ATOM   1693 C CB  . THR A 1 241 ? 40.746 15.925  8.055   1.00 26.94 ? 584 THR A CB  1 
ATOM   1694 O OG1 . THR A 1 241 ? 40.413 16.722  6.913   1.00 26.66 ? 584 THR A OG1 1 
ATOM   1695 C CG2 . THR A 1 241 ? 41.375 14.613  7.588   1.00 26.69 ? 584 THR A CG2 1 
ATOM   1696 N N   . SER A 1 242 ? 38.237 17.733  9.217   1.00 27.40 ? 585 SER A N   1 
ATOM   1697 C CA  . SER A 1 242 ? 37.722 18.875  9.986   1.00 27.87 ? 585 SER A CA  1 
ATOM   1698 C C   . SER A 1 242 ? 36.893 18.389  11.165  1.00 27.93 ? 585 SER A C   1 
ATOM   1699 O O   . SER A 1 242 ? 36.994 18.926  12.261  1.00 27.90 ? 585 SER A O   1 
ATOM   1700 C CB  . SER A 1 242 ? 36.871 19.801  9.106   1.00 27.81 ? 585 SER A CB  1 
ATOM   1701 O OG  . SER A 1 242 ? 37.656 20.379  8.083   1.00 28.85 ? 585 SER A OG  1 
ATOM   1702 N N   . TYR A 1 243 ? 36.076 17.367  10.918  1.00 28.47 ? 586 TYR A N   1 
ATOM   1703 C CA  . TYR A 1 243 ? 35.234 16.751  11.937  1.00 28.48 ? 586 TYR A CA  1 
ATOM   1704 C C   . TYR A 1 243 ? 36.061 16.188  13.096  1.00 28.47 ? 586 TYR A C   1 
ATOM   1705 O O   . TYR A 1 243 ? 35.728 16.417  14.263  1.00 28.53 ? 586 TYR A O   1 
ATOM   1706 C CB  . TYR A 1 243 ? 34.348 15.674  11.299  1.00 28.78 ? 586 TYR A CB  1 
ATOM   1707 C CG  . TYR A 1 243 ? 33.671 14.730  12.272  1.00 29.42 ? 586 TYR A CG  1 
ATOM   1708 C CD1 . TYR A 1 243 ? 32.510 15.106  12.952  1.00 29.98 ? 586 TYR A CD1 1 
ATOM   1709 C CD2 . TYR A 1 243 ? 34.177 13.448  12.487  1.00 30.33 ? 586 TYR A CD2 1 
ATOM   1710 C CE1 . TYR A 1 243 ? 31.888 14.232  13.841  1.00 31.04 ? 586 TYR A CE1 1 
ATOM   1711 C CE2 . TYR A 1 243 ? 33.562 12.570  13.367  1.00 30.74 ? 586 TYR A CE2 1 
ATOM   1712 C CZ  . TYR A 1 243 ? 32.423 12.968  14.041  1.00 31.16 ? 586 TYR A CZ  1 
ATOM   1713 O OH  . TYR A 1 243 ? 31.819 12.092  14.912  1.00 33.35 ? 586 TYR A OH  1 
ATOM   1714 N N   . VAL A 1 244 ? 37.141 15.473  12.778  1.00 28.03 ? 587 VAL A N   1 
ATOM   1715 C CA  . VAL A 1 244 ? 38.046 14.947  13.805  1.00 27.80 ? 587 VAL A CA  1 
ATOM   1716 C C   . VAL A 1 244 ? 38.663 16.068  14.644  1.00 28.17 ? 587 VAL A C   1 
ATOM   1717 O O   . VAL A 1 244 ? 38.755 15.958  15.870  1.00 27.72 ? 587 VAL A O   1 
ATOM   1718 C CB  . VAL A 1 244 ? 39.165 14.070  13.207  1.00 27.67 ? 587 VAL A CB  1 
ATOM   1719 C CG1 . VAL A 1 244 ? 40.076 13.548  14.305  1.00 27.05 ? 587 VAL A CG1 1 
ATOM   1720 C CG2 . VAL A 1 244 ? 38.570 12.899  12.433  1.00 27.05 ? 587 VAL A CG2 1 
ATOM   1721 N N   . GLN A 1 245 ? 39.078 17.142  13.978  1.00 28.43 ? 588 GLN A N   1 
ATOM   1722 C CA  . GLN A 1 245 ? 39.620 18.309  14.672  1.00 29.39 ? 588 GLN A CA  1 
ATOM   1723 C C   . GLN A 1 245 ? 38.605 18.913  15.645  1.00 29.99 ? 588 GLN A C   1 
ATOM   1724 O O   . GLN A 1 245 ? 38.933 19.200  16.800  1.00 30.65 ? 588 GLN A O   1 
ATOM   1725 C CB  . GLN A 1 245 ? 40.078 19.358  13.661  1.00 29.03 ? 588 GLN A CB  1 
ATOM   1726 C CG  . GLN A 1 245 ? 41.376 18.999  12.988  1.00 28.76 ? 588 GLN A CG  1 
ATOM   1727 C CD  . GLN A 1 245 ? 41.808 20.029  11.982  1.00 29.89 ? 588 GLN A CD  1 
ATOM   1728 O OE1 . GLN A 1 245 ? 41.057 20.375  11.064  1.00 29.37 ? 588 GLN A OE1 1 
ATOM   1729 N NE2 . GLN A 1 245 ? 43.031 20.520  12.136  1.00 28.75 ? 588 GLN A NE2 1 
ATOM   1730 N N   . GLU A 1 246 ? 37.375 19.076  15.169  1.00 30.83 ? 589 GLU A N   1 
ATOM   1731 C CA  . GLU A 1 246 ? 36.290 19.658  15.949  1.00 31.87 ? 589 GLU A CA  1 
ATOM   1732 C C   . GLU A 1 246 ? 35.952 18.805  17.162  1.00 32.05 ? 589 GLU A C   1 
ATOM   1733 O O   . GLU A 1 246 ? 35.726 19.325  18.262  1.00 32.02 ? 589 GLU A O   1 
ATOM   1734 C CB  . GLU A 1 246 ? 35.043 19.779  15.085  1.00 32.17 ? 589 GLU A CB  1 
ATOM   1735 C CG  . GLU A 1 246 ? 35.058 20.929  14.105  1.00 34.95 ? 589 GLU A CG  1 
ATOM   1736 C CD  . GLU A 1 246 ? 33.661 21.385  13.765  1.00 38.07 ? 589 GLU A CD  1 
ATOM   1737 O OE1 . GLU A 1 246 ? 32.821 20.521  13.416  1.00 40.42 ? 589 GLU A OE1 1 
ATOM   1738 O OE2 . GLU A 1 246 ? 33.399 22.607  13.862  1.00 39.84 ? 589 GLU A OE2 1 
ATOM   1739 N N   . LYS A 1 247 ? 35.924 17.491  16.943  1.00 31.87 ? 590 LYS A N   1 
ATOM   1740 C CA  . LYS A 1 247 ? 35.510 16.533  17.956  1.00 31.72 ? 590 LYS A CA  1 
ATOM   1741 C C   . LYS A 1 247 ? 36.570 16.282  19.028  1.00 31.06 ? 590 LYS A C   1 
ATOM   1742 O O   . LYS A 1 247 ? 36.238 15.834  20.119  1.00 31.14 ? 590 LYS A O   1 
ATOM   1743 C CB  . LYS A 1 247 ? 35.104 15.219  17.283  1.00 31.88 ? 590 LYS A CB  1 
ATOM   1744 C CG  . LYS A 1 247 ? 33.884 14.563  17.887  1.00 33.95 ? 590 LYS A CG  1 
ATOM   1745 C CD  . LYS A 1 247 ? 32.575 15.153  17.367  1.00 36.86 ? 590 LYS A CD  1 
ATOM   1746 C CE  . LYS A 1 247 ? 31.386 14.544  18.107  1.00 38.00 ? 590 LYS A CE  1 
ATOM   1747 N NZ  . LYS A 1 247 ? 30.080 14.824  17.441  1.00 39.78 ? 590 LYS A NZ  1 
ATOM   1748 N N   . THR A 1 248 ? 37.836 16.564  18.718  1.00 30.26 ? 591 THR A N   1 
ATOM   1749 C CA  . THR A 1 248 ? 38.942 16.302  19.648  1.00 29.52 ? 591 THR A CA  1 
ATOM   1750 C C   . THR A 1 248 ? 39.454 17.548  20.372  1.00 29.70 ? 591 THR A C   1 
ATOM   1751 O O   . THR A 1 248 ? 40.110 17.432  21.405  1.00 29.13 ? 591 THR A O   1 
ATOM   1752 C CB  . THR A 1 248 ? 40.151 15.615  18.959  1.00 29.35 ? 591 THR A CB  1 
ATOM   1753 O OG1 . THR A 1 248 ? 40.573 16.396  17.831  1.00 27.85 ? 591 THR A OG1 1 
ATOM   1754 C CG2 . THR A 1 248 ? 39.803 14.195  18.521  1.00 28.46 ? 591 THR A CG2 1 
ATOM   1755 N N   . ALA A 1 249 ? 39.147 18.730  19.836  1.00 30.11 ? 592 ALA A N   1 
ATOM   1756 C CA  . ALA A 1 249 ? 39.654 19.982  20.399  1.00 30.83 ? 592 ALA A CA  1 
ATOM   1757 C C   . ALA A 1 249 ? 39.295 20.110  21.873  1.00 31.21 ? 592 ALA A C   1 
ATOM   1758 O O   . ALA A 1 249 ? 38.140 19.927  22.257  1.00 31.54 ? 592 ALA A O   1 
ATOM   1759 C CB  . ALA A 1 249 ? 39.143 21.187  19.615  1.00 30.63 ? 592 ALA A CB  1 
ATOM   1760 N N   . GLY A 1 250 ? 40.299 20.405  22.688  1.00 31.74 ? 593 GLY A N   1 
ATOM   1761 C CA  . GLY A 1 250 ? 40.099 20.617  24.118  1.00 32.51 ? 593 GLY A CA  1 
ATOM   1762 C C   . GLY A 1 250 ? 40.129 19.342  24.941  1.00 32.99 ? 593 GLY A C   1 
ATOM   1763 O O   . GLY A 1 250 ? 40.126 19.398  26.177  1.00 33.53 ? 593 GLY A O   1 
ATOM   1764 N N   . LYS A 1 251 ? 40.159 18.196  24.261  1.00 32.67 ? 594 LYS A N   1 
ATOM   1765 C CA  . LYS A 1 251 ? 40.131 16.892  24.923  1.00 32.50 ? 594 LYS A CA  1 
ATOM   1766 C C   . LYS A 1 251 ? 41.535 16.356  25.177  1.00 32.05 ? 594 LYS A C   1 
ATOM   1767 O O   . LYS A 1 251 ? 42.470 16.698  24.437  1.00 31.76 ? 594 LYS A O   1 
ATOM   1768 C CB  . LYS A 1 251 ? 39.361 15.877  24.082  1.00 32.42 ? 594 LYS A CB  1 
ATOM   1769 C CG  . LYS A 1 251 ? 37.849 16.029  24.070  1.00 33.92 ? 594 LYS A CG  1 
ATOM   1770 C CD  . LYS A 1 251 ? 37.242 14.802  23.389  1.00 35.88 ? 594 LYS A CD  1 
ATOM   1771 C CE  . LYS A 1 251 ? 35.750 14.927  23.192  1.00 36.95 ? 594 LYS A CE  1 
ATOM   1772 N NZ  . LYS A 1 251 ? 35.168 13.626  22.746  1.00 39.28 ? 594 LYS A NZ  1 
ATOM   1773 N N   . PRO A 1 252 ? 41.690 15.506  26.222  1.00 31.72 ? 595 PRO A N   1 
ATOM   1774 C CA  . PRO A 1 252 ? 42.940 14.768  26.424  1.00 31.48 ? 595 PRO A CA  1 
ATOM   1775 C C   . PRO A 1 252 ? 43.297 13.964  25.169  1.00 30.92 ? 595 PRO A C   1 
ATOM   1776 O O   . PRO A 1 252 ? 42.413 13.454  24.483  1.00 30.68 ? 595 PRO A O   1 
ATOM   1777 C CB  . PRO A 1 252 ? 42.617 13.830  27.597  1.00 31.62 ? 595 PRO A CB  1 
ATOM   1778 C CG  . PRO A 1 252 ? 41.512 14.499  28.325  1.00 32.08 ? 595 PRO A CG  1 
ATOM   1779 C CD  . PRO A 1 252 ? 40.698 15.201  27.274  1.00 31.95 ? 595 PRO A CD  1 
ATOM   1780 N N   . ILE A 1 253 ? 44.586 13.883  24.865  1.00 30.61 ? 596 ILE A N   1 
ATOM   1781 C CA  . ILE A 1 253 ? 45.043 13.281  23.617  1.00 30.30 ? 596 ILE A CA  1 
ATOM   1782 C C   . ILE A 1 253 ? 45.059 11.761  23.698  1.00 30.29 ? 596 ILE A C   1 
ATOM   1783 O O   . ILE A 1 253 ? 45.703 11.185  24.581  1.00 29.71 ? 596 ILE A O   1 
ATOM   1784 C CB  . ILE A 1 253 ? 46.444 13.811  23.223  1.00 30.40 ? 596 ILE A CB  1 
ATOM   1785 C CG1 . ILE A 1 253 ? 46.391 15.324  22.983  1.00 29.83 ? 596 ILE A CG1 1 
ATOM   1786 C CG2 . ILE A 1 253 ? 46.967 13.087  21.991  1.00 29.94 ? 596 ILE A CG2 1 
ATOM   1787 C CD1 . ILE A 1 253 ? 47.747 16.005  23.078  1.00 30.83 ? 596 ILE A CD1 1 
ATOM   1788 N N   . LEU A 1 254 ? 44.344 11.123  22.772  1.00 30.61 ? 597 LEU A N   1 
ATOM   1789 C CA  . LEU A 1 254 ? 44.380 9.671   22.623  1.00 31.12 ? 597 LEU A CA  1 
ATOM   1790 C C   . LEU A 1 254 ? 45.472 9.263   21.632  1.00 31.51 ? 597 LEU A C   1 
ATOM   1791 O O   . LEU A 1 254 ? 45.259 9.277   20.415  1.00 31.38 ? 597 LEU A O   1 
ATOM   1792 C CB  . LEU A 1 254 ? 43.013 9.123   22.184  1.00 31.06 ? 597 LEU A CB  1 
ATOM   1793 C CG  . LEU A 1 254 ? 42.881 7.591   22.091  1.00 31.41 ? 597 LEU A CG  1 
ATOM   1794 C CD1 . LEU A 1 254 ? 42.816 6.946   23.469  1.00 31.43 ? 597 LEU A CD1 1 
ATOM   1795 C CD2 . LEU A 1 254 ? 41.669 7.200   21.276  1.00 31.41 ? 597 LEU A CD2 1 
ATOM   1796 N N   . PHE A 1 255 ? 46.639 8.905   22.163  1.00 31.73 ? 598 PHE A N   1 
ATOM   1797 C CA  . PHE A 1 255 ? 47.758 8.457   21.340  1.00 32.51 ? 598 PHE A CA  1 
ATOM   1798 C C   . PHE A 1 255 ? 47.553 7.033   20.817  1.00 32.49 ? 598 PHE A C   1 
ATOM   1799 O O   . PHE A 1 255 ? 46.747 6.264   21.362  1.00 32.62 ? 598 PHE A O   1 
ATOM   1800 C CB  . PHE A 1 255 ? 49.073 8.551   22.116  1.00 32.79 ? 598 PHE A CB  1 
ATOM   1801 C CG  . PHE A 1 255 ? 49.528 9.965   22.379  1.00 34.59 ? 598 PHE A CG  1 
ATOM   1802 C CD1 . PHE A 1 255 ? 50.176 10.701  21.386  1.00 35.31 ? 598 PHE A CD1 1 
ATOM   1803 C CD2 . PHE A 1 255 ? 49.318 10.556  23.626  1.00 35.56 ? 598 PHE A CD2 1 
ATOM   1804 C CE1 . PHE A 1 255 ? 50.602 12.007  21.630  1.00 36.04 ? 598 PHE A CE1 1 
ATOM   1805 C CE2 . PHE A 1 255 ? 49.741 11.866  23.881  1.00 36.73 ? 598 PHE A CE2 1 
ATOM   1806 C CZ  . PHE A 1 255 ? 50.386 12.592  22.880  1.00 36.36 ? 598 PHE A CZ  1 
HETATM 1807 O O   . HOH B 2 .   ? 34.053 1.332   9.554   1.00 20.78 ? 599 HOH A O   1 
HETATM 1808 O O   . HOH B 2 .   ? 39.226 3.944   -7.537  1.00 22.50 ? 600 HOH A O   1 
HETATM 1809 O O   . HOH B 2 .   ? 28.688 -16.172 5.110   1.00 29.90 ? 601 HOH A O   1 
HETATM 1810 O O   . HOH B 2 .   ? 51.679 8.991   6.159   1.00 27.76 ? 602 HOH A O   1 
HETATM 1811 O O   . HOH B 2 .   ? 35.227 3.263   3.027   1.00 27.20 ? 603 HOH A O   1 
HETATM 1812 O O   . HOH B 2 .   ? 38.769 8.686   -11.144 1.00 22.99 ? 604 HOH A O   1 
HETATM 1813 O O   . HOH B 2 .   ? 31.124 -5.072  -2.019  1.00 28.51 ? 605 HOH A O   1 
HETATM 1814 O O   . HOH B 2 .   ? 35.223 3.194   7.631   1.00 27.45 ? 606 HOH A O   1 
HETATM 1815 O O   . HOH B 2 .   ? 38.964 -2.474  -7.902  1.00 40.46 ? 607 HOH A O   1 
HETATM 1816 O O   . HOH B 2 .   ? 49.680 16.383  1.110   1.00 27.61 ? 608 HOH A O   1 
HETATM 1817 O O   . HOH B 2 .   ? 32.534 0.214   14.495  1.00 25.04 ? 609 HOH A O   1 
HETATM 1818 O O   . HOH B 2 .   ? 31.016 -7.786  -1.971  1.00 22.78 ? 610 HOH A O   1 
HETATM 1819 O O   . HOH B 2 .   ? 45.458 -3.425  16.551  1.00 30.10 ? 611 HOH A O   1 
HETATM 1820 O O   . HOH B 2 .   ? 45.554 25.427  -0.913  1.00 27.37 ? 612 HOH A O   1 
HETATM 1821 O O   . HOH B 2 .   ? 28.922 -9.362  -2.519  1.00 28.91 ? 613 HOH A O   1 
HETATM 1822 O O   . HOH B 2 .   ? 38.146 -9.628  19.711  1.00 32.87 ? 614 HOH A O   1 
HETATM 1823 O O   . HOH B 2 .   ? 39.180 7.308   -8.990  1.00 29.27 ? 615 HOH A O   1 
HETATM 1824 O O   . HOH B 2 .   ? 34.411 -16.125 11.408  1.00 27.85 ? 616 HOH A O   1 
HETATM 1825 O O   . HOH B 2 .   ? 30.997 -14.173 4.881   1.00 27.15 ? 617 HOH A O   1 
HETATM 1826 O O   . HOH B 2 .   ? 57.606 12.105  16.158  1.00 35.98 ? 618 HOH A O   1 
HETATM 1827 O O   . HOH B 2 .   ? 36.215 5.806   2.031   1.00 26.09 ? 619 HOH A O   1 
HETATM 1828 O O   . HOH B 2 .   ? 41.826 18.779  17.762  1.00 24.93 ? 620 HOH A O   1 
HETATM 1829 O O   . HOH B 2 .   ? 41.923 -16.502 7.601   1.00 28.78 ? 621 HOH A O   1 
HETATM 1830 O O   . HOH B 2 .   ? 27.616 -11.320 -0.736  1.00 27.28 ? 622 HOH A O   1 
HETATM 1831 O O   . HOH B 2 .   ? 54.058 20.159  29.414  1.00 45.62 ? 623 HOH A O   1 
HETATM 1832 O O   . HOH B 2 .   ? 54.416 1.323   11.799  1.00 26.40 ? 624 HOH A O   1 
HETATM 1833 O O   . HOH B 2 .   ? 31.229 -13.662 13.855  1.00 27.53 ? 625 HOH A O   1 
HETATM 1834 O O   . HOH B 2 .   ? 57.977 19.481  23.546  1.00 44.84 ? 626 HOH A O   1 
HETATM 1835 O O   . HOH B 2 .   ? 30.786 1.600   21.230  1.00 33.55 ? 627 HOH A O   1 
HETATM 1836 O O   . HOH B 2 .   ? 40.684 0.124   -8.746  1.00 34.90 ? 628 HOH A O   1 
HETATM 1837 O O   . HOH B 2 .   ? 51.424 13.037  -13.824 1.00 28.59 ? 629 HOH A O   1 
HETATM 1838 O O   . HOH B 2 .   ? 50.926 12.128  4.405   1.00 33.67 ? 630 HOH A O   1 
HETATM 1839 O O   . HOH B 2 .   ? 45.452 -4.220  -0.033  1.00 30.52 ? 631 HOH A O   1 
HETATM 1840 O O   . HOH B 2 .   ? 37.568 5.736   -7.291  1.00 36.08 ? 632 HOH A O   1 
HETATM 1841 O O   . HOH B 2 .   ? 48.204 24.142  -0.948  1.00 31.36 ? 633 HOH A O   1 
HETATM 1842 O O   . HOH B 2 .   ? 33.609 8.448   -6.943  1.00 36.94 ? 634 HOH A O   1 
HETATM 1843 O O   . HOH B 2 .   ? 21.158 -6.931  3.100   1.00 40.33 ? 635 HOH A O   1 
HETATM 1844 O O   . HOH B 2 .   ? 48.488 7.910   17.102  1.00 28.62 ? 636 HOH A O   1 
HETATM 1845 O O   . HOH B 2 .   ? 43.572 18.211  -12.359 1.00 39.00 ? 637 HOH A O   1 
HETATM 1846 O O   . HOH B 2 .   ? 48.127 0.564   -2.758  1.00 32.93 ? 638 HOH A O   1 
HETATM 1847 O O   . HOH B 2 .   ? 53.472 16.182  -5.406  1.00 30.09 ? 639 HOH A O   1 
HETATM 1848 O O   . HOH B 2 .   ? 27.992 -10.839 14.553  1.00 29.08 ? 640 HOH A O   1 
HETATM 1849 O O   . HOH B 2 .   ? 40.757 -15.966 16.180  1.00 46.75 ? 641 HOH A O   1 
HETATM 1850 O O   . HOH B 2 .   ? 37.007 -12.809 17.004  1.00 31.08 ? 642 HOH A O   1 
HETATM 1851 O O   . HOH B 2 .   ? 34.077 3.741   0.540   1.00 39.32 ? 643 HOH A O   1 
HETATM 1852 O O   . HOH B 2 .   ? 38.520 -1.329  18.716  1.00 45.10 ? 644 HOH A O   1 
HETATM 1853 O O   . HOH B 2 .   ? 45.075 3.703   -4.781  1.00 27.84 ? 645 HOH A O   1 
HETATM 1854 O O   . HOH B 2 .   ? 47.143 8.663   -15.439 1.00 38.74 ? 646 HOH A O   1 
HETATM 1855 O O   . HOH B 2 .   ? 55.431 22.704  17.798  1.00 43.26 ? 647 HOH A O   1 
HETATM 1856 O O   . HOH B 2 .   ? 27.344 7.857   18.741  1.00 37.72 ? 648 HOH A O   1 
HETATM 1857 O O   . HOH B 2 .   ? 28.512 -13.568 15.093  1.00 36.91 ? 649 HOH A O   1 
HETATM 1858 O O   . HOH B 2 .   ? 46.971 -19.051 4.032   1.00 29.39 ? 650 HOH A O   1 
HETATM 1859 O O   . HOH B 2 .   ? 48.070 2.866   21.447  1.00 37.17 ? 651 HOH A O   1 
HETATM 1860 O O   . HOH B 2 .   ? 43.388 0.401   -2.261  1.00 31.85 ? 652 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   344 ?   ?   ?   A . n 
A 1 2   ASN 2   345 ?   ?   ?   A . n 
A 1 3   SER 3   346 ?   ?   ?   A . n 
A 1 4   LEU 4   347 ?   ?   ?   A . n 
A 1 5   HIS 5   348 ?   ?   ?   A . n 
A 1 6   TRP 6   349 ?   ?   ?   A . n 
A 1 7   PRO 7   350 ?   ?   ?   A . n 
A 1 8   THR 8   351 ?   ?   ?   A . n 
A 1 9   SER 9   352 ?   ?   ?   A . n 
A 1 10  LEU 10  353 ?   ?   ?   A . n 
A 1 11  PRO 11  354 ?   ?   ?   A . n 
A 1 12  SER 12  355 ?   ?   ?   A . n 
A 1 13  GLY 13  356 ?   ?   ?   A . n 
A 1 14  ASP 14  357 ?   ?   ?   A . n 
A 1 15  ALA 15  358 ?   ?   ?   A . n 
A 1 16  PHE 16  359 ?   ?   ?   A . n 
A 1 17  SER 17  360 ?   ?   ?   A . n 
A 1 18  SER 18  361 ?   ?   ?   A . n 
A 1 19  VAL 19  362 ?   ?   ?   A . n 
A 1 20  GLY 20  363 ?   ?   ?   A . n 
A 1 21  THR 21  364 ?   ?   ?   A . n 
A 1 22  HIS 22  365 365 HIS HIS A . n 
A 1 23  ARG 23  366 366 ARG ARG A . n 
A 1 24  PHE 24  367 367 PHE PHE A . n 
A 1 25  VAL 25  368 368 VAL VAL A . n 
A 1 26  GLN 26  369 369 GLN GLN A . n 
A 1 27  LYS 27  370 370 LYS LYS A . n 
A 1 28  VAL 28  371 371 VAL VAL A . n 
A 1 29  GLU 29  372 372 GLU GLU A . n 
A 1 30  GLU 30  373 373 GLU GLU A . n 
A 1 31  MET 31  374 374 MET MET A . n 
A 1 32  VAL 32  375 375 VAL VAL A . n 
A 1 33  GLN 33  376 376 GLN GLN A . n 
A 1 34  ASN 34  377 377 ASN ASN A . n 
A 1 35  HIS 35  378 378 HIS HIS A . n 
A 1 36  MET 36  379 379 MET MET A . n 
A 1 37  THR 37  380 380 THR THR A . n 
A 1 38  TYR 38  381 381 TYR TYR A . n 
A 1 39  SER 39  382 382 SER SER A . n 
A 1 40  LEU 40  383 383 LEU LEU A . n 
A 1 41  GLN 41  384 384 GLN GLN A . n 
A 1 42  ASP 42  385 385 ASP ASP A . n 
A 1 43  VAL 43  386 386 VAL VAL A . n 
A 1 44  GLY 44  387 387 GLY GLY A . n 
A 1 45  GLY 45  388 388 GLY GLY A . n 
A 1 46  ASP 46  389 389 ASP ASP A . n 
A 1 47  ALA 47  390 390 ALA ALA A . n 
A 1 48  ASN 48  391 391 ASN ASN A . n 
A 1 49  TRP 49  392 392 TRP TRP A . n 
A 1 50  GLN 50  393 393 GLN GLN A . n 
A 1 51  LEU 51  394 394 LEU LEU A . n 
A 1 52  VAL 52  395 395 VAL VAL A . n 
A 1 53  VAL 53  396 396 VAL VAL A . n 
A 1 54  GLU 54  397 397 GLU GLU A . n 
A 1 55  GLU 55  398 398 GLU GLU A . n 
A 1 56  GLY 56  399 399 GLY GLY A . n 
A 1 57  GLU 57  400 400 GLU GLU A . n 
A 1 58  MET 58  401 401 MET MET A . n 
A 1 59  LYS 59  402 402 LYS LYS A . n 
A 1 60  VAL 60  403 403 VAL VAL A . n 
A 1 61  TYR 61  404 404 TYR TYR A . n 
A 1 62  ARG 62  405 405 ARG ARG A . n 
A 1 63  ARG 63  406 406 ARG ARG A . n 
A 1 64  GLU 64  407 407 GLU GLU A . n 
A 1 65  VAL 65  408 408 VAL VAL A . n 
A 1 66  GLU 66  409 409 GLU GLU A . n 
A 1 67  GLU 67  410 410 GLU GLU A . n 
A 1 68  ASN 68  411 411 ASN ASN A . n 
A 1 69  GLY 69  412 412 GLY GLY A . n 
A 1 70  ILE 70  413 413 ILE ILE A . n 
A 1 71  VAL 71  414 414 VAL VAL A . n 
A 1 72  LEU 72  415 415 LEU LEU A . n 
A 1 73  ASP 73  416 416 ASP ASP A . n 
A 1 74  PRO 74  417 417 PRO PRO A . n 
A 1 75  LEU 75  418 418 LEU LEU A . n 
A 1 76  LYS 76  419 419 LYS LYS A . n 
A 1 77  ALA 77  420 420 ALA ALA A . n 
A 1 78  THR 78  421 421 THR THR A . n 
A 1 79  HIS 79  422 422 HIS HIS A . n 
A 1 80  ALA 80  423 423 ALA ALA A . n 
A 1 81  VAL 81  424 424 VAL VAL A . n 
A 1 82  LYS 82  425 425 LYS LYS A . n 
A 1 83  GLY 83  426 426 GLY GLY A . n 
A 1 84  VAL 84  427 427 VAL VAL A . n 
A 1 85  THR 85  428 428 THR THR A . n 
A 1 86  GLY 86  429 429 GLY GLY A . n 
A 1 87  HIS 87  430 430 HIS HIS A . n 
A 1 88  GLU 88  431 431 GLU GLU A . n 
A 1 89  VAL 89  432 432 VAL VAL A . n 
A 1 90  CYS 90  433 433 CYS CYS A . n 
A 1 91  ASN 91  434 434 ASN ASN A . n 
A 1 92  TYR 92  435 435 TYR TYR A . n 
A 1 93  PHE 93  436 436 PHE PHE A . n 
A 1 94  TRP 94  437 437 TRP TRP A . n 
A 1 95  ASN 95  438 438 ASN ASN A . n 
A 1 96  VAL 96  439 439 VAL VAL A . n 
A 1 97  ASP 97  440 440 ASP ASP A . n 
A 1 98  VAL 98  441 441 VAL VAL A . n 
A 1 99  ARG 99  442 442 ARG ARG A . n 
A 1 100 ASN 100 443 443 ASN ASN A . n 
A 1 101 ASP 101 444 444 ASP ASP A . n 
A 1 102 TRP 102 445 445 TRP TRP A . n 
A 1 103 GLU 103 446 446 GLU GLU A . n 
A 1 104 THR 104 447 447 THR THR A . n 
A 1 105 THR 105 448 448 THR THR A . n 
A 1 106 ILE 106 449 449 ILE ILE A . n 
A 1 107 GLU 107 450 450 GLU GLU A . n 
A 1 108 ASN 108 451 451 ASN ASN A . n 
A 1 109 PHE 109 452 452 PHE PHE A . n 
A 1 110 HIS 110 453 453 HIS HIS A . n 
A 1 111 VAL 111 454 454 VAL VAL A . n 
A 1 112 VAL 112 455 455 VAL VAL A . n 
A 1 113 GLU 113 456 456 GLU GLU A . n 
A 1 114 THR 114 457 457 THR THR A . n 
A 1 115 LEU 115 458 458 LEU LEU A . n 
A 1 116 ALA 116 459 459 ALA ALA A . n 
A 1 117 ASP 117 460 460 ASP ASP A . n 
A 1 118 ASN 118 461 461 ASN ASN A . n 
A 1 119 ALA 119 462 462 ALA ALA A . n 
A 1 120 ILE 120 463 463 ILE ILE A . n 
A 1 121 ILE 121 464 464 ILE ILE A . n 
A 1 122 ILE 122 465 465 ILE ILE A . n 
A 1 123 TYR 123 466 466 TYR TYR A . n 
A 1 124 GLN 124 467 467 GLN GLN A . n 
A 1 125 THR 125 468 468 THR THR A . n 
A 1 126 HIS 126 469 469 HIS HIS A . n 
A 1 127 LYS 127 470 470 LYS LYS A . n 
A 1 128 ARG 128 471 471 ARG ARG A . n 
A 1 129 VAL 129 472 472 VAL VAL A . n 
A 1 130 TRP 130 473 ?   ?   ?   A . n 
A 1 131 PRO 131 474 ?   ?   ?   A . n 
A 1 132 ALA 132 475 ?   ?   ?   A . n 
A 1 133 SER 133 476 476 SER SER A . n 
A 1 134 GLN 134 477 477 GLN GLN A . n 
A 1 135 ARG 135 478 478 ARG ARG A . n 
A 1 136 ASP 136 479 479 ASP ASP A . n 
A 1 137 VAL 137 480 480 VAL VAL A . n 
A 1 138 LEU 138 481 481 LEU LEU A . n 
A 1 139 TYR 139 482 482 TYR TYR A . n 
A 1 140 LEU 140 483 483 LEU LEU A . n 
A 1 141 SER 141 484 484 SER SER A . n 
A 1 142 VAL 142 485 485 VAL VAL A . n 
A 1 143 ILE 143 486 486 ILE ILE A . n 
A 1 144 ARG 144 487 487 ARG ARG A . n 
A 1 145 LYS 145 488 488 LYS LYS A . n 
A 1 146 ILE 146 489 489 ILE ILE A . n 
A 1 147 PRO 147 490 490 PRO PRO A . n 
A 1 148 ALA 148 491 491 ALA ALA A . n 
A 1 149 LEU 149 492 492 LEU LEU A . n 
A 1 150 THR 150 493 493 THR THR A . n 
A 1 151 GLU 151 494 494 GLU GLU A . n 
A 1 152 ASN 152 495 495 ASN ASN A . n 
A 1 153 ASP 153 496 496 ASP ASP A . n 
A 1 154 PRO 154 497 497 PRO PRO A . n 
A 1 155 GLU 155 498 498 GLU GLU A . n 
A 1 156 THR 156 499 499 THR THR A . n 
A 1 157 TRP 157 500 500 TRP TRP A . n 
A 1 158 ILE 158 501 501 ILE ILE A . n 
A 1 159 VAL 159 502 502 VAL VAL A . n 
A 1 160 CYS 160 503 503 CYS CYS A . n 
A 1 161 ASN 161 504 504 ASN ASN A . n 
A 1 162 PHE 162 505 505 PHE PHE A . n 
A 1 163 SER 163 506 506 SER SER A . n 
A 1 164 VAL 164 507 507 VAL VAL A . n 
A 1 165 ASP 165 508 508 ASP ASP A . n 
A 1 166 HIS 166 509 509 HIS HIS A . n 
A 1 167 ASP 167 510 510 ASP ASP A . n 
A 1 168 SER 168 511 511 SER SER A . n 
A 1 169 ALA 169 512 512 ALA ALA A . n 
A 1 170 PRO 170 513 513 PRO PRO A . n 
A 1 171 LEU 171 514 514 LEU LEU A . n 
A 1 172 ASN 172 515 515 ASN ASN A . n 
A 1 173 ASN 173 516 516 ASN ASN A . n 
A 1 174 ARG 174 517 517 ARG ARG A . n 
A 1 175 CYS 175 518 518 CYS CYS A . n 
A 1 176 VAL 176 519 519 VAL VAL A . n 
A 1 177 ARG 177 520 520 ARG ARG A . n 
A 1 178 ALA 178 521 521 ALA ALA A . n 
A 1 179 LYS 179 522 522 LYS LYS A . n 
A 1 180 ILE 180 523 523 ILE ILE A . n 
A 1 181 ASN 181 524 524 ASN ASN A . n 
A 1 182 VAL 182 525 525 VAL VAL A . n 
A 1 183 ALA 183 526 526 ALA ALA A . n 
A 1 184 MET 184 527 527 MET MET A . n 
A 1 185 ILE 185 528 528 ILE ILE A . n 
A 1 186 CYS 186 529 529 CYS CYS A . n 
A 1 187 GLN 187 530 530 GLN GLN A . n 
A 1 188 THR 188 531 531 THR THR A . n 
A 1 189 LEU 189 532 532 LEU LEU A . n 
A 1 190 VAL 190 533 533 VAL VAL A . n 
A 1 191 SER 191 534 534 SER SER A . n 
A 1 192 PRO 192 535 ?   ?   ?   A . n 
A 1 193 PRO 193 536 ?   ?   ?   A . n 
A 1 194 GLU 194 537 ?   ?   ?   A . n 
A 1 195 GLY 195 538 ?   ?   ?   A . n 
A 1 196 ASN 196 539 ?   ?   ?   A . n 
A 1 197 GLN 197 540 ?   ?   ?   A . n 
A 1 198 GLU 198 541 ?   ?   ?   A . n 
A 1 199 ILE 199 542 542 ILE ILE A . n 
A 1 200 SER 200 543 543 SER SER A . n 
A 1 201 ARG 201 544 544 ARG ARG A . n 
A 1 202 ASP 202 545 545 ASP ASP A . n 
A 1 203 ASN 203 546 546 ASN ASN A . n 
A 1 204 ILE 204 547 547 ILE ILE A . n 
A 1 205 LEU 205 548 548 LEU LEU A . n 
A 1 206 CYS 206 549 549 CYS CYS A . n 
A 1 207 LYS 207 550 550 LYS LYS A . n 
A 1 208 ILE 208 551 551 ILE ILE A . n 
A 1 209 THR 209 552 552 THR THR A . n 
A 1 210 TYR 210 553 553 TYR TYR A . n 
A 1 211 VAL 211 554 554 VAL VAL A . n 
A 1 212 ALA 212 555 555 ALA ALA A . n 
A 1 213 ASN 213 556 556 ASN ASN A . n 
A 1 214 VAL 214 557 557 VAL VAL A . n 
A 1 215 ASN 215 558 558 ASN ASN A . n 
A 1 216 PRO 216 559 559 PRO PRO A . n 
A 1 217 GLY 217 560 560 GLY GLY A . n 
A 1 218 GLY 218 561 561 GLY GLY A . n 
A 1 219 TRP 219 562 562 TRP TRP A . n 
A 1 220 ALA 220 563 563 ALA ALA A . n 
A 1 221 PRO 221 564 564 PRO PRO A . n 
A 1 222 ALA 222 565 565 ALA ALA A . n 
A 1 223 SER 223 566 566 SER SER A . n 
A 1 224 VAL 224 567 567 VAL VAL A . n 
A 1 225 LEU 225 568 568 LEU LEU A . n 
A 1 226 ARG 226 569 569 ARG ARG A . n 
A 1 227 ALA 227 570 570 ALA ALA A . n 
A 1 228 VAL 228 571 571 VAL VAL A . n 
A 1 229 ALA 229 572 572 ALA ALA A . n 
A 1 230 LYS 230 573 573 LYS LYS A . n 
A 1 231 ARG 231 574 574 ARG ARG A . n 
A 1 232 GLU 232 575 575 GLU GLU A . n 
A 1 233 TYR 233 576 576 TYR TYR A . n 
A 1 234 PRO 234 577 577 PRO PRO A . n 
A 1 235 LYS 235 578 578 LYS LYS A . n 
A 1 236 PHE 236 579 579 PHE PHE A . n 
A 1 237 LEU 237 580 580 LEU LEU A . n 
A 1 238 LYS 238 581 581 LYS LYS A . n 
A 1 239 ARG 239 582 582 ARG ARG A . n 
A 1 240 PHE 240 583 583 PHE PHE A . n 
A 1 241 THR 241 584 584 THR THR A . n 
A 1 242 SER 242 585 585 SER SER A . n 
A 1 243 TYR 243 586 586 TYR TYR A . n 
A 1 244 VAL 244 587 587 VAL VAL A . n 
A 1 245 GLN 245 588 588 GLN GLN A . n 
A 1 246 GLU 246 589 589 GLU GLU A . n 
A 1 247 LYS 247 590 590 LYS LYS A . n 
A 1 248 THR 248 591 591 THR THR A . n 
A 1 249 ALA 249 592 592 ALA ALA A . n 
A 1 250 GLY 250 593 593 GLY GLY A . n 
A 1 251 LYS 251 594 594 LYS LYS A . n 
A 1 252 PRO 252 595 595 PRO PRO A . n 
A 1 253 ILE 253 596 596 ILE ILE A . n 
A 1 254 LEU 254 597 597 LEU LEU A . n 
A 1 255 PHE 255 598 598 PHE PHE A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-12-18 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOLREP    phasing           .        ? 1 
REFMAC    refinement        5.2.0005 ? 2 
HKL-2000  'data collection' .        ? 3 
HKL-2000  'data reduction'  .        ? 4 
SCALEPACK 'data scaling'    .        ? 5 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASP 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     416 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -10.93 
_pdbx_validate_torsion.psi             94.11 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 344 ? A SER 1   
2  1 Y 1 A ASN 345 ? A ASN 2   
3  1 Y 1 A SER 346 ? A SER 3   
4  1 Y 1 A LEU 347 ? A LEU 4   
5  1 Y 1 A HIS 348 ? A HIS 5   
6  1 Y 1 A TRP 349 ? A TRP 6   
7  1 Y 1 A PRO 350 ? A PRO 7   
8  1 Y 1 A THR 351 ? A THR 8   
9  1 Y 1 A SER 352 ? A SER 9   
10 1 Y 1 A LEU 353 ? A LEU 10  
11 1 Y 1 A PRO 354 ? A PRO 11  
12 1 Y 1 A SER 355 ? A SER 12  
13 1 Y 1 A GLY 356 ? A GLY 13  
14 1 Y 1 A ASP 357 ? A ASP 14  
15 1 Y 1 A ALA 358 ? A ALA 15  
16 1 Y 1 A PHE 359 ? A PHE 16  
17 1 Y 1 A SER 360 ? A SER 17  
18 1 Y 1 A SER 361 ? A SER 18  
19 1 Y 1 A VAL 362 ? A VAL 19  
20 1 Y 1 A GLY 363 ? A GLY 20  
21 1 Y 1 A THR 364 ? A THR 21  
22 1 Y 1 A TRP 473 ? A TRP 130 
23 1 Y 1 A PRO 474 ? A PRO 131 
24 1 Y 1 A ALA 475 ? A ALA 132 
25 1 Y 1 A PRO 535 ? A PRO 192 
26 1 Y 1 A PRO 536 ? A PRO 193 
27 1 Y 1 A GLU 537 ? A GLU 194 
28 1 Y 1 A GLY 538 ? A GLY 195 
29 1 Y 1 A ASN 539 ? A ASN 196 
30 1 Y 1 A GLN 540 ? A GLN 197 
31 1 Y 1 A GLU 541 ? A GLU 198 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  599 589 HOH HOH A . 
B 2 HOH 2  600 590 HOH HOH A . 
B 2 HOH 3  601 591 HOH HOH A . 
B 2 HOH 4  602 592 HOH HOH A . 
B 2 HOH 5  603 593 HOH HOH A . 
B 2 HOH 6  604 594 HOH HOH A . 
B 2 HOH 7  605 595 HOH HOH A . 
B 2 HOH 8  606 596 HOH HOH A . 
B 2 HOH 9  607 597 HOH HOH A . 
B 2 HOH 10 608 598 HOH HOH A . 
B 2 HOH 11 609 599 HOH HOH A . 
B 2 HOH 12 610 600 HOH HOH A . 
B 2 HOH 13 611 601 HOH HOH A . 
B 2 HOH 14 612 602 HOH HOH A . 
B 2 HOH 15 613 603 HOH HOH A . 
B 2 HOH 16 614 604 HOH HOH A . 
B 2 HOH 17 615 605 HOH HOH A . 
B 2 HOH 18 616 606 HOH HOH A . 
B 2 HOH 19 617 607 HOH HOH A . 
B 2 HOH 20 618 608 HOH HOH A . 
B 2 HOH 21 619 609 HOH HOH A . 
B 2 HOH 22 620 610 HOH HOH A . 
B 2 HOH 23 621 611 HOH HOH A . 
B 2 HOH 24 622 612 HOH HOH A . 
B 2 HOH 25 623 613 HOH HOH A . 
B 2 HOH 26 624 614 HOH HOH A . 
B 2 HOH 27 625 615 HOH HOH A . 
B 2 HOH 28 626 616 HOH HOH A . 
B 2 HOH 29 627 617 HOH HOH A . 
B 2 HOH 30 628 618 HOH HOH A . 
B 2 HOH 31 629 619 HOH HOH A . 
B 2 HOH 32 630 620 HOH HOH A . 
B 2 HOH 33 631 621 HOH HOH A . 
B 2 HOH 34 632 622 HOH HOH A . 
B 2 HOH 35 633 623 HOH HOH A . 
B 2 HOH 36 634 624 HOH HOH A . 
B 2 HOH 37 635 625 HOH HOH A . 
B 2 HOH 38 636 626 HOH HOH A . 
B 2 HOH 39 637 627 HOH HOH A . 
B 2 HOH 40 638 628 HOH HOH A . 
B 2 HOH 41 639 629 HOH HOH A . 
B 2 HOH 42 640 630 HOH HOH A . 
B 2 HOH 43 641 631 HOH HOH A . 
B 2 HOH 44 642 632 HOH HOH A . 
B 2 HOH 45 643 633 HOH HOH A . 
B 2 HOH 46 644 634 HOH HOH A . 
B 2 HOH 47 645 635 HOH HOH A . 
B 2 HOH 48 646 636 HOH HOH A . 
B 2 HOH 49 647 637 HOH HOH A . 
B 2 HOH 50 648 638 HOH HOH A . 
B 2 HOH 51 649 639 HOH HOH A . 
B 2 HOH 52 650 640 HOH HOH A . 
B 2 HOH 53 651 641 HOH HOH A . 
B 2 HOH 54 652 642 HOH HOH A . 
#