data_2E3V
# 
_entry.id   2E3V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2E3V         
RCSB  RCSB026191   
WWPDB D_1000026191 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB      2HAZ           'The same protein, splicing isoform' unspecified 
TargetDB hso002002037.2 .                                    unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2E3V 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-30 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nishino, A.'                                            1 
'Saijo, S.'                                              2 
'Kishishita, S.'                                         3 
'Chen, L.'                                               4 
'Liu, Z.J.'                                              5 
'Wang, B.C.'                                             6 
'Shirouzu, M.'                                           7 
'Yokoyama, S.'                                           8 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of the first fibronectin type III domain of neural cell adhesion molecule splicing isoform from human muscle culture lambda-4.4
;
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Saijo, S.'      1 
primary 'Nishino, A.'    2 
primary 'Kishishita, S.' 3 
primary 'Chen, L.'       4 
primary 'Liu, Z.J.'      5 
primary 'Wang, B.C.'     6 
primary 'Shirouzu, M.'   7 
primary 'Yokoyama, S.'   8 
# 
_cell.entry_id           2E3V 
_cell.length_a           55.378 
_cell.length_b           55.378 
_cell.length_c           118.830 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              9 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2E3V 
_symmetry.space_group_name_H-M             'P 31' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                144 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Neural cell adhesion molecule 1, 140 kDa isoform'                 12841.971 3   ? ? 
'first fibronectin type III domain' ? 
2 non-polymer syn 'DI(HYDROXYETHYL)ETHER'                                            106.120   3   ? ? ? ? 
3 non-polymer syn 'TRIETHYLENE GLYCOL'                                               150.173   2   ? ? ? ? 
4 non-polymer syn '2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL' 209.240   2   ? ? ? ? 
5 non-polymer syn 1,2-ETHANEDIOL                                                     62.068    1   ? ? ? ? 
6 water       nat water                                                              18.015    233 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'N-CAM 140, NCAM-140, CD56 antigen, neural cell adhesion molecule, splicing isoform from human muscle culture, clone lambda-4.4' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEAS(MSE)EGIVTIVGLKP
ETTYAVRLAALNGKGLGEISAASEFKTQPVREPSAPKLEGSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTY
AVRLAALNGKGLGEISAASEFKTQPVREPSAPKLEGSGPSSG
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         hso002002037.2 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   PRO n 
1 9   SER n 
1 10  SER n 
1 11  PRO n 
1 12  SER n 
1 13  ILE n 
1 14  ASP n 
1 15  GLN n 
1 16  VAL n 
1 17  GLU n 
1 18  PRO n 
1 19  TYR n 
1 20  SER n 
1 21  SER n 
1 22  THR n 
1 23  ALA n 
1 24  GLN n 
1 25  VAL n 
1 26  GLN n 
1 27  PHE n 
1 28  ASP n 
1 29  GLU n 
1 30  PRO n 
1 31  GLU n 
1 32  ALA n 
1 33  THR n 
1 34  GLY n 
1 35  GLY n 
1 36  VAL n 
1 37  PRO n 
1 38  ILE n 
1 39  LEU n 
1 40  LYS n 
1 41  TYR n 
1 42  LYS n 
1 43  ALA n 
1 44  GLU n 
1 45  TRP n 
1 46  ARG n 
1 47  ALA n 
1 48  VAL n 
1 49  GLY n 
1 50  GLU n 
1 51  GLU n 
1 52  VAL n 
1 53  TRP n 
1 54  HIS n 
1 55  SER n 
1 56  LYS n 
1 57  TRP n 
1 58  TYR n 
1 59  ASP n 
1 60  ALA n 
1 61  LYS n 
1 62  GLU n 
1 63  ALA n 
1 64  SER n 
1 65  MSE n 
1 66  GLU n 
1 67  GLY n 
1 68  ILE n 
1 69  VAL n 
1 70  THR n 
1 71  ILE n 
1 72  VAL n 
1 73  GLY n 
1 74  LEU n 
1 75  LYS n 
1 76  PRO n 
1 77  GLU n 
1 78  THR n 
1 79  THR n 
1 80  TYR n 
1 81  ALA n 
1 82  VAL n 
1 83  ARG n 
1 84  LEU n 
1 85  ALA n 
1 86  ALA n 
1 87  LEU n 
1 88  ASN n 
1 89  GLY n 
1 90  LYS n 
1 91  GLY n 
1 92  LEU n 
1 93  GLY n 
1 94  GLU n 
1 95  ILE n 
1 96  SER n 
1 97  ALA n 
1 98  ALA n 
1 99  SER n 
1 100 GLU n 
1 101 PHE n 
1 102 LYS n 
1 103 THR n 
1 104 GLN n 
1 105 PRO n 
1 106 VAL n 
1 107 ARG n 
1 108 GLU n 
1 109 PRO n 
1 110 SER n 
1 111 ALA n 
1 112 PRO n 
1 113 LYS n 
1 114 LEU n 
1 115 GLU n 
1 116 GLY n 
1 117 SER n 
1 118 GLY n 
1 119 PRO n 
1 120 SER n 
1 121 SER n 
1 122 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 NCAM1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Cell-free protein synthesis' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PK050314-05 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NCA11_HUMAN 
_struct_ref.pdbx_db_accession          P13591 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAAL
NGKGLGEISAASEFKTQPVQGEPSAPKLEG
;
_struct_ref.pdbx_align_begin           500 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2E3V A 8 ? 116 ? P13591 500 ? 609 ? 10 118 
2 1 2E3V B 8 ? 116 ? P13591 500 ? 609 ? 10 118 
3 1 2E3V C 8 ? 116 ? P13591 500 ? 609 ? 10 118 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2E3V GLY A 1   ? UNP P13591 ?   ?   'EXPRESSION TAG' 3   1  
1 2E3V SER A 2   ? UNP P13591 ?   ?   'EXPRESSION TAG' 4   2  
1 2E3V SER A 3   ? UNP P13591 ?   ?   'EXPRESSION TAG' 5   3  
1 2E3V GLY A 4   ? UNP P13591 ?   ?   'EXPRESSION TAG' 6   4  
1 2E3V SER A 5   ? UNP P13591 ?   ?   'EXPRESSION TAG' 7   5  
1 2E3V SER A 6   ? UNP P13591 ?   ?   'EXPRESSION TAG' 8   6  
1 2E3V GLY A 7   ? UNP P13591 ?   ?   'EXPRESSION TAG' 9   7  
1 2E3V ARG A 107 ? UNP P13591 GLN 599 'SEE REMARK 999' 109 8  
1 2E3V ARG A 107 ? UNP P13591 GLY 600 'SEE REMARK 999' 109 9  
1 2E3V SER A 117 ? UNP P13591 ?   ?   'EXPRESSION TAG' 119 10 
1 2E3V GLY A 118 ? UNP P13591 ?   ?   'EXPRESSION TAG' 120 11 
1 2E3V PRO A 119 ? UNP P13591 ?   ?   'EXPRESSION TAG' 121 12 
1 2E3V SER A 120 ? UNP P13591 ?   ?   'EXPRESSION TAG' 122 13 
1 2E3V SER A 121 ? UNP P13591 ?   ?   'EXPRESSION TAG' 123 14 
1 2E3V GLY A 122 ? UNP P13591 ?   ?   'EXPRESSION TAG' 124 15 
2 2E3V GLY B 1   ? UNP P13591 ?   ?   'EXPRESSION TAG' 3   16 
2 2E3V SER B 2   ? UNP P13591 ?   ?   'EXPRESSION TAG' 4   17 
2 2E3V SER B 3   ? UNP P13591 ?   ?   'EXPRESSION TAG' 5   18 
2 2E3V GLY B 4   ? UNP P13591 ?   ?   'EXPRESSION TAG' 6   19 
2 2E3V SER B 5   ? UNP P13591 ?   ?   'EXPRESSION TAG' 7   20 
2 2E3V SER B 6   ? UNP P13591 ?   ?   'EXPRESSION TAG' 8   21 
2 2E3V GLY B 7   ? UNP P13591 ?   ?   'EXPRESSION TAG' 9   22 
2 2E3V ARG B 107 ? UNP P13591 GLN 599 'SEE REMARK 999' 109 23 
2 2E3V ARG B 107 ? UNP P13591 GLY 600 'SEE REMARK 999' 109 24 
2 2E3V SER B 117 ? UNP P13591 ?   ?   'EXPRESSION TAG' 119 25 
2 2E3V GLY B 118 ? UNP P13591 ?   ?   'EXPRESSION TAG' 120 26 
2 2E3V PRO B 119 ? UNP P13591 ?   ?   'EXPRESSION TAG' 121 27 
2 2E3V SER B 120 ? UNP P13591 ?   ?   'EXPRESSION TAG' 122 28 
2 2E3V SER B 121 ? UNP P13591 ?   ?   'EXPRESSION TAG' 123 29 
2 2E3V GLY B 122 ? UNP P13591 ?   ?   'EXPRESSION TAG' 124 30 
3 2E3V GLY C 1   ? UNP P13591 ?   ?   'EXPRESSION TAG' 3   31 
3 2E3V SER C 2   ? UNP P13591 ?   ?   'EXPRESSION TAG' 4   32 
3 2E3V SER C 3   ? UNP P13591 ?   ?   'EXPRESSION TAG' 5   33 
3 2E3V GLY C 4   ? UNP P13591 ?   ?   'EXPRESSION TAG' 6   34 
3 2E3V SER C 5   ? UNP P13591 ?   ?   'EXPRESSION TAG' 7   35 
3 2E3V SER C 6   ? UNP P13591 ?   ?   'EXPRESSION TAG' 8   36 
3 2E3V GLY C 7   ? UNP P13591 ?   ?   'EXPRESSION TAG' 9   37 
3 2E3V ARG C 107 ? UNP P13591 GLN 599 'SEE REMARK 999' 109 38 
3 2E3V ARG C 107 ? UNP P13591 GLY 600 'SEE REMARK 999' 109 39 
3 2E3V SER C 117 ? UNP P13591 ?   ?   'EXPRESSION TAG' 119 40 
3 2E3V GLY C 118 ? UNP P13591 ?   ?   'EXPRESSION TAG' 120 41 
3 2E3V PRO C 119 ? UNP P13591 ?   ?   'EXPRESSION TAG' 121 42 
3 2E3V SER C 120 ? UNP P13591 ?   ?   'EXPRESSION TAG' 122 43 
3 2E3V SER C 121 ? UNP P13591 ?   ?   'EXPRESSION TAG' 123 44 
3 2E3V GLY C 122 ? UNP P13591 ?   ?   'EXPRESSION TAG' 124 45 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                            ?                 'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking' y ARGININE                                                           ?                 'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                         ?                 'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                    ?                 'C4 H7 N O4'     
133.103 
BTB non-polymer         . '2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL' 'BIS-TRIS BUFFER' 'C8 H19 N O5'    
209.240 
EDO non-polymer         . 1,2-ETHANEDIOL                                                     'ETHYLENE GLYCOL' 'C2 H6 O2'       
62.068  
GLN 'L-peptide linking' y GLUTAMINE                                                          ?                 'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                    ?                 'C5 H9 N O4'     
147.129 
GLY 'peptide linking'   y GLYCINE                                                            ?                 'C2 H5 N O2'     
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                          ?                 'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                                              ?                 'H2 O'           
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                         ?                 'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking' y LEUCINE                                                            ?                 'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking' y LYSINE                                                             ?                 'C6 H15 N2 O2 1' 
147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE                                                   ?                 'C5 H11 N O2 Se' 
196.106 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER'                                            ?                 'C4 H10 O3'      
106.120 
PGE non-polymer         . 'TRIETHYLENE GLYCOL'                                               ?                 'C6 H14 O4'      
150.173 
PHE 'L-peptide linking' y PHENYLALANINE                                                      ?                 'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking' y PROLINE                                                            ?                 'C5 H9 N O2'     
115.130 
SER 'L-peptide linking' y SERINE                                                             ?                 'C3 H7 N O3'     
105.093 
THR 'L-peptide linking' y THREONINE                                                          ?                 'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                         ?                 'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking' y TYROSINE                                                           ?                 'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking' y VALINE                                                             ?                 'C5 H11 N O2'    
117.146 
# 
_exptl.entry_id          2E3V 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.73 
_exptl_crystal.density_percent_sol   54.92 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    '22-25% PEG 3350, 0.1M Bis-Tris-HCl, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1   100 ? 1 
2   100 ? 1 
1,2 ?   ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'RIGAKU JUPITER 210'   2006-10-03 mirrors 
2 CCD 'MARMOSAIC 300 mm CCD' 2006-10-11 mirrors 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M Si       MAD                 x-ray 
2 1 M 'Si 220' 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.979274 1.0 
2 0.979740 1.0 
3 0.964000 1.0 
4 0.97105  1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'SPRING-8 BEAMLINE BL26B2' SPring-8 BL26B2 ? '0.979274, 0.979740, 0.964000' 
2 SYNCHROTRON 'APS BEAMLINE 22-ID'       APS      22-ID  ? 0.97105                        
# 
_reflns.entry_id                     2E3V 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.d_resolution_high            1.95 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   ? 
_reflns.number_obs                   29327 
_reflns.percent_possible_obs         98.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.073 
_reflns.pdbx_netI_over_sigmaI        36.1 
_reflns.B_iso_Wilson_estimate        16.1 
_reflns.pdbx_redundancy              10.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
_reflns_shell.d_res_high             1.95 
_reflns_shell.d_res_low              1.98 
_reflns_shell.percent_possible_all   80.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.387 
_reflns_shell.meanI_over_sigI_obs    3.38 
_reflns_shell.pdbx_redundancy        4.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1248 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1,2 
# 
_refine.entry_id                                 2E3V 
_refine.ls_number_reflns_obs                     27783 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    98.50 
_refine.ls_R_factor_obs                          0.183 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.182 
_refine.ls_R_factor_R_free                       0.211 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1500 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.963 
_refine.correlation_coeff_Fo_to_Fc_free          0.949 
_refine.B_iso_mean                               41.2 
_refine.aniso_B[1][1]                            0.16 
_refine.aniso_B[2][2]                            0.16 
_refine.aniso_B[3][3]                            -0.25 
_refine.aniso_B[1][2]                            0.08 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.140 
_refine.pdbx_overall_ESU_R_Free                  0.128 
_refine.overall_SU_ML                            0.091 
_refine.overall_SU_B                             6.061 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2278 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         65 
_refine_hist.number_atoms_solvent             233 
_refine_hist.number_atoms_total               2576 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.022  ? 2405 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.275  1.977  ? 3252 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.568  5.000  ? 296  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.074 25.269 ? 93   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       9.976  15.000 ? 369  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       5.987  15.000 ? 7    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.072  0.200  ? 353  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 1797 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.191  0.200  ? 1240 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.300  0.200  ? 1665 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.113  0.200  ? 247  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.211  0.200  ? 61   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.145  0.200  ? 22   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.627  1.500  ? 1545 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.791  2.000  ? 2426 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.283  3.000  ? 1002 'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.974  4.500  ? 826  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.950 
_refine_ls_shell.d_res_low                        2.001 
_refine_ls_shell.number_reflns_R_work             1748 
_refine_ls_shell.R_factor_R_work                  0.227 
_refine_ls_shell.percent_reflns_obs               83.13 
_refine_ls_shell.R_factor_R_free                  0.251 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             95 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                1748 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2E3V 
_struct.title                     
;Crystal structure of the first fibronectin type III domain of neural cell adhesion molecule splicing isoform from human muscle culture lambda-4.4
;
_struct.pdbx_descriptor           'Neural cell adhesion molecule 1, 140 kDa isoform' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2E3V 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            
;NCAM, N-CAM 1, NCAM-120, CD56 antigen, Cell adhesion, membrane protein, Glycoprotein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 2 ? 
I N N 5 ? 
J N N 4 ? 
K N N 2 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 60 ? MSE A 65 ? ALA A 62 MSE A 67 1 ? 6 
HELX_P HELX_P2 2 ALA B 60 ? MSE B 65 ? ALA B 62 MSE B 67 1 ? 6 
HELX_P HELX_P3 3 ALA C 60 ? MSE C 65 ? ALA C 62 MSE C 67 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A SER 64 C ? ? ? 1_555 A MSE 65 N ? ? A SER 66 A MSE 67 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale2 covale ? ? A MSE 65 C ? ? ? 1_555 A GLU 66 N ? ? A MSE 67 A GLU 68 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale3 covale ? ? B SER 64 C ? ? ? 1_555 B MSE 65 N ? ? B SER 66 B MSE 67 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale4 covale ? ? B MSE 65 C ? ? ? 1_555 B GLU 66 N ? ? B MSE 67 B GLU 68 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale5 covale ? ? C SER 64 C ? ? ? 1_555 C MSE 65 N ? ? C SER 66 C MSE 67 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale6 covale ? ? C MSE 65 C ? ? ? 1_555 C GLU 66 N ? ? C MSE 67 C GLU 68 1_555 ? ? ? ? ? ? ? 1.328 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 4 ? 
D ? 3 ? 
E ? 4 ? 
F ? 4 ? 
G ? 3 ? 
H ? 4 ? 
I ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 12 ? PRO A 18  ? SER A 14  PRO A 20  
A 2 ALA A 23 ? ASP A 28  ? ALA A 25  ASP A 30  
A 3 ILE A 68 ? ILE A 71  ? ILE A 70  ILE A 73  
B 1 HIS A 54 ? ASP A 59  ? HIS A 56  ASP A 61  
B 2 ILE A 38 ? ALA A 47  ? ILE A 40  ALA A 49  
B 3 THR A 79 ? ASN A 88  ? THR A 81  ASN A 90  
B 4 GLY A 91 ? LEU A 92  ? GLY A 93  LEU A 94  
C 1 HIS A 54 ? ASP A 59  ? HIS A 56  ASP A 61  
C 2 ILE A 38 ? ALA A 47  ? ILE A 40  ALA A 49  
C 3 THR A 79 ? ASN A 88  ? THR A 81  ASN A 90  
C 4 SER A 99 ? LYS A 102 ? SER A 101 LYS A 104 
D 1 SER B 12 ? PRO B 18  ? SER B 14  PRO B 20  
D 2 ALA B 23 ? ASP B 28  ? ALA B 25  ASP B 30  
D 3 ILE B 68 ? ILE B 71  ? ILE B 70  ILE B 73  
E 1 HIS B 54 ? ASP B 59  ? HIS B 56  ASP B 61  
E 2 LYS B 40 ? ALA B 47  ? LYS B 42  ALA B 49  
E 3 THR B 79 ? ASN B 88  ? THR B 81  ASN B 90  
E 4 GLY B 91 ? LEU B 92  ? GLY B 93  LEU B 94  
F 1 HIS B 54 ? ASP B 59  ? HIS B 56  ASP B 61  
F 2 LYS B 40 ? ALA B 47  ? LYS B 42  ALA B 49  
F 3 THR B 79 ? ASN B 88  ? THR B 81  ASN B 90  
F 4 SER B 99 ? LYS B 102 ? SER B 101 LYS B 104 
G 1 SER C 12 ? PRO C 18  ? SER C 14  PRO C 20  
G 2 THR C 22 ? ASP C 28  ? THR C 24  ASP C 30  
G 3 ILE C 68 ? VAL C 72  ? ILE C 70  VAL C 74  
H 1 HIS C 54 ? ASP C 59  ? HIS C 56  ASP C 61  
H 2 LYS C 40 ? ALA C 47  ? LYS C 42  ALA C 49  
H 3 THR C 79 ? ASN C 88  ? THR C 81  ASN C 90  
H 4 GLY C 91 ? LEU C 92  ? GLY C 93  LEU C 94  
I 1 HIS C 54 ? ASP C 59  ? HIS C 56  ASP C 61  
I 2 LYS C 40 ? ALA C 47  ? LYS C 42  ALA C 49  
I 3 THR C 79 ? ASN C 88  ? THR C 81  ASN C 90  
I 4 SER C 99 ? LYS C 102 ? SER C 101 LYS C 104 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 15 ? N GLN A 17 O GLN A 26 ? O GLN A 28  
A 2 3 N VAL A 25 ? N VAL A 27 O VAL A 69 ? O VAL A 71  
B 1 2 O HIS A 54 ? O HIS A 56 N TRP A 45 ? N TRP A 47  
B 2 3 N LEU A 39 ? N LEU A 41 O LEU A 87 ? O LEU A 89  
B 3 4 N ASN A 88 ? N ASN A 90 O GLY A 91 ? O GLY A 93  
C 1 2 O HIS A 54 ? O HIS A 56 N TRP A 45 ? N TRP A 47  
C 2 3 N LEU A 39 ? N LEU A 41 O LEU A 87 ? O LEU A 89  
C 3 4 N VAL A 82 ? N VAL A 84 O SER A 99 ? O SER A 101 
D 1 2 N GLN B 15 ? N GLN B 17 O GLN B 26 ? O GLN B 28  
D 2 3 N VAL B 25 ? N VAL B 27 O VAL B 69 ? O VAL B 71  
E 1 2 O HIS B 54 ? O HIS B 56 N TRP B 45 ? N TRP B 47  
E 2 3 N LYS B 40 ? N LYS B 42 O LEU B 87 ? O LEU B 89  
E 3 4 N ASN B 88 ? N ASN B 90 O GLY B 91 ? O GLY B 93  
F 1 2 O HIS B 54 ? O HIS B 56 N TRP B 45 ? N TRP B 47  
F 2 3 N LYS B 40 ? N LYS B 42 O LEU B 87 ? O LEU B 89  
F 3 4 N VAL B 82 ? N VAL B 84 O SER B 99 ? O SER B 101 
G 1 2 N GLN C 15 ? N GLN C 17 O GLN C 26 ? O GLN C 28  
G 2 3 N VAL C 25 ? N VAL C 27 O VAL C 69 ? O VAL C 71  
H 1 2 O HIS C 54 ? O HIS C 56 N TRP C 45 ? N TRP C 47  
H 2 3 N LYS C 40 ? N LYS C 42 O LEU C 87 ? O LEU C 89  
H 3 4 N ASN C 88 ? N ASN C 90 O GLY C 91 ? O GLY C 93  
I 1 2 O HIS C 54 ? O HIS C 56 N TRP C 45 ? N TRP C 47  
I 2 3 N LYS C 40 ? N LYS C 42 O LEU C 87 ? O LEU C 89  
I 3 4 N VAL C 82 ? N VAL C 84 O SER C 99 ? O SER C 101 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO C 1001' 
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE PGE B 1006' 
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE PGE B 1007' 
AC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE BTB C 1008' 
AC5 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE BTB B 1009' 
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE PEG C 1003' 
AC7 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE PEG A 1004' 
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE PEG B 1005' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ILE C 38  ? ILE C 40   . ? 1_555 ? 
2  AC1 4  ALA C 60  ? ALA C 62   . ? 1_555 ? 
3  AC1 4  LYS C 61  ? LYS C 63   . ? 1_555 ? 
4  AC1 4  SER C 64  ? SER C 66   . ? 1_555 ? 
5  AC2 8  VAL A 48  ? VAL A 50   . ? 2_655 ? 
6  AC2 8  HOH L .   ? HOH A 1092 . ? 2_655 ? 
7  AC2 8  ARG B 46  ? ARG B 48   . ? 1_555 ? 
8  AC2 8  TYR B 80  ? TYR B 82   . ? 1_555 ? 
9  AC2 8  ALA B 81  ? ALA B 83   . ? 1_555 ? 
10 AC2 8  ALA B 98  ? ALA B 100  . ? 1_555 ? 
11 AC2 8  GLU B 100 ? GLU B 102  . ? 1_555 ? 
12 AC2 8  HOH M .   ? HOH B 1038 . ? 1_555 ? 
13 AC3 8  ALA A 98  ? ALA A 100  . ? 2_655 ? 
14 AC3 8  GLU A 100 ? GLU A 102  . ? 2_655 ? 
15 AC3 8  ALA B 47  ? ALA B 49   . ? 1_555 ? 
16 AC3 8  VAL B 48  ? VAL B 50   . ? 1_555 ? 
17 AC3 8  GLY B 49  ? GLY B 51   . ? 1_555 ? 
18 AC3 8  LYS B 75  ? LYS B 77   . ? 1_555 ? 
19 AC3 8  THR B 78  ? THR B 80   . ? 1_555 ? 
20 AC3 8  HOH M .   ? HOH B 1060 . ? 1_555 ? 
21 AC4 12 LYS A 56  ? LYS A 58   . ? 1_445 ? 
22 AC4 12 HOH L .   ? HOH A 1090 . ? 1_445 ? 
23 AC4 12 PHE C 27  ? PHE C 29   . ? 1_555 ? 
24 AC4 12 GLU C 29  ? GLU C 31   . ? 1_555 ? 
25 AC4 12 PRO C 30  ? PRO C 32   . ? 1_555 ? 
26 AC4 12 GLU C 31  ? GLU C 33   . ? 1_555 ? 
27 AC4 12 ALA C 32  ? ALA C 34   . ? 1_555 ? 
28 AC4 12 ILE C 38  ? ILE C 40   . ? 1_555 ? 
29 AC4 12 TYR C 41  ? TYR C 43   . ? 1_555 ? 
30 AC4 12 SER C 64  ? SER C 66   . ? 1_555 ? 
31 AC4 12 GLY C 67  ? GLY C 69   . ? 1_555 ? 
32 AC4 12 HOH N .   ? HOH C 1061 . ? 1_555 ? 
33 AC5 8  GLN A 15  ? GLN A 17   . ? 1_555 ? 
34 AC5 8  GLU A 17  ? GLU A 19   . ? 1_555 ? 
35 AC5 8  GLN A 26  ? GLN A 28   . ? 1_555 ? 
36 AC5 8  LYS B 42  ? LYS B 44   . ? 1_555 ? 
37 AC5 8  GLU B 44  ? GLU B 46   . ? 1_555 ? 
38 AC5 8  TRP B 53  ? TRP B 55   . ? 1_555 ? 
39 AC5 8  SER B 55  ? SER B 57   . ? 1_555 ? 
40 AC5 8  HOH M .   ? HOH B 1093 . ? 1_555 ? 
41 AC6 5  GLY A 73  ? GLY A 75   . ? 1_445 ? 
42 AC6 5  LYS C 61  ? LYS C 63   . ? 1_555 ? 
43 AC6 5  GLU C 62  ? GLU C 64   . ? 1_555 ? 
44 AC6 5  SER C 64  ? SER C 66   . ? 1_555 ? 
45 AC6 5  MSE C 65  ? MSE C 67   . ? 1_555 ? 
46 AC7 10 PHE A 27  ? PHE A 29   . ? 1_555 ? 
47 AC7 10 ASP A 28  ? ASP A 30   . ? 1_555 ? 
48 AC7 10 GLU A 29  ? GLU A 31   . ? 1_555 ? 
49 AC7 10 PRO A 30  ? PRO A 32   . ? 1_555 ? 
50 AC7 10 GLU A 31  ? GLU A 33   . ? 1_555 ? 
51 AC7 10 TYR A 41  ? TYR A 43   . ? 1_555 ? 
52 AC7 10 GLY A 67  ? GLY A 69   . ? 1_555 ? 
53 AC7 10 HOH L .   ? HOH A 1049 . ? 1_555 ? 
54 AC7 10 LYS B 56  ? LYS B 58   . ? 1_555 ? 
55 AC7 10 HOH M .   ? HOH B 1030 . ? 1_555 ? 
56 AC8 5  HOH L .   ? HOH A 1093 . ? 1_555 ? 
57 AC8 5  LEU B 39  ? LEU B 41   . ? 1_555 ? 
58 AC8 5  LYS B 40  ? LYS B 42   . ? 1_555 ? 
59 AC8 5  ASN B 88  ? ASN B 90   . ? 1_555 ? 
60 AC8 5  HOH M .   ? HOH B 1090 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2E3V 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2E3V 
_atom_sites.fract_transf_matrix[1][1]   0.018058 
_atom_sites.fract_transf_matrix[1][2]   0.010426 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020851 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008415 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 6   ? 47.020 5.324   30.622 1.00 42.74 ? 8    SER A N   1 
ATOM   2    C  CA  . SER A 1 6   ? 47.132 6.793   30.374 1.00 42.73 ? 8    SER A CA  1 
ATOM   3    C  C   . SER A 1 6   ? 46.273 7.616   31.340 1.00 42.57 ? 8    SER A C   1 
ATOM   4    O  O   . SER A 1 6   ? 46.461 8.831   31.464 1.00 42.77 ? 8    SER A O   1 
ATOM   5    C  CB  . SER A 1 6   ? 46.766 7.124   28.923 1.00 42.82 ? 8    SER A CB  1 
ATOM   6    O  OG  . SER A 1 6   ? 45.420 6.775   28.641 1.00 42.95 ? 8    SER A OG  1 
ATOM   7    N  N   . GLY A 1 7   ? 45.337 6.950   32.019 1.00 42.23 ? 9    GLY A N   1 
ATOM   8    C  CA  . GLY A 1 7   ? 44.452 7.608   32.981 1.00 41.71 ? 9    GLY A CA  1 
ATOM   9    C  C   . GLY A 1 7   ? 43.201 6.806   33.297 1.00 41.31 ? 9    GLY A C   1 
ATOM   10   O  O   . GLY A 1 7   ? 42.955 5.769   32.677 1.00 41.45 ? 9    GLY A O   1 
ATOM   11   N  N   . PRO A 1 8   ? 42.399 7.278   34.272 1.00 40.94 ? 10   PRO A N   1 
ATOM   12   C  CA  . PRO A 1 8   ? 41.153 6.604   34.649 1.00 40.63 ? 10   PRO A CA  1 
ATOM   13   C  C   . PRO A 1 8   ? 40.046 6.876   33.636 1.00 40.48 ? 10   PRO A C   1 
ATOM   14   O  O   . PRO A 1 8   ? 40.176 7.784   32.817 1.00 40.22 ? 10   PRO A O   1 
ATOM   15   C  CB  . PRO A 1 8   ? 40.786 7.244   35.998 1.00 40.75 ? 10   PRO A CB  1 
ATOM   16   C  CG  . PRO A 1 8   ? 41.853 8.237   36.311 1.00 40.53 ? 10   PRO A CG  1 
ATOM   17   C  CD  . PRO A 1 8   ? 42.630 8.493   35.069 1.00 40.82 ? 10   PRO A CD  1 
ATOM   18   N  N   . SER A 1 9   ? 38.967 6.098   33.696 1.00 40.28 ? 11   SER A N   1 
ATOM   19   C  CA  . SER A 1 9   ? 37.840 6.292   32.785 1.00 40.44 ? 11   SER A CA  1 
ATOM   20   C  C   . SER A 1 9   ? 37.170 7.646   33.028 1.00 40.18 ? 11   SER A C   1 
ATOM   21   O  O   . SER A 1 9   ? 37.337 8.259   34.096 1.00 39.65 ? 11   SER A O   1 
ATOM   22   C  CB  . SER A 1 9   ? 36.845 5.118   32.854 1.00 40.81 ? 11   SER A CB  1 
ATOM   23   O  OG  . SER A 1 9   ? 36.439 4.845   34.181 1.00 42.50 ? 11   SER A OG  1 
ATOM   24   N  N   . SER A 1 10  ? 36.446 8.136   32.030 1.00 39.67 ? 12   SER A N   1 
ATOM   25   C  CA  . SER A 1 10  ? 35.810 9.435   32.170 1.00 39.86 ? 12   SER A CA  1 
ATOM   26   C  C   . SER A 1 10  ? 34.633 9.357   33.135 1.00 39.18 ? 12   SER A C   1 
ATOM   27   O  O   . SER A 1 10  ? 33.889 8.369   33.137 1.00 39.45 ? 12   SER A O   1 
ATOM   28   C  CB  . SER A 1 10  ? 35.363 9.982   30.814 1.00 39.99 ? 12   SER A CB  1 
ATOM   29   O  OG  . SER A 1 10  ? 34.417 9.130   30.213 1.00 42.41 ? 12   SER A OG  1 
ATOM   30   N  N   . PRO A 1 11  ? 34.498 10.372  34.004 1.00 38.74 ? 13   PRO A N   1 
ATOM   31   C  CA  . PRO A 1 11  ? 33.327 10.455  34.862 1.00 38.23 ? 13   PRO A CA  1 
ATOM   32   C  C   . PRO A 1 11  ? 32.055 10.573  34.026 1.00 37.94 ? 13   PRO A C   1 
ATOM   33   O  O   . PRO A 1 11  ? 32.108 10.913  32.833 1.00 37.61 ? 13   PRO A O   1 
ATOM   34   C  CB  . PRO A 1 11  ? 33.556 11.759  35.632 1.00 38.10 ? 13   PRO A CB  1 
ATOM   35   C  CG  . PRO A 1 11  ? 35.025 11.975  35.602 1.00 38.73 ? 13   PRO A CG  1 
ATOM   36   C  CD  . PRO A 1 11  ? 35.459 11.458  34.270 1.00 38.28 ? 13   PRO A CD  1 
ATOM   37   N  N   . SER A 1 12  ? 30.928 10.287  34.654 1.00 36.99 ? 14   SER A N   1 
ATOM   38   C  CA  . SER A 1 12  ? 29.636 10.464  34.026 1.00 36.76 ? 14   SER A CA  1 
ATOM   39   C  C   . SER A 1 12  ? 28.894 11.491  34.857 1.00 36.33 ? 14   SER A C   1 
ATOM   40   O  O   . SER A 1 12  ? 28.639 11.254  36.038 1.00 35.50 ? 14   SER A O   1 
ATOM   41   C  CB  . SER A 1 12  ? 28.871 9.134   33.998 1.00 36.88 ? 14   SER A CB  1 
ATOM   42   O  OG  . SER A 1 12  ? 27.502 9.334   33.677 1.00 38.76 ? 14   SER A OG  1 
ATOM   43   N  N   . ILE A 1 13  ? 28.562 12.632  34.252 1.00 36.08 ? 15   ILE A N   1 
ATOM   44   C  CA  . ILE A 1 13  ? 27.805 13.674  34.956 1.00 35.72 ? 15   ILE A CA  1 
ATOM   45   C  C   . ILE A 1 13  ? 26.353 13.209  35.033 1.00 35.75 ? 15   ILE A C   1 
ATOM   46   O  O   . ILE A 1 13  ? 25.751 12.867  34.011 1.00 35.02 ? 15   ILE A O   1 
ATOM   47   C  CB  . ILE A 1 13  ? 27.939 15.061  34.283 1.00 35.98 ? 15   ILE A CB  1 
ATOM   48   C  CG1 . ILE A 1 13  ? 29.404 15.512  34.335 1.00 35.00 ? 15   ILE A CG1 1 
ATOM   49   C  CG2 . ILE A 1 13  ? 27.021 16.098  34.978 1.00 35.91 ? 15   ILE A CG2 1 
ATOM   50   C  CD1 . ILE A 1 13  ? 29.731 16.736  33.483 1.00 36.12 ? 15   ILE A CD1 1 
ATOM   51   N  N   . ASP A 1 14  ? 25.811 13.174  36.250 1.00 34.96 ? 16   ASP A N   1 
ATOM   52   C  CA  . ASP A 1 14  ? 24.485 12.600  36.484 1.00 35.68 ? 16   ASP A CA  1 
ATOM   53   C  C   . ASP A 1 14  ? 23.427 13.576  36.944 1.00 35.44 ? 16   ASP A C   1 
ATOM   54   O  O   . ASP A 1 14  ? 22.226 13.322  36.804 1.00 35.08 ? 16   ASP A O   1 
ATOM   55   C  CB  . ASP A 1 14  ? 24.616 11.477  37.509 1.00 35.43 ? 16   ASP A CB  1 
ATOM   56   C  CG  . ASP A 1 14  ? 25.473 10.348  36.999 1.00 36.77 ? 16   ASP A CG  1 
ATOM   57   O  OD1 . ASP A 1 14  ? 25.360 10.022  35.797 1.00 35.31 ? 16   ASP A OD1 1 
ATOM   58   O  OD2 . ASP A 1 14  ? 26.270 9.806   37.785 1.00 37.42 ? 16   ASP A OD2 1 
ATOM   59   N  N   . GLN A 1 15  ? 23.880 14.671  37.533 1.00 35.57 ? 17   GLN A N   1 
ATOM   60   C  CA  . GLN A 1 15  ? 22.984 15.686  38.042 1.00 36.22 ? 17   GLN A CA  1 
ATOM   61   C  C   . GLN A 1 15  ? 23.749 16.983  38.249 1.00 36.35 ? 17   GLN A C   1 
ATOM   62   O  O   . GLN A 1 15  ? 24.841 16.989  38.830 1.00 36.68 ? 17   GLN A O   1 
ATOM   63   C  CB  . GLN A 1 15  ? 22.364 15.232  39.363 1.00 35.78 ? 17   GLN A CB  1 
ATOM   64   C  CG  . GLN A 1 15  ? 21.394 16.236  39.966 1.00 36.61 ? 17   GLN A CG  1 
ATOM   65   C  CD  . GLN A 1 15  ? 20.783 15.766  41.261 1.00 36.56 ? 17   GLN A CD  1 
ATOM   66   O  OE1 . GLN A 1 15  ? 21.111 14.691  41.779 1.00 36.45 ? 17   GLN A OE1 1 
ATOM   67   N  NE2 . GLN A 1 15  ? 19.875 16.573  41.800 1.00 37.20 ? 17   GLN A NE2 1 
ATOM   68   N  N   . VAL A 1 16  ? 23.181 18.077  37.756 1.00 36.34 ? 18   VAL A N   1 
ATOM   69   C  CA  . VAL A 1 16  ? 23.731 19.388  38.033 1.00 37.01 ? 18   VAL A CA  1 
ATOM   70   C  C   . VAL A 1 16  ? 22.667 20.197  38.746 1.00 37.05 ? 18   VAL A C   1 
ATOM   71   O  O   . VAL A 1 16  ? 21.511 20.237  38.311 1.00 36.64 ? 18   VAL A O   1 
ATOM   72   C  CB  . VAL A 1 16  ? 24.191 20.132  36.753 1.00 37.23 ? 18   VAL A CB  1 
ATOM   73   C  CG1 . VAL A 1 16  ? 24.744 21.505  37.102 1.00 37.93 ? 18   VAL A CG1 1 
ATOM   74   C  CG2 . VAL A 1 16  ? 25.242 19.316  36.014 1.00 38.61 ? 18   VAL A CG2 1 
ATOM   75   N  N   . GLU A 1 17  ? 23.060 20.809  39.861 1.00 36.93 ? 19   GLU A N   1 
ATOM   76   C  CA  . GLU A 1 17  ? 22.194 21.731  40.559 1.00 37.05 ? 19   GLU A CA  1 
ATOM   77   C  C   . GLU A 1 17  ? 22.751 23.128  40.361 1.00 36.94 ? 19   GLU A C   1 
ATOM   78   O  O   . GLU A 1 17  ? 23.751 23.490  40.984 1.00 36.84 ? 19   GLU A O   1 
ATOM   79   C  CB  . GLU A 1 17  ? 22.036 21.375  42.049 1.00 37.38 ? 19   GLU A CB  1 
ATOM   80   C  CG  . GLU A 1 17  ? 21.262 20.075  42.271 1.00 38.66 ? 19   GLU A CG  1 
ATOM   81   C  CD  A GLU A 1 17  ? 19.884 20.079  41.614 0.50 40.18 ? 19   GLU A CD  1 
ATOM   82   C  CD  B GLU A 1 17  ? 20.407 20.112  43.529 0.50 38.92 ? 19   GLU A CD  1 
ATOM   83   O  OE1 A GLU A 1 17  ? 19.129 21.059  41.803 0.50 41.26 ? 19   GLU A OE1 1 
ATOM   84   O  OE1 B GLU A 1 17  ? 20.872 20.621  44.575 0.50 38.70 ? 19   GLU A OE1 1 
ATOM   85   O  OE2 A GLU A 1 17  ? 19.555 19.100  40.907 0.50 40.21 ? 19   GLU A OE2 1 
ATOM   86   O  OE2 B GLU A 1 17  ? 19.258 19.629  43.466 0.50 39.61 ? 19   GLU A OE2 1 
ATOM   87   N  N   . PRO A 1 18  ? 22.129 23.901  39.453 1.00 36.91 ? 20   PRO A N   1 
ATOM   88   C  CA  . PRO A 1 18  ? 22.613 25.243  39.215 1.00 36.60 ? 20   PRO A CA  1 
ATOM   89   C  C   . PRO A 1 18  ? 21.990 26.276  40.150 1.00 36.65 ? 20   PRO A C   1 
ATOM   90   O  O   . PRO A 1 18  ? 20.820 26.163  40.529 1.00 36.11 ? 20   PRO A O   1 
ATOM   91   C  CB  . PRO A 1 18  ? 22.188 25.508  37.771 1.00 36.88 ? 20   PRO A CB  1 
ATOM   92   C  CG  . PRO A 1 18  ? 20.928 24.734  37.600 1.00 36.72 ? 20   PRO A CG  1 
ATOM   93   C  CD  . PRO A 1 18  ? 20.970 23.573  38.594 1.00 36.94 ? 20   PRO A CD  1 
ATOM   94   N  N   . TYR A 1 19  ? 22.796 27.256  40.536 1.00 36.43 ? 21   TYR A N   1 
ATOM   95   C  CA  . TYR A 1 19  ? 22.325 28.392  41.305 1.00 36.64 ? 21   TYR A CA  1 
ATOM   96   C  C   . TYR A 1 19  ? 22.564 29.602  40.418 1.00 36.16 ? 21   TYR A C   1 
ATOM   97   O  O   . TYR A 1 19  ? 22.623 29.437  39.205 1.00 36.00 ? 21   TYR A O   1 
ATOM   98   C  CB  . TYR A 1 19  ? 23.014 28.440  42.665 1.00 37.53 ? 21   TYR A CB  1 
ATOM   99   C  CG  . TYR A 1 19  ? 22.694 27.181  43.438 1.00 38.16 ? 21   TYR A CG  1 
ATOM   100  C  CD1 . TYR A 1 19  ? 21.504 27.070  44.151 1.00 38.92 ? 21   TYR A CD1 1 
ATOM   101  C  CD2 . TYR A 1 19  ? 23.550 26.080  43.402 1.00 38.82 ? 21   TYR A CD2 1 
ATOM   102  C  CE1 . TYR A 1 19  ? 21.185 25.904  44.840 1.00 39.78 ? 21   TYR A CE1 1 
ATOM   103  C  CE2 . TYR A 1 19  ? 23.241 24.907  44.085 1.00 39.85 ? 21   TYR A CE2 1 
ATOM   104  C  CZ  . TYR A 1 19  ? 22.056 24.831  44.806 1.00 40.00 ? 21   TYR A CZ  1 
ATOM   105  O  OH  . TYR A 1 19  ? 21.737 23.683  45.499 1.00 40.86 ? 21   TYR A OH  1 
ATOM   106  N  N   . SER A 1 20  ? 22.679 30.803  40.971 1.00 35.94 ? 22   SER A N   1 
ATOM   107  C  CA  . SER A 1 20  ? 22.831 31.976  40.109 1.00 35.83 ? 22   SER A CA  1 
ATOM   108  C  C   . SER A 1 20  ? 24.261 32.195  39.582 1.00 35.65 ? 22   SER A C   1 
ATOM   109  O  O   . SER A 1 20  ? 24.438 32.565  38.424 1.00 35.44 ? 22   SER A O   1 
ATOM   110  C  CB  . SER A 1 20  ? 22.244 33.240  40.753 1.00 35.89 ? 22   SER A CB  1 
ATOM   111  O  OG  . SER A 1 20  ? 22.839 33.529  42.004 1.00 37.44 ? 22   SER A OG  1 
ATOM   112  N  N   . SER A 1 21  ? 25.270 31.961  40.414 1.00 35.25 ? 23   SER A N   1 
ATOM   113  C  CA  . SER A 1 21  ? 26.659 32.158  39.990 1.00 35.24 ? 23   SER A CA  1 
ATOM   114  C  C   . SER A 1 21  ? 27.508 30.907  40.208 1.00 35.12 ? 23   SER A C   1 
ATOM   115  O  O   . SER A 1 21  ? 28.729 30.914  39.996 1.00 34.62 ? 23   SER A O   1 
ATOM   116  C  CB  . SER A 1 21  ? 27.282 33.370  40.704 1.00 35.29 ? 23   SER A CB  1 
ATOM   117  O  OG  . SER A 1 21  ? 27.523 33.096  42.076 1.00 35.88 ? 23   SER A OG  1 
ATOM   118  N  N   . THR A 1 22  ? 26.852 29.834  40.636 1.00 35.13 ? 24   THR A N   1 
ATOM   119  C  CA  . THR A 1 22  ? 27.533 28.587  40.932 1.00 35.53 ? 24   THR A CA  1 
ATOM   120  C  C   . THR A 1 22  ? 26.703 27.412  40.439 1.00 35.65 ? 24   THR A C   1 
ATOM   121  O  O   . THR A 1 22  ? 25.500 27.551  40.180 1.00 35.53 ? 24   THR A O   1 
ATOM   122  C  CB  . THR A 1 22  ? 27.789 28.391  42.454 1.00 35.50 ? 24   THR A CB  1 
ATOM   123  O  OG1 . THR A 1 22  ? 26.540 28.257  43.140 1.00 36.78 ? 24   THR A OG1 1 
ATOM   124  C  CG2 . THR A 1 22  ? 28.596 29.536  43.065 1.00 36.85 ? 24   THR A CG2 1 
ATOM   125  N  N   . ALA A 1 23  ? 27.361 26.263  40.295 1.00 35.78 ? 25   ALA A N   1 
ATOM   126  C  CA  . ALA A 1 23  ? 26.695 25.029  39.914 1.00 36.40 ? 25   ALA A CA  1 
ATOM   127  C  C   . ALA A 1 23  ? 27.369 23.846  40.590 1.00 36.64 ? 25   ALA A C   1 
ATOM   128  O  O   . ALA A 1 23  ? 28.599 23.723  40.590 1.00 36.88 ? 25   ALA A O   1 
ATOM   129  C  CB  . ALA A 1 23  ? 26.709 24.848  38.413 1.00 36.07 ? 25   ALA A CB  1 
ATOM   130  N  N   . GLN A 1 24  ? 26.555 22.986  41.176 1.00 36.89 ? 26   GLN A N   1 
ATOM   131  C  CA  . GLN A 1 24  ? 27.067 21.778  41.799 1.00 37.45 ? 26   GLN A CA  1 
ATOM   132  C  C   . GLN A 1 24  ? 26.907 20.673  40.785 1.00 37.36 ? 26   GLN A C   1 
ATOM   133  O  O   . GLN A 1 24  ? 25.793 20.402  40.327 1.00 38.30 ? 26   GLN A O   1 
ATOM   134  C  CB  . GLN A 1 24  ? 26.314 21.472  43.085 1.00 37.48 ? 26   GLN A CB  1 
ATOM   135  C  CG  . GLN A 1 24  ? 26.627 22.447  44.222 1.00 40.83 ? 26   GLN A CG  1 
ATOM   136  C  CD  . GLN A 1 24  ? 25.949 22.030  45.500 1.00 44.53 ? 26   GLN A CD  1 
ATOM   137  O  OE1 . GLN A 1 24  ? 24.748 21.743  45.514 1.00 46.35 ? 26   GLN A OE1 1 
ATOM   138  N  NE2 . GLN A 1 24  ? 26.715 21.968  46.585 1.00 46.73 ? 26   GLN A NE2 1 
ATOM   139  N  N   . VAL A 1 25  ? 28.024 20.060  40.409 1.00 37.05 ? 27   VAL A N   1 
ATOM   140  C  CA  . VAL A 1 25  ? 28.023 19.035  39.373 1.00 36.82 ? 27   VAL A CA  1 
ATOM   141  C  C   . VAL A 1 25  ? 28.316 17.684  40.002 1.00 36.58 ? 27   VAL A C   1 
ATOM   142  O  O   . VAL A 1 25  ? 29.414 17.471  40.531 1.00 36.53 ? 27   VAL A O   1 
ATOM   143  C  CB  . VAL A 1 25  ? 29.085 19.323  38.282 1.00 36.67 ? 27   VAL A CB  1 
ATOM   144  C  CG1 . VAL A 1 25  ? 29.096 18.202  37.240 1.00 37.87 ? 27   VAL A CG1 1 
ATOM   145  C  CG2 . VAL A 1 25  ? 28.821 20.688  37.616 1.00 37.46 ? 27   VAL A CG2 1 
ATOM   146  N  N   . GLN A 1 26  ? 27.328 16.792  39.956 1.00 36.25 ? 28   GLN A N   1 
ATOM   147  C  CA  . GLN A 1 26  ? 27.484 15.442  40.477 1.00 35.71 ? 28   GLN A CA  1 
ATOM   148  C  C   . GLN A 1 26  ? 27.717 14.443  39.376 1.00 35.86 ? 28   GLN A C   1 
ATOM   149  O  O   . GLN A 1 26  ? 27.052 14.462  38.337 1.00 35.00 ? 28   GLN A O   1 
ATOM   150  C  CB  . GLN A 1 26  ? 26.304 15.009  41.334 1.00 36.11 ? 28   GLN A CB  1 
ATOM   151  C  CG  . GLN A 1 26  ? 26.432 15.449  42.785 1.00 35.89 ? 28   GLN A CG  1 
ATOM   152  C  CD  . GLN A 1 26  ? 25.300 14.928  43.634 1.00 35.67 ? 28   GLN A CD  1 
ATOM   153  O  OE1 . GLN A 1 26  ? 25.524 14.245  44.644 1.00 36.88 ? 28   GLN A OE1 1 
ATOM   154  N  NE2 . GLN A 1 26  ? 24.072 15.201  43.209 1.00 33.43 ? 28   GLN A NE2 1 
ATOM   155  N  N   . PHE A 1 27  ? 28.648 13.539  39.642 1.00 35.79 ? 29   PHE A N   1 
ATOM   156  C  CA  . PHE A 1 27  ? 29.074 12.575  38.660 1.00 36.16 ? 29   PHE A CA  1 
ATOM   157  C  C   . PHE A 1 27  ? 29.338 11.242  39.332 1.00 36.76 ? 29   PHE A C   1 
ATOM   158  O  O   . PHE A 1 27  ? 29.426 11.143  40.566 1.00 36.19 ? 29   PHE A O   1 
ATOM   159  C  CB  . PHE A 1 27  ? 30.378 13.069  38.007 1.00 36.43 ? 29   PHE A CB  1 
ATOM   160  C  CG  . PHE A 1 27  ? 31.517 13.227  38.989 1.00 36.42 ? 29   PHE A CG  1 
ATOM   161  C  CD1 . PHE A 1 27  ? 32.371 12.162  39.266 1.00 36.61 ? 29   PHE A CD1 1 
ATOM   162  C  CD2 . PHE A 1 27  ? 31.718 14.434  39.650 1.00 37.11 ? 29   PHE A CD2 1 
ATOM   163  C  CE1 . PHE A 1 27  ? 33.412 12.311  40.190 1.00 36.72 ? 29   PHE A CE1 1 
ATOM   164  C  CE2 . PHE A 1 27  ? 32.755 14.585  40.574 1.00 38.28 ? 29   PHE A CE2 1 
ATOM   165  C  CZ  . PHE A 1 27  ? 33.600 13.524  40.839 1.00 37.00 ? 29   PHE A CZ  1 
ATOM   166  N  N   . ASP A 1 28  ? 29.452 10.210  38.513 1.00 37.32 ? 30   ASP A N   1 
ATOM   167  C  CA  . ASP A 1 28  ? 29.874 8.929   39.014 1.00 38.30 ? 30   ASP A CA  1 
ATOM   168  C  C   . ASP A 1 28  ? 31.185 8.609   38.333 1.00 39.32 ? 30   ASP A C   1 
ATOM   169  O  O   . ASP A 1 28  ? 31.449 9.058   37.215 1.00 38.30 ? 30   ASP A O   1 
ATOM   170  C  CB  . ASP A 1 28  ? 28.815 7.836   38.788 1.00 37.41 ? 30   ASP A CB  1 
ATOM   171  C  CG  . ASP A 1 28  ? 28.599 7.497   37.323 1.00 38.19 ? 30   ASP A CG  1 
ATOM   172  O  OD1 . ASP A 1 28  ? 27.628 8.014   36.742 1.00 37.82 ? 30   ASP A OD1 1 
ATOM   173  O  OD2 . ASP A 1 28  ? 29.380 6.700   36.758 1.00 37.17 ? 30   ASP A OD2 1 
ATOM   174  N  N   . GLU A 1 29  ? 31.997 7.825   39.025 1.00 40.95 ? 31   GLU A N   1 
ATOM   175  C  CA  . GLU A 1 29  ? 33.289 7.392   38.533 1.00 42.82 ? 31   GLU A CA  1 
ATOM   176  C  C   . GLU A 1 29  ? 33.548 6.020   39.151 1.00 43.63 ? 31   GLU A C   1 
ATOM   177  O  O   . GLU A 1 29  ? 33.265 5.834   40.335 1.00 43.81 ? 31   GLU A O   1 
ATOM   178  C  CB  . GLU A 1 29  ? 34.348 8.401   38.981 1.00 42.82 ? 31   GLU A CB  1 
ATOM   179  C  CG  . GLU A 1 29  ? 35.784 8.058   38.632 1.00 44.59 ? 31   GLU A CG  1 
ATOM   180  C  CD  . GLU A 1 29  ? 36.094 8.172   37.157 1.00 47.12 ? 31   GLU A CD  1 
ATOM   181  O  OE1 . GLU A 1 29  ? 35.257 8.708   36.407 1.00 48.93 ? 31   GLU A OE1 1 
ATOM   182  O  OE2 . GLU A 1 29  ? 37.181 7.718   36.741 1.00 48.29 ? 31   GLU A OE2 1 
ATOM   183  N  N   . PRO A 1 30  ? 34.075 5.054   38.368 1.00 44.75 ? 32   PRO A N   1 
ATOM   184  C  CA  . PRO A 1 30  ? 34.317 3.728   38.953 1.00 45.73 ? 32   PRO A CA  1 
ATOM   185  C  C   . PRO A 1 30  ? 35.216 3.756   40.191 1.00 46.79 ? 32   PRO A C   1 
ATOM   186  O  O   . PRO A 1 30  ? 36.102 4.617   40.308 1.00 46.32 ? 32   PRO A O   1 
ATOM   187  C  CB  . PRO A 1 30  ? 34.996 2.967   37.813 1.00 45.70 ? 32   PRO A CB  1 
ATOM   188  C  CG  . PRO A 1 30  ? 34.468 3.621   36.585 1.00 45.77 ? 32   PRO A CG  1 
ATOM   189  C  CD  . PRO A 1 30  ? 34.454 5.079   36.944 1.00 44.60 ? 32   PRO A CD  1 
ATOM   190  N  N   . GLU A 1 31  ? 34.959 2.833   41.117 1.00 47.89 ? 33   GLU A N   1 
ATOM   191  C  CA  . GLU A 1 31  ? 35.745 2.725   42.347 1.00 49.30 ? 33   GLU A CA  1 
ATOM   192  C  C   . GLU A 1 31  ? 37.173 2.302   42.011 1.00 50.03 ? 33   GLU A C   1 
ATOM   193  O  O   . GLU A 1 31  ? 37.385 1.445   41.146 1.00 50.28 ? 33   GLU A O   1 
ATOM   194  C  CB  . GLU A 1 31  ? 35.110 1.732   43.338 1.00 49.25 ? 33   GLU A CB  1 
ATOM   195  C  CG  . GLU A 1 31  ? 33.661 2.059   43.769 1.00 50.05 ? 33   GLU A CG  1 
ATOM   196  C  CD  . GLU A 1 31  ? 33.510 3.390   44.512 1.00 51.34 ? 33   GLU A CD  1 
ATOM   197  O  OE1 . GLU A 1 31  ? 34.522 3.913   45.031 1.00 52.78 ? 33   GLU A OE1 1 
ATOM   198  O  OE2 . GLU A 1 31  ? 32.373 3.916   44.581 1.00 49.47 ? 33   GLU A OE2 1 
ATOM   199  N  N   . ALA A 1 32  ? 38.140 2.921   42.687 1.00 51.00 ? 34   ALA A N   1 
ATOM   200  C  CA  . ALA A 1 32  ? 39.563 2.641   42.478 1.00 51.88 ? 34   ALA A CA  1 
ATOM   201  C  C   . ALA A 1 32  ? 39.878 1.167   42.721 1.00 52.38 ? 34   ALA A C   1 
ATOM   202  O  O   . ALA A 1 32  ? 39.373 0.562   43.672 1.00 52.63 ? 34   ALA A O   1 
ATOM   203  C  CB  . ALA A 1 32  ? 40.420 3.529   43.376 1.00 51.88 ? 34   ALA A CB  1 
ATOM   204  N  N   . THR A 1 33  ? 40.694 0.595   41.839 1.00 52.83 ? 35   THR A N   1 
ATOM   205  C  CA  . THR A 1 33  ? 41.070 -0.817  41.918 1.00 53.25 ? 35   THR A CA  1 
ATOM   206  C  C   . THR A 1 33  ? 42.565 -1.005  41.676 1.00 53.39 ? 35   THR A C   1 
ATOM   207  O  O   . THR A 1 33  ? 43.225 -0.132  41.111 1.00 53.49 ? 35   THR A O   1 
ATOM   208  C  CB  . THR A 1 33  ? 40.276 -1.681  40.906 1.00 53.40 ? 35   THR A CB  1 
ATOM   209  O  OG1 . THR A 1 33  ? 40.233 -1.014  39.636 1.00 53.85 ? 35   THR A OG1 1 
ATOM   210  C  CG2 . THR A 1 33  ? 38.846 -1.927  41.395 1.00 53.42 ? 35   THR A CG2 1 
ATOM   211  N  N   . VAL A 1 36  ? 45.783 2.016   42.722 1.00 44.31 ? 38   VAL A N   1 
ATOM   212  C  CA  . VAL A 1 36  ? 45.830 3.215   41.886 1.00 44.02 ? 38   VAL A CA  1 
ATOM   213  C  C   . VAL A 1 36  ? 44.574 4.099   42.064 1.00 43.75 ? 38   VAL A C   1 
ATOM   214  O  O   . VAL A 1 36  ? 43.637 4.056   41.256 1.00 43.88 ? 38   VAL A O   1 
ATOM   215  C  CB  . VAL A 1 36  ? 46.147 2.874   40.388 1.00 44.29 ? 38   VAL A CB  1 
ATOM   216  C  CG1 . VAL A 1 36  ? 45.096 1.937   39.780 1.00 44.84 ? 38   VAL A CG1 1 
ATOM   217  C  CG2 . VAL A 1 36  ? 46.319 4.141   39.552 1.00 43.85 ? 38   VAL A CG2 1 
ATOM   218  N  N   . PRO A 1 37  ? 44.561 4.918   43.131 1.00 43.12 ? 39   PRO A N   1 
ATOM   219  C  CA  . PRO A 1 37  ? 43.393 5.754   43.377 1.00 42.31 ? 39   PRO A CA  1 
ATOM   220  C  C   . PRO A 1 37  ? 43.326 6.959   42.443 1.00 41.27 ? 39   PRO A C   1 
ATOM   221  O  O   . PRO A 1 37  ? 44.340 7.371   41.877 1.00 41.03 ? 39   PRO A O   1 
ATOM   222  C  CB  . PRO A 1 37  ? 43.604 6.219   44.820 1.00 42.47 ? 39   PRO A CB  1 
ATOM   223  C  CG  . PRO A 1 37  ? 45.092 6.278   44.970 1.00 42.80 ? 39   PRO A CG  1 
ATOM   224  C  CD  . PRO A 1 37  ? 45.612 5.122   44.149 1.00 43.31 ? 39   PRO A CD  1 
ATOM   225  N  N   . ILE A 1 38  ? 42.128 7.500   42.268 1.00 40.05 ? 40   ILE A N   1 
ATOM   226  C  CA  . ILE A 1 38  ? 41.974 8.754   41.535 1.00 38.99 ? 40   ILE A CA  1 
ATOM   227  C  C   . ILE A 1 38  ? 42.523 9.846   42.444 1.00 37.92 ? 40   ILE A C   1 
ATOM   228  O  O   . ILE A 1 38  ? 42.215 9.876   43.634 1.00 37.76 ? 40   ILE A O   1 
ATOM   229  C  CB  . ILE A 1 38  ? 40.504 9.007   41.161 1.00 39.25 ? 40   ILE A CB  1 
ATOM   230  C  CG1 . ILE A 1 38  ? 40.046 7.915   40.190 1.00 39.61 ? 40   ILE A CG1 1 
ATOM   231  C  CG2 . ILE A 1 38  ? 40.317 10.402  40.555 1.00 38.12 ? 40   ILE A CG2 1 
ATOM   232  C  CD1 . ILE A 1 38  ? 38.619 8.005   39.807 1.00 42.09 ? 40   ILE A CD1 1 
ATOM   233  N  N   . LEU A 1 39  ? 43.358 10.719  41.891 1.00 37.00 ? 41   LEU A N   1 
ATOM   234  C  CA  . LEU A 1 39  ? 43.999 11.759  42.690 1.00 36.05 ? 41   LEU A CA  1 
ATOM   235  C  C   . LEU A 1 39  ? 43.244 13.078  42.646 1.00 35.42 ? 41   LEU A C   1 
ATOM   236  O  O   . LEU A 1 39  ? 43.035 13.712  43.676 1.00 34.87 ? 41   LEU A O   1 
ATOM   237  C  CB  . LEU A 1 39  ? 45.453 11.961  42.245 1.00 36.64 ? 41   LEU A CB  1 
ATOM   238  C  CG  . LEU A 1 39  ? 46.350 10.715  42.302 1.00 36.79 ? 41   LEU A CG  1 
ATOM   239  C  CD1 . LEU A 1 39  ? 47.743 11.076  41.815 1.00 37.26 ? 41   LEU A CD1 1 
ATOM   240  C  CD2 . LEU A 1 39  ? 46.411 10.115  43.701 1.00 37.73 ? 41   LEU A CD2 1 
ATOM   241  N  N   . LYS A 1 40  ? 42.826 13.475  41.448 1.00 34.92 ? 42   LYS A N   1 
ATOM   242  C  CA  . LYS A 1 40  ? 42.151 14.741  41.243 1.00 34.82 ? 42   LYS A CA  1 
ATOM   243  C  C   . LYS A 1 40  ? 41.111 14.631  40.138 1.00 35.01 ? 42   LYS A C   1 
ATOM   244  O  O   . LYS A 1 40  ? 41.093 13.655  39.389 1.00 34.51 ? 42   LYS A O   1 
ATOM   245  C  CB  . LYS A 1 40  ? 43.168 15.809  40.810 1.00 34.41 ? 42   LYS A CB  1 
ATOM   246  C  CG  . LYS A 1 40  ? 44.398 15.972  41.703 1.00 34.94 ? 42   LYS A CG  1 
ATOM   247  C  CD  . LYS A 1 40  ? 44.054 16.601  43.038 1.00 33.86 ? 42   LYS A CD  1 
ATOM   248  C  CE  . LYS A 1 40  ? 45.290 16.682  43.921 1.00 34.46 ? 42   LYS A CE  1 
ATOM   249  N  NZ  . LYS A 1 40  ? 44.982 17.362  45.207 1.00 34.44 ? 42   LYS A NZ  1 
ATOM   250  N  N   . TYR A 1 41  ? 40.263 15.653  40.042 1.00 35.13 ? 43   TYR A N   1 
ATOM   251  C  CA  . TYR A 1 41  ? 39.335 15.802  38.924 1.00 35.64 ? 43   TYR A CA  1 
ATOM   252  C  C   . TYR A 1 41  ? 39.572 17.169  38.322 1.00 35.35 ? 43   TYR A C   1 
ATOM   253  O  O   . TYR A 1 41  ? 39.952 18.107  39.025 1.00 35.25 ? 43   TYR A O   1 
ATOM   254  C  CB  . TYR A 1 41  ? 37.869 15.705  39.363 1.00 35.68 ? 43   TYR A CB  1 
ATOM   255  C  CG  . TYR A 1 41  ? 37.489 14.343  39.866 1.00 36.42 ? 43   TYR A CG  1 
ATOM   256  C  CD1 . TYR A 1 41  ? 37.110 13.337  38.976 1.00 36.00 ? 43   TYR A CD1 1 
ATOM   257  C  CD2 . TYR A 1 41  ? 37.511 14.055  41.224 1.00 36.58 ? 43   TYR A CD2 1 
ATOM   258  C  CE1 . TYR A 1 41  ? 36.766 12.072  39.434 1.00 37.25 ? 43   TYR A CE1 1 
ATOM   259  C  CE2 . TYR A 1 41  ? 37.172 12.795  41.692 1.00 37.34 ? 43   TYR A CE2 1 
ATOM   260  C  CZ  . TYR A 1 41  ? 36.801 11.814  40.789 1.00 37.40 ? 43   TYR A CZ  1 
ATOM   261  O  OH  . TYR A 1 41  ? 36.462 10.572  41.239 1.00 37.96 ? 43   TYR A OH  1 
ATOM   262  N  N   . LYS A 1 42  ? 39.366 17.264  37.017 1.00 35.53 ? 44   LYS A N   1 
ATOM   263  C  CA  . LYS A 1 42  ? 39.448 18.534  36.322 1.00 35.84 ? 44   LYS A CA  1 
ATOM   264  C  C   . LYS A 1 42  ? 38.113 18.752  35.634 1.00 36.33 ? 44   LYS A C   1 
ATOM   265  O  O   . LYS A 1 42  ? 37.663 17.915  34.838 1.00 36.91 ? 44   LYS A O   1 
ATOM   266  C  CB  . LYS A 1 42  ? 40.595 18.548  35.315 1.00 36.23 ? 44   LYS A CB  1 
ATOM   267  C  CG  . LYS A 1 42  ? 40.812 19.929  34.667 1.00 35.57 ? 44   LYS A CG  1 
ATOM   268  C  CD  . LYS A 1 42  ? 42.002 19.930  33.735 1.00 37.37 ? 44   LYS A CD  1 
ATOM   269  C  CE  . LYS A 1 42  ? 42.280 21.334  33.238 1.00 38.27 ? 44   LYS A CE  1 
ATOM   270  N  NZ  . LYS A 1 42  ? 43.462 21.433  32.315 1.00 40.54 ? 44   LYS A NZ  1 
ATOM   271  N  N   . ALA A 1 43  ? 37.463 19.851  35.991 1.00 36.02 ? 45   ALA A N   1 
ATOM   272  C  CA  . ALA A 1 43  ? 36.214 20.252  35.373 1.00 35.76 ? 45   ALA A CA  1 
ATOM   273  C  C   . ALA A 1 43  ? 36.492 21.329  34.336 1.00 35.76 ? 45   ALA A C   1 
ATOM   274  O  O   . ALA A 1 43  ? 37.399 22.152  34.505 1.00 34.70 ? 45   ALA A O   1 
ATOM   275  C  CB  . ALA A 1 43  ? 35.261 20.782  36.413 1.00 36.36 ? 45   ALA A CB  1 
ATOM   276  N  N   . GLU A 1 44  ? 35.721 21.309  33.255 1.00 35.62 ? 46   GLU A N   1 
ATOM   277  C  CA  . GLU A 1 44  ? 35.784 22.357  32.237 1.00 36.41 ? 46   GLU A CA  1 
ATOM   278  C  C   . GLU A 1 44  ? 34.361 22.790  31.942 1.00 35.52 ? 46   GLU A C   1 
ATOM   279  O  O   . GLU A 1 44  ? 33.455 21.967  31.929 1.00 34.98 ? 46   GLU A O   1 
ATOM   280  C  CB  . GLU A 1 44  ? 36.458 21.855  30.959 1.00 36.31 ? 46   GLU A CB  1 
ATOM   281  C  CG  . GLU A 1 44  ? 37.938 21.533  31.129 1.00 39.13 ? 46   GLU A CG  1 
ATOM   282  C  CD  . GLU A 1 44  ? 38.584 21.016  29.854 1.00 39.61 ? 46   GLU A CD  1 
ATOM   283  O  OE1 . GLU A 1 44  ? 39.691 21.477  29.520 1.00 44.80 ? 46   GLU A OE1 1 
ATOM   284  O  OE2 . GLU A 1 44  ? 37.990 20.148  29.181 1.00 44.95 ? 46   GLU A OE2 1 
ATOM   285  N  N   . TRP A 1 45  ? 34.158 24.083  31.724 1.00 34.76 ? 47   TRP A N   1 
ATOM   286  C  CA  . TRP A 1 45  ? 32.826 24.591  31.422 1.00 34.30 ? 47   TRP A CA  1 
ATOM   287  C  C   . TRP A 1 45  ? 32.946 25.760  30.451 1.00 34.01 ? 47   TRP A C   1 
ATOM   288  O  O   . TRP A 1 45  ? 34.000 26.390  30.342 1.00 33.68 ? 47   TRP A O   1 
ATOM   289  C  CB  . TRP A 1 45  ? 32.065 24.987  32.699 1.00 34.42 ? 47   TRP A CB  1 
ATOM   290  C  CG  . TRP A 1 45  ? 32.741 26.087  33.471 1.00 34.16 ? 47   TRP A CG  1 
ATOM   291  C  CD1 . TRP A 1 45  ? 32.459 27.427  33.423 1.00 35.02 ? 47   TRP A CD1 1 
ATOM   292  C  CD2 . TRP A 1 45  ? 33.841 25.938  34.374 1.00 34.62 ? 47   TRP A CD2 1 
ATOM   293  N  NE1 . TRP A 1 45  ? 33.314 28.117  34.254 1.00 34.83 ? 47   TRP A NE1 1 
ATOM   294  C  CE2 . TRP A 1 45  ? 34.169 27.225  34.849 1.00 35.80 ? 47   TRP A CE2 1 
ATOM   295  C  CE3 . TRP A 1 45  ? 34.582 24.834  34.832 1.00 35.44 ? 47   TRP A CE3 1 
ATOM   296  C  CZ2 . TRP A 1 45  ? 35.209 27.444  35.762 1.00 35.47 ? 47   TRP A CZ2 1 
ATOM   297  C  CZ3 . TRP A 1 45  ? 35.610 25.053  35.743 1.00 35.65 ? 47   TRP A CZ3 1 
ATOM   298  C  CH2 . TRP A 1 45  ? 35.913 26.349  36.195 1.00 34.47 ? 47   TRP A CH2 1 
ATOM   299  N  N   . ARG A 1 46  ? 31.867 26.025  29.735 1.00 33.62 ? 48   ARG A N   1 
ATOM   300  C  CA  . ARG A 1 46  ? 31.867 27.069  28.738 1.00 33.73 ? 48   ARG A CA  1 
ATOM   301  C  C   . ARG A 1 46  ? 30.452 27.521  28.455 1.00 33.79 ? 48   ARG A C   1 
ATOM   302  O  O   . ARG A 1 46  ? 29.558 26.696  28.217 1.00 33.52 ? 48   ARG A O   1 
ATOM   303  C  CB  . ARG A 1 46  ? 32.521 26.551  27.461 1.00 33.56 ? 48   ARG A CB  1 
ATOM   304  C  CG  . ARG A 1 46  ? 32.637 27.571  26.370 1.00 33.31 ? 48   ARG A CG  1 
ATOM   305  C  CD  . ARG A 1 46  ? 33.289 26.948  25.158 1.00 34.14 ? 48   ARG A CD  1 
ATOM   306  N  NE  . ARG A 1 46  ? 32.431 25.936  24.538 1.00 33.41 ? 48   ARG A NE  1 
ATOM   307  C  CZ  . ARG A 1 46  ? 32.751 25.260  23.438 1.00 34.09 ? 48   ARG A CZ  1 
ATOM   308  N  NH1 . ARG A 1 46  ? 33.915 25.479  22.834 1.00 32.57 ? 48   ARG A NH1 1 
ATOM   309  N  NH2 . ARG A 1 46  ? 31.903 24.370  22.940 1.00 34.54 ? 48   ARG A NH2 1 
ATOM   310  N  N   . ALA A 1 47  ? 30.263 28.835  28.481 1.00 34.17 ? 49   ALA A N   1 
ATOM   311  C  CA  . ALA A 1 47  ? 28.970 29.444  28.225 1.00 34.83 ? 49   ALA A CA  1 
ATOM   312  C  C   . ALA A 1 47  ? 28.594 29.386  26.757 1.00 35.53 ? 49   ALA A C   1 
ATOM   313  O  O   . ALA A 1 47  ? 29.461 29.358  25.868 1.00 35.64 ? 49   ALA A O   1 
ATOM   314  C  CB  . ALA A 1 47  ? 28.962 30.897  28.695 1.00 34.93 ? 49   ALA A CB  1 
ATOM   315  N  N   . VAL A 1 48  ? 27.288 29.365  26.524 1.00 36.08 ? 50   VAL A N   1 
ATOM   316  C  CA  . VAL A 1 48  ? 26.725 29.575  25.206 1.00 36.99 ? 50   VAL A CA  1 
ATOM   317  C  C   . VAL A 1 48  ? 27.335 30.867  24.653 1.00 37.66 ? 50   VAL A C   1 
ATOM   318  O  O   . VAL A 1 48  ? 27.342 31.902  25.330 1.00 37.84 ? 50   VAL A O   1 
ATOM   319  C  CB  . VAL A 1 48  ? 25.182 29.691  25.307 1.00 36.77 ? 50   VAL A CB  1 
ATOM   320  C  CG1 . VAL A 1 48  ? 24.601 30.558  24.207 1.00 37.55 ? 50   VAL A CG1 1 
ATOM   321  C  CG2 . VAL A 1 48  ? 24.545 28.312  25.325 1.00 36.26 ? 50   VAL A CG2 1 
ATOM   322  N  N   . GLY A 1 49  ? 27.879 30.784  23.443 1.00 38.47 ? 51   GLY A N   1 
ATOM   323  C  CA  . GLY A 1 49  ? 28.491 31.936  22.789 1.00 39.14 ? 51   GLY A CA  1 
ATOM   324  C  C   . GLY A 1 49  ? 30.001 32.028  22.933 1.00 39.61 ? 51   GLY A C   1 
ATOM   325  O  O   . GLY A 1 49  ? 30.628 32.875  22.301 1.00 39.67 ? 51   GLY A O   1 
ATOM   326  N  N   . GLU A 1 50  ? 30.589 31.168  23.762 1.00 39.82 ? 52   GLU A N   1 
ATOM   327  C  CA  . GLU A 1 50  ? 32.041 31.183  23.972 1.00 40.34 ? 52   GLU A CA  1 
ATOM   328  C  C   . GLU A 1 50  ? 32.738 30.043  23.220 1.00 39.87 ? 52   GLU A C   1 
ATOM   329  O  O   . GLU A 1 50  ? 32.099 29.060  22.837 1.00 39.91 ? 52   GLU A O   1 
ATOM   330  C  CB  . GLU A 1 50  ? 32.386 31.128  25.469 1.00 40.70 ? 52   GLU A CB  1 
ATOM   331  C  CG  . GLU A 1 50  ? 31.847 32.296  26.313 1.00 42.93 ? 52   GLU A CG  1 
ATOM   332  C  CD  . GLU A 1 50  ? 32.525 33.633  26.029 1.00 47.38 ? 52   GLU A CD  1 
ATOM   333  O  OE1 . GLU A 1 50  ? 33.728 33.653  25.675 1.00 48.40 ? 52   GLU A OE1 1 
ATOM   334  O  OE2 . GLU A 1 50  ? 31.846 34.676  26.174 1.00 49.15 ? 52   GLU A OE2 1 
ATOM   335  N  N   . GLU A 1 51  ? 34.042 30.198  22.997 1.00 39.42 ? 53   GLU A N   1 
ATOM   336  C  CA  . GLU A 1 51  ? 34.857 29.175  22.341 1.00 39.22 ? 53   GLU A CA  1 
ATOM   337  C  C   . GLU A 1 51  ? 35.816 28.513  23.325 1.00 39.01 ? 53   GLU A C   1 
ATOM   338  O  O   . GLU A 1 51  ? 36.067 27.310  23.245 1.00 39.08 ? 53   GLU A O   1 
ATOM   339  C  CB  . GLU A 1 51  ? 35.653 29.758  21.165 1.00 39.76 ? 53   GLU A CB  1 
ATOM   340  C  CG  . GLU A 1 51  ? 34.816 30.232  19.969 1.00 40.43 ? 53   GLU A CG  1 
ATOM   341  C  CD  . GLU A 1 51  ? 34.030 29.115  19.284 1.00 41.74 ? 53   GLU A CD  1 
ATOM   342  O  OE1 . GLU A 1 51  ? 33.069 29.436  18.551 1.00 43.34 ? 53   GLU A OE1 1 
ATOM   343  O  OE2 . GLU A 1 51  ? 34.363 27.923  19.464 1.00 42.45 ? 53   GLU A OE2 1 
ATOM   344  N  N   . VAL A 1 52  ? 36.332 29.300  24.263 1.00 38.59 ? 54   VAL A N   1 
ATOM   345  C  CA  . VAL A 1 52  ? 37.302 28.812  25.234 1.00 38.54 ? 54   VAL A CA  1 
ATOM   346  C  C   . VAL A 1 52  ? 36.616 28.202  26.461 1.00 37.93 ? 54   VAL A C   1 
ATOM   347  O  O   . VAL A 1 52  ? 35.639 28.746  26.988 1.00 38.09 ? 54   VAL A O   1 
ATOM   348  C  CB  . VAL A 1 52  ? 38.299 29.928  25.651 1.00 38.24 ? 54   VAL A CB  1 
ATOM   349  C  CG1 . VAL A 1 52  ? 39.334 29.406  26.656 1.00 39.02 ? 54   VAL A CG1 1 
ATOM   350  C  CG2 . VAL A 1 52  ? 39.008 30.501  24.425 1.00 39.47 ? 54   VAL A CG2 1 
ATOM   351  N  N   . TRP A 1 53  ? 37.126 27.055  26.891 1.00 37.62 ? 55   TRP A N   1 
ATOM   352  C  CA  . TRP A 1 53  ? 36.646 26.396  28.092 1.00 36.85 ? 55   TRP A CA  1 
ATOM   353  C  C   . TRP A 1 53  ? 37.406 26.910  29.309 1.00 36.71 ? 55   TRP A C   1 
ATOM   354  O  O   . TRP A 1 53  ? 38.634 27.025  29.278 1.00 36.57 ? 55   TRP A O   1 
ATOM   355  C  CB  . TRP A 1 53  ? 36.860 24.882  27.993 1.00 37.05 ? 55   TRP A CB  1 
ATOM   356  C  CG  . TRP A 1 53  ? 36.048 24.227  26.942 1.00 36.36 ? 55   TRP A CG  1 
ATOM   357  C  CD1 . TRP A 1 53  ? 36.308 24.199  25.604 1.00 37.05 ? 55   TRP A CD1 1 
ATOM   358  C  CD2 . TRP A 1 53  ? 34.846 23.482  27.135 1.00 36.68 ? 55   TRP A CD2 1 
ATOM   359  N  NE1 . TRP A 1 53  ? 35.331 23.495  24.949 1.00 36.65 ? 55   TRP A NE1 1 
ATOM   360  C  CE2 . TRP A 1 53  ? 34.421 23.041  25.864 1.00 36.41 ? 55   TRP A CE2 1 
ATOM   361  C  CE3 . TRP A 1 53  ? 34.078 23.150  28.260 1.00 35.82 ? 55   TRP A CE3 1 
ATOM   362  C  CZ2 . TRP A 1 53  ? 33.266 22.276  25.681 1.00 37.16 ? 55   TRP A CZ2 1 
ATOM   363  C  CZ3 . TRP A 1 53  ? 32.926 22.389  28.079 1.00 37.08 ? 55   TRP A CZ3 1 
ATOM   364  C  CH2 . TRP A 1 53  ? 32.533 21.962  26.795 1.00 36.45 ? 55   TRP A CH2 1 
ATOM   365  N  N   . HIS A 1 54  ? 36.678 27.215  30.376 1.00 36.32 ? 56   HIS A N   1 
ATOM   366  C  CA  . HIS A 1 54  ? 37.309 27.520  31.649 1.00 36.30 ? 56   HIS A CA  1 
ATOM   367  C  C   . HIS A 1 54  ? 37.555 26.160  32.306 1.00 35.99 ? 56   HIS A C   1 
ATOM   368  O  O   . HIS A 1 54  ? 36.932 25.170  31.929 1.00 35.51 ? 56   HIS A O   1 
ATOM   369  C  CB  . HIS A 1 54  ? 36.402 28.378  32.530 1.00 36.72 ? 56   HIS A CB  1 
ATOM   370  C  CG  . HIS A 1 54  ? 36.115 29.740  31.975 1.00 38.98 ? 56   HIS A CG  1 
ATOM   371  N  ND1 . HIS A 1 54  ? 37.089 30.700  31.821 1.00 42.15 ? 56   HIS A ND1 1 
ATOM   372  C  CD2 . HIS A 1 54  ? 34.956 30.311  31.570 1.00 41.46 ? 56   HIS A CD2 1 
ATOM   373  C  CE1 . HIS A 1 54  ? 36.551 31.799  31.319 1.00 44.04 ? 56   HIS A CE1 1 
ATOM   374  N  NE2 . HIS A 1 54  ? 35.255 31.591  31.164 1.00 44.17 ? 56   HIS A NE2 1 
ATOM   375  N  N   . SER A 1 55  ? 38.461 26.097  33.274 1.00 35.13 ? 57   SER A N   1 
ATOM   376  C  CA  . SER A 1 55  ? 38.722 24.832  33.955 1.00 34.94 ? 57   SER A CA  1 
ATOM   377  C  C   . SER A 1 55  ? 39.095 25.077  35.400 1.00 34.61 ? 57   SER A C   1 
ATOM   378  O  O   . SER A 1 55  ? 39.525 26.164  35.760 1.00 33.85 ? 57   SER A O   1 
ATOM   379  C  CB  . SER A 1 55  ? 39.866 24.085  33.282 1.00 34.78 ? 57   SER A CB  1 
ATOM   380  O  OG  . SER A 1 55  ? 41.058 24.825  33.425 1.00 35.60 ? 57   SER A OG  1 
ATOM   381  N  N   . LYS A 1 56  ? 38.936 24.051  36.219 1.00 34.32 ? 58   LYS A N   1 
ATOM   382  C  CA  . LYS A 1 56  ? 39.333 24.130  37.613 1.00 34.20 ? 58   LYS A CA  1 
ATOM   383  C  C   . LYS A 1 56  ? 39.646 22.716  38.079 1.00 33.94 ? 58   LYS A C   1 
ATOM   384  O  O   . LYS A 1 56  ? 39.033 21.744  37.614 1.00 34.12 ? 58   LYS A O   1 
ATOM   385  C  CB  . LYS A 1 56  ? 38.227 24.757  38.469 1.00 34.16 ? 58   LYS A CB  1 
ATOM   386  C  CG  . LYS A 1 56  ? 38.598 24.913  39.934 1.00 34.57 ? 58   LYS A CG  1 
ATOM   387  C  CD  . LYS A 1 56  ? 37.578 25.734  40.688 1.00 36.10 ? 58   LYS A CD  1 
ATOM   388  C  CE  . LYS A 1 56  ? 38.003 25.899  42.126 1.00 36.97 ? 58   LYS A CE  1 
ATOM   389  N  NZ  . LYS A 1 56  ? 37.150 26.887  42.843 1.00 38.34 ? 58   LYS A NZ  1 
ATOM   390  N  N   . TRP A 1 57  ? 40.630 22.607  38.965 1.00 33.73 ? 59   TRP A N   1 
ATOM   391  C  CA  . TRP A 1 57  ? 41.005 21.318  39.532 1.00 33.62 ? 59   TRP A CA  1 
ATOM   392  C  C   . TRP A 1 57  ? 40.357 21.120  40.894 1.00 33.15 ? 59   TRP A C   1 
ATOM   393  O  O   . TRP A 1 57  ? 40.121 22.086  41.638 1.00 32.34 ? 59   TRP A O   1 
ATOM   394  C  CB  . TRP A 1 57  ? 42.523 21.233  39.666 1.00 33.89 ? 59   TRP A CB  1 
ATOM   395  C  CG  . TRP A 1 57  ? 43.233 21.046  38.371 1.00 34.34 ? 59   TRP A CG  1 
ATOM   396  C  CD1 . TRP A 1 57  ? 43.661 22.025  37.514 1.00 35.18 ? 59   TRP A CD1 1 
ATOM   397  C  CD2 . TRP A 1 57  ? 43.620 19.800  37.786 1.00 34.45 ? 59   TRP A CD2 1 
ATOM   398  N  NE1 . TRP A 1 57  ? 44.294 21.460  36.429 1.00 34.68 ? 59   TRP A NE1 1 
ATOM   399  C  CE2 . TRP A 1 57  ? 44.281 20.096  36.571 1.00 35.35 ? 59   TRP A CE2 1 
ATOM   400  C  CE3 . TRP A 1 57  ? 43.467 18.452  38.171 1.00 34.80 ? 59   TRP A CE3 1 
ATOM   401  C  CZ2 . TRP A 1 57  ? 44.795 19.097  35.734 1.00 34.47 ? 59   TRP A CZ2 1 
ATOM   402  C  CZ3 . TRP A 1 57  ? 43.981 17.465  37.340 1.00 34.86 ? 59   TRP A CZ3 1 
ATOM   403  C  CH2 . TRP A 1 57  ? 44.640 17.795  36.137 1.00 34.77 ? 59   TRP A CH2 1 
ATOM   404  N  N   . TYR A 1 58  ? 40.125 19.855  41.232 1.00 32.75 ? 60   TYR A N   1 
ATOM   405  C  CA  . TYR A 1 58  ? 39.457 19.476  42.462 1.00 33.22 ? 60   TYR A CA  1 
ATOM   406  C  C   . TYR A 1 58  ? 40.120 18.242  43.035 1.00 33.74 ? 60   TYR A C   1 
ATOM   407  O  O   . TYR A 1 58  ? 40.450 17.315  42.300 1.00 32.95 ? 60   TYR A O   1 
ATOM   408  C  CB  . TYR A 1 58  ? 37.983 19.130  42.180 1.00 33.36 ? 60   TYR A CB  1 
ATOM   409  C  CG  . TYR A 1 58  ? 37.197 20.276  41.599 1.00 33.67 ? 60   TYR A CG  1 
ATOM   410  C  CD1 . TYR A 1 58  ? 36.514 21.167  42.434 1.00 34.10 ? 60   TYR A CD1 1 
ATOM   411  C  CD2 . TYR A 1 58  ? 37.162 20.493  40.221 1.00 34.97 ? 60   TYR A CD2 1 
ATOM   412  C  CE1 . TYR A 1 58  ? 35.804 22.226  41.906 1.00 35.80 ? 60   TYR A CE1 1 
ATOM   413  C  CE2 . TYR A 1 58  ? 36.467 21.561  39.683 1.00 34.45 ? 60   TYR A CE2 1 
ATOM   414  C  CZ  . TYR A 1 58  ? 35.785 22.423  40.530 1.00 33.88 ? 60   TYR A CZ  1 
ATOM   415  O  OH  . TYR A 1 58  ? 35.076 23.476  40.001 1.00 34.59 ? 60   TYR A OH  1 
ATOM   416  N  N   . ASP A 1 59  ? 40.308 18.242  44.349 1.00 33.97 ? 61   ASP A N   1 
ATOM   417  C  CA  . ASP A 1 59  ? 40.881 17.110  45.026 1.00 35.18 ? 61   ASP A CA  1 
ATOM   418  C  C   . ASP A 1 59  ? 39.884 15.955  44.979 1.00 35.25 ? 61   ASP A C   1 
ATOM   419  O  O   . ASP A 1 59  ? 38.689 16.159  45.218 1.00 35.47 ? 61   ASP A O   1 
ATOM   420  C  CB  . ASP A 1 59  ? 41.203 17.450  46.472 1.00 35.03 ? 61   ASP A CB  1 
ATOM   421  C  CG  . ASP A 1 59  ? 41.842 16.293  47.190 1.00 36.68 ? 61   ASP A CG  1 
ATOM   422  O  OD1 . ASP A 1 59  ? 42.975 15.911  46.809 1.00 38.35 ? 61   ASP A OD1 1 
ATOM   423  O  OD2 . ASP A 1 59  ? 41.203 15.762  48.122 1.00 36.33 ? 61   ASP A OD2 1 
ATOM   424  N  N   . ALA A 1 60  ? 40.369 14.758  44.656 1.00 35.80 ? 62   ALA A N   1 
ATOM   425  C  CA  . ALA A 1 60  ? 39.479 13.592  44.542 1.00 36.41 ? 62   ALA A CA  1 
ATOM   426  C  C   . ALA A 1 60  ? 38.884 13.181  45.883 1.00 37.05 ? 62   ALA A C   1 
ATOM   427  O  O   . ALA A 1 60  ? 37.707 12.845  45.957 1.00 37.06 ? 62   ALA A O   1 
ATOM   428  C  CB  . ALA A 1 60  ? 40.186 12.403  43.895 1.00 36.45 ? 62   ALA A CB  1 
ATOM   429  N  N   . LYS A 1 61  ? 39.689 13.206  46.939 1.00 37.53 ? 63   LYS A N   1 
ATOM   430  C  CA  . LYS A 1 61  ? 39.204 12.778  48.255 1.00 38.17 ? 63   LYS A CA  1 
ATOM   431  C  C   . LYS A 1 61  ? 38.005 13.639  48.657 1.00 37.98 ? 63   LYS A C   1 
ATOM   432  O  O   . LYS A 1 61  ? 36.959 13.128  49.044 1.00 37.75 ? 63   LYS A O   1 
ATOM   433  C  CB  . LYS A 1 61  ? 40.317 12.866  49.307 1.00 38.57 ? 63   LYS A CB  1 
ATOM   434  C  CG  . LYS A 1 61  ? 40.039 12.078  50.563 1.00 41.55 ? 63   LYS A CG  1 
ATOM   435  C  CD  . LYS A 1 61  ? 41.026 12.421  51.665 1.00 45.07 ? 63   LYS A CD  1 
ATOM   436  C  CE  . LYS A 1 61  ? 41.168 11.268  52.647 1.00 47.37 ? 63   LYS A CE  1 
ATOM   437  N  NZ  . LYS A 1 61  ? 39.858 10.711  53.090 1.00 49.87 ? 63   LYS A NZ  1 
ATOM   438  N  N   . GLU A 1 62  ? 38.150 14.952  48.524 1.00 38.14 ? 64   GLU A N   1 
ATOM   439  C  CA  . GLU A 1 62  ? 37.063 15.868  48.843 1.00 38.46 ? 64   GLU A CA  1 
ATOM   440  C  C   . GLU A 1 62  ? 35.838 15.679  47.950 1.00 37.72 ? 64   GLU A C   1 
ATOM   441  O  O   . GLU A 1 62  ? 34.701 15.736  48.426 1.00 38.18 ? 64   GLU A O   1 
ATOM   442  C  CB  . GLU A 1 62  ? 37.548 17.312  48.770 1.00 39.37 ? 64   GLU A CB  1 
ATOM   443  C  CG  . GLU A 1 62  ? 36.411 18.318  48.779 1.00 42.76 ? 64   GLU A CG  1 
ATOM   444  C  CD  . GLU A 1 62  ? 36.808 19.638  49.374 1.00 46.15 ? 64   GLU A CD  1 
ATOM   445  O  OE1 . GLU A 1 62  ? 37.525 19.636  50.397 1.00 50.82 ? 64   GLU A OE1 1 
ATOM   446  O  OE2 . GLU A 1 62  ? 36.370 20.668  48.840 1.00 45.99 ? 64   GLU A OE2 1 
ATOM   447  N  N   . ALA A 1 63  ? 36.067 15.470  46.657 1.00 36.59 ? 65   ALA A N   1 
ATOM   448  C  CA  . ALA A 1 63  ? 34.974 15.277  45.716 1.00 36.35 ? 65   ALA A CA  1 
ATOM   449  C  C   . ALA A 1 63  ? 34.268 13.941  45.925 1.00 36.09 ? 65   ALA A C   1 
ATOM   450  O  O   . ALA A 1 63  ? 33.108 13.807  45.563 1.00 35.40 ? 65   ALA A O   1 
ATOM   451  C  CB  . ALA A 1 63  ? 35.481 15.354  44.279 1.00 35.79 ? 65   ALA A CB  1 
ATOM   452  N  N   . SER A 1 64  ? 34.963 12.977  46.528 1.00 36.01 ? 66   SER A N   1 
ATOM   453  C  CA  . SER A 1 64  ? 34.474 11.597  46.597 1.00 36.42 ? 66   SER A CA  1 
ATOM   454  C  C   . SER A 1 64  ? 33.279 11.372  47.527 1.00 36.38 ? 66   SER A C   1 
ATOM   455  O  O   . SER A 1 64  ? 32.516 10.429  47.321 1.00 35.52 ? 66   SER A O   1 
ATOM   456  C  CB  . SER A 1 64  ? 35.610 10.623  46.935 1.00 36.34 ? 66   SER A CB  1 
ATOM   457  O  OG  . SER A 1 64  ? 35.980 10.710  48.307 1.00 38.23 ? 66   SER A OG  1 
HETATM 458  N  N   . MSE A 1 65  ? 33.106 12.219  48.541 1.00 36.33 ? 67   MSE A N   1 
HETATM 459  C  CA  . MSE A 1 65  ? 32.005 12.001  49.473 1.00 38.30 ? 67   MSE A CA  1 
HETATM 460  C  C   . MSE A 1 65  ? 30.669 12.055  48.745 1.00 36.20 ? 67   MSE A C   1 
HETATM 461  O  O   . MSE A 1 65  ? 29.801 11.228  48.978 1.00 35.35 ? 67   MSE A O   1 
HETATM 462  C  CB  . MSE A 1 65  ? 31.998 12.998  50.632 1.00 37.92 ? 67   MSE A CB  1 
HETATM 463  C  CG  . MSE A 1 65  ? 30.964 12.603  51.676 1.00 39.75 ? 67   MSE A CG  1 
HETATM 464  SE SE  . MSE A 1 65  ? 30.786 13.883  53.114 1.00 47.77 ? 67   MSE A SE  1 
HETATM 465  C  CE  . MSE A 1 65  ? 30.044 15.365  52.137 1.00 43.07 ? 67   MSE A CE  1 
ATOM   466  N  N   . GLU A 1 66  ? 30.523 13.025  47.849 1.00 34.91 ? 68   GLU A N   1 
ATOM   467  C  CA  . GLU A 1 66  ? 29.277 13.179  47.126 1.00 34.57 ? 68   GLU A CA  1 
ATOM   468  C  C   . GLU A 1 66  ? 29.428 13.066  45.613 1.00 34.46 ? 68   GLU A C   1 
ATOM   469  O  O   . GLU A 1 66  ? 28.448 13.230  44.885 1.00 34.46 ? 68   GLU A O   1 
ATOM   470  C  CB  . GLU A 1 66  ? 28.605 14.488  47.516 1.00 33.96 ? 68   GLU A CB  1 
ATOM   471  C  CG  . GLU A 1 66  ? 28.138 14.495  48.962 1.00 35.10 ? 68   GLU A CG  1 
ATOM   472  C  CD  . GLU A 1 66  ? 27.269 15.675  49.255 1.00 37.29 ? 68   GLU A CD  1 
ATOM   473  O  OE1 . GLU A 1 66  ? 27.805 16.797  49.321 1.00 39.84 ? 68   GLU A OE1 1 
ATOM   474  O  OE2 . GLU A 1 66  ? 26.049 15.484  49.400 1.00 36.82 ? 68   GLU A OE2 1 
ATOM   475  N  N   . GLY A 1 67  ? 30.641 12.748  45.159 1.00 34.09 ? 69   GLY A N   1 
ATOM   476  C  CA  . GLY A 1 67  ? 30.947 12.667  43.733 1.00 34.84 ? 69   GLY A CA  1 
ATOM   477  C  C   . GLY A 1 67  ? 30.587 14.017  43.149 1.00 35.41 ? 69   GLY A C   1 
ATOM   478  O  O   . GLY A 1 67  ? 29.807 14.113  42.204 1.00 35.36 ? 69   GLY A O   1 
ATOM   479  N  N   . ILE A 1 68  ? 31.154 15.068  43.725 1.00 35.72 ? 70   ILE A N   1 
ATOM   480  C  CA  . ILE A 1 68  ? 30.698 16.406  43.409 1.00 36.76 ? 70   ILE A CA  1 
ATOM   481  C  C   . ILE A 1 68  ? 31.835 17.396  43.229 1.00 36.44 ? 70   ILE A C   1 
ATOM   482  O  O   . ILE A 1 68  ? 32.844 17.334  43.935 1.00 35.65 ? 70   ILE A O   1 
ATOM   483  C  CB  . ILE A 1 68  ? 29.729 16.896  44.527 1.00 36.59 ? 70   ILE A CB  1 
ATOM   484  C  CG1 . ILE A 1 68  ? 28.846 18.061  44.082 1.00 38.59 ? 70   ILE A CG1 1 
ATOM   485  C  CG2 . ILE A 1 68  ? 30.479 17.253  45.828 1.00 37.93 ? 70   ILE A CG2 1 
ATOM   486  C  CD1 . ILE A 1 68  ? 27.591 18.183  44.988 1.00 38.51 ? 70   ILE A CD1 1 
ATOM   487  N  N   . VAL A 1 69  ? 31.667 18.284  42.253 1.00 36.58 ? 71   VAL A N   1 
ATOM   488  C  CA  . VAL A 1 69  ? 32.530 19.459  42.130 1.00 37.08 ? 71   VAL A CA  1 
ATOM   489  C  C   . VAL A 1 69  ? 31.629 20.686  41.968 1.00 37.13 ? 71   VAL A C   1 
ATOM   490  O  O   . VAL A 1 69  ? 30.571 20.616  41.349 1.00 37.43 ? 71   VAL A O   1 
ATOM   491  C  CB  . VAL A 1 69  ? 33.576 19.342  40.976 1.00 36.66 ? 71   VAL A CB  1 
ATOM   492  C  CG1 . VAL A 1 69  ? 34.535 18.180  41.252 1.00 36.40 ? 71   VAL A CG1 1 
ATOM   493  C  CG2 . VAL A 1 69  ? 32.912 19.201  39.615 1.00 37.74 ? 71   VAL A CG2 1 
ATOM   494  N  N   . THR A 1 70  ? 32.037 21.803  42.548 1.00 36.79 ? 72   THR A N   1 
ATOM   495  C  CA  . THR A 1 70  ? 31.258 23.014  42.443 1.00 36.75 ? 72   THR A CA  1 
ATOM   496  C  C   . THR A 1 70  ? 32.008 23.992  41.561 1.00 36.44 ? 72   THR A C   1 
ATOM   497  O  O   . THR A 1 70  ? 33.183 24.276  41.786 1.00 36.33 ? 72   THR A O   1 
ATOM   498  C  CB  . THR A 1 70  ? 30.988 23.647  43.813 1.00 37.32 ? 72   THR A CB  1 
ATOM   499  O  OG1 . THR A 1 70  ? 30.276 22.709  44.621 1.00 38.64 ? 72   THR A OG1 1 
ATOM   500  C  CG2 . THR A 1 70  ? 30.153 24.937  43.674 1.00 37.22 ? 72   THR A CG2 1 
ATOM   501  N  N   . ILE A 1 71  ? 31.315 24.473  40.545 1.00 35.97 ? 73   ILE A N   1 
ATOM   502  C  CA  . ILE A 1 71  ? 31.853 25.478  39.647 1.00 36.09 ? 73   ILE A CA  1 
ATOM   503  C  C   . ILE A 1 71  ? 31.328 26.812  40.135 1.00 35.94 ? 73   ILE A C   1 
ATOM   504  O  O   . ILE A 1 71  ? 30.145 26.939  40.456 1.00 35.75 ? 73   ILE A O   1 
ATOM   505  C  CB  . ILE A 1 71  ? 31.412 25.235  38.203 1.00 36.24 ? 73   ILE A CB  1 
ATOM   506  C  CG1 . ILE A 1 71  ? 31.904 23.865  37.727 1.00 37.10 ? 73   ILE A CG1 1 
ATOM   507  C  CG2 . ILE A 1 71  ? 31.919 26.376  37.304 1.00 36.55 ? 73   ILE A CG2 1 
ATOM   508  C  CD1 . ILE A 1 71  ? 31.237 23.389  36.474 1.00 38.04 ? 73   ILE A CD1 1 
ATOM   509  N  N   . VAL A 1 72  ? 32.214 27.800  40.209 1.00 35.98 ? 74   VAL A N   1 
ATOM   510  C  CA  . VAL A 1 72  ? 31.851 29.120  40.716 1.00 35.93 ? 74   VAL A CA  1 
ATOM   511  C  C   . VAL A 1 72  ? 32.207 30.208  39.703 1.00 35.86 ? 74   VAL A C   1 
ATOM   512  O  O   . VAL A 1 72  ? 32.854 29.932  38.696 1.00 35.73 ? 74   VAL A O   1 
ATOM   513  C  CB  . VAL A 1 72  ? 32.517 29.415  42.095 1.00 36.08 ? 74   VAL A CB  1 
ATOM   514  C  CG1 . VAL A 1 72  ? 32.221 28.278  43.092 1.00 36.69 ? 74   VAL A CG1 1 
ATOM   515  C  CG2 . VAL A 1 72  ? 34.025 29.634  41.948 1.00 36.05 ? 74   VAL A CG2 1 
ATOM   516  N  N   . GLY A 1 73  ? 31.751 31.426  39.965 1.00 35.68 ? 75   GLY A N   1 
ATOM   517  C  CA  . GLY A 1 73  ? 32.068 32.578  39.115 1.00 36.03 ? 75   GLY A CA  1 
ATOM   518  C  C   . GLY A 1 73  ? 31.311 32.571  37.809 1.00 36.11 ? 75   GLY A C   1 
ATOM   519  O  O   . GLY A 1 73  ? 31.783 33.115  36.804 1.00 36.03 ? 75   GLY A O   1 
ATOM   520  N  N   . LEU A 1 74  ? 30.131 31.955  37.829 1.00 35.17 ? 76   LEU A N   1 
ATOM   521  C  CA  . LEU A 1 74  ? 29.275 31.883  36.651 1.00 35.21 ? 76   LEU A CA  1 
ATOM   522  C  C   . LEU A 1 74  ? 28.353 33.093  36.540 1.00 35.16 ? 76   LEU A C   1 
ATOM   523  O  O   . LEU A 1 74  ? 28.155 33.824  37.510 1.00 34.92 ? 76   LEU A O   1 
ATOM   524  C  CB  . LEU A 1 74  ? 28.441 30.608  36.692 1.00 34.84 ? 76   LEU A CB  1 
ATOM   525  C  CG  . LEU A 1 74  ? 29.234 29.308  36.820 1.00 35.47 ? 76   LEU A CG  1 
ATOM   526  C  CD1 . LEU A 1 74  ? 28.278 28.135  36.932 1.00 34.58 ? 76   LEU A CD1 1 
ATOM   527  C  CD2 . LEU A 1 74  ? 30.189 29.142  35.641 1.00 35.95 ? 76   LEU A CD2 1 
ATOM   528  N  N   . LYS A 1 75  ? 27.800 33.292  35.347 1.00 35.41 ? 77   LYS A N   1 
ATOM   529  C  CA  . LYS A 1 75  ? 26.867 34.381  35.084 1.00 35.75 ? 77   LYS A CA  1 
ATOM   530  C  C   . LYS A 1 75  ? 25.443 33.856  35.271 1.00 35.44 ? 77   LYS A C   1 
ATOM   531  O  O   . LYS A 1 75  ? 25.144 32.728  34.859 1.00 34.90 ? 77   LYS A O   1 
ATOM   532  C  CB  . LYS A 1 75  ? 27.050 34.914  33.660 1.00 35.87 ? 77   LYS A CB  1 
ATOM   533  C  CG  . LYS A 1 75  ? 28.409 35.561  33.392 1.00 36.48 ? 77   LYS A CG  1 
ATOM   534  C  CD  . LYS A 1 75  ? 28.512 36.060  31.959 1.00 37.38 ? 77   LYS A CD  1 
ATOM   535  C  CE  . LYS A 1 75  ? 29.858 36.746  31.700 1.00 39.55 ? 77   LYS A CE  1 
ATOM   536  N  NZ  . LYS A 1 75  ? 29.991 37.205  30.292 1.00 40.69 ? 77   LYS A NZ  1 
ATOM   537  N  N   . PRO A 1 76  ? 24.564 34.657  35.906 1.00 35.23 ? 78   PRO A N   1 
ATOM   538  C  CA  . PRO A 1 76  ? 23.174 34.218  36.088 1.00 35.29 ? 78   PRO A CA  1 
ATOM   539  C  C   . PRO A 1 76  ? 22.449 34.115  34.751 1.00 35.17 ? 78   PRO A C   1 
ATOM   540  O  O   . PRO A 1 76  ? 22.866 34.749  33.784 1.00 34.68 ? 78   PRO A O   1 
ATOM   541  C  CB  . PRO A 1 76  ? 22.551 35.334  36.945 1.00 35.32 ? 78   PRO A CB  1 
ATOM   542  C  CG  . PRO A 1 76  ? 23.720 36.088  37.528 1.00 36.00 ? 78   PRO A CG  1 
ATOM   543  C  CD  . PRO A 1 76  ? 24.799 35.990  36.491 1.00 35.70 ? 78   PRO A CD  1 
ATOM   544  N  N   . GLU A 1 77  ? 21.386 33.310  34.702 1.00 35.20 ? 79   GLU A N   1 
ATOM   545  C  CA  . GLU A 1 77  ? 20.563 33.155  33.493 1.00 35.51 ? 79   GLU A CA  1 
ATOM   546  C  C   . GLU A 1 77  ? 21.393 32.816  32.249 1.00 35.10 ? 79   GLU A C   1 
ATOM   547  O  O   . GLU A 1 77  ? 21.104 33.293  31.148 1.00 34.83 ? 79   GLU A O   1 
ATOM   548  C  CB  . GLU A 1 77  ? 19.713 34.414  33.249 1.00 35.25 ? 79   GLU A CB  1 
ATOM   549  C  CG  . GLU A 1 77  ? 18.650 34.657  34.311 1.00 36.62 ? 79   GLU A CG  1 
ATOM   550  C  CD  . GLU A 1 77  ? 17.800 35.885  34.050 1.00 36.67 ? 79   GLU A CD  1 
ATOM   551  O  OE1 . GLU A 1 77  ? 18.315 36.886  33.504 1.00 39.05 ? 79   GLU A OE1 1 
ATOM   552  O  OE2 . GLU A 1 77  ? 16.606 35.856  34.410 1.00 39.73 ? 79   GLU A OE2 1 
ATOM   553  N  N   . THR A 1 78  ? 22.417 31.988  32.435 1.00 34.90 ? 80   THR A N   1 
ATOM   554  C  CA  . THR A 1 78  ? 23.343 31.638  31.358 1.00 34.63 ? 80   THR A CA  1 
ATOM   555  C  C   . THR A 1 78  ? 23.452 30.127  31.199 1.00 34.48 ? 80   THR A C   1 
ATOM   556  O  O   . THR A 1 78  ? 23.525 29.388  32.193 1.00 34.33 ? 80   THR A O   1 
ATOM   557  C  CB  . THR A 1 78  ? 24.745 32.255  31.613 1.00 34.68 ? 80   THR A CB  1 
ATOM   558  O  OG1 . THR A 1 78  ? 24.629 33.681  31.699 1.00 33.92 ? 80   THR A OG1 1 
ATOM   559  C  CG2 . THR A 1 78  ? 25.740 31.897  30.499 1.00 34.80 ? 80   THR A CG2 1 
ATOM   560  N  N   . THR A 1 79  ? 23.448 29.668  29.950 1.00 34.11 ? 81   THR A N   1 
ATOM   561  C  CA  . THR A 1 79  ? 23.604 28.243  29.670 1.00 34.17 ? 81   THR A CA  1 
ATOM   562  C  C   . THR A 1 79  ? 25.077 27.889  29.485 1.00 34.09 ? 81   THR A C   1 
ATOM   563  O  O   . THR A 1 79  ? 25.799 28.574  28.763 1.00 34.20 ? 81   THR A O   1 
ATOM   564  C  CB  . THR A 1 79  ? 22.748 27.796  28.467 1.00 34.34 ? 81   THR A CB  1 
ATOM   565  O  OG1 . THR A 1 79  ? 21.369 28.056  28.754 1.00 34.50 ? 81   THR A OG1 1 
ATOM   566  C  CG2 . THR A 1 79  ? 22.918 26.302  28.191 1.00 34.62 ? 81   THR A CG2 1 
ATOM   567  N  N   . TYR A 1 80  ? 25.507 26.836  30.180 1.00 33.85 ? 82   TYR A N   1 
ATOM   568  C  CA  . TYR A 1 80  ? 26.876 26.334  30.136 1.00 33.90 ? 82   TYR A CA  1 
ATOM   569  C  C   . TYR A 1 80  ? 26.938 24.863  29.761 1.00 33.90 ? 82   TYR A C   1 
ATOM   570  O  O   . TYR A 1 80  ? 26.062 24.084  30.128 1.00 33.47 ? 82   TYR A O   1 
ATOM   571  C  CB  . TYR A 1 80  ? 27.543 26.455  31.511 1.00 33.74 ? 82   TYR A CB  1 
ATOM   572  C  CG  . TYR A 1 80  ? 27.793 27.864  31.958 1.00 33.77 ? 82   TYR A CG  1 
ATOM   573  C  CD1 . TYR A 1 80  ? 29.007 28.490  31.689 1.00 33.02 ? 82   TYR A CD1 1 
ATOM   574  C  CD2 . TYR A 1 80  ? 26.813 28.579  32.643 1.00 33.58 ? 82   TYR A CD2 1 
ATOM   575  C  CE1 . TYR A 1 80  ? 29.236 29.800  32.087 1.00 33.82 ? 82   TYR A CE1 1 
ATOM   576  C  CE2 . TYR A 1 80  ? 27.034 29.884  33.053 1.00 33.65 ? 82   TYR A CE2 1 
ATOM   577  C  CZ  . TYR A 1 80  ? 28.250 30.488  32.773 1.00 33.32 ? 82   TYR A CZ  1 
ATOM   578  O  OH  . TYR A 1 80  ? 28.470 31.784  33.164 1.00 34.62 ? 82   TYR A OH  1 
ATOM   579  N  N   . ALA A 1 81  ? 27.984 24.501  29.028 1.00 33.68 ? 83   ALA A N   1 
ATOM   580  C  CA  . ALA A 1 81  ? 28.334 23.112  28.829 1.00 33.80 ? 83   ALA A CA  1 
ATOM   581  C  C   . ALA A 1 81  ? 29.306 22.821  29.948 1.00 34.13 ? 83   ALA A C   1 
ATOM   582  O  O   . ALA A 1 81  ? 30.038 23.712  30.382 1.00 33.86 ? 83   ALA A O   1 
ATOM   583  C  CB  . ALA A 1 81  ? 29.027 22.919  27.481 1.00 33.74 ? 83   ALA A CB  1 
ATOM   584  N  N   . VAL A 1 82  ? 29.306 21.591  30.442 1.00 34.16 ? 84   VAL A N   1 
ATOM   585  C  CA  . VAL A 1 82  ? 30.253 21.215  31.476 1.00 34.73 ? 84   VAL A CA  1 
ATOM   586  C  C   . VAL A 1 82  ? 30.721 19.787  31.229 1.00 35.12 ? 84   VAL A C   1 
ATOM   587  O  O   . VAL A 1 82  ? 29.946 18.931  30.776 1.00 34.80 ? 84   VAL A O   1 
ATOM   588  C  CB  . VAL A 1 82  ? 29.677 21.402  32.917 1.00 34.55 ? 84   VAL A CB  1 
ATOM   589  C  CG1 . VAL A 1 82  ? 28.408 20.577  33.132 1.00 34.83 ? 84   VAL A CG1 1 
ATOM   590  C  CG2 . VAL A 1 82  ? 30.732 21.071  33.982 1.00 35.73 ? 84   VAL A CG2 1 
ATOM   591  N  N   . ARG A 1 83  ? 31.999 19.551  31.490 1.00 34.99 ? 85   ARG A N   1 
ATOM   592  C  CA  . ARG A 1 83  ? 32.570 18.217  31.355 1.00 35.45 ? 85   ARG A CA  1 
ATOM   593  C  C   . ARG A 1 83  ? 33.646 18.023  32.412 1.00 35.69 ? 85   ARG A C   1 
ATOM   594  O  O   . ARG A 1 83  ? 34.136 19.000  33.007 1.00 35.23 ? 85   ARG A O   1 
ATOM   595  C  CB  . ARG A 1 83  ? 33.136 18.001  29.951 1.00 35.16 ? 85   ARG A CB  1 
ATOM   596  C  CG  . ARG A 1 83  ? 34.158 19.038  29.531 1.00 35.70 ? 85   ARG A CG  1 
ATOM   597  C  CD  . ARG A 1 83  ? 34.466 18.911  28.052 1.00 37.03 ? 85   ARG A CD  1 
ATOM   598  N  NE  . ARG A 1 83  ? 35.593 19.747  27.657 1.00 36.79 ? 85   ARG A NE  1 
ATOM   599  C  CZ  . ARG A 1 83  ? 36.000 19.917  26.401 1.00 37.48 ? 85   ARG A CZ  1 
ATOM   600  N  NH1 . ARG A 1 83  ? 35.375 19.301  25.405 1.00 37.11 ? 85   ARG A NH1 1 
ATOM   601  N  NH2 . ARG A 1 83  ? 37.042 20.703  26.142 1.00 36.72 ? 85   ARG A NH2 1 
ATOM   602  N  N   . LEU A 1 84  ? 34.007 16.764  32.634 1.00 35.75 ? 86   LEU A N   1 
ATOM   603  C  CA  . LEU A 1 84  ? 34.909 16.385  33.711 1.00 37.37 ? 86   LEU A CA  1 
ATOM   604  C  C   . LEU A 1 84  ? 35.880 15.310  33.286 1.00 37.17 ? 86   LEU A C   1 
ATOM   605  O  O   . LEU A 1 84  ? 35.541 14.449  32.491 1.00 37.22 ? 86   LEU A O   1 
ATOM   606  C  CB  . LEU A 1 84  ? 34.087 15.808  34.866 1.00 37.84 ? 86   LEU A CB  1 
ATOM   607  C  CG  . LEU A 1 84  ? 33.595 16.563  36.085 1.00 43.05 ? 86   LEU A CG  1 
ATOM   608  C  CD1 . LEU A 1 84  ? 33.224 18.018  35.838 1.00 45.17 ? 86   LEU A CD1 1 
ATOM   609  C  CD2 . LEU A 1 84  ? 32.419 15.788  36.621 1.00 44.48 ? 86   LEU A CD2 1 
ATOM   610  N  N   . ALA A 1 85  ? 37.092 15.370  33.822 1.00 37.30 ? 87   ALA A N   1 
ATOM   611  C  CA  . ALA A 1 85  ? 38.072 14.315  33.635 1.00 37.02 ? 87   ALA A CA  1 
ATOM   612  C  C   . ALA A 1 85  ? 38.671 13.960  34.993 1.00 37.32 ? 87   ALA A C   1 
ATOM   613  O  O   . ALA A 1 85  ? 38.724 14.796  35.902 1.00 36.77 ? 87   ALA A O   1 
ATOM   614  C  CB  . ALA A 1 85  ? 39.151 14.740  32.672 1.00 37.38 ? 87   ALA A CB  1 
ATOM   615  N  N   . ALA A 1 86  ? 39.114 12.715  35.117 1.00 37.02 ? 88   ALA A N   1 
ATOM   616  C  CA  . ALA A 1 86  ? 39.761 12.226  36.325 1.00 37.24 ? 88   ALA A CA  1 
ATOM   617  C  C   . ALA A 1 86  ? 41.251 12.037  36.073 1.00 37.17 ? 88   ALA A C   1 
ATOM   618  O  O   . ALA A 1 86  ? 41.665 11.699  34.963 1.00 37.56 ? 88   ALA A O   1 
ATOM   619  C  CB  . ALA A 1 86  ? 39.126 10.906  36.772 1.00 36.68 ? 88   ALA A CB  1 
ATOM   620  N  N   . LEU A 1 87  ? 42.044 12.256  37.115 1.00 37.08 ? 89   LEU A N   1 
ATOM   621  C  CA  . LEU A 1 87  ? 43.487 12.098  37.064 1.00 37.71 ? 89   LEU A CA  1 
ATOM   622  C  C   . LEU A 1 87  ? 43.927 11.091  38.115 1.00 37.73 ? 89   LEU A C   1 
ATOM   623  O  O   . LEU A 1 87  ? 43.506 11.170  39.264 1.00 37.55 ? 89   LEU A O   1 
ATOM   624  C  CB  . LEU A 1 87  ? 44.184 13.441  37.353 1.00 37.31 ? 89   LEU A CB  1 
ATOM   625  C  CG  . LEU A 1 87  ? 45.678 13.438  37.731 1.00 38.47 ? 89   LEU A CG  1 
ATOM   626  C  CD1 . LEU A 1 87  ? 46.561 13.235  36.516 1.00 38.41 ? 89   LEU A CD1 1 
ATOM   627  C  CD2 . LEU A 1 87  ? 46.079 14.736  38.423 1.00 38.47 ? 89   LEU A CD2 1 
ATOM   628  N  N   . ASN A 1 88  ? 44.773 10.149  37.715 1.00 38.18 ? 90   ASN A N   1 
ATOM   629  C  CA  . ASN A 1 88  ? 45.414 9.257   38.672 1.00 38.68 ? 90   ASN A CA  1 
ATOM   630  C  C   . ASN A 1 88  ? 46.925 9.324   38.477 1.00 39.18 ? 90   ASN A C   1 
ATOM   631  O  O   . ASN A 1 88  ? 47.420 10.226  37.792 1.00 38.97 ? 90   ASN A O   1 
ATOM   632  C  CB  . ASN A 1 88  ? 44.858 7.823   38.587 1.00 38.63 ? 90   ASN A CB  1 
ATOM   633  C  CG  . ASN A 1 88  ? 45.096 7.164   37.237 1.00 38.83 ? 90   ASN A CG  1 
ATOM   634  O  OD1 . ASN A 1 88  ? 45.830 7.678   36.390 1.00 39.39 ? 90   ASN A OD1 1 
ATOM   635  N  ND2 . ASN A 1 88  ? 44.468 6.012   37.033 1.00 37.83 ? 90   ASN A ND2 1 
ATOM   636  N  N   . GLY A 1 89  ? 47.653 8.385   39.076 1.00 39.71 ? 91   GLY A N   1 
ATOM   637  C  CA  . GLY A 1 89  ? 49.112 8.332   38.951 1.00 40.49 ? 91   GLY A CA  1 
ATOM   638  C  C   . GLY A 1 89  ? 49.614 8.155   37.527 1.00 40.92 ? 91   GLY A C   1 
ATOM   639  O  O   . GLY A 1 89  ? 50.722 8.587   37.197 1.00 40.98 ? 91   GLY A O   1 
ATOM   640  N  N   . LYS A 1 90  ? 48.795 7.526   36.683 1.00 41.25 ? 92   LYS A N   1 
ATOM   641  C  CA  . LYS A 1 90  ? 49.146 7.277   35.283 1.00 41.45 ? 92   LYS A CA  1 
ATOM   642  C  C   . LYS A 1 90  ? 48.906 8.499   34.389 1.00 41.45 ? 92   LYS A C   1 
ATOM   643  O  O   . LYS A 1 90  ? 49.456 8.588   33.288 1.00 41.60 ? 92   LYS A O   1 
ATOM   644  C  CB  . LYS A 1 90  ? 48.395 6.055   34.751 1.00 41.60 ? 92   LYS A CB  1 
ATOM   645  N  N   . GLY A 1 91  ? 48.086 9.433   34.864 1.00 41.38 ? 93   GLY A N   1 
ATOM   646  C  CA  . GLY A 1 91  ? 47.814 10.666  34.131 1.00 41.08 ? 93   GLY A CA  1 
ATOM   647  C  C   . GLY A 1 91  ? 46.350 11.052  34.067 1.00 40.93 ? 93   GLY A C   1 
ATOM   648  O  O   . GLY A 1 91  ? 45.488 10.405  34.675 1.00 40.77 ? 93   GLY A O   1 
ATOM   649  N  N   . LEU A 1 92  ? 46.077 12.129  33.335 1.00 40.73 ? 94   LEU A N   1 
ATOM   650  C  CA  . LEU A 1 92  ? 44.718 12.615  33.148 1.00 40.51 ? 94   LEU A CA  1 
ATOM   651  C  C   . LEU A 1 92  ? 43.997 11.707  32.155 1.00 40.48 ? 94   LEU A C   1 
ATOM   652  O  O   . LEU A 1 92  ? 44.517 11.420  31.075 1.00 40.45 ? 94   LEU A O   1 
ATOM   653  C  CB  . LEU A 1 92  ? 44.732 14.065  32.651 1.00 40.49 ? 94   LEU A CB  1 
ATOM   654  C  CG  . LEU A 1 92  ? 43.423 14.861  32.596 1.00 40.31 ? 94   LEU A CG  1 
ATOM   655  C  CD1 . LEU A 1 92  ? 42.770 14.974  33.963 1.00 38.78 ? 94   LEU A CD1 1 
ATOM   656  C  CD2 . LEU A 1 92  ? 43.672 16.248  32.004 1.00 40.48 ? 94   LEU A CD2 1 
ATOM   657  N  N   . GLY A 1 93  ? 42.809 11.250  32.536 1.00 40.23 ? 95   GLY A N   1 
ATOM   658  C  CA  . GLY A 1 93  ? 42.014 10.367  31.695 1.00 40.41 ? 95   GLY A CA  1 
ATOM   659  C  C   . GLY A 1 93  ? 41.192 11.138  30.685 1.00 40.36 ? 95   GLY A C   1 
ATOM   660  O  O   . GLY A 1 93  ? 41.255 12.368  30.632 1.00 40.39 ? 95   GLY A O   1 
ATOM   661  N  N   . GLU A 1 94  ? 40.418 10.410  29.885 1.00 40.29 ? 96   GLU A N   1 
ATOM   662  C  CA  . GLU A 1 94  ? 39.567 11.009  28.859 1.00 40.38 ? 96   GLU A CA  1 
ATOM   663  C  C   . GLU A 1 94  ? 38.502 11.894  29.491 1.00 40.43 ? 96   GLU A C   1 
ATOM   664  O  O   . GLU A 1 94  ? 37.960 11.569  30.552 1.00 40.37 ? 96   GLU A O   1 
ATOM   665  C  CB  . GLU A 1 94  ? 38.920 9.926   27.995 1.00 40.28 ? 96   GLU A CB  1 
ATOM   666  N  N   . ILE A 1 95  ? 38.232 13.025  28.842 1.00 40.43 ? 97   ILE A N   1 
ATOM   667  C  CA  . ILE A 1 95  ? 37.218 13.964  29.297 1.00 40.61 ? 97   ILE A CA  1 
ATOM   668  C  C   . ILE A 1 95  ? 35.833 13.328  29.120 1.00 40.07 ? 97   ILE A C   1 
ATOM   669  O  O   . ILE A 1 95  ? 35.627 12.527  28.210 1.00 40.28 ? 97   ILE A O   1 
ATOM   670  C  CB  . ILE A 1 95  ? 37.342 15.342  28.559 1.00 40.80 ? 97   ILE A CB  1 
ATOM   671  C  CG1 . ILE A 1 95  ? 36.603 16.446  29.311 1.00 41.76 ? 97   ILE A CG1 1 
ATOM   672  C  CG2 . ILE A 1 95  ? 36.915 15.260  27.076 1.00 41.93 ? 97   ILE A CG2 1 
ATOM   673  C  CD1 . ILE A 1 95  ? 37.392 17.070  30.456 1.00 43.89 ? 97   ILE A CD1 1 
ATOM   674  N  N   . SER A 1 96  ? 34.896 13.657  30.003 1.00 39.22 ? 98   SER A N   1 
ATOM   675  C  CA  . SER A 1 96  ? 33.548 13.110  29.907 1.00 38.60 ? 98   SER A CA  1 
ATOM   676  C  C   . SER A 1 96  ? 32.802 13.742  28.748 1.00 38.37 ? 98   SER A C   1 
ATOM   677  O  O   . SER A 1 96  ? 33.231 14.764  28.197 1.00 37.64 ? 98   SER A O   1 
ATOM   678  C  CB  . SER A 1 96  ? 32.761 13.429  31.170 1.00 38.54 ? 98   SER A CB  1 
ATOM   679  O  OG  . SER A 1 96  ? 32.465 14.815  31.213 1.00 37.36 ? 98   SER A OG  1 
ATOM   680  N  N   . ALA A 1 97  ? 31.669 13.134  28.403 1.00 38.07 ? 99   ALA A N   1 
ATOM   681  C  CA  . ALA A 1 97  ? 30.731 13.742  27.492 1.00 38.01 ? 99   ALA A CA  1 
ATOM   682  C  C   . ALA A 1 97  ? 30.265 15.004  28.208 1.00 38.07 ? 99   ALA A C   1 
ATOM   683  O  O   . ALA A 1 97  ? 30.273 15.072  29.453 1.00 37.92 ? 99   ALA A O   1 
ATOM   684  C  CB  . ALA A 1 97  ? 29.562 12.807  27.226 1.00 38.22 ? 99   ALA A CB  1 
ATOM   685  N  N   . ALA A 1 98  ? 29.896 16.015  27.436 1.00 37.73 ? 100  ALA A N   1 
ATOM   686  C  CA  . ALA A 1 98  ? 29.449 17.255  28.028 1.00 37.95 ? 100  ALA A CA  1 
ATOM   687  C  C   . ALA A 1 98  ? 28.021 17.115  28.524 1.00 38.04 ? 100  ALA A C   1 
ATOM   688  O  O   . ALA A 1 98  ? 27.201 16.393  27.940 1.00 37.36 ? 100  ALA A O   1 
ATOM   689  C  CB  . ALA A 1 98  ? 29.555 18.397  27.030 1.00 38.08 ? 100  ALA A CB  1 
ATOM   690  N  N   . SER A 1 99  ? 27.761 17.759  29.648 1.00 38.21 ? 101  SER A N   1 
ATOM   691  C  CA  . SER A 1 99  ? 26.414 17.944  30.137 1.00 38.50 ? 101  SER A CA  1 
ATOM   692  C  C   . SER A 1 99  ? 26.189 19.437  30.049 1.00 38.26 ? 101  SER A C   1 
ATOM   693  O  O   . SER A 1 99  ? 27.074 20.173  29.608 1.00 38.28 ? 101  SER A O   1 
ATOM   694  C  CB  . SER A 1 99  ? 26.270 17.431  31.562 1.00 38.49 ? 101  SER A CB  1 
ATOM   695  O  OG  . SER A 1 99  ? 26.385 16.022  31.557 1.00 41.79 ? 101  SER A OG  1 
ATOM   696  N  N   . GLU A 1 100 ? 25.008 19.892  30.423 1.00 38.16 ? 102  GLU A N   1 
ATOM   697  C  CA  . GLU A 1 100 ? 24.728 21.317  30.367 1.00 38.56 ? 102  GLU A CA  1 
ATOM   698  C  C   . GLU A 1 100 ? 23.782 21.705  31.487 1.00 38.96 ? 102  GLU A C   1 
ATOM   699  O  O   . GLU A 1 100 ? 23.090 20.851  32.053 1.00 38.60 ? 102  GLU A O   1 
ATOM   700  C  CB  . GLU A 1 100 ? 24.131 21.701  29.016 1.00 38.51 ? 102  GLU A CB  1 
ATOM   701  C  CG  . GLU A 1 100 ? 22.739 21.154  28.766 1.00 37.71 ? 102  GLU A CG  1 
ATOM   702  C  CD  . GLU A 1 100 ? 22.162 21.648  27.464 1.00 36.76 ? 102  GLU A CD  1 
ATOM   703  O  OE1 . GLU A 1 100 ? 22.639 21.206  26.393 1.00 35.06 ? 102  GLU A OE1 1 
ATOM   704  O  OE2 . GLU A 1 100 ? 21.219 22.468  27.511 1.00 35.67 ? 102  GLU A OE2 1 
ATOM   705  N  N   . PHE A 1 101 ? 23.750 22.996  31.789 1.00 39.02 ? 103  PHE A N   1 
ATOM   706  C  CA  . PHE A 1 101 ? 22.864 23.513  32.820 1.00 39.37 ? 103  PHE A CA  1 
ATOM   707  C  C   . PHE A 1 101 ? 22.672 24.986  32.542 1.00 39.46 ? 103  PHE A C   1 
ATOM   708  O  O   . PHE A 1 101 ? 23.465 25.596  31.824 1.00 39.50 ? 103  PHE A O   1 
ATOM   709  C  CB  . PHE A 1 101 ? 23.462 23.304  34.221 1.00 39.60 ? 103  PHE A CB  1 
ATOM   710  C  CG  . PHE A 1 101 ? 24.797 23.974  34.426 1.00 40.42 ? 103  PHE A CG  1 
ATOM   711  C  CD1 . PHE A 1 101 ? 24.870 25.293  34.869 1.00 40.35 ? 103  PHE A CD1 1 
ATOM   712  C  CD2 . PHE A 1 101 ? 25.984 23.283  34.183 1.00 41.00 ? 103  PHE A CD2 1 
ATOM   713  C  CE1 . PHE A 1 101 ? 26.097 25.920  35.047 1.00 41.47 ? 103  PHE A CE1 1 
ATOM   714  C  CE2 . PHE A 1 101 ? 27.223 23.903  34.361 1.00 40.87 ? 103  PHE A CE2 1 
ATOM   715  C  CZ  . PHE A 1 101 ? 27.282 25.222  34.800 1.00 41.98 ? 103  PHE A CZ  1 
ATOM   716  N  N   . LYS A 1 102 ? 21.610 25.557  33.097 1.00 39.25 ? 104  LYS A N   1 
ATOM   717  C  CA  . LYS A 1 102 ? 21.401 26.984  32.969 1.00 39.09 ? 104  LYS A CA  1 
ATOM   718  C  C   . LYS A 1 102 ? 21.342 27.544  34.381 1.00 38.80 ? 104  LYS A C   1 
ATOM   719  O  O   . LYS A 1 102 ? 20.564 27.079  35.210 1.00 38.14 ? 104  LYS A O   1 
ATOM   720  C  CB  . LYS A 1 102 ? 20.131 27.302  32.179 1.00 38.84 ? 104  LYS A CB  1 
ATOM   721  C  CG  . LYS A 1 102 ? 19.888 28.799  31.990 1.00 39.37 ? 104  LYS A CG  1 
ATOM   722  C  CD  . LYS A 1 102 ? 18.703 29.079  31.077 1.00 39.65 ? 104  LYS A CD  1 
ATOM   723  C  CE  . LYS A 1 102 ? 18.478 30.577  30.950 1.00 41.14 ? 104  LYS A CE  1 
ATOM   724  N  NZ  . LYS A 1 102 ? 17.489 30.912  29.889 1.00 42.71 ? 104  LYS A NZ  1 
ATOM   725  N  N   . THR A 1 103 ? 22.185 28.534  34.651 1.00 38.22 ? 105  THR A N   1 
ATOM   726  C  CA  . THR A 1 103 ? 22.194 29.167  35.957 1.00 38.01 ? 105  THR A CA  1 
ATOM   727  C  C   . THR A 1 103 ? 20.892 29.940  36.159 1.00 37.50 ? 105  THR A C   1 
ATOM   728  O  O   . THR A 1 103 ? 20.298 30.449  35.201 1.00 37.05 ? 105  THR A O   1 
ATOM   729  C  CB  . THR A 1 103 ? 23.383 30.127  36.103 1.00 37.96 ? 105  THR A CB  1 
ATOM   730  O  OG1 . THR A 1 103 ? 23.416 30.995  34.970 1.00 37.96 ? 105  THR A OG1 1 
ATOM   731  C  CG2 . THR A 1 103 ? 24.709 29.349  36.193 1.00 38.30 ? 105  THR A CG2 1 
ATOM   732  N  N   . GLN A 1 104 ? 20.453 30.009  37.410 1.00 37.44 ? 106  GLN A N   1 
ATOM   733  C  CA  . GLN A 1 104 ? 19.226 30.703  37.775 1.00 37.23 ? 106  GLN A CA  1 
ATOM   734  C  C   . GLN A 1 104 ? 19.432 32.222  37.762 1.00 36.90 ? 106  GLN A C   1 
ATOM   735  O  O   . GLN A 1 104 ? 20.573 32.696  37.730 1.00 36.52 ? 106  GLN A O   1 
ATOM   736  C  CB  . GLN A 1 104 ? 18.797 30.260  39.175 1.00 37.34 ? 106  GLN A CB  1 
ATOM   737  C  CG  . GLN A 1 104 ? 18.535 28.761  39.323 1.00 38.07 ? 106  GLN A CG  1 
ATOM   738  C  CD  . GLN A 1 104 ? 18.301 28.335  40.767 1.00 38.35 ? 106  GLN A CD  1 
ATOM   739  O  OE1 . GLN A 1 104 ? 18.372 29.145  41.691 1.00 39.30 ? 106  GLN A OE1 1 
ATOM   740  N  NE2 . GLN A 1 104 ? 18.021 27.052  40.964 1.00 40.84 ? 106  GLN A NE2 1 
ATOM   741  N  N   . PRO A 1 105 ? 18.329 32.998  37.762 1.00 36.71 ? 107  PRO A N   1 
ATOM   742  C  CA  . PRO A 1 105 ? 18.532 34.425  37.972 1.00 36.58 ? 107  PRO A CA  1 
ATOM   743  C  C   . PRO A 1 105 ? 18.895 34.670  39.436 1.00 36.55 ? 107  PRO A C   1 
ATOM   744  O  O   . PRO A 1 105 ? 18.668 33.798  40.283 1.00 36.23 ? 107  PRO A O   1 
ATOM   745  C  CB  . PRO A 1 105 ? 17.161 35.031  37.650 1.00 36.72 ? 107  PRO A CB  1 
ATOM   746  C  CG  . PRO A 1 105 ? 16.187 33.932  37.865 1.00 36.88 ? 107  PRO A CG  1 
ATOM   747  C  CD  . PRO A 1 105 ? 16.908 32.656  37.548 1.00 36.69 ? 107  PRO A CD  1 
ATOM   748  N  N   . VAL A 1 106 ? 19.472 35.830  39.727 1.00 36.53 ? 108  VAL A N   1 
ATOM   749  C  CA  . VAL A 1 106 ? 19.787 36.197  41.106 1.00 36.79 ? 108  VAL A CA  1 
ATOM   750  C  C   . VAL A 1 106 ? 18.486 36.156  41.910 1.00 36.87 ? 108  VAL A C   1 
ATOM   751  O  O   . VAL A 1 106 ? 17.508 36.826  41.562 1.00 37.01 ? 108  VAL A O   1 
ATOM   752  C  CB  . VAL A 1 106 ? 20.475 37.580  41.188 1.00 36.80 ? 108  VAL A CB  1 
ATOM   753  C  CG1 . VAL A 1 106 ? 20.650 38.020  42.637 1.00 36.87 ? 108  VAL A CG1 1 
ATOM   754  C  CG2 . VAL A 1 106 ? 21.828 37.533  40.477 1.00 36.65 ? 108  VAL A CG2 1 
ATOM   755  N  N   . ARG A 1 107 ? 18.473 35.337  42.960 1.00 36.99 ? 109  ARG A N   1 
ATOM   756  C  CA  . ARG A 1 107 ? 17.265 35.125  43.763 1.00 37.10 ? 109  ARG A CA  1 
ATOM   757  C  C   . ARG A 1 107 ? 16.770 36.408  44.427 1.00 37.10 ? 109  ARG A C   1 
ATOM   758  O  O   . ARG A 1 107 ? 17.561 37.294  44.765 1.00 36.90 ? 109  ARG A O   1 
ATOM   759  C  CB  . ARG A 1 107 ? 17.476 34.007  44.799 1.00 37.08 ? 109  ARG A CB  1 
ATOM   760  C  CG  . ARG A 1 107 ? 18.359 34.375  45.991 1.00 37.25 ? 109  ARG A CG  1 
ATOM   761  C  CD  . ARG A 1 107 ? 18.804 33.144  46.775 1.00 37.28 ? 109  ARG A CD  1 
ATOM   762  N  NE  . ARG A 1 107 ? 17.688 32.361  47.307 1.00 37.22 ? 109  ARG A NE  1 
ATOM   763  C  CZ  . ARG A 1 107 ? 17.822 31.217  47.974 1.00 37.21 ? 109  ARG A CZ  1 
ATOM   764  N  NH1 . ARG A 1 107 ? 19.026 30.706  48.199 1.00 37.21 ? 109  ARG A NH1 1 
ATOM   765  N  NH2 . ARG A 1 107 ? 16.749 30.577  48.417 1.00 37.18 ? 109  ARG A NH2 1 
ATOM   766  N  N   . GLU A 1 108 ? 15.451 36.499  44.582 1.00 37.14 ? 110  GLU A N   1 
ATOM   767  C  CA  . GLU A 1 108 ? 14.816 37.638  45.232 1.00 37.22 ? 110  GLU A CA  1 
ATOM   768  C  C   . GLU A 1 108 ? 15.142 37.598  46.726 1.00 37.29 ? 110  GLU A C   1 
ATOM   769  O  O   . GLU A 1 108 ? 14.847 36.600  47.392 1.00 37.24 ? 110  GLU A O   1 
ATOM   770  C  CB  . GLU A 1 108 ? 13.303 37.593  45.003 1.00 37.18 ? 110  GLU A CB  1 
ATOM   771  C  CG  . GLU A 1 108 ? 12.541 38.820  45.475 1.00 37.21 ? 110  GLU A CG  1 
ATOM   772  C  CD  . GLU A 1 108 ? 11.043 38.716  45.220 1.00 37.16 ? 110  GLU A CD  1 
ATOM   773  O  OE1 . GLU A 1 108 ? 10.286 39.515  45.810 1.00 37.29 ? 110  GLU A OE1 1 
ATOM   774  O  OE2 . GLU A 1 108 ? 10.622 37.837  44.434 1.00 36.63 ? 110  GLU A OE2 1 
ATOM   775  N  N   . PRO A 1 109 ? 15.771 38.675  47.248 1.00 37.38 ? 111  PRO A N   1 
ATOM   776  C  CA  . PRO A 1 109 ? 16.149 38.773  48.664 1.00 37.45 ? 111  PRO A CA  1 
ATOM   777  C  C   . PRO A 1 109 ? 14.983 38.495  49.616 1.00 37.49 ? 111  PRO A C   1 
ATOM   778  O  O   . PRO A 1 109 ? 13.870 38.983  49.397 1.00 37.49 ? 111  PRO A O   1 
ATOM   779  C  CB  . PRO A 1 109 ? 16.618 40.227  48.802 1.00 37.46 ? 111  PRO A CB  1 
ATOM   780  C  CG  . PRO A 1 109 ? 17.088 40.596  47.442 1.00 37.45 ? 111  PRO A CG  1 
ATOM   781  C  CD  . PRO A 1 109 ? 16.171 39.878  46.492 1.00 37.37 ? 111  PRO A CD  1 
ATOM   782  N  N   . SER A 1 110 ? 15.251 37.707  50.655 1.00 37.54 ? 112  SER A N   1 
ATOM   783  C  CA  . SER A 1 110 ? 14.240 37.336  51.643 1.00 37.52 ? 112  SER A CA  1 
ATOM   784  C  C   . SER A 1 110 ? 14.167 38.349  52.782 1.00 37.53 ? 112  SER A C   1 
ATOM   785  O  O   . SER A 1 110 ? 15.165 38.968  53.154 1.00 37.53 ? 112  SER A O   1 
ATOM   786  C  CB  . SER A 1 110 ? 14.525 35.940  52.201 1.00 37.54 ? 112  SER A CB  1 
ATOM   787  O  OG  . SER A 1 110 ? 14.558 34.971  51.166 1.00 37.52 ? 112  SER A OG  1 
ATOM   788  N  N   . SER B 1 6   ? 7.522  7.120   35.324 1.00 45.21 ? 8    SER B N   1 
ATOM   789  C  CA  . SER B 1 6   ? 7.759  7.501   36.751 1.00 45.05 ? 8    SER B CA  1 
ATOM   790  C  C   . SER B 1 6   ? 9.174  7.155   37.216 1.00 44.85 ? 8    SER B C   1 
ATOM   791  O  O   . SER B 1 6   ? 9.843  7.967   37.860 1.00 45.01 ? 8    SER B O   1 
ATOM   792  C  CB  . SER B 1 6   ? 6.724  6.829   37.661 1.00 45.18 ? 8    SER B CB  1 
ATOM   793  O  OG  . SER B 1 6   ? 6.782  5.415   37.553 1.00 45.33 ? 8    SER B OG  1 
ATOM   794  N  N   . GLY B 1 7   ? 9.620  5.944   36.888 1.00 44.45 ? 9    GLY B N   1 
ATOM   795  C  CA  . GLY B 1 7   ? 10.947 5.471   37.278 1.00 43.60 ? 9    GLY B CA  1 
ATOM   796  C  C   . GLY B 1 7   ? 10.906 4.026   37.742 1.00 43.06 ? 9    GLY B C   1 
ATOM   797  O  O   . GLY B 1 7   ? 9.824  3.473   37.943 1.00 43.00 ? 9    GLY B O   1 
ATOM   798  N  N   . PRO B 1 8   ? 12.085 3.400   37.913 1.00 42.50 ? 10   PRO B N   1 
ATOM   799  C  CA  . PRO B 1 8   ? 12.136 2.012   38.377 1.00 42.10 ? 10   PRO B CA  1 
ATOM   800  C  C   . PRO B 1 8   ? 11.792 1.899   39.860 1.00 41.87 ? 10   PRO B C   1 
ATOM   801  O  O   . PRO B 1 8   ? 11.747 2.918   40.557 1.00 41.54 ? 10   PRO B O   1 
ATOM   802  C  CB  . PRO B 1 8   ? 13.590 1.604   38.130 1.00 42.14 ? 10   PRO B CB  1 
ATOM   803  C  CG  . PRO B 1 8   ? 14.354 2.860   38.053 1.00 41.79 ? 10   PRO B CG  1 
ATOM   804  C  CD  . PRO B 1 8   ? 13.425 3.964   37.668 1.00 42.21 ? 10   PRO B CD  1 
ATOM   805  N  N   . SER B 1 9   ? 11.549 0.676   40.336 1.00 41.73 ? 11   SER B N   1 
ATOM   806  C  CA  . SER B 1 9   ? 11.214 0.466   41.746 1.00 41.82 ? 11   SER B CA  1 
ATOM   807  C  C   . SER B 1 9   ? 12.402 0.851   42.619 1.00 41.57 ? 11   SER B C   1 
ATOM   808  O  O   . SER B 1 9   ? 13.548 0.877   42.151 1.00 41.00 ? 11   SER B O   1 
ATOM   809  C  CB  . SER B 1 9   ? 10.755 -0.976  42.022 1.00 42.61 ? 11   SER B CB  1 
ATOM   810  O  OG  . SER B 1 9   ? 11.825 -1.906  41.951 1.00 44.37 ? 11   SER B OG  1 
ATOM   811  N  N   . SER B 1 10  ? 12.124 1.191   43.874 1.00 41.31 ? 12   SER B N   1 
ATOM   812  C  CA  . SER B 1 10  ? 13.184 1.548   44.797 1.00 41.23 ? 12   SER B CA  1 
ATOM   813  C  C   . SER B 1 10  ? 14.004 0.303   45.105 1.00 40.59 ? 12   SER B C   1 
ATOM   814  O  O   . SER B 1 10  ? 13.435 -0.773  45.287 1.00 40.99 ? 12   SER B O   1 
ATOM   815  C  CB  . SER B 1 10  ? 12.607 2.142   46.084 1.00 41.53 ? 12   SER B CB  1 
ATOM   816  O  OG  . SER B 1 10  ? 11.757 1.219   46.735 1.00 43.52 ? 12   SER B OG  1 
ATOM   817  N  N   . PRO B 1 11  ? 15.345 0.434   45.126 1.00 39.99 ? 13   PRO B N   1 
ATOM   818  C  CA  . PRO B 1 11  ? 16.155 -0.704  45.542 1.00 39.16 ? 13   PRO B CA  1 
ATOM   819  C  C   . PRO B 1 11  ? 15.782 -1.108  46.963 1.00 38.64 ? 13   PRO B C   1 
ATOM   820  O  O   . PRO B 1 11  ? 15.242 -0.300  47.725 1.00 38.16 ? 13   PRO B O   1 
ATOM   821  C  CB  . PRO B 1 11  ? 17.586 -0.144  45.537 1.00 39.36 ? 13   PRO B CB  1 
ATOM   822  C  CG  . PRO B 1 11  ? 17.544 1.025   44.619 1.00 39.83 ? 13   PRO B CG  1 
ATOM   823  C  CD  . PRO B 1 11  ? 16.172 1.607   44.782 1.00 39.80 ? 13   PRO B CD  1 
ATOM   824  N  N   . SER B 1 12  ? 16.070 -2.349  47.313 1.00 37.36 ? 14   SER B N   1 
ATOM   825  C  CA  . SER B 1 12  ? 15.864 -2.818  48.664 1.00 37.30 ? 14   SER B CA  1 
ATOM   826  C  C   . SER B 1 12  ? 17.230 -3.008  49.308 1.00 37.06 ? 14   SER B C   1 
ATOM   827  O  O   . SER B 1 12  ? 18.036 -3.790  48.812 1.00 37.02 ? 14   SER B O   1 
ATOM   828  C  CB  . SER B 1 12  ? 15.073 -4.137  48.631 1.00 37.11 ? 14   SER B CB  1 
ATOM   829  O  OG  . SER B 1 12  ? 15.230 -4.848  49.834 1.00 38.16 ? 14   SER B OG  1 
ATOM   830  N  N   . ILE B 1 13  ? 17.499 -2.280  50.392 1.00 37.10 ? 15   ILE B N   1 
ATOM   831  C  CA  . ILE B 1 13  ? 18.775 -2.402  51.105 1.00 37.13 ? 15   ILE B CA  1 
ATOM   832  C  C   . ILE B 1 13  ? 18.754 -3.683  51.922 1.00 37.11 ? 15   ILE B C   1 
ATOM   833  O  O   . ILE B 1 13  ? 17.887 -3.874  52.777 1.00 37.36 ? 15   ILE B O   1 
ATOM   834  C  CB  . ILE B 1 13  ? 19.077 -1.182  52.014 1.00 37.42 ? 15   ILE B CB  1 
ATOM   835  C  CG1 . ILE B 1 13  ? 19.241 0.087   51.167 1.00 36.75 ? 15   ILE B CG1 1 
ATOM   836  C  CG2 . ILE B 1 13  ? 20.338 -1.448  52.854 1.00 37.18 ? 15   ILE B CG2 1 
ATOM   837  C  CD1 . ILE B 1 13  ? 19.408 1.382   51.969 1.00 37.38 ? 15   ILE B CD1 1 
ATOM   838  N  N   . ASP B 1 14  ? 19.720 -4.556  51.655 1.00 37.03 ? 16   ASP B N   1 
ATOM   839  C  CA  . ASP B 1 14  ? 19.730 -5.893  52.247 1.00 36.98 ? 16   ASP B CA  1 
ATOM   840  C  C   . ASP B 1 14  ? 20.836 -6.129  53.261 1.00 36.88 ? 16   ASP B C   1 
ATOM   841  O  O   . ASP B 1 14  ? 20.696 -6.968  54.147 1.00 36.63 ? 16   ASP B O   1 
ATOM   842  C  CB  . ASP B 1 14  ? 19.804 -6.938  51.131 1.00 36.88 ? 16   ASP B CB  1 
ATOM   843  C  CG  . ASP B 1 14  ? 18.586 -6.904  50.225 1.00 37.58 ? 16   ASP B CG  1 
ATOM   844  O  OD1 . ASP B 1 14  ? 17.458 -6.711  50.734 1.00 37.67 ? 16   ASP B OD1 1 
ATOM   845  O  OD2 . ASP B 1 14  ? 18.751 -7.075  49.004 1.00 36.50 ? 16   ASP B OD2 1 
ATOM   846  N  N   . GLN B 1 15  ? 21.933 -5.389  53.122 1.00 37.04 ? 17   GLN B N   1 
ATOM   847  C  CA  . GLN B 1 15  ? 23.078 -5.537  54.002 1.00 37.49 ? 17   GLN B CA  1 
ATOM   848  C  C   . GLN B 1 15  ? 23.939 -4.286  53.950 1.00 37.57 ? 17   GLN B C   1 
ATOM   849  O  O   . GLN B 1 15  ? 24.297 -3.799  52.873 1.00 37.41 ? 17   GLN B O   1 
ATOM   850  C  CB  . GLN B 1 15  ? 23.890 -6.784  53.610 1.00 37.60 ? 17   GLN B CB  1 
ATOM   851  C  CG  . GLN B 1 15  ? 25.164 -7.028  54.415 1.00 37.83 ? 17   GLN B CG  1 
ATOM   852  C  CD  . GLN B 1 15  ? 25.791 -8.389  54.130 1.00 38.46 ? 17   GLN B CD  1 
ATOM   853  O  OE1 . GLN B 1 15  ? 25.341 -9.129  53.249 1.00 39.32 ? 17   GLN B OE1 1 
ATOM   854  N  NE2 . GLN B 1 15  ? 26.836 -8.727  54.880 1.00 39.16 ? 17   GLN B NE2 1 
ATOM   855  N  N   . VAL B 1 16  ? 24.246 -3.746  55.120 1.00 37.58 ? 18   VAL B N   1 
ATOM   856  C  CA  . VAL B 1 16  ? 25.153 -2.618  55.201 1.00 38.15 ? 18   VAL B CA  1 
ATOM   857  C  C   . VAL B 1 16  ? 26.334 -3.056  56.049 1.00 38.04 ? 18   VAL B C   1 
ATOM   858  O  O   . VAL B 1 16  ? 26.151 -3.527  57.179 1.00 37.71 ? 18   VAL B O   1 
ATOM   859  C  CB  . VAL B 1 16  ? 24.495 -1.368  55.833 1.00 38.42 ? 18   VAL B CB  1 
ATOM   860  C  CG1 . VAL B 1 16  ? 25.506 -0.214  55.912 1.00 39.60 ? 18   VAL B CG1 1 
ATOM   861  C  CG2 . VAL B 1 16  ? 23.265 -0.943  55.036 1.00 39.63 ? 18   VAL B CG2 1 
ATOM   862  N  N   . GLU B 1 17  ? 27.531 -2.946  55.486 1.00 37.29 ? 19   GLU B N   1 
ATOM   863  C  CA  . GLU B 1 17  ? 28.751 -3.229  56.223 1.00 37.47 ? 19   GLU B CA  1 
ATOM   864  C  C   . GLU B 1 17  ? 29.443 -1.902  56.495 1.00 37.41 ? 19   GLU B C   1 
ATOM   865  O  O   . GLU B 1 17  ? 30.039 -1.309  55.596 1.00 37.28 ? 19   GLU B O   1 
ATOM   866  C  CB  . GLU B 1 17  ? 29.666 -4.204  55.472 1.00 37.33 ? 19   GLU B CB  1 
ATOM   867  C  CG  . GLU B 1 17  ? 29.079 -5.620  55.340 1.00 39.02 ? 19   GLU B CG  1 
ATOM   868  C  CD  . GLU B 1 17  ? 28.791 -6.285  56.689 1.00 41.22 ? 19   GLU B CD  1 
ATOM   869  O  OE1 . GLU B 1 17  ? 29.584 -6.095  57.643 1.00 41.88 ? 19   GLU B OE1 1 
ATOM   870  O  OE2 . GLU B 1 17  ? 27.773 -7.010  56.792 1.00 41.98 ? 19   GLU B OE2 1 
ATOM   871  N  N   . PRO B 1 18  ? 29.321 -1.407  57.731 1.00 37.59 ? 20   PRO B N   1 
ATOM   872  C  CA  . PRO B 1 18  ? 29.954 -0.142  58.049 1.00 37.54 ? 20   PRO B CA  1 
ATOM   873  C  C   . PRO B 1 18  ? 31.404 -0.299  58.479 1.00 37.59 ? 20   PRO B C   1 
ATOM   874  O  O   . PRO B 1 18  ? 31.774 -1.293  59.112 1.00 36.94 ? 20   PRO B O   1 
ATOM   875  C  CB  . PRO B 1 18  ? 29.116 0.396   59.214 1.00 37.53 ? 20   PRO B CB  1 
ATOM   876  C  CG  . PRO B 1 18  ? 28.224 -0.748  59.664 1.00 38.03 ? 20   PRO B CG  1 
ATOM   877  C  CD  . PRO B 1 18  ? 28.581 -1.965  58.877 1.00 37.73 ? 20   PRO B CD  1 
ATOM   878  N  N   . TYR B 1 19  ? 32.214 0.687   58.117 1.00 37.33 ? 21   TYR B N   1 
ATOM   879  C  CA  . TYR B 1 19  ? 33.595 0.752   58.557 1.00 37.76 ? 21   TYR B CA  1 
ATOM   880  C  C   . TYR B 1 19  ? 33.708 2.064   59.327 1.00 37.71 ? 21   TYR B C   1 
ATOM   881  O  O   . TYR B 1 19  ? 32.696 2.547   59.827 1.00 37.90 ? 21   TYR B O   1 
ATOM   882  C  CB  . TYR B 1 19  ? 34.548 0.611   57.366 1.00 38.20 ? 21   TYR B CB  1 
ATOM   883  C  CG  . TYR B 1 19  ? 34.355 -0.724  56.671 1.00 39.05 ? 21   TYR B CG  1 
ATOM   884  C  CD1 . TYR B 1 19  ? 35.049 -1.858  57.093 1.00 39.36 ? 21   TYR B CD1 1 
ATOM   885  C  CD2 . TYR B 1 19  ? 33.450 -0.860  55.618 1.00 39.57 ? 21   TYR B CD2 1 
ATOM   886  C  CE1 . TYR B 1 19  ? 34.863 -3.088  56.473 1.00 40.02 ? 21   TYR B CE1 1 
ATOM   887  C  CE2 . TYR B 1 19  ? 33.250 -2.094  54.992 1.00 39.37 ? 21   TYR B CE2 1 
ATOM   888  C  CZ  . TYR B 1 19  ? 33.963 -3.197  55.422 1.00 39.81 ? 21   TYR B CZ  1 
ATOM   889  O  OH  . TYR B 1 19  ? 33.774 -4.417  54.808 1.00 40.18 ? 21   TYR B OH  1 
ATOM   890  N  N   . SER B 1 20  ? 34.895 2.639   59.455 1.00 37.20 ? 22   SER B N   1 
ATOM   891  C  CA  . SER B 1 20  ? 35.020 3.861   60.246 1.00 37.00 ? 22   SER B CA  1 
ATOM   892  C  C   . SER B 1 20  ? 34.561 5.119   59.494 1.00 36.57 ? 22   SER B C   1 
ATOM   893  O  O   . SER B 1 20  ? 33.898 5.976   60.070 1.00 36.37 ? 22   SER B O   1 
ATOM   894  C  CB  . SER B 1 20  ? 36.440 4.024   60.789 1.00 37.10 ? 22   SER B CB  1 
ATOM   895  O  OG  . SER B 1 20  ? 37.372 4.172   59.733 1.00 38.59 ? 22   SER B OG  1 
ATOM   896  N  N   . SER B 1 21  ? 34.906 5.225   58.215 1.00 36.04 ? 23   SER B N   1 
ATOM   897  C  CA  . SER B 1 21  ? 34.541 6.403   57.429 1.00 35.65 ? 23   SER B CA  1 
ATOM   898  C  C   . SER B 1 21  ? 33.822 6.030   56.135 1.00 35.46 ? 23   SER B C   1 
ATOM   899  O  O   . SER B 1 21  ? 33.542 6.889   55.298 1.00 35.39 ? 23   SER B O   1 
ATOM   900  C  CB  . SER B 1 21  ? 35.780 7.247   57.120 1.00 36.15 ? 23   SER B CB  1 
ATOM   901  O  OG  . SER B 1 21  ? 36.635 6.587   56.205 1.00 36.41 ? 23   SER B OG  1 
ATOM   902  N  N   . THR B 1 22  ? 33.530 4.744   55.976 1.00 35.38 ? 24   THR B N   1 
ATOM   903  C  CA  . THR B 1 22  ? 32.862 4.242   54.777 1.00 35.60 ? 24   THR B CA  1 
ATOM   904  C  C   . THR B 1 22  ? 31.837 3.188   55.158 1.00 35.61 ? 24   THR B C   1 
ATOM   905  O  O   . THR B 1 22  ? 31.881 2.636   56.255 1.00 35.61 ? 24   THR B O   1 
ATOM   906  C  CB  . THR B 1 22  ? 33.860 3.581   53.775 1.00 35.60 ? 24   THR B CB  1 
ATOM   907  O  OG1 . THR B 1 22  ? 34.427 2.410   54.372 1.00 36.20 ? 24   THR B OG1 1 
ATOM   908  C  CG2 . THR B 1 22  ? 34.980 4.532   53.360 1.00 36.21 ? 24   THR B CG2 1 
ATOM   909  N  N   . ALA B 1 23  ? 30.914 2.908   54.243 1.00 35.67 ? 25   ALA B N   1 
ATOM   910  C  CA  . ALA B 1 23  ? 29.926 1.861   54.450 1.00 35.95 ? 25   ALA B CA  1 
ATOM   911  C  C   . ALA B 1 23  ? 29.597 1.242   53.107 1.00 36.20 ? 25   ALA B C   1 
ATOM   912  O  O   . ALA B 1 23  ? 29.390 1.948   52.118 1.00 36.11 ? 25   ALA B O   1 
ATOM   913  C  CB  . ALA B 1 23  ? 28.676 2.405   55.105 1.00 35.79 ? 25   ALA B CB  1 
ATOM   914  N  N   . GLN B 1 24  ? 29.604 -0.080  53.069 1.00 36.13 ? 26   GLN B N   1 
ATOM   915  C  CA  . GLN B 1 24  ? 29.224 -0.795  51.874 1.00 37.14 ? 26   GLN B CA  1 
ATOM   916  C  C   . GLN B 1 24  ? 27.757 -1.133  52.023 1.00 36.79 ? 26   GLN B C   1 
ATOM   917  O  O   . GLN B 1 24  ? 27.351 -1.796  52.989 1.00 37.37 ? 26   GLN B O   1 
ATOM   918  C  CB  . GLN B 1 24  ? 30.066 -2.057  51.701 1.00 37.11 ? 26   GLN B CB  1 
ATOM   919  C  CG  . GLN B 1 24  ? 31.545 -1.751  51.440 1.00 38.47 ? 26   GLN B CG  1 
ATOM   920  C  CD  . GLN B 1 24  ? 32.390 -3.003  51.302 1.00 39.23 ? 26   GLN B CD  1 
ATOM   921  O  OE1 . GLN B 1 24  ? 33.308 -3.057  50.482 1.00 43.10 ? 26   GLN B OE1 1 
ATOM   922  N  NE2 . GLN B 1 24  ? 32.076 -4.024  52.098 1.00 42.12 ? 26   GLN B NE2 1 
ATOM   923  N  N   . VAL B 1 25  ? 26.965 -0.661  51.072 1.00 36.42 ? 27   VAL B N   1 
ATOM   924  C  CA  . VAL B 1 25  ? 25.528 -0.868  51.095 1.00 36.39 ? 27   VAL B CA  1 
ATOM   925  C  C   . VAL B 1 25  ? 25.183 -1.830  49.972 1.00 36.51 ? 27   VAL B C   1 
ATOM   926  O  O   . VAL B 1 25  ? 25.356 -1.503  48.790 1.00 36.36 ? 27   VAL B O   1 
ATOM   927  C  CB  . VAL B 1 25  ? 24.758 0.467   50.934 1.00 36.55 ? 27   VAL B CB  1 
ATOM   928  C  CG1 . VAL B 1 25  ? 23.251 0.239   50.943 1.00 36.83 ? 27   VAL B CG1 1 
ATOM   929  C  CG2 . VAL B 1 25  ? 25.163 1.481   52.040 1.00 35.92 ? 27   VAL B CG2 1 
ATOM   930  N  N   . GLN B 1 26  ? 24.754 -3.032  50.346 1.00 36.76 ? 28   GLN B N   1 
ATOM   931  C  CA  . GLN B 1 26  ? 24.258 -4.001  49.365 1.00 37.19 ? 28   GLN B CA  1 
ATOM   932  C  C   . GLN B 1 26  ? 22.758 -3.948  49.269 1.00 37.28 ? 28   GLN B C   1 
ATOM   933  O  O   . GLN B 1 26  ? 22.052 -3.896  50.279 1.00 37.66 ? 28   GLN B O   1 
ATOM   934  C  CB  . GLN B 1 26  ? 24.715 -5.427  49.649 1.00 37.54 ? 28   GLN B CB  1 
ATOM   935  C  CG  . GLN B 1 26  ? 25.936 -5.803  48.859 1.00 37.86 ? 28   GLN B CG  1 
ATOM   936  C  CD  . GLN B 1 26  ? 26.424 -7.207  49.132 1.00 38.97 ? 28   GLN B CD  1 
ATOM   937  O  OE1 . GLN B 1 26  ? 26.753 -7.952  48.204 1.00 37.61 ? 28   GLN B OE1 1 
ATOM   938  N  NE2 . GLN B 1 26  ? 26.472 -7.579  50.401 1.00 38.08 ? 28   GLN B NE2 1 
ATOM   939  N  N   . PHE B 1 27  ? 22.281 -3.981  48.034 1.00 37.40 ? 29   PHE B N   1 
ATOM   940  C  CA  . PHE B 1 27  ? 20.865 -3.897  47.758 1.00 37.34 ? 29   PHE B CA  1 
ATOM   941  C  C   . PHE B 1 27  ? 20.474 -4.872  46.662 1.00 37.41 ? 29   PHE B C   1 
ATOM   942  O  O   . PHE B 1 27  ? 21.331 -5.453  45.987 1.00 37.09 ? 29   PHE B O   1 
ATOM   943  C  CB  . PHE B 1 27  ? 20.528 -2.469  47.304 1.00 37.32 ? 29   PHE B CB  1 
ATOM   944  C  CG  . PHE B 1 27  ? 21.236 -2.053  46.045 1.00 37.79 ? 29   PHE B CG  1 
ATOM   945  C  CD1 . PHE B 1 27  ? 20.645 -2.267  44.799 1.00 38.59 ? 29   PHE B CD1 1 
ATOM   946  C  CD2 . PHE B 1 27  ? 22.503 -1.480  46.096 1.00 37.69 ? 29   PHE B CD2 1 
ATOM   947  C  CE1 . PHE B 1 27  ? 21.306 -1.904  43.628 1.00 38.19 ? 29   PHE B CE1 1 
ATOM   948  C  CE2 . PHE B 1 27  ? 23.173 -1.115  44.930 1.00 37.80 ? 29   PHE B CE2 1 
ATOM   949  C  CZ  . PHE B 1 27  ? 22.565 -1.324  43.694 1.00 38.08 ? 29   PHE B CZ  1 
ATOM   950  N  N   . ASP B 1 28  ? 19.171 -5.045  46.488 1.00 37.59 ? 30   ASP B N   1 
ATOM   951  C  CA  . ASP B 1 28  ? 18.668 -5.774  45.346 1.00 38.52 ? 30   ASP B CA  1 
ATOM   952  C  C   . ASP B 1 28  ? 17.760 -4.841  44.567 1.00 39.23 ? 30   ASP B C   1 
ATOM   953  O  O   . ASP B 1 28  ? 17.187 -3.900  45.126 1.00 38.82 ? 30   ASP B O   1 
ATOM   954  C  CB  . ASP B 1 28  ? 17.960 -7.075  45.752 1.00 38.09 ? 30   ASP B CB  1 
ATOM   955  C  CG  . ASP B 1 28  ? 16.651 -6.840  46.480 1.00 38.38 ? 30   ASP B CG  1 
ATOM   956  O  OD1 . ASP B 1 28  ? 16.671 -6.874  47.724 1.00 37.32 ? 30   ASP B OD1 1 
ATOM   957  O  OD2 . ASP B 1 28  ? 15.601 -6.642  45.814 1.00 39.27 ? 30   ASP B OD2 1 
ATOM   958  N  N   . GLU B 1 29  ? 17.656 -5.115  43.273 1.00 40.16 ? 31   GLU B N   1 
ATOM   959  C  CA  . GLU B 1 29  ? 16.866 -4.341  42.339 1.00 41.43 ? 31   GLU B CA  1 
ATOM   960  C  C   . GLU B 1 29  ? 16.436 -5.311  41.239 1.00 41.93 ? 31   GLU B C   1 
ATOM   961  O  O   . GLU B 1 29  ? 17.240 -6.131  40.809 1.00 42.18 ? 31   GLU B O   1 
ATOM   962  C  CB  . GLU B 1 29  ? 17.741 -3.211  41.770 1.00 41.25 ? 31   GLU B CB  1 
ATOM   963  C  CG  . GLU B 1 29  ? 17.072 -2.311  40.731 1.00 43.30 ? 31   GLU B CG  1 
ATOM   964  C  CD  . GLU B 1 29  ? 15.974 -1.428  41.302 1.00 45.23 ? 31   GLU B CD  1 
ATOM   965  O  OE1 . GLU B 1 29  ? 15.967 -1.185  42.522 1.00 46.52 ? 31   GLU B OE1 1 
ATOM   966  O  OE2 . GLU B 1 29  ? 15.114 -0.971  40.524 1.00 46.42 ? 31   GLU B OE2 1 
ATOM   967  N  N   . PRO B 1 30  ? 15.160 -5.258  40.807 1.00 42.73 ? 32   PRO B N   1 
ATOM   968  C  CA  . PRO B 1 30  ? 14.693 -6.145  39.731 1.00 43.50 ? 32   PRO B CA  1 
ATOM   969  C  C   . PRO B 1 30  ? 15.573 -6.140  38.473 1.00 44.23 ? 32   PRO B C   1 
ATOM   970  O  O   . PRO B 1 30  ? 16.126 -5.093  38.110 1.00 44.02 ? 32   PRO B O   1 
ATOM   971  C  CB  . PRO B 1 30  ? 13.299 -5.603  39.414 1.00 43.51 ? 32   PRO B CB  1 
ATOM   972  C  CG  . PRO B 1 30  ? 12.841 -5.016  40.703 1.00 43.12 ? 32   PRO B CG  1 
ATOM   973  C  CD  . PRO B 1 30  ? 14.068 -4.412  41.323 1.00 42.87 ? 32   PRO B CD  1 
ATOM   974  N  N   . GLU B 1 31  ? 15.701 -7.307  37.836 1.00 44.89 ? 33   GLU B N   1 
ATOM   975  C  CA  . GLU B 1 31  ? 16.479 -7.467  36.595 1.00 45.85 ? 33   GLU B CA  1 
ATOM   976  C  C   . GLU B 1 31  ? 15.793 -6.756  35.427 1.00 46.14 ? 33   GLU B C   1 
ATOM   977  O  O   . GLU B 1 31  ? 16.370 -5.858  34.805 1.00 46.68 ? 33   GLU B O   1 
ATOM   978  C  CB  . GLU B 1 31  ? 16.674 -8.955  36.228 1.00 45.85 ? 33   GLU B CB  1 
ATOM   979  C  CG  . GLU B 1 31  ? 17.409 -9.839  37.268 1.00 46.77 ? 33   GLU B CG  1 
ATOM   980  C  CD  . GLU B 1 31  ? 18.867 -9.439  37.528 1.00 47.98 ? 33   GLU B CD  1 
ATOM   981  O  OE1 . GLU B 1 31  ? 19.531 -8.902  36.605 1.00 49.71 ? 33   GLU B OE1 1 
ATOM   982  O  OE2 . GLU B 1 31  ? 19.355 -9.678  38.662 1.00 45.62 ? 33   GLU B OE2 1 
ATOM   983  N  N   . VAL B 1 36  ? 14.490 -1.531  29.111 1.00 42.54 ? 38   VAL B N   1 
ATOM   984  C  CA  . VAL B 1 36  ? 14.700 -0.340  29.934 1.00 42.18 ? 38   VAL B CA  1 
ATOM   985  C  C   . VAL B 1 36  ? 15.683 -0.639  31.082 1.00 41.93 ? 38   VAL B C   1 
ATOM   986  O  O   . VAL B 1 36  ? 15.268 -0.872  32.221 1.00 41.99 ? 38   VAL B O   1 
ATOM   987  C  CB  . VAL B 1 36  ? 13.358 0.239   30.473 1.00 42.15 ? 38   VAL B CB  1 
ATOM   988  C  CG1 . VAL B 1 36  ? 13.588 1.569   31.191 1.00 42.56 ? 38   VAL B CG1 1 
ATOM   989  C  CG2 . VAL B 1 36  ? 12.354 0.420   29.345 1.00 43.09 ? 38   VAL B CG2 1 
ATOM   990  N  N   . PRO B 1 37  ? 16.995 -0.642  30.778 1.00 41.49 ? 39   PRO B N   1 
ATOM   991  C  CA  . PRO B 1 37  ? 18.007 -0.938  31.796 1.00 40.92 ? 39   PRO B CA  1 
ATOM   992  C  C   . PRO B 1 37  ? 18.108 0.119   32.893 1.00 40.01 ? 39   PRO B C   1 
ATOM   993  O  O   . PRO B 1 37  ? 17.797 1.290   32.656 1.00 39.66 ? 39   PRO B O   1 
ATOM   994  C  CB  . PRO B 1 37  ? 19.317 -0.946  30.994 1.00 41.34 ? 39   PRO B CB  1 
ATOM   995  C  CG  . PRO B 1 37  ? 19.040 -0.107  29.795 1.00 41.70 ? 39   PRO B CG  1 
ATOM   996  C  CD  . PRO B 1 37  ? 17.604 -0.374  29.460 1.00 41.28 ? 39   PRO B CD  1 
ATOM   997  N  N   . ILE B 1 38  ? 18.514 -0.309  34.088 1.00 38.99 ? 40   ILE B N   1 
ATOM   998  C  CA  . ILE B 1 38  ? 18.846 0.620   35.153 1.00 38.40 ? 40   ILE B CA  1 
ATOM   999  C  C   . ILE B 1 38  ? 20.149 1.261   34.692 1.00 37.40 ? 40   ILE B C   1 
ATOM   1000 O  O   . ILE B 1 38  ? 21.063 0.561   34.246 1.00 37.23 ? 40   ILE B O   1 
ATOM   1001 C  CB  . ILE B 1 38  ? 19.082 -0.073  36.520 1.00 38.62 ? 40   ILE B CB  1 
ATOM   1002 C  CG1 . ILE B 1 38  ? 17.862 -0.895  36.963 1.00 39.65 ? 40   ILE B CG1 1 
ATOM   1003 C  CG2 . ILE B 1 38  ? 19.487 0.965   37.585 1.00 38.23 ? 40   ILE B CG2 1 
ATOM   1004 C  CD1 . ILE B 1 38  ? 16.638 -0.085  37.365 1.00 41.03 ? 40   ILE B CD1 1 
ATOM   1005 N  N   . LEU B 1 39  ? 20.216 2.582   34.762 1.00 36.40 ? 41   LEU B N   1 
ATOM   1006 C  CA  . LEU B 1 39  ? 21.390 3.317   34.293 1.00 35.83 ? 41   LEU B CA  1 
ATOM   1007 C  C   . LEU B 1 39  ? 22.288 3.763   35.434 1.00 35.39 ? 41   LEU B C   1 
ATOM   1008 O  O   . LEU B 1 39  ? 23.517 3.692   35.341 1.00 34.86 ? 41   LEU B O   1 
ATOM   1009 C  CB  . LEU B 1 39  ? 20.940 4.528   33.474 1.00 36.18 ? 41   LEU B CB  1 
ATOM   1010 C  CG  . LEU B 1 39  ? 20.064 4.130   32.275 1.00 36.25 ? 41   LEU B CG  1 
ATOM   1011 C  CD1 . LEU B 1 39  ? 19.520 5.362   31.578 1.00 38.08 ? 41   LEU B CD1 1 
ATOM   1012 C  CD2 . LEU B 1 39  ? 20.826 3.239   31.301 1.00 37.10 ? 41   LEU B CD2 1 
ATOM   1013 N  N   . LYS B 1 40  ? 21.663 4.215   36.515 1.00 34.79 ? 42   LYS B N   1 
ATOM   1014 C  CA  . LYS B 1 40  ? 22.398 4.713   37.662 1.00 34.65 ? 42   LYS B CA  1 
ATOM   1015 C  C   . LYS B 1 40  ? 21.634 4.411   38.938 1.00 34.53 ? 42   LYS B C   1 
ATOM   1016 O  O   . LYS B 1 40  ? 20.438 4.106   38.913 1.00 33.97 ? 42   LYS B O   1 
ATOM   1017 C  CB  . LYS B 1 40  ? 22.603 6.242   37.575 1.00 34.43 ? 42   LYS B CB  1 
ATOM   1018 C  CG  . LYS B 1 40  ? 23.273 6.792   36.300 1.00 34.78 ? 42   LYS B CG  1 
ATOM   1019 C  CD  . LYS B 1 40  ? 24.739 6.403   36.163 1.00 33.81 ? 42   LYS B CD  1 
ATOM   1020 C  CE  . LYS B 1 40  ? 25.220 6.627   34.717 1.00 34.43 ? 42   LYS B CE  1 
ATOM   1021 N  NZ  . LYS B 1 40  ? 26.710 6.544   34.577 1.00 33.12 ? 42   LYS B NZ  1 
ATOM   1022 N  N   . TYR B 1 41  ? 22.349 4.518   40.052 1.00 34.79 ? 43   TYR B N   1 
ATOM   1023 C  CA  . TYR B 1 41  ? 21.766 4.476   41.371 1.00 35.27 ? 43   TYR B CA  1 
ATOM   1024 C  C   . TYR B 1 41  ? 22.152 5.762   42.074 1.00 35.50 ? 43   TYR B C   1 
ATOM   1025 O  O   . TYR B 1 41  ? 23.222 6.330   41.818 1.00 34.61 ? 43   TYR B O   1 
ATOM   1026 C  CB  . TYR B 1 41  ? 22.297 3.287   42.160 1.00 35.39 ? 43   TYR B CB  1 
ATOM   1027 C  CG  . TYR B 1 41  ? 21.827 1.979   41.612 1.00 35.68 ? 43   TYR B CG  1 
ATOM   1028 C  CD1 . TYR B 1 41  ? 20.556 1.497   41.928 1.00 36.20 ? 43   TYR B CD1 1 
ATOM   1029 C  CD2 . TYR B 1 41  ? 22.633 1.225   40.763 1.00 36.23 ? 43   TYR B CD2 1 
ATOM   1030 C  CE1 . TYR B 1 41  ? 20.097 0.299   41.411 1.00 37.43 ? 43   TYR B CE1 1 
ATOM   1031 C  CE2 . TYR B 1 41  ? 22.182 0.013   40.241 1.00 36.37 ? 43   TYR B CE2 1 
ATOM   1032 C  CZ  . TYR B 1 41  ? 20.915 -0.438  40.574 1.00 36.23 ? 43   TYR B CZ  1 
ATOM   1033 O  OH  . TYR B 1 41  ? 20.449 -1.633  40.095 1.00 36.44 ? 43   TYR B OH  1 
ATOM   1034 N  N   . LYS B 1 42  ? 21.267 6.238   42.938 1.00 35.83 ? 44   LYS B N   1 
ATOM   1035 C  CA  . LYS B 1 42  ? 21.587 7.398   43.747 1.00 36.09 ? 44   LYS B CA  1 
ATOM   1036 C  C   . LYS B 1 42  ? 21.393 7.017   45.200 1.00 36.22 ? 44   LYS B C   1 
ATOM   1037 O  O   . LYS B 1 42  ? 20.337 6.501   45.588 1.00 36.62 ? 44   LYS B O   1 
ATOM   1038 C  CB  . LYS B 1 42  ? 20.722 8.602   43.372 1.00 36.55 ? 44   LYS B CB  1 
ATOM   1039 C  CG  . LYS B 1 42  ? 21.123 9.896   44.100 1.00 36.85 ? 44   LYS B CG  1 
ATOM   1040 C  CD  . LYS B 1 42  ? 20.157 11.012  43.749 1.00 40.31 ? 44   LYS B CD  1 
ATOM   1041 C  CE  . LYS B 1 42  ? 20.583 12.321  44.396 1.00 41.42 ? 44   LYS B CE  1 
ATOM   1042 N  NZ  . LYS B 1 42  ? 19.721 13.453  43.951 1.00 42.02 ? 44   LYS B NZ  1 
ATOM   1043 N  N   . ALA B 1 43  ? 22.433 7.225   46.000 1.00 35.70 ? 45   ALA B N   1 
ATOM   1044 C  CA  . ALA B 1 43  ? 22.335 6.958   47.420 1.00 35.06 ? 45   ALA B CA  1 
ATOM   1045 C  C   . ALA B 1 43  ? 22.179 8.280   48.131 1.00 35.28 ? 45   ALA B C   1 
ATOM   1046 O  O   . ALA B 1 43  ? 22.709 9.299   47.679 1.00 33.90 ? 45   ALA B O   1 
ATOM   1047 C  CB  . ALA B 1 43  ? 23.568 6.229   47.919 1.00 35.15 ? 45   ALA B CB  1 
ATOM   1048 N  N   . GLU B 1 44  ? 21.404 8.275   49.211 1.00 35.15 ? 46   GLU B N   1 
ATOM   1049 C  CA  . GLU B 1 44  ? 21.303 9.437   50.075 1.00 35.88 ? 46   GLU B CA  1 
ATOM   1050 C  C   . GLU B 1 44  ? 21.545 8.965   51.489 1.00 35.04 ? 46   GLU B C   1 
ATOM   1051 O  O   . GLU B 1 44  ? 21.113 7.879   51.872 1.00 35.20 ? 46   GLU B O   1 
ATOM   1052 C  CB  . GLU B 1 44  ? 19.929 10.102  49.998 1.00 36.14 ? 46   GLU B CB  1 
ATOM   1053 C  CG  . GLU B 1 44  ? 19.588 10.741  48.669 1.00 38.10 ? 46   GLU B CG  1 
ATOM   1054 C  CD  . GLU B 1 44  ? 18.261 11.486  48.726 1.00 38.77 ? 46   GLU B CD  1 
ATOM   1055 O  OE1 . GLU B 1 44  ? 17.404 11.148  49.573 1.00 42.53 ? 46   GLU B OE1 1 
ATOM   1056 O  OE2 . GLU B 1 44  ? 18.076 12.423  47.932 1.00 42.84 ? 46   GLU B OE2 1 
ATOM   1057 N  N   . TRP B 1 45  ? 22.249 9.772   52.269 1.00 34.68 ? 47   TRP B N   1 
ATOM   1058 C  CA  . TRP B 1 45  ? 22.478 9.432   53.663 1.00 34.09 ? 47   TRP B CA  1 
ATOM   1059 C  C   . TRP B 1 45  ? 22.511 10.691  54.512 1.00 34.02 ? 47   TRP B C   1 
ATOM   1060 O  O   . TRP B 1 45  ? 22.727 11.799  54.006 1.00 33.17 ? 47   TRP B O   1 
ATOM   1061 C  CB  . TRP B 1 45  ? 23.748 8.590   53.838 1.00 34.47 ? 47   TRP B CB  1 
ATOM   1062 C  CG  . TRP B 1 45  ? 25.009 9.319   53.443 1.00 35.29 ? 47   TRP B CG  1 
ATOM   1063 C  CD1 . TRP B 1 45  ? 25.889 9.959   54.273 1.00 34.61 ? 47   TRP B CD1 1 
ATOM   1064 C  CD2 . TRP B 1 45  ? 25.509 9.478   52.116 1.00 34.56 ? 47   TRP B CD2 1 
ATOM   1065 N  NE1 . TRP B 1 45  ? 26.917 10.500  53.534 1.00 34.55 ? 47   TRP B NE1 1 
ATOM   1066 C  CE2 . TRP B 1 45  ? 26.705 10.215  52.207 1.00 35.04 ? 47   TRP B CE2 1 
ATOM   1067 C  CE3 . TRP B 1 45  ? 25.062 9.050   50.847 1.00 36.25 ? 47   TRP B CE3 1 
ATOM   1068 C  CZ2 . TRP B 1 45  ? 27.458 10.557  51.082 1.00 34.33 ? 47   TRP B CZ2 1 
ATOM   1069 C  CZ3 . TRP B 1 45  ? 25.816 9.384   49.726 1.00 34.76 ? 47   TRP B CZ3 1 
ATOM   1070 C  CH2 . TRP B 1 45  ? 26.999 10.133  49.851 1.00 34.42 ? 47   TRP B CH2 1 
ATOM   1071 N  N   . ARG B 1 46  ? 22.282 10.520  55.806 1.00 33.59 ? 48   ARG B N   1 
ATOM   1072 C  CA  . ARG B 1 46  ? 22.224 11.650  56.717 1.00 33.67 ? 48   ARG B CA  1 
ATOM   1073 C  C   . ARG B 1 46  ? 22.585 11.156  58.106 1.00 33.27 ? 48   ARG B C   1 
ATOM   1074 O  O   . ARG B 1 46  ? 22.054 10.144  58.553 1.00 32.94 ? 48   ARG B O   1 
ATOM   1075 C  CB  . ARG B 1 46  ? 20.805 12.231  56.701 1.00 33.68 ? 48   ARG B CB  1 
ATOM   1076 C  CG  . ARG B 1 46  ? 20.608 13.438  57.569 1.00 35.77 ? 48   ARG B CG  1 
ATOM   1077 C  CD  . ARG B 1 46  ? 19.234 14.044  57.369 1.00 37.09 ? 48   ARG B CD  1 
ATOM   1078 N  NE  . ARG B 1 46  ? 18.179 13.249  57.992 1.00 39.55 ? 48   ARG B NE  1 
ATOM   1079 C  CZ  . ARG B 1 46  ? 16.928 13.669  58.147 1.00 40.78 ? 48   ARG B CZ  1 
ATOM   1080 N  NH1 . ARG B 1 46  ? 16.570 14.877  57.727 1.00 39.94 ? 48   ARG B NH1 1 
ATOM   1081 N  NH2 . ARG B 1 46  ? 16.034 12.885  58.731 1.00 41.78 ? 48   ARG B NH2 1 
ATOM   1082 N  N   . ALA B 1 47  ? 23.507 11.854  58.768 1.00 33.07 ? 49   ALA B N   1 
ATOM   1083 C  CA  . ALA B 1 47  ? 23.864 11.539  60.142 1.00 33.45 ? 49   ALA B CA  1 
ATOM   1084 C  C   . ALA B 1 47  ? 22.666 11.854  61.023 1.00 33.43 ? 49   ALA B C   1 
ATOM   1085 O  O   . ALA B 1 47  ? 21.847 12.719  60.689 1.00 32.79 ? 49   ALA B O   1 
ATOM   1086 C  CB  . ALA B 1 47  ? 25.084 12.339  60.589 1.00 33.76 ? 49   ALA B CB  1 
ATOM   1087 N  N   . VAL B 1 48  ? 22.562 11.145  62.143 1.00 33.55 ? 50   VAL B N   1 
ATOM   1088 C  CA  . VAL B 1 48  ? 21.444 11.325  63.075 1.00 33.87 ? 50   VAL B CA  1 
ATOM   1089 C  C   . VAL B 1 48  ? 21.235 12.789  63.487 1.00 34.13 ? 50   VAL B C   1 
ATOM   1090 O  O   . VAL B 1 48  ? 20.097 13.228  63.649 1.00 34.52 ? 50   VAL B O   1 
ATOM   1091 C  CB  . VAL B 1 48  ? 21.546 10.351  64.303 1.00 33.96 ? 50   VAL B CB  1 
ATOM   1092 C  CG1 . VAL B 1 48  ? 22.803 10.616  65.137 1.00 33.88 ? 50   VAL B CG1 1 
ATOM   1093 C  CG2 . VAL B 1 48  ? 20.296 10.411  65.178 1.00 34.05 ? 50   VAL B CG2 1 
ATOM   1094 N  N   . GLY B 1 49  ? 22.317 13.552  63.617 1.00 34.27 ? 51   GLY B N   1 
ATOM   1095 C  CA  . GLY B 1 49  ? 22.209 14.961  64.011 1.00 35.20 ? 51   GLY B CA  1 
ATOM   1096 C  C   . GLY B 1 49  ? 22.159 15.973  62.867 1.00 35.67 ? 51   GLY B C   1 
ATOM   1097 O  O   . GLY B 1 49  ? 22.231 17.178  63.110 1.00 35.26 ? 51   GLY B O   1 
ATOM   1098 N  N   . GLU B 1 50  ? 22.031 15.487  61.632 1.00 36.39 ? 52   GLU B N   1 
ATOM   1099 C  CA  . GLU B 1 50  ? 21.991 16.348  60.433 1.00 37.80 ? 52   GLU B CA  1 
ATOM   1100 C  C   . GLU B 1 50  ? 20.575 16.568  59.896 1.00 37.52 ? 52   GLU B C   1 
ATOM   1101 O  O   . GLU B 1 50  ? 19.671 15.779  60.161 1.00 37.00 ? 52   GLU B O   1 
ATOM   1102 C  CB  . GLU B 1 50  ? 22.840 15.753  59.299 1.00 38.01 ? 52   GLU B CB  1 
ATOM   1103 C  CG  . GLU B 1 50  ? 24.311 15.567  59.621 1.00 39.58 ? 52   GLU B CG  1 
ATOM   1104 C  CD  . GLU B 1 50  ? 25.136 15.097  58.416 1.00 40.19 ? 52   GLU B CD  1 
ATOM   1105 O  OE1 . GLU B 1 50  ? 26.199 15.722  58.199 1.00 44.27 ? 52   GLU B OE1 1 
ATOM   1106 O  OE2 . GLU B 1 50  ? 24.741 14.138  57.685 1.00 39.19 ? 52   GLU B OE2 1 
ATOM   1107 N  N   . GLU B 1 51  ? 20.401 17.643  59.129 1.00 37.62 ? 53   GLU B N   1 
ATOM   1108 C  CA  . GLU B 1 51  ? 19.127 17.943  58.472 1.00 37.96 ? 53   GLU B CA  1 
ATOM   1109 C  C   . GLU B 1 51  ? 19.170 17.591  56.992 1.00 37.79 ? 53   GLU B C   1 
ATOM   1110 O  O   . GLU B 1 51  ? 18.210 17.039  56.440 1.00 37.96 ? 53   GLU B O   1 
ATOM   1111 C  CB  . GLU B 1 51  ? 18.767 19.432  58.606 1.00 38.15 ? 53   GLU B CB  1 
ATOM   1112 C  CG  . GLU B 1 51  ? 18.772 19.988  60.024 1.00 39.55 ? 53   GLU B CG  1 
ATOM   1113 C  CD  . GLU B 1 51  ? 17.865 19.225  60.972 1.00 41.37 ? 53   GLU B CD  1 
ATOM   1114 O  OE1 . GLU B 1 51  ? 18.101 19.321  62.189 1.00 41.00 ? 53   GLU B OE1 1 
ATOM   1115 O  OE2 . GLU B 1 51  ? 16.937 18.519  60.504 1.00 42.51 ? 53   GLU B OE2 1 
ATOM   1116 N  N   . VAL B 1 52  ? 20.290 17.904  56.351 1.00 37.51 ? 54   VAL B N   1 
ATOM   1117 C  CA  . VAL B 1 52  ? 20.411 17.716  54.911 1.00 37.77 ? 54   VAL B CA  1 
ATOM   1118 C  C   . VAL B 1 52  ? 20.913 16.315  54.581 1.00 37.47 ? 54   VAL B C   1 
ATOM   1119 O  O   . VAL B 1 52  ? 21.840 15.797  55.220 1.00 37.58 ? 54   VAL B O   1 
ATOM   1120 C  CB  . VAL B 1 52  ? 21.316 18.801  54.263 1.00 37.67 ? 54   VAL B CB  1 
ATOM   1121 C  CG1 . VAL B 1 52  ? 21.410 18.621  52.749 1.00 39.07 ? 54   VAL B CG1 1 
ATOM   1122 C  CG2 . VAL B 1 52  ? 20.788 20.195  54.583 1.00 39.24 ? 54   VAL B CG2 1 
ATOM   1123 N  N   . TRP B 1 53  ? 20.280 15.706  53.585 1.00 36.72 ? 55   TRP B N   1 
ATOM   1124 C  CA  . TRP B 1 53  ? 20.704 14.419  53.093 1.00 36.32 ? 55   TRP B CA  1 
ATOM   1125 C  C   . TRP B 1 53  ? 21.858 14.597  52.125 1.00 36.45 ? 55   TRP B C   1 
ATOM   1126 O  O   . TRP B 1 53  ? 21.744 15.350  51.154 1.00 36.55 ? 55   TRP B O   1 
ATOM   1127 C  CB  . TRP B 1 53  ? 19.545 13.721  52.376 1.00 36.58 ? 55   TRP B CB  1 
ATOM   1128 C  CG  . TRP B 1 53  ? 18.484 13.248  53.308 1.00 36.71 ? 55   TRP B CG  1 
ATOM   1129 C  CD1 . TRP B 1 53  ? 17.444 13.980  53.809 1.00 36.91 ? 55   TRP B CD1 1 
ATOM   1130 C  CD2 . TRP B 1 53  ? 18.358 11.938  53.859 1.00 36.23 ? 55   TRP B CD2 1 
ATOM   1131 N  NE1 . TRP B 1 53  ? 16.680 13.204  54.644 1.00 36.18 ? 55   TRP B NE1 1 
ATOM   1132 C  CE2 . TRP B 1 53  ? 17.216 11.945  54.693 1.00 36.52 ? 55   TRP B CE2 1 
ATOM   1133 C  CE3 . TRP B 1 53  ? 19.101 10.758  53.736 1.00 35.20 ? 55   TRP B CE3 1 
ATOM   1134 C  CZ2 . TRP B 1 53  ? 16.797 10.813  55.404 1.00 36.38 ? 55   TRP B CZ2 1 
ATOM   1135 C  CZ3 . TRP B 1 53  ? 18.683 9.630   54.442 1.00 36.45 ? 55   TRP B CZ3 1 
ATOM   1136 C  CH2 . TRP B 1 53  ? 17.539 9.668   55.262 1.00 37.25 ? 55   TRP B CH2 1 
ATOM   1137 N  N   . HIS B 1 54  ? 22.970 13.922  52.386 1.00 35.61 ? 56   HIS B N   1 
ATOM   1138 C  CA  . HIS B 1 54  ? 24.053 13.889  51.409 1.00 35.96 ? 56   HIS B CA  1 
ATOM   1139 C  C   . HIS B 1 54  ? 23.662 12.924  50.308 1.00 35.27 ? 56   HIS B C   1 
ATOM   1140 O  O   . HIS B 1 54  ? 22.792 12.094  50.512 1.00 34.87 ? 56   HIS B O   1 
ATOM   1141 C  CB  . HIS B 1 54  ? 25.364 13.454  52.050 1.00 36.40 ? 56   HIS B CB  1 
ATOM   1142 C  CG  . HIS B 1 54  ? 25.890 14.439  53.046 1.00 38.05 ? 56   HIS B CG  1 
ATOM   1143 N  ND1 . HIS B 1 54  ? 26.231 15.726  52.706 1.00 41.66 ? 56   HIS B ND1 1 
ATOM   1144 C  CD2 . HIS B 1 54  ? 26.110 14.329  54.376 1.00 40.61 ? 56   HIS B CD2 1 
ATOM   1145 C  CE1 . HIS B 1 54  ? 26.653 16.368  53.782 1.00 41.74 ? 56   HIS B CE1 1 
ATOM   1146 N  NE2 . HIS B 1 54  ? 26.585 15.542  54.810 1.00 41.56 ? 56   HIS B NE2 1 
ATOM   1147 N  N   . SER B 1 55  ? 24.280 13.047  49.135 1.00 34.79 ? 57   SER B N   1 
ATOM   1148 C  CA  . SER B 1 55  ? 23.977 12.116  48.053 1.00 34.82 ? 57   SER B CA  1 
ATOM   1149 C  C   . SER B 1 55  ? 25.193 11.860  47.192 1.00 34.43 ? 57   SER B C   1 
ATOM   1150 O  O   . SER B 1 55  ? 26.146 12.641  47.198 1.00 33.41 ? 57   SER B O   1 
ATOM   1151 C  CB  . SER B 1 55  ? 22.829 12.617  47.174 1.00 34.70 ? 57   SER B CB  1 
ATOM   1152 O  OG  . SER B 1 55  ? 23.222 13.745  46.426 1.00 35.20 ? 57   SER B OG  1 
ATOM   1153 N  N   . LYS B 1 56  ? 25.141 10.747  46.475 1.00 34.03 ? 58   LYS B N   1 
ATOM   1154 C  CA  . LYS B 1 56  ? 26.172 10.380  45.528 1.00 34.02 ? 58   LYS B CA  1 
ATOM   1155 C  C   . LYS B 1 56  ? 25.551 9.464   44.485 1.00 33.61 ? 58   LYS B C   1 
ATOM   1156 O  O   . LYS B 1 56  ? 24.680 8.649   44.790 1.00 33.06 ? 58   LYS B O   1 
ATOM   1157 C  CB  . LYS B 1 56  ? 27.332 9.662   46.221 1.00 34.26 ? 58   LYS B CB  1 
ATOM   1158 C  CG  . LYS B 1 56  ? 28.497 9.339   45.271 1.00 35.39 ? 58   LYS B CG  1 
ATOM   1159 C  CD  . LYS B 1 56  ? 29.759 8.964   46.037 1.00 36.01 ? 58   LYS B CD  1 
ATOM   1160 C  CE  . LYS B 1 56  ? 30.884 8.618   45.079 1.00 37.10 ? 58   LYS B CE  1 
ATOM   1161 N  NZ  . LYS B 1 56  ? 32.161 8.384   45.812 1.00 35.82 ? 58   LYS B NZ  1 
ATOM   1162 N  N   . TRP B 1 57  ? 26.020 9.611   43.259 1.00 33.27 ? 59   TRP B N   1 
ATOM   1163 C  CA  . TRP B 1 57  ? 25.548 8.810   42.152 1.00 33.93 ? 59   TRP B CA  1 
ATOM   1164 C  C   . TRP B 1 57  ? 26.534 7.696   41.861 1.00 33.90 ? 59   TRP B C   1 
ATOM   1165 O  O   . TRP B 1 57  ? 27.759 7.862   42.023 1.00 34.31 ? 59   TRP B O   1 
ATOM   1166 C  CB  . TRP B 1 57  ? 25.409 9.705   40.925 1.00 33.99 ? 59   TRP B CB  1 
ATOM   1167 C  CG  . TRP B 1 57  ? 24.239 10.630  40.991 1.00 34.52 ? 59   TRP B CG  1 
ATOM   1168 C  CD1 . TRP B 1 57  ? 24.191 11.870  41.572 1.00 34.51 ? 59   TRP B CD1 1 
ATOM   1169 C  CD2 . TRP B 1 57  ? 22.940 10.388  40.446 1.00 34.78 ? 59   TRP B CD2 1 
ATOM   1170 N  NE1 . TRP B 1 57  ? 22.937 12.415  41.415 1.00 34.23 ? 59   TRP B NE1 1 
ATOM   1171 C  CE2 . TRP B 1 57  ? 22.151 11.523  40.727 1.00 34.48 ? 59   TRP B CE2 1 
ATOM   1172 C  CE3 . TRP B 1 57  ? 22.363 9.312   39.748 1.00 35.53 ? 59   TRP B CE3 1 
ATOM   1173 C  CZ2 . TRP B 1 57  ? 20.813 11.622  40.325 1.00 34.79 ? 59   TRP B CZ2 1 
ATOM   1174 C  CZ3 . TRP B 1 57  ? 21.030 9.412   39.351 1.00 35.64 ? 59   TRP B CZ3 1 
ATOM   1175 C  CH2 . TRP B 1 57  ? 20.272 10.561  39.644 1.00 34.87 ? 59   TRP B CH2 1 
ATOM   1176 N  N   . TYR B 1 58  ? 25.999 6.589   41.356 1.00 34.14 ? 60   TYR B N   1 
ATOM   1177 C  CA  . TYR B 1 58  ? 26.782 5.397   41.079 1.00 33.92 ? 60   TYR B CA  1 
ATOM   1178 C  C   . TYR B 1 58  ? 26.337 4.818   39.750 1.00 34.41 ? 60   TYR B C   1 
ATOM   1179 O  O   . TYR B 1 58  ? 25.143 4.778   39.451 1.00 34.08 ? 60   TYR B O   1 
ATOM   1180 C  CB  . TYR B 1 58  ? 26.544 4.351   42.180 1.00 34.13 ? 60   TYR B CB  1 
ATOM   1181 C  CG  . TYR B 1 58  ? 26.961 4.816   43.554 1.00 33.32 ? 60   TYR B CG  1 
ATOM   1182 C  CD1 . TYR B 1 58  ? 28.248 4.578   44.024 1.00 34.01 ? 60   TYR B CD1 1 
ATOM   1183 C  CD2 . TYR B 1 58  ? 26.074 5.521   44.376 1.00 34.01 ? 60   TYR B CD2 1 
ATOM   1184 C  CE1 . TYR B 1 58  ? 28.654 5.049   45.303 1.00 35.05 ? 60   TYR B CE1 1 
ATOM   1185 C  CE2 . TYR B 1 58  ? 26.461 5.975   45.650 1.00 33.91 ? 60   TYR B CE2 1 
ATOM   1186 C  CZ  . TYR B 1 58  ? 27.747 5.732   46.099 1.00 33.99 ? 60   TYR B CZ  1 
ATOM   1187 O  OH  . TYR B 1 58  ? 28.130 6.169   47.348 1.00 34.92 ? 60   TYR B OH  1 
ATOM   1188 N  N   . ASP B 1 59  ? 27.300 4.378   38.954 1.00 34.57 ? 61   ASP B N   1 
ATOM   1189 C  CA  . ASP B 1 59  ? 26.989 3.741   37.699 1.00 35.12 ? 61   ASP B CA  1 
ATOM   1190 C  C   . ASP B 1 59  ? 26.336 2.377   37.962 1.00 35.43 ? 61   ASP B C   1 
ATOM   1191 O  O   . ASP B 1 59  ? 26.833 1.598   38.779 1.00 35.61 ? 61   ASP B O   1 
ATOM   1192 C  CB  . ASP B 1 59  ? 28.248 3.534   36.887 1.00 34.70 ? 61   ASP B CB  1 
ATOM   1193 C  CG  . ASP B 1 59  ? 27.961 2.894   35.555 1.00 37.01 ? 61   ASP B CG  1 
ATOM   1194 O  OD1 . ASP B 1 59  ? 27.267 3.530   34.719 1.00 37.30 ? 61   ASP B OD1 1 
ATOM   1195 O  OD2 . ASP B 1 59  ? 28.438 1.760   35.354 1.00 37.74 ? 61   ASP B OD2 1 
ATOM   1196 N  N   . ALA B 1 60  ? 25.244 2.090   37.258 1.00 35.78 ? 62   ALA B N   1 
ATOM   1197 C  CA  . ALA B 1 60  ? 24.507 0.839   37.485 1.00 36.62 ? 62   ALA B CA  1 
ATOM   1198 C  C   . ALA B 1 60  ? 25.330 -0.393  37.135 1.00 37.21 ? 62   ALA B C   1 
ATOM   1199 O  O   . ALA B 1 60  ? 25.316 -1.367  37.870 1.00 37.10 ? 62   ALA B O   1 
ATOM   1200 C  CB  . ALA B 1 60  ? 23.197 0.828   36.715 1.00 37.12 ? 62   ALA B CB  1 
ATOM   1201 N  N   . LYS B 1 61  ? 26.054 -0.343  36.019 1.00 37.68 ? 63   LYS B N   1 
ATOM   1202 C  CA  . LYS B 1 61  ? 26.850 -1.485  35.585 1.00 38.86 ? 63   LYS B CA  1 
ATOM   1203 C  C   . LYS B 1 61  ? 27.930 -1.857  36.612 1.00 38.84 ? 63   LYS B C   1 
ATOM   1204 O  O   . LYS B 1 61  ? 28.146 -3.036  36.894 1.00 39.21 ? 63   LYS B O   1 
ATOM   1205 C  CB  . LYS B 1 61  ? 27.418 -1.247  34.176 1.00 39.04 ? 63   LYS B CB  1 
ATOM   1206 C  CG  . LYS B 1 61  ? 27.916 -2.496  33.460 1.00 41.98 ? 63   LYS B CG  1 
ATOM   1207 C  CD  . LYS B 1 61  ? 29.432 -2.653  33.551 1.00 45.58 ? 63   LYS B CD  1 
ATOM   1208 C  CE  . LYS B 1 61  ? 29.878 -4.018  33.034 1.00 46.98 ? 63   LYS B CE  1 
ATOM   1209 N  NZ  . LYS B 1 61  ? 29.374 -4.337  31.664 1.00 48.23 ? 63   LYS B NZ  1 
ATOM   1210 N  N   . GLU B 1 62  ? 28.581 -0.851  37.186 1.00 39.25 ? 64   GLU B N   1 
ATOM   1211 C  CA  . GLU B 1 62  ? 29.598 -1.078  38.210 1.00 39.31 ? 64   GLU B CA  1 
ATOM   1212 C  C   . GLU B 1 62  ? 28.981 -1.623  39.497 1.00 38.52 ? 64   GLU B C   1 
ATOM   1213 O  O   . GLU B 1 62  ? 29.524 -2.541  40.119 1.00 38.60 ? 64   GLU B O   1 
ATOM   1214 C  CB  . GLU B 1 62  ? 30.370 0.213   38.520 1.00 39.82 ? 64   GLU B CB  1 
ATOM   1215 C  CG  A GLU B 1 62  ? 31.590 -0.067  39.396 0.50 40.34 ? 64   GLU B CG  1 
ATOM   1216 C  CG  B GLU B 1 62  ? 31.175 0.758   37.337 0.50 40.85 ? 64   GLU B CG  1 
ATOM   1217 C  CD  A GLU B 1 62  ? 32.149 1.137   40.123 0.50 40.86 ? 64   GLU B CD  1 
ATOM   1218 C  CD  B GLU B 1 62  ? 32.403 -0.076  37.025 0.50 42.62 ? 64   GLU B CD  1 
ATOM   1219 O  OE1 A GLU B 1 62  ? 31.581 2.249   40.035 0.50 42.93 ? 64   GLU B OE1 1 
ATOM   1220 O  OE1 B GLU B 1 62  ? 32.878 -0.795  37.932 0.50 43.94 ? 64   GLU B OE1 1 
ATOM   1221 O  OE2 A GLU B 1 62  ? 33.171 0.951   40.808 0.50 39.85 ? 64   GLU B OE2 1 
ATOM   1222 O  OE2 B GLU B 1 62  ? 32.901 -0.006  35.878 0.50 43.24 ? 64   GLU B OE2 1 
ATOM   1223 N  N   . ALA B 1 63  ? 27.850 -1.048  39.894 1.00 37.61 ? 65   ALA B N   1 
ATOM   1224 C  CA  . ALA B 1 63  ? 27.123 -1.507  41.079 1.00 37.00 ? 65   ALA B CA  1 
ATOM   1225 C  C   . ALA B 1 63  ? 26.480 -2.893  40.889 1.00 37.11 ? 65   ALA B C   1 
ATOM   1226 O  O   . ALA B 1 63  ? 26.211 -3.588  41.864 1.00 36.18 ? 65   ALA B O   1 
ATOM   1227 C  CB  . ALA B 1 63  ? 26.062 -0.503  41.457 1.00 36.85 ? 65   ALA B CB  1 
ATOM   1228 N  N   . SER B 1 64  ? 26.242 -3.282  39.642 1.00 37.18 ? 66   SER B N   1 
ATOM   1229 C  CA  . SER B 1 64  ? 25.512 -4.518  39.343 1.00 37.98 ? 66   SER B CA  1 
ATOM   1230 C  C   . SER B 1 64  ? 26.226 -5.817  39.720 1.00 38.35 ? 66   SER B C   1 
ATOM   1231 O  O   . SER B 1 64  ? 25.560 -6.800  40.018 1.00 37.39 ? 66   SER B O   1 
ATOM   1232 C  CB  . SER B 1 64  ? 25.096 -4.561  37.872 1.00 37.91 ? 66   SER B CB  1 
ATOM   1233 O  OG  . SER B 1 64  ? 26.206 -4.840  37.026 1.00 39.60 ? 66   SER B OG  1 
HETATM 1234 N  N   . MSE B 1 65  ? 27.562 -5.836  39.713 1.00 38.99 ? 67   MSE B N   1 
HETATM 1235 C  CA  . MSE B 1 65  ? 28.263 -7.093  39.999 1.00 41.04 ? 67   MSE B CA  1 
HETATM 1236 C  C   . MSE B 1 65  ? 27.896 -7.645  41.370 1.00 38.94 ? 67   MSE B C   1 
HETATM 1237 O  O   . MSE B 1 65  ? 27.603 -8.824  41.505 1.00 37.84 ? 67   MSE B O   1 
HETATM 1238 C  CB  . MSE B 1 65  ? 29.784 -7.002  39.881 1.00 40.50 ? 67   MSE B CB  1 
HETATM 1239 C  CG  . MSE B 1 65  ? 30.427 -8.391  40.078 1.00 43.33 ? 67   MSE B CG  1 
HETATM 1240 SE SE  . MSE B 1 65  ? 32.376 -8.493  39.993 1.00 49.96 ? 67   MSE B SE  1 
HETATM 1241 C  CE  . MSE B 1 65  ? 32.803 -7.587  41.653 1.00 46.45 ? 67   MSE B CE  1 
ATOM   1242 N  N   . GLU B 1 66  ? 27.909 -6.778  42.374 1.00 37.61 ? 68   GLU B N   1 
ATOM   1243 C  CA  . GLU B 1 66  ? 27.592 -7.201  43.729 1.00 37.03 ? 68   GLU B CA  1 
ATOM   1244 C  C   . GLU B 1 66  ? 26.374 -6.496  44.312 1.00 36.63 ? 68   GLU B C   1 
ATOM   1245 O  O   . GLU B 1 66  ? 26.047 -6.697  45.479 1.00 36.18 ? 68   GLU B O   1 
ATOM   1246 C  CB  . GLU B 1 66  ? 28.813 -7.026  44.638 1.00 36.84 ? 68   GLU B CB  1 
ATOM   1247 C  CG  . GLU B 1 66  ? 29.941 -7.995  44.320 1.00 37.38 ? 68   GLU B CG  1 
ATOM   1248 C  CD  . GLU B 1 66  ? 31.099 -7.868  45.277 1.00 39.20 ? 68   GLU B CD  1 
ATOM   1249 O  OE1 . GLU B 1 66  ? 31.783 -6.820  45.257 1.00 39.13 ? 68   GLU B OE1 1 
ATOM   1250 O  OE2 . GLU B 1 66  ? 31.325 -8.819  46.042 1.00 39.00 ? 68   GLU B OE2 1 
ATOM   1251 N  N   . GLY B 1 67  ? 25.688 -5.702  43.488 1.00 36.45 ? 69   GLY B N   1 
ATOM   1252 C  CA  . GLY B 1 67  ? 24.550 -4.906  43.946 1.00 36.69 ? 69   GLY B CA  1 
ATOM   1253 C  C   . GLY B 1 67  ? 25.027 -4.072  45.113 1.00 37.21 ? 69   GLY B C   1 
ATOM   1254 O  O   . GLY B 1 67  ? 24.424 -4.091  46.179 1.00 37.53 ? 69   GLY B O   1 
ATOM   1255 N  N   . ILE B 1 68  ? 26.138 -3.360  44.907 1.00 36.89 ? 70   ILE B N   1 
ATOM   1256 C  CA  . ILE B 1 68  ? 26.797 -2.636  45.977 1.00 37.29 ? 70   ILE B CA  1 
ATOM   1257 C  C   . ILE B 1 68  ? 27.070 -1.179  45.608 1.00 36.77 ? 70   ILE B C   1 
ATOM   1258 O  O   . ILE B 1 68  ? 27.427 -0.869  44.461 1.00 36.34 ? 70   ILE B O   1 
ATOM   1259 C  CB  . ILE B 1 68  ? 28.168 -3.312  46.388 1.00 37.18 ? 70   ILE B CB  1 
ATOM   1260 C  CG1 A ILE B 1 68  ? 28.576 -2.907  47.808 0.50 36.95 ? 70   ILE B CG1 1 
ATOM   1261 C  CG1 B ILE B 1 68  ? 27.971 -4.582  47.201 0.50 37.45 ? 70   ILE B CG1 1 
ATOM   1262 C  CG2 A ILE B 1 68  ? 29.247 -3.065  45.332 0.50 37.37 ? 70   ILE B CG2 1 
ATOM   1263 C  CG2 B ILE B 1 68  ? 29.022 -2.355  47.231 0.50 37.73 ? 70   ILE B CG2 1 
ATOM   1264 C  CD1 A ILE B 1 68  ? 29.756 -3.689  48.349 0.50 37.81 ? 70   ILE B CD1 1 
ATOM   1265 C  CD1 B ILE B 1 68  ? 29.255 -5.131  47.852 0.50 37.01 ? 70   ILE B CD1 1 
ATOM   1266 N  N   . VAL B 1 69  ? 26.871 -0.293  46.579 1.00 36.82 ? 71   VAL B N   1 
ATOM   1267 C  CA  . VAL B 1 69  ? 27.376 1.082   46.479 1.00 36.73 ? 71   VAL B CA  1 
ATOM   1268 C  C   . VAL B 1 69  ? 28.139 1.344   47.777 1.00 37.07 ? 71   VAL B C   1 
ATOM   1269 O  O   . VAL B 1 69  ? 27.759 0.846   48.839 1.00 36.58 ? 71   VAL B O   1 
ATOM   1270 C  CB  . VAL B 1 69  ? 26.279 2.169   46.201 1.00 36.84 ? 71   VAL B CB  1 
ATOM   1271 C  CG1 . VAL B 1 69  ? 25.606 1.941   44.839 1.00 37.40 ? 71   VAL B CG1 1 
ATOM   1272 C  CG2 . VAL B 1 69  ? 25.215 2.245   47.315 1.00 37.55 ? 71   VAL B CG2 1 
ATOM   1273 N  N   . THR B 1 70  ? 29.246 2.064   47.678 1.00 36.77 ? 72   THR B N   1 
ATOM   1274 C  CA  . THR B 1 70  ? 30.034 2.389   48.852 1.00 37.64 ? 72   THR B CA  1 
ATOM   1275 C  C   . THR B 1 70  ? 29.902 3.872   49.156 1.00 37.38 ? 72   THR B C   1 
ATOM   1276 O  O   . THR B 1 70  ? 30.120 4.729   48.286 1.00 36.54 ? 72   THR B O   1 
ATOM   1277 C  CB  . THR B 1 70  ? 31.528 1.983   48.696 1.00 37.80 ? 72   THR B CB  1 
ATOM   1278 O  OG1 . THR B 1 70  ? 31.611 0.561   48.561 1.00 39.79 ? 72   THR B OG1 1 
ATOM   1279 C  CG2 . THR B 1 70  ? 32.331 2.395   49.927 1.00 38.35 ? 72   THR B CG2 1 
ATOM   1280 N  N   . ILE B 1 71  ? 29.514 4.156   50.394 1.00 37.55 ? 73   ILE B N   1 
ATOM   1281 C  CA  . ILE B 1 71  ? 29.396 5.513   50.884 1.00 37.81 ? 73   ILE B CA  1 
ATOM   1282 C  C   . ILE B 1 71  ? 30.708 5.815   51.579 1.00 37.54 ? 73   ILE B C   1 
ATOM   1283 O  O   . ILE B 1 71  ? 31.160 5.024   52.402 1.00 36.85 ? 73   ILE B O   1 
ATOM   1284 C  CB  . ILE B 1 71  ? 28.288 5.645   51.962 1.00 38.07 ? 73   ILE B CB  1 
ATOM   1285 C  CG1 . ILE B 1 71  ? 26.974 4.957   51.551 1.00 41.66 ? 73   ILE B CG1 1 
ATOM   1286 C  CG2 . ILE B 1 71  ? 28.097 7.114   52.358 1.00 39.10 ? 73   ILE B CG2 1 
ATOM   1287 C  CD1 . ILE B 1 71  ? 26.235 5.604   50.415 1.00 44.57 ? 73   ILE B CD1 1 
ATOM   1288 N  N   . VAL B 1 72  ? 31.310 6.960   51.266 1.00 37.00 ? 74   VAL B N   1 
ATOM   1289 C  CA  . VAL B 1 72  ? 32.582 7.355   51.873 1.00 37.07 ? 74   VAL B CA  1 
ATOM   1290 C  C   . VAL B 1 72  ? 32.479 8.726   52.534 1.00 37.39 ? 74   VAL B C   1 
ATOM   1291 O  O   . VAL B 1 72  ? 31.455 9.405   52.409 1.00 37.55 ? 74   VAL B O   1 
ATOM   1292 C  CB  . VAL B 1 72  ? 33.757 7.358   50.851 1.00 37.34 ? 74   VAL B CB  1 
ATOM   1293 C  CG1 . VAL B 1 72  ? 33.817 6.026   50.094 1.00 36.49 ? 74   VAL B CG1 1 
ATOM   1294 C  CG2 . VAL B 1 72  ? 33.649 8.533   49.863 1.00 36.78 ? 74   VAL B CG2 1 
ATOM   1295 N  N   . GLY B 1 73  ? 33.538 9.109   53.245 1.00 36.95 ? 75   GLY B N   1 
ATOM   1296 C  CA  . GLY B 1 73  ? 33.633 10.415  53.877 1.00 37.37 ? 75   GLY B CA  1 
ATOM   1297 C  C   . GLY B 1 73  ? 32.775 10.537  55.114 1.00 37.53 ? 75   GLY B C   1 
ATOM   1298 O  O   . GLY B 1 73  ? 32.459 11.642  55.542 1.00 37.74 ? 75   GLY B O   1 
ATOM   1299 N  N   . LEU B 1 74  ? 32.407 9.399   55.697 1.00 36.77 ? 76   LEU B N   1 
ATOM   1300 C  CA  . LEU B 1 74  ? 31.575 9.384   56.886 1.00 36.89 ? 76   LEU B CA  1 
ATOM   1301 C  C   . LEU B 1 74  ? 32.399 9.656   58.125 1.00 37.18 ? 76   LEU B C   1 
ATOM   1302 O  O   . LEU B 1 74  ? 33.620 9.479   58.127 1.00 36.52 ? 76   LEU B O   1 
ATOM   1303 C  CB  . LEU B 1 74  ? 30.872 8.026   57.040 1.00 36.36 ? 76   LEU B CB  1 
ATOM   1304 C  CG  . LEU B 1 74  ? 30.024 7.582   55.849 1.00 36.69 ? 76   LEU B CG  1 
ATOM   1305 C  CD1 . LEU B 1 74  ? 29.525 6.167   56.067 1.00 34.30 ? 76   LEU B CD1 1 
ATOM   1306 C  CD2 . LEU B 1 74  ? 28.861 8.546   55.618 1.00 35.53 ? 76   LEU B CD2 1 
ATOM   1307 N  N   . LYS B 1 75  ? 31.709 10.088  59.173 1.00 38.04 ? 77   LYS B N   1 
ATOM   1308 C  CA  . LYS B 1 75  ? 32.319 10.345  60.472 1.00 39.47 ? 77   LYS B CA  1 
ATOM   1309 C  C   . LYS B 1 75  ? 32.276 9.056   61.292 1.00 38.68 ? 77   LYS B C   1 
ATOM   1310 O  O   . LYS B 1 75  ? 31.251 8.375   61.311 1.00 39.18 ? 77   LYS B O   1 
ATOM   1311 C  CB  . LYS B 1 75  ? 31.563 11.454  61.201 1.00 39.44 ? 77   LYS B CB  1 
ATOM   1312 C  CG  . LYS B 1 75  ? 31.770 12.845  60.600 1.00 42.08 ? 77   LYS B CG  1 
ATOM   1313 C  CD  . LYS B 1 75  ? 30.866 13.919  61.231 1.00 42.23 ? 77   LYS B CD  1 
ATOM   1314 C  CE  . LYS B 1 75  ? 29.411 13.773  60.768 1.00 47.58 ? 77   LYS B CE  1 
ATOM   1315 N  NZ  . LYS B 1 75  ? 28.641 15.051  60.911 1.00 49.59 ? 77   LYS B NZ  1 
ATOM   1316 N  N   . PRO B 1 76  ? 33.398 8.696   61.941 1.00 38.33 ? 78   PRO B N   1 
ATOM   1317 C  CA  . PRO B 1 76  ? 33.458 7.508   62.795 1.00 38.02 ? 78   PRO B CA  1 
ATOM   1318 C  C   . PRO B 1 76  ? 32.473 7.570   63.968 1.00 37.52 ? 78   PRO B C   1 
ATOM   1319 O  O   . PRO B 1 76  ? 32.091 8.663   64.397 1.00 37.23 ? 78   PRO B O   1 
ATOM   1320 C  CB  . PRO B 1 76  ? 34.902 7.519   63.309 1.00 38.02 ? 78   PRO B CB  1 
ATOM   1321 C  CG  . PRO B 1 76  ? 35.653 8.293   62.287 1.00 38.81 ? 78   PRO B CG  1 
ATOM   1322 C  CD  . PRO B 1 76  ? 34.705 9.371   61.859 1.00 38.43 ? 78   PRO B CD  1 
ATOM   1323 N  N   . GLU B 1 77  ? 32.063 6.397   64.455 1.00 37.05 ? 79   GLU B N   1 
ATOM   1324 C  CA  . GLU B 1 77  ? 31.124 6.261   65.582 1.00 36.69 ? 79   GLU B CA  1 
ATOM   1325 C  C   . GLU B 1 77  ? 29.885 7.143   65.445 1.00 36.19 ? 79   GLU B C   1 
ATOM   1326 O  O   . GLU B 1 77  ? 29.455 7.786   66.401 1.00 35.40 ? 79   GLU B O   1 
ATOM   1327 C  CB  . GLU B 1 77  ? 31.829 6.539   66.914 1.00 37.03 ? 79   GLU B CB  1 
ATOM   1328 C  CG  . GLU B 1 77  ? 33.101 5.754   67.089 1.00 38.37 ? 79   GLU B CG  1 
ATOM   1329 C  CD  . GLU B 1 77  ? 33.718 5.937   68.449 1.00 39.96 ? 79   GLU B CD  1 
ATOM   1330 O  OE1 . GLU B 1 77  ? 34.812 6.534   68.521 1.00 41.20 ? 79   GLU B OE1 1 
ATOM   1331 O  OE2 . GLU B 1 77  ? 33.104 5.496   69.444 1.00 41.69 ? 79   GLU B OE2 1 
ATOM   1332 N  N   . THR B 1 78  ? 29.304 7.143   64.251 1.00 35.80 ? 80   THR B N   1 
ATOM   1333 C  CA  . THR B 1 78  ? 28.168 7.999   63.945 1.00 35.72 ? 80   THR B CA  1 
ATOM   1334 C  C   . THR B 1 78  ? 27.060 7.184   63.296 1.00 35.30 ? 80   THR B C   1 
ATOM   1335 O  O   . THR B 1 78  ? 27.308 6.387   62.388 1.00 35.14 ? 80   THR B O   1 
ATOM   1336 C  CB  . THR B 1 78  ? 28.601 9.182   63.025 1.00 36.13 ? 80   THR B CB  1 
ATOM   1337 O  OG1 . THR B 1 78  ? 29.573 9.979   63.710 1.00 36.17 ? 80   THR B OG1 1 
ATOM   1338 C  CG2 . THR B 1 78  ? 27.422 10.080  62.645 1.00 36.80 ? 80   THR B CG2 1 
ATOM   1339 N  N   . THR B 1 79  ? 25.840 7.386   63.780 1.00 34.60 ? 81   THR B N   1 
ATOM   1340 C  CA  . THR B 1 79  ? 24.674 6.735   63.219 1.00 34.33 ? 81   THR B CA  1 
ATOM   1341 C  C   . THR B 1 79  ? 24.178 7.497   62.002 1.00 34.37 ? 81   THR B C   1 
ATOM   1342 O  O   . THR B 1 79  ? 24.031 8.724   62.044 1.00 34.09 ? 81   THR B O   1 
ATOM   1343 C  CB  . THR B 1 79  ? 23.556 6.601   64.273 1.00 34.38 ? 81   THR B CB  1 
ATOM   1344 O  OG1 . THR B 1 79  ? 24.043 5.800   65.344 1.00 34.09 ? 81   THR B OG1 1 
ATOM   1345 C  CG2 . THR B 1 79  ? 22.312 5.941   63.690 1.00 34.16 ? 81   THR B CG2 1 
ATOM   1346 N  N   . TYR B 1 80  ? 23.939 6.747   60.923 1.00 34.10 ? 82   TYR B N   1 
ATOM   1347 C  CA  . TYR B 1 80  ? 23.443 7.292   59.668 1.00 34.24 ? 82   TYR B CA  1 
ATOM   1348 C  C   . TYR B 1 80  ? 22.192 6.577   59.237 1.00 34.12 ? 82   TYR B C   1 
ATOM   1349 O  O   . TYR B 1 80  ? 21.985 5.412   59.573 1.00 34.26 ? 82   TYR B O   1 
ATOM   1350 C  CB  . TYR B 1 80  ? 24.472 7.107   58.541 1.00 33.70 ? 82   TYR B CB  1 
ATOM   1351 C  CG  . TYR B 1 80  ? 25.661 8.002   58.662 1.00 34.29 ? 82   TYR B CG  1 
ATOM   1352 C  CD1 . TYR B 1 80  ? 25.668 9.273   58.073 1.00 32.93 ? 82   TYR B CD1 1 
ATOM   1353 C  CD2 . TYR B 1 80  ? 26.779 7.588   59.362 1.00 33.60 ? 82   TYR B CD2 1 
ATOM   1354 C  CE1 . TYR B 1 80  ? 26.759 10.103  58.207 1.00 34.49 ? 82   TYR B CE1 1 
ATOM   1355 C  CE2 . TYR B 1 80  ? 27.866 8.396   59.497 1.00 32.95 ? 82   TYR B CE2 1 
ATOM   1356 C  CZ  . TYR B 1 80  ? 27.860 9.650   58.924 1.00 33.68 ? 82   TYR B CZ  1 
ATOM   1357 O  OH  . TYR B 1 80  ? 28.962 10.442  59.087 1.00 33.62 ? 82   TYR B OH  1 
ATOM   1358 N  N   . ALA B 1 81  ? 21.353 7.302   58.507 1.00 33.96 ? 83   ALA B N   1 
ATOM   1359 C  CA  . ALA B 1 81  ? 20.245 6.708   57.780 1.00 34.23 ? 83   ALA B CA  1 
ATOM   1360 C  C   . ALA B 1 81  ? 20.709 6.724   56.337 1.00 34.01 ? 83   ALA B C   1 
ATOM   1361 O  O   . ALA B 1 81  ? 21.328 7.697   55.901 1.00 33.30 ? 83   ALA B O   1 
ATOM   1362 C  CB  . ALA B 1 81  ? 18.990 7.542   57.929 1.00 34.77 ? 83   ALA B CB  1 
ATOM   1363 N  N   . VAL B 1 82  ? 20.436 5.653   55.593 1.00 33.83 ? 84   VAL B N   1 
ATOM   1364 C  CA  . VAL B 1 82  ? 20.809 5.617   54.177 1.00 33.67 ? 84   VAL B CA  1 
ATOM   1365 C  C   . VAL B 1 82  ? 19.621 5.108   53.372 1.00 33.97 ? 84   VAL B C   1 
ATOM   1366 O  O   . VAL B 1 82  ? 18.887 4.222   53.829 1.00 33.22 ? 84   VAL B O   1 
ATOM   1367 C  CB  . VAL B 1 82  ? 22.094 4.746   53.915 1.00 33.82 ? 84   VAL B CB  1 
ATOM   1368 C  CG1 . VAL B 1 82  ? 21.903 3.276   54.392 1.00 34.03 ? 84   VAL B CG1 1 
ATOM   1369 C  CG2 . VAL B 1 82  ? 22.518 4.794   52.435 1.00 33.87 ? 84   VAL B CG2 1 
ATOM   1370 N  N   . ARG B 1 83  ? 19.417 5.687   52.197 1.00 33.82 ? 85   ARG B N   1 
ATOM   1371 C  CA  . ARG B 1 83  ? 18.347 5.236   51.301 1.00 34.31 ? 85   ARG B CA  1 
ATOM   1372 C  C   . ARG B 1 83  ? 18.843 5.315   49.864 1.00 34.54 ? 85   ARG B C   1 
ATOM   1373 O  O   . ARG B 1 83  ? 19.787 6.055   49.576 1.00 34.69 ? 85   ARG B O   1 
ATOM   1374 C  CB  . ARG B 1 83  ? 17.072 6.055   51.522 1.00 34.26 ? 85   ARG B CB  1 
ATOM   1375 C  CG  . ARG B 1 83  ? 17.269 7.550   51.365 1.00 35.83 ? 85   ARG B CG  1 
ATOM   1376 C  CD  . ARG B 1 83  ? 16.107 8.334   51.952 1.00 37.21 ? 85   ARG B CD  1 
ATOM   1377 N  NE  . ARG B 1 83  ? 16.201 9.732   51.548 1.00 37.87 ? 85   ARG B NE  1 
ATOM   1378 C  CZ  . ARG B 1 83  ? 15.383 10.692  51.961 1.00 38.93 ? 85   ARG B CZ  1 
ATOM   1379 N  NH1 . ARG B 1 83  ? 14.393 10.420  52.805 1.00 39.56 ? 85   ARG B NH1 1 
ATOM   1380 N  NH2 . ARG B 1 83  ? 15.560 11.926  51.523 1.00 40.08 ? 85   ARG B NH2 1 
ATOM   1381 N  N   . LEU B 1 84  ? 18.232 4.533   48.977 1.00 34.34 ? 86   LEU B N   1 
ATOM   1382 C  CA  . LEU B 1 84  ? 18.680 4.437   47.588 1.00 34.96 ? 86   LEU B CA  1 
ATOM   1383 C  C   . LEU B 1 84  ? 17.541 4.618   46.594 1.00 34.52 ? 86   LEU B C   1 
ATOM   1384 O  O   . LEU B 1 84  ? 16.386 4.335   46.895 1.00 34.11 ? 86   LEU B O   1 
ATOM   1385 C  CB  . LEU B 1 84  ? 19.324 3.071   47.332 1.00 35.52 ? 86   LEU B CB  1 
ATOM   1386 C  CG  . LEU B 1 84  ? 20.368 2.508   48.300 1.00 38.15 ? 86   LEU B CG  1 
ATOM   1387 C  CD1 . LEU B 1 84  ? 20.716 1.103   47.868 1.00 41.01 ? 86   LEU B CD1 1 
ATOM   1388 C  CD2 . LEU B 1 84  ? 21.614 3.372   48.326 1.00 40.04 ? 86   LEU B CD2 1 
ATOM   1389 N  N   . ALA B 1 85  ? 17.882 5.115   45.413 1.00 34.58 ? 87   ALA B N   1 
ATOM   1390 C  CA  . ALA B 1 85  ? 16.933 5.226   44.319 1.00 34.69 ? 87   ALA B CA  1 
ATOM   1391 C  C   . ALA B 1 85  ? 17.654 4.737   43.068 1.00 34.97 ? 87   ALA B C   1 
ATOM   1392 O  O   . ALA B 1 85  ? 18.890 4.720   43.019 1.00 35.00 ? 87   ALA B O   1 
ATOM   1393 C  CB  . ALA B 1 85  ? 16.462 6.664   44.155 1.00 34.85 ? 87   ALA B CB  1 
ATOM   1394 N  N   . ALA B 1 86  ? 16.888 4.318   42.070 1.00 34.68 ? 88   ALA B N   1 
ATOM   1395 C  CA  . ALA B 1 86  ? 17.456 3.824   40.824 1.00 34.86 ? 88   ALA B CA  1 
ATOM   1396 C  C   . ALA B 1 86  ? 17.007 4.737   39.697 1.00 35.09 ? 88   ALA B C   1 
ATOM   1397 O  O   . ALA B 1 86  ? 15.927 5.322   39.758 1.00 35.25 ? 88   ALA B O   1 
ATOM   1398 C  CB  . ALA B 1 86  ? 17.009 2.368   40.566 1.00 34.78 ? 88   ALA B CB  1 
ATOM   1399 N  N   . LEU B 1 87  ? 17.861 4.894   38.693 1.00 35.21 ? 89   LEU B N   1 
ATOM   1400 C  CA  . LEU B 1 87  ? 17.551 5.727   37.542 1.00 35.71 ? 89   LEU B CA  1 
ATOM   1401 C  C   . LEU B 1 87  ? 17.521 4.880   36.277 1.00 35.83 ? 89   LEU B C   1 
ATOM   1402 O  O   . LEU B 1 87  ? 18.440 4.096   36.027 1.00 35.63 ? 89   LEU B O   1 
ATOM   1403 C  CB  . LEU B 1 87  ? 18.605 6.828   37.365 1.00 35.74 ? 89   LEU B CB  1 
ATOM   1404 C  CG  . LEU B 1 87  ? 18.401 7.807   36.198 1.00 36.41 ? 89   LEU B CG  1 
ATOM   1405 C  CD1 . LEU B 1 87  ? 17.629 9.028   36.661 1.00 37.50 ? 89   LEU B CD1 1 
ATOM   1406 C  CD2 . LEU B 1 87  ? 19.733 8.253   35.619 1.00 37.08 ? 89   LEU B CD2 1 
ATOM   1407 N  N   . ASN B 1 88  ? 16.456 5.035   35.497 1.00 36.37 ? 90   ASN B N   1 
ATOM   1408 C  CA  . ASN B 1 88  ? 16.410 4.475   34.152 1.00 36.85 ? 90   ASN B CA  1 
ATOM   1409 C  C   . ASN B 1 88  ? 16.053 5.578   33.151 1.00 37.36 ? 90   ASN B C   1 
ATOM   1410 O  O   . ASN B 1 88  ? 16.135 6.764   33.482 1.00 36.96 ? 90   ASN B O   1 
ATOM   1411 C  CB  . ASN B 1 88  ? 15.499 3.232   34.049 1.00 37.03 ? 90   ASN B CB  1 
ATOM   1412 C  CG  . ASN B 1 88  ? 14.016 3.538   34.249 1.00 37.46 ? 90   ASN B CG  1 
ATOM   1413 O  OD1 . ASN B 1 88  ? 13.575 4.687   34.225 1.00 38.05 ? 90   ASN B OD1 1 
ATOM   1414 N  ND2 . ASN B 1 88  ? 13.235 2.482   34.436 1.00 38.35 ? 90   ASN B ND2 1 
ATOM   1415 N  N   . GLY B 1 89  ? 15.672 5.186   31.939 1.00 37.95 ? 91   GLY B N   1 
ATOM   1416 C  CA  . GLY B 1 89  ? 15.304 6.133   30.886 1.00 39.02 ? 91   GLY B CA  1 
ATOM   1417 C  C   . GLY B 1 89  ? 14.070 6.955   31.212 1.00 39.66 ? 91   GLY B C   1 
ATOM   1418 O  O   . GLY B 1 89  ? 13.962 8.110   30.796 1.00 40.09 ? 91   GLY B O   1 
ATOM   1419 N  N   . LYS B 1 90  ? 13.139 6.359   31.957 1.00 40.09 ? 92   LYS B N   1 
ATOM   1420 C  CA  . LYS B 1 90  ? 11.902 7.032   32.355 1.00 40.33 ? 92   LYS B CA  1 
ATOM   1421 C  C   . LYS B 1 90  ? 12.147 8.081   33.443 1.00 40.45 ? 92   LYS B C   1 
ATOM   1422 O  O   . LYS B 1 90  ? 11.322 8.974   33.651 1.00 40.78 ? 92   LYS B O   1 
ATOM   1423 C  CB  . LYS B 1 90  ? 10.864 6.013   32.811 1.00 40.57 ? 92   LYS B CB  1 
ATOM   1424 N  N   . GLY B 1 91  ? 13.277 7.960   34.136 1.00 40.17 ? 93   GLY B N   1 
ATOM   1425 C  CA  . GLY B 1 91  ? 13.668 8.923   35.154 1.00 39.83 ? 93   GLY B CA  1 
ATOM   1426 C  C   . GLY B 1 91  ? 14.131 8.269   36.440 1.00 39.51 ? 93   GLY B C   1 
ATOM   1427 O  O   . GLY B 1 91  ? 14.366 7.058   36.489 1.00 39.18 ? 93   GLY B O   1 
ATOM   1428 N  N   . LEU B 1 92  ? 14.269 9.087   37.478 1.00 39.39 ? 94   LEU B N   1 
ATOM   1429 C  CA  . LEU B 1 92  ? 14.659 8.609   38.791 1.00 39.46 ? 94   LEU B CA  1 
ATOM   1430 C  C   . LEU B 1 92  ? 13.431 8.012   39.466 1.00 39.58 ? 94   LEU B C   1 
ATOM   1431 O  O   . LEU B 1 92  ? 12.357 8.623   39.479 1.00 39.62 ? 94   LEU B O   1 
ATOM   1432 C  CB  . LEU B 1 92  ? 15.251 9.749   39.632 1.00 39.42 ? 94   LEU B CB  1 
ATOM   1433 C  CG  . LEU B 1 92  ? 15.918 9.419   40.974 1.00 39.05 ? 94   LEU B CG  1 
ATOM   1434 C  CD1 . LEU B 1 92  ? 17.095 8.454   40.822 1.00 38.45 ? 94   LEU B CD1 1 
ATOM   1435 C  CD2 . LEU B 1 92  ? 16.382 10.712  41.646 1.00 39.82 ? 94   LEU B CD2 1 
ATOM   1436 N  N   . GLY B 1 93  ? 13.587 6.807   39.998 1.00 39.37 ? 95   GLY B N   1 
ATOM   1437 C  CA  . GLY B 1 93  ? 12.497 6.140   40.690 1.00 39.44 ? 95   GLY B CA  1 
ATOM   1438 C  C   . GLY B 1 93  ? 12.364 6.636   42.115 1.00 39.41 ? 95   GLY B C   1 
ATOM   1439 O  O   . GLY B 1 93  ? 13.143 7.479   42.567 1.00 39.10 ? 95   GLY B O   1 
ATOM   1440 N  N   . GLU B 1 94  ? 11.368 6.108   42.821 1.00 39.68 ? 96   GLU B N   1 
ATOM   1441 C  CA  . GLU B 1 94  ? 11.134 6.457   44.215 1.00 39.75 ? 96   GLU B CA  1 
ATOM   1442 C  C   . GLU B 1 94  ? 12.311 6.024   45.076 1.00 39.93 ? 96   GLU B C   1 
ATOM   1443 O  O   . GLU B 1 94  ? 12.944 4.998   44.816 1.00 39.61 ? 96   GLU B O   1 
ATOM   1444 C  CB  . GLU B 1 94  ? 9.844  5.823   44.715 1.00 40.07 ? 96   GLU B CB  1 
ATOM   1445 N  N   . ILE B 1 95  ? 12.620 6.836   46.084 1.00 40.06 ? 97   ILE B N   1 
ATOM   1446 C  CA  . ILE B 1 95  ? 13.690 6.524   47.018 1.00 40.34 ? 97   ILE B CA  1 
ATOM   1447 C  C   . ILE B 1 95  ? 13.201 5.419   47.968 1.00 40.10 ? 97   ILE B C   1 
ATOM   1448 O  O   . ILE B 1 95  ? 12.010 5.355   48.288 1.00 40.04 ? 97   ILE B O   1 
ATOM   1449 C  CB  . ILE B 1 95  ? 14.152 7.805   47.784 1.00 40.44 ? 97   ILE B CB  1 
ATOM   1450 C  CG1 . ILE B 1 95  ? 15.551 7.635   48.384 1.00 41.84 ? 97   ILE B CG1 1 
ATOM   1451 C  CG2 . ILE B 1 95  ? 13.115 8.266   48.812 1.00 40.75 ? 97   ILE B CG2 1 
ATOM   1452 C  CD1 . ILE B 1 95  ? 16.703 8.108   47.489 1.00 42.66 ? 97   ILE B CD1 1 
ATOM   1453 N  N   . SER B 1 96  ? 14.113 4.538   48.382 1.00 39.65 ? 98   SER B N   1 
ATOM   1454 C  CA  . SER B 1 96  ? 13.787 3.454   49.309 1.00 38.97 ? 98   SER B CA  1 
ATOM   1455 C  C   . SER B 1 96  ? 13.526 3.988   50.708 1.00 39.12 ? 98   SER B C   1 
ATOM   1456 O  O   . SER B 1 96  ? 13.781 5.166   51.004 1.00 38.87 ? 98   SER B O   1 
ATOM   1457 C  CB  . SER B 1 96  ? 14.939 2.443   49.387 1.00 38.93 ? 98   SER B CB  1 
ATOM   1458 O  OG  . SER B 1 96  ? 16.064 2.996   50.079 1.00 36.96 ? 98   SER B OG  1 
ATOM   1459 N  N   . ALA B 1 97  ? 13.020 3.108   51.568 1.00 38.96 ? 99   ALA B N   1 
ATOM   1460 C  CA  . ALA B 1 97  ? 12.937 3.397   52.986 1.00 39.06 ? 99   ALA B CA  1 
ATOM   1461 C  C   . ALA B 1 97  ? 14.385 3.504   53.470 1.00 39.08 ? 99   ALA B C   1 
ATOM   1462 O  O   . ALA B 1 97  ? 15.304 2.939   52.856 1.00 38.75 ? 99   ALA B O   1 
ATOM   1463 C  CB  . ALA B 1 97  ? 12.190 2.284   53.717 1.00 39.28 ? 99   ALA B CB  1 
ATOM   1464 N  N   . ALA B 1 98  ? 14.606 4.244   54.549 1.00 39.05 ? 100  ALA B N   1 
ATOM   1465 C  CA  . ALA B 1 98  ? 15.953 4.410   55.048 1.00 39.01 ? 100  ALA B CA  1 
ATOM   1466 C  C   . ALA B 1 98  ? 16.361 3.252   55.959 1.00 39.41 ? 100  ALA B C   1 
ATOM   1467 O  O   . ALA B 1 98  ? 15.560 2.774   56.773 1.00 39.44 ? 100  ALA B O   1 
ATOM   1468 C  CB  . ALA B 1 98  ? 16.088 5.744   55.766 1.00 39.28 ? 100  ALA B CB  1 
ATOM   1469 N  N   . SER B 1 99  ? 17.593 2.784   55.780 1.00 39.35 ? 101  SER B N   1 
ATOM   1470 C  CA  . SER B 1 99  ? 18.185 1.776   56.651 1.00 39.87 ? 101  SER B CA  1 
ATOM   1471 C  C   . SER B 1 99  ? 19.128 2.507   57.582 1.00 39.77 ? 101  SER B C   1 
ATOM   1472 O  O   . SER B 1 99  ? 19.745 3.488   57.194 1.00 39.81 ? 101  SER B O   1 
ATOM   1473 C  CB  . SER B 1 99  ? 18.945 0.717   55.847 1.00 39.81 ? 101  SER B CB  1 
ATOM   1474 O  OG  . SER B 1 99  ? 18.039 -0.115  55.158 1.00 41.11 ? 101  SER B OG  1 
ATOM   1475 N  N   . GLU B 1 100 ? 19.232 2.035   58.812 1.00 39.35 ? 102  GLU B N   1 
ATOM   1476 C  CA  . GLU B 1 100 ? 20.083 2.674   59.803 1.00 39.86 ? 102  GLU B CA  1 
ATOM   1477 C  C   . GLU B 1 100 ? 21.366 1.872   59.964 1.00 39.37 ? 102  GLU B C   1 
ATOM   1478 O  O   . GLU B 1 100 ? 21.341 0.637   59.973 1.00 39.40 ? 102  GLU B O   1 
ATOM   1479 C  CB  . GLU B 1 100 ? 19.342 2.752   61.149 1.00 39.95 ? 102  GLU B CB  1 
ATOM   1480 C  CG  . GLU B 1 100 ? 20.182 3.234   62.337 1.00 41.66 ? 102  GLU B CG  1 
ATOM   1481 C  CD  . GLU B 1 100 ? 19.514 3.014   63.688 1.00 41.88 ? 102  GLU B CD  1 
ATOM   1482 O  OE1 . GLU B 1 100 ? 18.263 3.000   63.764 1.00 46.96 ? 102  GLU B OE1 1 
ATOM   1483 O  OE2 . GLU B 1 100 ? 20.241 2.852   64.693 1.00 45.03 ? 102  GLU B OE2 1 
ATOM   1484 N  N   . PHE B 1 101 ? 22.486 2.574   60.091 1.00 38.51 ? 103  PHE B N   1 
ATOM   1485 C  CA  . PHE B 1 101 ? 23.742 1.917   60.421 1.00 38.09 ? 103  PHE B CA  1 
ATOM   1486 C  C   . PHE B 1 101 ? 24.599 2.849   61.260 1.00 37.14 ? 103  PHE B C   1 
ATOM   1487 O  O   . PHE B 1 101 ? 24.326 4.045   61.360 1.00 37.16 ? 103  PHE B O   1 
ATOM   1488 C  CB  . PHE B 1 101 ? 24.495 1.435   59.168 1.00 37.76 ? 103  PHE B CB  1 
ATOM   1489 C  CG  . PHE B 1 101 ? 25.034 2.538   58.321 1.00 38.09 ? 103  PHE B CG  1 
ATOM   1490 C  CD1 . PHE B 1 101 ? 26.303 3.064   58.564 1.00 38.05 ? 103  PHE B CD1 1 
ATOM   1491 C  CD2 . PHE B 1 101 ? 24.287 3.054   57.274 1.00 38.00 ? 103  PHE B CD2 1 
ATOM   1492 C  CE1 . PHE B 1 101 ? 26.806 4.082   57.792 1.00 37.98 ? 103  PHE B CE1 1 
ATOM   1493 C  CE2 . PHE B 1 101 ? 24.793 4.079   56.489 1.00 37.92 ? 103  PHE B CE2 1 
ATOM   1494 C  CZ  . PHE B 1 101 ? 26.057 4.593   56.746 1.00 39.03 ? 103  PHE B CZ  1 
ATOM   1495 N  N   . LYS B 1 102 ? 25.634 2.295   61.874 1.00 36.17 ? 104  LYS B N   1 
ATOM   1496 C  CA  . LYS B 1 102 ? 26.545 3.111   62.656 1.00 35.10 ? 104  LYS B CA  1 
ATOM   1497 C  C   . LYS B 1 102 ? 27.964 2.780   62.236 1.00 35.04 ? 104  LYS B C   1 
ATOM   1498 O  O   . LYS B 1 102 ? 28.330 1.610   62.146 1.00 33.92 ? 104  LYS B O   1 
ATOM   1499 C  CB  . LYS B 1 102 ? 26.354 2.872   64.156 1.00 35.22 ? 104  LYS B CB  1 
ATOM   1500 C  CG  . LYS B 1 102 ? 27.184 3.796   65.022 1.00 34.14 ? 104  LYS B CG  1 
ATOM   1501 C  CD  . LYS B 1 102 ? 26.871 3.622   66.496 1.00 34.33 ? 104  LYS B CD  1 
ATOM   1502 C  CE  . LYS B 1 102 ? 27.601 4.680   67.312 1.00 33.08 ? 104  LYS B CE  1 
ATOM   1503 N  NZ  . LYS B 1 102 ? 27.420 4.496   68.777 1.00 33.67 ? 104  LYS B NZ  1 
ATOM   1504 N  N   . THR B 1 103 ? 28.760 3.815   61.977 1.00 34.55 ? 105  THR B N   1 
ATOM   1505 C  CA  . THR B 1 103 ? 30.153 3.603   61.593 1.00 34.68 ? 105  THR B CA  1 
ATOM   1506 C  C   . THR B 1 103 ? 30.954 3.130   62.794 1.00 35.07 ? 105  THR B C   1 
ATOM   1507 O  O   . THR B 1 103 ? 30.588 3.392   63.946 1.00 34.50 ? 105  THR B O   1 
ATOM   1508 C  CB  . THR B 1 103 ? 30.807 4.869   61.005 1.00 34.63 ? 105  THR B CB  1 
ATOM   1509 O  OG1 . THR B 1 103 ? 30.556 5.979   61.868 1.00 34.12 ? 105  THR B OG1 1 
ATOM   1510 C  CG2 . THR B 1 103 ? 30.260 5.167   59.600 1.00 34.15 ? 105  THR B CG2 1 
ATOM   1511 N  N   . GLN B 1 104 ? 32.034 2.409   62.512 1.00 35.51 ? 106  GLN B N   1 
ATOM   1512 C  CA  . GLN B 1 104 ? 32.917 1.893   63.541 1.00 36.63 ? 106  GLN B CA  1 
ATOM   1513 C  C   . GLN B 1 104 ? 33.839 3.008   64.036 1.00 36.87 ? 106  GLN B C   1 
ATOM   1514 O  O   . GLN B 1 104 ? 33.925 4.068   63.404 1.00 36.88 ? 106  GLN B O   1 
ATOM   1515 C  CB  . GLN B 1 104 ? 33.757 0.743   62.979 1.00 36.57 ? 106  GLN B CB  1 
ATOM   1516 C  CG  . GLN B 1 104 ? 32.957 -0.456  62.487 1.00 37.34 ? 106  GLN B CG  1 
ATOM   1517 C  CD  . GLN B 1 104 ? 33.836 -1.624  62.071 1.00 38.01 ? 106  GLN B CD  1 
ATOM   1518 O  OE1 . GLN B 1 104 ? 34.897 -1.870  62.657 1.00 40.22 ? 106  GLN B OE1 1 
ATOM   1519 N  NE2 . GLN B 1 104 ? 33.388 -2.366  61.067 1.00 40.36 ? 106  GLN B NE2 1 
ATOM   1520 N  N   . PRO B 1 105 ? 34.506 2.792   65.188 1.00 37.36 ? 107  PRO B N   1 
ATOM   1521 C  CA  . PRO B 1 105 ? 35.546 3.733   65.592 1.00 37.61 ? 107  PRO B CA  1 
ATOM   1522 C  C   . PRO B 1 105 ? 36.758 3.560   64.687 1.00 38.08 ? 107  PRO B C   1 
ATOM   1523 O  O   . PRO B 1 105 ? 36.892 2.522   64.028 1.00 38.05 ? 107  PRO B O   1 
ATOM   1524 C  CB  . PRO B 1 105 ? 35.899 3.286   67.020 1.00 37.76 ? 107  PRO B CB  1 
ATOM   1525 C  CG  . PRO B 1 105 ? 34.807 2.358   67.434 1.00 37.54 ? 107  PRO B CG  1 
ATOM   1526 C  CD  . PRO B 1 105 ? 34.324 1.723   66.185 1.00 37.26 ? 107  PRO B CD  1 
ATOM   1527 N  N   . VAL B 1 106 ? 37.622 4.572   64.643 1.00 38.50 ? 108  VAL B N   1 
ATOM   1528 C  CA  . VAL B 1 106 ? 38.855 4.502   63.861 1.00 38.91 ? 108  VAL B CA  1 
ATOM   1529 C  C   . VAL B 1 106 ? 39.696 3.332   64.366 1.00 38.98 ? 108  VAL B C   1 
ATOM   1530 O  O   . VAL B 1 106 ? 40.023 3.246   65.550 1.00 39.06 ? 108  VAL B O   1 
ATOM   1531 C  CB  . VAL B 1 106 ? 39.659 5.832   63.927 1.00 39.01 ? 108  VAL B CB  1 
ATOM   1532 C  CG1 . VAL B 1 106 ? 41.045 5.675   63.302 1.00 39.34 ? 108  VAL B CG1 1 
ATOM   1533 C  CG2 . VAL B 1 106 ? 38.897 6.949   63.241 1.00 39.05 ? 108  VAL B CG2 1 
ATOM   1534 N  N   . SER C 1 6   ? 16.793 -19.706 63.216 1.00 55.01 ? 8    SER C N   1 
ATOM   1535 C  CA  . SER C 1 6   ? 18.051 -19.533 62.425 1.00 54.96 ? 8    SER C CA  1 
ATOM   1536 C  C   . SER C 1 6   ? 17.779 -19.036 61.004 1.00 54.83 ? 8    SER C C   1 
ATOM   1537 O  O   . SER C 1 6   ? 18.405 -18.076 60.546 1.00 54.97 ? 8    SER C O   1 
ATOM   1538 C  CB  . SER C 1 6   ? 18.852 -20.838 62.390 1.00 54.97 ? 8    SER C CB  1 
ATOM   1539 O  OG  . SER C 1 6   ? 18.090 -21.887 61.817 1.00 55.35 ? 8    SER C OG  1 
ATOM   1540 N  N   . GLY C 1 7   ? 16.854 -19.697 60.311 1.00 54.65 ? 9    GLY C N   1 
ATOM   1541 C  CA  . GLY C 1 7   ? 16.490 -19.315 58.948 1.00 54.01 ? 9    GLY C CA  1 
ATOM   1542 C  C   . GLY C 1 7   ? 16.063 -20.473 58.062 1.00 53.73 ? 9    GLY C C   1 
ATOM   1543 O  O   . GLY C 1 7   ? 15.887 -21.595 58.543 1.00 53.63 ? 9    GLY C O   1 
ATOM   1544 N  N   . PRO C 1 8   ? 15.901 -20.208 56.750 1.00 53.46 ? 10   PRO C N   1 
ATOM   1545 C  CA  . PRO C 1 8   ? 15.465 -21.222 55.789 1.00 53.23 ? 10   PRO C CA  1 
ATOM   1546 C  C   . PRO C 1 8   ? 16.578 -22.200 55.453 1.00 53.07 ? 10   PRO C C   1 
ATOM   1547 O  O   . PRO C 1 8   ? 17.756 -21.891 55.662 1.00 53.02 ? 10   PRO C O   1 
ATOM   1548 C  CB  . PRO C 1 8   ? 15.127 -20.409 54.529 1.00 53.38 ? 10   PRO C CB  1 
ATOM   1549 C  CG  . PRO C 1 8   ? 15.292 -18.972 54.888 1.00 53.27 ? 10   PRO C CG  1 
ATOM   1550 C  CD  . PRO C 1 8   ? 16.155 -18.911 56.098 1.00 53.54 ? 10   PRO C CD  1 
ATOM   1551 N  N   . SER C 1 9   ? 16.211 -23.362 54.915 1.00 52.61 ? 11   SER C N   1 
ATOM   1552 C  CA  . SER C 1 9   ? 17.204 -24.339 54.490 1.00 52.54 ? 11   SER C CA  1 
ATOM   1553 C  C   . SER C 1 9   ? 17.953 -23.788 53.278 1.00 52.34 ? 11   SER C C   1 
ATOM   1554 O  O   . SER C 1 9   ? 17.458 -22.897 52.573 1.00 51.95 ? 11   SER C O   1 
ATOM   1555 C  CB  . SER C 1 9   ? 16.561 -25.704 54.191 1.00 52.97 ? 11   SER C CB  1 
ATOM   1556 O  OG  . SER C 1 9   ? 15.731 -25.650 53.044 1.00 53.79 ? 11   SER C OG  1 
ATOM   1557 N  N   . SER C 1 10  ? 19.160 -24.292 53.059 1.00 51.91 ? 12   SER C N   1 
ATOM   1558 C  CA  . SER C 1 10  ? 19.982 -23.823 51.958 1.00 51.84 ? 12   SER C CA  1 
ATOM   1559 C  C   . SER C 1 10  ? 19.347 -24.205 50.626 1.00 50.94 ? 12   SER C C   1 
ATOM   1560 O  O   . SER C 1 10  ? 18.820 -25.308 50.486 1.00 51.41 ? 12   SER C O   1 
ATOM   1561 C  CB  . SER C 1 10  ? 21.406 -24.376 52.069 1.00 51.96 ? 12   SER C CB  1 
ATOM   1562 O  OG  . SER C 1 10  ? 21.402 -25.792 52.142 1.00 54.02 ? 12   SER C OG  1 
ATOM   1563 N  N   . PRO C 1 11  ? 19.352 -23.276 49.656 1.00 50.19 ? 13   PRO C N   1 
ATOM   1564 C  CA  . PRO C 1 11  ? 18.856 -23.616 48.335 1.00 49.43 ? 13   PRO C CA  1 
ATOM   1565 C  C   . PRO C 1 11  ? 19.699 -24.734 47.748 1.00 48.71 ? 13   PRO C C   1 
ATOM   1566 O  O   . PRO C 1 11  ? 20.851 -24.930 48.155 1.00 48.82 ? 13   PRO C O   1 
ATOM   1567 C  CB  . PRO C 1 11  ? 19.102 -22.330 47.532 1.00 49.32 ? 13   PRO C CB  1 
ATOM   1568 C  CG  . PRO C 1 11  ? 19.126 -21.257 48.540 1.00 49.77 ? 13   PRO C CG  1 
ATOM   1569 C  CD  . PRO C 1 11  ? 19.795 -21.874 49.725 1.00 49.97 ? 13   PRO C CD  1 
ATOM   1570 N  N   . SER C 1 12  ? 19.133 -25.457 46.796 1.00 47.31 ? 14   SER C N   1 
ATOM   1571 C  CA  . SER C 1 12  ? 19.882 -26.461 46.082 1.00 46.69 ? 14   SER C CA  1 
ATOM   1572 C  C   . SER C 1 12  ? 20.065 -25.980 44.649 1.00 46.28 ? 14   SER C C   1 
ATOM   1573 O  O   . SER C 1 12  ? 19.086 -25.776 43.928 1.00 45.99 ? 14   SER C O   1 
ATOM   1574 C  CB  . SER C 1 12  ? 19.142 -27.806 46.124 1.00 46.67 ? 14   SER C CB  1 
ATOM   1575 O  OG  . SER C 1 12  ? 19.628 -28.669 45.117 1.00 47.57 ? 14   SER C OG  1 
ATOM   1576 N  N   . ILE C 1 13  ? 21.318 -25.785 44.248 1.00 46.03 ? 15   ILE C N   1 
ATOM   1577 C  CA  . ILE C 1 13  ? 21.641 -25.372 42.883 1.00 46.25 ? 15   ILE C CA  1 
ATOM   1578 C  C   . ILE C 1 13  ? 21.441 -26.584 41.980 1.00 46.06 ? 15   ILE C C   1 
ATOM   1579 O  O   . ILE C 1 13  ? 22.067 -27.630 42.190 1.00 45.62 ? 15   ILE C O   1 
ATOM   1580 C  CB  . ILE C 1 13  ? 23.083 -24.835 42.767 1.00 46.22 ? 15   ILE C CB  1 
ATOM   1581 C  CG1 . ILE C 1 13  ? 23.245 -23.571 43.624 1.00 46.74 ? 15   ILE C CG1 1 
ATOM   1582 C  CG2 . ILE C 1 13  ? 23.433 -24.551 41.302 1.00 46.51 ? 15   ILE C CG2 1 
ATOM   1583 C  CD1 . ILE C 1 13  ? 24.645 -22.947 43.592 1.00 46.62 ? 15   ILE C CD1 1 
ATOM   1584 N  N   . ASP C 1 14  ? 20.562 -26.426 40.987 1.00 45.86 ? 16   ASP C N   1 
ATOM   1585 C  CA  . ASP C 1 14  ? 20.159 -27.525 40.105 1.00 46.16 ? 16   ASP C CA  1 
ATOM   1586 C  C   . ASP C 1 14  ? 20.623 -27.410 38.663 1.00 46.14 ? 16   ASP C C   1 
ATOM   1587 O  O   . ASP C 1 14  ? 20.804 -28.422 37.990 1.00 45.69 ? 16   ASP C O   1 
ATOM   1588 C  CB  . ASP C 1 14  ? 18.636 -27.673 40.137 1.00 46.38 ? 16   ASP C CB  1 
ATOM   1589 C  CG  . ASP C 1 14  ? 18.117 -27.992 41.523 1.00 46.95 ? 16   ASP C CG  1 
ATOM   1590 O  OD1 . ASP C 1 14  ? 18.773 -28.780 42.232 1.00 46.27 ? 16   ASP C OD1 1 
ATOM   1591 O  OD2 . ASP C 1 14  ? 17.058 -27.455 41.907 1.00 47.73 ? 16   ASP C OD2 1 
ATOM   1592 N  N   . GLN C 1 15  ? 20.794 -26.176 38.183 1.00 46.15 ? 17   GLN C N   1 
ATOM   1593 C  CA  . GLN C 1 15  ? 21.210 -25.940 36.802 1.00 46.53 ? 17   GLN C CA  1 
ATOM   1594 C  C   . GLN C 1 15  ? 21.896 -24.575 36.706 1.00 46.72 ? 17   GLN C C   1 
ATOM   1595 O  O   . GLN C 1 15  ? 21.336 -23.562 37.128 1.00 47.13 ? 17   GLN C O   1 
ATOM   1596 C  CB  . GLN C 1 15  ? 19.998 -26.013 35.851 1.00 46.36 ? 17   GLN C CB  1 
ATOM   1597 C  CG  . GLN C 1 15  ? 20.304 -25.747 34.374 1.00 45.88 ? 17   GLN C CG  1 
ATOM   1598 C  CD  . GLN C 1 15  ? 19.097 -25.905 33.440 1.00 47.06 ? 17   GLN C CD  1 
ATOM   1599 O  OE1 . GLN C 1 15  ? 17.957 -26.091 33.873 1.00 47.36 ? 17   GLN C OE1 1 
ATOM   1600 N  NE2 . GLN C 1 15  ? 19.356 -25.834 32.138 1.00 47.52 ? 17   GLN C NE2 1 
ATOM   1601 N  N   . VAL C 1 16  ? 23.124 -24.560 36.199 1.00 46.81 ? 18   VAL C N   1 
ATOM   1602 C  CA  . VAL C 1 16  ? 23.812 -23.297 35.940 1.00 47.19 ? 18   VAL C CA  1 
ATOM   1603 C  C   . VAL C 1 16  ? 24.027 -23.178 34.439 1.00 47.52 ? 18   VAL C C   1 
ATOM   1604 O  O   . VAL C 1 16  ? 24.554 -24.099 33.808 1.00 47.64 ? 18   VAL C O   1 
ATOM   1605 C  CB  . VAL C 1 16  ? 25.172 -23.174 36.676 1.00 47.09 ? 18   VAL C CB  1 
ATOM   1606 C  CG1 . VAL C 1 16  ? 25.829 -21.815 36.367 1.00 47.54 ? 18   VAL C CG1 1 
ATOM   1607 C  CG2 . VAL C 1 16  ? 24.988 -23.337 38.184 1.00 47.07 ? 18   VAL C CG2 1 
ATOM   1608 N  N   . GLU C 1 17  ? 23.573 -22.065 33.871 1.00 47.84 ? 19   GLU C N   1 
ATOM   1609 C  CA  . GLU C 1 17  ? 23.805 -21.762 32.469 1.00 48.06 ? 19   GLU C CA  1 
ATOM   1610 C  C   . GLU C 1 17  ? 24.816 -20.624 32.377 1.00 48.17 ? 19   GLU C C   1 
ATOM   1611 O  O   . GLU C 1 17  ? 24.467 -19.450 32.568 1.00 47.95 ? 19   GLU C O   1 
ATOM   1612 C  CB  . GLU C 1 17  ? 22.498 -21.441 31.739 1.00 48.40 ? 19   GLU C CB  1 
ATOM   1613 C  CG  . GLU C 1 17  ? 21.538 -22.637 31.637 1.00 49.91 ? 19   GLU C CG  1 
ATOM   1614 C  CD  . GLU C 1 17  ? 22.130 -23.821 30.874 1.00 53.17 ? 19   GLU C CD  1 
ATOM   1615 O  OE1 . GLU C 1 17  ? 22.899 -23.586 29.913 1.00 54.89 ? 19   GLU C OE1 1 
ATOM   1616 O  OE2 . GLU C 1 17  ? 21.819 -24.987 31.226 1.00 53.26 ? 19   GLU C OE2 1 
ATOM   1617 N  N   . PRO C 1 18  ? 26.090 -20.977 32.128 1.00 48.17 ? 20   PRO C N   1 
ATOM   1618 C  CA  . PRO C 1 18  ? 27.142 -19.983 32.064 1.00 48.06 ? 20   PRO C CA  1 
ATOM   1619 C  C   . PRO C 1 18  ? 27.292 -19.372 30.682 1.00 48.06 ? 20   PRO C C   1 
ATOM   1620 O  O   . PRO C 1 18  ? 27.232 -20.074 29.673 1.00 47.55 ? 20   PRO C O   1 
ATOM   1621 C  CB  . PRO C 1 18  ? 28.404 -20.770 32.444 1.00 48.01 ? 20   PRO C CB  1 
ATOM   1622 C  CG  . PRO C 1 18  ? 28.036 -22.223 32.378 1.00 48.81 ? 20   PRO C CG  1 
ATOM   1623 C  CD  . PRO C 1 18  ? 26.612 -22.338 31.921 1.00 48.52 ? 20   PRO C CD  1 
ATOM   1624 N  N   . TYR C 1 19  ? 27.454 -18.057 30.659 1.00 47.80 ? 21   TYR C N   1 
ATOM   1625 C  CA  . TYR C 1 19  ? 27.713 -17.323 29.437 1.00 48.13 ? 21   TYR C CA  1 
ATOM   1626 C  C   . TYR C 1 19  ? 29.133 -16.799 29.583 1.00 47.68 ? 21   TYR C C   1 
ATOM   1627 O  O   . TYR C 1 19  ? 29.896 -17.349 30.374 1.00 47.77 ? 21   TYR C O   1 
ATOM   1628 C  CB  . TYR C 1 19  ? 26.664 -16.224 29.245 1.00 48.78 ? 21   TYR C CB  1 
ATOM   1629 C  CG  . TYR C 1 19  ? 25.274 -16.811 29.135 1.00 50.05 ? 21   TYR C CG  1 
ATOM   1630 C  CD1 . TYR C 1 19  ? 24.746 -17.163 27.895 1.00 51.01 ? 21   TYR C CD1 1 
ATOM   1631 C  CD2 . TYR C 1 19  ? 24.504 -17.059 30.274 1.00 51.16 ? 21   TYR C CD2 1 
ATOM   1632 C  CE1 . TYR C 1 19  ? 23.476 -17.729 27.786 1.00 52.01 ? 21   TYR C CE1 1 
ATOM   1633 C  CE2 . TYR C 1 19  ? 23.229 -17.629 30.176 1.00 51.56 ? 21   TYR C CE2 1 
ATOM   1634 C  CZ  . TYR C 1 19  ? 22.726 -17.956 28.927 1.00 51.33 ? 21   TYR C CZ  1 
ATOM   1635 O  OH  . TYR C 1 19  ? 21.472 -18.515 28.809 1.00 52.09 ? 21   TYR C OH  1 
ATOM   1636 N  N   . SER C 1 20  ? 29.502 -15.762 28.843 1.00 46.97 ? 22   SER C N   1 
ATOM   1637 C  CA  . SER C 1 20  ? 30.868 -15.255 28.912 1.00 46.59 ? 22   SER C CA  1 
ATOM   1638 C  C   . SER C 1 20  ? 31.182 -14.439 30.175 1.00 46.09 ? 22   SER C C   1 
ATOM   1639 O  O   . SER C 1 20  ? 32.243 -14.611 30.771 1.00 45.94 ? 22   SER C O   1 
ATOM   1640 C  CB  . SER C 1 20  ? 31.230 -14.478 27.640 1.00 46.56 ? 22   SER C CB  1 
ATOM   1641 O  OG  . SER C 1 20  ? 30.314 -13.427 27.391 1.00 47.34 ? 22   SER C OG  1 
ATOM   1642 N  N   . SER C 1 21  ? 30.260 -13.574 30.588 1.00 45.58 ? 23   SER C N   1 
ATOM   1643 C  CA  . SER C 1 21  ? 30.492 -12.706 31.751 1.00 45.34 ? 23   SER C CA  1 
ATOM   1644 C  C   . SER C 1 21  ? 29.368 -12.801 32.777 1.00 44.98 ? 23   SER C C   1 
ATOM   1645 O  O   . SER C 1 21  ? 29.335 -12.043 33.753 1.00 44.36 ? 23   SER C O   1 
ATOM   1646 C  CB  . SER C 1 21  ? 30.669 -11.251 31.309 1.00 45.71 ? 23   SER C CB  1 
ATOM   1647 O  OG  . SER C 1 21  ? 29.440 -10.707 30.866 1.00 46.63 ? 23   SER C OG  1 
ATOM   1648 N  N   . THR C 1 22  ? 28.451 -13.737 32.541 1.00 44.61 ? 24   THR C N   1 
ATOM   1649 C  CA  . THR C 1 22  ? 27.296 -13.932 33.400 1.00 44.69 ? 24   THR C CA  1 
ATOM   1650 C  C   . THR C 1 22  ? 26.999 -15.419 33.507 1.00 44.84 ? 24   THR C C   1 
ATOM   1651 O  O   . THR C 1 22  ? 27.461 -16.221 32.682 1.00 44.42 ? 24   THR C O   1 
ATOM   1652 C  CB  . THR C 1 22  ? 26.027 -13.215 32.852 1.00 44.74 ? 24   THR C CB  1 
ATOM   1653 O  OG1 . THR C 1 22  ? 25.590 -13.861 31.649 1.00 45.02 ? 24   THR C OG1 1 
ATOM   1654 C  CG2 . THR C 1 22  ? 26.278 -11.718 32.578 1.00 44.95 ? 24   THR C CG2 1 
ATOM   1655 N  N   . ALA C 1 23  ? 26.230 -15.777 34.527 1.00 44.88 ? 25   ALA C N   1 
ATOM   1656 C  CA  . ALA C 1 23  ? 25.780 -17.136 34.714 1.00 45.36 ? 25   ALA C CA  1 
ATOM   1657 C  C   . ALA C 1 23  ? 24.402 -17.094 35.346 1.00 45.81 ? 25   ALA C C   1 
ATOM   1658 O  O   . ALA C 1 23  ? 24.167 -16.349 36.306 1.00 45.55 ? 25   ALA C O   1 
ATOM   1659 C  CB  . ALA C 1 23  ? 26.738 -17.913 35.584 1.00 45.36 ? 25   ALA C CB  1 
ATOM   1660 N  N   . GLN C 1 24  ? 23.485 -17.865 34.777 1.00 45.78 ? 26   GLN C N   1 
ATOM   1661 C  CA  . GLN C 1 24  ? 22.157 -17.998 35.343 1.00 46.16 ? 26   GLN C CA  1 
ATOM   1662 C  C   . GLN C 1 24  ? 22.204 -19.222 36.228 1.00 46.08 ? 26   GLN C C   1 
ATOM   1663 O  O   . GLN C 1 24  ? 22.565 -20.319 35.781 1.00 46.40 ? 26   GLN C O   1 
ATOM   1664 C  CB  . GLN C 1 24  ? 21.091 -18.121 34.249 1.00 46.18 ? 26   GLN C CB  1 
ATOM   1665 C  CG  . GLN C 1 24  ? 20.962 -16.835 33.406 1.00 47.43 ? 26   GLN C CG  1 
ATOM   1666 C  CD  . GLN C 1 24  ? 19.963 -16.941 32.254 1.00 47.44 ? 26   GLN C CD  1 
ATOM   1667 O  OE1 . GLN C 1 24  ? 20.005 -16.144 31.314 1.00 51.48 ? 26   GLN C OE1 1 
ATOM   1668 N  NE2 . GLN C 1 24  ? 19.070 -17.917 32.321 1.00 49.32 ? 26   GLN C NE2 1 
ATOM   1669 N  N   . VAL C 1 25  ? 21.865 -19.021 37.495 1.00 45.80 ? 27   VAL C N   1 
ATOM   1670 C  CA  . VAL C 1 25  ? 21.894 -20.086 38.476 1.00 45.59 ? 27   VAL C CA  1 
ATOM   1671 C  C   . VAL C 1 25  ? 20.467 -20.426 38.872 1.00 45.67 ? 27   VAL C C   1 
ATOM   1672 O  O   . VAL C 1 25  ? 19.775 -19.599 39.458 1.00 45.72 ? 27   VAL C O   1 
ATOM   1673 C  CB  . VAL C 1 25  ? 22.731 -19.679 39.718 1.00 45.64 ? 27   VAL C CB  1 
ATOM   1674 C  CG1 . VAL C 1 25  ? 22.737 -20.792 40.767 1.00 45.97 ? 27   VAL C CG1 1 
ATOM   1675 C  CG2 . VAL C 1 25  ? 24.164 -19.314 39.302 1.00 44.86 ? 27   VAL C CG2 1 
ATOM   1676 N  N   . GLN C 1 26  ? 20.020 -21.627 38.503 1.00 45.30 ? 28   GLN C N   1 
ATOM   1677 C  CA  . GLN C 1 26  ? 18.702 -22.099 38.912 1.00 45.29 ? 28   GLN C CA  1 
ATOM   1678 C  C   . GLN C 1 26  ? 18.809 -23.009 40.104 1.00 45.21 ? 28   GLN C C   1 
ATOM   1679 O  O   . GLN C 1 26  ? 19.668 -23.892 40.162 1.00 45.15 ? 28   GLN C O   1 
ATOM   1680 C  CB  . GLN C 1 26  ? 17.957 -22.800 37.787 1.00 45.01 ? 28   GLN C CB  1 
ATOM   1681 C  CG  . GLN C 1 26  ? 17.049 -21.856 37.022 1.00 45.10 ? 28   GLN C CG  1 
ATOM   1682 C  CD  . GLN C 1 26  ? 16.241 -22.569 35.978 1.00 43.52 ? 28   GLN C CD  1 
ATOM   1683 O  OE1 . GLN C 1 26  ? 16.787 -23.347 35.206 1.00 45.79 ? 28   GLN C OE1 1 
ATOM   1684 N  NE2 . GLN C 1 26  ? 14.930 -22.316 35.946 1.00 41.43 ? 28   GLN C NE2 1 
ATOM   1685 N  N   . PHE C 1 27  ? 17.902 -22.799 41.042 1.00 44.88 ? 29   PHE C N   1 
ATOM   1686 C  CA  . PHE C 1 27  ? 17.938 -23.522 42.286 1.00 45.03 ? 29   PHE C CA  1 
ATOM   1687 C  C   . PHE C 1 27  ? 16.535 -23.906 42.708 1.00 45.27 ? 29   PHE C C   1 
ATOM   1688 O  O   . PHE C 1 27  ? 15.549 -23.396 42.168 1.00 44.83 ? 29   PHE C O   1 
ATOM   1689 C  CB  . PHE C 1 27  ? 18.569 -22.611 43.364 1.00 44.39 ? 29   PHE C CB  1 
ATOM   1690 C  CG  . PHE C 1 27  ? 17.775 -21.356 43.640 1.00 44.09 ? 29   PHE C CG  1 
ATOM   1691 C  CD1 . PHE C 1 27  ? 16.768 -21.355 44.605 1.00 43.91 ? 29   PHE C CD1 1 
ATOM   1692 C  CD2 . PHE C 1 27  ? 18.032 -20.178 42.941 1.00 43.95 ? 29   PHE C CD2 1 
ATOM   1693 C  CE1 . PHE C 1 27  ? 16.021 -20.210 44.846 1.00 43.95 ? 29   PHE C CE1 1 
ATOM   1694 C  CE2 . PHE C 1 27  ? 17.292 -19.021 43.180 1.00 43.40 ? 29   PHE C CE2 1 
ATOM   1695 C  CZ  . PHE C 1 27  ? 16.285 -19.036 44.139 1.00 43.80 ? 29   PHE C CZ  1 
ATOM   1696 N  N   . ASP C 1 28  ? 16.450 -24.806 43.683 1.00 45.75 ? 30   ASP C N   1 
ATOM   1697 C  CA  . ASP C 1 28  ? 15.181 -25.086 44.317 1.00 46.27 ? 30   ASP C CA  1 
ATOM   1698 C  C   . ASP C 1 28  ? 15.302 -24.718 45.790 1.00 46.45 ? 30   ASP C C   1 
ATOM   1699 O  O   . ASP C 1 28  ? 16.392 -24.779 46.371 1.00 46.23 ? 30   ASP C O   1 
ATOM   1700 C  CB  . ASP C 1 28  ? 14.715 -26.537 44.101 1.00 46.00 ? 30   ASP C CB  1 
ATOM   1701 C  CG  . ASP C 1 28  ? 15.544 -27.554 44.859 1.00 47.17 ? 30   ASP C CG  1 
ATOM   1702 O  OD1 . ASP C 1 28  ? 16.420 -28.183 44.235 1.00 48.02 ? 30   ASP C OD1 1 
ATOM   1703 O  OD2 . ASP C 1 28  ? 15.305 -27.750 46.071 1.00 48.27 ? 30   ASP C OD2 1 
ATOM   1704 N  N   . GLU C 1 29  ? 14.176 -24.316 46.363 1.00 46.91 ? 31   GLU C N   1 
ATOM   1705 C  CA  . GLU C 1 29  ? 14.069 -23.937 47.757 1.00 47.61 ? 31   GLU C CA  1 
ATOM   1706 C  C   . GLU C 1 29  ? 12.718 -24.453 48.245 1.00 48.02 ? 31   GLU C C   1 
ATOM   1707 O  O   . GLU C 1 29  ? 11.721 -24.306 47.540 1.00 48.00 ? 31   GLU C O   1 
ATOM   1708 C  CB  . GLU C 1 29  ? 14.157 -22.411 47.894 1.00 47.34 ? 31   GLU C CB  1 
ATOM   1709 C  CG  . GLU C 1 29  ? 13.965 -21.862 49.316 1.00 47.95 ? 31   GLU C CG  1 
ATOM   1710 C  CD  . GLU C 1 29  ? 15.121 -22.172 50.262 1.00 49.54 ? 31   GLU C CD  1 
ATOM   1711 O  OE1 . GLU C 1 29  ? 16.157 -22.697 49.815 1.00 50.42 ? 31   GLU C OE1 1 
ATOM   1712 O  OE2 . GLU C 1 29  ? 14.992 -21.890 51.470 1.00 50.68 ? 31   GLU C OE2 1 
ATOM   1713 N  N   . PRO C 1 30  ? 12.680 -25.079 49.435 1.00 48.82 ? 32   PRO C N   1 
ATOM   1714 C  CA  . PRO C 1 30  ? 11.412 -25.586 49.979 1.00 49.47 ? 32   PRO C CA  1 
ATOM   1715 C  C   . PRO C 1 30  ? 10.322 -24.518 50.045 1.00 50.15 ? 32   PRO C C   1 
ATOM   1716 O  O   . PRO C 1 30  ? 10.620 -23.351 50.322 1.00 49.93 ? 32   PRO C O   1 
ATOM   1717 C  CB  . PRO C 1 30  ? 11.795 -26.031 51.390 1.00 49.34 ? 32   PRO C CB  1 
ATOM   1718 C  CG  . PRO C 1 30  ? 13.219 -26.405 51.272 1.00 49.30 ? 32   PRO C CG  1 
ATOM   1719 C  CD  . PRO C 1 30  ? 13.809 -25.383 50.332 1.00 48.89 ? 32   PRO C CD  1 
ATOM   1720 N  N   . GLU C 1 31  ? 9.079  -24.919 49.772 1.00 50.78 ? 33   GLU C N   1 
ATOM   1721 C  CA  . GLU C 1 31  ? 7.931  -24.005 49.802 1.00 51.66 ? 33   GLU C CA  1 
ATOM   1722 C  C   . GLU C 1 31  ? 7.709  -23.459 51.214 1.00 52.01 ? 33   GLU C C   1 
ATOM   1723 O  O   . GLU C 1 31  ? 7.795  -24.203 52.195 1.00 52.10 ? 33   GLU C O   1 
ATOM   1724 C  CB  . GLU C 1 31  ? 6.651  -24.678 49.271 1.00 51.69 ? 33   GLU C CB  1 
ATOM   1725 C  CG  . GLU C 1 31  ? 6.711  -25.163 47.810 1.00 52.43 ? 33   GLU C CG  1 
ATOM   1726 C  CD  . GLU C 1 31  ? 6.950  -24.051 46.792 1.00 54.39 ? 33   GLU C CD  1 
ATOM   1727 O  OE1 . GLU C 1 31  ? 6.579  -22.887 47.071 1.00 56.20 ? 33   GLU C OE1 1 
ATOM   1728 O  OE2 . GLU C 1 31  ? 7.512  -24.343 45.705 1.00 53.70 ? 33   GLU C OE2 1 
ATOM   1729 N  N   . ALA C 1 32  ? 7.427  -22.160 51.296 1.00 52.49 ? 34   ALA C N   1 
ATOM   1730 C  CA  . ALA C 1 32  ? 7.231  -21.462 52.570 1.00 52.89 ? 34   ALA C CA  1 
ATOM   1731 C  C   . ALA C 1 32  ? 6.060  -22.004 53.377 1.00 53.15 ? 34   ALA C C   1 
ATOM   1732 O  O   . ALA C 1 32  ? 4.985  -22.278 52.833 1.00 53.41 ? 34   ALA C O   1 
ATOM   1733 C  CB  . ALA C 1 32  ? 7.068  -19.965 52.335 1.00 52.96 ? 34   ALA C CB  1 
ATOM   1734 N  N   . THR C 1 33  ? 6.288  -22.157 54.681 1.00 53.27 ? 35   THR C N   1 
ATOM   1735 C  CA  . THR C 1 33  ? 5.295  -22.698 55.602 1.00 53.33 ? 35   THR C CA  1 
ATOM   1736 C  C   . THR C 1 33  ? 5.270  -21.854 56.879 1.00 53.05 ? 35   THR C C   1 
ATOM   1737 O  O   . THR C 1 33  ? 6.263  -21.201 57.219 1.00 53.09 ? 35   THR C O   1 
ATOM   1738 C  CB  . THR C 1 33  ? 5.615  -24.173 55.964 1.00 53.47 ? 35   THR C CB  1 
ATOM   1739 O  OG1 . THR C 1 33  ? 6.126  -24.859 54.813 1.00 54.17 ? 35   THR C OG1 1 
ATOM   1740 C  CG2 . THR C 1 33  ? 4.372  -24.898 56.482 1.00 53.52 ? 35   THR C CG2 1 
ATOM   1741 N  N   . GLY C 1 34  ? 4.126  -21.860 57.561 1.00 52.79 ? 36   GLY C N   1 
ATOM   1742 C  CA  . GLY C 1 34  ? 3.945  -21.153 58.830 1.00 52.33 ? 36   GLY C CA  1 
ATOM   1743 C  C   . GLY C 1 34  ? 3.850  -19.641 58.734 1.00 51.98 ? 36   GLY C C   1 
ATOM   1744 O  O   . GLY C 1 34  ? 3.904  -18.946 59.753 1.00 52.17 ? 36   GLY C O   1 
ATOM   1745 N  N   . GLY C 1 35  ? 3.702  -19.133 57.512 1.00 51.54 ? 37   GLY C N   1 
ATOM   1746 C  CA  . GLY C 1 35  ? 3.635  -17.694 57.267 1.00 50.64 ? 37   GLY C CA  1 
ATOM   1747 C  C   . GLY C 1 35  ? 4.998  -17.034 57.352 1.00 50.11 ? 37   GLY C C   1 
ATOM   1748 O  O   . GLY C 1 35  ? 5.101  -15.848 57.679 1.00 50.16 ? 37   GLY C O   1 
ATOM   1749 N  N   . VAL C 1 36  ? 6.045  -17.809 57.063 1.00 49.30 ? 38   VAL C N   1 
ATOM   1750 C  CA  . VAL C 1 36  ? 7.421  -17.314 57.078 1.00 48.38 ? 38   VAL C CA  1 
ATOM   1751 C  C   . VAL C 1 36  ? 8.011  -17.469 55.669 1.00 47.59 ? 38   VAL C C   1 
ATOM   1752 O  O   . VAL C 1 36  ? 8.758  -18.417 55.403 1.00 47.77 ? 38   VAL C O   1 
ATOM   1753 C  CB  . VAL C 1 36  ? 8.303  -18.052 58.131 1.00 48.57 ? 38   VAL C CB  1 
ATOM   1754 C  CG1 . VAL C 1 36  ? 9.637  -17.331 58.315 1.00 48.45 ? 38   VAL C CG1 1 
ATOM   1755 C  CG2 . VAL C 1 36  ? 7.590  -18.152 59.471 1.00 48.34 ? 38   VAL C CG2 1 
ATOM   1756 N  N   . PRO C 1 37  ? 7.679  -16.533 54.758 1.00 46.46 ? 39   PRO C N   1 
ATOM   1757 C  CA  . PRO C 1 37  ? 8.156  -16.678 53.388 1.00 45.45 ? 39   PRO C CA  1 
ATOM   1758 C  C   . PRO C 1 37  ? 9.632  -16.322 53.264 1.00 44.18 ? 39   PRO C C   1 
ATOM   1759 O  O   . PRO C 1 37  ? 10.186 -15.676 54.156 1.00 43.90 ? 39   PRO C O   1 
ATOM   1760 C  CB  . PRO C 1 37  ? 7.303  -15.666 52.617 1.00 45.58 ? 39   PRO C CB  1 
ATOM   1761 C  CG  . PRO C 1 37  ? 7.004  -14.603 53.609 1.00 46.06 ? 39   PRO C CG  1 
ATOM   1762 C  CD  . PRO C 1 37  ? 6.886  -15.299 54.937 1.00 46.46 ? 39   PRO C CD  1 
ATOM   1763 N  N   . ILE C 1 38  ? 10.261 -16.777 52.183 1.00 42.95 ? 40   ILE C N   1 
ATOM   1764 C  CA  . ILE C 1 38  ? 11.633 -16.397 51.876 1.00 41.63 ? 40   ILE C CA  1 
ATOM   1765 C  C   . ILE C 1 38  ? 11.553 -14.928 51.479 1.00 40.74 ? 40   ILE C C   1 
ATOM   1766 O  O   . ILE C 1 38  ? 10.662 -14.531 50.728 1.00 40.79 ? 40   ILE C O   1 
ATOM   1767 C  CB  . ILE C 1 38  ? 12.240 -17.222 50.709 1.00 41.63 ? 40   ILE C CB  1 
ATOM   1768 C  CG1 . ILE C 1 38  ? 12.005 -18.730 50.882 1.00 41.99 ? 40   ILE C CG1 1 
ATOM   1769 C  CG2 . ILE C 1 38  ? 13.739 -16.913 50.529 1.00 40.59 ? 40   ILE C CG2 1 
ATOM   1770 C  CD1 . ILE C 1 38  ? 12.671 -19.352 52.099 1.00 44.14 ? 40   ILE C CD1 1 
ATOM   1771 N  N   . LEU C 1 39  ? 12.456 -14.116 52.009 1.00 39.72 ? 41   LEU C N   1 
ATOM   1772 C  CA  . LEU C 1 39  ? 12.447 -12.687 51.705 1.00 38.50 ? 41   LEU C CA  1 
ATOM   1773 C  C   . LEU C 1 39  ? 13.462 -12.324 50.637 1.00 37.71 ? 41   LEU C C   1 
ATOM   1774 O  O   . LEU C 1 39  ? 13.159 -11.565 49.713 1.00 37.13 ? 41   LEU C O   1 
ATOM   1775 C  CB  . LEU C 1 39  ? 12.686 -11.863 52.970 1.00 38.35 ? 41   LEU C CB  1 
ATOM   1776 C  CG  . LEU C 1 39  ? 11.667 -12.043 54.103 1.00 38.11 ? 41   LEU C CG  1 
ATOM   1777 C  CD1 . LEU C 1 39  ? 12.126 -11.265 55.321 1.00 38.37 ? 41   LEU C CD1 1 
ATOM   1778 C  CD2 . LEU C 1 39  ? 10.275 -11.608 53.672 1.00 38.24 ? 41   LEU C CD2 1 
ATOM   1779 N  N   . LYS C 1 40  ? 14.664 -12.874 50.775 1.00 37.19 ? 42   LYS C N   1 
ATOM   1780 C  CA  . LYS C 1 40  ? 15.763 -12.593 49.860 1.00 37.00 ? 42   LYS C CA  1 
ATOM   1781 C  C   . LYS C 1 40  ? 16.604 -13.841 49.658 1.00 37.12 ? 42   LYS C C   1 
ATOM   1782 O  O   . LYS C 1 40  ? 16.515 -14.793 50.438 1.00 36.88 ? 42   LYS C O   1 
ATOM   1783 C  CB  . LYS C 1 40  ? 16.674 -11.499 50.440 1.00 36.75 ? 42   LYS C CB  1 
ATOM   1784 C  CG  . LYS C 1 40  ? 15.993 -10.172 50.793 1.00 36.86 ? 42   LYS C CG  1 
ATOM   1785 C  CD  . LYS C 1 40  ? 15.508 -9.416  49.563 1.00 36.07 ? 42   LYS C CD  1 
ATOM   1786 C  CE  . LYS C 1 40  ? 14.592 -8.260  49.960 1.00 36.48 ? 42   LYS C CE  1 
ATOM   1787 N  NZ  . LYS C 1 40  ? 14.178 -7.442  48.788 1.00 35.46 ? 42   LYS C NZ  1 
ATOM   1788 N  N   . TYR C 1 41  ? 17.395 -13.827 48.588 1.00 37.00 ? 43   TYR C N   1 
ATOM   1789 C  CA  . TYR C 1 41  ? 18.442 -14.809 48.363 1.00 37.39 ? 43   TYR C CA  1 
ATOM   1790 C  C   . TYR C 1 41  ? 19.775 -14.078 48.284 1.00 37.62 ? 43   TYR C C   1 
ATOM   1791 O  O   . TYR C 1 41  ? 19.846 -12.923 47.835 1.00 37.11 ? 43   TYR C O   1 
ATOM   1792 C  CB  . TYR C 1 41  ? 18.211 -15.590 47.072 1.00 37.72 ? 43   TYR C CB  1 
ATOM   1793 C  CG  . TYR C 1 41  ? 17.025 -16.497 47.153 1.00 37.87 ? 43   TYR C CG  1 
ATOM   1794 C  CD1 . TYR C 1 41  ? 17.114 -17.726 47.811 1.00 37.33 ? 43   TYR C CD1 1 
ATOM   1795 C  CD2 . TYR C 1 41  ? 15.804 -16.129 46.590 1.00 37.44 ? 43   TYR C CD2 1 
ATOM   1796 C  CE1 . TYR C 1 41  ? 16.013 -18.565 47.907 1.00 38.70 ? 43   TYR C CE1 1 
ATOM   1797 C  CE2 . TYR C 1 41  ? 14.694 -16.961 46.685 1.00 37.89 ? 43   TYR C CE2 1 
ATOM   1798 C  CZ  . TYR C 1 41  ? 14.811 -18.179 47.340 1.00 38.44 ? 43   TYR C CZ  1 
ATOM   1799 O  OH  . TYR C 1 41  ? 13.732 -19.017 47.431 1.00 37.72 ? 43   TYR C OH  1 
ATOM   1800 N  N   . LYS C 1 42  ? 20.826 -14.742 48.747 1.00 37.72 ? 44   LYS C N   1 
ATOM   1801 C  CA  . LYS C 1 42  ? 22.172 -14.203 48.615 1.00 37.87 ? 44   LYS C CA  1 
ATOM   1802 C  C   . LYS C 1 42  ? 23.008 -15.242 47.885 1.00 37.93 ? 44   LYS C C   1 
ATOM   1803 O  O   . LYS C 1 42  ? 23.017 -16.412 48.260 1.00 38.23 ? 44   LYS C O   1 
ATOM   1804 C  CB  . LYS C 1 42  ? 22.775 -13.862 49.981 1.00 37.81 ? 44   LYS C CB  1 
ATOM   1805 C  CG  . LYS C 1 42  ? 24.138 -13.172 49.912 1.00 37.53 ? 44   LYS C CG  1 
ATOM   1806 C  CD  . LYS C 1 42  ? 24.721 -12.932 51.299 1.00 38.27 ? 44   LYS C CD  1 
ATOM   1807 C  CE  . LYS C 1 42  ? 26.045 -12.209 51.172 1.00 39.84 ? 44   LYS C CE  1 
ATOM   1808 N  NZ  . LYS C 1 42  ? 26.685 -11.781 52.463 1.00 39.89 ? 44   LYS C NZ  1 
ATOM   1809 N  N   . ALA C 1 43  ? 23.659 -14.816 46.806 1.00 37.68 ? 45   ALA C N   1 
ATOM   1810 C  CA  . ALA C 1 43  ? 24.561 -15.677 46.060 1.00 36.92 ? 45   ALA C CA  1 
ATOM   1811 C  C   . ALA C 1 43  ? 25.982 -15.269 46.398 1.00 37.25 ? 45   ALA C C   1 
ATOM   1812 O  O   . ALA C 1 43  ? 26.258 -14.088 46.624 1.00 36.55 ? 45   ALA C O   1 
ATOM   1813 C  CB  . ALA C 1 43  ? 24.329 -15.539 44.575 1.00 37.19 ? 45   ALA C CB  1 
ATOM   1814 N  N   . GLU C 1 44  ? 26.874 -16.250 46.459 1.00 37.10 ? 46   GLU C N   1 
ATOM   1815 C  CA  . GLU C 1 44  ? 28.295 -15.984 46.638 1.00 37.74 ? 46   GLU C CA  1 
ATOM   1816 C  C   . GLU C 1 44  ? 29.038 -16.772 45.575 1.00 36.91 ? 46   GLU C C   1 
ATOM   1817 O  O   . GLU C 1 44  ? 28.664 -17.903 45.261 1.00 36.87 ? 46   GLU C O   1 
ATOM   1818 C  CB  . GLU C 1 44  ? 28.783 -16.395 48.029 1.00 37.69 ? 46   GLU C CB  1 
ATOM   1819 C  CG  . GLU C 1 44  ? 28.323 -15.492 49.169 1.00 39.08 ? 46   GLU C CG  1 
ATOM   1820 C  CD  . GLU C 1 44  ? 28.949 -15.879 50.501 1.00 39.80 ? 46   GLU C CD  1 
ATOM   1821 O  OE1 . GLU C 1 44  ? 29.152 -17.084 50.739 1.00 41.96 ? 46   GLU C OE1 1 
ATOM   1822 O  OE2 . GLU C 1 44  ? 29.245 -14.974 51.311 1.00 43.23 ? 46   GLU C OE2 1 
ATOM   1823 N  N   . TRP C 1 45  ? 30.068 -16.165 45.000 1.00 36.45 ? 47   TRP C N   1 
ATOM   1824 C  CA  . TRP C 1 45  ? 30.876 -16.841 43.994 1.00 35.98 ? 47   TRP C CA  1 
ATOM   1825 C  C   . TRP C 1 45  ? 32.331 -16.430 44.096 1.00 36.35 ? 47   TRP C C   1 
ATOM   1826 O  O   . TRP C 1 45  ? 32.664 -15.326 44.560 1.00 36.30 ? 47   TRP C O   1 
ATOM   1827 C  CB  . TRP C 1 45  ? 30.329 -16.606 42.583 1.00 36.03 ? 47   TRP C CB  1 
ATOM   1828 C  CG  . TRP C 1 45  ? 30.369 -15.178 42.178 1.00 35.65 ? 47   TRP C CG  1 
ATOM   1829 C  CD1 . TRP C 1 45  ? 31.328 -14.563 41.424 1.00 36.37 ? 47   TRP C CD1 1 
ATOM   1830 C  CD2 . TRP C 1 45  ? 29.429 -14.166 42.542 1.00 35.00 ? 47   TRP C CD2 1 
ATOM   1831 N  NE1 . TRP C 1 45  ? 31.031 -13.232 41.281 1.00 35.55 ? 47   TRP C NE1 1 
ATOM   1832 C  CE2 . TRP C 1 45  ? 29.870 -12.961 41.959 1.00 35.77 ? 47   TRP C CE2 1 
ATOM   1833 C  CE3 . TRP C 1 45  ? 28.242 -14.166 43.294 1.00 35.40 ? 47   TRP C CE3 1 
ATOM   1834 C  CZ2 . TRP C 1 45  ? 29.171 -11.757 42.105 1.00 36.68 ? 47   TRP C CZ2 1 
ATOM   1835 C  CZ3 . TRP C 1 45  ? 27.547 -12.971 43.439 1.00 36.13 ? 47   TRP C CZ3 1 
ATOM   1836 C  CH2 . TRP C 1 45  ? 28.015 -11.783 42.847 1.00 35.85 ? 47   TRP C CH2 1 
ATOM   1837 N  N   . ARG C 1 46  ? 33.197 -17.324 43.646 1.00 36.23 ? 48   ARG C N   1 
ATOM   1838 C  CA  . ARG C 1 46  ? 34.628 -17.130 43.767 1.00 36.52 ? 48   ARG C CA  1 
ATOM   1839 C  C   . ARG C 1 46  ? 35.313 -17.918 42.668 1.00 36.35 ? 48   ARG C C   1 
ATOM   1840 O  O   . ARG C 1 46  ? 35.060 -19.118 42.517 1.00 36.19 ? 48   ARG C O   1 
ATOM   1841 C  CB  . ARG C 1 46  ? 35.075 -17.653 45.134 1.00 36.56 ? 48   ARG C CB  1 
ATOM   1842 C  CG  . ARG C 1 46  ? 36.513 -17.396 45.480 1.00 37.53 ? 48   ARG C CG  1 
ATOM   1843 C  CD  . ARG C 1 46  ? 36.805 -17.839 46.900 1.00 39.37 ? 48   ARG C CD  1 
ATOM   1844 N  NE  . ARG C 1 46  ? 36.686 -19.287 47.077 1.00 39.49 ? 48   ARG C NE  1 
ATOM   1845 C  CZ  . ARG C 1 46  ? 37.005 -19.929 48.197 1.00 39.98 ? 48   ARG C CZ  1 
ATOM   1846 N  NH1 . ARG C 1 46  ? 37.464 -19.258 49.248 1.00 40.18 ? 48   ARG C NH1 1 
ATOM   1847 N  NH2 . ARG C 1 46  ? 36.869 -21.244 48.266 1.00 39.94 ? 48   ARG C NH2 1 
ATOM   1848 N  N   . ALA C 1 47  ? 36.165 -17.243 41.901 1.00 36.18 ? 49   ALA C N   1 
ATOM   1849 C  CA  . ALA C 1 47  ? 36.955 -17.902 40.863 1.00 36.31 ? 49   ALA C CA  1 
ATOM   1850 C  C   . ALA C 1 47  ? 37.930 -18.869 41.518 1.00 36.51 ? 49   ALA C C   1 
ATOM   1851 O  O   . ALA C 1 47  ? 38.566 -18.534 42.522 1.00 36.44 ? 49   ALA C O   1 
ATOM   1852 C  CB  . ALA C 1 47  ? 37.706 -16.877 40.020 1.00 36.24 ? 49   ALA C CB  1 
ATOM   1853 N  N   . VAL C 1 48  ? 38.030 -20.072 40.960 1.00 36.92 ? 50   VAL C N   1 
ATOM   1854 C  CA  . VAL C 1 48  ? 38.942 -21.092 41.478 1.00 37.24 ? 50   VAL C CA  1 
ATOM   1855 C  C   . VAL C 1 48  ? 40.350 -20.511 41.527 1.00 37.40 ? 50   VAL C C   1 
ATOM   1856 O  O   . VAL C 1 48  ? 40.864 -20.022 40.520 1.00 37.60 ? 50   VAL C O   1 
ATOM   1857 C  CB  . VAL C 1 48  ? 38.882 -22.396 40.641 1.00 37.19 ? 50   VAL C CB  1 
ATOM   1858 C  CG1 . VAL C 1 48  ? 39.973 -23.368 41.061 1.00 37.26 ? 50   VAL C CG1 1 
ATOM   1859 C  CG2 . VAL C 1 48  ? 37.511 -23.045 40.785 1.00 37.57 ? 50   VAL C CG2 1 
ATOM   1860 N  N   . GLY C 1 49  ? 40.946 -20.530 42.717 1.00 37.60 ? 51   GLY C N   1 
ATOM   1861 C  CA  . GLY C 1 49  ? 42.262 -19.933 42.938 1.00 37.54 ? 51   GLY C CA  1 
ATOM   1862 C  C   . GLY C 1 49  ? 42.193 -18.667 43.777 1.00 37.71 ? 51   GLY C C   1 
ATOM   1863 O  O   . GLY C 1 49  ? 43.192 -18.261 44.376 1.00 37.54 ? 51   GLY C O   1 
ATOM   1864 N  N   . GLU C 1 50  ? 41.016 -18.039 43.808 1.00 37.75 ? 52   GLU C N   1 
ATOM   1865 C  CA  . GLU C 1 50  ? 40.787 -16.835 44.613 1.00 38.03 ? 52   GLU C CA  1 
ATOM   1866 C  C   . GLU C 1 50  ? 40.404 -17.204 46.044 1.00 37.96 ? 52   GLU C C   1 
ATOM   1867 O  O   . GLU C 1 50  ? 39.990 -18.332 46.311 1.00 37.86 ? 52   GLU C O   1 
ATOM   1868 C  CB  . GLU C 1 50  ? 39.691 -15.960 43.993 1.00 38.10 ? 52   GLU C CB  1 
ATOM   1869 C  CG  . GLU C 1 50  ? 40.021 -15.361 42.622 1.00 39.38 ? 52   GLU C CG  1 
ATOM   1870 C  CD  . GLU C 1 50  ? 41.058 -14.245 42.673 1.00 41.38 ? 52   GLU C CD  1 
ATOM   1871 O  OE1 . GLU C 1 50  ? 41.737 -14.027 41.645 1.00 42.45 ? 52   GLU C OE1 1 
ATOM   1872 O  OE2 . GLU C 1 50  ? 41.202 -13.582 43.729 1.00 42.25 ? 52   GLU C OE2 1 
ATOM   1873 N  N   . GLU C 1 51  ? 40.544 -16.249 46.960 1.00 38.12 ? 53   GLU C N   1 
ATOM   1874 C  CA  . GLU C 1 51  ? 40.191 -16.471 48.361 1.00 38.39 ? 53   GLU C CA  1 
ATOM   1875 C  C   . GLU C 1 51  ? 38.928 -15.703 48.756 1.00 38.16 ? 53   GLU C C   1 
ATOM   1876 O  O   . GLU C 1 51  ? 38.150 -16.160 49.596 1.00 38.32 ? 53   GLU C O   1 
ATOM   1877 C  CB  . GLU C 1 51  ? 41.360 -16.092 49.280 1.00 38.63 ? 53   GLU C CB  1 
ATOM   1878 C  CG  . GLU C 1 51  ? 41.158 -16.457 50.754 1.00 40.04 ? 53   GLU C CG  1 
ATOM   1879 C  CD  . GLU C 1 51  ? 41.050 -17.957 50.992 1.00 41.65 ? 53   GLU C CD  1 
ATOM   1880 O  OE1 . GLU C 1 51  ? 41.970 -18.702 50.587 1.00 42.62 ? 53   GLU C OE1 1 
ATOM   1881 O  OE2 . GLU C 1 51  ? 40.050 -18.391 51.603 1.00 42.72 ? 53   GLU C OE2 1 
ATOM   1882 N  N   . VAL C 1 52  ? 38.729 -14.544 48.139 1.00 37.94 ? 54   VAL C N   1 
ATOM   1883 C  CA  . VAL C 1 52  ? 37.593 -13.686 48.453 1.00 37.67 ? 54   VAL C CA  1 
ATOM   1884 C  C   . VAL C 1 52  ? 36.338 -14.107 47.692 1.00 37.57 ? 54   VAL C C   1 
ATOM   1885 O  O   . VAL C 1 52  ? 36.372 -14.278 46.470 1.00 37.67 ? 54   VAL C O   1 
ATOM   1886 C  CB  . VAL C 1 52  ? 37.914 -12.196 48.162 1.00 37.74 ? 54   VAL C CB  1 
ATOM   1887 C  CG1 . VAL C 1 52  ? 36.726 -11.305 48.495 1.00 37.78 ? 54   VAL C CG1 1 
ATOM   1888 C  CG2 . VAL C 1 52  ? 39.137 -11.750 48.945 1.00 37.74 ? 54   VAL C CG2 1 
ATOM   1889 N  N   . TRP C 1 53  ? 35.241 -14.295 48.427 1.00 36.97 ? 55   TRP C N   1 
ATOM   1890 C  CA  . TRP C 1 53  ? 33.949 -14.569 47.817 1.00 36.69 ? 55   TRP C CA  1 
ATOM   1891 C  C   . TRP C 1 53  ? 33.278 -13.257 47.460 1.00 36.68 ? 55   TRP C C   1 
ATOM   1892 O  O   . TRP C 1 53  ? 33.232 -12.330 48.276 1.00 36.78 ? 55   TRP C O   1 
ATOM   1893 C  CB  . TRP C 1 53  ? 33.030 -15.340 48.773 1.00 36.69 ? 55   TRP C CB  1 
ATOM   1894 C  CG  . TRP C 1 53  ? 33.441 -16.743 49.008 1.00 36.21 ? 55   TRP C CG  1 
ATOM   1895 C  CD1 . TRP C 1 53  ? 34.326 -17.194 49.947 1.00 36.48 ? 55   TRP C CD1 1 
ATOM   1896 C  CD2 . TRP C 1 53  ? 32.985 -17.894 48.299 1.00 36.31 ? 55   TRP C CD2 1 
ATOM   1897 N  NE1 . TRP C 1 53  ? 34.449 -18.557 49.864 1.00 35.73 ? 55   TRP C NE1 1 
ATOM   1898 C  CE2 . TRP C 1 53  ? 33.635 -19.014 48.861 1.00 36.45 ? 55   TRP C CE2 1 
ATOM   1899 C  CE3 . TRP C 1 53  ? 32.085 -18.092 47.240 1.00 36.17 ? 55   TRP C CE3 1 
ATOM   1900 C  CZ2 . TRP C 1 53  ? 33.418 -20.314 48.400 1.00 36.40 ? 55   TRP C CZ2 1 
ATOM   1901 C  CZ3 . TRP C 1 53  ? 31.868 -19.388 46.785 1.00 36.23 ? 55   TRP C CZ3 1 
ATOM   1902 C  CH2 . TRP C 1 53  ? 32.537 -20.479 47.360 1.00 36.17 ? 55   TRP C CH2 1 
ATOM   1903 N  N   . HIS C 1 54  ? 32.775 -13.163 46.237 1.00 36.12 ? 56   HIS C N   1 
ATOM   1904 C  CA  . HIS C 1 54  ? 31.945 -12.037 45.879 1.00 36.44 ? 56   HIS C CA  1 
ATOM   1905 C  C   . HIS C 1 54  ? 30.520 -12.415 46.252 1.00 36.20 ? 56   HIS C C   1 
ATOM   1906 O  O   . HIS C 1 54  ? 30.219 -13.598 46.448 1.00 36.01 ? 56   HIS C O   1 
ATOM   1907 C  CB  . HIS C 1 54  ? 32.081 -11.685 44.397 1.00 36.75 ? 56   HIS C CB  1 
ATOM   1908 C  CG  . HIS C 1 54  ? 33.435 -11.159 44.032 1.00 38.99 ? 56   HIS C CG  1 
ATOM   1909 N  ND1 . HIS C 1 54  ? 34.238 -11.761 43.088 1.00 42.02 ? 56   HIS C ND1 1 
ATOM   1910 C  CD2 . HIS C 1 54  ? 34.143 -10.112 44.513 1.00 40.43 ? 56   HIS C CD2 1 
ATOM   1911 C  CE1 . HIS C 1 54  ? 35.371 -11.091 42.984 1.00 41.22 ? 56   HIS C CE1 1 
ATOM   1912 N  NE2 . HIS C 1 54  ? 35.339 -10.087 43.840 1.00 41.75 ? 56   HIS C NE2 1 
ATOM   1913 N  N   . SER C 1 55  ? 29.647 -11.428 46.390 1.00 35.89 ? 57   SER C N   1 
ATOM   1914 C  CA  . SER C 1 55  ? 28.267 -11.732 46.744 1.00 36.15 ? 57   SER C CA  1 
ATOM   1915 C  C   . SER C 1 55  ? 27.292 -10.738 46.151 1.00 36.25 ? 57   SER C C   1 
ATOM   1916 O  O   . SER C 1 55  ? 27.664 -9.616  45.807 1.00 35.31 ? 57   SER C O   1 
ATOM   1917 C  CB  . SER C 1 55  ? 28.099 -11.758 48.264 1.00 35.95 ? 57   SER C CB  1 
ATOM   1918 O  OG  . SER C 1 55  ? 28.192 -10.446 48.789 1.00 36.18 ? 57   SER C OG  1 
ATOM   1919 N  N   . LYS C 1 56  ? 26.037 -11.162 46.052 1.00 36.33 ? 58   LYS C N   1 
ATOM   1920 C  CA  . LYS C 1 56  ? 24.967 -10.290 45.600 1.00 36.59 ? 58   LYS C CA  1 
ATOM   1921 C  C   . LYS C 1 56  ? 23.657 -10.766 46.199 1.00 36.22 ? 58   LYS C C   1 
ATOM   1922 O  O   . LYS C 1 56  ? 23.429 -11.965 46.361 1.00 36.44 ? 58   LYS C O   1 
ATOM   1923 C  CB  . LYS C 1 56  ? 24.866 -10.268 44.068 1.00 36.58 ? 58   LYS C CB  1 
ATOM   1924 C  CG  . LYS C 1 56  ? 23.811 -9.305  43.521 1.00 37.11 ? 58   LYS C CG  1 
ATOM   1925 C  CD  . LYS C 1 56  ? 23.977 -9.092  42.026 1.00 38.03 ? 58   LYS C CD  1 
ATOM   1926 C  CE  . LYS C 1 56  ? 22.933 -8.129  41.496 1.00 39.28 ? 58   LYS C CE  1 
ATOM   1927 N  NZ  . LYS C 1 56  ? 23.187 -7.780  40.067 1.00 39.37 ? 58   LYS C NZ  1 
ATOM   1928 N  N   . TRP C 1 57  ? 22.804 -9.804  46.518 1.00 35.69 ? 59   TRP C N   1 
ATOM   1929 C  CA  . TRP C 1 57  ? 21.489 -10.085 47.047 1.00 35.85 ? 59   TRP C CA  1 
ATOM   1930 C  C   . TRP C 1 57  ? 20.424 -10.025 45.956 1.00 35.56 ? 59   TRP C C   1 
ATOM   1931 O  O   . TRP C 1 57  ? 20.520 -9.225  45.014 1.00 34.94 ? 59   TRP C O   1 
ATOM   1932 C  CB  . TRP C 1 57  ? 21.162 -9.086  48.136 1.00 35.37 ? 59   TRP C CB  1 
ATOM   1933 C  CG  . TRP C 1 57  ? 21.912 -9.315  49.400 1.00 35.65 ? 59   TRP C CG  1 
ATOM   1934 C  CD1 . TRP C 1 57  ? 23.147 -8.830  49.725 1.00 36.21 ? 59   TRP C CD1 1 
ATOM   1935 C  CD2 . TRP C 1 57  ? 21.464 -10.063 50.530 1.00 35.72 ? 59   TRP C CD2 1 
ATOM   1936 N  NE1 . TRP C 1 57  ? 23.495 -9.233  50.990 1.00 35.22 ? 59   TRP C NE1 1 
ATOM   1937 C  CE2 . TRP C 1 57  ? 22.482 -9.996  51.506 1.00 36.58 ? 59   TRP C CE2 1 
ATOM   1938 C  CE3 . TRP C 1 57  ? 20.297 -10.790 50.814 1.00 36.98 ? 59   TRP C CE3 1 
ATOM   1939 C  CZ2 . TRP C 1 57  ? 22.370 -10.625 52.750 1.00 36.82 ? 59   TRP C CZ2 1 
ATOM   1940 C  CZ3 . TRP C 1 57  ? 20.189 -11.424 52.048 1.00 35.88 ? 59   TRP C CZ3 1 
ATOM   1941 C  CH2 . TRP C 1 57  ? 21.222 -11.335 52.998 1.00 36.45 ? 59   TRP C CH2 1 
ATOM   1942 N  N   . TYR C 1 58  ? 19.394 -10.849 46.129 1.00 36.20 ? 60   TYR C N   1 
ATOM   1943 C  CA  . TYR C 1 58  ? 18.297 -10.970 45.179 1.00 36.66 ? 60   TYR C CA  1 
ATOM   1944 C  C   . TYR C 1 58  ? 16.962 -11.029 45.890 1.00 36.88 ? 60   TYR C C   1 
ATOM   1945 O  O   . TYR C 1 58  ? 16.829 -11.700 46.911 1.00 37.45 ? 60   TYR C O   1 
ATOM   1946 C  CB  . TYR C 1 58  ? 18.465 -12.245 44.350 1.00 36.31 ? 60   TYR C CB  1 
ATOM   1947 C  CG  . TYR C 1 58  ? 19.778 -12.300 43.605 1.00 36.78 ? 60   TYR C CG  1 
ATOM   1948 C  CD1 . TYR C 1 58  ? 19.877 -11.861 42.284 1.00 35.59 ? 60   TYR C CD1 1 
ATOM   1949 C  CD2 . TYR C 1 58  ? 20.924 -12.804 44.225 1.00 36.06 ? 60   TYR C CD2 1 
ATOM   1950 C  CE1 . TYR C 1 58  ? 21.102 -11.908 41.602 1.00 36.37 ? 60   TYR C CE1 1 
ATOM   1951 C  CE2 . TYR C 1 58  ? 22.133 -12.854 43.563 1.00 36.11 ? 60   TYR C CE2 1 
ATOM   1952 C  CZ  . TYR C 1 58  ? 22.217 -12.412 42.257 1.00 36.50 ? 60   TYR C CZ  1 
ATOM   1953 O  OH  . TYR C 1 58  ? 23.420 -12.490 41.618 1.00 37.48 ? 60   TYR C OH  1 
ATOM   1954 N  N   . ASP C 1 59  ? 15.973 -10.327 45.350 1.00 36.56 ? 61   ASP C N   1 
ATOM   1955 C  CA  . ASP C 1 59  ? 14.645 -10.360 45.930 1.00 36.99 ? 61   ASP C CA  1 
ATOM   1956 C  C   . ASP C 1 59  ? 14.050 -11.756 45.703 1.00 36.93 ? 61   ASP C C   1 
ATOM   1957 O  O   . ASP C 1 59  ? 14.136 -12.299 44.596 1.00 36.21 ? 61   ASP C O   1 
ATOM   1958 C  CB  . ASP C 1 59  ? 13.759 -9.290  45.303 1.00 36.79 ? 61   ASP C CB  1 
ATOM   1959 C  CG  . ASP C 1 59  ? 12.409 -9.201  45.970 1.00 38.14 ? 61   ASP C CG  1 
ATOM   1960 O  OD1 . ASP C 1 59  ? 12.354 -8.822  47.161 1.00 37.67 ? 61   ASP C OD1 1 
ATOM   1961 O  OD2 . ASP C 1 59  ? 11.405 -9.528  45.301 1.00 38.57 ? 61   ASP C OD2 1 
ATOM   1962 N  N   . ALA C 1 60  ? 13.471 -12.337 46.755 1.00 37.86 ? 62   ALA C N   1 
ATOM   1963 C  CA  . ALA C 1 60  ? 12.891 -13.676 46.669 1.00 38.69 ? 62   ALA C CA  1 
ATOM   1964 C  C   . ALA C 1 60  ? 11.711 -13.747 45.708 1.00 39.68 ? 62   ALA C C   1 
ATOM   1965 O  O   . ALA C 1 60  ? 11.602 -14.701 44.927 1.00 39.82 ? 62   ALA C O   1 
ATOM   1966 C  CB  . ALA C 1 60  ? 12.487 -14.191 48.045 1.00 38.73 ? 62   ALA C CB  1 
ATOM   1967 N  N   . LYS C 1 61  ? 10.823 -12.753 45.775 1.00 40.35 ? 63   LYS C N   1 
ATOM   1968 C  CA  . LYS C 1 61  ? 9.659  -12.693 44.891 1.00 41.48 ? 63   LYS C CA  1 
ATOM   1969 C  C   . LYS C 1 61  ? 10.101 -12.768 43.428 1.00 41.70 ? 63   LYS C C   1 
ATOM   1970 O  O   . LYS C 1 61  ? 9.605  -13.598 42.668 1.00 41.79 ? 63   LYS C O   1 
ATOM   1971 C  CB  . LYS C 1 61  ? 8.829  -11.425 45.155 1.00 41.89 ? 63   LYS C CB  1 
ATOM   1972 C  CG  . LYS C 1 61  ? 7.575  -11.249 44.268 1.00 43.05 ? 63   LYS C CG  1 
ATOM   1973 C  CD  . LYS C 1 61  ? 6.396  -12.136 44.691 1.00 45.87 ? 63   LYS C CD  1 
ATOM   1974 C  CE  . LYS C 1 61  ? 5.718  -11.638 45.966 1.00 46.94 ? 63   LYS C CE  1 
ATOM   1975 N  NZ  . LYS C 1 61  ? 4.525  -12.463 46.325 1.00 47.58 ? 63   LYS C NZ  1 
ATOM   1976 N  N   . GLU C 1 62  ? 11.056 -11.925 43.049 1.00 42.17 ? 64   GLU C N   1 
ATOM   1977 C  CA  . GLU C 1 62  ? 11.570 -11.909 41.677 1.00 42.92 ? 64   GLU C CA  1 
ATOM   1978 C  C   . GLU C 1 62  ? 12.245 -13.235 41.308 1.00 41.95 ? 64   GLU C C   1 
ATOM   1979 O  O   . GLU C 1 62  ? 12.022 -13.778 40.222 1.00 42.14 ? 64   GLU C O   1 
ATOM   1980 C  CB  . GLU C 1 62  ? 12.544 -10.739 41.474 1.00 43.05 ? 64   GLU C CB  1 
ATOM   1981 C  CG  . GLU C 1 62  ? 13.035 -10.614 40.031 1.00 44.94 ? 64   GLU C CG  1 
ATOM   1982 C  CD  . GLU C 1 62  ? 14.144 -9.606  39.845 1.00 45.66 ? 64   GLU C CD  1 
ATOM   1983 O  OE1 . GLU C 1 62  ? 14.435 -8.823  40.784 1.00 50.71 ? 64   GLU C OE1 1 
ATOM   1984 O  OE2 . GLU C 1 62  ? 14.730 -9.592  38.742 1.00 48.90 ? 64   GLU C OE2 1 
ATOM   1985 N  N   . ALA C 1 63  ? 13.057 -13.758 42.221 1.00 40.76 ? 65   ALA C N   1 
ATOM   1986 C  CA  . ALA C 1 63  ? 13.754 -15.011 41.985 1.00 39.89 ? 65   ALA C CA  1 
ATOM   1987 C  C   . ALA C 1 63  ? 12.825 -16.238 41.978 1.00 39.08 ? 65   ALA C C   1 
ATOM   1988 O  O   . ALA C 1 63  ? 13.169 -17.240 41.377 1.00 38.54 ? 65   ALA C O   1 
ATOM   1989 C  CB  . ALA C 1 63  ? 14.866 -15.207 43.006 1.00 39.90 ? 65   ALA C CB  1 
ATOM   1990 N  N   . SER C 1 64  ? 11.660 -16.139 42.620 1.00 38.60 ? 66   SER C N   1 
ATOM   1991 C  CA  . SER C 1 64  ? 10.754 -17.285 42.795 1.00 38.31 ? 66   SER C CA  1 
ATOM   1992 C  C   . SER C 1 64  ? 10.065 -17.788 41.529 1.00 38.34 ? 66   SER C C   1 
ATOM   1993 O  O   . SER C 1 64  ? 9.757  -18.974 41.437 1.00 37.61 ? 66   SER C O   1 
ATOM   1994 C  CB  . SER C 1 64  ? 9.699  -17.012 43.879 1.00 38.32 ? 66   SER C CB  1 
ATOM   1995 O  OG  A SER C 1 64  ? 8.769  -16.025 43.469 0.50 37.92 ? 66   SER C OG  1 
ATOM   1996 O  OG  B SER C 1 64  ? 10.308 -16.854 45.149 0.50 39.08 ? 66   SER C OG  1 
HETATM 1997 N  N   . MSE C 1 65  ? 9.807  -16.905 40.565 1.00 38.48 ? 67   MSE C N   1 
HETATM 1998 C  CA  . MSE C 1 65  ? 9.107  -17.336 39.365 1.00 40.93 ? 67   MSE C CA  1 
HETATM 1999 C  C   . MSE C 1 65  ? 9.814  -18.503 38.691 1.00 38.70 ? 67   MSE C C   1 
HETATM 2000 O  O   . MSE C 1 65  ? 9.178  -19.488 38.344 1.00 38.84 ? 67   MSE C O   1 
HETATM 2001 C  CB  . MSE C 1 65  ? 8.877  -16.216 38.347 1.00 40.13 ? 67   MSE C CB  1 
HETATM 2002 C  CG  . MSE C 1 65  ? 7.940  -16.703 37.219 1.00 43.61 ? 67   MSE C CG  1 
HETATM 2003 SE SE  . MSE C 1 65  ? 7.567  -15.415 35.786 1.00 49.47 ? 67   MSE C SE  1 
HETATM 2004 C  CE  . MSE C 1 65  ? 9.404  -15.038 35.173 1.00 47.89 ? 67   MSE C CE  1 
ATOM   2005 N  N   . GLU C 1 66  ? 11.127 -18.388 38.532 1.00 37.71 ? 68   GLU C N   1 
ATOM   2006 C  CA  . GLU C 1 66  ? 11.899 -19.432 37.868 1.00 37.20 ? 68   GLU C CA  1 
ATOM   2007 C  C   . GLU C 1 66  ? 12.988 -20.046 38.750 1.00 37.02 ? 68   GLU C C   1 
ATOM   2008 O  O   . GLU C 1 66  ? 13.752 -20.900 38.295 1.00 36.28 ? 68   GLU C O   1 
ATOM   2009 C  CB  . GLU C 1 66  ? 12.495 -18.887 36.572 1.00 37.26 ? 68   GLU C CB  1 
ATOM   2010 C  CG  . GLU C 1 66  ? 11.456 -18.652 35.499 1.00 36.64 ? 68   GLU C CG  1 
ATOM   2011 C  CD  . GLU C 1 66  ? 12.080 -18.272 34.189 1.00 37.54 ? 68   GLU C CD  1 
ATOM   2012 O  OE1 . GLU C 1 66  ? 12.709 -17.196 34.122 1.00 37.35 ? 68   GLU C OE1 1 
ATOM   2013 O  OE2 . GLU C 1 66  ? 11.937 -19.045 33.228 1.00 37.04 ? 68   GLU C OE2 1 
ATOM   2014 N  N   . GLY C 1 67  ? 13.020 -19.626 40.012 1.00 36.84 ? 69   GLY C N   1 
ATOM   2015 C  CA  . GLY C 1 67  ? 14.019 -20.090 40.974 1.00 38.03 ? 69   GLY C CA  1 
ATOM   2016 C  C   . GLY C 1 67  ? 15.389 -19.787 40.410 1.00 38.57 ? 69   GLY C C   1 
ATOM   2017 O  O   . GLY C 1 67  ? 16.243 -20.671 40.351 1.00 38.58 ? 69   GLY C O   1 
ATOM   2018 N  N   . ILE C 1 68  ? 15.571 -18.550 39.940 1.00 38.92 ? 70   ILE C N   1 
ATOM   2019 C  CA  . ILE C 1 68  ? 16.805 -18.145 39.281 1.00 40.33 ? 70   ILE C CA  1 
ATOM   2020 C  C   . ILE C 1 68  ? 17.402 -16.901 39.905 1.00 39.51 ? 70   ILE C C   1 
ATOM   2021 O  O   . ILE C 1 68  ? 16.679 -15.974 40.300 1.00 39.11 ? 70   ILE C O   1 
ATOM   2022 C  CB  . ILE C 1 68  ? 16.606 -17.748 37.775 1.00 40.26 ? 70   ILE C CB  1 
ATOM   2023 C  CG1 . ILE C 1 68  ? 16.127 -18.900 36.911 1.00 42.22 ? 70   ILE C CG1 1 
ATOM   2024 C  CG2 . ILE C 1 68  ? 17.918 -17.239 37.165 1.00 42.65 ? 70   ILE C CG2 1 
ATOM   2025 C  CD1 . ILE C 1 68  ? 16.090 -18.536 35.424 1.00 41.52 ? 70   ILE C CD1 1 
ATOM   2026 N  N   . VAL C 1 69  ? 18.727 -16.894 39.976 1.00 39.47 ? 71   VAL C N   1 
ATOM   2027 C  CA  . VAL C 1 69  ? 19.490 -15.661 40.229 1.00 39.08 ? 71   VAL C CA  1 
ATOM   2028 C  C   . VAL C 1 69  ? 20.561 -15.623 39.148 1.00 39.20 ? 71   VAL C C   1 
ATOM   2029 O  O   . VAL C 1 69  ? 21.083 -16.677 38.744 1.00 39.42 ? 71   VAL C O   1 
ATOM   2030 C  CB  . VAL C 1 69  ? 20.121 -15.591 41.643 1.00 38.77 ? 71   VAL C CB  1 
ATOM   2031 C  CG1 . VAL C 1 69  ? 19.036 -15.580 42.720 1.00 38.77 ? 71   VAL C CG1 1 
ATOM   2032 C  CG2 . VAL C 1 69  ? 21.102 -16.728 41.876 1.00 39.72 ? 71   VAL C CG2 1 
ATOM   2033 N  N   . THR C 1 70  ? 20.844 -14.430 38.638 1.00 39.17 ? 72   THR C N   1 
ATOM   2034 C  CA  . THR C 1 70  ? 21.853 -14.244 37.608 1.00 39.33 ? 72   THR C CA  1 
ATOM   2035 C  C   . THR C 1 70  ? 23.072 -13.526 38.196 1.00 39.58 ? 72   THR C C   1 
ATOM   2036 O  O   . THR C 1 70  ? 22.951 -12.479 38.847 1.00 38.92 ? 72   THR C O   1 
ATOM   2037 C  CB  . THR C 1 70  ? 21.284 -13.475 36.394 1.00 39.58 ? 72   THR C CB  1 
ATOM   2038 O  OG1 . THR C 1 70  ? 20.198 -14.233 35.834 1.00 39.93 ? 72   THR C OG1 1 
ATOM   2039 C  CG2 . THR C 1 70  ? 22.356 -13.256 35.320 1.00 39.51 ? 72   THR C CG2 1 
ATOM   2040 N  N   . ILE C 1 71  ? 24.237 -14.130 37.992 1.00 39.53 ? 73   ILE C N   1 
ATOM   2041 C  CA  . ILE C 1 71  ? 25.488 -13.555 38.445 1.00 40.05 ? 73   ILE C CA  1 
ATOM   2042 C  C   . ILE C 1 71  ? 26.121 -12.852 37.250 1.00 40.37 ? 73   ILE C C   1 
ATOM   2043 O  O   . ILE C 1 71  ? 26.169 -13.415 36.156 1.00 39.96 ? 73   ILE C O   1 
ATOM   2044 C  CB  . ILE C 1 71  ? 26.425 -14.639 39.009 1.00 40.31 ? 73   ILE C CB  1 
ATOM   2045 C  CG1 . ILE C 1 71  ? 25.809 -15.260 40.270 1.00 40.85 ? 73   ILE C CG1 1 
ATOM   2046 C  CG2 . ILE C 1 71  ? 27.780 -14.038 39.342 1.00 40.98 ? 73   ILE C CG2 1 
ATOM   2047 C  CD1 . ILE C 1 71  ? 26.531 -16.486 40.782 1.00 41.60 ? 73   ILE C CD1 1 
ATOM   2048 N  N   . VAL C 1 72  ? 26.585 -11.621 37.459 1.00 39.92 ? 74   VAL C N   1 
ATOM   2049 C  CA  . VAL C 1 72  ? 27.170 -10.829 36.388 1.00 40.22 ? 74   VAL C CA  1 
ATOM   2050 C  C   . VAL C 1 72  ? 28.578 -10.352 36.749 1.00 40.06 ? 74   VAL C C   1 
ATOM   2051 O  O   . VAL C 1 72  ? 29.021 -10.495 37.891 1.00 40.18 ? 74   VAL C O   1 
ATOM   2052 C  CB  . VAL C 1 72  ? 26.266 -9.611  36.001 1.00 40.32 ? 74   VAL C CB  1 
ATOM   2053 C  CG1 . VAL C 1 72  ? 24.843 -10.075 35.664 1.00 39.90 ? 74   VAL C CG1 1 
ATOM   2054 C  CG2 . VAL C 1 72  ? 26.239 -8.549  37.115 1.00 40.19 ? 74   VAL C CG2 1 
ATOM   2055 N  N   . GLY C 1 73  ? 29.269 -9.796  35.763 1.00 39.88 ? 75   GLY C N   1 
ATOM   2056 C  CA  . GLY C 1 73  ? 30.602 -9.226  35.959 1.00 39.71 ? 75   GLY C CA  1 
ATOM   2057 C  C   . GLY C 1 73  ? 31.684 -10.275 36.097 1.00 39.55 ? 75   GLY C C   1 
ATOM   2058 O  O   . GLY C 1 73  ? 32.738 -10.015 36.685 1.00 39.29 ? 75   GLY C O   1 
ATOM   2059 N  N   . LEU C 1 74  ? 31.424 -11.457 35.541 1.00 38.87 ? 76   LEU C N   1 
ATOM   2060 C  CA  . LEU C 1 74  ? 32.366 -12.567 35.598 1.00 39.16 ? 76   LEU C CA  1 
ATOM   2061 C  C   . LEU C 1 74  ? 33.405 -12.475 34.501 1.00 39.17 ? 76   LEU C C   1 
ATOM   2062 O  O   . LEU C 1 74  ? 33.186 -11.830 33.476 1.00 38.97 ? 76   LEU C O   1 
ATOM   2063 C  CB  . LEU C 1 74  ? 31.633 -13.908 35.482 1.00 39.07 ? 76   LEU C CB  1 
ATOM   2064 C  CG  . LEU C 1 74  ? 30.541 -14.168 36.516 1.00 39.70 ? 76   LEU C CG  1 
ATOM   2065 C  CD1 . LEU C 1 74  ? 29.903 -15.507 36.253 1.00 38.85 ? 76   LEU C CD1 1 
ATOM   2066 C  CD2 . LEU C 1 74  ? 31.095 -14.096 37.939 1.00 40.85 ? 76   LEU C CD2 1 
ATOM   2067 N  N   . LYS C 1 75  ? 34.538 -13.127 34.732 1.00 39.25 ? 77   LYS C N   1 
ATOM   2068 C  CA  . LYS C 1 75  ? 35.610 -13.175 33.754 1.00 39.66 ? 77   LYS C CA  1 
ATOM   2069 C  C   . LYS C 1 75  ? 35.377 -14.372 32.835 1.00 39.41 ? 77   LYS C C   1 
ATOM   2070 O  O   . LYS C 1 75  ? 34.938 -15.429 33.299 1.00 39.40 ? 77   LYS C O   1 
ATOM   2071 C  CB  . LYS C 1 75  ? 36.969 -13.263 34.450 1.00 39.95 ? 77   LYS C CB  1 
ATOM   2072 C  CG  . LYS C 1 75  ? 37.221 -12.117 35.431 1.00 41.63 ? 77   LYS C CG  1 
ATOM   2073 C  CD  . LYS C 1 75  ? 38.697 -11.924 35.754 1.00 44.87 ? 77   LYS C CD  1 
ATOM   2074 C  CE  . LYS C 1 75  ? 39.303 -13.118 36.474 1.00 46.20 ? 77   LYS C CE  1 
ATOM   2075 N  NZ  . LYS C 1 75  ? 40.715 -12.815 36.855 1.00 47.87 ? 77   LYS C NZ  1 
ATOM   2076 N  N   . PRO C 1 76  ? 35.650 -14.207 31.524 1.00 39.27 ? 78   PRO C N   1 
ATOM   2077 C  CA  . PRO C 1 76  ? 35.442 -15.280 30.547 1.00 38.97 ? 78   PRO C CA  1 
ATOM   2078 C  C   . PRO C 1 76  ? 36.391 -16.460 30.765 1.00 38.73 ? 78   PRO C C   1 
ATOM   2079 O  O   . PRO C 1 76  ? 37.441 -16.295 31.386 1.00 38.73 ? 78   PRO C O   1 
ATOM   2080 C  CB  . PRO C 1 76  ? 35.757 -14.602 29.202 1.00 39.01 ? 78   PRO C CB  1 
ATOM   2081 C  CG  . PRO C 1 76  ? 35.749 -13.140 29.474 1.00 39.34 ? 78   PRO C CG  1 
ATOM   2082 C  CD  . PRO C 1 76  ? 36.181 -12.987 30.888 1.00 39.31 ? 78   PRO C CD  1 
ATOM   2083 N  N   . GLU C 1 77  ? 36.007 -17.635 30.262 1.00 38.44 ? 79   GLU C N   1 
ATOM   2084 C  CA  . GLU C 1 77  ? 36.825 -18.857 30.346 1.00 38.25 ? 79   GLU C CA  1 
ATOM   2085 C  C   . GLU C 1 77  ? 37.442 -19.063 31.732 1.00 38.00 ? 79   GLU C C   1 
ATOM   2086 O  O   . GLU C 1 77  ? 38.628 -19.369 31.867 1.00 37.94 ? 79   GLU C O   1 
ATOM   2087 C  CB  . GLU C 1 77  ? 37.908 -18.852 29.252 1.00 38.22 ? 79   GLU C CB  1 
ATOM   2088 N  N   . THR C 1 78  ? 36.616 -18.896 32.758 1.00 37.79 ? 80   THR C N   1 
ATOM   2089 C  CA  . THR C 1 78  ? 37.068 -18.971 34.136 1.00 37.66 ? 80   THR C CA  1 
ATOM   2090 C  C   . THR C 1 78  ? 36.145 -19.890 34.911 1.00 37.67 ? 80   THR C C   1 
ATOM   2091 O  O   . THR C 1 78  ? 34.923 -19.820 34.765 1.00 37.79 ? 80   THR C O   1 
ATOM   2092 C  CB  . THR C 1 78  ? 37.088 -17.554 34.787 1.00 37.77 ? 80   THR C CB  1 
ATOM   2093 O  OG1 . THR C 1 78  ? 37.900 -16.680 33.995 1.00 38.16 ? 80   THR C OG1 1 
ATOM   2094 C  CG2 . THR C 1 78  ? 37.640 -17.589 36.213 1.00 37.77 ? 80   THR C CG2 1 
ATOM   2095 N  N   . THR C 1 79  ? 36.733 -20.762 35.723 1.00 37.51 ? 81   THR C N   1 
ATOM   2096 C  CA  . THR C 1 79  ? 35.951 -21.641 36.576 1.00 37.20 ? 81   THR C CA  1 
ATOM   2097 C  C   . THR C 1 79  ? 35.641 -20.926 37.890 1.00 37.14 ? 81   THR C C   1 
ATOM   2098 O  O   . THR C 1 79  ? 36.525 -20.325 38.507 1.00 36.97 ? 81   THR C O   1 
ATOM   2099 C  CB  . THR C 1 79  ? 36.667 -22.975 36.838 1.00 37.20 ? 81   THR C CB  1 
ATOM   2100 O  OG1 . THR C 1 79  ? 37.059 -23.556 35.591 1.00 36.84 ? 81   THR C OG1 1 
ATOM   2101 C  CG2 . THR C 1 79  ? 35.746 -23.938 37.551 1.00 37.40 ? 81   THR C CG2 1 
ATOM   2102 N  N   . TYR C 1 80  ? 34.377 -20.989 38.295 1.00 36.91 ? 82   TYR C N   1 
ATOM   2103 C  CA  . TYR C 1 80  ? 33.905 -20.366 39.522 1.00 36.88 ? 82   TYR C CA  1 
ATOM   2104 C  C   . TYR C 1 80  ? 33.189 -21.360 40.422 1.00 37.01 ? 82   TYR C C   1 
ATOM   2105 O  O   . TYR C 1 80  ? 32.533 -22.288 39.949 1.00 36.72 ? 82   TYR C O   1 
ATOM   2106 C  CB  . TYR C 1 80  ? 32.896 -19.264 39.205 1.00 37.17 ? 82   TYR C CB  1 
ATOM   2107 C  CG  . TYR C 1 80  ? 33.471 -18.014 38.610 1.00 37.24 ? 82   TYR C CG  1 
ATOM   2108 C  CD1 . TYR C 1 80  ? 33.869 -16.950 39.423 1.00 36.79 ? 82   TYR C CD1 1 
ATOM   2109 C  CD2 . TYR C 1 80  ? 33.592 -17.879 37.234 1.00 36.94 ? 82   TYR C CD2 1 
ATOM   2110 C  CE1 . TYR C 1 80  ? 34.397 -15.791 38.872 1.00 36.78 ? 82   TYR C CE1 1 
ATOM   2111 C  CE2 . TYR C 1 80  ? 34.111 -16.738 36.677 1.00 36.88 ? 82   TYR C CE2 1 
ATOM   2112 C  CZ  . TYR C 1 80  ? 34.511 -15.696 37.498 1.00 37.05 ? 82   TYR C CZ  1 
ATOM   2113 O  OH  . TYR C 1 80  ? 35.020 -14.569 36.927 1.00 37.73 ? 82   TYR C OH  1 
ATOM   2114 N  N   . ALA C 1 81  ? 33.316 -21.143 41.726 1.00 36.82 ? 83   ALA C N   1 
ATOM   2115 C  CA  . ALA C 1 81  ? 32.514 -21.853 42.697 1.00 36.68 ? 83   ALA C CA  1 
ATOM   2116 C  C   . ALA C 1 81  ? 31.359 -20.903 42.989 1.00 36.72 ? 83   ALA C C   1 
ATOM   2117 O  O   . ALA C 1 81  ? 31.552 -19.693 43.036 1.00 36.14 ? 83   ALA C O   1 
ATOM   2118 C  CB  . ALA C 1 81  ? 33.311 -22.136 43.952 1.00 36.47 ? 83   ALA C CB  1 
ATOM   2119 N  N   . VAL C 1 82  ? 30.158 -21.444 43.156 1.00 36.86 ? 84   VAL C N   1 
ATOM   2120 C  CA  . VAL C 1 82  ? 28.996 -20.619 43.486 1.00 36.82 ? 84   VAL C CA  1 
ATOM   2121 C  C   . VAL C 1 82  ? 28.169 -21.329 44.545 1.00 36.84 ? 84   VAL C C   1 
ATOM   2122 O  O   . VAL C 1 82  ? 28.066 -22.558 44.548 1.00 36.44 ? 84   VAL C O   1 
ATOM   2123 C  CB  . VAL C 1 82  ? 28.138 -20.244 42.235 1.00 36.80 ? 84   VAL C CB  1 
ATOM   2124 C  CG1 . VAL C 1 82  ? 27.651 -21.492 41.489 1.00 37.39 ? 84   VAL C CG1 1 
ATOM   2125 C  CG2 . VAL C 1 82  ? 26.948 -19.379 42.633 1.00 37.27 ? 84   VAL C CG2 1 
ATOM   2126 N  N   . ARG C 1 83  ? 27.612 -20.548 45.463 1.00 36.60 ? 85   ARG C N   1 
ATOM   2127 C  CA  . ARG C 1 83  ? 26.758 -21.083 46.514 1.00 36.41 ? 85   ARG C CA  1 
ATOM   2128 C  C   . ARG C 1 83  ? 25.674 -20.058 46.829 1.00 36.72 ? 85   ARG C C   1 
ATOM   2129 O  O   . ARG C 1 83  ? 25.812 -18.875 46.489 1.00 36.78 ? 85   ARG C O   1 
ATOM   2130 C  CB  . ARG C 1 83  ? 27.581 -21.447 47.750 1.00 36.16 ? 85   ARG C CB  1 
ATOM   2131 C  CG  . ARG C 1 83  ? 28.466 -20.320 48.265 1.00 35.72 ? 85   ARG C CG  1 
ATOM   2132 C  CD  . ARG C 1 83  ? 29.366 -20.796 49.386 1.00 36.85 ? 85   ARG C CD  1 
ATOM   2133 N  NE  . ARG C 1 83  ? 29.992 -19.664 50.065 1.00 37.00 ? 85   ARG C NE  1 
ATOM   2134 C  CZ  . ARG C 1 83  ? 30.891 -19.770 51.037 1.00 38.13 ? 85   ARG C CZ  1 
ATOM   2135 N  NH1 . ARG C 1 83  ? 31.281 -20.965 51.462 1.00 38.31 ? 85   ARG C NH1 1 
ATOM   2136 N  NH2 . ARG C 1 83  ? 31.394 -18.675 51.587 1.00 38.42 ? 85   ARG C NH2 1 
ATOM   2137 N  N   . LEU C 1 84  ? 24.593 -20.516 47.456 1.00 36.76 ? 86   LEU C N   1 
ATOM   2138 C  CA  . LEU C 1 84  ? 23.446 -19.664 47.734 1.00 37.43 ? 86   LEU C CA  1 
ATOM   2139 C  C   . LEU C 1 84  ? 22.929 -19.851 49.145 1.00 37.90 ? 86   LEU C C   1 
ATOM   2140 O  O   . LEU C 1 84  ? 23.061 -20.923 49.731 1.00 37.92 ? 86   LEU C O   1 
ATOM   2141 C  CB  . LEU C 1 84  ? 22.299 -19.970 46.759 1.00 37.98 ? 86   LEU C CB  1 
ATOM   2142 C  CG  . LEU C 1 84  ? 22.539 -20.011 45.254 1.00 39.59 ? 86   LEU C CG  1 
ATOM   2143 C  CD1 . LEU C 1 84  ? 21.289 -20.516 44.548 1.00 41.06 ? 86   LEU C CD1 1 
ATOM   2144 C  CD2 . LEU C 1 84  ? 22.949 -18.642 44.699 1.00 41.20 ? 86   LEU C CD2 1 
ATOM   2145 N  N   . ALA C 1 85  ? 22.354 -18.783 49.683 1.00 38.11 ? 87   ALA C N   1 
ATOM   2146 C  CA  . ALA C 1 85  ? 21.669 -18.820 50.959 1.00 38.45 ? 87   ALA C CA  1 
ATOM   2147 C  C   . ALA C 1 85  ? 20.326 -18.116 50.776 1.00 38.66 ? 87   ALA C C   1 
ATOM   2148 O  O   . ALA C 1 85  ? 20.164 -17.302 49.865 1.00 38.47 ? 87   ALA C O   1 
ATOM   2149 C  CB  . ALA C 1 85  ? 22.502 -18.142 52.044 1.00 38.39 ? 87   ALA C CB  1 
ATOM   2150 N  N   . ALA C 1 86  ? 19.361 -18.449 51.622 1.00 38.72 ? 88   ALA C N   1 
ATOM   2151 C  CA  . ALA C 1 86  ? 18.051 -17.810 51.587 1.00 39.15 ? 88   ALA C CA  1 
ATOM   2152 C  C   . ALA C 1 86  ? 17.827 -17.049 52.886 1.00 39.55 ? 88   ALA C C   1 
ATOM   2153 O  O   . ALA C 1 86  ? 18.293 -17.470 53.941 1.00 39.84 ? 88   ALA C O   1 
ATOM   2154 C  CB  . ALA C 1 86  ? 16.960 -18.849 51.382 1.00 39.09 ? 88   ALA C CB  1 
ATOM   2155 N  N   . LEU C 1 87  ? 17.115 -15.927 52.799 1.00 40.11 ? 89   LEU C N   1 
ATOM   2156 C  CA  . LEU C 1 87  ? 16.804 -15.091 53.959 1.00 40.66 ? 89   LEU C CA  1 
ATOM   2157 C  C   . LEU C 1 87  ? 15.304 -15.062 54.226 1.00 41.06 ? 89   LEU C C   1 
ATOM   2158 O  O   . LEU C 1 87  ? 14.512 -14.835 53.311 1.00 41.00 ? 89   LEU C O   1 
ATOM   2159 C  CB  . LEU C 1 87  ? 17.297 -13.656 53.728 1.00 40.59 ? 89   LEU C CB  1 
ATOM   2160 C  CG  . LEU C 1 87  ? 17.000 -12.589 54.793 1.00 40.48 ? 89   LEU C CG  1 
ATOM   2161 C  CD1 . LEU C 1 87  ? 17.903 -12.769 55.991 1.00 40.84 ? 89   LEU C CD1 1 
ATOM   2162 C  CD2 . LEU C 1 87  ? 17.175 -11.173 54.236 1.00 40.80 ? 89   LEU C CD2 1 
ATOM   2163 N  N   . ASN C 1 88  ? 14.915 -15.303 55.476 1.00 41.67 ? 90   ASN C N   1 
ATOM   2164 C  CA  . ASN C 1 88  ? 13.518 -15.143 55.869 1.00 42.26 ? 90   ASN C CA  1 
ATOM   2165 C  C   . ASN C 1 88  ? 13.416 -14.192 57.062 1.00 42.81 ? 90   ASN C C   1 
ATOM   2166 O  O   . ASN C 1 88  ? 14.391 -13.512 57.390 1.00 42.95 ? 90   ASN C O   1 
ATOM   2167 C  CB  . ASN C 1 88  ? 12.815 -16.498 56.108 1.00 42.28 ? 90   ASN C CB  1 
ATOM   2168 C  CG  . ASN C 1 88  ? 13.327 -17.247 57.342 1.00 42.61 ? 90   ASN C CG  1 
ATOM   2169 O  OD1 . ASN C 1 88  ? 14.114 -16.730 58.137 1.00 42.98 ? 90   ASN C OD1 1 
ATOM   2170 N  ND2 . ASN C 1 88  ? 12.863 -18.481 57.503 1.00 42.68 ? 90   ASN C ND2 1 
ATOM   2171 N  N   . GLY C 1 89  ? 12.245 -14.135 57.693 1.00 43.32 ? 91   GLY C N   1 
ATOM   2172 C  CA  . GLY C 1 89  ? 12.036 -13.282 58.862 1.00 44.07 ? 91   GLY C CA  1 
ATOM   2173 C  C   . GLY C 1 89  ? 12.955 -13.647 60.015 1.00 44.60 ? 91   GLY C C   1 
ATOM   2174 O  O   . GLY C 1 89  ? 13.493 -12.766 60.689 1.00 44.88 ? 91   GLY C O   1 
ATOM   2175 N  N   . LYS C 1 90  ? 13.140 -14.950 60.226 1.00 44.97 ? 92   LYS C N   1 
ATOM   2176 C  CA  . LYS C 1 90  ? 13.992 -15.475 61.297 1.00 45.31 ? 92   LYS C CA  1 
ATOM   2177 C  C   . LYS C 1 90  ? 15.490 -15.233 61.068 1.00 45.53 ? 92   LYS C C   1 
ATOM   2178 O  O   . LYS C 1 90  ? 16.291 -15.357 61.997 1.00 45.61 ? 92   LYS C O   1 
ATOM   2179 C  CB  . LYS C 1 90  ? 13.713 -16.965 61.512 1.00 45.30 ? 92   LYS C CB  1 
ATOM   2180 N  N   . GLY C 1 91  ? 15.865 -14.896 59.834 1.00 45.86 ? 93   GLY C N   1 
ATOM   2181 C  CA  . GLY C 1 91  ? 17.259 -14.597 59.508 1.00 46.06 ? 93   GLY C CA  1 
ATOM   2182 C  C   . GLY C 1 91  ? 17.799 -15.298 58.276 1.00 46.30 ? 93   GLY C C   1 
ATOM   2183 O  O   . GLY C 1 91  ? 17.047 -15.900 57.501 1.00 46.18 ? 93   GLY C O   1 
ATOM   2184 N  N   . LEU C 1 92  ? 19.113 -15.194 58.089 1.00 46.50 ? 94   LEU C N   1 
ATOM   2185 C  CA  . LEU C 1 92  ? 19.793 -15.820 56.961 1.00 46.69 ? 94   LEU C CA  1 
ATOM   2186 C  C   . LEU C 1 92  ? 20.077 -17.281 57.289 1.00 46.79 ? 94   LEU C C   1 
ATOM   2187 O  O   . LEU C 1 92  ? 20.612 -17.597 58.357 1.00 46.74 ? 94   LEU C O   1 
ATOM   2188 C  CB  . LEU C 1 92  ? 21.090 -15.068 56.623 1.00 46.71 ? 94   LEU C CB  1 
ATOM   2189 C  CG  . LEU C 1 92  ? 21.901 -15.453 55.377 1.00 46.82 ? 94   LEU C CG  1 
ATOM   2190 C  CD1 . LEU C 1 92  ? 21.125 -15.230 54.071 1.00 46.36 ? 94   LEU C CD1 1 
ATOM   2191 C  CD2 . LEU C 1 92  ? 23.215 -14.685 55.347 1.00 46.85 ? 94   LEU C CD2 1 
ATOM   2192 N  N   . GLY C 1 93  ? 19.696 -18.164 56.371 1.00 46.80 ? 95   GLY C N   1 
ATOM   2193 C  CA  . GLY C 1 93  ? 19.912 -19.596 56.538 1.00 47.11 ? 95   GLY C CA  1 
ATOM   2194 C  C   . GLY C 1 93  ? 21.301 -20.003 56.093 1.00 47.24 ? 95   GLY C C   1 
ATOM   2195 O  O   . GLY C 1 93  ? 22.072 -19.175 55.592 1.00 47.35 ? 95   GLY C O   1 
ATOM   2196 N  N   . GLU C 1 94  ? 21.616 -21.283 56.269 1.00 47.25 ? 96   GLU C N   1 
ATOM   2197 C  CA  . GLU C 1 94  ? 22.924 -21.819 55.904 1.00 47.51 ? 96   GLU C CA  1 
ATOM   2198 C  C   . GLU C 1 94  ? 23.179 -21.698 54.403 1.00 47.75 ? 96   GLU C C   1 
ATOM   2199 O  O   . GLU C 1 94  ? 22.269 -21.887 53.591 1.00 47.44 ? 96   GLU C O   1 
ATOM   2200 C  CB  . GLU C 1 94  ? 23.049 -23.269 56.353 1.00 47.50 ? 96   GLU C CB  1 
ATOM   2201 N  N   . ILE C 1 95  ? 24.418 -21.357 54.052 1.00 47.99 ? 97   ILE C N   1 
ATOM   2202 C  CA  . ILE C 1 95  ? 24.828 -21.276 52.657 1.00 48.45 ? 97   ILE C CA  1 
ATOM   2203 C  C   . ILE C 1 95  ? 24.898 -22.708 52.115 1.00 48.37 ? 97   ILE C C   1 
ATOM   2204 O  O   . ILE C 1 95  ? 25.240 -23.638 52.847 1.00 48.45 ? 97   ILE C O   1 
ATOM   2205 C  CB  . ILE C 1 95  ? 26.191 -20.526 52.492 1.00 48.43 ? 97   ILE C CB  1 
ATOM   2206 C  CG1 . ILE C 1 95  ? 26.389 -20.037 51.055 1.00 49.25 ? 97   ILE C CG1 1 
ATOM   2207 C  CG2 . ILE C 1 95  ? 27.376 -21.373 52.965 1.00 48.83 ? 97   ILE C CG2 1 
ATOM   2208 C  CD1 . ILE C 1 95  ? 25.897 -18.628 50.782 1.00 50.30 ? 97   ILE C CD1 1 
ATOM   2209 N  N   . SER C 1 96  ? 24.550 -22.880 50.844 1.00 48.44 ? 98   SER C N   1 
ATOM   2210 C  CA  . SER C 1 96  ? 24.570 -24.192 50.208 1.00 48.30 ? 98   SER C CA  1 
ATOM   2211 C  C   . SER C 1 96  ? 25.999 -24.646 49.966 1.00 48.42 ? 98   SER C C   1 
ATOM   2212 O  O   . SER C 1 96  ? 26.940 -23.856 50.084 1.00 48.34 ? 98   SER C O   1 
ATOM   2213 C  CB  . SER C 1 96  ? 23.833 -24.134 48.871 1.00 48.29 ? 98   SER C CB  1 
ATOM   2214 O  OG  . SER C 1 96  ? 24.562 -23.371 47.919 1.00 47.52 ? 98   SER C OG  1 
ATOM   2215 N  N   . ALA C 1 97  ? 26.154 -25.923 49.627 1.00 48.59 ? 99   ALA C N   1 
ATOM   2216 C  CA  . ALA C 1 97  ? 27.442 -26.456 49.210 1.00 48.69 ? 99   ALA C CA  1 
ATOM   2217 C  C   . ALA C 1 97  ? 27.771 -25.766 47.890 1.00 48.68 ? 99   ALA C C   1 
ATOM   2218 O  O   . ALA C 1 97  ? 26.870 -25.314 47.182 1.00 48.86 ? 99   ALA C O   1 
ATOM   2219 C  CB  . ALA C 1 97  ? 27.368 -27.962 49.031 1.00 48.58 ? 99   ALA C CB  1 
ATOM   2220 N  N   . ALA C 1 98  ? 29.053 -25.665 47.567 1.00 48.76 ? 100  ALA C N   1 
ATOM   2221 C  CA  . ALA C 1 98  ? 29.462 -24.955 46.366 1.00 48.90 ? 100  ALA C CA  1 
ATOM   2222 C  C   . ALA C 1 98  ? 29.298 -25.793 45.106 1.00 48.98 ? 100  ALA C C   1 
ATOM   2223 O  O   . ALA C 1 98  ? 29.689 -26.963 45.065 1.00 48.94 ? 100  ALA C O   1 
ATOM   2224 C  CB  . ALA C 1 98  ? 30.896 -24.455 46.501 1.00 48.92 ? 100  ALA C CB  1 
ATOM   2225 N  N   . SER C 1 99  ? 28.678 -25.190 44.097 1.00 49.07 ? 101  SER C N   1 
ATOM   2226 C  CA  . SER C 1 99  ? 28.596 -25.781 42.771 1.00 49.14 ? 101  SER C CA  1 
ATOM   2227 C  C   . SER C 1 99  ? 29.675 -25.116 41.936 1.00 49.15 ? 101  SER C C   1 
ATOM   2228 O  O   . SER C 1 99  ? 30.119 -24.012 42.252 1.00 49.40 ? 101  SER C O   1 
ATOM   2229 C  CB  . SER C 1 99  ? 27.216 -25.566 42.151 1.00 49.12 ? 101  SER C CB  1 
ATOM   2230 O  OG  . SER C 1 99  ? 26.266 -26.436 42.739 1.00 49.54 ? 101  SER C OG  1 
ATOM   2231 N  N   . GLU C 1 100 ? 30.107 -25.785 40.877 1.00 48.91 ? 102  GLU C N   1 
ATOM   2232 C  CA  . GLU C 1 100 ? 31.171 -25.253 40.049 1.00 48.87 ? 102  GLU C CA  1 
ATOM   2233 C  C   . GLU C 1 100 ? 30.705 -25.113 38.605 1.00 48.64 ? 102  GLU C C   1 
ATOM   2234 O  O   . GLU C 1 100 ? 30.020 -25.991 38.084 1.00 48.69 ? 102  GLU C O   1 
ATOM   2235 C  CB  . GLU C 1 100 ? 32.385 -26.173 40.132 1.00 48.96 ? 102  GLU C CB  1 
ATOM   2236 C  CG  . GLU C 1 100 ? 33.705 -25.458 39.999 1.00 49.57 ? 102  GLU C CG  1 
ATOM   2237 C  CD  . GLU C 1 100 ? 34.889 -26.352 40.298 1.00 50.24 ? 102  GLU C CD  1 
ATOM   2238 O  OE1 . GLU C 1 100 ? 35.483 -26.202 41.386 1.00 50.33 ? 102  GLU C OE1 1 
ATOM   2239 O  OE2 . GLU C 1 100 ? 35.213 -27.217 39.457 1.00 51.05 ? 102  GLU C OE2 1 
ATOM   2240 N  N   . PHE C 1 101 ? 31.056 -23.994 37.978 1.00 48.36 ? 103  PHE C N   1 
ATOM   2241 C  CA  . PHE C 1 101 ? 30.755 -23.769 36.561 1.00 47.91 ? 103  PHE C CA  1 
ATOM   2242 C  C   . PHE C 1 101 ? 31.911 -23.040 35.904 1.00 47.08 ? 103  PHE C C   1 
ATOM   2243 O  O   . PHE C 1 101 ? 32.740 -22.445 36.589 1.00 47.45 ? 103  PHE C O   1 
ATOM   2244 C  CB  . PHE C 1 101 ? 29.438 -23.000 36.366 1.00 48.07 ? 103  PHE C CB  1 
ATOM   2245 C  CG  . PHE C 1 101 ? 29.473 -21.578 36.849 1.00 48.44 ? 103  PHE C CG  1 
ATOM   2246 C  CD1 . PHE C 1 101 ? 29.870 -20.547 35.999 1.00 48.67 ? 103  PHE C CD1 1 
ATOM   2247 C  CD2 . PHE C 1 101 ? 29.096 -21.260 38.149 1.00 48.44 ? 103  PHE C CD2 1 
ATOM   2248 C  CE1 . PHE C 1 101 ? 29.901 -19.242 36.439 1.00 48.93 ? 103  PHE C CE1 1 
ATOM   2249 C  CE2 . PHE C 1 101 ? 29.120 -19.947 38.592 1.00 49.32 ? 103  PHE C CE2 1 
ATOM   2250 C  CZ  . PHE C 1 101 ? 29.523 -18.938 37.740 1.00 49.05 ? 103  PHE C CZ  1 
ATOM   2251 N  N   . LYS C 1 102 ? 31.967 -23.095 34.578 1.00 46.24 ? 104  LYS C N   1 
ATOM   2252 C  CA  . LYS C 1 102 ? 32.992 -22.394 33.823 1.00 45.48 ? 104  LYS C CA  1 
ATOM   2253 C  C   . LYS C 1 102 ? 32.332 -21.484 32.801 1.00 45.13 ? 104  LYS C C   1 
ATOM   2254 O  O   . LYS C 1 102 ? 31.476 -21.916 32.036 1.00 44.72 ? 104  LYS C O   1 
ATOM   2255 C  CB  . LYS C 1 102 ? 33.940 -23.378 33.129 1.00 45.59 ? 104  LYS C CB  1 
ATOM   2256 C  CG  . LYS C 1 102 ? 35.175 -22.728 32.512 1.00 45.13 ? 104  LYS C CG  1 
ATOM   2257 C  CD  . LYS C 1 102 ? 36.059 -23.756 31.805 1.00 45.27 ? 104  LYS C CD  1 
ATOM   2258 C  CE  . LYS C 1 102 ? 37.302 -23.103 31.234 1.00 44.85 ? 104  LYS C CE  1 
ATOM   2259 N  NZ  . LYS C 1 102 ? 38.177 -24.077 30.519 1.00 45.28 ? 104  LYS C NZ  1 
ATOM   2260 N  N   . THR C 1 103 ? 32.732 -20.219 32.805 1.00 44.89 ? 105  THR C N   1 
ATOM   2261 C  CA  . THR C 1 103 ? 32.203 -19.239 31.858 1.00 44.87 ? 105  THR C CA  1 
ATOM   2262 C  C   . THR C 1 103 ? 32.701 -19.504 30.438 1.00 45.20 ? 105  THR C C   1 
ATOM   2263 O  O   . THR C 1 103 ? 33.764 -20.096 30.243 1.00 44.92 ? 105  THR C O   1 
ATOM   2264 C  CB  . THR C 1 103 ? 32.576 -17.803 32.270 1.00 44.77 ? 105  THR C CB  1 
ATOM   2265 O  OG1 . THR C 1 103 ? 33.959 -17.760 32.638 1.00 44.40 ? 105  THR C OG1 1 
ATOM   2266 C  CG2 . THR C 1 103 ? 31.731 -17.352 33.450 1.00 44.44 ? 105  THR C CG2 1 
ATOM   2267 N  N   . GLN C 1 104 ? 31.916 -19.067 29.456 1.00 45.74 ? 106  GLN C N   1 
ATOM   2268 C  CA  . GLN C 1 104 ? 32.264 -19.203 28.040 1.00 46.37 ? 106  GLN C CA  1 
ATOM   2269 C  C   . GLN C 1 104 ? 33.404 -18.237 27.681 1.00 46.55 ? 106  GLN C C   1 
ATOM   2270 O  O   . GLN C 1 104 ? 33.552 -17.194 28.325 1.00 46.63 ? 106  GLN C O   1 
ATOM   2271 C  CB  . GLN C 1 104 ? 31.032 -18.939 27.169 1.00 46.30 ? 106  GLN C CB  1 
ATOM   2272 C  CG  . GLN C 1 104 ? 29.867 -19.894 27.428 1.00 46.70 ? 106  GLN C CG  1 
ATOM   2273 C  CD  . GLN C 1 104 ? 28.602 -19.536 26.652 1.00 47.03 ? 106  GLN C CD  1 
ATOM   2274 O  OE1 . GLN C 1 104 ? 28.558 -18.551 25.906 1.00 48.20 ? 106  GLN C OE1 1 
ATOM   2275 N  NE2 . GLN C 1 104 ? 27.561 -20.342 26.830 1.00 47.88 ? 106  GLN C NE2 1 
ATOM   2276 N  N   . PRO C 1 105 ? 34.213 -18.578 26.653 1.00 46.99 ? 107  PRO C N   1 
ATOM   2277 C  CA  . PRO C 1 105 ? 35.376 -17.761 26.285 1.00 47.22 ? 107  PRO C CA  1 
ATOM   2278 C  C   . PRO C 1 105 ? 35.107 -16.518 25.414 1.00 47.57 ? 107  PRO C C   1 
ATOM   2279 O  O   . PRO C 1 105 ? 36.068 -15.905 24.936 1.00 47.66 ? 107  PRO C O   1 
ATOM   2280 C  CB  . PRO C 1 105 ? 36.250 -18.754 25.511 1.00 47.29 ? 107  PRO C CB  1 
ATOM   2281 C  CG  . PRO C 1 105 ? 35.269 -19.650 24.846 1.00 47.06 ? 107  PRO C CG  1 
ATOM   2282 C  CD  . PRO C 1 105 ? 34.093 -19.770 25.788 1.00 46.94 ? 107  PRO C CD  1 
ATOM   2283 N  N   . VAL C 1 106 ? 33.838 -16.143 25.231 1.00 47.74 ? 108  VAL C N   1 
ATOM   2284 C  CA  . VAL C 1 106 ? 33.433 -15.017 24.348 1.00 48.12 ? 108  VAL C CA  1 
ATOM   2285 C  C   . VAL C 1 106 ? 33.594 -15.361 22.856 1.00 48.28 ? 108  VAL C C   1 
ATOM   2286 O  O   . VAL C 1 106 ? 32.645 -15.259 22.073 1.00 48.48 ? 108  VAL C O   1 
ATOM   2287 C  CB  . VAL C 1 106 ? 34.169 -13.661 24.649 1.00 48.06 ? 108  VAL C CB  1 
ATOM   2288 C  CG1 . VAL C 1 106 ? 33.605 -12.539 23.787 1.00 48.19 ? 108  VAL C CG1 1 
ATOM   2289 C  CG2 . VAL C 1 106 ? 34.061 -13.277 26.108 1.00 48.28 ? 108  VAL C CG2 1 
HETATM 2290 C  C1  . PEG D 2 .   ? 32.983 9.604   41.896 1.00 51.03 ? 1004 PEG A C1  1 
HETATM 2291 O  O1  . PEG D 2 .   ? 31.565 9.765   42.051 1.00 47.03 ? 1004 PEG A O1  1 
HETATM 2292 C  C2  . PEG D 2 .   ? 33.769 9.674   43.209 1.00 51.11 ? 1004 PEG A C2  1 
HETATM 2293 O  O2  . PEG D 2 .   ? 33.797 8.354   43.781 1.00 53.27 ? 1004 PEG A O2  1 
HETATM 2294 C  C3  . PEG D 2 .   ? 35.095 7.781   43.941 1.00 53.50 ? 1004 PEG A C3  1 
HETATM 2295 C  C4  . PEG D 2 .   ? 35.347 6.761   42.835 1.00 54.12 ? 1004 PEG A C4  1 
HETATM 2296 O  O4  . PEG D 2 .   ? 36.724 6.365   42.840 1.00 54.54 ? 1004 PEG A O4  1 
HETATM 2297 C  C1  . PGE E 3 .   ? 15.308 9.601   58.697 1.00 68.20 ? 1006 PGE B C1  1 
HETATM 2298 O  O1  . PGE E 3 .   ? 16.670 9.938   58.998 1.00 66.49 ? 1006 PGE B O1  1 
HETATM 2299 C  C2  . PGE E 3 .   ? 15.198 8.131   58.305 1.00 68.17 ? 1006 PGE B C2  1 
HETATM 2300 O  O2  . PGE E 3 .   ? 15.683 7.312   59.370 1.00 68.92 ? 1006 PGE B O2  1 
HETATM 2301 C  C3  . PGE E 3 .   ? 15.278 5.946   59.256 1.00 69.43 ? 1006 PGE B C3  1 
HETATM 2302 C  C4  . PGE E 3 .   ? 16.222 5.010   60.017 1.00 69.70 ? 1006 PGE B C4  1 
HETATM 2303 O  O4  . PGE E 3 .   ? 19.366 7.943   61.717 1.00 71.06 ? 1006 PGE B O4  1 
HETATM 2304 C  C6  . PGE E 3 .   ? 19.375 6.569   61.295 1.00 70.41 ? 1006 PGE B C6  1 
HETATM 2305 C  C5  . PGE E 3 .   ? 17.945 6.045   61.253 1.00 70.60 ? 1006 PGE B C5  1 
HETATM 2306 O  O3  . PGE E 3 .   ? 17.578 5.467   59.998 1.00 70.18 ? 1006 PGE B O3  1 
HETATM 2307 C  C1  . PGE F 3 .   ? 28.562 14.664  64.167 1.00 69.43 ? 1007 PGE B C1  1 
HETATM 2308 O  O1  . PGE F 3 .   ? 28.989 15.608  65.158 1.00 69.11 ? 1007 PGE B O1  1 
HETATM 2309 C  C2  . PGE F 3 .   ? 27.127 14.960  63.725 1.00 69.28 ? 1007 PGE B C2  1 
HETATM 2310 O  O2  . PGE F 3 .   ? 26.466 13.751  63.345 1.00 68.95 ? 1007 PGE B O2  1 
HETATM 2311 C  C3  . PGE F 3 .   ? 25.465 13.348  64.282 1.00 68.04 ? 1007 PGE B C3  1 
HETATM 2312 C  C4  . PGE F 3 .   ? 25.922 12.131  65.089 1.00 67.96 ? 1007 PGE B C4  1 
HETATM 2313 O  O4  . PGE F 3 .   ? 29.812 11.291  67.703 1.00 67.99 ? 1007 PGE B O4  1 
HETATM 2314 C  C6  . PGE F 3 .   ? 29.176 12.109  66.714 1.00 67.96 ? 1007 PGE B C6  1 
HETATM 2315 C  C5  . PGE F 3 .   ? 27.858 11.477  66.287 1.00 67.44 ? 1007 PGE B C5  1 
HETATM 2316 O  O3  . PGE F 3 .   ? 26.882 12.496  66.079 1.00 67.54 ? 1007 PGE B O3  1 
HETATM 2317 C  C2  . BTB G 4 .   ? 18.978 17.490  45.989 1.00 60.04 ? 1009 BTB B C2  1 
HETATM 2318 C  C3  . BTB G 4 .   ? 18.001 16.467  45.414 1.00 60.12 ? 1009 BTB B C3  1 
HETATM 2319 O  O3  . BTB G 4 .   ? 18.306 16.268  44.033 1.00 59.20 ? 1009 BTB B O3  1 
HETATM 2320 N  N   . BTB G 4 .   ? 20.024 16.921  46.844 1.00 59.91 ? 1009 BTB B N   1 
HETATM 2321 C  C5  . BTB G 4 .   ? 21.438 17.070  46.479 1.00 59.88 ? 1009 BTB B C5  1 
HETATM 2322 C  C6  . BTB G 4 .   ? 21.605 16.758  44.993 1.00 59.43 ? 1009 BTB B C6  1 
HETATM 2323 O  O6  . BTB G 4 .   ? 21.760 15.345  44.798 1.00 57.68 ? 1009 BTB B O6  1 
HETATM 2324 C  C7  . BTB G 4 .   ? 19.647 16.270  48.105 1.00 60.01 ? 1009 BTB B C7  1 
HETATM 2325 C  C8  . BTB G 4 .   ? 20.221 14.860  48.153 1.00 59.58 ? 1009 BTB B C8  1 
HETATM 2326 O  O8  . BTB G 4 .   ? 19.714 14.103  47.050 1.00 59.53 ? 1009 BTB B O8  1 
HETATM 2327 C  C1  . PEG H 2 .   ? 19.151 9.642   31.955 1.00 66.16 ? 1005 PEG B C1  1 
HETATM 2328 O  O1  . PEG H 2 .   ? 17.986 8.860   32.247 1.00 66.05 ? 1005 PEG B O1  1 
HETATM 2329 C  C2  . PEG H 2 .   ? 20.279 8.743   31.462 1.00 65.73 ? 1005 PEG B C2  1 
HETATM 2330 O  O2  . PEG H 2 .   ? 21.410 8.854   32.331 1.00 66.36 ? 1005 PEG B O2  1 
HETATM 2331 C  C3  . PEG H 2 .   ? 22.135 7.631   32.486 1.00 65.30 ? 1005 PEG B C3  1 
HETATM 2332 C  C4  . PEG H 2 .   ? 23.365 7.601   31.580 1.00 65.48 ? 1005 PEG B C4  1 
HETATM 2333 O  O4  . PEG H 2 .   ? 23.800 6.249   31.392 1.00 64.23 ? 1005 PEG B O4  1 
HETATM 2334 C  C1  . EDO I 5 .   ? 8.042  -14.466 47.877 1.00 70.30 ? 1001 EDO C C1  1 
HETATM 2335 O  O1  . EDO I 5 .   ? 7.245  -14.837 46.747 1.00 70.57 ? 1001 EDO C O1  1 
HETATM 2336 C  C2  . EDO I 5 .   ? 8.521  -15.724 48.591 1.00 70.34 ? 1001 EDO C C2  1 
HETATM 2337 O  O2  . EDO I 5 .   ? 9.714  -16.206 47.963 1.00 69.95 ? 1001 EDO C O2  1 
HETATM 2338 C  C2  . BTB J 4 .   ? 9.132  -19.530 46.305 1.00 62.54 ? 1008 BTB C C2  1 
HETATM 2339 C  C3  . BTB J 4 .   ? 7.794  -19.730 45.603 1.00 62.28 ? 1008 BTB C C3  1 
HETATM 2340 O  O3  . BTB J 4 .   ? 7.007  -18.544 45.779 1.00 62.16 ? 1008 BTB C O3  1 
HETATM 2341 N  N   . BTB J 4 .   ? 9.930  -20.746 46.475 1.00 62.42 ? 1008 BTB C N   1 
HETATM 2342 C  C5  . BTB J 4 .   ? 9.707  -21.621 47.616 1.00 62.50 ? 1008 BTB C C5  1 
HETATM 2343 C  C6  . BTB J 4 .   ? 9.850  -20.753 48.862 1.00 62.60 ? 1008 BTB C C6  1 
HETATM 2344 O  O6  . BTB J 4 .   ? 8.549  -20.445 49.379 1.00 63.33 ? 1008 BTB C O6  1 
HETATM 2345 C  C7  . BTB J 4 .   ? 10.973 -21.108 45.525 1.00 62.26 ? 1008 BTB C C7  1 
HETATM 2346 C  C8  . BTB J 4 .   ? 11.806 -19.853 45.279 1.00 62.39 ? 1008 BTB C C8  1 
HETATM 2347 O  O8  . BTB J 4 .   ? 12.617 -20.020 44.112 1.00 61.90 ? 1008 BTB C O8  1 
HETATM 2348 C  C1  . PEG K 2 .   ? 9.093  -12.177 37.724 1.00 71.92 ? 1003 PEG C C1  1 
HETATM 2349 O  O1  . PEG K 2 .   ? 10.191 -13.091 37.837 1.00 71.15 ? 1003 PEG C O1  1 
HETATM 2350 C  C2  . PEG K 2 .   ? 7.838  -12.773 38.354 1.00 71.70 ? 1003 PEG C C2  1 
HETATM 2351 O  O2  . PEG K 2 .   ? 8.148  -13.277 39.650 1.00 71.79 ? 1003 PEG C O2  1 
HETATM 2352 C  C3  . PEG K 2 .   ? 7.018  -13.263 40.520 1.00 71.88 ? 1003 PEG C C3  1 
HETATM 2353 C  C4  . PEG K 2 .   ? 6.943  -14.605 41.239 1.00 71.60 ? 1003 PEG C C4  1 
HETATM 2354 O  O4  . PEG K 2 .   ? 6.203  -14.470 42.458 1.00 72.01 ? 1003 PEG C O4  1 
HETATM 2355 O  O   . HOH L 6 .   ? 42.291 24.739  39.485 1.00 30.39 ? 1005 HOH A O   1 
HETATM 2356 O  O   . HOH L 6 .   ? 30.000 8.531   49.300 1.00 29.26 ? 1006 HOH A O   1 
HETATM 2357 O  O   . HOH L 6 .   ? 38.885 10.869  33.023 1.00 34.88 ? 1007 HOH A O   1 
HETATM 2358 O  O   . HOH L 6 .   ? 37.622 21.339  23.597 1.00 49.21 ? 1008 HOH A O   1 
HETATM 2359 O  O   . HOH L 6 .   ? 27.636 11.806  42.510 1.00 25.94 ? 1009 HOH A O   1 
HETATM 2360 O  O   . HOH L 6 .   ? 20.362 23.823  29.622 1.00 46.56 ? 1010 HOH A O   1 
HETATM 2361 O  O   . HOH L 6 .   ? 23.886 19.198  44.240 1.00 42.61 ? 1011 HOH A O   1 
HETATM 2362 O  O   . HOH L 6 .   ? 30.558 2.112   44.975 1.00 29.15 ? 1012 HOH A O   1 
HETATM 2363 O  O   . HOH L 6 .   ? 24.280 16.099  47.791 1.00 42.23 ? 1013 HOH A O   1 
HETATM 2364 O  O   . HOH L 6 .   ? 32.222 5.576   46.692 1.00 31.47 ? 1014 HOH A O   1 
HETATM 2365 O  O   . HOH L 6 .   ? 39.447 25.834  25.467 1.00 42.38 ? 1015 HOH A O   1 
HETATM 2366 O  O   . HOH L 6 .   ? 30.640 17.283  49.207 1.00 37.47 ? 1016 HOH A O   1 
HETATM 2367 O  O   . HOH L 6 .   ? 31.189 4.871   37.432 1.00 38.58 ? 1017 HOH A O   1 
HETATM 2368 O  O   . HOH L 6 .   ? 34.662 25.533  43.647 1.00 34.49 ? 1018 HOH A O   1 
HETATM 2369 O  O   . HOH L 6 .   ? 34.372 18.855  45.490 1.00 30.85 ? 1019 HOH A O   1 
HETATM 2370 O  O   . HOH L 6 .   ? 28.812 12.739  31.243 1.00 42.68 ? 1020 HOH A O   1 
HETATM 2371 O  O   . HOH L 6 .   ? 18.089 26.362  35.630 1.00 51.18 ? 1021 HOH A O   1 
HETATM 2372 O  O   . HOH L 6 .   ? 42.767 13.337  46.733 1.00 41.66 ? 1022 HOH A O   1 
HETATM 2373 O  O   . HOH L 6 .   ? 45.377 19.240  31.930 1.00 47.79 ? 1023 HOH A O   1 
HETATM 2374 O  O   . HOH L 6 .   ? 19.760 23.542  34.355 1.00 36.38 ? 1024 HOH A O   1 
HETATM 2375 O  O   . HOH L 6 .   ? 44.851 22.239  29.998 1.00 55.59 ? 1025 HOH A O   1 
HETATM 2376 O  O   . HOH L 6 .   ? 23.869 17.743  42.109 1.00 36.01 ? 1026 HOH A O   1 
HETATM 2377 O  O   . HOH L 6 .   ? 24.841 31.246  43.458 1.00 45.67 ? 1027 HOH A O   1 
HETATM 2378 O  O   . HOH L 6 .   ? 32.620 28.860  15.978 1.00 48.02 ? 1028 HOH A O   1 
HETATM 2379 O  O   . HOH L 6 .   ? 32.048 15.409  48.054 1.00 36.03 ? 1029 HOH A O   1 
HETATM 2380 O  O   . HOH L 6 .   ? 46.866 6.980   41.293 1.00 49.30 ? 1030 HOH A O   1 
HETATM 2381 O  O   . HOH L 6 .   ? 29.818 27.360  22.975 1.00 48.43 ? 1031 HOH A O   1 
HETATM 2382 O  O   . HOH L 6 .   ? 39.135 20.378  45.909 1.00 35.08 ? 1032 HOH A O   1 
HETATM 2383 O  O   . HOH L 6 .   ? 34.107 15.716  51.545 1.00 46.15 ? 1033 HOH A O   1 
HETATM 2384 O  O   . HOH L 6 .   ? 46.714 16.710  47.082 1.00 54.32 ? 1034 HOH A O   1 
HETATM 2385 O  O   . HOH L 6 .   ? 30.840 10.378  30.252 1.00 46.59 ? 1035 HOH A O   1 
HETATM 2386 O  O   . HOH L 6 .   ? 39.370 23.056  44.031 1.00 31.75 ? 1036 HOH A O   1 
HETATM 2387 O  O   . HOH L 6 .   ? 17.810 30.950  34.350 1.00 48.28 ? 1037 HOH A O   1 
HETATM 2388 O  O   . HOH L 6 .   ? 23.133 31.638  27.783 1.00 37.96 ? 1038 HOH A O   1 
HETATM 2389 O  O   . HOH L 6 .   ? 40.430 7.769   30.019 1.00 49.76 ? 1039 HOH A O   1 
HETATM 2390 O  O   . HOH L 6 .   ? 37.099 18.495  45.508 1.00 35.33 ? 1040 HOH A O   1 
HETATM 2391 O  O   . HOH L 6 .   ? 41.509 14.854  29.358 1.00 42.58 ? 1041 HOH A O   1 
HETATM 2392 O  O   . HOH L 6 .   ? 40.462 14.158  26.778 1.00 51.06 ? 1042 HOH A O   1 
HETATM 2393 O  O   . HOH L 6 .   ? 30.851 32.556  32.557 1.00 42.90 ? 1043 HOH A O   1 
HETATM 2394 O  O   . HOH L 6 .   ? 19.632 37.426  36.919 1.00 51.18 ? 1044 HOH A O   1 
HETATM 2395 O  O   . HOH L 6 .   ? 25.724 35.237  29.621 1.00 62.33 ? 1045 HOH A O   1 
HETATM 2396 O  O   . HOH L 6 .   ? 21.114 33.718  44.241 1.00 57.45 ? 1046 HOH A O   1 
HETATM 2397 O  O   . HOH L 6 .   ? 30.458 32.508  42.326 1.00 42.37 ? 1047 HOH A O   1 
HETATM 2398 O  O   . HOH L 6 .   ? 20.366 21.300  35.872 1.00 44.13 ? 1048 HOH A O   1 
HETATM 2399 O  O   . HOH L 6 .   ? 37.024 10.144  43.803 1.00 48.77 ? 1049 HOH A O   1 
HETATM 2400 O  O   . HOH L 6 .   ? 19.458 26.192  28.672 1.00 39.45 ? 1050 HOH A O   1 
HETATM 2401 O  O   . HOH L 6 .   ? 40.775 24.620  29.478 1.00 68.69 ? 1051 HOH A O   1 
HETATM 2402 O  O   . HOH L 6 .   ? 20.397 30.344  27.763 1.00 49.30 ? 1052 HOH A O   1 
HETATM 2403 O  O   . HOH L 6 .   ? 20.863 17.524  36.197 1.00 52.05 ? 1053 HOH A O   1 
HETATM 2404 O  O   . HOH L 6 .   ? 29.830 20.250  48.234 1.00 51.75 ? 1054 HOH A O   1 
HETATM 2405 O  O   . HOH L 6 .   ? 48.405 7.010   43.579 1.00 60.31 ? 1055 HOH A O   1 
HETATM 2406 O  O   . HOH L 6 .   ? 25.322 32.849  26.794 1.00 48.82 ? 1056 HOH A O   1 
HETATM 2407 O  O   . HOH L 6 .   ? 24.813 35.517  42.203 1.00 62.18 ? 1057 HOH A O   1 
HETATM 2408 O  O   . HOH L 6 .   ? 16.588 26.329  38.302 1.00 63.57 ? 1058 HOH A O   1 
HETATM 2409 O  O   . HOH L 6 .   ? 43.848 24.055  32.706 1.00 54.11 ? 1059 HOH A O   1 
HETATM 2410 O  O   . HOH L 6 .   ? 35.575 32.186  24.036 1.00 52.88 ? 1060 HOH A O   1 
HETATM 2411 O  O   . HOH L 6 .   ? 30.000 15.501  24.636 1.00 55.86 ? 1061 HOH A O   1 
HETATM 2412 O  O   . HOH L 6 .   ? 33.242 15.990  25.922 1.00 43.95 ? 1062 HOH A O   1 
HETATM 2413 O  O   . HOH L 6 .   ? 19.140 24.075  41.529 1.00 49.45 ? 1063 HOH A O   1 
HETATM 2414 O  O   . HOH L 6 .   ? 34.473 30.825  28.130 1.00 52.95 ? 1064 HOH A O   1 
HETATM 2415 O  O   . HOH L 6 .   ? 32.196 30.622  29.440 1.00 45.31 ? 1065 HOH A O   1 
HETATM 2416 O  O   . HOH L 6 .   ? 21.506 19.950  33.828 1.00 49.72 ? 1066 HOH A O   1 
HETATM 2417 O  O   . HOH L 6 .   ? 29.672 5.968   34.362 1.00 43.17 ? 1067 HOH A O   1 
HETATM 2418 O  O   . HOH L 6 .   ? 33.368 5.698   33.816 1.00 65.58 ? 1068 HOH A O   1 
HETATM 2419 O  O   . HOH L 6 .   ? 23.738 14.906  31.927 1.00 60.06 ? 1069 HOH A O   1 
HETATM 2420 O  O   . HOH L 6 .   ? 32.403 19.462  48.213 1.00 53.53 ? 1070 HOH A O   1 
HETATM 2421 O  O   . HOH L 6 .   ? 27.103 26.139  45.293 1.00 54.65 ? 1071 HOH A O   1 
HETATM 2422 O  O   . HOH L 6 .   ? 24.398 27.396  47.058 1.00 59.76 ? 1072 HOH A O   1 
HETATM 2423 O  O   . HOH L 6 .   ? 49.781 12.092  37.309 1.00 63.26 ? 1073 HOH A O   1 
HETATM 2424 O  O   . HOH L 6 .   ? 11.624 40.410  54.752 1.00 63.24 ? 1074 HOH A O   1 
HETATM 2425 O  O   . HOH L 6 .   ? 19.615 14.386  36.958 1.00 52.07 ? 1075 HOH A O   1 
HETATM 2426 O  O   . HOH L 6 .   ? 34.419 10.071  26.774 1.00 63.64 ? 1076 HOH A O   1 
HETATM 2427 O  O   . HOH L 6 .   ? 17.863 12.745  38.004 1.00 61.12 ? 1077 HOH A O   1 
HETATM 2428 O  O   . HOH L 6 .   ? 34.582 27.446  15.146 1.00 59.67 ? 1078 HOH A O   1 
HETATM 2429 O  O   . HOH L 6 .   ? 35.881 6.975   46.990 1.00 48.06 ? 1079 HOH A O   1 
HETATM 2430 O  O   . HOH L 6 .   ? 31.578 4.899   42.303 1.00 52.95 ? 1080 HOH A O   1 
HETATM 2431 O  O   . HOH L 6 .   ? 34.522 4.775   47.292 1.00 50.62 ? 1081 HOH A O   1 
HETATM 2432 O  O   . HOH L 6 .   ? 31.630 33.179  30.056 1.00 51.84 ? 1082 HOH A O   1 
HETATM 2433 O  O   . HOH L 6 .   ? 47.621 13.999  44.860 1.00 53.23 ? 1083 HOH A O   1 
HETATM 2434 O  O   . HOH L 6 .   ? 29.641 34.408  28.964 1.00 60.33 ? 1084 HOH A O   1 
HETATM 2435 O  O   . HOH L 6 .   ? 18.804 12.254  33.961 1.00 69.56 ? 1085 HOH A O   1 
HETATM 2436 O  O   . HOH L 6 .   ? 37.909 0.294   38.634 1.00 67.15 ? 1086 HOH A O   1 
HETATM 2437 O  O   . HOH L 6 .   ? 39.396 8.971   44.953 1.00 55.49 ? 1087 HOH A O   1 
HETATM 2438 O  O   . HOH L 6 .   ? 39.713 18.694  27.773 1.00 48.96 ? 1088 HOH A O   1 
HETATM 2439 O  O   . HOH L 6 .   ? 19.355 40.123  44.938 1.00 78.10 ? 1089 HOH A O   1 
HETATM 2440 O  O   . HOH L 6 .   ? 41.146 25.538  43.603 1.00 52.78 ? 1090 HOH A O   1 
HETATM 2441 O  O   . HOH L 6 .   ? 35.233 31.570  16.304 1.00 69.86 ? 1091 HOH A O   1 
HETATM 2442 O  O   . HOH L 6 .   ? 27.534 28.492  22.062 1.00 63.34 ? 1092 HOH A O   1 
HETATM 2443 O  O   . HOH L 6 .   ? 23.324 9.985   34.144 1.00 45.64 ? 1093 HOH A O   1 
HETATM 2444 O  O   . HOH L 6 .   ? 21.313 11.353  35.188 1.00 51.59 ? 1094 HOH A O   1 
HETATM 2445 O  O   . HOH L 6 .   ? 24.402 10.725  31.588 1.00 71.75 ? 1095 HOH A O   1 
HETATM 2446 O  O   . HOH L 6 .   ? 33.327 33.743  21.218 1.00 58.66 ? 1096 HOH A O   1 
HETATM 2447 O  O   . HOH M 6 .   ? 26.227 -10.722 40.096 1.00 32.51 ? 1010 HOH B O   1 
HETATM 2448 O  O   . HOH M 6 .   ? 23.396 -7.016  46.582 1.00 28.17 ? 1011 HOH B O   1 
HETATM 2449 O  O   . HOH M 6 .   ? 29.946 -5.434  51.625 1.00 40.23 ? 1012 HOH B O   1 
HETATM 2450 O  O   . HOH M 6 .   ? 31.141 13.501  57.016 1.00 52.66 ? 1013 HOH B O   1 
HETATM 2451 O  O   . HOH M 6 .   ? 36.126 8.006   53.609 1.00 33.90 ? 1014 HOH B O   1 
HETATM 2452 O  O   . HOH M 6 .   ? 30.708 -9.092  48.693 1.00 50.69 ? 1015 HOH B O   1 
HETATM 2453 O  O   . HOH M 6 .   ? 31.653 -4.606  43.764 1.00 39.84 ? 1016 HOH B O   1 
HETATM 2454 O  O   . HOH M 6 .   ? 21.193 -5.490  43.012 1.00 41.80 ? 1017 HOH B O   1 
HETATM 2455 O  O   . HOH M 6 .   ? 24.998 -2.367  59.894 1.00 54.32 ? 1018 HOH B O   1 
HETATM 2456 O  O   . HOH M 6 .   ? 34.637 0.490   52.167 1.00 49.88 ? 1019 HOH B O   1 
HETATM 2457 O  O   . HOH M 6 .   ? 29.930 4.329   39.956 1.00 32.98 ? 1020 HOH B O   1 
HETATM 2458 O  O   . HOH M 6 .   ? 17.978 12.619  64.970 1.00 33.68 ? 1021 HOH B O   1 
HETATM 2459 O  O   . HOH M 6 .   ? 36.643 3.413   56.896 1.00 44.85 ? 1022 HOH B O   1 
HETATM 2460 O  O   . HOH M 6 .   ? 28.489 -5.949  35.838 1.00 56.86 ? 1023 HOH B O   1 
HETATM 2461 O  O   . HOH M 6 .   ? 34.206 13.580  54.976 1.00 49.35 ? 1024 HOH B O   1 
HETATM 2462 O  O   . HOH M 6 .   ? 16.504 -7.304  53.212 1.00 46.70 ? 1025 HOH B O   1 
HETATM 2463 O  O   . HOH M 6 .   ? 18.805 -12.365 39.027 1.00 30.92 ? 1026 HOH B O   1 
HETATM 2464 O  O   . HOH M 6 .   ? 37.656 6.464   52.000 1.00 62.61 ? 1027 HOH B O   1 
HETATM 2465 O  O   . HOH M 6 .   ? 16.025 0.497   53.718 1.00 40.65 ? 1028 HOH B O   1 
HETATM 2466 O  O   . HOH M 6 .   ? 30.615 2.560   66.382 1.00 50.18 ? 1029 HOH B O   1 
HETATM 2467 O  O   . HOH M 6 .   ? 30.342 6.953   41.724 1.00 33.43 ? 1030 HOH B O   1 
HETATM 2468 O  O   . HOH M 6 .   ? 25.425 1.821   33.853 1.00 48.64 ? 1031 HOH B O   1 
HETATM 2469 O  O   . HOH M 6 .   ? 23.952 -2.722  34.251 1.00 54.46 ? 1032 HOH B O   1 
HETATM 2470 O  O   . HOH M 6 .   ? 13.470 9.975   44.040 1.00 51.17 ? 1033 HOH B O   1 
HETATM 2471 O  O   . HOH M 6 .   ? 29.312 0.588   43.169 1.00 29.40 ? 1034 HOH B O   1 
HETATM 2472 O  O   . HOH M 6 .   ? 36.768 6.792   66.514 1.00 54.35 ? 1035 HOH B O   1 
HETATM 2473 O  O   . HOH M 6 .   ? 28.721 2.095   40.869 1.00 40.43 ? 1036 HOH B O   1 
HETATM 2474 O  O   . HOH M 6 .   ? 14.239 3.845   42.580 1.00 33.20 ? 1037 HOH B O   1 
HETATM 2475 O  O   . HOH M 6 .   ? 19.552 10.510  59.773 1.00 42.21 ? 1038 HOH B O   1 
HETATM 2476 O  O   . HOH M 6 .   ? 29.318 -4.224  42.088 1.00 42.16 ? 1039 HOH B O   1 
HETATM 2477 O  O   . HOH M 6 .   ? 15.194 -1.005  51.755 1.00 37.73 ? 1040 HOH B O   1 
HETATM 2478 O  O   . HOH M 6 .   ? 22.533 19.283  57.971 1.00 40.27 ? 1041 HOH B O   1 
HETATM 2479 O  O   . HOH M 6 .   ? 35.834 10.773  58.026 1.00 51.50 ? 1042 HOH B O   1 
HETATM 2480 O  O   . HOH M 6 .   ? 28.731 12.825  57.678 1.00 54.48 ? 1043 HOH B O   1 
HETATM 2481 O  O   . HOH M 6 .   ? 17.730 -0.230  59.535 1.00 41.65 ? 1044 HOH B O   1 
HETATM 2482 O  O   . HOH M 6 .   ? 31.516 -0.311  46.213 1.00 53.37 ? 1045 HOH B O   1 
HETATM 2483 O  O   . HOH M 6 .   ? 21.062 19.559  62.305 1.00 43.58 ? 1046 HOH B O   1 
HETATM 2484 O  O   . HOH M 6 .   ? 28.879 11.879  54.864 1.00 49.54 ? 1047 HOH B O   1 
HETATM 2485 O  O   . HOH M 6 .   ? 14.910 11.604  47.825 1.00 53.24 ? 1048 HOH B O   1 
HETATM 2486 O  O   . HOH M 6 .   ? 25.505 -0.654  61.972 1.00 37.89 ? 1049 HOH B O   1 
HETATM 2487 O  O   . HOH M 6 .   ? 12.987 7.133   52.733 1.00 43.21 ? 1050 HOH B O   1 
HETATM 2488 O  O   . HOH M 6 .   ? 14.984 20.305  61.938 1.00 59.32 ? 1051 HOH B O   1 
HETATM 2489 O  O   . HOH M 6 .   ? 21.897 -2.885  38.327 1.00 48.52 ? 1052 HOH B O   1 
HETATM 2490 O  O   . HOH M 6 .   ? 27.880 -9.552  51.366 1.00 47.45 ? 1053 HOH B O   1 
HETATM 2491 O  O   . HOH M 6 .   ? 31.631 -4.192  58.999 1.00 55.09 ? 1054 HOH B O   1 
HETATM 2492 O  O   . HOH M 6 .   ? 27.324 -5.455  52.350 1.00 47.84 ? 1055 HOH B O   1 
HETATM 2493 O  O   . HOH M 6 .   ? 22.943 3.226   65.734 1.00 45.92 ? 1056 HOH B O   1 
HETATM 2494 O  O   . HOH M 6 .   ? 9.612  4.342   41.626 1.00 51.65 ? 1057 HOH B O   1 
HETATM 2495 O  O   . HOH M 6 .   ? 18.263 -8.826  40.881 1.00 52.80 ? 1058 HOH B O   1 
HETATM 2496 O  O   . HOH M 6 .   ? 18.202 17.183  52.136 1.00 35.93 ? 1059 HOH B O   1 
HETATM 2497 O  O   . HOH M 6 .   ? 28.514 10.910  69.849 1.00 46.71 ? 1060 HOH B O   1 
HETATM 2498 O  O   . HOH M 6 .   ? 13.164 -5.503  46.009 1.00 63.12 ? 1061 HOH B O   1 
HETATM 2499 O  O   . HOH M 6 .   ? 9.830  3.131   34.747 1.00 64.11 ? 1062 HOH B O   1 
HETATM 2500 O  O   . HOH M 6 .   ? 22.340 -4.429  40.955 1.00 51.03 ? 1063 HOH B O   1 
HETATM 2501 O  O   . HOH M 6 .   ? 12.171 0.639   50.721 1.00 49.68 ? 1064 HOH B O   1 
HETATM 2502 O  O   . HOH M 6 .   ? 12.742 -3.661  30.870 1.00 60.97 ? 1065 HOH B O   1 
HETATM 2503 O  O   . HOH M 6 .   ? 18.713 12.734  60.773 1.00 42.27 ? 1066 HOH B O   1 
HETATM 2504 O  O   . HOH M 6 .   ? 18.936 -4.594  37.775 1.00 60.34 ? 1067 HOH B O   1 
HETATM 2505 O  O   . HOH M 6 .   ? 28.615 1.718   32.557 1.00 53.82 ? 1068 HOH B O   1 
HETATM 2506 O  O   . HOH M 6 .   ? 16.722 2.978   30.839 1.00 50.51 ? 1069 HOH B O   1 
HETATM 2507 O  O   . HOH M 6 .   ? 23.211 18.945  65.017 1.00 47.49 ? 1070 HOH B O   1 
HETATM 2508 O  O   . HOH M 6 .   ? 32.220 -2.008  44.235 1.00 54.78 ? 1071 HOH B O   1 
HETATM 2509 O  O   . HOH M 6 .   ? 17.701 3.622   28.465 1.00 52.28 ? 1072 HOH B O   1 
HETATM 2510 O  O   . HOH M 6 .   ? 12.297 5.455   55.817 1.00 50.95 ? 1073 HOH B O   1 
HETATM 2511 O  O   . HOH M 6 .   ? 11.316 9.555   45.976 1.00 46.93 ? 1074 HOH B O   1 
HETATM 2512 O  O   . HOH M 6 .   ? 21.700 21.938  57.653 1.00 58.71 ? 1075 HOH B O   1 
HETATM 2513 O  O   . HOH M 6 .   ? 22.264 -1.452  58.666 1.00 56.56 ? 1076 HOH B O   1 
HETATM 2514 O  O   . HOH M 6 .   ? 36.987 -1.397  53.089 1.00 66.91 ? 1077 HOH B O   1 
HETATM 2515 O  O   . HOH M 6 .   ? 23.182 -5.362  57.459 1.00 49.06 ? 1078 HOH B O   1 
HETATM 2516 O  O   . HOH M 6 .   ? 33.183 10.842  65.353 1.00 56.25 ? 1079 HOH B O   1 
HETATM 2517 O  O   . HOH M 6 .   ? 32.152 13.295  64.687 1.00 49.80 ? 1080 HOH B O   1 
HETATM 2518 O  O   . HOH M 6 .   ? 25.986 5.149   71.621 1.00 48.31 ? 1081 HOH B O   1 
HETATM 2519 O  O   . HOH M 6 .   ? 35.153 -5.498  50.994 1.00 61.91 ? 1082 HOH B O   1 
HETATM 2520 O  O   . HOH M 6 .   ? 29.119 -0.500  63.467 1.00 51.59 ? 1083 HOH B O   1 
HETATM 2521 O  O   . HOH M 6 .   ? 8.482  7.597   40.394 1.00 70.29 ? 1084 HOH B O   1 
HETATM 2522 O  O   . HOH M 6 .   ? 20.444 -9.911  57.120 1.00 64.27 ? 1085 HOH B O   1 
HETATM 2523 O  O   . HOH M 6 .   ? 17.763 13.729  42.212 1.00 47.39 ? 1086 HOH B O   1 
HETATM 2524 O  O   . HOH M 6 .   ? 39.736 7.909   56.613 1.00 63.98 ? 1087 HOH B O   1 
HETATM 2525 O  O   . HOH M 6 .   ? 19.503 -0.381  63.686 1.00 67.20 ? 1088 HOH B O   1 
HETATM 2526 O  O   . HOH M 6 .   ? 19.981 -3.558  56.518 1.00 63.19 ? 1089 HOH B O   1 
HETATM 2527 O  O   . HOH M 6 .   ? 24.478 3.769   32.681 1.00 61.23 ? 1090 HOH B O   1 
HETATM 2528 O  O   . HOH M 6 .   ? 30.879 -5.866  36.936 1.00 72.88 ? 1091 HOH B O   1 
HETATM 2529 O  O   . HOH M 6 .   ? 27.293 6.578   31.817 1.00 56.85 ? 1092 HOH B O   1 
HETATM 2530 O  O   . HOH M 6 .   ? 19.720 19.101  48.994 1.00 64.25 ? 1093 HOH B O   1 
HETATM 2531 O  O   . HOH N 6 .   ? 6.248  -26.494 44.747 1.00 26.92 ? 1009 HOH C O   1 
HETATM 2532 O  O   . HOH N 6 .   ? 7.145  -20.884 39.349 1.00 28.41 ? 1010 HOH C O   1 
HETATM 2533 O  O   . HOH N 6 .   ? 28.526 -8.953  33.148 1.00 38.52 ? 1011 HOH C O   1 
HETATM 2534 O  O   . HOH N 6 .   ? 36.445 -14.393 42.204 1.00 40.66 ? 1012 HOH C O   1 
HETATM 2535 O  O   . HOH N 6 .   ? 41.101 -13.459 46.453 1.00 51.42 ? 1013 HOH C O   1 
HETATM 2536 O  O   . HOH N 6 .   ? 35.277 -13.621 51.264 1.00 43.35 ? 1014 HOH C O   1 
HETATM 2537 O  O   . HOH N 6 .   ? 13.014 -15.154 35.945 1.00 42.87 ? 1015 HOH C O   1 
HETATM 2538 O  O   . HOH N 6 .   ? 16.408 -13.235 40.214 1.00 33.46 ? 1016 HOH C O   1 
HETATM 2539 O  O   . HOH N 6 .   ? 22.173 -9.813  38.475 1.00 36.54 ? 1017 HOH C O   1 
HETATM 2540 O  O   . HOH N 6 .   ? 20.873 -6.013  39.013 1.00 52.67 ? 1018 HOH C O   1 
HETATM 2541 O  O   . HOH N 6 .   ? 16.452 -9.101  42.760 1.00 33.28 ? 1019 HOH C O   1 
HETATM 2542 O  O   . HOH N 6 .   ? 17.900 -13.393 36.688 1.00 53.86 ? 1020 HOH C O   1 
HETATM 2543 O  O   . HOH N 6 .   ? 12.728 -16.043 38.454 1.00 38.40 ? 1021 HOH C O   1 
HETATM 2544 O  O   . HOH N 6 .   ? 22.860 -13.967 31.698 1.00 57.04 ? 1022 HOH C O   1 
HETATM 2545 O  O   . HOH N 6 .   ? 19.487 -7.950  42.918 1.00 39.23 ? 1023 HOH C O   1 
HETATM 2546 O  O   . HOH N 6 .   ? 13.895 -20.688 32.534 1.00 46.69 ? 1024 HOH C O   1 
HETATM 2547 O  O   . HOH N 6 .   ? 29.950 -25.009 33.365 1.00 51.97 ? 1025 HOH C O   1 
HETATM 2548 O  O   . HOH N 6 .   ? 22.401 -29.658 44.548 1.00 61.56 ? 1026 HOH C O   1 
HETATM 2549 O  O   . HOH N 6 .   ? 19.870 -20.737 53.322 1.00 48.09 ? 1027 HOH C O   1 
HETATM 2550 O  O   . HOH N 6 .   ? 39.633 -20.751 36.309 1.00 51.18 ? 1028 HOH C O   1 
HETATM 2551 O  O   . HOH N 6 .   ? 35.179 -10.352 37.449 1.00 44.84 ? 1029 HOH C O   1 
HETATM 2552 O  O   . HOH N 6 .   ? 29.286 -12.035 51.643 1.00 55.87 ? 1030 HOH C O   1 
HETATM 2553 O  O   . HOH N 6 .   ? 11.955 -5.860  49.616 1.00 53.78 ? 1031 HOH C O   1 
HETATM 2554 O  O   . HOH N 6 .   ? 27.763 -12.916 28.978 1.00 51.89 ? 1032 HOH C O   1 
HETATM 2555 O  O   . HOH N 6 .   ? 37.499 -13.338 44.320 1.00 55.56 ? 1033 HOH C O   1 
HETATM 2556 O  O   . HOH N 6 .   ? 40.038 -13.971 39.494 1.00 54.09 ? 1034 HOH C O   1 
HETATM 2557 O  O   . HOH N 6 .   ? 24.147 -27.244 35.504 1.00 50.45 ? 1035 HOH C O   1 
HETATM 2558 O  O   . HOH N 6 .   ? 10.680 -10.766 48.113 1.00 53.24 ? 1036 HOH C O   1 
HETATM 2559 O  O   . HOH N 6 .   ? 22.109 -27.211 48.883 1.00 52.74 ? 1037 HOH C O   1 
HETATM 2560 O  O   . HOH N 6 .   ? 18.853 -20.407 32.966 1.00 46.25 ? 1038 HOH C O   1 
HETATM 2561 O  O   . HOH N 6 .   ? 33.570 -9.524  32.334 1.00 57.47 ? 1039 HOH C O   1 
HETATM 2562 O  O   . HOH N 6 .   ? 37.763 -13.088 40.189 1.00 49.88 ? 1040 HOH C O   1 
HETATM 2563 O  O   . HOH N 6 .   ? 19.553 -22.419 34.640 1.00 42.43 ? 1041 HOH C O   1 
HETATM 2564 O  O   . HOH N 6 .   ? 41.310 -21.537 49.026 1.00 65.67 ? 1042 HOH C O   1 
HETATM 2565 O  O   . HOH N 6 .   ? 35.453 -12.630 38.925 1.00 45.30 ? 1043 HOH C O   1 
HETATM 2566 O  O   . HOH N 6 .   ? 19.628 -23.060 57.249 1.00 60.05 ? 1044 HOH C O   1 
HETATM 2567 O  O   . HOH N 6 .   ? 13.010 -23.273 54.051 1.00 53.19 ? 1045 HOH C O   1 
HETATM 2568 O  O   . HOH N 6 .   ? 23.280 -26.814 45.911 1.00 47.14 ? 1046 HOH C O   1 
HETATM 2569 O  O   . HOH N 6 .   ? 39.600 -14.061 31.519 1.00 53.90 ? 1047 HOH C O   1 
HETATM 2570 O  O   . HOH N 6 .   ? 39.404 -20.657 45.136 1.00 48.50 ? 1048 HOH C O   1 
HETATM 2571 O  O   . HOH N 6 .   ? 25.082 -21.768 28.518 1.00 57.96 ? 1049 HOH C O   1 
HETATM 2572 O  O   . HOH N 6 .   ? 29.303 -28.387 40.527 1.00 52.03 ? 1050 HOH C O   1 
HETATM 2573 O  O   . HOH N 6 .   ? 27.417 -24.964 34.184 1.00 49.13 ? 1051 HOH C O   1 
HETATM 2574 O  O   . HOH N 6 .   ? 36.713 -20.613 44.636 1.00 55.31 ? 1052 HOH C O   1 
HETATM 2575 O  O   . HOH N 6 .   ? 24.755 -28.071 39.497 1.00 65.41 ? 1053 HOH C O   1 
HETATM 2576 O  O   . HOH N 6 .   ? 27.741 -15.041 26.209 1.00 60.66 ? 1054 HOH C O   1 
HETATM 2577 O  O   . HOH N 6 .   ? 21.559 -31.790 35.768 1.00 68.79 ? 1055 HOH C O   1 
HETATM 2578 O  O   . HOH N 6 .   ? 16.628 -29.196 47.952 1.00 54.48 ? 1056 HOH C O   1 
HETATM 2579 O  O   . HOH N 6 .   ? 17.476 -24.269 60.977 1.00 64.91 ? 1057 HOH C O   1 
HETATM 2580 O  O   . HOH N 6 .   ? 11.518 -21.452 57.885 1.00 64.03 ? 1058 HOH C O   1 
HETATM 2581 O  O   . HOH N 6 .   ? 35.694 -20.297 51.789 1.00 57.66 ? 1059 HOH C O   1 
HETATM 2582 O  O   . HOH N 6 .   ? 12.157 -8.081  52.851 1.00 54.09 ? 1060 HOH C O   1 
HETATM 2583 O  O   . HOH N 6 .   ? 5.250  -21.480 45.653 1.00 66.70 ? 1061 HOH C O   1 
HETATM 2584 O  O   . HOH N 6 .   ? 21.187 -20.208 60.008 1.00 68.82 ? 1062 HOH C O   1 
HETATM 2585 O  O   . HOH N 6 .   ? 4.598  -17.836 53.383 1.00 62.02 ? 1063 HOH C O   1 
HETATM 2586 O  O   . HOH N 6 .   ? 2.996  -20.221 46.375 1.00 56.49 ? 1064 HOH C O   1 
HETATM 2587 O  O   . HOH N 6 .   ? 19.591 -30.672 34.182 1.00 70.60 ? 1065 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   3   ?   ?   ?   A . n 
A 1 2   SER 2   4   ?   ?   ?   A . n 
A 1 3   SER 3   5   ?   ?   ?   A . n 
A 1 4   GLY 4   6   ?   ?   ?   A . n 
A 1 5   SER 5   7   ?   ?   ?   A . n 
A 1 6   SER 6   8   8   SER SER A . n 
A 1 7   GLY 7   9   9   GLY GLY A . n 
A 1 8   PRO 8   10  10  PRO PRO A . n 
A 1 9   SER 9   11  11  SER SER A . n 
A 1 10  SER 10  12  12  SER SER A . n 
A 1 11  PRO 11  13  13  PRO PRO A . n 
A 1 12  SER 12  14  14  SER SER A . n 
A 1 13  ILE 13  15  15  ILE ILE A . n 
A 1 14  ASP 14  16  16  ASP ASP A . n 
A 1 15  GLN 15  17  17  GLN GLN A . n 
A 1 16  VAL 16  18  18  VAL VAL A . n 
A 1 17  GLU 17  19  19  GLU GLU A . n 
A 1 18  PRO 18  20  20  PRO PRO A . n 
A 1 19  TYR 19  21  21  TYR TYR A . n 
A 1 20  SER 20  22  22  SER SER A . n 
A 1 21  SER 21  23  23  SER SER A . n 
A 1 22  THR 22  24  24  THR THR A . n 
A 1 23  ALA 23  25  25  ALA ALA A . n 
A 1 24  GLN 24  26  26  GLN GLN A . n 
A 1 25  VAL 25  27  27  VAL VAL A . n 
A 1 26  GLN 26  28  28  GLN GLN A . n 
A 1 27  PHE 27  29  29  PHE PHE A . n 
A 1 28  ASP 28  30  30  ASP ASP A . n 
A 1 29  GLU 29  31  31  GLU GLU A . n 
A 1 30  PRO 30  32  32  PRO PRO A . n 
A 1 31  GLU 31  33  33  GLU GLU A . n 
A 1 32  ALA 32  34  34  ALA ALA A . n 
A 1 33  THR 33  35  35  THR THR A . n 
A 1 34  GLY 34  36  ?   ?   ?   A . n 
A 1 35  GLY 35  37  ?   ?   ?   A . n 
A 1 36  VAL 36  38  38  VAL VAL A . n 
A 1 37  PRO 37  39  39  PRO PRO A . n 
A 1 38  ILE 38  40  40  ILE ILE A . n 
A 1 39  LEU 39  41  41  LEU LEU A . n 
A 1 40  LYS 40  42  42  LYS LYS A . n 
A 1 41  TYR 41  43  43  TYR TYR A . n 
A 1 42  LYS 42  44  44  LYS LYS A . n 
A 1 43  ALA 43  45  45  ALA ALA A . n 
A 1 44  GLU 44  46  46  GLU GLU A . n 
A 1 45  TRP 45  47  47  TRP TRP A . n 
A 1 46  ARG 46  48  48  ARG ARG A . n 
A 1 47  ALA 47  49  49  ALA ALA A . n 
A 1 48  VAL 48  50  50  VAL VAL A . n 
A 1 49  GLY 49  51  51  GLY GLY A . n 
A 1 50  GLU 50  52  52  GLU GLU A . n 
A 1 51  GLU 51  53  53  GLU GLU A . n 
A 1 52  VAL 52  54  54  VAL VAL A . n 
A 1 53  TRP 53  55  55  TRP TRP A . n 
A 1 54  HIS 54  56  56  HIS HIS A . n 
A 1 55  SER 55  57  57  SER SER A . n 
A 1 56  LYS 56  58  58  LYS LYS A . n 
A 1 57  TRP 57  59  59  TRP TRP A . n 
A 1 58  TYR 58  60  60  TYR TYR A . n 
A 1 59  ASP 59  61  61  ASP ASP A . n 
A 1 60  ALA 60  62  62  ALA ALA A . n 
A 1 61  LYS 61  63  63  LYS LYS A . n 
A 1 62  GLU 62  64  64  GLU GLU A . n 
A 1 63  ALA 63  65  65  ALA ALA A . n 
A 1 64  SER 64  66  66  SER SER A . n 
A 1 65  MSE 65  67  67  MSE MSE A . n 
A 1 66  GLU 66  68  68  GLU GLU A . n 
A 1 67  GLY 67  69  69  GLY GLY A . n 
A 1 68  ILE 68  70  70  ILE ILE A . n 
A 1 69  VAL 69  71  71  VAL VAL A . n 
A 1 70  THR 70  72  72  THR THR A . n 
A 1 71  ILE 71  73  73  ILE ILE A . n 
A 1 72  VAL 72  74  74  VAL VAL A . n 
A 1 73  GLY 73  75  75  GLY GLY A . n 
A 1 74  LEU 74  76  76  LEU LEU A . n 
A 1 75  LYS 75  77  77  LYS LYS A . n 
A 1 76  PRO 76  78  78  PRO PRO A . n 
A 1 77  GLU 77  79  79  GLU GLU A . n 
A 1 78  THR 78  80  80  THR THR A . n 
A 1 79  THR 79  81  81  THR THR A . n 
A 1 80  TYR 80  82  82  TYR TYR A . n 
A 1 81  ALA 81  83  83  ALA ALA A . n 
A 1 82  VAL 82  84  84  VAL VAL A . n 
A 1 83  ARG 83  85  85  ARG ARG A . n 
A 1 84  LEU 84  86  86  LEU LEU A . n 
A 1 85  ALA 85  87  87  ALA ALA A . n 
A 1 86  ALA 86  88  88  ALA ALA A . n 
A 1 87  LEU 87  89  89  LEU LEU A . n 
A 1 88  ASN 88  90  90  ASN ASN A . n 
A 1 89  GLY 89  91  91  GLY GLY A . n 
A 1 90  LYS 90  92  92  LYS LYS A . n 
A 1 91  GLY 91  93  93  GLY GLY A . n 
A 1 92  LEU 92  94  94  LEU LEU A . n 
A 1 93  GLY 93  95  95  GLY GLY A . n 
A 1 94  GLU 94  96  96  GLU GLU A . n 
A 1 95  ILE 95  97  97  ILE ILE A . n 
A 1 96  SER 96  98  98  SER SER A . n 
A 1 97  ALA 97  99  99  ALA ALA A . n 
A 1 98  ALA 98  100 100 ALA ALA A . n 
A 1 99  SER 99  101 101 SER SER A . n 
A 1 100 GLU 100 102 102 GLU GLU A . n 
A 1 101 PHE 101 103 103 PHE PHE A . n 
A 1 102 LYS 102 104 104 LYS LYS A . n 
A 1 103 THR 103 105 105 THR THR A . n 
A 1 104 GLN 104 106 106 GLN GLN A . n 
A 1 105 PRO 105 107 107 PRO PRO A . n 
A 1 106 VAL 106 108 108 VAL VAL A . n 
A 1 107 ARG 107 109 109 ARG ARG A . n 
A 1 108 GLU 108 110 110 GLU GLU A . n 
A 1 109 PRO 109 111 111 PRO PRO A . n 
A 1 110 SER 110 112 112 SER SER A . n 
A 1 111 ALA 111 113 ?   ?   ?   A . n 
A 1 112 PRO 112 114 ?   ?   ?   A . n 
A 1 113 LYS 113 115 ?   ?   ?   A . n 
A 1 114 LEU 114 116 ?   ?   ?   A . n 
A 1 115 GLU 115 117 ?   ?   ?   A . n 
A 1 116 GLY 116 118 ?   ?   ?   A . n 
A 1 117 SER 117 119 ?   ?   ?   A . n 
A 1 118 GLY 118 120 ?   ?   ?   A . n 
A 1 119 PRO 119 121 ?   ?   ?   A . n 
A 1 120 SER 120 122 ?   ?   ?   A . n 
A 1 121 SER 121 123 ?   ?   ?   A . n 
A 1 122 GLY 122 124 ?   ?   ?   A . n 
B 1 1   GLY 1   3   ?   ?   ?   B . n 
B 1 2   SER 2   4   ?   ?   ?   B . n 
B 1 3   SER 3   5   ?   ?   ?   B . n 
B 1 4   GLY 4   6   ?   ?   ?   B . n 
B 1 5   SER 5   7   ?   ?   ?   B . n 
B 1 6   SER 6   8   8   SER SER B . n 
B 1 7   GLY 7   9   9   GLY GLY B . n 
B 1 8   PRO 8   10  10  PRO PRO B . n 
B 1 9   SER 9   11  11  SER SER B . n 
B 1 10  SER 10  12  12  SER SER B . n 
B 1 11  PRO 11  13  13  PRO PRO B . n 
B 1 12  SER 12  14  14  SER SER B . n 
B 1 13  ILE 13  15  15  ILE ILE B . n 
B 1 14  ASP 14  16  16  ASP ASP B . n 
B 1 15  GLN 15  17  17  GLN GLN B . n 
B 1 16  VAL 16  18  18  VAL VAL B . n 
B 1 17  GLU 17  19  19  GLU GLU B . n 
B 1 18  PRO 18  20  20  PRO PRO B . n 
B 1 19  TYR 19  21  21  TYR TYR B . n 
B 1 20  SER 20  22  22  SER SER B . n 
B 1 21  SER 21  23  23  SER SER B . n 
B 1 22  THR 22  24  24  THR THR B . n 
B 1 23  ALA 23  25  25  ALA ALA B . n 
B 1 24  GLN 24  26  26  GLN GLN B . n 
B 1 25  VAL 25  27  27  VAL VAL B . n 
B 1 26  GLN 26  28  28  GLN GLN B . n 
B 1 27  PHE 27  29  29  PHE PHE B . n 
B 1 28  ASP 28  30  30  ASP ASP B . n 
B 1 29  GLU 29  31  31  GLU GLU B . n 
B 1 30  PRO 30  32  32  PRO PRO B . n 
B 1 31  GLU 31  33  33  GLU GLU B . n 
B 1 32  ALA 32  34  ?   ?   ?   B . n 
B 1 33  THR 33  35  ?   ?   ?   B . n 
B 1 34  GLY 34  36  ?   ?   ?   B . n 
B 1 35  GLY 35  37  ?   ?   ?   B . n 
B 1 36  VAL 36  38  38  VAL VAL B . n 
B 1 37  PRO 37  39  39  PRO PRO B . n 
B 1 38  ILE 38  40  40  ILE ILE B . n 
B 1 39  LEU 39  41  41  LEU LEU B . n 
B 1 40  LYS 40  42  42  LYS LYS B . n 
B 1 41  TYR 41  43  43  TYR TYR B . n 
B 1 42  LYS 42  44  44  LYS LYS B . n 
B 1 43  ALA 43  45  45  ALA ALA B . n 
B 1 44  GLU 44  46  46  GLU GLU B . n 
B 1 45  TRP 45  47  47  TRP TRP B . n 
B 1 46  ARG 46  48  48  ARG ARG B . n 
B 1 47  ALA 47  49  49  ALA ALA B . n 
B 1 48  VAL 48  50  50  VAL VAL B . n 
B 1 49  GLY 49  51  51  GLY GLY B . n 
B 1 50  GLU 50  52  52  GLU GLU B . n 
B 1 51  GLU 51  53  53  GLU GLU B . n 
B 1 52  VAL 52  54  54  VAL VAL B . n 
B 1 53  TRP 53  55  55  TRP TRP B . n 
B 1 54  HIS 54  56  56  HIS HIS B . n 
B 1 55  SER 55  57  57  SER SER B . n 
B 1 56  LYS 56  58  58  LYS LYS B . n 
B 1 57  TRP 57  59  59  TRP TRP B . n 
B 1 58  TYR 58  60  60  TYR TYR B . n 
B 1 59  ASP 59  61  61  ASP ASP B . n 
B 1 60  ALA 60  62  62  ALA ALA B . n 
B 1 61  LYS 61  63  63  LYS LYS B . n 
B 1 62  GLU 62  64  64  GLU GLU B . n 
B 1 63  ALA 63  65  65  ALA ALA B . n 
B 1 64  SER 64  66  66  SER SER B . n 
B 1 65  MSE 65  67  67  MSE MSE B . n 
B 1 66  GLU 66  68  68  GLU GLU B . n 
B 1 67  GLY 67  69  69  GLY GLY B . n 
B 1 68  ILE 68  70  70  ILE ILE B . n 
B 1 69  VAL 69  71  71  VAL VAL B . n 
B 1 70  THR 70  72  72  THR THR B . n 
B 1 71  ILE 71  73  73  ILE ILE B . n 
B 1 72  VAL 72  74  74  VAL VAL B . n 
B 1 73  GLY 73  75  75  GLY GLY B . n 
B 1 74  LEU 74  76  76  LEU LEU B . n 
B 1 75  LYS 75  77  77  LYS LYS B . n 
B 1 76  PRO 76  78  78  PRO PRO B . n 
B 1 77  GLU 77  79  79  GLU GLU B . n 
B 1 78  THR 78  80  80  THR THR B . n 
B 1 79  THR 79  81  81  THR THR B . n 
B 1 80  TYR 80  82  82  TYR TYR B . n 
B 1 81  ALA 81  83  83  ALA ALA B . n 
B 1 82  VAL 82  84  84  VAL VAL B . n 
B 1 83  ARG 83  85  85  ARG ARG B . n 
B 1 84  LEU 84  86  86  LEU LEU B . n 
B 1 85  ALA 85  87  87  ALA ALA B . n 
B 1 86  ALA 86  88  88  ALA ALA B . n 
B 1 87  LEU 87  89  89  LEU LEU B . n 
B 1 88  ASN 88  90  90  ASN ASN B . n 
B 1 89  GLY 89  91  91  GLY GLY B . n 
B 1 90  LYS 90  92  92  LYS LYS B . n 
B 1 91  GLY 91  93  93  GLY GLY B . n 
B 1 92  LEU 92  94  94  LEU LEU B . n 
B 1 93  GLY 93  95  95  GLY GLY B . n 
B 1 94  GLU 94  96  96  GLU GLU B . n 
B 1 95  ILE 95  97  97  ILE ILE B . n 
B 1 96  SER 96  98  98  SER SER B . n 
B 1 97  ALA 97  99  99  ALA ALA B . n 
B 1 98  ALA 98  100 100 ALA ALA B . n 
B 1 99  SER 99  101 101 SER SER B . n 
B 1 100 GLU 100 102 102 GLU GLU B . n 
B 1 101 PHE 101 103 103 PHE PHE B . n 
B 1 102 LYS 102 104 104 LYS LYS B . n 
B 1 103 THR 103 105 105 THR THR B . n 
B 1 104 GLN 104 106 106 GLN GLN B . n 
B 1 105 PRO 105 107 107 PRO PRO B . n 
B 1 106 VAL 106 108 108 VAL VAL B . n 
B 1 107 ARG 107 109 ?   ?   ?   B . n 
B 1 108 GLU 108 110 ?   ?   ?   B . n 
B 1 109 PRO 109 111 ?   ?   ?   B . n 
B 1 110 SER 110 112 ?   ?   ?   B . n 
B 1 111 ALA 111 113 ?   ?   ?   B . n 
B 1 112 PRO 112 114 ?   ?   ?   B . n 
B 1 113 LYS 113 115 ?   ?   ?   B . n 
B 1 114 LEU 114 116 ?   ?   ?   B . n 
B 1 115 GLU 115 117 ?   ?   ?   B . n 
B 1 116 GLY 116 118 ?   ?   ?   B . n 
B 1 117 SER 117 119 ?   ?   ?   B . n 
B 1 118 GLY 118 120 ?   ?   ?   B . n 
B 1 119 PRO 119 121 ?   ?   ?   B . n 
B 1 120 SER 120 122 ?   ?   ?   B . n 
B 1 121 SER 121 123 ?   ?   ?   B . n 
B 1 122 GLY 122 124 ?   ?   ?   B . n 
C 1 1   GLY 1   3   ?   ?   ?   C . n 
C 1 2   SER 2   4   ?   ?   ?   C . n 
C 1 3   SER 3   5   ?   ?   ?   C . n 
C 1 4   GLY 4   6   ?   ?   ?   C . n 
C 1 5   SER 5   7   ?   ?   ?   C . n 
C 1 6   SER 6   8   8   SER SER C . n 
C 1 7   GLY 7   9   9   GLY GLY C . n 
C 1 8   PRO 8   10  10  PRO PRO C . n 
C 1 9   SER 9   11  11  SER SER C . n 
C 1 10  SER 10  12  12  SER SER C . n 
C 1 11  PRO 11  13  13  PRO PRO C . n 
C 1 12  SER 12  14  14  SER SER C . n 
C 1 13  ILE 13  15  15  ILE ILE C . n 
C 1 14  ASP 14  16  16  ASP ASP C . n 
C 1 15  GLN 15  17  17  GLN GLN C . n 
C 1 16  VAL 16  18  18  VAL VAL C . n 
C 1 17  GLU 17  19  19  GLU GLU C . n 
C 1 18  PRO 18  20  20  PRO PRO C . n 
C 1 19  TYR 19  21  21  TYR TYR C . n 
C 1 20  SER 20  22  22  SER SER C . n 
C 1 21  SER 21  23  23  SER SER C . n 
C 1 22  THR 22  24  24  THR THR C . n 
C 1 23  ALA 23  25  25  ALA ALA C . n 
C 1 24  GLN 24  26  26  GLN GLN C . n 
C 1 25  VAL 25  27  27  VAL VAL C . n 
C 1 26  GLN 26  28  28  GLN GLN C . n 
C 1 27  PHE 27  29  29  PHE PHE C . n 
C 1 28  ASP 28  30  30  ASP ASP C . n 
C 1 29  GLU 29  31  31  GLU GLU C . n 
C 1 30  PRO 30  32  32  PRO PRO C . n 
C 1 31  GLU 31  33  33  GLU GLU C . n 
C 1 32  ALA 32  34  34  ALA ALA C . n 
C 1 33  THR 33  35  35  THR THR C . n 
C 1 34  GLY 34  36  36  GLY GLY C . n 
C 1 35  GLY 35  37  37  GLY GLY C . n 
C 1 36  VAL 36  38  38  VAL VAL C . n 
C 1 37  PRO 37  39  39  PRO PRO C . n 
C 1 38  ILE 38  40  40  ILE ILE C . n 
C 1 39  LEU 39  41  41  LEU LEU C . n 
C 1 40  LYS 40  42  42  LYS LYS C . n 
C 1 41  TYR 41  43  43  TYR TYR C . n 
C 1 42  LYS 42  44  44  LYS LYS C . n 
C 1 43  ALA 43  45  45  ALA ALA C . n 
C 1 44  GLU 44  46  46  GLU GLU C . n 
C 1 45  TRP 45  47  47  TRP TRP C . n 
C 1 46  ARG 46  48  48  ARG ARG C . n 
C 1 47  ALA 47  49  49  ALA ALA C . n 
C 1 48  VAL 48  50  50  VAL VAL C . n 
C 1 49  GLY 49  51  51  GLY GLY C . n 
C 1 50  GLU 50  52  52  GLU GLU C . n 
C 1 51  GLU 51  53  53  GLU GLU C . n 
C 1 52  VAL 52  54  54  VAL VAL C . n 
C 1 53  TRP 53  55  55  TRP TRP C . n 
C 1 54  HIS 54  56  56  HIS HIS C . n 
C 1 55  SER 55  57  57  SER SER C . n 
C 1 56  LYS 56  58  58  LYS LYS C . n 
C 1 57  TRP 57  59  59  TRP TRP C . n 
C 1 58  TYR 58  60  60  TYR TYR C . n 
C 1 59  ASP 59  61  61  ASP ASP C . n 
C 1 60  ALA 60  62  62  ALA ALA C . n 
C 1 61  LYS 61  63  63  LYS LYS C . n 
C 1 62  GLU 62  64  64  GLU GLU C . n 
C 1 63  ALA 63  65  65  ALA ALA C . n 
C 1 64  SER 64  66  66  SER SER C . n 
C 1 65  MSE 65  67  67  MSE MSE C . n 
C 1 66  GLU 66  68  68  GLU GLU C . n 
C 1 67  GLY 67  69  69  GLY GLY C . n 
C 1 68  ILE 68  70  70  ILE ILE C . n 
C 1 69  VAL 69  71  71  VAL VAL C . n 
C 1 70  THR 70  72  72  THR THR C . n 
C 1 71  ILE 71  73  73  ILE ILE C . n 
C 1 72  VAL 72  74  74  VAL VAL C . n 
C 1 73  GLY 73  75  75  GLY GLY C . n 
C 1 74  LEU 74  76  76  LEU LEU C . n 
C 1 75  LYS 75  77  77  LYS LYS C . n 
C 1 76  PRO 76  78  78  PRO PRO C . n 
C 1 77  GLU 77  79  79  GLU GLU C . n 
C 1 78  THR 78  80  80  THR THR C . n 
C 1 79  THR 79  81  81  THR THR C . n 
C 1 80  TYR 80  82  82  TYR TYR C . n 
C 1 81  ALA 81  83  83  ALA ALA C . n 
C 1 82  VAL 82  84  84  VAL VAL C . n 
C 1 83  ARG 83  85  85  ARG ARG C . n 
C 1 84  LEU 84  86  86  LEU LEU C . n 
C 1 85  ALA 85  87  87  ALA ALA C . n 
C 1 86  ALA 86  88  88  ALA ALA C . n 
C 1 87  LEU 87  89  89  LEU LEU C . n 
C 1 88  ASN 88  90  90  ASN ASN C . n 
C 1 89  GLY 89  91  91  GLY GLY C . n 
C 1 90  LYS 90  92  92  LYS LYS C . n 
C 1 91  GLY 91  93  93  GLY GLY C . n 
C 1 92  LEU 92  94  94  LEU LEU C . n 
C 1 93  GLY 93  95  95  GLY GLY C . n 
C 1 94  GLU 94  96  96  GLU GLU C . n 
C 1 95  ILE 95  97  97  ILE ILE C . n 
C 1 96  SER 96  98  98  SER SER C . n 
C 1 97  ALA 97  99  99  ALA ALA C . n 
C 1 98  ALA 98  100 100 ALA ALA C . n 
C 1 99  SER 99  101 101 SER SER C . n 
C 1 100 GLU 100 102 102 GLU GLU C . n 
C 1 101 PHE 101 103 103 PHE PHE C . n 
C 1 102 LYS 102 104 104 LYS LYS C . n 
C 1 103 THR 103 105 105 THR THR C . n 
C 1 104 GLN 104 106 106 GLN GLN C . n 
C 1 105 PRO 105 107 107 PRO PRO C . n 
C 1 106 VAL 106 108 108 VAL VAL C . n 
C 1 107 ARG 107 109 ?   ?   ?   C . n 
C 1 108 GLU 108 110 ?   ?   ?   C . n 
C 1 109 PRO 109 111 ?   ?   ?   C . n 
C 1 110 SER 110 112 ?   ?   ?   C . n 
C 1 111 ALA 111 113 ?   ?   ?   C . n 
C 1 112 PRO 112 114 ?   ?   ?   C . n 
C 1 113 LYS 113 115 ?   ?   ?   C . n 
C 1 114 LEU 114 116 ?   ?   ?   C . n 
C 1 115 GLU 115 117 ?   ?   ?   C . n 
C 1 116 GLY 116 118 ?   ?   ?   C . n 
C 1 117 SER 117 119 ?   ?   ?   C . n 
C 1 118 GLY 118 120 ?   ?   ?   C . n 
C 1 119 PRO 119 121 ?   ?   ?   C . n 
C 1 120 SER 120 122 ?   ?   ?   C . n 
C 1 121 SER 121 123 ?   ?   ?   C . n 
C 1 122 GLY 122 124 ?   ?   ?   C . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'NPPSFA, National Project on Protein Structural and Functional Analyses' 
_pdbx_SG_project.full_name_of_center   'RIKEN Structural Genomics/Proteomics Initiative' 
_pdbx_SG_project.initial_of_center     RSGI 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 PEG 1  1004 1004 PEG PEG A . 
E 3 PGE 1  1006 1006 PGE PGE B . 
F 3 PGE 1  1007 1007 PGE PGE B . 
G 4 BTB 1  1009 1009 BTB BTB B . 
H 2 PEG 1  1005 1005 PEG PEG B . 
I 5 EDO 1  1001 1001 EDO EDO C . 
J 4 BTB 1  1008 1008 BTB BTB C . 
K 2 PEG 1  1003 1003 PEG PEG C . 
L 6 HOH 1  1005 1    HOH HOH A . 
L 6 HOH 2  1006 6    HOH HOH A . 
L 6 HOH 3  1007 7    HOH HOH A . 
L 6 HOH 4  1008 9    HOH HOH A . 
L 6 HOH 5  1009 10   HOH HOH A . 
L 6 HOH 6  1010 15   HOH HOH A . 
L 6 HOH 7  1011 17   HOH HOH A . 
L 6 HOH 8  1012 18   HOH HOH A . 
L 6 HOH 9  1013 20   HOH HOH A . 
L 6 HOH 10 1014 21   HOH HOH A . 
L 6 HOH 11 1015 23   HOH HOH A . 
L 6 HOH 12 1016 24   HOH HOH A . 
L 6 HOH 13 1017 25   HOH HOH A . 
L 6 HOH 14 1018 29   HOH HOH A . 
L 6 HOH 15 1019 35   HOH HOH A . 
L 6 HOH 16 1020 36   HOH HOH A . 
L 6 HOH 17 1021 43   HOH HOH A . 
L 6 HOH 18 1022 48   HOH HOH A . 
L 6 HOH 19 1023 50   HOH HOH A . 
L 6 HOH 20 1024 54   HOH HOH A . 
L 6 HOH 21 1025 57   HOH HOH A . 
L 6 HOH 22 1026 59   HOH HOH A . 
L 6 HOH 23 1027 64   HOH HOH A . 
L 6 HOH 24 1028 65   HOH HOH A . 
L 6 HOH 25 1029 68   HOH HOH A . 
L 6 HOH 26 1030 69   HOH HOH A . 
L 6 HOH 27 1031 70   HOH HOH A . 
L 6 HOH 28 1032 72   HOH HOH A . 
L 6 HOH 29 1033 75   HOH HOH A . 
L 6 HOH 30 1034 76   HOH HOH A . 
L 6 HOH 31 1035 79   HOH HOH A . 
L 6 HOH 32 1036 81   HOH HOH A . 
L 6 HOH 33 1037 83   HOH HOH A . 
L 6 HOH 34 1038 84   HOH HOH A . 
L 6 HOH 35 1039 85   HOH HOH A . 
L 6 HOH 36 1040 86   HOH HOH A . 
L 6 HOH 37 1041 88   HOH HOH A . 
L 6 HOH 38 1042 89   HOH HOH A . 
L 6 HOH 39 1043 91   HOH HOH A . 
L 6 HOH 40 1044 96   HOH HOH A . 
L 6 HOH 41 1045 98   HOH HOH A . 
L 6 HOH 42 1046 100  HOH HOH A . 
L 6 HOH 43 1047 102  HOH HOH A . 
L 6 HOH 44 1048 106  HOH HOH A . 
L 6 HOH 45 1049 112  HOH HOH A . 
L 6 HOH 46 1050 113  HOH HOH A . 
L 6 HOH 47 1051 114  HOH HOH A . 
L 6 HOH 48 1052 117  HOH HOH A . 
L 6 HOH 49 1053 122  HOH HOH A . 
L 6 HOH 50 1054 123  HOH HOH A . 
L 6 HOH 51 1055 127  HOH HOH A . 
L 6 HOH 52 1056 131  HOH HOH A . 
L 6 HOH 53 1057 132  HOH HOH A . 
L 6 HOH 54 1058 139  HOH HOH A . 
L 6 HOH 55 1059 143  HOH HOH A . 
L 6 HOH 56 1060 145  HOH HOH A . 
L 6 HOH 57 1061 151  HOH HOH A . 
L 6 HOH 58 1062 152  HOH HOH A . 
L 6 HOH 59 1063 156  HOH HOH A . 
L 6 HOH 60 1064 158  HOH HOH A . 
L 6 HOH 61 1065 159  HOH HOH A . 
L 6 HOH 62 1066 164  HOH HOH A . 
L 6 HOH 63 1067 165  HOH HOH A . 
L 6 HOH 64 1068 166  HOH HOH A . 
L 6 HOH 65 1069 167  HOH HOH A . 
L 6 HOH 66 1070 170  HOH HOH A . 
L 6 HOH 67 1071 171  HOH HOH A . 
L 6 HOH 68 1072 173  HOH HOH A . 
L 6 HOH 69 1073 175  HOH HOH A . 
L 6 HOH 70 1074 176  HOH HOH A . 
L 6 HOH 71 1075 180  HOH HOH A . 
L 6 HOH 72 1076 181  HOH HOH A . 
L 6 HOH 73 1077 182  HOH HOH A . 
L 6 HOH 74 1078 186  HOH HOH A . 
L 6 HOH 75 1079 191  HOH HOH A . 
L 6 HOH 76 1080 193  HOH HOH A . 
L 6 HOH 77 1081 195  HOH HOH A . 
L 6 HOH 78 1082 196  HOH HOH A . 
L 6 HOH 79 1083 197  HOH HOH A . 
L 6 HOH 80 1084 200  HOH HOH A . 
L 6 HOH 81 1085 201  HOH HOH A . 
L 6 HOH 82 1086 202  HOH HOH A . 
L 6 HOH 83 1087 206  HOH HOH A . 
L 6 HOH 84 1088 208  HOH HOH A . 
L 6 HOH 85 1089 215  HOH HOH A . 
L 6 HOH 86 1090 225  HOH HOH A . 
L 6 HOH 87 1091 226  HOH HOH A . 
L 6 HOH 88 1092 227  HOH HOH A . 
L 6 HOH 89 1093 228  HOH HOH A . 
L 6 HOH 90 1094 229  HOH HOH A . 
L 6 HOH 91 1095 230  HOH HOH A . 
L 6 HOH 92 1096 233  HOH HOH A . 
M 6 HOH 1  1010 2    HOH HOH B . 
M 6 HOH 2  1011 4    HOH HOH B . 
M 6 HOH 3  1012 8    HOH HOH B . 
M 6 HOH 4  1013 12   HOH HOH B . 
M 6 HOH 5  1014 13   HOH HOH B . 
M 6 HOH 6  1015 19   HOH HOH B . 
M 6 HOH 7  1016 22   HOH HOH B . 
M 6 HOH 8  1017 27   HOH HOH B . 
M 6 HOH 9  1018 28   HOH HOH B . 
M 6 HOH 10 1019 30   HOH HOH B . 
M 6 HOH 11 1020 31   HOH HOH B . 
M 6 HOH 12 1021 32   HOH HOH B . 
M 6 HOH 13 1022 34   HOH HOH B . 
M 6 HOH 14 1023 37   HOH HOH B . 
M 6 HOH 15 1024 39   HOH HOH B . 
M 6 HOH 16 1025 40   HOH HOH B . 
M 6 HOH 17 1026 42   HOH HOH B . 
M 6 HOH 18 1027 49   HOH HOH B . 
M 6 HOH 19 1028 51   HOH HOH B . 
M 6 HOH 20 1029 52   HOH HOH B . 
M 6 HOH 21 1030 56   HOH HOH B . 
M 6 HOH 22 1031 58   HOH HOH B . 
M 6 HOH 23 1032 60   HOH HOH B . 
M 6 HOH 24 1033 61   HOH HOH B . 
M 6 HOH 25 1034 63   HOH HOH B . 
M 6 HOH 26 1035 66   HOH HOH B . 
M 6 HOH 27 1036 73   HOH HOH B . 
M 6 HOH 28 1037 74   HOH HOH B . 
M 6 HOH 29 1038 77   HOH HOH B . 
M 6 HOH 30 1039 78   HOH HOH B . 
M 6 HOH 31 1040 82   HOH HOH B . 
M 6 HOH 32 1041 87   HOH HOH B . 
M 6 HOH 33 1042 90   HOH HOH B . 
M 6 HOH 34 1043 92   HOH HOH B . 
M 6 HOH 35 1044 93   HOH HOH B . 
M 6 HOH 36 1045 94   HOH HOH B . 
M 6 HOH 37 1046 95   HOH HOH B . 
M 6 HOH 38 1047 97   HOH HOH B . 
M 6 HOH 39 1048 99   HOH HOH B . 
M 6 HOH 40 1049 101  HOH HOH B . 
M 6 HOH 41 1050 103  HOH HOH B . 
M 6 HOH 42 1051 105  HOH HOH B . 
M 6 HOH 43 1052 107  HOH HOH B . 
M 6 HOH 44 1053 108  HOH HOH B . 
M 6 HOH 45 1054 109  HOH HOH B . 
M 6 HOH 46 1055 111  HOH HOH B . 
M 6 HOH 47 1056 119  HOH HOH B . 
M 6 HOH 48 1057 124  HOH HOH B . 
M 6 HOH 49 1058 126  HOH HOH B . 
M 6 HOH 50 1059 128  HOH HOH B . 
M 6 HOH 51 1060 137  HOH HOH B . 
M 6 HOH 52 1061 138  HOH HOH B . 
M 6 HOH 53 1062 141  HOH HOH B . 
M 6 HOH 54 1063 144  HOH HOH B . 
M 6 HOH 55 1064 146  HOH HOH B . 
M 6 HOH 56 1065 149  HOH HOH B . 
M 6 HOH 57 1066 154  HOH HOH B . 
M 6 HOH 58 1067 155  HOH HOH B . 
M 6 HOH 59 1068 157  HOH HOH B . 
M 6 HOH 60 1069 161  HOH HOH B . 
M 6 HOH 61 1070 162  HOH HOH B . 
M 6 HOH 62 1071 163  HOH HOH B . 
M 6 HOH 63 1072 169  HOH HOH B . 
M 6 HOH 64 1073 172  HOH HOH B . 
M 6 HOH 65 1074 174  HOH HOH B . 
M 6 HOH 66 1075 177  HOH HOH B . 
M 6 HOH 67 1076 178  HOH HOH B . 
M 6 HOH 68 1077 179  HOH HOH B . 
M 6 HOH 69 1078 184  HOH HOH B . 
M 6 HOH 70 1079 187  HOH HOH B . 
M 6 HOH 71 1080 189  HOH HOH B . 
M 6 HOH 72 1081 190  HOH HOH B . 
M 6 HOH 73 1082 192  HOH HOH B . 
M 6 HOH 74 1083 198  HOH HOH B . 
M 6 HOH 75 1084 199  HOH HOH B . 
M 6 HOH 76 1085 203  HOH HOH B . 
M 6 HOH 77 1086 209  HOH HOH B . 
M 6 HOH 78 1087 210  HOH HOH B . 
M 6 HOH 79 1088 212  HOH HOH B . 
M 6 HOH 80 1089 221  HOH HOH B . 
M 6 HOH 81 1090 222  HOH HOH B . 
M 6 HOH 82 1091 223  HOH HOH B . 
M 6 HOH 83 1092 231  HOH HOH B . 
M 6 HOH 84 1093 232  HOH HOH B . 
N 6 HOH 1  1009 3    HOH HOH C . 
N 6 HOH 2  1010 5    HOH HOH C . 
N 6 HOH 3  1011 11   HOH HOH C . 
N 6 HOH 4  1012 14   HOH HOH C . 
N 6 HOH 5  1013 16   HOH HOH C . 
N 6 HOH 6  1014 26   HOH HOH C . 
N 6 HOH 7  1015 33   HOH HOH C . 
N 6 HOH 8  1016 38   HOH HOH C . 
N 6 HOH 9  1017 41   HOH HOH C . 
N 6 HOH 10 1018 44   HOH HOH C . 
N 6 HOH 11 1019 45   HOH HOH C . 
N 6 HOH 12 1020 46   HOH HOH C . 
N 6 HOH 13 1021 47   HOH HOH C . 
N 6 HOH 14 1022 53   HOH HOH C . 
N 6 HOH 15 1023 55   HOH HOH C . 
N 6 HOH 16 1024 62   HOH HOH C . 
N 6 HOH 17 1025 67   HOH HOH C . 
N 6 HOH 18 1026 71   HOH HOH C . 
N 6 HOH 19 1027 80   HOH HOH C . 
N 6 HOH 20 1028 104  HOH HOH C . 
N 6 HOH 21 1029 110  HOH HOH C . 
N 6 HOH 22 1030 115  HOH HOH C . 
N 6 HOH 23 1031 116  HOH HOH C . 
N 6 HOH 24 1032 118  HOH HOH C . 
N 6 HOH 25 1033 120  HOH HOH C . 
N 6 HOH 26 1034 121  HOH HOH C . 
N 6 HOH 27 1035 125  HOH HOH C . 
N 6 HOH 28 1036 129  HOH HOH C . 
N 6 HOH 29 1037 130  HOH HOH C . 
N 6 HOH 30 1038 133  HOH HOH C . 
N 6 HOH 31 1039 134  HOH HOH C . 
N 6 HOH 32 1040 135  HOH HOH C . 
N 6 HOH 33 1041 136  HOH HOH C . 
N 6 HOH 34 1042 140  HOH HOH C . 
N 6 HOH 35 1043 142  HOH HOH C . 
N 6 HOH 36 1044 147  HOH HOH C . 
N 6 HOH 37 1045 148  HOH HOH C . 
N 6 HOH 38 1046 150  HOH HOH C . 
N 6 HOH 39 1047 153  HOH HOH C . 
N 6 HOH 40 1048 160  HOH HOH C . 
N 6 HOH 41 1049 168  HOH HOH C . 
N 6 HOH 42 1050 183  HOH HOH C . 
N 6 HOH 43 1051 185  HOH HOH C . 
N 6 HOH 44 1052 188  HOH HOH C . 
N 6 HOH 45 1053 194  HOH HOH C . 
N 6 HOH 46 1054 204  HOH HOH C . 
N 6 HOH 47 1055 205  HOH HOH C . 
N 6 HOH 48 1056 207  HOH HOH C . 
N 6 HOH 49 1057 211  HOH HOH C . 
N 6 HOH 50 1058 213  HOH HOH C . 
N 6 HOH 51 1059 214  HOH HOH C . 
N 6 HOH 52 1060 216  HOH HOH C . 
N 6 HOH 53 1061 217  HOH HOH C . 
N 6 HOH 54 1062 218  HOH HOH C . 
N 6 HOH 55 1063 219  HOH HOH C . 
N 6 HOH 56 1064 220  HOH HOH C . 
N 6 HOH 57 1065 224  HOH HOH C . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 65 A MSE 67 ? MET SELENOMETHIONINE 
2 B MSE 65 B MSE 67 ? MET SELENOMETHIONINE 
3 C MSE 65 C MSE 67 ? MET SELENOMETHIONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
3 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D,L       
2 1 B,E,F,G,H,M 
3 1 C,I,J,K,N   
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-06-05 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1  ? refined 28.5718 18.0786  37.8637 0.0127  -0.1449 -0.1838 -0.1362 -0.0363 0.0119  3.6181  10.0711 3.1365  -1.3895 -0.5656  
1.0933   0.0457  0.1419  0.0590  0.2443  -0.0192 -0.1959 0.1999  -0.1723 -0.0264 'X-RAY DIFFRACTION' 
2  ? refined 34.1770 19.7824  36.9891 -0.0150 -0.1810 -0.1451 -0.1309 -0.0090 0.0043  3.1918  3.6639  2.8774  0.6294  -0.3257  
-1.0899  0.0268  0.1889  0.0609  0.0794  -0.1493 -0.2843 -0.0394 -0.0116 0.1225  'X-RAY DIFFRACTION' 
3  ? refined 32.2905 18.6186  33.3631 -0.0231 -0.2293 -0.2090 -0.1519 0.0321  0.0417  10.3328 6.3691  5.1644  -3.4794 1.8994   
-0.6176  0.5462  0.7140  -0.3843 -0.4084 -0.3636 -0.0801 0.2541  0.0146  -0.1825 'X-RAY DIFFRACTION' 
4  ? refined 16.1951 36.7581  46.4984 0.2878  0.5172  0.4722  0.0029  0.0475  -0.2468 55.5915 11.0937 63.2272 20.7841 -42.3528 
-23.2851 -0.4482 -3.2234 0.2789  1.8685  0.0194  -0.8643 1.3357  -0.6419 0.4288  'X-RAY DIFFRACTION' 
5  ? refined 23.6387 -0.3352  51.1125 -0.0054 -0.1795 -0.0989 -0.1220 0.0911  -0.0187 10.7664 5.0554  7.7303  4.7457  5.8571   
3.1201   -0.3610 0.0257  -0.5226 -0.0957 0.2113  -0.0557 0.1316  -0.0742 0.1497  'X-RAY DIFFRACTION' 
6  ? refined 23.7800 4.9662   48.2389 -0.0558 -0.1677 -0.1398 -0.1384 0.0065  -0.0012 2.1733  4.0162  4.4289  0.0318  -0.0596  
0.4917   -0.1472 -0.0109 -0.2385 -0.2011 0.1342  0.0873  -0.1872 -0.1311 0.0130  'X-RAY DIFFRACTION' 
7  ? refined 21.3190 4.5192   51.6027 -0.0667 -0.2906 -0.1052 -0.0994 0.0289  -0.0091 6.3804  3.6765  13.9734 0.0044  3.8484   
-0.5623  -0.0325 -0.1937 -0.0225 -0.0889 0.0232  0.2031  0.2719  -0.4528 0.0093  'X-RAY DIFFRACTION' 
8  ? refined 21.4930 -21.3212 40.3652 -0.0561 -0.2747 -0.1601 -0.1531 -0.0530 -0.0041 7.8310  7.9446  3.1352  3.8238  -4.6307  
-3.4112  0.1258  -0.0258 -0.0856 -0.3285 0.0396  -0.0339 0.2139  0.1371  -0.1654 'X-RAY DIFFRACTION' 
9  ? refined 23.2638 -16.1831 44.7219 0.0103  -0.2017 -0.1084 -0.1466 0.0127  -0.0012 6.0763  4.5777  3.7631  1.7590  -0.6058  
-0.0324  0.1952  -0.4703 0.1643  0.0856  -0.1187 -0.1089 0.3032  0.1465  -0.0765 'X-RAY DIFFRACTION' 
10 ? refined 26.2114 -19.7932 43.8686 -0.0391 -0.3139 -0.1146 -0.2262 -0.0721 0.0010  11.1033 7.3357  12.9088 -3.3214 -6.7248  
2.5710   0.1788  -0.3623 -0.2377 0.2952  -0.1451 -0.3317 0.3443  0.3659  -0.0337 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1  1  A 8   A 6   A 26  A 24  ? 'X-RAY DIFFRACTION' ? 
2  2  A 27  A 25  A 88  A 86  ? 'X-RAY DIFFRACTION' ? 
3  3  A 89  A 87  A 107 A 105 ? 'X-RAY DIFFRACTION' ? 
4  4  A 108 A 106 A 112 A 110 ? 'X-RAY DIFFRACTION' ? 
5  5  B 8   B 6   B 26  B 24  ? 'X-RAY DIFFRACTION' ? 
6  6  B 27  B 25  B 88  B 86  ? 'X-RAY DIFFRACTION' ? 
7  7  B 89  B 87  B 108 B 106 ? 'X-RAY DIFFRACTION' ? 
8  8  C 8   C 6   C 30  C 28  ? 'X-RAY DIFFRACTION' ? 
9  9  C 31  C 29  C 88  C 86  ? 'X-RAY DIFFRACTION' ? 
10 10 C 89  C 87  C 108 C 106 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.2.0005 ? 1 
HKL-2000  'data collection' .        ? 2 
HKL-2000  'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
SOLVE     phasing           .        ? 5 
# 
_pdbx_entry_details.entry_id             2E3V 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THE RESIDUE IS ARG ACCORDING TO DICKSON G., GOWER H.J., 
BARTON C.H., ET AL. [CELL 50:1119-1130(1987)].
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 21 ? ? -117.27 -156.77 
2 1 ASN A 90 ? ? -125.54 -166.96 
3 1 TYR B 21 ? ? -119.90 -156.68 
4 1 ASN B 90 ? ? -126.66 -165.04 
5 1 TYR C 21 ? ? -112.72 -158.93 
6 1 VAL C 38 ? ? -119.03 79.87   
7 1 ASN C 90 ? ? -125.13 -167.90 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 92   ? CG  ? A LYS 90 CG  
2  1 Y 1 A LYS 92   ? CD  ? A LYS 90 CD  
3  1 Y 1 A LYS 92   ? CE  ? A LYS 90 CE  
4  1 Y 1 A LYS 92   ? NZ  ? A LYS 90 NZ  
5  1 Y 1 A GLU 96   ? CG  ? A GLU 94 CG  
6  1 Y 1 A GLU 96   ? CD  ? A GLU 94 CD  
7  1 Y 1 A GLU 96   ? OE1 ? A GLU 94 OE1 
8  1 Y 1 A GLU 96   ? OE2 ? A GLU 94 OE2 
9  1 Y 1 B LYS 92   ? CG  ? B LYS 90 CG  
10 1 Y 1 B LYS 92   ? CD  ? B LYS 90 CD  
11 1 Y 1 B LYS 92   ? CE  ? B LYS 90 CE  
12 1 Y 1 B LYS 92   ? NZ  ? B LYS 90 NZ  
13 1 Y 1 B GLU 96   ? CG  ? B GLU 94 CG  
14 1 Y 1 B GLU 96   ? CD  ? B GLU 94 CD  
15 1 Y 1 B GLU 96   ? OE1 ? B GLU 94 OE1 
16 1 Y 1 B GLU 96   ? OE2 ? B GLU 94 OE2 
17 1 Y 1 C GLU 79   ? CG  ? C GLU 77 CG  
18 1 Y 1 C GLU 79   ? CD  ? C GLU 77 CD  
19 1 Y 1 C GLU 79   ? OE1 ? C GLU 77 OE1 
20 1 Y 1 C GLU 79   ? OE2 ? C GLU 77 OE2 
21 1 Y 1 C LYS 92   ? CG  ? C LYS 90 CG  
22 1 Y 1 C LYS 92   ? CD  ? C LYS 90 CD  
23 1 Y 1 C LYS 92   ? CE  ? C LYS 90 CE  
24 1 Y 1 C LYS 92   ? NZ  ? C LYS 90 NZ  
25 1 Y 1 C GLU 96   ? CG  ? C GLU 94 CG  
26 1 Y 1 C GLU 96   ? CD  ? C GLU 94 CD  
27 1 Y 1 C GLU 96   ? OE1 ? C GLU 94 OE1 
28 1 Y 1 C GLU 96   ? OE2 ? C GLU 94 OE2 
29 1 N 1 B BTB 1009 ? C1  ? G BTB 1  C1  
30 1 N 1 B BTB 1009 ? O1  ? G BTB 1  O1  
31 1 N 1 B BTB 1009 ? C4  ? G BTB 1  C4  
32 1 N 1 B BTB 1009 ? O4  ? G BTB 1  O4  
33 1 N 1 C BTB 1008 ? C1  ? J BTB 1  C1  
34 1 N 1 C BTB 1008 ? O1  ? J BTB 1  O1  
35 1 N 1 C BTB 1008 ? C4  ? J BTB 1  C4  
36 1 N 1 C BTB 1008 ? O4  ? J BTB 1  O4  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 3   ? A GLY 1   
2  1 Y 1 A SER 4   ? A SER 2   
3  1 Y 1 A SER 5   ? A SER 3   
4  1 Y 1 A GLY 6   ? A GLY 4   
5  1 Y 1 A SER 7   ? A SER 5   
6  1 Y 1 A GLY 36  ? A GLY 34  
7  1 Y 1 A GLY 37  ? A GLY 35  
8  1 Y 1 A ALA 113 ? A ALA 111 
9  1 Y 1 A PRO 114 ? A PRO 112 
10 1 Y 1 A LYS 115 ? A LYS 113 
11 1 Y 1 A LEU 116 ? A LEU 114 
12 1 Y 1 A GLU 117 ? A GLU 115 
13 1 Y 1 A GLY 118 ? A GLY 116 
14 1 Y 1 A SER 119 ? A SER 117 
15 1 Y 1 A GLY 120 ? A GLY 118 
16 1 Y 1 A PRO 121 ? A PRO 119 
17 1 Y 1 A SER 122 ? A SER 120 
18 1 Y 1 A SER 123 ? A SER 121 
19 1 Y 1 A GLY 124 ? A GLY 122 
20 1 Y 1 B GLY 3   ? B GLY 1   
21 1 Y 1 B SER 4   ? B SER 2   
22 1 Y 1 B SER 5   ? B SER 3   
23 1 Y 1 B GLY 6   ? B GLY 4   
24 1 Y 1 B SER 7   ? B SER 5   
25 1 Y 1 B ALA 34  ? B ALA 32  
26 1 Y 1 B THR 35  ? B THR 33  
27 1 Y 1 B GLY 36  ? B GLY 34  
28 1 Y 1 B GLY 37  ? B GLY 35  
29 1 Y 1 B ARG 109 ? B ARG 107 
30 1 Y 1 B GLU 110 ? B GLU 108 
31 1 Y 1 B PRO 111 ? B PRO 109 
32 1 Y 1 B SER 112 ? B SER 110 
33 1 Y 1 B ALA 113 ? B ALA 111 
34 1 Y 1 B PRO 114 ? B PRO 112 
35 1 Y 1 B LYS 115 ? B LYS 113 
36 1 Y 1 B LEU 116 ? B LEU 114 
37 1 Y 1 B GLU 117 ? B GLU 115 
38 1 Y 1 B GLY 118 ? B GLY 116 
39 1 Y 1 B SER 119 ? B SER 117 
40 1 Y 1 B GLY 120 ? B GLY 118 
41 1 Y 1 B PRO 121 ? B PRO 119 
42 1 Y 1 B SER 122 ? B SER 120 
43 1 Y 1 B SER 123 ? B SER 121 
44 1 Y 1 B GLY 124 ? B GLY 122 
45 1 Y 1 C GLY 3   ? C GLY 1   
46 1 Y 1 C SER 4   ? C SER 2   
47 1 Y 1 C SER 5   ? C SER 3   
48 1 Y 1 C GLY 6   ? C GLY 4   
49 1 Y 1 C SER 7   ? C SER 5   
50 1 Y 1 C ARG 109 ? C ARG 107 
51 1 Y 1 C GLU 110 ? C GLU 108 
52 1 Y 1 C PRO 111 ? C PRO 109 
53 1 Y 1 C SER 112 ? C SER 110 
54 1 Y 1 C ALA 113 ? C ALA 111 
55 1 Y 1 C PRO 114 ? C PRO 112 
56 1 Y 1 C LYS 115 ? C LYS 113 
57 1 Y 1 C LEU 116 ? C LEU 114 
58 1 Y 1 C GLU 117 ? C GLU 115 
59 1 Y 1 C GLY 118 ? C GLY 116 
60 1 Y 1 C SER 119 ? C SER 117 
61 1 Y 1 C GLY 120 ? C GLY 118 
62 1 Y 1 C PRO 121 ? C PRO 119 
63 1 Y 1 C SER 122 ? C SER 120 
64 1 Y 1 C SER 123 ? C SER 121 
65 1 Y 1 C GLY 124 ? C GLY 122 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'DI(HYDROXYETHYL)ETHER'                                            PEG 
3 'TRIETHYLENE GLYCOL'                                               PGE 
4 '2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL' BTB 
5 1,2-ETHANEDIOL                                                     EDO 
6 water                                                              HOH 
#