data_2E4H
# 
_entry.id   2E4H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2E4H         
RCSB  RCSB026213   
WWPDB D_1000026213 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2E4H 
_pdbx_database_status.recvd_initial_deposition_date   2006-12-08 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mishima, M.'   1 
'Hakoshima, T.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            104 
_citation.page_first                10346 
_citation.page_last                 10351 
_citation.year                      2007 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17563362 
_citation.pdbx_database_id_DOI      10.1073/pnas.0703876104 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mishima, M.'   1 
primary 'Maesaki, R.'   2 
primary 'Kasa, M.'      3 
primary 'Watanabe, T.'  4 
primary 'Fukata, M.'    5 
primary 'Kaibuchi, K.'  6 
primary 'Hakoshima, T.' 7 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Restin                           10540.216 1 ? ? 'CAP-Gly domain 2, residues 203-300' ? 
2 polymer man 'Tubulin alpha-ubiquitous chain' 4016.046  1 ? ? 'C-tail, residues 416-451'           ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;Cytoplasmic linker protein 170 alpha-2, CLIP-170, Reed-Sternberg intermediate filament-associated protein, Cytoplasmic linker protein 1
;
2 'Alpha-tubulin ubiquitous, Tubulin K-alpha-1, Alpha-tubulin 3' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSIKKGERELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIG
FPSTTPAKAKANAVRRVM
;
;GSIKKGERELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIG
FPSTTPAKAKANAVRRVM
;
A ? 
2 'polypeptide(L)' no no GEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY                                                                  
GEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY                                                                  B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  ILE n 
1 4  LYS n 
1 5  LYS n 
1 6  GLY n 
1 7  GLU n 
1 8  ARG n 
1 9  GLU n 
1 10 LEU n 
1 11 LYS n 
1 12 ILE n 
1 13 GLY n 
1 14 ASP n 
1 15 ARG n 
1 16 VAL n 
1 17 LEU n 
1 18 VAL n 
1 19 GLY n 
1 20 GLY n 
1 21 THR n 
1 22 LYS n 
1 23 ALA n 
1 24 GLY n 
1 25 VAL n 
1 26 VAL n 
1 27 ARG n 
1 28 PHE n 
1 29 LEU n 
1 30 GLY n 
1 31 GLU n 
1 32 THR n 
1 33 ASP n 
1 34 PHE n 
1 35 ALA n 
1 36 LYS n 
1 37 GLY n 
1 38 GLU n 
1 39 TRP n 
1 40 CYS n 
1 41 GLY n 
1 42 VAL n 
1 43 GLU n 
1 44 LEU n 
1 45 ASP n 
1 46 GLU n 
1 47 PRO n 
1 48 LEU n 
1 49 GLY n 
1 50 LYS n 
1 51 ASN n 
1 52 ASP n 
1 53 GLY n 
1 54 ALA n 
1 55 VAL n 
1 56 ALA n 
1 57 GLY n 
1 58 THR n 
1 59 ARG n 
1 60 TYR n 
1 61 PHE n 
1 62 GLN n 
1 63 CYS n 
1 64 GLN n 
1 65 PRO n 
1 66 LYS n 
1 67 TYR n 
1 68 GLY n 
1 69 LEU n 
1 70 PHE n 
1 71 ALA n 
1 72 PRO n 
1 73 VAL n 
1 74 HIS n 
1 75 LYS n 
1 76 VAL n 
1 77 THR n 
1 78 LYS n 
1 79 ILE n 
1 80 GLY n 
1 81 PHE n 
1 82 PRO n 
1 83 SER n 
1 84 THR n 
1 85 THR n 
1 86 PRO n 
1 87 ALA n 
1 88 LYS n 
1 89 ALA n 
1 90 LYS n 
1 91 ALA n 
1 92 ASN n 
1 93 ALA n 
1 94 VAL n 
1 95 ARG n 
1 96 ARG n 
1 97 VAL n 
1 98 MET n 
2 1  GLY n 
2 2  GLU n 
2 3  PHE n 
2 4  SER n 
2 5  GLU n 
2 6  ALA n 
2 7  ARG n 
2 8  GLU n 
2 9  ASP n 
2 10 MET n 
2 11 ALA n 
2 12 ALA n 
2 13 LEU n 
2 14 GLU n 
2 15 LYS n 
2 16 ASP n 
2 17 TYR n 
2 18 GLU n 
2 19 GLU n 
2 20 VAL n 
2 21 GLY n 
2 22 VAL n 
2 23 ASP n 
2 24 SER n 
2 25 VAL n 
2 26 GLU n 
2 27 GLY n 
2 28 GLU n 
2 29 GLY n 
2 30 GLU n 
2 31 GLU n 
2 32 GLU n 
2 33 GLY n 
2 34 GLU n 
2 35 GLU n 
2 36 TYR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo CLIP-170   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 Escherichia 
? ? 'Escherichia coli' ? ? BL21         ? ? ? ? ? ? ? PLASMID ? ? ? pGEX4T ? ? 
2 1 sample ? ? ? human Homo a3-tubulin ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli'      562    Escherichia 
? ? ?                  ? ? 'BL21(Star)' ? ? ? ? ? ? ? PLASMID ? ? ? pGEX6P ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP REST_HUMAN P30622 1 
;GSIKKGERELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIG
FPSTTPAKAKANAVRRVM
;
203 ? 
2 UNP TBAK_HUMAN P68363 2 GEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY                                                                  
416 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2E4H A 1 ? 98 ? P30622 203 ? 300 ? 203 300 
2 2 2E4H B 1 ? 36 ? P68363 416 ? 451 ? 416 451 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_13C-separated_NOESY 1 
2 1 3D_15N-separated_NOESY 2 
3 1 3D_13C-separated_NOESY 3 
4 1 3D_15N-separated_NOESY 4 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.9 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '0.9mM U-15N,13C CLIP: Nonlabel tubulin; 30mM BisTris buffer K; 1mM DTT; 100% D2O'     '100% D2O'        
2 '0.9mM U-15N CLIP: Nonlabel tubulin; 30mM BisTris buffer K; 1mM DTT; 90% H2O, 10% D2O' '90% H2O/10% D2O' 
3 '0.9mM U-15N,13C tubulin: Nonlabel CLIP; 30mM BisTris buffer K; 1mM DTT; 100% D2O'     '100% D2O'        
4 '0.9mM U-15N tubulin: Nonlabel CLIP; 30mM BisTris buffer K; 1mM DTT; 90% H2O, 10% D2O' '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 Avance Bruker 500 ? 
2 DRX    Bruker 800 ? 
# 
_pdbx_nmr_refine.entry_id           2E4H 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2E4H 
_pdbx_nmr_details.text       'Standard heteronuclear NMR technique and NH RDCs' 
# 
_pdbx_nmr_ensemble.entry_id                                      2E4H 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2E4H 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
processing           NMRPipe 2.4    'F. Delaglio'                     1 
'data analysis'      Sparky  3.1.10 'T. D. Goddard and D. G. Kneller' 2 
'structure solution' CYANA   2.1    'P. Guntert'                      3 
refinement           CNS     1.1    ?                                 4 
# 
_exptl.entry_id          2E4H 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2E4H 
_struct.title                     'Solution structure of cytoskeletal protein in complex with tubulin tail' 
_struct.pdbx_descriptor           'Restin, Tubulin alpha-ubiquitous chain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2E4H 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
_struct_keywords.text            'cytoskeleton, CAP-Gly, complex structure, tubulin, solution structure, CLIP, STRUCTURAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 68 ? ALA A 71 ? GLY A 270 ALA A 273 
A 2 TRP A 39 ? LEU A 44 ? TRP A 241 LEU A 246 
A 3 LYS A 22 ? GLY A 30 ? LYS A 224 GLY A 232 
A 4 ARG A 15 ? VAL A 18 ? ARG A 217 VAL A 220 
A 5 THR A 77 ? LYS A 78 ? THR A 279 LYS A 280 
B 1 ALA A 54 ? VAL A 55 ? ALA A 256 VAL A 257 
B 2 THR A 58 ? ARG A 59 ? THR A 260 ARG A 261 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 69 ? O LEU A 271 N VAL A 42 ? N VAL A 244 
A 2 3 O GLY A 41 ? O GLY A 243 N PHE A 28 ? N PHE A 230 
A 3 4 O GLY A 24 ? O GLY A 226 N VAL A 16 ? N VAL A 218 
A 4 5 N LEU A 17 ? N LEU A 219 O THR A 77 ? O THR A 279 
B 1 2 N VAL A 55 ? N VAL A 257 O THR A 58 ? O THR A 260 
# 
_database_PDB_matrix.entry_id          2E4H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2E4H 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ARG A 1 8  ? 14.038  10.006  1.063  1.00 0.00 ? 210 ARG A N    1  
ATOM 2     C CA   . ARG A 1 8  ? 13.875  8.599   0.713  1.00 0.00 ? 210 ARG A CA   1  
ATOM 3     C C    . ARG A 1 8  ? 12.493  8.095   1.111  1.00 0.00 ? 210 ARG A C    1  
ATOM 4     O O    . ARG A 1 8  ? 12.345  7.369   2.096  1.00 0.00 ? 210 ARG A O    1  
ATOM 5     C CB   . ARG A 1 8  ? 14.959  7.756   1.391  1.00 0.00 ? 210 ARG A CB   1  
ATOM 6     C CG   . ARG A 1 8  ? 16.107  7.383   0.468  1.00 0.00 ? 210 ARG A CG   1  
ATOM 7     C CD   . ARG A 1 8  ? 16.899  6.205   1.011  1.00 0.00 ? 210 ARG A CD   1  
ATOM 8     N NE   . ARG A 1 8  ? 17.246  5.248   -0.037 1.00 0.00 ? 210 ARG A NE   1  
ATOM 9     C CZ   . ARG A 1 8  ? 18.247  5.420   -0.897 1.00 0.00 ? 210 ARG A CZ   1  
ATOM 10    N NH1  . ARG A 1 8  ? 19.001  6.511   -0.838 1.00 0.00 ? 210 ARG A NH1  1  
ATOM 11    N NH2  . ARG A 1 8  ? 18.494  4.500   -1.820 1.00 0.00 ? 210 ARG A NH2  1  
ATOM 12    H HA   . ARG A 1 8  ? 13.983  8.511   -0.358 1.00 0.00 ? 210 ARG A HA   1  
ATOM 13    H HB2  . ARG A 1 8  ? 15.362  8.312   2.225  1.00 0.00 ? 210 ARG A HB2  1  
ATOM 14    H HB3  . ARG A 1 8  ? 14.511  6.845   1.760  1.00 0.00 ? 210 ARG A HB3  1  
ATOM 15    H HG2  . ARG A 1 8  ? 15.706  7.118   -0.500 1.00 0.00 ? 210 ARG A HG2  1  
ATOM 16    H HG3  . ARG A 1 8  ? 16.765  8.233   0.367  1.00 0.00 ? 210 ARG A HG3  1  
ATOM 17    H HD2  . ARG A 1 8  ? 17.808  6.577   1.460  1.00 0.00 ? 210 ARG A HD2  1  
ATOM 18    H HD3  . ARG A 1 8  ? 16.306  5.703   1.761  1.00 0.00 ? 210 ARG A HD3  1  
ATOM 19    H HE   . ARG A 1 8  ? 16.704  4.434   -0.104 1.00 0.00 ? 210 ARG A HE   1  
ATOM 20    H HH11 . ARG A 1 8  ? 18.821  7.208   -0.145 1.00 0.00 ? 210 ARG A HH11 1  
ATOM 21    H HH12 . ARG A 1 8  ? 19.753  6.634   -1.487 1.00 0.00 ? 210 ARG A HH12 1  
ATOM 22    H HH21 . ARG A 1 8  ? 17.928  3.677   -1.868 1.00 0.00 ? 210 ARG A HH21 1  
ATOM 23    H HH22 . ARG A 1 8  ? 19.246  4.630   -2.466 1.00 0.00 ? 210 ARG A HH22 1  
ATOM 24    N N    . GLU A 1 9  ? 11.481  8.483   0.342  1.00 0.00 ? 211 GLU A N    1  
ATOM 25    C CA   . GLU A 1 9  ? 10.110  8.070   0.614  1.00 0.00 ? 211 GLU A CA   1  
ATOM 26    C C    . GLU A 1 9  ? 9.916   6.589   0.304  1.00 0.00 ? 211 GLU A C    1  
ATOM 27    O O    . GLU A 1 9  ? 10.883  5.861   0.074  1.00 0.00 ? 211 GLU A O    1  
ATOM 28    C CB   . GLU A 1 9  ? 9.131   8.909   -0.207 1.00 0.00 ? 211 GLU A CB   1  
ATOM 29    C CG   . GLU A 1 9  ? 9.388   10.404  -0.119 1.00 0.00 ? 211 GLU A CG   1  
ATOM 30    C CD   . GLU A 1 9  ? 8.389   11.118  0.770  1.00 0.00 ? 211 GLU A CD   1  
ATOM 31    O OE1  . GLU A 1 9  ? 7.183   11.091  0.447  1.00 0.00 ? 211 GLU A OE1  1  
ATOM 32    O OE2  . GLU A 1 9  ? 8.812   11.702  1.790  1.00 0.00 ? 211 GLU A OE2  1  
ATOM 33    H H    . GLU A 1 9  ? 11.662  9.061   -0.428 1.00 0.00 ? 211 GLU A H    1  
ATOM 34    H HA   . GLU A 1 9  ? 9.917   8.232   1.664  1.00 0.00 ? 211 GLU A HA   1  
ATOM 35    H HB2  . GLU A 1 9  ? 9.202   8.613   -1.243 1.00 0.00 ? 211 GLU A HB2  1  
ATOM 36    H HB3  . GLU A 1 9  ? 8.127   8.718   0.144  1.00 0.00 ? 211 GLU A HB3  1  
ATOM 37    H HG2  . GLU A 1 9  ? 10.380  10.562  0.280  1.00 0.00 ? 211 GLU A HG2  1  
ATOM 38    H HG3  . GLU A 1 9  ? 9.330   10.826  -1.113 1.00 0.00 ? 211 GLU A HG3  1  
ATOM 39    N N    . LEU A 1 10 ? 8.663   6.149   0.297  1.00 0.00 ? 212 LEU A N    1  
ATOM 40    C CA   . LEU A 1 10 ? 8.344   4.754   0.013  1.00 0.00 ? 212 LEU A CA   1  
ATOM 41    C C    . LEU A 1 10 ? 7.785   4.600   -1.397 1.00 0.00 ? 212 LEU A C    1  
ATOM 42    O O    . LEU A 1 10 ? 7.163   5.518   -1.934 1.00 0.00 ? 212 LEU A O    1  
ATOM 43    C CB   . LEU A 1 10 ? 7.337   4.221   1.034  1.00 0.00 ? 212 LEU A CB   1  
ATOM 44    C CG   . LEU A 1 10 ? 7.894   4.005   2.442  1.00 0.00 ? 212 LEU A CG   1  
ATOM 45    C CD1  . LEU A 1 10 ? 6.783   3.605   3.401  1.00 0.00 ? 212 LEU A CD1  1  
ATOM 46    C CD2  . LEU A 1 10 ? 8.992   2.952   2.425  1.00 0.00 ? 212 LEU A CD2  1  
ATOM 47    H H    . LEU A 1 10 ? 7.935   6.777   0.486  1.00 0.00 ? 212 LEU A H    1  
ATOM 48    H HA   . LEU A 1 10 ? 9.257   4.183   0.089  1.00 0.00 ? 212 LEU A HA   1  
ATOM 49    H HB2  . LEU A 1 10 ? 6.516   4.920   1.097  1.00 0.00 ? 212 LEU A HB2  1  
ATOM 50    H HB3  . LEU A 1 10 ? 6.956   3.277   0.673  1.00 0.00 ? 212 LEU A HB3  1  
ATOM 51    H HG   . LEU A 1 10 ? 8.322   4.931   2.799  1.00 0.00 ? 212 LEU A HG   1  
ATOM 52    H HD11 . LEU A 1 10 ? 6.144   4.455   3.588  1.00 0.00 ? 212 LEU A HD11 1  
ATOM 53    H HD12 . LEU A 1 10 ? 6.201   2.806   2.963  1.00 0.00 ? 212 LEU A HD12 1  
ATOM 54    H HD13 . LEU A 1 10 ? 7.215   3.266   4.331  1.00 0.00 ? 212 LEU A HD13 1  
ATOM 55    H HD21 . LEU A 1 10 ? 9.930   3.414   2.153  1.00 0.00 ? 212 LEU A HD21 1  
ATOM 56    H HD22 . LEU A 1 10 ? 9.080   2.507   3.405  1.00 0.00 ? 212 LEU A HD22 1  
ATOM 57    H HD23 . LEU A 1 10 ? 8.745   2.187   1.703  1.00 0.00 ? 212 LEU A HD23 1  
ATOM 58    N N    . LYS A 1 11 ? 8.011   3.434   -1.994 1.00 0.00 ? 213 LYS A N    1  
ATOM 59    C CA   . LYS A 1 11 ? 7.530   3.162   -3.344 1.00 0.00 ? 213 LYS A CA   1  
ATOM 60    C C    . LYS A 1 11 ? 6.728   1.865   -3.385 1.00 0.00 ? 213 LYS A C    1  
ATOM 61    O O    . LYS A 1 11 ? 7.039   0.908   -2.673 1.00 0.00 ? 213 LYS A O    1  
ATOM 62    C CB   . LYS A 1 11 ? 8.707   3.078   -4.320 1.00 0.00 ? 213 LYS A CB   1  
ATOM 63    C CG   . LYS A 1 11 ? 9.731   4.187   -4.137 1.00 0.00 ? 213 LYS A CG   1  
ATOM 64    C CD   . LYS A 1 11 ? 10.968  3.690   -3.405 1.00 0.00 ? 213 LYS A CD   1  
ATOM 65    C CE   . LYS A 1 11 ? 12.019  3.174   -4.375 1.00 0.00 ? 213 LYS A CE   1  
ATOM 66    N NZ   . LYS A 1 11 ? 13.086  4.182   -4.623 1.00 0.00 ? 213 LYS A NZ   1  
ATOM 67    H H    . LYS A 1 11 ? 8.513   2.741   -1.517 1.00 0.00 ? 213 LYS A H    1  
ATOM 68    H HA   . LYS A 1 11 ? 6.888   3.977   -3.639 1.00 0.00 ? 213 LYS A HA   1  
ATOM 69    H HB2  . LYS A 1 11 ? 9.204   2.129   -4.184 1.00 0.00 ? 213 LYS A HB2  1  
ATOM 70    H HB3  . LYS A 1 11 ? 8.326   3.132   -5.329 1.00 0.00 ? 213 LYS A HB3  1  
ATOM 71    H HG2  . LYS A 1 11 ? 10.023  4.555   -5.107 1.00 0.00 ? 213 LYS A HG2  1  
ATOM 72    H HG3  . LYS A 1 11 ? 9.281   4.986   -3.566 1.00 0.00 ? 213 LYS A HG3  1  
ATOM 73    H HD2  . LYS A 1 11 ? 11.387  4.505   -2.835 1.00 0.00 ? 213 LYS A HD2  1  
ATOM 74    H HD3  . LYS A 1 11 ? 10.681  2.891   -2.738 1.00 0.00 ? 213 LYS A HD3  1  
ATOM 75    H HE2  . LYS A 1 11 ? 12.466  2.284   -3.960 1.00 0.00 ? 213 LYS A HE2  1  
ATOM 76    H HE3  . LYS A 1 11 ? 11.538  2.933   -5.311 1.00 0.00 ? 213 LYS A HE3  1  
ATOM 77    H HZ1  . LYS A 1 11 ? 13.209  4.786   -3.785 1.00 0.00 ? 213 LYS A HZ1  1  
ATOM 78    H HZ2  . LYS A 1 11 ? 12.830  4.781   -5.434 1.00 0.00 ? 213 LYS A HZ2  1  
ATOM 79    H HZ3  . LYS A 1 11 ? 13.987  3.706   -4.829 1.00 0.00 ? 213 LYS A HZ3  1  
ATOM 80    N N    . ILE A 1 12 ? 5.697   1.840   -4.222 1.00 0.00 ? 214 ILE A N    1  
ATOM 81    C CA   . ILE A 1 12 ? 4.849   0.661   -4.357 1.00 0.00 ? 214 ILE A CA   1  
ATOM 82    C C    . ILE A 1 12 ? 5.668   -0.553  -4.786 1.00 0.00 ? 214 ILE A C    1  
ATOM 83    O O    . ILE A 1 12 ? 6.562   -0.448  -5.626 1.00 0.00 ? 214 ILE A O    1  
ATOM 84    C CB   . ILE A 1 12 ? 3.716   0.901   -5.375 1.00 0.00 ? 214 ILE A CB   1  
ATOM 85    C CG1  . ILE A 1 12 ? 2.876   2.109   -4.954 1.00 0.00 ? 214 ILE A CG1  1  
ATOM 86    C CG2  . ILE A 1 12 ? 2.839   -0.337  -5.508 1.00 0.00 ? 214 ILE A CG2  1  
ATOM 87    C CD1  . ILE A 1 12 ? 2.429   2.969   -6.115 1.00 0.00 ? 214 ILE A CD1  1  
ATOM 88    H H    . ILE A 1 12 ? 5.500   2.633   -4.763 1.00 0.00 ? 214 ILE A H    1  
ATOM 89    H HA   . ILE A 1 12 ? 4.403   0.459   -3.393 1.00 0.00 ? 214 ILE A HA   1  
ATOM 90    H HB   . ILE A 1 12 ? 4.161   1.101   -6.336 1.00 0.00 ? 214 ILE A HB   1  
ATOM 91    H HG12 . ILE A 1 12 ? 1.992   1.764   -4.439 1.00 0.00 ? 214 ILE A HG12 1  
ATOM 92    H HG13 . ILE A 1 12 ? 3.457   2.728   -4.286 1.00 0.00 ? 214 ILE A HG13 1  
ATOM 93    H HG21 . ILE A 1 12 ? 2.892   -0.915  -4.598 1.00 0.00 ? 214 ILE A HG21 1  
ATOM 94    H HG22 . ILE A 1 12 ? 1.817   -0.036  -5.684 1.00 0.00 ? 214 ILE A HG22 1  
ATOM 95    H HG23 . ILE A 1 12 ? 3.186   -0.937  -6.335 1.00 0.00 ? 214 ILE A HG23 1  
ATOM 96    H HD11 . ILE A 1 12 ? 2.274   3.982   -5.774 1.00 0.00 ? 214 ILE A HD11 1  
ATOM 97    H HD12 . ILE A 1 12 ? 3.189   2.961   -6.882 1.00 0.00 ? 214 ILE A HD12 1  
ATOM 98    H HD13 . ILE A 1 12 ? 1.506   2.579   -6.517 1.00 0.00 ? 214 ILE A HD13 1  
ATOM 99    N N    . GLY A 1 13 ? 5.357   -1.707  -4.202 1.00 0.00 ? 215 GLY A N    1  
ATOM 100   C CA   . GLY A 1 13 ? 6.074   -2.924  -4.532 1.00 0.00 ? 215 GLY A CA   1  
ATOM 101   C C    . GLY A 1 13 ? 7.303   -3.133  -3.664 1.00 0.00 ? 215 GLY A C    1  
ATOM 102   O O    . GLY A 1 13 ? 8.002   -4.135  -3.804 1.00 0.00 ? 215 GLY A O    1  
ATOM 103   H H    . GLY A 1 13 ? 4.637   -1.730  -3.538 1.00 0.00 ? 215 GLY A H    1  
ATOM 104   H HA2  . GLY A 1 13 ? 5.410   -3.766  -4.404 1.00 0.00 ? 215 GLY A HA2  1  
ATOM 105   H HA3  . GLY A 1 13 ? 6.382   -2.877  -5.566 1.00 0.00 ? 215 GLY A HA3  1  
ATOM 106   N N    . ASP A 1 14 ? 7.568   -2.185  -2.767 1.00 0.00 ? 216 ASP A N    1  
ATOM 107   C CA   . ASP A 1 14 ? 8.722   -2.274  -1.880 1.00 0.00 ? 216 ASP A CA   1  
ATOM 108   C C    . ASP A 1 14 ? 8.341   -2.903  -0.545 1.00 0.00 ? 216 ASP A C    1  
ATOM 109   O O    . ASP A 1 14 ? 7.240   -2.690  -0.037 1.00 0.00 ? 216 ASP A O    1  
ATOM 110   C CB   . ASP A 1 14 ? 9.321   -0.886  -1.650 1.00 0.00 ? 216 ASP A CB   1  
ATOM 111   C CG   . ASP A 1 14 ? 10.035  -0.354  -2.876 1.00 0.00 ? 216 ASP A CG   1  
ATOM 112   O OD1  . ASP A 1 14 ? 9.391   -0.251  -3.942 1.00 0.00 ? 216 ASP A OD1  1  
ATOM 113   O OD2  . ASP A 1 14 ? 11.241  -0.041  -2.773 1.00 0.00 ? 216 ASP A OD2  1  
ATOM 114   H H    . ASP A 1 14 ? 6.976   -1.407  -2.702 1.00 0.00 ? 216 ASP A H    1  
ATOM 115   H HA   . ASP A 1 14 ? 9.459   -2.898  -2.357 1.00 0.00 ? 216 ASP A HA   1  
ATOM 116   H HB2  . ASP A 1 14 ? 8.530   -0.197  -1.390 1.00 0.00 ? 216 ASP A HB2  1  
ATOM 117   H HB3  . ASP A 1 14 ? 10.028  -0.936  -0.836 1.00 0.00 ? 216 ASP A HB3  1  
ATOM 118   N N    . ARG A 1 15 ? 9.264   -3.674  0.024  1.00 0.00 ? 217 ARG A N    1  
ATOM 119   C CA   . ARG A 1 15 ? 9.029   -4.329  1.304  1.00 0.00 ? 217 ARG A CA   1  
ATOM 120   C C    . ARG A 1 15 ? 9.158   -3.327  2.444  1.00 0.00 ? 217 ARG A C    1  
ATOM 121   O O    . ARG A 1 15 ? 10.128  -2.572  2.511  1.00 0.00 ? 217 ARG A O    1  
ATOM 122   C CB   . ARG A 1 15 ? 10.016  -5.479  1.507  1.00 0.00 ? 217 ARG A CB   1  
ATOM 123   C CG   . ARG A 1 15 ? 9.434   -6.647  2.285  1.00 0.00 ? 217 ARG A CG   1  
ATOM 124   C CD   . ARG A 1 15 ? 8.587   -7.542  1.394  1.00 0.00 ? 217 ARG A CD   1  
ATOM 125   N NE   . ARG A 1 15 ? 9.396   -8.240  0.396  1.00 0.00 ? 217 ARG A NE   1  
ATOM 126   C CZ   . ARG A 1 15 ? 9.610   -7.793  -0.841 1.00 0.00 ? 217 ARG A CZ   1  
ATOM 127   N NH1  . ARG A 1 15 ? 9.098   -6.633  -1.237 1.00 0.00 ? 217 ARG A NH1  1  
ATOM 128   N NH2  . ARG A 1 15 ? 10.348  -8.503  -1.681 1.00 0.00 ? 217 ARG A NH2  1  
ATOM 129   H H    . ARG A 1 15 ? 10.124  -3.801  -0.427 1.00 0.00 ? 217 ARG A H    1  
ATOM 130   H HA   . ARG A 1 15 ? 8.022   -4.722  1.299  1.00 0.00 ? 217 ARG A HA   1  
ATOM 131   H HB2  . ARG A 1 15 ? 10.334  -5.840  0.541  1.00 0.00 ? 217 ARG A HB2  1  
ATOM 132   H HB3  . ARG A 1 15 ? 10.876  -5.110  2.044  1.00 0.00 ? 217 ARG A HB3  1  
ATOM 133   H HG2  . ARG A 1 15 ? 10.241  -7.230  2.699  1.00 0.00 ? 217 ARG A HG2  1  
ATOM 134   H HG3  . ARG A 1 15 ? 8.816   -6.262  3.083  1.00 0.00 ? 217 ARG A HG3  1  
ATOM 135   H HD2  . ARG A 1 15 ? 8.088   -8.274  2.013  1.00 0.00 ? 217 ARG A HD2  1  
ATOM 136   H HD3  . ARG A 1 15 ? 7.849   -6.936  0.890  1.00 0.00 ? 217 ARG A HD3  1  
ATOM 137   H HE   . ARG A 1 15 ? 9.797   -9.093  0.661  1.00 0.00 ? 217 ARG A HE   1  
ATOM 138   H HH11 . ARG A 1 15 ? 8.548   -6.086  -0.609 1.00 0.00 ? 217 ARG A HH11 1  
ATOM 139   H HH12 . ARG A 1 15 ? 9.265   -6.307  -2.168 1.00 0.00 ? 217 ARG A HH12 1  
ATOM 140   H HH21 . ARG A 1 15 ? 10.743  -9.374  -1.387 1.00 0.00 ? 217 ARG A HH21 1  
ATOM 141   H HH22 . ARG A 1 15 ? 10.511  -8.169  -2.609 1.00 0.00 ? 217 ARG A HH22 1  
ATOM 142   N N    . VAL A 1 16 ? 8.172   -3.318  3.332  1.00 0.00 ? 218 VAL A N    1  
ATOM 143   C CA   . VAL A 1 16 ? 8.179   -2.396  4.458  1.00 0.00 ? 218 VAL A CA   1  
ATOM 144   C C    . VAL A 1 16 ? 7.437   -2.971  5.657  1.00 0.00 ? 218 VAL A C    1  
ATOM 145   O O    . VAL A 1 16 ? 6.966   -4.108  5.627  1.00 0.00 ? 218 VAL A O    1  
ATOM 146   C CB   . VAL A 1 16 ? 7.531   -1.050  4.076  1.00 0.00 ? 218 VAL A CB   1  
ATOM 147   C CG1  . VAL A 1 16 ? 8.165   -0.491  2.810  1.00 0.00 ? 218 VAL A CG1  1  
ATOM 148   C CG2  . VAL A 1 16 ? 6.026   -1.209  3.901  1.00 0.00 ? 218 VAL A CG2  1  
ATOM 149   H H    . VAL A 1 16 ? 7.422   -3.937  3.222  1.00 0.00 ? 218 VAL A H    1  
ATOM 150   H HA   . VAL A 1 16 ? 9.207   -2.210  4.734  1.00 0.00 ? 218 VAL A HA   1  
ATOM 151   H HB   . VAL A 1 16 ? 7.707   -0.349  4.879  1.00 0.00 ? 218 VAL A HB   1  
ATOM 152   H HG11 . VAL A 1 16 ? 7.997   -1.174  1.991  1.00 0.00 ? 218 VAL A HG11 1  
ATOM 153   H HG12 . VAL A 1 16 ? 7.720   0.466   2.578  1.00 0.00 ? 218 VAL A HG12 1  
ATOM 154   H HG13 . VAL A 1 16 ? 9.227   -0.366  2.963  1.00 0.00 ? 218 VAL A HG13 1  
ATOM 155   H HG21 . VAL A 1 16 ? 5.628   -0.342  3.395  1.00 0.00 ? 218 VAL A HG21 1  
ATOM 156   H HG22 . VAL A 1 16 ? 5.820   -2.093  3.318  1.00 0.00 ? 218 VAL A HG22 1  
ATOM 157   H HG23 . VAL A 1 16 ? 5.560   -1.303  4.872  1.00 0.00 ? 218 VAL A HG23 1  
ATOM 158   N N    . LEU A 1 17 ? 7.323   -2.162  6.705  1.00 0.00 ? 219 LEU A N    1  
ATOM 159   C CA   . LEU A 1 17 ? 6.621   -2.568  7.912  1.00 0.00 ? 219 LEU A CA   1  
ATOM 160   C C    . LEU A 1 17 ? 5.513   -1.579  8.234  1.00 0.00 ? 219 LEU A C    1  
ATOM 161   O O    . LEU A 1 17 ? 5.769   -0.393  8.427  1.00 0.00 ? 219 LEU A O    1  
ATOM 162   C CB   . LEU A 1 17 ? 7.580   -2.656  9.099  1.00 0.00 ? 219 LEU A CB   1  
ATOM 163   C CG   . LEU A 1 17 ? 8.690   -3.700  8.977  1.00 0.00 ? 219 LEU A CG   1  
ATOM 164   C CD1  . LEU A 1 17 ? 9.402   -3.870  10.311 1.00 0.00 ? 219 LEU A CD1  1  
ATOM 165   C CD2  . LEU A 1 17 ? 8.127   -5.030  8.498  1.00 0.00 ? 219 LEU A CD2  1  
ATOM 166   H H    . LEU A 1 17 ? 7.709   -1.264  6.657  1.00 0.00 ? 219 LEU A H    1  
ATOM 167   H HA   . LEU A 1 17 ? 6.185   -3.539  7.736  1.00 0.00 ? 219 LEU A HA   1  
ATOM 168   H HB2  . LEU A 1 17 ? 8.039   -1.687  9.234  1.00 0.00 ? 219 LEU A HB2  1  
ATOM 169   H HB3  . LEU A 1 17 ? 6.999   -2.883  9.981  1.00 0.00 ? 219 LEU A HB3  1  
ATOM 170   H HG   . LEU A 1 17 ? 9.416   -3.360  8.253  1.00 0.00 ? 219 LEU A HG   1  
ATOM 171   H HD11 . LEU A 1 17 ? 8.725   -3.611  11.113 1.00 0.00 ? 219 LEU A HD11 1  
ATOM 172   H HD12 . LEU A 1 17 ? 9.718   -4.896  10.423 1.00 0.00 ? 219 LEU A HD12 1  
ATOM 173   H HD13 . LEU A 1 17 ? 10.264  -3.220  10.344 1.00 0.00 ? 219 LEU A HD13 1  
ATOM 174   H HD21 . LEU A 1 17 ? 7.213   -5.246  9.030  1.00 0.00 ? 219 LEU A HD21 1  
ATOM 175   H HD22 . LEU A 1 17 ? 7.921   -4.972  7.438  1.00 0.00 ? 219 LEU A HD22 1  
ATOM 176   H HD23 . LEU A 1 17 ? 8.846   -5.813  8.682  1.00 0.00 ? 219 LEU A HD23 1  
ATOM 177   N N    . VAL A 1 18 ? 4.286   -2.070  8.302  1.00 0.00 ? 220 VAL A N    1  
ATOM 178   C CA   . VAL A 1 18 ? 3.148   -1.215  8.614  1.00 0.00 ? 220 VAL A CA   1  
ATOM 179   C C    . VAL A 1 18 ? 2.939   -1.150  10.122 1.00 0.00 ? 220 VAL A C    1  
ATOM 180   O O    . VAL A 1 18 ? 2.592   -2.148  10.757 1.00 0.00 ? 220 VAL A O    1  
ATOM 181   C CB   . VAL A 1 18 ? 1.843   -1.689  7.925  1.00 0.00 ? 220 VAL A CB   1  
ATOM 182   C CG1  . VAL A 1 18 ? 1.232   -0.563  7.106  1.00 0.00 ? 220 VAL A CG1  1  
ATOM 183   C CG2  . VAL A 1 18 ? 2.091   -2.912  7.053  1.00 0.00 ? 220 VAL A CG2  1  
ATOM 184   H H    . VAL A 1 18 ? 4.145   -3.027  8.149  1.00 0.00 ? 220 VAL A H    1  
ATOM 185   H HA   . VAL A 1 18 ? 3.378   -0.221  8.256  1.00 0.00 ? 220 VAL A HA   1  
ATOM 186   H HB   . VAL A 1 18 ? 1.135   -1.961  8.691  1.00 0.00 ? 220 VAL A HB   1  
ATOM 187   H HG11 . VAL A 1 18 ? 1.994   0.167   6.872  1.00 0.00 ? 220 VAL A HG11 1  
ATOM 188   H HG12 . VAL A 1 18 ? 0.825   -0.963  6.189  1.00 0.00 ? 220 VAL A HG12 1  
ATOM 189   H HG13 . VAL A 1 18 ? 0.444   -0.091  7.675  1.00 0.00 ? 220 VAL A HG13 1  
ATOM 190   H HG21 . VAL A 1 18 ? 2.902   -2.707  6.368  1.00 0.00 ? 220 VAL A HG21 1  
ATOM 191   H HG22 . VAL A 1 18 ? 2.352   -3.753  7.677  1.00 0.00 ? 220 VAL A HG22 1  
ATOM 192   H HG23 . VAL A 1 18 ? 1.197   -3.143  6.493  1.00 0.00 ? 220 VAL A HG23 1  
ATOM 193   N N    . GLY A 1 19 ? 3.176   0.027   10.691 1.00 0.00 ? 221 GLY A N    1  
ATOM 194   C CA   . GLY A 1 19 ? 3.028   0.203   12.125 1.00 0.00 ? 221 GLY A CA   1  
ATOM 195   C C    . GLY A 1 19 ? 4.293   -0.163  12.885 1.00 0.00 ? 221 GLY A C    1  
ATOM 196   O O    . GLY A 1 19 ? 4.375   0.042   14.096 1.00 0.00 ? 221 GLY A O    1  
ATOM 197   H H    . GLY A 1 19 ? 3.464   0.780   10.136 1.00 0.00 ? 221 GLY A H    1  
ATOM 198   H HA2  . GLY A 1 19 ? 2.786   1.234   12.326 1.00 0.00 ? 221 GLY A HA2  1  
ATOM 199   H HA3  . GLY A 1 19 ? 2.219   -0.423  12.472 1.00 0.00 ? 221 GLY A HA3  1  
ATOM 200   N N    . GLY A 1 20 ? 5.282   -0.705  12.174 1.00 0.00 ? 222 GLY A N    1  
ATOM 201   C CA   . GLY A 1 20 ? 6.533   -1.089  12.805 1.00 0.00 ? 222 GLY A CA   1  
ATOM 202   C C    . GLY A 1 20 ? 6.523   -2.520  13.305 1.00 0.00 ? 222 GLY A C    1  
ATOM 203   O O    . GLY A 1 20 ? 7.574   -3.153  13.413 1.00 0.00 ? 222 GLY A O    1  
ATOM 204   H H    . GLY A 1 20 ? 5.162   -0.844  11.212 1.00 0.00 ? 222 GLY A H    1  
ATOM 205   H HA2  . GLY A 1 20 ? 7.331   -0.979  12.086 1.00 0.00 ? 222 GLY A HA2  1  
ATOM 206   H HA3  . GLY A 1 20 ? 6.721   -0.430  13.637 1.00 0.00 ? 222 GLY A HA3  1  
ATOM 207   N N    . THR A 1 21 ? 5.337   -3.032  13.611 1.00 0.00 ? 223 THR A N    1  
ATOM 208   C CA   . THR A 1 21 ? 5.199   -4.396  14.103 1.00 0.00 ? 223 THR A CA   1  
ATOM 209   C C    . THR A 1 21 ? 4.758   -5.335  12.989 1.00 0.00 ? 223 THR A C    1  
ATOM 210   O O    . THR A 1 21 ? 5.053   -6.530  13.018 1.00 0.00 ? 223 THR A O    1  
ATOM 211   C CB   . THR A 1 21 ? 4.192   -4.437  15.252 1.00 0.00 ? 223 THR A CB   1  
ATOM 212   O OG1  . THR A 1 21 ? 2.987   -3.789  14.887 1.00 0.00 ? 223 THR A OG1  1  
ATOM 213   C CG2  . THR A 1 21 ? 4.703   -3.780  16.515 1.00 0.00 ? 223 THR A CG2  1  
ATOM 214   H H    . THR A 1 21 ? 4.536   -2.481  13.506 1.00 0.00 ? 223 THR A H    1  
ATOM 215   H HA   . THR A 1 21 ? 6.163   -4.715  14.470 1.00 0.00 ? 223 THR A HA   1  
ATOM 216   H HB   . THR A 1 21 ? 3.966   -5.469  15.483 1.00 0.00 ? 223 THR A HB   1  
ATOM 217   H HG1  . THR A 1 21 ? 2.362   -4.437  14.557 1.00 0.00 ? 223 THR A HG1  1  
ATOM 218   H HG21 . THR A 1 21 ? 4.428   -2.735  16.513 1.00 0.00 ? 223 THR A HG21 1  
ATOM 219   H HG22 . THR A 1 21 ? 5.781   -3.866  16.554 1.00 0.00 ? 223 THR A HG22 1  
ATOM 220   H HG23 . THR A 1 21 ? 4.272   -4.266  17.376 1.00 0.00 ? 223 THR A HG23 1  
ATOM 221   N N    . LYS A 1 22 ? 4.046   -4.789  12.009 1.00 0.00 ? 224 LYS A N    1  
ATOM 222   C CA   . LYS A 1 22 ? 3.560   -5.582  10.887 1.00 0.00 ? 224 LYS A CA   1  
ATOM 223   C C    . LYS A 1 22 ? 4.460   -5.402  9.670  1.00 0.00 ? 224 LYS A C    1  
ATOM 224   O O    . LYS A 1 22 ? 5.051   -4.341  9.476  1.00 0.00 ? 224 LYS A O    1  
ATOM 225   C CB   . LYS A 1 22 ? 2.124   -5.186  10.536 1.00 0.00 ? 224 LYS A CB   1  
ATOM 226   C CG   . LYS A 1 22 ? 1.256   -4.870  11.745 1.00 0.00 ? 224 LYS A CG   1  
ATOM 227   C CD   . LYS A 1 22 ? 0.685   -6.135  12.367 1.00 0.00 ? 224 LYS A CD   1  
ATOM 228   C CE   . LYS A 1 22 ? 1.764   -6.949  13.061 1.00 0.00 ? 224 LYS A CE   1  
ATOM 229   N NZ   . LYS A 1 22 ? 1.220   -7.738  14.200 1.00 0.00 ? 224 LYS A NZ   1  
ATOM 230   H H    . LYS A 1 22 ? 3.839   -3.832  12.043 1.00 0.00 ? 224 LYS A H    1  
ATOM 231   H HA   . LYS A 1 22 ? 3.577   -6.620  11.182 1.00 0.00 ? 224 LYS A HA   1  
ATOM 232   H HB2  . LYS A 1 22 ? 2.151   -4.312  9.903  1.00 0.00 ? 224 LYS A HB2  1  
ATOM 233   H HB3  . LYS A 1 22 ? 1.665   -5.997  9.992  1.00 0.00 ? 224 LYS A HB3  1  
ATOM 234   H HG2  . LYS A 1 22 ? 1.852   -4.357  12.484 1.00 0.00 ? 224 LYS A HG2  1  
ATOM 235   H HG3  . LYS A 1 22 ? 0.440   -4.235  11.434 1.00 0.00 ? 224 LYS A HG3  1  
ATOM 236   H HD2  . LYS A 1 22 ? -0.067  -5.859  13.092 1.00 0.00 ? 224 LYS A HD2  1  
ATOM 237   H HD3  . LYS A 1 22 ? 0.236   -6.735  11.592 1.00 0.00 ? 224 LYS A HD3  1  
ATOM 238   H HE2  . LYS A 1 22 ? 2.204   -7.625  12.343 1.00 0.00 ? 224 LYS A HE2  1  
ATOM 239   H HE3  . LYS A 1 22 ? 2.522   -6.274  13.430 1.00 0.00 ? 224 LYS A HE3  1  
ATOM 240   H HZ1  . LYS A 1 22 ? 0.188   -7.846  14.102 1.00 0.00 ? 224 LYS A HZ1  1  
ATOM 241   H HZ2  . LYS A 1 22 ? 1.422   -7.255  15.099 1.00 0.00 ? 224 LYS A HZ2  1  
ATOM 242   H HZ3  . LYS A 1 22 ? 1.654   -8.682  14.222 1.00 0.00 ? 224 LYS A HZ3  1  
ATOM 243   N N    . ALA A 1 23 ? 4.561   -6.445  8.852  1.00 0.00 ? 225 ALA A N    1  
ATOM 244   C CA   . ALA A 1 23 ? 5.390   -6.396  7.652  1.00 0.00 ? 225 ALA A CA   1  
ATOM 245   C C    . ALA A 1 23 ? 4.554   -6.620  6.401  1.00 0.00 ? 225 ALA A C    1  
ATOM 246   O O    . ALA A 1 23 ? 3.609   -7.409  6.407  1.00 0.00 ? 225 ALA A O    1  
ATOM 247   C CB   . ALA A 1 23 ? 6.501   -7.430  7.729  1.00 0.00 ? 225 ALA A CB   1  
ATOM 248   H H    . ALA A 1 23 ? 4.066   -7.264  9.058  1.00 0.00 ? 225 ALA A H    1  
ATOM 249   H HA   . ALA A 1 23 ? 5.842   -5.419  7.599  1.00 0.00 ? 225 ALA A HA   1  
ATOM 250   H HB1  . ALA A 1 23 ? 7.177   -7.291  6.899  1.00 0.00 ? 225 ALA A HB1  1  
ATOM 251   H HB2  . ALA A 1 23 ? 7.039   -7.312  8.657  1.00 0.00 ? 225 ALA A HB2  1  
ATOM 252   H HB3  . ALA A 1 23 ? 6.074   -8.420  7.682  1.00 0.00 ? 225 ALA A HB3  1  
ATOM 253   N N    . GLY A 1 24 ? 4.905   -5.920  5.328  1.00 0.00 ? 226 GLY A N    1  
ATOM 254   C CA   . GLY A 1 24 ? 4.174   -6.060  4.085  1.00 0.00 ? 226 GLY A CA   1  
ATOM 255   C C    . GLY A 1 24 ? 4.820   -5.312  2.937  1.00 0.00 ? 226 GLY A C    1  
ATOM 256   O O    . GLY A 1 24 ? 5.952   -4.838  3.051  1.00 0.00 ? 226 GLY A O    1  
ATOM 257   H H    . GLY A 1 24 ? 5.668   -5.306  5.382  1.00 0.00 ? 226 GLY A H    1  
ATOM 258   H HA2  . GLY A 1 24 ? 4.117   -7.107  3.831  1.00 0.00 ? 226 GLY A HA2  1  
ATOM 259   H HA3  . GLY A 1 24 ? 3.174   -5.681  4.228  1.00 0.00 ? 226 GLY A HA3  1  
ATOM 260   N N    . VAL A 1 25 ? 4.098   -5.208  1.826  1.00 0.00 ? 227 VAL A N    1  
ATOM 261   C CA   . VAL A 1 25 ? 4.597   -4.516  0.645  1.00 0.00 ? 227 VAL A CA   1  
ATOM 262   C C    . VAL A 1 25 ? 3.709   -3.326  0.295  1.00 0.00 ? 227 VAL A C    1  
ATOM 263   O O    . VAL A 1 25 ? 2.486   -3.445  0.251  1.00 0.00 ? 227 VAL A O    1  
ATOM 264   C CB   . VAL A 1 25 ? 4.674   -5.467  -0.569 1.00 0.00 ? 227 VAL A CB   1  
ATOM 265   C CG1  . VAL A 1 25 ? 5.009   -4.700  -1.843 1.00 0.00 ? 227 VAL A CG1  1  
ATOM 266   C CG2  . VAL A 1 25 ? 5.693   -6.568  -0.321 1.00 0.00 ? 227 VAL A CG2  1  
ATOM 267   H H    . VAL A 1 25 ? 3.204   -5.608  1.800  1.00 0.00 ? 227 VAL A H    1  
ATOM 268   H HA   . VAL A 1 25 ? 5.594   -4.159  0.862  1.00 0.00 ? 227 VAL A HA   1  
ATOM 269   H HB   . VAL A 1 25 ? 3.705   -5.927  -0.700 1.00 0.00 ? 227 VAL A HB   1  
ATOM 270   H HG11 . VAL A 1 25 ? 5.617   -5.319  -2.484 1.00 0.00 ? 227 VAL A HG11 1  
ATOM 271   H HG12 . VAL A 1 25 ? 4.094   -4.439  -2.355 1.00 0.00 ? 227 VAL A HG12 1  
ATOM 272   H HG13 . VAL A 1 25 ? 5.549   -3.799  -1.589 1.00 0.00 ? 227 VAL A HG13 1  
ATOM 273   H HG21 . VAL A 1 25 ? 6.611   -6.330  -0.836 1.00 0.00 ? 227 VAL A HG21 1  
ATOM 274   H HG22 . VAL A 1 25 ? 5.886   -6.648  0.739  1.00 0.00 ? 227 VAL A HG22 1  
ATOM 275   H HG23 . VAL A 1 25 ? 5.306   -7.506  -0.689 1.00 0.00 ? 227 VAL A HG23 1  
ATOM 276   N N    . VAL A 1 26 ? 4.331   -2.183  0.034  1.00 0.00 ? 228 VAL A N    1  
ATOM 277   C CA   . VAL A 1 26 ? 3.590   -0.981  -0.321 1.00 0.00 ? 228 VAL A CA   1  
ATOM 278   C C    . VAL A 1 26 ? 2.800   -1.199  -1.607 1.00 0.00 ? 228 VAL A C    1  
ATOM 279   O O    . VAL A 1 26 ? 3.323   -1.735  -2.582 1.00 0.00 ? 228 VAL A O    1  
ATOM 280   C CB   . VAL A 1 26 ? 4.529   0.225   -0.500 1.00 0.00 ? 228 VAL A CB   1  
ATOM 281   C CG1  . VAL A 1 26 ? 3.731   1.506   -0.688 1.00 0.00 ? 228 VAL A CG1  1  
ATOM 282   C CG2  . VAL A 1 26 ? 5.473   0.339   0.688  1.00 0.00 ? 228 VAL A CG2  1  
ATOM 283   H H    . VAL A 1 26 ? 5.309   -2.149  0.073  1.00 0.00 ? 228 VAL A H    1  
ATOM 284   H HA   . VAL A 1 26 ? 2.901   -0.762  0.482  1.00 0.00 ? 228 VAL A HA   1  
ATOM 285   H HB   . VAL A 1 26 ? 5.123   0.063   -1.389 1.00 0.00 ? 228 VAL A HB   1  
ATOM 286   H HG11 . VAL A 1 26 ? 4.060   2.005   -1.589 1.00 0.00 ? 228 VAL A HG11 1  
ATOM 287   H HG12 . VAL A 1 26 ? 2.681   1.269   -0.771 1.00 0.00 ? 228 VAL A HG12 1  
ATOM 288   H HG13 . VAL A 1 26 ? 3.888   2.157   0.160  1.00 0.00 ? 228 VAL A HG13 1  
ATOM 289   H HG21 . VAL A 1 26 ? 4.907   0.246   1.604  1.00 0.00 ? 228 VAL A HG21 1  
ATOM 290   H HG22 . VAL A 1 26 ? 6.210   -0.449  0.639  1.00 0.00 ? 228 VAL A HG22 1  
ATOM 291   H HG23 . VAL A 1 26 ? 5.968   1.297   0.666  1.00 0.00 ? 228 VAL A HG23 1  
ATOM 292   N N    . ARG A 1 27 ? 1.536   -0.796  -1.598 1.00 0.00 ? 229 ARG A N    1  
ATOM 293   C CA   . ARG A 1 27 ? 0.675   -0.961  -2.763 1.00 0.00 ? 229 ARG A CA   1  
ATOM 294   C C    . ARG A 1 27 ? 0.139   0.380   -3.251 1.00 0.00 ? 229 ARG A C    1  
ATOM 295   O O    . ARG A 1 27 ? 0.060   0.625   -4.455 1.00 0.00 ? 229 ARG A O    1  
ATOM 296   C CB   . ARG A 1 27 ? -0.485  -1.902  -2.426 1.00 0.00 ? 229 ARG A CB   1  
ATOM 297   C CG   . ARG A 1 27 ? -0.069  -3.114  -1.610 1.00 0.00 ? 229 ARG A CG   1  
ATOM 298   C CD   . ARG A 1 27 ? 0.982   -3.939  -2.332 1.00 0.00 ? 229 ARG A CD   1  
ATOM 299   N NE   . ARG A 1 27 ? 0.386   -5.019  -3.115 1.00 0.00 ? 229 ARG A NE   1  
ATOM 300   C CZ   . ARG A 1 27 ? -0.022  -4.891  -4.376 1.00 0.00 ? 229 ARG A CZ   1  
ATOM 301   N NH1  . ARG A 1 27 ? 0.095   -3.729  -5.008 1.00 0.00 ? 229 ARG A NH1  1  
ATOM 302   N NH2  . ARG A 1 27 ? -0.551  -5.929  -5.010 1.00 0.00 ? 229 ARG A NH2  1  
ATOM 303   H H    . ARG A 1 27 ? 1.169   -0.385  -0.787 1.00 0.00 ? 229 ARG A H    1  
ATOM 304   H HA   . ARG A 1 27 ? 1.266   -1.406  -3.548 1.00 0.00 ? 229 ARG A HA   1  
ATOM 305   H HB2  . ARG A 1 27 ? -1.228  -1.355  -1.866 1.00 0.00 ? 229 ARG A HB2  1  
ATOM 306   H HB3  . ARG A 1 27 ? -0.928  -2.252  -3.345 1.00 0.00 ? 229 ARG A HB3  1  
ATOM 307   H HG2  . ARG A 1 27 ? 0.337   -2.778  -0.667 1.00 0.00 ? 229 ARG A HG2  1  
ATOM 308   H HG3  . ARG A 1 27 ? -0.938  -3.730  -1.430 1.00 0.00 ? 229 ARG A HG3  1  
ATOM 309   H HD2  . ARG A 1 27 ? 1.540   -3.293  -2.993 1.00 0.00 ? 229 ARG A HD2  1  
ATOM 310   H HD3  . ARG A 1 27 ? 1.651   -4.366  -1.600 1.00 0.00 ? 229 ARG A HD3  1  
ATOM 311   H HE   . ARG A 1 27 ? 0.283   -5.888  -2.675 1.00 0.00 ? 229 ARG A HE   1  
ATOM 312   H HH11 . ARG A 1 27 ? 0.491   -2.940  -4.538 1.00 0.00 ? 229 ARG A HH11 1  
ATOM 313   H HH12 . ARG A 1 27 ? -0.214  -3.642  -5.954 1.00 0.00 ? 229 ARG A HH12 1  
ATOM 314   H HH21 . ARG A 1 27 ? -0.641  -6.807  -4.540 1.00 0.00 ? 229 ARG A HH21 1  
ATOM 315   H HH22 . ARG A 1 27 ? -0.857  -5.833  -5.956 1.00 0.00 ? 229 ARG A HH22 1  
ATOM 316   N N    . PHE A 1 28 ? -0.229  1.247   -2.315 1.00 0.00 ? 230 PHE A N    1  
ATOM 317   C CA   . PHE A 1 28 ? -0.755  2.563   -2.658 1.00 0.00 ? 230 PHE A CA   1  
ATOM 318   C C    . PHE A 1 28 ? -0.400  3.589   -1.589 1.00 0.00 ? 230 PHE A C    1  
ATOM 319   O O    . PHE A 1 28 ? -0.265  3.250   -0.419 1.00 0.00 ? 230 PHE A O    1  
ATOM 320   C CB   . PHE A 1 28 ? -2.273  2.497   -2.838 1.00 0.00 ? 230 PHE A CB   1  
ATOM 321   C CG   . PHE A 1 28 ? -2.860  3.738   -3.448 1.00 0.00 ? 230 PHE A CG   1  
ATOM 322   C CD1  . PHE A 1 28 ? -2.654  4.031   -4.787 1.00 0.00 ? 230 PHE A CD1  1  
ATOM 323   C CD2  . PHE A 1 28 ? -3.616  4.611   -2.682 1.00 0.00 ? 230 PHE A CD2  1  
ATOM 324   C CE1  . PHE A 1 28 ? -3.193  5.171   -5.350 1.00 0.00 ? 230 PHE A CE1  1  
ATOM 325   C CE2  . PHE A 1 28 ? -4.156  5.752   -3.240 1.00 0.00 ? 230 PHE A CE2  1  
ATOM 326   C CZ   . PHE A 1 28 ? -3.945  6.034   -4.576 1.00 0.00 ? 230 PHE A CZ   1  
ATOM 327   H H    . PHE A 1 28 ? -0.142  0.998   -1.370 1.00 0.00 ? 230 PHE A H    1  
ATOM 328   H HA   . PHE A 1 28 ? -0.306  2.864   -3.591 1.00 0.00 ? 230 PHE A HA   1  
ATOM 329   H HB2  . PHE A 1 28 ? -2.518  1.665   -3.481 1.00 0.00 ? 230 PHE A HB2  1  
ATOM 330   H HB3  . PHE A 1 28 ? -2.736  2.349   -1.872 1.00 0.00 ? 230 PHE A HB3  1  
ATOM 331   H HD1  . PHE A 1 28 ? -2.067  3.358   -5.392 1.00 0.00 ? 230 PHE A HD1  1  
ATOM 332   H HD2  . PHE A 1 28 ? -3.782  4.392   -1.637 1.00 0.00 ? 230 PHE A HD2  1  
ATOM 333   H HE1  . PHE A 1 28 ? -3.026  5.388   -6.395 1.00 0.00 ? 230 PHE A HE1  1  
ATOM 334   H HE2  . PHE A 1 28 ? -4.745  6.426   -2.633 1.00 0.00 ? 230 PHE A HE2  1  
ATOM 335   H HZ   . PHE A 1 28 ? -4.366  6.926   -5.015 1.00 0.00 ? 230 PHE A HZ   1  
ATOM 336   N N    . LEU A 1 29 ? -0.252  4.843   -1.996 1.00 0.00 ? 231 LEU A N    1  
ATOM 337   C CA   . LEU A 1 29 ? 0.086   5.908   -1.058 1.00 0.00 ? 231 LEU A CA   1  
ATOM 338   C C    . LEU A 1 29 ? -0.793  7.133   -1.283 1.00 0.00 ? 231 LEU A C    1  
ATOM 339   O O    . LEU A 1 29 ? -0.873  7.659   -2.394 1.00 0.00 ? 231 LEU A O    1  
ATOM 340   C CB   . LEU A 1 29 ? 1.563   6.286   -1.189 1.00 0.00 ? 231 LEU A CB   1  
ATOM 341   C CG   . LEU A 1 29 ? 2.535   5.103   -1.162 1.00 0.00 ? 231 LEU A CG   1  
ATOM 342   C CD1  . LEU A 1 29 ? 3.299   5.007   -2.473 1.00 0.00 ? 231 LEU A CD1  1  
ATOM 343   C CD2  . LEU A 1 29 ? 3.499   5.226   0.008  1.00 0.00 ? 231 LEU A CD2  1  
ATOM 344   H H    . LEU A 1 29 ? -0.372  5.059   -2.943 1.00 0.00 ? 231 LEU A H    1  
ATOM 345   H HA   . LEU A 1 29 ? -0.091  5.536   -0.059 1.00 0.00 ? 231 LEU A HA   1  
ATOM 346   H HB2  . LEU A 1 29 ? 1.695   6.817   -2.119 1.00 0.00 ? 231 LEU A HB2  1  
ATOM 347   H HB3  . LEU A 1 29 ? 1.815   6.950   -0.376 1.00 0.00 ? 231 LEU A HB3  1  
ATOM 348   H HG   . LEU A 1 29 ? 1.973   4.189   -1.039 1.00 0.00 ? 231 LEU A HG   1  
ATOM 349   H HD11 . LEU A 1 29 ? 2.707   4.462   -3.195 1.00 0.00 ? 231 LEU A HD11 1  
ATOM 350   H HD12 . LEU A 1 29 ? 3.498   6.000   -2.846 1.00 0.00 ? 231 LEU A HD12 1  
ATOM 351   H HD13 . LEU A 1 29 ? 4.232   4.488   -2.308 1.00 0.00 ? 231 LEU A HD13 1  
ATOM 352   H HD21 . LEU A 1 29 ? 3.904   4.252   0.245  1.00 0.00 ? 231 LEU A HD21 1  
ATOM 353   H HD22 . LEU A 1 29 ? 4.303   5.897   -0.256 1.00 0.00 ? 231 LEU A HD22 1  
ATOM 354   H HD23 . LEU A 1 29 ? 2.974   5.614   0.868  1.00 0.00 ? 231 LEU A HD23 1  
ATOM 355   N N    . GLY A 1 30 ? -1.453  7.584   -0.221 1.00 0.00 ? 232 GLY A N    1  
ATOM 356   C CA   . GLY A 1 30 ? -2.320  8.743   -0.323 1.00 0.00 ? 232 GLY A CA   1  
ATOM 357   C C    . GLY A 1 30 ? -3.210  8.907   0.893  1.00 0.00 ? 232 GLY A C    1  
ATOM 358   O O    . GLY A 1 30 ? -3.071  8.179   1.876  1.00 0.00 ? 232 GLY A O    1  
ATOM 359   H H    . GLY A 1 30 ? -1.351  7.124   0.638  1.00 0.00 ? 232 GLY A H    1  
ATOM 360   H HA2  . GLY A 1 30 ? -1.709  9.627   -0.429 1.00 0.00 ? 232 GLY A HA2  1  
ATOM 361   H HA3  . GLY A 1 30 ? -2.941  8.639   -1.199 1.00 0.00 ? 232 GLY A HA3  1  
ATOM 362   N N    . GLU A 1 31 ? -4.127  9.866   0.827  1.00 0.00 ? 233 GLU A N    1  
ATOM 363   C CA   . GLU A 1 31 ? -5.042  10.125  1.931  1.00 0.00 ? 233 GLU A CA   1  
ATOM 364   C C    . GLU A 1 31 ? -6.194  9.123   1.929  1.00 0.00 ? 233 GLU A C    1  
ATOM 365   O O    . GLU A 1 31 ? -6.480  8.495   0.910  1.00 0.00 ? 233 GLU A O    1  
ATOM 366   C CB   . GLU A 1 31 ? -5.592  11.550  1.843  1.00 0.00 ? 233 GLU A CB   1  
ATOM 367   C CG   . GLU A 1 31 ? -4.518  12.604  1.629  1.00 0.00 ? 233 GLU A CG   1  
ATOM 368   C CD   . GLU A 1 31 ? -5.038  13.826  0.897  1.00 0.00 ? 233 GLU A CD   1  
ATOM 369   O OE1  . GLU A 1 31 ? -6.241  14.134  1.036  1.00 0.00 ? 233 GLU A OE1  1  
ATOM 370   O OE2  . GLU A 1 31 ? -4.242  14.473  0.185  1.00 0.00 ? 233 GLU A OE2  1  
ATOM 371   H H    . GLU A 1 31 ? -4.188  10.414  0.017  1.00 0.00 ? 233 GLU A H    1  
ATOM 372   H HA   . GLU A 1 31 ? -4.491  10.018  2.853  1.00 0.00 ? 233 GLU A HA   1  
ATOM 373   H HB2  . GLU A 1 31 ? -6.289  11.604  1.018  1.00 0.00 ? 233 GLU A HB2  1  
ATOM 374   H HB3  . GLU A 1 31 ? -6.115  11.781  2.759  1.00 0.00 ? 233 GLU A HB3  1  
ATOM 375   H HG2  . GLU A 1 31 ? -4.140  12.914  2.591  1.00 0.00 ? 233 GLU A HG2  1  
ATOM 376   H HG3  . GLU A 1 31 ? -3.716  12.170  1.051  1.00 0.00 ? 233 GLU A HG3  1  
ATOM 377   N N    . THR A 1 32 ? -6.848  8.977   3.076  1.00 0.00 ? 234 THR A N    1  
ATOM 378   C CA   . THR A 1 32 ? -7.967  8.053   3.206  1.00 0.00 ? 234 THR A CA   1  
ATOM 379   C C    . THR A 1 32 ? -9.291  8.805   3.278  1.00 0.00 ? 234 THR A C    1  
ATOM 380   O O    . THR A 1 32 ? -9.323  9.994   3.596  1.00 0.00 ? 234 THR A O    1  
ATOM 381   C CB   . THR A 1 32 ? -7.795  7.180   4.450  1.00 0.00 ? 234 THR A CB   1  
ATOM 382   O OG1  . THR A 1 32 ? -7.908  7.959   5.627  1.00 0.00 ? 234 THR A OG1  1  
ATOM 383   C CG2  . THR A 1 32 ? -6.462  6.463   4.499  1.00 0.00 ? 234 THR A CG2  1  
ATOM 384   H H    . THR A 1 32 ? -6.573  9.507   3.855  1.00 0.00 ? 234 THR A H    1  
ATOM 385   H HA   . THR A 1 32 ? -7.975  7.418   2.331  1.00 0.00 ? 234 THR A HA   1  
ATOM 386   H HB   . THR A 1 32 ? -8.573  6.431   4.462  1.00 0.00 ? 234 THR A HB   1  
ATOM 387   H HG1  . THR A 1 32 ? -7.270  8.677   5.599  1.00 0.00 ? 234 THR A HG1  1  
ATOM 388   H HG21 . THR A 1 32 ? -6.590  5.442   4.174  1.00 0.00 ? 234 THR A HG21 1  
ATOM 389   H HG22 . THR A 1 32 ? -6.084  6.475   5.510  1.00 0.00 ? 234 THR A HG22 1  
ATOM 390   H HG23 . THR A 1 32 ? -5.760  6.963   3.848  1.00 0.00 ? 234 THR A HG23 1  
ATOM 391   N N    . ASP A 1 33 ? -10.381 8.106   2.982  1.00 0.00 ? 235 ASP A N    1  
ATOM 392   C CA   . ASP A 1 33 ? -11.707 8.709   3.013  1.00 0.00 ? 235 ASP A CA   1  
ATOM 393   C C    . ASP A 1 33 ? -12.298 8.686   4.424  1.00 0.00 ? 235 ASP A C    1  
ATOM 394   O O    . ASP A 1 33 ? -13.393 9.199   4.652  1.00 0.00 ? 235 ASP A O    1  
ATOM 395   C CB   . ASP A 1 33 ? -12.642 7.982   2.045  1.00 0.00 ? 235 ASP A CB   1  
ATOM 396   C CG   . ASP A 1 33 ? -13.501 8.939   1.242  1.00 0.00 ? 235 ASP A CG   1  
ATOM 397   O OD1  . ASP A 1 33 ? -12.937 9.721   0.448  1.00 0.00 ? 235 ASP A OD1  1  
ATOM 398   O OD2  . ASP A 1 33 ? -14.740 8.906   1.407  1.00 0.00 ? 235 ASP A OD2  1  
ATOM 399   H H    . ASP A 1 33 ? -10.290 7.162   2.735  1.00 0.00 ? 235 ASP A H    1  
ATOM 400   H HA   . ASP A 1 33 ? -11.610 9.737   2.697  1.00 0.00 ? 235 ASP A HA   1  
ATOM 401   H HB2  . ASP A 1 33 ? -12.052 7.394   1.357  1.00 0.00 ? 235 ASP A HB2  1  
ATOM 402   H HB3  . ASP A 1 33 ? -13.292 7.326   2.606  1.00 0.00 ? 235 ASP A HB3  1  
ATOM 403   N N    . PHE A 1 34 ? -11.572 8.088   5.368  1.00 0.00 ? 236 PHE A N    1  
ATOM 404   C CA   . PHE A 1 34 ? -12.041 8.009   6.748  1.00 0.00 ? 236 PHE A CA   1  
ATOM 405   C C    . PHE A 1 34 ? -11.032 8.628   7.719  1.00 0.00 ? 236 PHE A C    1  
ATOM 406   O O    . PHE A 1 34 ? -11.370 8.931   8.863  1.00 0.00 ? 236 PHE A O    1  
ATOM 407   C CB   . PHE A 1 34 ? -12.315 6.549   7.134  1.00 0.00 ? 236 PHE A CB   1  
ATOM 408   C CG   . PHE A 1 34 ? -11.085 5.773   7.521  1.00 0.00 ? 236 PHE A CG   1  
ATOM 409   C CD1  . PHE A 1 34 ? -10.051 5.583   6.618  1.00 0.00 ? 236 PHE A CD1  1  
ATOM 410   C CD2  . PHE A 1 34 ? -10.964 5.237   8.794  1.00 0.00 ? 236 PHE A CD2  1  
ATOM 411   C CE1  . PHE A 1 34 ? -8.921  4.874   6.976  1.00 0.00 ? 236 PHE A CE1  1  
ATOM 412   C CE2  . PHE A 1 34 ? -9.836  4.526   9.158  1.00 0.00 ? 236 PHE A CE2  1  
ATOM 413   C CZ   . PHE A 1 34 ? -8.814  4.344   8.248  1.00 0.00 ? 236 PHE A CZ   1  
ATOM 414   H H    . PHE A 1 34 ? -10.709 7.697   5.131  1.00 0.00 ? 236 PHE A H    1  
ATOM 415   H HA   . PHE A 1 34 ? -12.964 8.564   6.813  1.00 0.00 ? 236 PHE A HA   1  
ATOM 416   H HB2  . PHE A 1 34 ? -12.995 6.530   7.973  1.00 0.00 ? 236 PHE A HB2  1  
ATOM 417   H HB3  . PHE A 1 34 ? -12.775 6.045   6.296  1.00 0.00 ? 236 PHE A HB3  1  
ATOM 418   H HD1  . PHE A 1 34 ? -10.133 5.995   5.625  1.00 0.00 ? 236 PHE A HD1  1  
ATOM 419   H HD2  . PHE A 1 34 ? -11.764 5.378   9.506  1.00 0.00 ? 236 PHE A HD2  1  
ATOM 420   H HE1  . PHE A 1 34 ? -8.121  4.733   6.264  1.00 0.00 ? 236 PHE A HE1  1  
ATOM 421   H HE2  . PHE A 1 34 ? -9.755  4.113   10.152 1.00 0.00 ? 236 PHE A HE2  1  
ATOM 422   H HZ   . PHE A 1 34 ? -7.930  3.790   8.530  1.00 0.00 ? 236 PHE A HZ   1  
ATOM 423   N N    . ALA A 1 35 ? -9.793  8.806   7.263  1.00 0.00 ? 237 ALA A N    1  
ATOM 424   C CA   . ALA A 1 35 ? -8.750  9.383   8.102  1.00 0.00 ? 237 ALA A CA   1  
ATOM 425   C C    . ALA A 1 35 ? -8.190  10.662  7.486  1.00 0.00 ? 237 ALA A C    1  
ATOM 426   O O    . ALA A 1 35 ? -8.079  10.779  6.267  1.00 0.00 ? 237 ALA A O    1  
ATOM 427   C CB   . ALA A 1 35 ? -7.636  8.371   8.324  1.00 0.00 ? 237 ALA A CB   1  
ATOM 428   H H    . ALA A 1 35 ? -9.576  8.544   6.346  1.00 0.00 ? 237 ALA A H    1  
ATOM 429   H HA   . ALA A 1 35 ? -9.186  9.619   9.061  1.00 0.00 ? 237 ALA A HA   1  
ATOM 430   H HB1  . ALA A 1 35 ? -6.888  8.484   7.554  1.00 0.00 ? 237 ALA A HB1  1  
ATOM 431   H HB2  . ALA A 1 35 ? -7.185  8.540   9.291  1.00 0.00 ? 237 ALA A HB2  1  
ATOM 432   H HB3  . ALA A 1 35 ? -8.044  7.373   8.287  1.00 0.00 ? 237 ALA A HB3  1  
ATOM 433   N N    . LYS A 1 36 ? -7.837  11.616  8.341  1.00 0.00 ? 238 LYS A N    1  
ATOM 434   C CA   . LYS A 1 36 ? -7.285  12.887  7.883  1.00 0.00 ? 238 LYS A CA   1  
ATOM 435   C C    . LYS A 1 36 ? -5.764  12.821  7.802  1.00 0.00 ? 238 LYS A C    1  
ATOM 436   O O    . LYS A 1 36 ? -5.109  12.289  8.698  1.00 0.00 ? 238 LYS A O    1  
ATOM 437   C CB   . LYS A 1 36 ? -7.711  14.018  8.820  1.00 0.00 ? 238 LYS A CB   1  
ATOM 438   C CG   . LYS A 1 36 ? -7.333  15.401  8.316  1.00 0.00 ? 238 LYS A CG   1  
ATOM 439   C CD   . LYS A 1 36 ? -8.364  16.443  8.720  1.00 0.00 ? 238 LYS A CD   1  
ATOM 440   C CE   . LYS A 1 36 ? -9.418  16.631  7.642  1.00 0.00 ? 238 LYS A CE   1  
ATOM 441   N NZ   . LYS A 1 36 ? -10.196 17.885  7.837  1.00 0.00 ? 238 LYS A NZ   1  
ATOM 442   H H    . LYS A 1 36 ? -7.950  11.463  9.302  1.00 0.00 ? 238 LYS A H    1  
ATOM 443   H HA   . LYS A 1 36 ? -7.679  13.080  6.896  1.00 0.00 ? 238 LYS A HA   1  
ATOM 444   H HB2  . LYS A 1 36 ? -8.784  13.985  8.943  1.00 0.00 ? 238 LYS A HB2  1  
ATOM 445   H HB3  . LYS A 1 36 ? -7.243  13.869  9.782  1.00 0.00 ? 238 LYS A HB3  1  
ATOM 446   H HG2  . LYS A 1 36 ? -6.376  15.677  8.732  1.00 0.00 ? 238 LYS A HG2  1  
ATOM 447   H HG3  . LYS A 1 36 ? -7.265  15.375  7.237  1.00 0.00 ? 238 LYS A HG3  1  
ATOM 448   H HD2  . LYS A 1 36 ? -8.847  16.122  9.629  1.00 0.00 ? 238 LYS A HD2  1  
ATOM 449   H HD3  . LYS A 1 36 ? -7.862  17.384  8.889  1.00 0.00 ? 238 LYS A HD3  1  
ATOM 450   H HE2  . LYS A 1 36 ? -8.928  16.668  6.679  1.00 0.00 ? 238 LYS A HE2  1  
ATOM 451   H HE3  . LYS A 1 36 ? -10.095 15.790  7.666  1.00 0.00 ? 238 LYS A HE3  1  
ATOM 452   H HZ1  . LYS A 1 36 ? -10.539 17.943  8.817  1.00 0.00 ? 238 LYS A HZ1  1  
ATOM 453   H HZ2  . LYS A 1 36 ? -11.011 17.904  7.192  1.00 0.00 ? 238 LYS A HZ2  1  
ATOM 454   H HZ3  . LYS A 1 36 ? -9.596  18.712  7.643  1.00 0.00 ? 238 LYS A HZ3  1  
ATOM 455   N N    . GLY A 1 37 ? -5.209  13.365  6.725  1.00 0.00 ? 239 GLY A N    1  
ATOM 456   C CA   . GLY A 1 37 ? -3.768  13.359  6.549  1.00 0.00 ? 239 GLY A CA   1  
ATOM 457   C C    . GLY A 1 37 ? -3.322  12.411  5.452  1.00 0.00 ? 239 GLY A C    1  
ATOM 458   O O    . GLY A 1 37 ? -4.130  11.975  4.632  1.00 0.00 ? 239 GLY A O    1  
ATOM 459   H H    . GLY A 1 37 ? -5.782  13.775  6.044  1.00 0.00 ? 239 GLY A H    1  
ATOM 460   H HA2  . GLY A 1 37 ? -3.442  14.357  6.300  1.00 0.00 ? 239 GLY A HA2  1  
ATOM 461   H HA3  . GLY A 1 37 ? -3.303  13.060  7.477  1.00 0.00 ? 239 GLY A HA3  1  
ATOM 462   N N    . GLU A 1 38 ? -2.031  12.093  5.436  1.00 0.00 ? 240 GLU A N    1  
ATOM 463   C CA   . GLU A 1 38 ? -1.478  11.192  4.432  1.00 0.00 ? 240 GLU A CA   1  
ATOM 464   C C    . GLU A 1 38 ? -1.360  9.773   4.978  1.00 0.00 ? 240 GLU A C    1  
ATOM 465   O O    . GLU A 1 38 ? -0.907  9.566   6.104  1.00 0.00 ? 240 GLU A O    1  
ATOM 466   C CB   . GLU A 1 38 ? -0.105  11.689  3.973  1.00 0.00 ? 240 GLU A CB   1  
ATOM 467   C CG   . GLU A 1 38 ? 0.941   11.693  5.075  1.00 0.00 ? 240 GLU A CG   1  
ATOM 468   C CD   . GLU A 1 38 ? 2.234   12.358  4.647  1.00 0.00 ? 240 GLU A CD   1  
ATOM 469   O OE1  . GLU A 1 38 ? 2.182   13.258  3.782  1.00 0.00 ? 240 GLU A OE1  1  
ATOM 470   O OE2  . GLU A 1 38 ? 3.300   11.981  5.179  1.00 0.00 ? 240 GLU A OE2  1  
ATOM 471   H H    . GLU A 1 38 ? -1.437  12.473  6.117  1.00 0.00 ? 240 GLU A H    1  
ATOM 472   H HA   . GLU A 1 38 ? -2.149  11.186  3.587  1.00 0.00 ? 240 GLU A HA   1  
ATOM 473   H HB2  . GLU A 1 38 ? 0.247   11.052  3.175  1.00 0.00 ? 240 GLU A HB2  1  
ATOM 474   H HB3  . GLU A 1 38 ? -0.207  12.697  3.598  1.00 0.00 ? 240 GLU A HB3  1  
ATOM 475   H HG2  . GLU A 1 38 ? 0.546   12.226  5.927  1.00 0.00 ? 240 GLU A HG2  1  
ATOM 476   H HG3  . GLU A 1 38 ? 1.153   10.673  5.356  1.00 0.00 ? 240 GLU A HG3  1  
ATOM 477   N N    . TRP A 1 39 ? -1.771  8.798   4.173  1.00 0.00 ? 241 TRP A N    1  
ATOM 478   C CA   . TRP A 1 39 ? -1.713  7.399   4.577  1.00 0.00 ? 241 TRP A CA   1  
ATOM 479   C C    . TRP A 1 39 ? -1.096  6.540   3.477  1.00 0.00 ? 241 TRP A C    1  
ATOM 480   O O    . TRP A 1 39 ? -0.921  6.996   2.347  1.00 0.00 ? 241 TRP A O    1  
ATOM 481   C CB   . TRP A 1 39 ? -3.113  6.887   4.920  1.00 0.00 ? 241 TRP A CB   1  
ATOM 482   C CG   . TRP A 1 39 ? -3.690  7.528   6.146  1.00 0.00 ? 241 TRP A CG   1  
ATOM 483   C CD1  . TRP A 1 39 ? -4.168  8.803   6.257  1.00 0.00 ? 241 TRP A CD1  1  
ATOM 484   C CD2  . TRP A 1 39 ? -3.847  6.927   7.437  1.00 0.00 ? 241 TRP A CD2  1  
ATOM 485   N NE1  . TRP A 1 39 ? -4.610  9.031   7.538  1.00 0.00 ? 241 TRP A NE1  1  
ATOM 486   C CE2  . TRP A 1 39 ? -4.425  7.895   8.280  1.00 0.00 ? 241 TRP A CE2  1  
ATOM 487   C CE3  . TRP A 1 39 ? -3.555  5.665   7.959  1.00 0.00 ? 241 TRP A CE3  1  
ATOM 488   C CZ2  . TRP A 1 39 ? -4.716  7.637   9.618  1.00 0.00 ? 241 TRP A CZ2  1  
ATOM 489   C CZ3  . TRP A 1 39 ? -3.845  5.410   9.287  1.00 0.00 ? 241 TRP A CZ3  1  
ATOM 490   C CH2  . TRP A 1 39 ? -4.420  6.392   10.103 1.00 0.00 ? 241 TRP A CH2  1  
ATOM 491   H H    . TRP A 1 39 ? -2.124  9.026   3.288  1.00 0.00 ? 241 TRP A H    1  
ATOM 492   H HA   . TRP A 1 39 ? -1.091  7.335   5.457  1.00 0.00 ? 241 TRP A HA   1  
ATOM 493   H HB2  . TRP A 1 39 ? -3.777  7.090   4.093  1.00 0.00 ? 241 TRP A HB2  1  
ATOM 494   H HB3  . TRP A 1 39 ? -3.069  5.821   5.089  1.00 0.00 ? 241 TRP A HB3  1  
ATOM 495   H HD1  . TRP A 1 39 ? -4.186  9.518   5.449  1.00 0.00 ? 241 TRP A HD1  1  
ATOM 496   H HE1  . TRP A 1 39 ? -4.997  9.869   7.865  1.00 0.00 ? 241 TRP A HE1  1  
ATOM 497   H HE3  . TRP A 1 39 ? -3.112  4.894   7.345  1.00 0.00 ? 241 TRP A HE3  1  
ATOM 498   H HZ2  . TRP A 1 39 ? -5.160  8.383   10.260 1.00 0.00 ? 241 TRP A HZ2  1  
ATOM 499   H HZ3  . TRP A 1 39 ? -3.627  4.441   9.708  1.00 0.00 ? 241 TRP A HZ3  1  
ATOM 500   H HH2  . TRP A 1 39 ? -4.627  6.150   11.135 1.00 0.00 ? 241 TRP A HH2  1  
ATOM 501   N N    . CYS A 1 40 ? -0.766  5.297   3.815  1.00 0.00 ? 242 CYS A N    1  
ATOM 502   C CA   . CYS A 1 40 ? -0.166  4.379   2.853  1.00 0.00 ? 242 CYS A CA   1  
ATOM 503   C C    . CYS A 1 40 ? -0.769  2.982   2.978  1.00 0.00 ? 242 CYS A C    1  
ATOM 504   O O    . CYS A 1 40 ? -1.289  2.606   4.031  1.00 0.00 ? 242 CYS A O    1  
ATOM 505   C CB   . CYS A 1 40 ? 1.351   4.318   3.054  1.00 0.00 ? 242 CYS A CB   1  
ATOM 506   S SG   . CYS A 1 40 ? 2.197   3.119   1.997  1.00 0.00 ? 242 CYS A SG   1  
ATOM 507   H H    . CYS A 1 40 ? -0.928  4.991   4.732  1.00 0.00 ? 242 CYS A H    1  
ATOM 508   H HA   . CYS A 1 40 ? -0.372  4.757   1.862  1.00 0.00 ? 242 CYS A HA   1  
ATOM 509   H HB2  . CYS A 1 40 ? 1.772   5.290   2.841  1.00 0.00 ? 242 CYS A HB2  1  
ATOM 510   H HB3  . CYS A 1 40 ? 1.562   4.058   4.081  1.00 0.00 ? 242 CYS A HB3  1  
ATOM 511   H HG   . CYS A 1 40 ? 2.047   3.371   1.083  1.00 0.00 ? 242 CYS A HG   1  
ATOM 512   N N    . GLY A 1 41 ? -0.689  2.219   1.894  1.00 0.00 ? 243 GLY A N    1  
ATOM 513   C CA   . GLY A 1 41 ? -1.222  0.872   1.880  1.00 0.00 ? 243 GLY A CA   1  
ATOM 514   C C    . GLY A 1 41 ? -0.130  -0.171  1.749  1.00 0.00 ? 243 GLY A C    1  
ATOM 515   O O    . GLY A 1 41 ? 0.688   -0.105  0.832  1.00 0.00 ? 243 GLY A O    1  
ATOM 516   H H    . GLY A 1 41 ? -0.262  2.578   1.089  1.00 0.00 ? 243 GLY A H    1  
ATOM 517   H HA2  . GLY A 1 41 ? -1.765  0.697   2.798  1.00 0.00 ? 243 GLY A HA2  1  
ATOM 518   H HA3  . GLY A 1 41 ? -1.898  0.773   1.044  1.00 0.00 ? 243 GLY A HA3  1  
ATOM 519   N N    . VAL A 1 42 ? -0.112  -1.131  2.664  1.00 0.00 ? 244 VAL A N    1  
ATOM 520   C CA   . VAL A 1 42 ? 0.894   -2.185  2.640  1.00 0.00 ? 244 VAL A CA   1  
ATOM 521   C C    . VAL A 1 42 ? 0.249   -3.564  2.736  1.00 0.00 ? 244 VAL A C    1  
ATOM 522   O O    . VAL A 1 42 ? -0.592  -3.808  3.601  1.00 0.00 ? 244 VAL A O    1  
ATOM 523   C CB   . VAL A 1 42 ? 1.906   -2.029  3.794  1.00 0.00 ? 244 VAL A CB   1  
ATOM 524   C CG1  . VAL A 1 42 ? 3.138   -2.887  3.549  1.00 0.00 ? 244 VAL A CG1  1  
ATOM 525   C CG2  . VAL A 1 42 ? 2.299   -0.570  3.984  1.00 0.00 ? 244 VAL A CG2  1  
ATOM 526   H H    . VAL A 1 42 ? -0.788  -1.130  3.374  1.00 0.00 ? 244 VAL A H    1  
ATOM 527   H HA   . VAL A 1 42 ? 1.431   -2.113  1.703  1.00 0.00 ? 244 VAL A HA   1  
ATOM 528   H HB   . VAL A 1 42 ? 1.436   -2.372  4.704  1.00 0.00 ? 244 VAL A HB   1  
ATOM 529   H HG11 . VAL A 1 42 ? 3.680   -2.502  2.697  1.00 0.00 ? 244 VAL A HG11 1  
ATOM 530   H HG12 . VAL A 1 42 ? 3.775   -2.861  4.421  1.00 0.00 ? 244 VAL A HG12 1  
ATOM 531   H HG13 . VAL A 1 42 ? 2.834   -3.904  3.355  1.00 0.00 ? 244 VAL A HG13 1  
ATOM 532   H HG21 . VAL A 1 42 ? 1.409   0.034   4.071  1.00 0.00 ? 244 VAL A HG21 1  
ATOM 533   H HG22 . VAL A 1 42 ? 2.891   -0.472  4.882  1.00 0.00 ? 244 VAL A HG22 1  
ATOM 534   H HG23 . VAL A 1 42 ? 2.879   -0.240  3.134  1.00 0.00 ? 244 VAL A HG23 1  
ATOM 535   N N    . GLU A 1 43 ? 0.658   -4.464  1.849  1.00 0.00 ? 245 GLU A N    1  
ATOM 536   C CA   . GLU A 1 43 ? 0.131   -5.822  1.840  1.00 0.00 ? 245 GLU A CA   1  
ATOM 537   C C    . GLU A 1 43 ? 0.899   -6.686  2.830  1.00 0.00 ? 245 GLU A C    1  
ATOM 538   O O    . GLU A 1 43 ? 2.083   -6.965  2.638  1.00 0.00 ? 245 GLU A O    1  
ATOM 539   C CB   . GLU A 1 43 ? 0.225   -6.420  0.435  1.00 0.00 ? 245 GLU A CB   1  
ATOM 540   C CG   . GLU A 1 43 ? -0.426  -7.790  0.314  1.00 0.00 ? 245 GLU A CG   1  
ATOM 541   C CD   . GLU A 1 43 ? -0.648  -8.202  -1.129 1.00 0.00 ? 245 GLU A CD   1  
ATOM 542   O OE1  . GLU A 1 43 ? -0.855  -7.309  -1.977 1.00 0.00 ? 245 GLU A OE1  1  
ATOM 543   O OE2  . GLU A 1 43 ? -0.615  -9.419  -1.410 1.00 0.00 ? 245 GLU A OE2  1  
ATOM 544   H H    . GLU A 1 43 ? 1.338   -4.211  1.189  1.00 0.00 ? 245 GLU A H    1  
ATOM 545   H HA   . GLU A 1 43 ? -0.905  -5.780  2.139  1.00 0.00 ? 245 GLU A HA   1  
ATOM 546   H HB2  . GLU A 1 43 ? -0.259  -5.752  -0.262 1.00 0.00 ? 245 GLU A HB2  1  
ATOM 547   H HB3  . GLU A 1 43 ? 1.267   -6.516  0.165  1.00 0.00 ? 245 GLU A HB3  1  
ATOM 548   H HG2  . GLU A 1 43 ? 0.212   -8.520  0.786  1.00 0.00 ? 245 GLU A HG2  1  
ATOM 549   H HG3  . GLU A 1 43 ? -1.381  -7.765  0.817  1.00 0.00 ? 245 GLU A HG3  1  
ATOM 550   N N    . LEU A 1 44 ? 0.225   -7.096  3.897  1.00 0.00 ? 246 LEU A N    1  
ATOM 551   C CA   . LEU A 1 44 ? 0.850   -7.911  4.928  1.00 0.00 ? 246 LEU A CA   1  
ATOM 552   C C    . LEU A 1 44 ? 1.194   -9.303  4.408  1.00 0.00 ? 246 LEU A C    1  
ATOM 553   O O    . LEU A 1 44 ? 0.462   -9.878  3.604  1.00 0.00 ? 246 LEU A O    1  
ATOM 554   C CB   . LEU A 1 44 ? -0.070  -8.021  6.145  1.00 0.00 ? 246 LEU A CB   1  
ATOM 555   C CG   . LEU A 1 44 ? -0.575  -6.687  6.694  1.00 0.00 ? 246 LEU A CG   1  
ATOM 556   C CD1  . LEU A 1 44 ? -1.689  -6.913  7.704  1.00 0.00 ? 246 LEU A CD1  1  
ATOM 557   C CD2  . LEU A 1 44 ? 0.567   -5.904  7.324  1.00 0.00 ? 246 LEU A CD2  1  
ATOM 558   H H    . LEU A 1 44 ? -0.712  -6.832  4.000  1.00 0.00 ? 246 LEU A H    1  
ATOM 559   H HA   . LEU A 1 44 ? 1.763   -7.417  5.226  1.00 0.00 ? 246 LEU A HA   1  
ATOM 560   H HB2  . LEU A 1 44 ? -0.923  -8.622  5.870  1.00 0.00 ? 246 LEU A HB2  1  
ATOM 561   H HB3  . LEU A 1 44 ? 0.468   -8.529  6.932  1.00 0.00 ? 246 LEU A HB3  1  
ATOM 562   H HG   . LEU A 1 44 ? -0.977  -6.099  5.882  1.00 0.00 ? 246 LEU A HG   1  
ATOM 563   H HD11 . LEU A 1 44 ? -2.357  -6.065  7.697  1.00 0.00 ? 246 LEU A HD11 1  
ATOM 564   H HD12 . LEU A 1 44 ? -2.236  -7.807  7.443  1.00 0.00 ? 246 LEU A HD12 1  
ATOM 565   H HD13 . LEU A 1 44 ? -1.263  -7.027  8.690  1.00 0.00 ? 246 LEU A HD13 1  
ATOM 566   H HD21 . LEU A 1 44 ? 0.457   -4.857  7.089  1.00 0.00 ? 246 LEU A HD21 1  
ATOM 567   H HD22 . LEU A 1 44 ? 0.545   -6.038  8.395  1.00 0.00 ? 246 LEU A HD22 1  
ATOM 568   H HD23 . LEU A 1 44 ? 1.509   -6.265  6.935  1.00 0.00 ? 246 LEU A HD23 1  
ATOM 569   N N    . ASP A 1 45 ? 2.317   -9.833  4.880  1.00 0.00 ? 247 ASP A N    1  
ATOM 570   C CA   . ASP A 1 45 ? 2.775   -11.155 4.475  1.00 0.00 ? 247 ASP A CA   1  
ATOM 571   C C    . ASP A 1 45 ? 1.858   -12.247 5.026  1.00 0.00 ? 247 ASP A C    1  
ATOM 572   O O    . ASP A 1 45 ? 1.788   -13.345 4.476  1.00 0.00 ? 247 ASP A O    1  
ATOM 573   C CB   . ASP A 1 45 ? 4.209   -11.384 4.956  1.00 0.00 ? 247 ASP A CB   1  
ATOM 574   C CG   . ASP A 1 45 ? 5.234   -10.723 4.055  1.00 0.00 ? 247 ASP A CG   1  
ATOM 575   O OD1  . ASP A 1 45 ? 5.248   -11.032 2.845  1.00 0.00 ? 247 ASP A OD1  1  
ATOM 576   O OD2  . ASP A 1 45 ? 6.022   -9.896  4.559  1.00 0.00 ? 247 ASP A OD2  1  
ATOM 577   H H    . ASP A 1 45 ? 2.853   -9.319  5.520  1.00 0.00 ? 247 ASP A H    1  
ATOM 578   H HA   . ASP A 1 45 ? 2.757   -11.196 3.395  1.00 0.00 ? 247 ASP A HA   1  
ATOM 579   H HB2  . ASP A 1 45 ? 4.317   -10.975 5.950  1.00 0.00 ? 247 ASP A HB2  1  
ATOM 580   H HB3  . ASP A 1 45 ? 4.412   -12.443 4.985  1.00 0.00 ? 247 ASP A HB3  1  
ATOM 581   N N    . GLU A 1 46 ? 1.160   -11.936 6.114  1.00 0.00 ? 248 GLU A N    1  
ATOM 582   C CA   . GLU A 1 46 ? 0.250   -12.891 6.737  1.00 0.00 ? 248 GLU A CA   1  
ATOM 583   C C    . GLU A 1 46 ? -1.048  -12.205 7.162  1.00 0.00 ? 248 GLU A C    1  
ATOM 584   O O    . GLU A 1 46 ? -1.138  -10.978 7.158  1.00 0.00 ? 248 GLU A O    1  
ATOM 585   C CB   . GLU A 1 46 ? 0.922   -13.546 7.946  1.00 0.00 ? 248 GLU A CB   1  
ATOM 586   C CG   . GLU A 1 46 ? 1.433   -14.949 7.670  1.00 0.00 ? 248 GLU A CG   1  
ATOM 587   C CD   . GLU A 1 46 ? 2.604   -15.328 8.556  1.00 0.00 ? 248 GLU A CD   1  
ATOM 588   O OE1  . GLU A 1 46 ? 2.505   -15.134 9.787  1.00 0.00 ? 248 GLU A OE1  1  
ATOM 589   O OE2  . GLU A 1 46 ? 3.621   -15.816 8.020  1.00 0.00 ? 248 GLU A OE2  1  
ATOM 590   H H    . GLU A 1 46 ? 1.258   -11.045 6.507  1.00 0.00 ? 248 GLU A H    1  
ATOM 591   H HA   . GLU A 1 46 ? 0.016   -13.653 6.008  1.00 0.00 ? 248 GLU A HA   1  
ATOM 592   H HB2  . GLU A 1 46 ? 1.758   -12.935 8.254  1.00 0.00 ? 248 GLU A HB2  1  
ATOM 593   H HB3  . GLU A 1 46 ? 0.209   -13.598 8.758  1.00 0.00 ? 248 GLU A HB3  1  
ATOM 594   H HG2  . GLU A 1 46 ? 0.631   -15.653 7.841  1.00 0.00 ? 248 GLU A HG2  1  
ATOM 595   H HG3  . GLU A 1 46 ? 1.748   -15.008 6.639  1.00 0.00 ? 248 GLU A HG3  1  
ATOM 596   N N    . PRO A 1 47 ? -2.075  -12.991 7.534  1.00 0.00 ? 249 PRO A N    1  
ATOM 597   C CA   . PRO A 1 47 ? -3.370  -12.447 7.960  1.00 0.00 ? 249 PRO A CA   1  
ATOM 598   C C    . PRO A 1 47 ? -3.266  -11.661 9.264  1.00 0.00 ? 249 PRO A C    1  
ATOM 599   O O    . PRO A 1 47 ? -3.757  -12.096 10.306 1.00 0.00 ? 249 PRO A O    1  
ATOM 600   C CB   . PRO A 1 47 ? -4.241  -13.693 8.151  1.00 0.00 ? 249 PRO A CB   1  
ATOM 601   C CG   . PRO A 1 47 ? -3.276  -14.804 8.377  1.00 0.00 ? 249 PRO A CG   1  
ATOM 602   C CD   . PRO A 1 47 ? -2.059  -14.466 7.566  1.00 0.00 ? 249 PRO A CD   1  
ATOM 603   H HA   . PRO A 1 47 ? -3.802  -11.817 7.197  1.00 0.00 ? 249 PRO A HA   1  
ATOM 604   H HB2  . PRO A 1 47 ? -4.891  -13.554 9.004  1.00 0.00 ? 249 PRO A HB2  1  
ATOM 605   H HB3  . PRO A 1 47 ? -4.835  -13.860 7.264  1.00 0.00 ? 249 PRO A HB3  1  
ATOM 606   H HG2  . PRO A 1 47 ? -3.024  -14.866 9.425  1.00 0.00 ? 249 PRO A HG2  1  
ATOM 607   H HG3  . PRO A 1 47 ? -3.704  -15.737 8.040  1.00 0.00 ? 249 PRO A HG3  1  
ATOM 608   H HD2  . PRO A 1 47 ? -1.168  -14.832 8.053  1.00 0.00 ? 249 PRO A HD2  1  
ATOM 609   H HD3  . PRO A 1 47 ? -2.142  -14.873 6.570  1.00 0.00 ? 249 PRO A HD3  1  
ATOM 610   N N    . LEU A 1 48 ? -2.622  -10.502 9.195  1.00 0.00 ? 250 LEU A N    1  
ATOM 611   C CA   . LEU A 1 48 ? -2.450  -9.648  10.365 1.00 0.00 ? 250 LEU A CA   1  
ATOM 612   C C    . LEU A 1 48 ? -2.944  -8.231  10.089 1.00 0.00 ? 250 LEU A C    1  
ATOM 613   O O    . LEU A 1 48 ? -2.461  -7.270  10.686 1.00 0.00 ? 250 LEU A O    1  
ATOM 614   C CB   . LEU A 1 48 ? -0.979  -9.617  10.788 1.00 0.00 ? 250 LEU A CB   1  
ATOM 615   C CG   . LEU A 1 48 ? 0.028   -9.571  9.634  1.00 0.00 ? 250 LEU A CG   1  
ATOM 616   C CD1  . LEU A 1 48 ? 0.944   -8.365  9.768  1.00 0.00 ? 250 LEU A CD1  1  
ATOM 617   C CD2  . LEU A 1 48 ? 0.843   -10.854 9.584  1.00 0.00 ? 250 LEU A CD2  1  
ATOM 618   H H    . LEU A 1 48 ? -2.257  -10.211 8.334  1.00 0.00 ? 250 LEU A H    1  
ATOM 619   H HA   . LEU A 1 48 ? -3.036  -10.069 11.169 1.00 0.00 ? 250 LEU A HA   1  
ATOM 620   H HB2  . LEU A 1 48 ? -0.827  -8.746  11.410 1.00 0.00 ? 250 LEU A HB2  1  
ATOM 621   H HB3  . LEU A 1 48 ? -0.778  -10.498 11.378 1.00 0.00 ? 250 LEU A HB3  1  
ATOM 622   H HG   . LEU A 1 48 ? -0.508  -9.476  8.702  1.00 0.00 ? 250 LEU A HG   1  
ATOM 623   H HD11 . LEU A 1 48 ? 1.638   -8.347  8.943  1.00 0.00 ? 250 LEU A HD11 1  
ATOM 624   H HD12 . LEU A 1 48 ? 0.353   -7.462  9.762  1.00 0.00 ? 250 LEU A HD12 1  
ATOM 625   H HD13 . LEU A 1 48 ? 1.490   -8.430  10.697 1.00 0.00 ? 250 LEU A HD13 1  
ATOM 626   H HD21 . LEU A 1 48 ? 1.407   -10.958 10.497 1.00 0.00 ? 250 LEU A HD21 1  
ATOM 627   H HD22 . LEU A 1 48 ? 0.178   -11.698 9.474  1.00 0.00 ? 250 LEU A HD22 1  
ATOM 628   H HD23 . LEU A 1 48 ? 1.520   -10.819 8.743  1.00 0.00 ? 250 LEU A HD23 1  
ATOM 629   N N    . GLY A 1 49 ? -3.907  -8.109  9.181  1.00 0.00 ? 251 GLY A N    1  
ATOM 630   C CA   . GLY A 1 49 ? -4.445  -6.803  8.844  1.00 0.00 ? 251 GLY A CA   1  
ATOM 631   C C    . GLY A 1 49 ? -5.866  -6.617  9.339  1.00 0.00 ? 251 GLY A C    1  
ATOM 632   O O    . GLY A 1 49 ? -6.381  -7.441  10.095 1.00 0.00 ? 251 GLY A O    1  
ATOM 633   H H    . GLY A 1 49 ? -4.255  -8.909  8.735  1.00 0.00 ? 251 GLY A H    1  
ATOM 634   H HA2  . GLY A 1 49 ? -3.820  -6.043  9.289  1.00 0.00 ? 251 GLY A HA2  1  
ATOM 635   H HA3  . GLY A 1 49 ? -4.430  -6.684  7.771  1.00 0.00 ? 251 GLY A HA3  1  
ATOM 636   N N    . LYS A 1 50 ? -6.501  -5.528  8.913  1.00 0.00 ? 252 LYS A N    1  
ATOM 637   C CA   . LYS A 1 50 ? -7.872  -5.236  9.322  1.00 0.00 ? 252 LYS A CA   1  
ATOM 638   C C    . LYS A 1 50 ? -8.816  -5.250  8.124  1.00 0.00 ? 252 LYS A C    1  
ATOM 639   O O    . LYS A 1 50 ? -9.977  -5.641  8.244  1.00 0.00 ? 252 LYS A O    1  
ATOM 640   C CB   . LYS A 1 50 ? -7.941  -3.876  10.020 1.00 0.00 ? 252 LYS A CB   1  
ATOM 641   C CG   . LYS A 1 50 ? -6.766  -3.601  10.947 1.00 0.00 ? 252 LYS A CG   1  
ATOM 642   C CD   . LYS A 1 50 ? -6.868  -4.403  12.233 1.00 0.00 ? 252 LYS A CD   1  
ATOM 643   C CE   . LYS A 1 50 ? -5.514  -4.547  12.910 1.00 0.00 ? 252 LYS A CE   1  
ATOM 644   N NZ   . LYS A 1 50 ? -5.623  -5.217  14.234 1.00 0.00 ? 252 LYS A NZ   1  
ATOM 645   H H    . LYS A 1 50 ? -6.037  -4.907  8.314  1.00 0.00 ? 252 LYS A H    1  
ATOM 646   H HA   . LYS A 1 50 ? -8.181  -6.003  10.016 1.00 0.00 ? 252 LYS A HA   1  
ATOM 647   H HB2  . LYS A 1 50 ? -7.967  -3.101  9.270  1.00 0.00 ? 252 LYS A HB2  1  
ATOM 648   H HB3  . LYS A 1 50 ? -8.848  -3.831  10.604 1.00 0.00 ? 252 LYS A HB3  1  
ATOM 649   H HG2  . LYS A 1 50 ? -5.851  -3.870  10.439 1.00 0.00 ? 252 LYS A HG2  1  
ATOM 650   H HG3  . LYS A 1 50 ? -6.750  -2.548  11.190 1.00 0.00 ? 252 LYS A HG3  1  
ATOM 651   H HD2  . LYS A 1 50 ? -7.545  -3.899  12.907 1.00 0.00 ? 252 LYS A HD2  1  
ATOM 652   H HD3  . LYS A 1 50 ? -7.253  -5.387  12.003 1.00 0.00 ? 252 LYS A HD3  1  
ATOM 653   H HE2  . LYS A 1 50 ? -4.869  -5.131  12.272 1.00 0.00 ? 252 LYS A HE2  1  
ATOM 654   H HE3  . LYS A 1 50 ? -5.090  -3.564  13.046 1.00 0.00 ? 252 LYS A HE3  1  
ATOM 655   H HZ1  . LYS A 1 50 ? -4.796  -5.828  14.393 1.00 0.00 ? 252 LYS A HZ1  1  
ATOM 656   H HZ2  . LYS A 1 50 ? -6.484  -5.801  14.269 1.00 0.00 ? 252 LYS A HZ2  1  
ATOM 657   H HZ3  . LYS A 1 50 ? -5.668  -4.507  14.991 1.00 0.00 ? 252 LYS A HZ3  1  
ATOM 658   N N    . ASN A 1 51 ? -8.316  -4.817  6.971  1.00 0.00 ? 253 ASN A N    1  
ATOM 659   C CA   . ASN A 1 51 ? -9.122  -4.778  5.754  1.00 0.00 ? 253 ASN A CA   1  
ATOM 660   C C    . ASN A 1 51 ? -8.491  -5.622  4.651  1.00 0.00 ? 253 ASN A C    1  
ATOM 661   O O    . ASN A 1 51 ? -7.338  -6.039  4.755  1.00 0.00 ? 253 ASN A O    1  
ATOM 662   C CB   . ASN A 1 51 ? -9.292  -3.333  5.275  1.00 0.00 ? 253 ASN A CB   1  
ATOM 663   C CG   . ASN A 1 51 ? -7.979  -2.705  4.849  1.00 0.00 ? 253 ASN A CG   1  
ATOM 664   O OD1  . ASN A 1 51 ? -7.721  -2.527  3.657  1.00 0.00 ? 253 ASN A OD1  1  
ATOM 665   N ND2  . ASN A 1 51 ? -7.141  -2.366  5.820  1.00 0.00 ? 253 ASN A ND2  1  
ATOM 666   H H    . ASN A 1 51 ? -7.385  -4.515  6.935  1.00 0.00 ? 253 ASN A H    1  
ATOM 667   H HA   . ASN A 1 51 ? -10.094 -5.186  5.990  1.00 0.00 ? 253 ASN A HA   1  
ATOM 668   H HB2  . ASN A 1 51 ? -9.966  -3.318  4.432  1.00 0.00 ? 253 ASN A HB2  1  
ATOM 669   H HB3  . ASN A 1 51 ? -9.710  -2.743  6.076  1.00 0.00 ? 253 ASN A HB3  1  
ATOM 670   H HD21 . ASN A 1 51 ? -7.414  -2.538  6.749  1.00 0.00 ? 253 ASN A HD21 1  
ATOM 671   H HD22 . ASN A 1 51 ? -6.284  -1.957  5.572  1.00 0.00 ? 253 ASN A HD22 1  
ATOM 672   N N    . ASP A 1 52 ? -9.258  -5.869  3.594  1.00 0.00 ? 254 ASP A N    1  
ATOM 673   C CA   . ASP A 1 52 ? -8.778  -6.665  2.468  1.00 0.00 ? 254 ASP A CA   1  
ATOM 674   C C    . ASP A 1 52 ? -8.318  -5.771  1.319  1.00 0.00 ? 254 ASP A C    1  
ATOM 675   O O    . ASP A 1 52 ? -8.323  -6.185  0.160  1.00 0.00 ? 254 ASP A O    1  
ATOM 676   C CB   . ASP A 1 52 ? -9.877  -7.614  1.986  1.00 0.00 ? 254 ASP A CB   1  
ATOM 677   C CG   . ASP A 1 52 ? -11.082 -6.878  1.434  1.00 0.00 ? 254 ASP A CG   1  
ATOM 678   O OD1  . ASP A 1 52 ? -11.790 -6.223  2.227  1.00 0.00 ? 254 ASP A OD1  1  
ATOM 679   O OD2  . ASP A 1 52 ? -11.317 -6.956  0.210  1.00 0.00 ? 254 ASP A OD2  1  
ATOM 680   H H    . ASP A 1 52 ? -10.169 -5.510  3.571  1.00 0.00 ? 254 ASP A H    1  
ATOM 681   H HA   . ASP A 1 52 ? -7.938  -7.248  2.811  1.00 0.00 ? 254 ASP A HA   1  
ATOM 682   H HB2  . ASP A 1 52 ? -9.479  -8.249  1.207  1.00 0.00 ? 254 ASP A HB2  1  
ATOM 683   H HB3  . ASP A 1 52 ? -10.200 -8.230  2.812  1.00 0.00 ? 254 ASP A HB3  1  
ATOM 684   N N    . GLY A 1 53 ? -7.917  -4.546  1.645  1.00 0.00 ? 255 GLY A N    1  
ATOM 685   C CA   . GLY A 1 53 ? -7.455  -3.621  0.626  1.00 0.00 ? 255 GLY A CA   1  
ATOM 686   C C    . GLY A 1 53 ? -8.468  -2.534  0.310  1.00 0.00 ? 255 GLY A C    1  
ATOM 687   O O    . GLY A 1 53 ? -8.372  -1.873  -0.724 1.00 0.00 ? 255 GLY A O    1  
ATOM 688   H H    . GLY A 1 53 ? -7.928  -4.269  2.586  1.00 0.00 ? 255 GLY A H    1  
ATOM 689   H HA2  . GLY A 1 53 ? -6.542  -3.156  0.965  1.00 0.00 ? 255 GLY A HA2  1  
ATOM 690   H HA3  . GLY A 1 53 ? -7.249  -4.176  -0.278 1.00 0.00 ? 255 GLY A HA3  1  
ATOM 691   N N    . ALA A 1 54 ? -9.438  -2.345  1.200  1.00 0.00 ? 256 ALA A N    1  
ATOM 692   C CA   . ALA A 1 54 ? -10.463 -1.328  1.001  1.00 0.00 ? 256 ALA A CA   1  
ATOM 693   C C    . ALA A 1 54 ? -10.762 -0.583  2.299  1.00 0.00 ? 256 ALA A C    1  
ATOM 694   O O    . ALA A 1 54 ? -10.479 -1.079  3.390  1.00 0.00 ? 256 ALA A O    1  
ATOM 695   C CB   . ALA A 1 54 ? -11.733 -1.958  0.444  1.00 0.00 ? 256 ALA A CB   1  
ATOM 696   H H    . ALA A 1 54 ? -9.465  -2.899  2.008  1.00 0.00 ? 256 ALA A H    1  
ATOM 697   H HA   . ALA A 1 54 ? -10.094 -0.622  0.274  1.00 0.00 ? 256 ALA A HA   1  
ATOM 698   H HB1  . ALA A 1 54 ? -12.125 -2.668  1.158  1.00 0.00 ? 256 ALA A HB1  1  
ATOM 699   H HB2  . ALA A 1 54 ? -12.467 -1.188  0.262  1.00 0.00 ? 256 ALA A HB2  1  
ATOM 700   H HB3  . ALA A 1 54 ? -11.505 -2.467  -0.481 1.00 0.00 ? 256 ALA A HB3  1  
ATOM 701   N N    . VAL A 1 55 ? -11.332 0.610   2.172  1.00 0.00 ? 257 VAL A N    1  
ATOM 702   C CA   . VAL A 1 55 ? -11.667 1.427   3.331  1.00 0.00 ? 257 VAL A CA   1  
ATOM 703   C C    . VAL A 1 55 ? -12.923 2.255   3.078  1.00 0.00 ? 257 VAL A C    1  
ATOM 704   O O    . VAL A 1 55 ? -12.976 3.052   2.141  1.00 0.00 ? 257 VAL A O    1  
ATOM 705   C CB   . VAL A 1 55 ? -10.508 2.372   3.703  1.00 0.00 ? 257 VAL A CB   1  
ATOM 706   C CG1  . VAL A 1 55 ? -10.832 3.155   4.967  1.00 0.00 ? 257 VAL A CG1  1  
ATOM 707   C CG2  . VAL A 1 55 ? -9.214  1.587   3.868  1.00 0.00 ? 257 VAL A CG2  1  
ATOM 708   H H    . VAL A 1 55 ? -11.531 0.951   1.274  1.00 0.00 ? 257 VAL A H    1  
ATOM 709   H HA   . VAL A 1 55 ? -11.846 0.764   4.165  1.00 0.00 ? 257 VAL A HA   1  
ATOM 710   H HB   . VAL A 1 55 ? -10.372 3.078   2.896  1.00 0.00 ? 257 VAL A HB   1  
ATOM 711   H HG11 . VAL A 1 55 ? -11.736 2.765   5.412  1.00 0.00 ? 257 VAL A HG11 1  
ATOM 712   H HG12 . VAL A 1 55 ? -10.017 3.063   5.670  1.00 0.00 ? 257 VAL A HG12 1  
ATOM 713   H HG13 . VAL A 1 55 ? -10.974 4.197   4.718  1.00 0.00 ? 257 VAL A HG13 1  
ATOM 714   H HG21 . VAL A 1 55 ? -9.409  0.688   4.434  1.00 0.00 ? 257 VAL A HG21 1  
ATOM 715   H HG22 . VAL A 1 55 ? -8.825  1.323   2.896  1.00 0.00 ? 257 VAL A HG22 1  
ATOM 716   H HG23 . VAL A 1 55 ? -8.490  2.192   4.393  1.00 0.00 ? 257 VAL A HG23 1  
ATOM 717   N N    . ALA A 1 56 ? -13.933 2.063   3.922  1.00 0.00 ? 258 ALA A N    1  
ATOM 718   C CA   . ALA A 1 56 ? -15.188 2.794   3.793  1.00 0.00 ? 258 ALA A CA   1  
ATOM 719   C C    . ALA A 1 56 ? -15.813 2.585   2.418  1.00 0.00 ? 258 ALA A C    1  
ATOM 720   O O    . ALA A 1 56 ? -16.425 3.494   1.859  1.00 0.00 ? 258 ALA A O    1  
ATOM 721   C CB   . ALA A 1 56 ? -14.964 4.276   4.051  1.00 0.00 ? 258 ALA A CB   1  
ATOM 722   H H    . ALA A 1 56 ? -13.829 1.416   4.650  1.00 0.00 ? 258 ALA A H    1  
ATOM 723   H HA   . ALA A 1 56 ? -15.870 2.421   4.545  1.00 0.00 ? 258 ALA A HA   1  
ATOM 724   H HB1  . ALA A 1 56 ? -15.904 4.801   3.975  1.00 0.00 ? 258 ALA A HB1  1  
ATOM 725   H HB2  . ALA A 1 56 ? -14.556 4.411   5.043  1.00 0.00 ? 258 ALA A HB2  1  
ATOM 726   H HB3  . ALA A 1 56 ? -14.272 4.667   3.322  1.00 0.00 ? 258 ALA A HB3  1  
ATOM 727   N N    . GLY A 1 57 ? -15.652 1.382   1.875  1.00 0.00 ? 259 GLY A N    1  
ATOM 728   C CA   . GLY A 1 57 ? -16.204 1.078   0.568  1.00 0.00 ? 259 GLY A CA   1  
ATOM 729   C C    . GLY A 1 57 ? -15.321 1.560   -0.567 1.00 0.00 ? 259 GLY A C    1  
ATOM 730   O O    . GLY A 1 57 ? -15.737 1.556   -1.727 1.00 0.00 ? 259 GLY A O    1  
ATOM 731   H H    . GLY A 1 57 ? -15.152 0.697   2.366  1.00 0.00 ? 259 GLY A H    1  
ATOM 732   H HA2  . GLY A 1 57 ? -16.328 0.009   0.483  1.00 0.00 ? 259 GLY A HA2  1  
ATOM 733   H HA3  . GLY A 1 57 ? -17.171 1.550   0.482  1.00 0.00 ? 259 GLY A HA3  1  
ATOM 734   N N    . THR A 1 58 ? -14.100 1.976   -0.239 1.00 0.00 ? 260 THR A N    1  
ATOM 735   C CA   . THR A 1 58 ? -13.161 2.461   -1.244 1.00 0.00 ? 260 THR A CA   1  
ATOM 736   C C    . THR A 1 58 ? -11.929 1.565   -1.310 1.00 0.00 ? 260 THR A C    1  
ATOM 737   O O    . THR A 1 58 ? -11.150 1.496   -0.360 1.00 0.00 ? 260 THR A O    1  
ATOM 738   C CB   . THR A 1 58 ? -12.745 3.898   -0.932 1.00 0.00 ? 260 THR A CB   1  
ATOM 739   O OG1  . THR A 1 58 ? -13.878 4.696   -0.638 1.00 0.00 ? 260 THR A OG1  1  
ATOM 740   C CG2  . THR A 1 58 ? -11.995 4.565   -2.064 1.00 0.00 ? 260 THR A CG2  1  
ATOM 741   H H    . THR A 1 58 ? -13.824 1.955   0.699  1.00 0.00 ? 260 THR A H    1  
ATOM 742   H HA   . THR A 1 58 ? -13.659 2.439   -2.201 1.00 0.00 ? 260 THR A HA   1  
ATOM 743   H HB   . THR A 1 58 ? -12.099 3.895   -0.065 1.00 0.00 ? 260 THR A HB   1  
ATOM 744   H HG1  . THR A 1 58 ? -13.597 5.595   -0.449 1.00 0.00 ? 260 THR A HG1  1  
ATOM 745   H HG21 . THR A 1 58 ? -10.948 4.640   -1.808 1.00 0.00 ? 260 THR A HG21 1  
ATOM 746   H HG22 . THR A 1 58 ? -12.396 5.553   -2.231 1.00 0.00 ? 260 THR A HG22 1  
ATOM 747   H HG23 . THR A 1 58 ? -12.102 3.976   -2.964 1.00 0.00 ? 260 THR A HG23 1  
ATOM 748   N N    . ARG A 1 59 ? -11.758 0.882   -2.438 1.00 0.00 ? 261 ARG A N    1  
ATOM 749   C CA   . ARG A 1 59 ? -10.618 -0.009  -2.623 1.00 0.00 ? 261 ARG A CA   1  
ATOM 750   C C    . ARG A 1 59 ? -9.427  0.748   -3.202 1.00 0.00 ? 261 ARG A C    1  
ATOM 751   O O    . ARG A 1 59 ? -9.468  1.210   -4.343 1.00 0.00 ? 261 ARG A O    1  
ATOM 752   C CB   . ARG A 1 59 ? -10.996 -1.172  -3.541 1.00 0.00 ? 261 ARG A CB   1  
ATOM 753   C CG   . ARG A 1 59 ? -9.946  -2.271  -3.595 1.00 0.00 ? 261 ARG A CG   1  
ATOM 754   C CD   . ARG A 1 59 ? -8.920  -2.009  -4.686 1.00 0.00 ? 261 ARG A CD   1  
ATOM 755   N NE   . ARG A 1 59 ? -9.546  -1.803  -5.990 1.00 0.00 ? 261 ARG A NE   1  
ATOM 756   C CZ   . ARG A 1 59 ? -9.988  -2.791  -6.765 1.00 0.00 ? 261 ARG A CZ   1  
ATOM 757   N NH1  . ARG A 1 59 ? -9.876  -4.054  -6.372 1.00 0.00 ? 261 ARG A NH1  1  
ATOM 758   N NH2  . ARG A 1 59 ? -10.544 -2.516  -7.937 1.00 0.00 ? 261 ARG A NH2  1  
ATOM 759   H H    . ARG A 1 59 ? -12.413 0.978   -3.160 1.00 0.00 ? 261 ARG A H    1  
ATOM 760   H HA   . ARG A 1 59 ? -10.344 -0.400  -1.656 1.00 0.00 ? 261 ARG A HA   1  
ATOM 761   H HB2  . ARG A 1 59 ? -11.922 -1.605  -3.192 1.00 0.00 ? 261 ARG A HB2  1  
ATOM 762   H HB3  . ARG A 1 59 ? -11.143 -0.794  -4.542 1.00 0.00 ? 261 ARG A HB3  1  
ATOM 763   H HG2  . ARG A 1 59 ? -9.440  -2.319  -2.642 1.00 0.00 ? 261 ARG A HG2  1  
ATOM 764   H HG3  . ARG A 1 59 ? -10.436 -3.213  -3.793 1.00 0.00 ? 261 ARG A HG3  1  
ATOM 765   H HD2  . ARG A 1 59 ? -8.352  -1.129  -4.426 1.00 0.00 ? 261 ARG A HD2  1  
ATOM 766   H HD3  . ARG A 1 59 ? -8.256  -2.860  -4.747 1.00 0.00 ? 261 ARG A HD3  1  
ATOM 767   H HE   . ARG A 1 59 ? -9.642  -0.880  -6.305 1.00 0.00 ? 261 ARG A HE   1  
ATOM 768   H HH11 . ARG A 1 59 ? -9.458  -4.268  -5.489 1.00 0.00 ? 261 ARG A HH11 1  
ATOM 769   H HH12 . ARG A 1 59 ? -10.209 -4.791  -6.959 1.00 0.00 ? 261 ARG A HH12 1  
ATOM 770   H HH21 . ARG A 1 59 ? -10.630 -1.566  -8.238 1.00 0.00 ? 261 ARG A HH21 1  
ATOM 771   H HH22 . ARG A 1 59 ? -10.876 -3.258  -8.519 1.00 0.00 ? 261 ARG A HH22 1  
ATOM 772   N N    . TYR A 1 60 ? -8.370  0.871   -2.409 1.00 0.00 ? 262 TYR A N    1  
ATOM 773   C CA   . TYR A 1 60 ? -7.167  1.571   -2.844 1.00 0.00 ? 262 TYR A CA   1  
ATOM 774   C C    . TYR A 1 60 ? -6.238  0.629   -3.603 1.00 0.00 ? 262 TYR A C    1  
ATOM 775   O O    . TYR A 1 60 ? -5.553  1.038   -4.542 1.00 0.00 ? 262 TYR A O    1  
ATOM 776   C CB   . TYR A 1 60 ? -6.439  2.169   -1.640 1.00 0.00 ? 262 TYR A CB   1  
ATOM 777   C CG   . TYR A 1 60 ? -7.198  3.295   -0.975 1.00 0.00 ? 262 TYR A CG   1  
ATOM 778   C CD1  . TYR A 1 60 ? -8.301  3.038   -0.170 1.00 0.00 ? 262 TYR A CD1  1  
ATOM 779   C CD2  . TYR A 1 60 ? -6.812  4.619   -1.155 1.00 0.00 ? 262 TYR A CD2  1  
ATOM 780   C CE1  . TYR A 1 60 ? -8.998  4.064   0.436  1.00 0.00 ? 262 TYR A CE1  1  
ATOM 781   C CE2  . TYR A 1 60 ? -7.505  5.651   -0.551 1.00 0.00 ? 262 TYR A CE2  1  
ATOM 782   C CZ   . TYR A 1 60 ? -8.597  5.369   0.243  1.00 0.00 ? 262 TYR A CZ   1  
ATOM 783   O OH   . TYR A 1 60 ? -9.289  6.394   0.845  1.00 0.00 ? 262 TYR A OH   1  
ATOM 784   H H    . TYR A 1 60 ? -8.396  0.481   -1.510 1.00 0.00 ? 262 TYR A H    1  
ATOM 785   H HA   . TYR A 1 60 ? -7.469  2.369   -3.505 1.00 0.00 ? 262 TYR A HA   1  
ATOM 786   H HB2  . TYR A 1 60 ? -6.280  1.397   -0.904 1.00 0.00 ? 262 TYR A HB2  1  
ATOM 787   H HB3  . TYR A 1 60 ? -5.483  2.556   -1.961 1.00 0.00 ? 262 TYR A HB3  1  
ATOM 788   H HD1  . TYR A 1 60 ? -8.613  2.014   -0.021 1.00 0.00 ? 262 TYR A HD1  1  
ATOM 789   H HD2  . TYR A 1 60 ? -5.958  4.837   -1.778 1.00 0.00 ? 262 TYR A HD2  1  
ATOM 790   H HE1  . TYR A 1 60 ? -9.852  3.843   1.058  1.00 0.00 ? 262 TYR A HE1  1  
ATOM 791   H HE2  . TYR A 1 60 ? -7.189  6.673   -0.702 1.00 0.00 ? 262 TYR A HE2  1  
ATOM 792   H HH   . TYR A 1 60 ? -10.231 6.212   0.805  1.00 0.00 ? 262 TYR A HH   1  
ATOM 793   N N    . PHE A 1 61 ? -6.225  -0.635  -3.194 1.00 0.00 ? 263 PHE A N    1  
ATOM 794   C CA   . PHE A 1 61 ? -5.386  -1.640  -3.836 1.00 0.00 ? 263 PHE A CA   1  
ATOM 795   C C    . PHE A 1 61 ? -5.979  -3.032  -3.653 1.00 0.00 ? 263 PHE A C    1  
ATOM 796   O O    . PHE A 1 61 ? -6.921  -3.219  -2.884 1.00 0.00 ? 263 PHE A O    1  
ATOM 797   C CB   . PHE A 1 61 ? -3.965  -1.595  -3.269 1.00 0.00 ? 263 PHE A CB   1  
ATOM 798   C CG   . PHE A 1 61 ? -3.916  -1.493  -1.773 1.00 0.00 ? 263 PHE A CG   1  
ATOM 799   C CD1  . PHE A 1 61 ? -4.083  -0.271  -1.143 1.00 0.00 ? 263 PHE A CD1  1  
ATOM 800   C CD2  . PHE A 1 61 ? -3.699  -2.621  -0.995 1.00 0.00 ? 263 PHE A CD2  1  
ATOM 801   C CE1  . PHE A 1 61 ? -4.036  -0.173  0.234  1.00 0.00 ? 263 PHE A CE1  1  
ATOM 802   C CE2  . PHE A 1 61 ? -3.651  -2.528  0.383  1.00 0.00 ? 263 PHE A CE2  1  
ATOM 803   C CZ   . PHE A 1 61 ? -3.818  -1.304  0.998  1.00 0.00 ? 263 PHE A CZ   1  
ATOM 804   H H    . PHE A 1 61 ? -6.796  -0.899  -2.444 1.00 0.00 ? 263 PHE A H    1  
ATOM 805   H HA   . PHE A 1 61 ? -5.350  -1.415  -4.892 1.00 0.00 ? 263 PHE A HA   1  
ATOM 806   H HB2  . PHE A 1 61 ? -3.442  -2.493  -3.558 1.00 0.00 ? 263 PHE A HB2  1  
ATOM 807   H HB3  . PHE A 1 61 ? -3.450  -0.737  -3.678 1.00 0.00 ? 263 PHE A HB3  1  
ATOM 808   H HD1  . PHE A 1 61 ? -4.253  0.613   -1.740 1.00 0.00 ? 263 PHE A HD1  1  
ATOM 809   H HD2  . PHE A 1 61 ? -3.568  -3.578  -1.475 1.00 0.00 ? 263 PHE A HD2  1  
ATOM 810   H HE1  . PHE A 1 61 ? -4.166  0.786   0.712  1.00 0.00 ? 263 PHE A HE1  1  
ATOM 811   H HE2  . PHE A 1 61 ? -3.481  -3.414  0.978  1.00 0.00 ? 263 PHE A HE2  1  
ATOM 812   H HZ   . PHE A 1 61 ? -3.781  -1.230  2.075  1.00 0.00 ? 263 PHE A HZ   1  
ATOM 813   N N    . GLN A 1 62 ? -5.424  -4.007  -4.366 1.00 0.00 ? 264 GLN A N    1  
ATOM 814   C CA   . GLN A 1 62 ? -5.903  -5.383  -4.280 1.00 0.00 ? 264 GLN A CA   1  
ATOM 815   C C    . GLN A 1 62 ? -4.945  -6.245  -3.466 1.00 0.00 ? 264 GLN A C    1  
ATOM 816   O O    . GLN A 1 62 ? -3.746  -6.288  -3.741 1.00 0.00 ? 264 GLN A O    1  
ATOM 817   C CB   . GLN A 1 62 ? -6.075  -5.973  -5.680 1.00 0.00 ? 264 GLN A CB   1  
ATOM 818   C CG   . GLN A 1 62 ? -6.845  -7.285  -5.697 1.00 0.00 ? 264 GLN A CG   1  
ATOM 819   C CD   . GLN A 1 62 ? -8.345  -7.080  -5.623 1.00 0.00 ? 264 GLN A CD   1  
ATOM 820   O OE1  . GLN A 1 62 ? -9.041  -7.135  -6.638 1.00 0.00 ? 264 GLN A OE1  1  
ATOM 821   N NE2  . GLN A 1 62 ? -8.853  -6.843  -4.420 1.00 0.00 ? 264 GLN A NE2  1  
ATOM 822   H H    . GLN A 1 62 ? -4.677  -3.798  -4.964 1.00 0.00 ? 264 GLN A H    1  
ATOM 823   H HA   . GLN A 1 62 ? -6.862  -5.366  -3.785 1.00 0.00 ? 264 GLN A HA   1  
ATOM 824   H HB2  . GLN A 1 62 ? -6.606  -5.262  -6.296 1.00 0.00 ? 264 GLN A HB2  1  
ATOM 825   H HB3  . GLN A 1 62 ? -5.100  -6.149  -6.107 1.00 0.00 ? 264 GLN A HB3  1  
ATOM 826   H HG2  . GLN A 1 62 ? -6.612  -7.811  -6.609 1.00 0.00 ? 264 GLN A HG2  1  
ATOM 827   H HG3  . GLN A 1 62 ? -6.535  -7.879  -4.849 1.00 0.00 ? 264 GLN A HG3  1  
ATOM 828   H HE21 . GLN A 1 62 ? -8.240  -6.812  -3.656 1.00 0.00 ? 264 GLN A HE21 1  
ATOM 829   H HE22 . GLN A 1 62 ? -9.821  -6.708  -4.344 1.00 0.00 ? 264 GLN A HE22 1  
ATOM 830   N N    . CYS A 1 63 ? -5.485  -6.929  -2.463 1.00 0.00 ? 265 CYS A N    1  
ATOM 831   C CA   . CYS A 1 63 ? -4.680  -7.792  -1.607 1.00 0.00 ? 265 CYS A CA   1  
ATOM 832   C C    . CYS A 1 63 ? -5.532  -8.900  -0.996 1.00 0.00 ? 265 CYS A C    1  
ATOM 833   O O    . CYS A 1 63 ? -6.758  -8.811  -0.971 1.00 0.00 ? 265 CYS A O    1  
ATOM 834   C CB   . CYS A 1 63 ? -4.017  -6.973  -0.499 1.00 0.00 ? 265 CYS A CB   1  
ATOM 835   S SG   . CYS A 1 63 ? -5.159  -5.917  0.423  1.00 0.00 ? 265 CYS A SG   1  
ATOM 836   H H    . CYS A 1 63 ? -6.447  -6.854  -2.296 1.00 0.00 ? 265 CYS A H    1  
ATOM 837   H HA   . CYS A 1 63 ? -3.911  -8.242  -2.219 1.00 0.00 ? 265 CYS A HA   1  
ATOM 838   H HB2  . CYS A 1 63 ? -3.549  -7.645  0.206  1.00 0.00 ? 265 CYS A HB2  1  
ATOM 839   H HB3  . CYS A 1 63 ? -3.259  -6.337  -0.935 1.00 0.00 ? 265 CYS A HB3  1  
ATOM 840   H HG   . CYS A 1 63 ? -4.664  -5.486  1.124  1.00 0.00 ? 265 CYS A HG   1  
ATOM 841   N N    . GLN A 1 64 ? -4.871  -9.942  -0.503 1.00 0.00 ? 266 GLN A N    1  
ATOM 842   C CA   . GLN A 1 64 ? -5.566  -11.069 0.110  1.00 0.00 ? 266 GLN A CA   1  
ATOM 843   C C    . GLN A 1 64 ? -6.372  -10.615 1.325  1.00 0.00 ? 266 GLN A C    1  
ATOM 844   O O    . GLN A 1 64 ? -6.180  -9.509  1.830  1.00 0.00 ? 266 GLN A O    1  
ATOM 845   C CB   . GLN A 1 64 ? -4.566  -12.149 0.522  1.00 0.00 ? 266 GLN A CB   1  
ATOM 846   C CG   . GLN A 1 64 ? -4.268  -13.154 -0.579 1.00 0.00 ? 266 GLN A CG   1  
ATOM 847   C CD   . GLN A 1 64 ? -5.130  -14.397 -0.482 1.00 0.00 ? 266 GLN A CD   1  
ATOM 848   O OE1  . GLN A 1 64 ? -4.743  -15.390 0.134  1.00 0.00 ? 266 GLN A OE1  1  
ATOM 849   N NE2  . GLN A 1 64 ? -6.309  -14.347 -1.093 1.00 0.00 ? 266 GLN A NE2  1  
ATOM 850   H H    . GLN A 1 64 ? -3.892  -9.954  -0.552 1.00 0.00 ? 266 GLN A H    1  
ATOM 851   H HA   . GLN A 1 64 ? -6.244  -11.479 -0.624 1.00 0.00 ? 266 GLN A HA   1  
ATOM 852   H HB2  . GLN A 1 64 ? -3.638  -11.675 0.807  1.00 0.00 ? 266 GLN A HB2  1  
ATOM 853   H HB3  . GLN A 1 64 ? -4.962  -12.685 1.371  1.00 0.00 ? 266 GLN A HB3  1  
ATOM 854   H HG2  . GLN A 1 64 ? -4.444  -12.685 -1.535 1.00 0.00 ? 266 GLN A HG2  1  
ATOM 855   H HG3  . GLN A 1 64 ? -3.230  -13.448 -0.509 1.00 0.00 ? 266 GLN A HG3  1  
ATOM 856   H HE21 . GLN A 1 64 ? -6.552  -13.524 -1.564 1.00 0.00 ? 266 GLN A HE21 1  
ATOM 857   H HE22 . GLN A 1 64 ? -6.887  -15.138 -1.045 1.00 0.00 ? 266 GLN A HE22 1  
ATOM 858   N N    . PRO A 1 65 ? -7.292  -11.464 1.810  1.00 0.00 ? 267 PRO A N    1  
ATOM 859   C CA   . PRO A 1 65 ? -8.127  -11.146 2.971  1.00 0.00 ? 267 PRO A CA   1  
ATOM 860   C C    . PRO A 1 65 ? -7.302  -10.973 4.244  1.00 0.00 ? 267 PRO A C    1  
ATOM 861   O O    . PRO A 1 65 ? -6.394  -11.757 4.517  1.00 0.00 ? 267 PRO A O    1  
ATOM 862   C CB   . PRO A 1 65 ? -9.059  -12.358 3.101  1.00 0.00 ? 267 PRO A CB   1  
ATOM 863   C CG   . PRO A 1 65 ? -8.973  -13.064 1.789  1.00 0.00 ? 267 PRO A CG   1  
ATOM 864   C CD   . PRO A 1 65 ? -7.592  -12.798 1.269  1.00 0.00 ? 267 PRO A CD   1  
ATOM 865   H HA   . PRO A 1 65 ? -8.713  -10.254 2.803  1.00 0.00 ? 267 PRO A HA   1  
ATOM 866   H HB2  . PRO A 1 65 ? -8.721  -12.989 3.909  1.00 0.00 ? 267 PRO A HB2  1  
ATOM 867   H HB3  . PRO A 1 65 ? -10.065 -12.020 3.300  1.00 0.00 ? 267 PRO A HB3  1  
ATOM 868   H HG2  . PRO A 1 65 ? -9.126  -14.123 1.931  1.00 0.00 ? 267 PRO A HG2  1  
ATOM 869   H HG3  . PRO A 1 65 ? -9.713  -12.666 1.110  1.00 0.00 ? 267 PRO A HG3  1  
ATOM 870   H HD2  . PRO A 1 65 ? -6.897  -13.536 1.646  1.00 0.00 ? 267 PRO A HD2  1  
ATOM 871   H HD3  . PRO A 1 65 ? -7.587  -12.788 0.190  1.00 0.00 ? 267 PRO A HD3  1  
ATOM 872   N N    . LYS A 1 66 ? -7.627  -9.944  5.020  1.00 0.00 ? 268 LYS A N    1  
ATOM 873   C CA   . LYS A 1 66 ? -6.920  -9.669  6.266  1.00 0.00 ? 268 LYS A CA   1  
ATOM 874   C C    . LYS A 1 66 ? -5.440  -9.385  6.016  1.00 0.00 ? 268 LYS A C    1  
ATOM 875   O O    . LYS A 1 66 ? -4.618  -9.487  6.926  1.00 0.00 ? 268 LYS A O    1  
ATOM 876   C CB   . LYS A 1 66 ? -7.069  -10.846 7.231  1.00 0.00 ? 268 LYS A CB   1  
ATOM 877   C CG   . LYS A 1 66 ? -8.420  -10.899 7.924  1.00 0.00 ? 268 LYS A CG   1  
ATOM 878   C CD   . LYS A 1 66 ? -8.403  -10.137 9.239  1.00 0.00 ? 268 LYS A CD   1  
ATOM 879   C CE   . LYS A 1 66 ? -9.783  -10.084 9.871  1.00 0.00 ? 268 LYS A CE   1  
ATOM 880   N NZ   . LYS A 1 66 ? -9.722  -10.235 11.351 1.00 0.00 ? 268 LYS A NZ   1  
ATOM 881   H H    . LYS A 1 66 ? -8.364  -9.356  4.749  1.00 0.00 ? 268 LYS A H    1  
ATOM 882   H HA   . LYS A 1 66 ? -7.369  -8.794  6.712  1.00 0.00 ? 268 LYS A HA   1  
ATOM 883   H HB2  . LYS A 1 66 ? -6.932  -11.766 6.683  1.00 0.00 ? 268 LYS A HB2  1  
ATOM 884   H HB3  . LYS A 1 66 ? -6.302  -10.774 7.989  1.00 0.00 ? 268 LYS A HB3  1  
ATOM 885   H HG2  . LYS A 1 66 ? -9.164  -10.459 7.275  1.00 0.00 ? 268 LYS A HG2  1  
ATOM 886   H HG3  . LYS A 1 66 ? -8.674  -11.931 8.118  1.00 0.00 ? 268 LYS A HG3  1  
ATOM 887   H HD2  . LYS A 1 66 ? -7.725  -10.631 9.920  1.00 0.00 ? 268 LYS A HD2  1  
ATOM 888   H HD3  . LYS A 1 66 ? -8.060  -9.129  9.055  1.00 0.00 ? 268 LYS A HD3  1  
ATOM 889   H HE2  . LYS A 1 66 ? -10.237 -9.133  9.634  1.00 0.00 ? 268 LYS A HE2  1  
ATOM 890   H HE3  . LYS A 1 66 ? -10.385 -10.881 9.460  1.00 0.00 ? 268 LYS A HE3  1  
ATOM 891   H HZ1  . LYS A 1 66 ? -9.734  -9.300  11.807 1.00 0.00 ? 268 LYS A HZ1  1  
ATOM 892   H HZ2  . LYS A 1 66 ? -8.851  -10.732 11.625 1.00 0.00 ? 268 LYS A HZ2  1  
ATOM 893   H HZ3  . LYS A 1 66 ? -10.540 -10.782 11.689 1.00 0.00 ? 268 LYS A HZ3  1  
ATOM 894   N N    . TYR A 1 67 ? -5.103  -9.024  4.779  1.00 0.00 ? 269 TYR A N    1  
ATOM 895   C CA   . TYR A 1 67 ? -3.720  -8.722  4.422  1.00 0.00 ? 269 TYR A CA   1  
ATOM 896   C C    . TYR A 1 67 ? -3.538  -7.233  4.134  1.00 0.00 ? 269 TYR A C    1  
ATOM 897   O O    . TYR A 1 67 ? -2.412  -6.758  3.981  1.00 0.00 ? 269 TYR A O    1  
ATOM 898   C CB   . TYR A 1 67 ? -3.293  -9.537  3.198  1.00 0.00 ? 269 TYR A CB   1  
ATOM 899   C CG   . TYR A 1 67 ? -2.753  -10.910 3.528  1.00 0.00 ? 269 TYR A CG   1  
ATOM 900   C CD1  . TYR A 1 67 ? -3.335  -11.691 4.520  1.00 0.00 ? 269 TYR A CD1  1  
ATOM 901   C CD2  . TYR A 1 67 ? -1.661  -11.429 2.843  1.00 0.00 ? 269 TYR A CD2  1  
ATOM 902   C CE1  . TYR A 1 67 ? -2.844  -12.948 4.820  1.00 0.00 ? 269 TYR A CE1  1  
ATOM 903   C CE2  . TYR A 1 67 ? -1.165  -12.685 3.136  1.00 0.00 ? 269 TYR A CE2  1  
ATOM 904   C CZ   . TYR A 1 67 ? -1.759  -13.439 4.125  1.00 0.00 ? 269 TYR A CZ   1  
ATOM 905   O OH   . TYR A 1 67 ? -1.267  -14.690 4.420  1.00 0.00 ? 269 TYR A OH   1  
ATOM 906   H H    . TYR A 1 67 ? -5.799  -8.955  4.094  1.00 0.00 ? 269 TYR A H    1  
ATOM 907   H HA   . TYR A 1 67 ? -3.095  -8.994  5.259  1.00 0.00 ? 269 TYR A HA   1  
ATOM 908   H HB2  . TYR A 1 67 ? -4.143  -9.665  2.546  1.00 0.00 ? 269 TYR A HB2  1  
ATOM 909   H HB3  . TYR A 1 67 ? -2.521  -8.996  2.669  1.00 0.00 ? 269 TYR A HB3  1  
ATOM 910   H HD1  . TYR A 1 67 ? -4.183  -11.303 5.063  1.00 0.00 ? 269 TYR A HD1  1  
ATOM 911   H HD2  . TYR A 1 67 ? -1.197  -10.836 2.069  1.00 0.00 ? 269 TYR A HD2  1  
ATOM 912   H HE1  . TYR A 1 67 ? -3.309  -13.538 5.594  1.00 0.00 ? 269 TYR A HE1  1  
ATOM 913   H HE2  . TYR A 1 67 ? -0.314  -13.069 2.593  1.00 0.00 ? 269 TYR A HE2  1  
ATOM 914   H HH   . TYR A 1 67 ? -1.990  -15.323 4.434  1.00 0.00 ? 269 TYR A HH   1  
ATOM 915   N N    . GLY A 1 68 ? -4.644  -6.499  4.054  1.00 0.00 ? 270 GLY A N    1  
ATOM 916   C CA   . GLY A 1 68 ? -4.570  -5.075  3.777  1.00 0.00 ? 270 GLY A CA   1  
ATOM 917   C C    . GLY A 1 68 ? -4.462  -4.237  5.036  1.00 0.00 ? 270 GLY A C    1  
ATOM 918   O O    . GLY A 1 68 ? -5.347  -4.271  5.891  1.00 0.00 ? 270 GLY A O    1  
ATOM 919   H H    . GLY A 1 68 ? -5.517  -6.925  4.180  1.00 0.00 ? 270 GLY A H    1  
ATOM 920   H HA2  . GLY A 1 68 ? -3.704  -4.887  3.158  1.00 0.00 ? 270 GLY A HA2  1  
ATOM 921   H HA3  . GLY A 1 68 ? -5.455  -4.780  3.236  1.00 0.00 ? 270 GLY A HA3  1  
ATOM 922   N N    . LEU A 1 69 ? -3.377  -3.476  5.143  1.00 0.00 ? 271 LEU A N    1  
ATOM 923   C CA   . LEU A 1 69 ? -3.156  -2.614  6.299  1.00 0.00 ? 271 LEU A CA   1  
ATOM 924   C C    . LEU A 1 69 ? -2.831  -1.192  5.852  1.00 0.00 ? 271 LEU A C    1  
ATOM 925   O O    . LEU A 1 69 ? -1.922  -0.976  5.052  1.00 0.00 ? 271 LEU A O    1  
ATOM 926   C CB   . LEU A 1 69 ? -2.023  -3.166  7.167  1.00 0.00 ? 271 LEU A CB   1  
ATOM 927   C CG   . LEU A 1 69 ? -2.191  -2.939  8.671  1.00 0.00 ? 271 LEU A CG   1  
ATOM 928   C CD1  . LEU A 1 69 ? -3.483  -3.574  9.169  1.00 0.00 ? 271 LEU A CD1  1  
ATOM 929   C CD2  . LEU A 1 69 ? -0.992  -3.492  9.432  1.00 0.00 ? 271 LEU A CD2  1  
ATOM 930   H H    . LEU A 1 69 ? -2.712  -3.488  4.424  1.00 0.00 ? 271 LEU A H    1  
ATOM 931   H HA   . LEU A 1 69 ? -4.067  -2.597  6.879  1.00 0.00 ? 271 LEU A HA   1  
ATOM 932   H HB2  . LEU A 1 69 ? -1.948  -4.229  6.990  1.00 0.00 ? 271 LEU A HB2  1  
ATOM 933   H HB3  . LEU A 1 69 ? -1.100  -2.701  6.856  1.00 0.00 ? 271 LEU A HB3  1  
ATOM 934   H HG   . LEU A 1 69 ? -2.248  -1.877  8.863  1.00 0.00 ? 271 LEU A HG   1  
ATOM 935   H HD11 . LEU A 1 69 ? -3.262  -4.255  9.978  1.00 0.00 ? 271 LEU A HD11 1  
ATOM 936   H HD12 . LEU A 1 69 ? -4.150  -2.802  9.522  1.00 0.00 ? 271 LEU A HD12 1  
ATOM 937   H HD13 . LEU A 1 69 ? -3.953  -4.115  8.362  1.00 0.00 ? 271 LEU A HD13 1  
ATOM 938   H HD21 . LEU A 1 69 ? -0.372  -2.674  9.770  1.00 0.00 ? 271 LEU A HD21 1  
ATOM 939   H HD22 . LEU A 1 69 ? -1.335  -4.060  10.284 1.00 0.00 ? 271 LEU A HD22 1  
ATOM 940   H HD23 . LEU A 1 69 ? -0.415  -4.133  8.781  1.00 0.00 ? 271 LEU A HD23 1  
ATOM 941   N N    . PHE A 1 70 ? -3.588  -0.228  6.364  1.00 0.00 ? 272 PHE A N    1  
ATOM 942   C CA   . PHE A 1 70 ? -3.389  1.173   6.009  1.00 0.00 ? 272 PHE A CA   1  
ATOM 943   C C    . PHE A 1 70 ? -2.685  1.936   7.126  1.00 0.00 ? 272 PHE A C    1  
ATOM 944   O O    . PHE A 1 70 ? -3.254  2.142   8.197  1.00 0.00 ? 272 PHE A O    1  
ATOM 945   C CB   . PHE A 1 70 ? -4.736  1.835   5.710  1.00 0.00 ? 272 PHE A CB   1  
ATOM 946   C CG   . PHE A 1 70 ? -5.299  1.485   4.362  1.00 0.00 ? 272 PHE A CG   1  
ATOM 947   C CD1  . PHE A 1 70 ? -5.443  0.160   3.977  1.00 0.00 ? 272 PHE A CD1  1  
ATOM 948   C CD2  . PHE A 1 70 ? -5.690  2.480   3.482  1.00 0.00 ? 272 PHE A CD2  1  
ATOM 949   C CE1  . PHE A 1 70 ? -5.965  -0.163  2.740  1.00 0.00 ? 272 PHE A CE1  1  
ATOM 950   C CE2  . PHE A 1 70 ? -6.213  2.163   2.243  1.00 0.00 ? 272 PHE A CE2  1  
ATOM 951   C CZ   . PHE A 1 70 ? -6.351  0.839   1.871  1.00 0.00 ? 272 PHE A CZ   1  
ATOM 952   H H    . PHE A 1 70 ? -4.303  -0.464  6.992  1.00 0.00 ? 272 PHE A H    1  
ATOM 953   H HA   . PHE A 1 70 ? -2.775  1.207   5.122  1.00 0.00 ? 272 PHE A HA   1  
ATOM 954   H HB2  . PHE A 1 70 ? -5.452  1.526   6.456  1.00 0.00 ? 272 PHE A HB2  1  
ATOM 955   H HB3  . PHE A 1 70 ? -4.619  2.907   5.755  1.00 0.00 ? 272 PHE A HB3  1  
ATOM 956   H HD1  . PHE A 1 70 ? -5.140  -0.624  4.655  1.00 0.00 ? 272 PHE A HD1  1  
ATOM 957   H HD2  . PHE A 1 70 ? -5.583  3.515   3.771  1.00 0.00 ? 272 PHE A HD2  1  
ATOM 958   H HE1  . PHE A 1 70 ? -6.071  -1.198  2.452  1.00 0.00 ? 272 PHE A HE1  1  
ATOM 959   H HE2  . PHE A 1 70 ? -6.513  2.949   1.565  1.00 0.00 ? 272 PHE A HE2  1  
ATOM 960   H HZ   . PHE A 1 70 ? -6.760  0.589   0.904  1.00 0.00 ? 272 PHE A HZ   1  
ATOM 961   N N    . ALA A 1 71 ? -1.451  2.368   6.869  1.00 0.00 ? 273 ALA A N    1  
ATOM 962   C CA   . ALA A 1 71 ? -0.688  3.124   7.857  1.00 0.00 ? 273 ALA A CA   1  
ATOM 963   C C    . ALA A 1 71 ? 0.082   4.267   7.199  1.00 0.00 ? 273 ALA A C    1  
ATOM 964   O O    . ALA A 1 71 ? 0.494   4.169   6.042  1.00 0.00 ? 273 ALA A O    1  
ATOM 965   C CB   . ALA A 1 71 ? 0.267   2.216   8.621  1.00 0.00 ? 273 ALA A CB   1  
ATOM 966   H H    . ALA A 1 71 ? -1.053  2.183   5.994  1.00 0.00 ? 273 ALA A H    1  
ATOM 967   H HA   . ALA A 1 71 ? -1.389  3.541   8.564  1.00 0.00 ? 273 ALA A HA   1  
ATOM 968   H HB1  . ALA A 1 71 ? 1.094   1.943   7.983  1.00 0.00 ? 273 ALA A HB1  1  
ATOM 969   H HB2  . ALA A 1 71 ? 0.642   2.741   9.489  1.00 0.00 ? 273 ALA A HB2  1  
ATOM 970   H HB3  . ALA A 1 71 ? -0.254  1.326   8.937  1.00 0.00 ? 273 ALA A HB3  1  
ATOM 971   N N    . PRO A 1 72 ? 0.283   5.370   7.936  1.00 0.00 ? 274 PRO A N    1  
ATOM 972   C CA   . PRO A 1 72 ? 1.001   6.546   7.433  1.00 0.00 ? 274 PRO A CA   1  
ATOM 973   C C    . PRO A 1 72 ? 2.346   6.190   6.810  1.00 0.00 ? 274 PRO A C    1  
ATOM 974   O O    . PRO A 1 72 ? 2.880   5.104   7.036  1.00 0.00 ? 274 PRO A O    1  
ATOM 975   C CB   . PRO A 1 72 ? 1.216   7.393   8.686  1.00 0.00 ? 274 PRO A CB   1  
ATOM 976   C CG   . PRO A 1 72 ? 0.121   7.000   9.613  1.00 0.00 ? 274 PRO A CG   1  
ATOM 977   C CD   . PRO A 1 72 ? -0.184  5.557   9.320  1.00 0.00 ? 274 PRO A CD   1  
ATOM 978   H HA   . PRO A 1 72 ? 0.409   7.098   6.720  1.00 0.00 ? 274 PRO A HA   1  
ATOM 979   H HB2  . PRO A 1 72 ? 2.185   7.171   9.104  1.00 0.00 ? 274 PRO A HB2  1  
ATOM 980   H HB3  . PRO A 1 72 ? 1.158   8.440   8.429  1.00 0.00 ? 274 PRO A HB3  1  
ATOM 981   H HG2  . PRO A 1 72 ? 0.453   7.109   10.634 1.00 0.00 ? 274 PRO A HG2  1  
ATOM 982   H HG3  . PRO A 1 72 ? -0.751  7.611   9.432  1.00 0.00 ? 274 PRO A HG3  1  
ATOM 983   H HD2  . PRO A 1 72 ? 0.357   4.913   9.997  1.00 0.00 ? 274 PRO A HD2  1  
ATOM 984   H HD3  . PRO A 1 72 ? -1.246  5.374   9.393  1.00 0.00 ? 274 PRO A HD3  1  
ATOM 985   N N    . VAL A 1 73 ? 2.888   7.118   6.029  1.00 0.00 ? 275 VAL A N    1  
ATOM 986   C CA   . VAL A 1 73 ? 4.173   6.910   5.376  1.00 0.00 ? 275 VAL A CA   1  
ATOM 987   C C    . VAL A 1 73 ? 5.316   6.947   6.389  1.00 0.00 ? 275 VAL A C    1  
ATOM 988   O O    . VAL A 1 73 ? 6.322   6.259   6.226  1.00 0.00 ? 275 VAL A O    1  
ATOM 989   C CB   . VAL A 1 73 ? 4.427   7.972   4.287  1.00 0.00 ? 275 VAL A CB   1  
ATOM 990   C CG1  . VAL A 1 73 ? 4.476   9.367   4.894  1.00 0.00 ? 275 VAL A CG1  1  
ATOM 991   C CG2  . VAL A 1 73 ? 5.711   7.667   3.529  1.00 0.00 ? 275 VAL A CG2  1  
ATOM 992   H H    . VAL A 1 73 ? 2.414   7.964   5.892  1.00 0.00 ? 275 VAL A H    1  
ATOM 993   H HA   . VAL A 1 73 ? 4.155   5.939   4.904  1.00 0.00 ? 275 VAL A HA   1  
ATOM 994   H HB   . VAL A 1 73 ? 3.606   7.940   3.585  1.00 0.00 ? 275 VAL A HB   1  
ATOM 995   H HG11 . VAL A 1 73 ? 3.617   9.510   5.533  1.00 0.00 ? 275 VAL A HG11 1  
ATOM 996   H HG12 . VAL A 1 73 ? 5.379   9.474   5.476  1.00 0.00 ? 275 VAL A HG12 1  
ATOM 997   H HG13 . VAL A 1 73 ? 4.467   10.104  4.105  1.00 0.00 ? 275 VAL A HG13 1  
ATOM 998   H HG21 . VAL A 1 73 ? 6.560   7.878   4.161  1.00 0.00 ? 275 VAL A HG21 1  
ATOM 999   H HG22 . VAL A 1 73 ? 5.723   6.623   3.247  1.00 0.00 ? 275 VAL A HG22 1  
ATOM 1000  H HG23 . VAL A 1 73 ? 5.760   8.280   2.642  1.00 0.00 ? 275 VAL A HG23 1  
ATOM 1001  N N    . HIS A 1 74 ? 5.151   7.752   7.436  1.00 0.00 ? 276 HIS A N    1  
ATOM 1002  C CA   . HIS A 1 74 ? 6.172   7.869   8.473  1.00 0.00 ? 276 HIS A CA   1  
ATOM 1003  C C    . HIS A 1 74 ? 6.161   6.647   9.386  1.00 0.00 ? 276 HIS A C    1  
ATOM 1004  O O    . HIS A 1 74 ? 7.187   6.283   9.961  1.00 0.00 ? 276 HIS A O    1  
ATOM 1005  C CB   . HIS A 1 74 ? 5.964   9.144   9.295  1.00 0.00 ? 276 HIS A CB   1  
ATOM 1006  C CG   . HIS A 1 74 ? 4.548   9.363   9.731  1.00 0.00 ? 276 HIS A CG   1  
ATOM 1007  N ND1  . HIS A 1 74 ? 3.879   10.554  9.537  1.00 0.00 ? 276 HIS A ND1  1  
ATOM 1008  C CD2  . HIS A 1 74 ? 3.674   8.542   10.360 1.00 0.00 ? 276 HIS A CD2  1  
ATOM 1009  C CE1  . HIS A 1 74 ? 2.656   10.454  10.027 1.00 0.00 ? 276 HIS A CE1  1  
ATOM 1010  N NE2  . HIS A 1 74 ? 2.507   9.244   10.532 1.00 0.00 ? 276 HIS A NE2  1  
ATOM 1011  H H    . HIS A 1 74 ? 4.326   8.273   7.514  1.00 0.00 ? 276 HIS A H    1  
ATOM 1012  H HA   . HIS A 1 74 ? 7.131   7.923   7.982  1.00 0.00 ? 276 HIS A HA   1  
ATOM 1013  H HB2  . HIS A 1 74 ? 6.578   9.094   10.182 1.00 0.00 ? 276 HIS A HB2  1  
ATOM 1014  H HB3  . HIS A 1 74 ? 6.265   9.996   8.704  1.00 0.00 ? 276 HIS A HB3  1  
ATOM 1015  H HD1  . HIS A 1 74 ? 4.245   11.353  9.104  1.00 0.00 ? 276 HIS A HD1  1  
ATOM 1016  H HD2  . HIS A 1 74 ? 3.856   7.520   10.662 1.00 0.00 ? 276 HIS A HD2  1  
ATOM 1017  H HE1  . HIS A 1 74 ? 1.904   11.231  10.017 1.00 0.00 ? 276 HIS A HE1  1  
ATOM 1018  H HE2  . HIS A 1 74 ? 1.719   8.929   11.023 1.00 0.00 ? 276 HIS A HE2  1  
ATOM 1019  N N    . LYS A 1 75 ? 4.999   6.011   9.508  1.00 0.00 ? 277 LYS A N    1  
ATOM 1020  C CA   . LYS A 1 75 ? 4.864   4.823   10.343 1.00 0.00 ? 277 LYS A CA   1  
ATOM 1021  C C    . LYS A 1 75 ? 5.423   3.597   9.633  1.00 0.00 ? 277 LYS A C    1  
ATOM 1022  O O    . LYS A 1 75 ? 5.737   2.589   10.268 1.00 0.00 ? 277 LYS A O    1  
ATOM 1023  C CB   . LYS A 1 75 ? 3.395   4.582   10.699 1.00 0.00 ? 277 LYS A CB   1  
ATOM 1024  C CG   . LYS A 1 75 ? 2.895   5.435   11.854 1.00 0.00 ? 277 LYS A CG   1  
ATOM 1025  C CD   . LYS A 1 75 ? 2.474   4.577   13.037 1.00 0.00 ? 277 LYS A CD   1  
ATOM 1026  C CE   . LYS A 1 75 ? 3.584   4.462   14.069 1.00 0.00 ? 277 LYS A CE   1  
ATOM 1027  N NZ   . LYS A 1 75 ? 3.985   5.791   14.608 1.00 0.00 ? 277 LYS A NZ   1  
ATOM 1028  H H    . LYS A 1 75 ? 4.218   6.343   9.020  1.00 0.00 ? 277 LYS A H    1  
ATOM 1029  H HA   . LYS A 1 75 ? 5.423   4.989   11.251 1.00 0.00 ? 277 LYS A HA   1  
ATOM 1030  H HB2  . LYS A 1 75 ? 2.787   4.798   9.833  1.00 0.00 ? 277 LYS A HB2  1  
ATOM 1031  H HB3  . LYS A 1 75 ? 3.268   3.542   10.965 1.00 0.00 ? 277 LYS A HB3  1  
ATOM 1032  H HG2  . LYS A 1 75 ? 3.687   6.098   12.167 1.00 0.00 ? 277 LYS A HG2  1  
ATOM 1033  H HG3  . LYS A 1 75 ? 2.046   6.013   11.520 1.00 0.00 ? 277 LYS A HG3  1  
ATOM 1034  H HD2  . LYS A 1 75 ? 1.610   5.022   13.502 1.00 0.00 ? 277 LYS A HD2  1  
ATOM 1035  H HD3  . LYS A 1 75 ? 2.222   3.587   12.680 1.00 0.00 ? 277 LYS A HD3  1  
ATOM 1036  H HE2  . LYS A 1 75 ? 3.237   3.844   14.885 1.00 0.00 ? 277 LYS A HE2  1  
ATOM 1037  H HE3  . LYS A 1 75 ? 4.442   3.995   13.607 1.00 0.00 ? 277 LYS A HE3  1  
ATOM 1038  H HZ1  . LYS A 1 75 ? 3.487   6.551   14.101 1.00 0.00 ? 277 LYS A HZ1  1  
ATOM 1039  H HZ2  . LYS A 1 75 ? 5.009   5.928   14.497 1.00 0.00 ? 277 LYS A HZ2  1  
ATOM 1040  H HZ3  . LYS A 1 75 ? 3.747   5.854   15.620 1.00 0.00 ? 277 LYS A HZ3  1  
ATOM 1041  N N    . VAL A 1 76 ? 5.546   3.690   8.313  1.00 0.00 ? 278 VAL A N    1  
ATOM 1042  C CA   . VAL A 1 76 ? 6.066   2.585   7.522  1.00 0.00 ? 278 VAL A CA   1  
ATOM 1043  C C    . VAL A 1 76 ? 7.552   2.756   7.235  1.00 0.00 ? 278 VAL A C    1  
ATOM 1044  O O    . VAL A 1 76 ? 8.030   3.869   7.016  1.00 0.00 ? 278 VAL A O    1  
ATOM 1045  C CB   . VAL A 1 76 ? 5.309   2.440   6.189  1.00 0.00 ? 278 VAL A CB   1  
ATOM 1046  C CG1  . VAL A 1 76 ? 5.743   1.177   5.466  1.00 0.00 ? 278 VAL A CG1  1  
ATOM 1047  C CG2  . VAL A 1 76 ? 3.808   2.429   6.422  1.00 0.00 ? 278 VAL A CG2  1  
ATOM 1048  H H    . VAL A 1 76 ? 5.277   4.517   7.862  1.00 0.00 ? 278 VAL A H    1  
ATOM 1049  H HA   . VAL A 1 76 ? 5.927   1.679   8.089  1.00 0.00 ? 278 VAL A HA   1  
ATOM 1050  H HB   . VAL A 1 76 ? 5.550   3.287   5.565  1.00 0.00 ? 278 VAL A HB   1  
ATOM 1051  H HG11 . VAL A 1 76 ? 6.576   1.401   4.818  1.00 0.00 ? 278 VAL A HG11 1  
ATOM 1052  H HG12 . VAL A 1 76 ? 6.040   0.433   6.191  1.00 0.00 ? 278 VAL A HG12 1  
ATOM 1053  H HG13 . VAL A 1 76 ? 4.920   0.799   4.879  1.00 0.00 ? 278 VAL A HG13 1  
ATOM 1054  H HG21 . VAL A 1 76 ? 3.591   2.853   7.390  1.00 0.00 ? 278 VAL A HG21 1  
ATOM 1055  H HG22 . VAL A 1 76 ? 3.321   3.009   5.653  1.00 0.00 ? 278 VAL A HG22 1  
ATOM 1056  H HG23 . VAL A 1 76 ? 3.449   1.410   6.386  1.00 0.00 ? 278 VAL A HG23 1  
ATOM 1057  N N    . THR A 1 77 ? 8.274   1.643   7.239  1.00 0.00 ? 279 THR A N    1  
ATOM 1058  C CA   . THR A 1 77 ? 9.708   1.657   6.981  1.00 0.00 ? 279 THR A CA   1  
ATOM 1059  C C    . THR A 1 77 ? 10.124  0.428   6.179  1.00 0.00 ? 279 THR A C    1  
ATOM 1060  O O    . THR A 1 77 ? 9.540   -0.645  6.322  1.00 0.00 ? 279 THR A O    1  
ATOM 1061  C CB   . THR A 1 77 ? 10.482  1.708   8.301  1.00 0.00 ? 279 THR A CB   1  
ATOM 1062  O OG1  . THR A 1 77 ? 9.641   2.132   9.360  1.00 0.00 ? 279 THR A OG1  1  
ATOM 1063  C CG2  . THR A 1 77 ? 11.672  2.641   8.260  1.00 0.00 ? 279 THR A CG2  1  
ATOM 1064  H H    . THR A 1 77 ? 7.832   0.788   7.422  1.00 0.00 ? 279 THR A H    1  
ATOM 1065  H HA   . THR A 1 77 ? 9.934   2.543   6.407  1.00 0.00 ? 279 THR A HA   1  
ATOM 1066  H HB   . THR A 1 77 ? 10.844  0.718   8.532  1.00 0.00 ? 279 THR A HB   1  
ATOM 1067  H HG1  . THR A 1 77 ? 9.751   1.544   10.111 1.00 0.00 ? 279 THR A HG1  1  
ATOM 1068  H HG21 . THR A 1 77 ? 12.562  2.078   8.019  1.00 0.00 ? 279 THR A HG21 1  
ATOM 1069  H HG22 . THR A 1 77 ? 11.794  3.110   9.224  1.00 0.00 ? 279 THR A HG22 1  
ATOM 1070  H HG23 . THR A 1 77 ? 11.510  3.399   7.507  1.00 0.00 ? 279 THR A HG23 1  
ATOM 1071  N N    . LYS A 1 78 ? 11.140  0.591   5.339  1.00 0.00 ? 280 LYS A N    1  
ATOM 1072  C CA   . LYS A 1 78 ? 11.631  -0.509  4.518  1.00 0.00 ? 280 LYS A CA   1  
ATOM 1073  C C    . LYS A 1 78 ? 12.350  -1.547  5.375  1.00 0.00 ? 280 LYS A C    1  
ATOM 1074  O O    . LYS A 1 78 ? 13.213  -1.209  6.186  1.00 0.00 ? 280 LYS A O    1  
ATOM 1075  C CB   . LYS A 1 78 ? 12.571  0.018   3.430  1.00 0.00 ? 280 LYS A CB   1  
ATOM 1076  C CG   . LYS A 1 78 ? 12.098  -0.291  2.018  1.00 0.00 ? 280 LYS A CG   1  
ATOM 1077  C CD   . LYS A 1 78 ? 13.151  0.075   0.985  1.00 0.00 ? 280 LYS A CD   1  
ATOM 1078  C CE   . LYS A 1 78 ? 13.039  -0.796  -0.256 1.00 0.00 ? 280 LYS A CE   1  
ATOM 1079  N NZ   . LYS A 1 78 ? 13.491  -2.191  -0.000 1.00 0.00 ? 280 LYS A NZ   1  
ATOM 1080  H H    . LYS A 1 78 ? 11.570  1.469   5.268  1.00 0.00 ? 280 LYS A H    1  
ATOM 1081  H HA   . LYS A 1 78 ? 10.780  -0.977  4.048  1.00 0.00 ? 280 LYS A HA   1  
ATOM 1082  H HB2  . LYS A 1 78 ? 12.654  1.090   3.531  1.00 0.00 ? 280 LYS A HB2  1  
ATOM 1083  H HB3  . LYS A 1 78 ? 13.548  -0.422  3.564  1.00 0.00 ? 280 LYS A HB3  1  
ATOM 1084  H HG2  . LYS A 1 78 ? 11.888  -1.347  1.943  1.00 0.00 ? 280 LYS A HG2  1  
ATOM 1085  H HG3  . LYS A 1 78 ? 11.199  0.274   1.819  1.00 0.00 ? 280 LYS A HG3  1  
ATOM 1086  H HD2  . LYS A 1 78 ? 13.020  1.109   0.701  1.00 0.00 ? 280 LYS A HD2  1  
ATOM 1087  H HD3  . LYS A 1 78 ? 14.131  -0.058  1.421  1.00 0.00 ? 280 LYS A HD3  1  
ATOM 1088  H HE2  . LYS A 1 78 ? 12.007  -0.814  -0.574 1.00 0.00 ? 280 LYS A HE2  1  
ATOM 1089  H HE3  . LYS A 1 78 ? 13.648  -0.367  -1.038 1.00 0.00 ? 280 LYS A HE3  1  
ATOM 1090  H HZ1  . LYS A 1 78 ? 14.525  -2.255  -0.099 1.00 0.00 ? 280 LYS A HZ1  1  
ATOM 1091  H HZ2  . LYS A 1 78 ? 13.048  -2.841  -0.679 1.00 0.00 ? 280 LYS A HZ2  1  
ATOM 1092  H HZ3  . LYS A 1 78 ? 13.228  -2.481  0.963  1.00 0.00 ? 280 LYS A HZ3  1  
ATOM 1093  N N    . ILE A 1 79 ? 11.985  -2.813  5.191  1.00 0.00 ? 281 ILE A N    1  
ATOM 1094  C CA   . ILE A 1 79 ? 12.593  -3.901  5.949  1.00 0.00 ? 281 ILE A CA   1  
ATOM 1095  C C    . ILE A 1 79 ? 13.938  -4.302  5.350  1.00 0.00 ? 281 ILE A C    1  
ATOM 1096  O O    . ILE A 1 79 ? 14.836  -4.753  6.061  1.00 0.00 ? 281 ILE A O    1  
ATOM 1097  C CB   . ILE A 1 79 ? 11.670  -5.136  5.999  1.00 0.00 ? 281 ILE A CB   1  
ATOM 1098  C CG1  . ILE A 1 79 ? 12.280  -6.225  6.883  1.00 0.00 ? 281 ILE A CG1  1  
ATOM 1099  C CG2  . ILE A 1 79 ? 11.414  -5.667  4.595  1.00 0.00 ? 281 ILE A CG2  1  
ATOM 1100  C CD1  . ILE A 1 79 ? 11.264  -7.210  7.415  1.00 0.00 ? 281 ILE A CD1  1  
ATOM 1101  H H    . ILE A 1 79 ? 11.292  -3.019  4.530  1.00 0.00 ? 281 ILE A H    1  
ATOM 1102  H HA   . ILE A 1 79 ? 12.750  -3.554  6.960  1.00 0.00 ? 281 ILE A HA   1  
ATOM 1103  H HB   . ILE A 1 79 ? 10.723  -4.831  6.418  1.00 0.00 ? 281 ILE A HB   1  
ATOM 1104  H HG12 . ILE A 1 79 ? 13.010  -6.778  6.311  1.00 0.00 ? 281 ILE A HG12 1  
ATOM 1105  H HG13 . ILE A 1 79 ? 12.769  -5.761  7.729  1.00 0.00 ? 281 ILE A HG13 1  
ATOM 1106  H HG21 . ILE A 1 79 ? 11.642  -4.898  3.873  1.00 0.00 ? 281 ILE A HG21 1  
ATOM 1107  H HG22 . ILE A 1 79 ? 12.041  -6.527  4.415  1.00 0.00 ? 281 ILE A HG22 1  
ATOM 1108  H HG23 . ILE A 1 79 ? 10.376  -5.952  4.502  1.00 0.00 ? 281 ILE A HG23 1  
ATOM 1109  H HD11 . ILE A 1 79 ? 10.301  -6.729  7.492  1.00 0.00 ? 281 ILE A HD11 1  
ATOM 1110  H HD12 . ILE A 1 79 ? 11.192  -8.053  6.743  1.00 0.00 ? 281 ILE A HD12 1  
ATOM 1111  H HD13 . ILE A 1 79 ? 11.573  -7.555  8.392  1.00 0.00 ? 281 ILE A HD13 1  
ATOM 1112  N N    . GLY A 1 80 ? 14.070  -4.134  4.038  1.00 0.00 ? 282 GLY A N    1  
ATOM 1113  C CA   . GLY A 1 80 ? 15.308  -4.482  3.367  1.00 0.00 ? 282 GLY A CA   1  
ATOM 1114  C C    . GLY A 1 80 ? 16.472  -3.621  3.816  1.00 0.00 ? 282 GLY A C    1  
ATOM 1115  O O    . GLY A 1 80 ? 16.843  -2.664  3.136  1.00 0.00 ? 282 GLY A O    1  
ATOM 1116  H H    . GLY A 1 80 ? 13.321  -3.770  3.522  1.00 0.00 ? 282 GLY A H    1  
ATOM 1117  H HA2  . GLY A 1 80 ? 15.540  -5.516  3.577  1.00 0.00 ? 282 GLY A HA2  1  
ATOM 1118  H HA3  . GLY A 1 80 ? 15.175  -4.361  2.303  1.00 0.00 ? 282 GLY A HA3  1  
ATOM 1119  N N    . PHE A 1 81 ? 17.048  -3.960  4.963  1.00 0.00 ? 283 PHE A N    1  
ATOM 1120  C CA   . PHE A 1 81 ? 18.176  -3.209  5.503  1.00 0.00 ? 283 PHE A CA   1  
ATOM 1121  C C    . PHE A 1 81 ? 19.422  -3.405  4.642  1.00 0.00 ? 283 PHE A C    1  
ATOM 1122  O O    . PHE A 1 81 ? 19.619  -4.469  4.054  1.00 0.00 ? 283 PHE A O    1  
ATOM 1123  C CB   . PHE A 1 81 ? 18.463  -3.643  6.942  1.00 0.00 ? 283 PHE A CB   1  
ATOM 1124  C CG   . PHE A 1 81 ? 17.246  -3.638  7.823  1.00 0.00 ? 283 PHE A CG   1  
ATOM 1125  C CD1  . PHE A 1 81 ? 16.619  -2.448  8.155  1.00 0.00 ? 283 PHE A CD1  1  
ATOM 1126  C CD2  . PHE A 1 81 ? 16.730  -4.824  8.320  1.00 0.00 ? 283 PHE A CD2  1  
ATOM 1127  C CE1  . PHE A 1 81 ? 15.499  -2.441  8.966  1.00 0.00 ? 283 PHE A CE1  1  
ATOM 1128  C CE2  . PHE A 1 81 ? 15.611  -4.823  9.130  1.00 0.00 ? 283 PHE A CE2  1  
ATOM 1129  C CZ   . PHE A 1 81 ? 14.994  -3.630  9.454  1.00 0.00 ? 283 PHE A CZ   1  
ATOM 1130  H H    . PHE A 1 81 ? 16.707  -4.732  5.460  1.00 0.00 ? 283 PHE A H    1  
ATOM 1131  H HA   . PHE A 1 81 ? 17.911  -2.163  5.497  1.00 0.00 ? 283 PHE A HA   1  
ATOM 1132  H HB2  . PHE A 1 81 ? 18.864  -4.645  6.936  1.00 0.00 ? 283 PHE A HB2  1  
ATOM 1133  H HB3  . PHE A 1 81 ? 19.190  -2.971  7.374  1.00 0.00 ? 283 PHE A HB3  1  
ATOM 1134  H HD1  . PHE A 1 81 ? 17.013  -1.517  7.773  1.00 0.00 ? 283 PHE A HD1  1  
ATOM 1135  H HD2  . PHE A 1 81 ? 17.210  -5.758  8.067  1.00 0.00 ? 283 PHE A HD2  1  
ATOM 1136  H HE1  . PHE A 1 81 ? 15.020  -1.506  9.216  1.00 0.00 ? 283 PHE A HE1  1  
ATOM 1137  H HE2  . PHE A 1 81 ? 15.219  -5.755  9.510  1.00 0.00 ? 283 PHE A HE2  1  
ATOM 1138  H HZ   . PHE A 1 81 ? 14.120  -3.628  10.087 1.00 0.00 ? 283 PHE A HZ   1  
ATOM 1139  N N    . GLY B 2 29 ? 7.835   3.316   23.425 1.00 0.00 ? 444 GLY B N    1  
ATOM 1140  C CA   . GLY B 2 29 ? 7.115   2.850   22.254 1.00 0.00 ? 444 GLY B CA   1  
ATOM 1141  C C    . GLY B 2 29 ? 7.161   3.846   21.111 1.00 0.00 ? 444 GLY B C    1  
ATOM 1142  O O    . GLY B 2 29 ? 7.392   5.036   21.325 1.00 0.00 ? 444 GLY B O    1  
ATOM 1143  H HA2  . GLY B 2 29 ? 7.553   1.920   21.924 1.00 0.00 ? 444 GLY B HA2  1  
ATOM 1144  H HA3  . GLY B 2 29 ? 6.086   2.677   22.524 1.00 0.00 ? 444 GLY B HA3  1  
ATOM 1145  N N    . GLU B 2 30 ? 6.942   3.357   19.895 1.00 0.00 ? 445 GLU B N    1  
ATOM 1146  C CA   . GLU B 2 30 ? 6.958   4.212   18.713 1.00 0.00 ? 445 GLU B CA   1  
ATOM 1147  C C    . GLU B 2 30 ? 5.541   4.581   18.289 1.00 0.00 ? 445 GLU B C    1  
ATOM 1148  O O    . GLU B 2 30 ? 5.246   4.689   17.099 1.00 0.00 ? 445 GLU B O    1  
ATOM 1149  C CB   . GLU B 2 30 ? 7.683   3.512   17.563 1.00 0.00 ? 445 GLU B CB   1  
ATOM 1150  C CG   . GLU B 2 30 ? 9.129   3.168   17.874 1.00 0.00 ? 445 GLU B CG   1  
ATOM 1151  C CD   . GLU B 2 30 ? 10.054  3.412   16.697 1.00 0.00 ? 445 GLU B CD   1  
ATOM 1152  O OE1  . GLU B 2 30 ? 10.077  4.552   16.188 1.00 0.00 ? 445 GLU B OE1  1  
ATOM 1153  O OE2  . GLU B 2 30 ? 10.754  2.462   16.285 1.00 0.00 ? 445 GLU B OE2  1  
ATOM 1154  H H    . GLU B 2 30 ? 6.764   2.400   19.789 1.00 0.00 ? 445 GLU B H    1  
ATOM 1155  H HA   . GLU B 2 30 ? 7.492   5.116   18.967 1.00 0.00 ? 445 GLU B HA   1  
ATOM 1156  H HB2  . GLU B 2 30 ? 7.160   2.597   17.326 1.00 0.00 ? 445 GLU B HB2  1  
ATOM 1157  H HB3  . GLU B 2 30 ? 7.668   4.159   16.697 1.00 0.00 ? 445 GLU B HB3  1  
ATOM 1158  H HG2  . GLU B 2 30 ? 9.461   3.775   18.704 1.00 0.00 ? 445 GLU B HG2  1  
ATOM 1159  H HG3  . GLU B 2 30 ? 9.187   2.124   18.148 1.00 0.00 ? 445 GLU B HG3  1  
ATOM 1160  N N    . GLU B 2 31 ? 4.665   4.772   19.272 1.00 0.00 ? 446 GLU B N    1  
ATOM 1161  C CA   . GLU B 2 31 ? 3.277   5.128   19.003 1.00 0.00 ? 446 GLU B CA   1  
ATOM 1162  C C    . GLU B 2 31 ? 2.567   4.012   18.242 1.00 0.00 ? 446 GLU B C    1  
ATOM 1163  O O    . GLU B 2 31 ? 3.144   3.389   17.349 1.00 0.00 ? 446 GLU B O    1  
ATOM 1164  C CB   . GLU B 2 31 ? 3.206   6.434   18.207 1.00 0.00 ? 446 GLU B CB   1  
ATOM 1165  C CG   . GLU B 2 31 ? 2.634   7.598   19.002 1.00 0.00 ? 446 GLU B CG   1  
ATOM 1166  C CD   . GLU B 2 31 ? 1.511   8.307   18.272 1.00 0.00 ? 446 GLU B CD   1  
ATOM 1167  O OE1  . GLU B 2 31 ? 0.356   7.840   18.362 1.00 0.00 ? 446 GLU B OE1  1  
ATOM 1168  O OE2  . GLU B 2 31 ? 1.785   9.331   17.611 1.00 0.00 ? 446 GLU B OE2  1  
ATOM 1169  H H    . GLU B 2 31 ? 4.960   4.669   20.201 1.00 0.00 ? 446 GLU B H    1  
ATOM 1170  H HA   . GLU B 2 31 ? 2.783   5.269   19.952 1.00 0.00 ? 446 GLU B HA   1  
ATOM 1171  H HB2  . GLU B 2 31 ? 4.202   6.701   17.887 1.00 0.00 ? 446 GLU B HB2  1  
ATOM 1172  H HB3  . GLU B 2 31 ? 2.586   6.282   17.335 1.00 0.00 ? 446 GLU B HB3  1  
ATOM 1173  H HG2  . GLU B 2 31 ? 2.252   7.223   19.941 1.00 0.00 ? 446 GLU B HG2  1  
ATOM 1174  H HG3  . GLU B 2 31 ? 3.425   8.309   19.195 1.00 0.00 ? 446 GLU B HG3  1  
ATOM 1175  N N    . GLU B 2 32 ? 1.312   3.764   18.602 1.00 0.00 ? 447 GLU B N    1  
ATOM 1176  C CA   . GLU B 2 32 ? 0.520   2.723   17.955 1.00 0.00 ? 447 GLU B CA   1  
ATOM 1177  C C    . GLU B 2 32 ? -0.923  3.178   17.767 1.00 0.00 ? 447 GLU B C    1  
ATOM 1178  O O    . GLU B 2 32 ? -1.371  4.133   18.403 1.00 0.00 ? 447 GLU B O    1  
ATOM 1179  C CB   . GLU B 2 32 ? 0.561   1.435   18.779 1.00 0.00 ? 447 GLU B CB   1  
ATOM 1180  C CG   . GLU B 2 32 ? 1.948   1.078   19.284 1.00 0.00 ? 447 GLU B CG   1  
ATOM 1181  C CD   . GLU B 2 32 ? 2.915   0.758   18.160 1.00 0.00 ? 447 GLU B CD   1  
ATOM 1182  O OE1  . GLU B 2 32 ? 2.472   0.181   17.144 1.00 0.00 ? 447 GLU B OE1  1  
ATOM 1183  O OE2  . GLU B 2 32 ? 4.113   1.085   18.296 1.00 0.00 ? 447 GLU B OE2  1  
ATOM 1184  H H    . GLU B 2 32 ? 0.907   4.294   19.320 1.00 0.00 ? 447 GLU B H    1  
ATOM 1185  H HA   . GLU B 2 32 ? 0.954   2.534   16.985 1.00 0.00 ? 447 GLU B HA   1  
ATOM 1186  H HB2  . GLU B 2 32 ? -0.093  1.547   19.630 1.00 0.00 ? 447 GLU B HB2  1  
ATOM 1187  H HB3  . GLU B 2 32 ? 0.204   0.620   18.166 1.00 0.00 ? 447 GLU B HB3  1  
ATOM 1188  H HG2  . GLU B 2 32 ? 2.339   1.914   19.847 1.00 0.00 ? 447 GLU B HG2  1  
ATOM 1189  H HG3  . GLU B 2 32 ? 1.871   0.216   19.930 1.00 0.00 ? 447 GLU B HG3  1  
ATOM 1190  N N    . GLY B 2 33 ? -1.646  2.490   16.890 1.00 0.00 ? 448 GLY B N    1  
ATOM 1191  C CA   . GLY B 2 33 ? -3.031  2.840   16.634 1.00 0.00 ? 448 GLY B CA   1  
ATOM 1192  C C    . GLY B 2 33 ? -3.185  3.805   15.476 1.00 0.00 ? 448 GLY B C    1  
ATOM 1193  O O    . GLY B 2 33 ? -4.223  4.451   15.332 1.00 0.00 ? 448 GLY B O    1  
ATOM 1194  H H    . GLY B 2 33 ? -1.237  1.737   16.414 1.00 0.00 ? 448 GLY B H    1  
ATOM 1195  H HA2  . GLY B 2 33 ? -3.582  1.937   16.414 1.00 0.00 ? 448 GLY B HA2  1  
ATOM 1196  H HA3  . GLY B 2 33 ? -3.445  3.292   17.523 1.00 0.00 ? 448 GLY B HA3  1  
ATOM 1197  N N    . GLU B 2 34 ? -2.150  3.906   14.646 1.00 0.00 ? 449 GLU B N    1  
ATOM 1198  C CA   . GLU B 2 34 ? -2.179  4.802   13.494 1.00 0.00 ? 449 GLU B CA   1  
ATOM 1199  C C    . GLU B 2 34 ? -2.342  4.020   12.201 1.00 0.00 ? 449 GLU B C    1  
ATOM 1200  O O    . GLU B 2 34 ? -1.934  4.481   11.139 1.00 0.00 ? 449 GLU B O    1  
ATOM 1201  C CB   . GLU B 2 34 ? -0.894  5.627   13.417 1.00 0.00 ? 449 GLU B CB   1  
ATOM 1202  C CG   . GLU B 2 34 ? -0.314  5.996   14.774 1.00 0.00 ? 449 GLU B CG   1  
ATOM 1203  C CD   . GLU B 2 34 ? -1.142  7.039   15.498 1.00 0.00 ? 449 GLU B CD   1  
ATOM 1204  O OE1  . GLU B 2 34 ? -1.244  8.173   14.988 1.00 0.00 ? 449 GLU B OE1  1  
ATOM 1205  O OE2  . GLU B 2 34 ? -1.685  6.721   16.577 1.00 0.00 ? 449 GLU B OE2  1  
ATOM 1206  H H    . GLU B 2 34 ? -1.349  3.367   14.810 1.00 0.00 ? 449 GLU B H    1  
ATOM 1207  H HA   . GLU B 2 34 ? -3.021  5.469   13.609 1.00 0.00 ? 449 GLU B HA   1  
ATOM 1208  H HB2  . GLU B 2 34 ? -0.153  5.061   12.869 1.00 0.00 ? 449 GLU B HB2  1  
ATOM 1209  H HB3  . GLU B 2 34 ? -1.101  6.541   12.879 1.00 0.00 ? 449 GLU B HB3  1  
ATOM 1210  H HG2  . GLU B 2 34 ? -0.268  5.107   15.386 1.00 0.00 ? 449 GLU B HG2  1  
ATOM 1211  H HG3  . GLU B 2 34 ? 0.683   6.384   14.631 1.00 0.00 ? 449 GLU B HG3  1  
ATOM 1212  N N    . GLU B 2 35 ? -2.931  2.834   12.287 1.00 0.00 ? 450 GLU B N    1  
ATOM 1213  C CA   . GLU B 2 35 ? -3.124  2.010   11.103 1.00 0.00 ? 450 GLU B CA   1  
ATOM 1214  C C    . GLU B 2 35 ? -4.493  1.336   11.113 1.00 0.00 ? 450 GLU B C    1  
ATOM 1215  O O    . GLU B 2 35 ? -5.070  1.092   12.172 1.00 0.00 ? 450 GLU B O    1  
ATOM 1216  C CB   . GLU B 2 35 ? -2.009  0.967   10.995 1.00 0.00 ? 450 GLU B CB   1  
ATOM 1217  C CG   . GLU B 2 35 ? -2.096  -0.143  12.033 1.00 0.00 ? 450 GLU B CG   1  
ATOM 1218  C CD   . GLU B 2 35 ? -1.402  0.219   13.332 1.00 0.00 ? 450 GLU B CD   1  
ATOM 1219  O OE1  . GLU B 2 35 ? -0.439  1.013   13.290 1.00 0.00 ? 450 GLU B OE1  1  
ATOM 1220  O OE2  . GLU B 2 35 ? -1.823  -0.291  14.392 1.00 0.00 ? 450 GLU B OE2  1  
ATOM 1221  H H    . GLU B 2 35 ? -3.236  2.507   13.158 1.00 0.00 ? 450 GLU B H    1  
ATOM 1222  H HA   . GLU B 2 35 ? -3.072  2.661   10.245 1.00 0.00 ? 450 GLU B HA   1  
ATOM 1223  H HB2  . GLU B 2 35 ? -2.047  0.519   10.015 1.00 0.00 ? 450 GLU B HB2  1  
ATOM 1224  H HB3  . GLU B 2 35 ? -1.057  1.466   11.114 1.00 0.00 ? 450 GLU B HB3  1  
ATOM 1225  H HG2  . GLU B 2 35 ? -3.136  -0.346  12.243 1.00 0.00 ? 450 GLU B HG2  1  
ATOM 1226  H HG3  . GLU B 2 35 ? -1.632  -1.031  11.630 1.00 0.00 ? 450 GLU B HG3  1  
ATOM 1227  N N    . TYR B 2 36 ? -5.005  1.042   9.923  1.00 0.00 ? 451 TYR B N    1  
ATOM 1228  C CA   . TYR B 2 36 ? -6.306  0.402   9.783  1.00 0.00 ? 451 TYR B CA   1  
ATOM 1229  C C    . TYR B 2 36 ? -6.252  -0.728  8.760  1.00 0.00 ? 451 TYR B C    1  
ATOM 1230  O O    . TYR B 2 36 ? -5.132  -1.141  8.395  1.00 0.00 ? 451 TYR B O    1  
ATOM 1231  C CB   . TYR B 2 36 ? -7.357  1.431   9.367  1.00 0.00 ? 451 TYR B CB   1  
ATOM 1232  C CG   . TYR B 2 36 ? -7.869  2.273   10.514 1.00 0.00 ? 451 TYR B CG   1  
ATOM 1233  C CD1  . TYR B 2 36 ? -7.176  3.402   10.933 1.00 0.00 ? 451 TYR B CD1  1  
ATOM 1234  C CD2  . TYR B 2 36 ? -9.042  1.940   11.177 1.00 0.00 ? 451 TYR B CD2  1  
ATOM 1235  C CE1  . TYR B 2 36 ? -7.639  4.175   11.982 1.00 0.00 ? 451 TYR B CE1  1  
ATOM 1236  C CE2  . TYR B 2 36 ? -9.511  2.706   12.227 1.00 0.00 ? 451 TYR B CE2  1  
ATOM 1237  C CZ   . TYR B 2 36 ? -8.806  3.823   12.625 1.00 0.00 ? 451 TYR B CZ   1  
ATOM 1238  O OH   . TYR B 2 36 ? -9.270  4.588   13.670 1.00 0.00 ? 451 TYR B OH   1  
ATOM 1239  O OXT  . TYR B 2 36 ? -7.331  -1.188  8.332  1.00 0.00 ? 451 TYR B OXT  1  
ATOM 1240  H H    . TYR B 2 36 ? -4.495  1.266   9.115  1.00 0.00 ? 451 TYR B H    1  
ATOM 1241  H HA   . TYR B 2 36 ? -6.578  -0.010  10.745 1.00 0.00 ? 451 TYR B HA   1  
ATOM 1242  H HB2  . TYR B 2 36 ? -6.927  2.096   8.634  1.00 0.00 ? 451 TYR B HB2  1  
ATOM 1243  H HB3  . TYR B 2 36 ? -8.201  0.917   8.929  1.00 0.00 ? 451 TYR B HB3  1  
ATOM 1244  H HD1  . TYR B 2 36 ? -6.261  3.675   10.428 1.00 0.00 ? 451 TYR B HD1  1  
ATOM 1245  H HD2  . TYR B 2 36 ? -9.593  1.064   10.863 1.00 0.00 ? 451 TYR B HD2  1  
ATOM 1246  H HE1  . TYR B 2 36 ? -7.085  5.048   12.294 1.00 0.00 ? 451 TYR B HE1  1  
ATOM 1247  H HE2  . TYR B 2 36 ? -10.427 2.431   12.731 1.00 0.00 ? 451 TYR B HE2  1  
ATOM 1248  H HH   . TYR B 2 36 ? -10.020 5.109   13.376 1.00 0.00 ? 451 TYR B HH   1  
ATOM 1249  N N    . ARG A 1 8  ? 12.679  9.902   -2.541 1.00 0.00 ? 210 ARG A N    2  
ATOM 1250  C CA   . ARG A 1 8  ? 11.615  8.906   -2.589 1.00 0.00 ? 210 ARG A CA   2  
ATOM 1251  C C    . ARG A 1 8  ? 11.654  8.007   -1.356 1.00 0.00 ? 210 ARG A C    2  
ATOM 1252  O O    . ARG A 1 8  ? 12.384  7.017   -1.322 1.00 0.00 ? 210 ARG A O    2  
ATOM 1253  C CB   . ARG A 1 8  ? 11.739  8.060   -3.859 1.00 0.00 ? 210 ARG A CB   2  
ATOM 1254  C CG   . ARG A 1 8  ? 10.415  7.836   -4.572 1.00 0.00 ? 210 ARG A CG   2  
ATOM 1255  C CD   . ARG A 1 8  ? 10.287  8.720   -5.803 1.00 0.00 ? 210 ARG A CD   2  
ATOM 1256  N NE   . ARG A 1 8  ? 9.629   8.027   -6.909 1.00 0.00 ? 210 ARG A NE   2  
ATOM 1257  C CZ   . ARG A 1 8  ? 8.334   7.717   -6.923 1.00 0.00 ? 210 ARG A CZ   2  
ATOM 1258  N NH1  . ARG A 1 8  ? 7.557   8.037   -5.896 1.00 0.00 ? 210 ARG A NH1  2  
ATOM 1259  N NH2  . ARG A 1 8  ? 7.816   7.086   -7.968 1.00 0.00 ? 210 ARG A NH2  2  
ATOM 1260  H HA   . ARG A 1 8  ? 10.671  9.430   -2.608 1.00 0.00 ? 210 ARG A HA   2  
ATOM 1261  H HB2  . ARG A 1 8  ? 12.413  8.554   -4.542 1.00 0.00 ? 210 ARG A HB2  2  
ATOM 1262  H HB3  . ARG A 1 8  ? 12.150  7.095   -3.598 1.00 0.00 ? 210 ARG A HB3  2  
ATOM 1263  H HG2  . ARG A 1 8  ? 10.351  6.802   -4.876 1.00 0.00 ? 210 ARG A HG2  2  
ATOM 1264  H HG3  . ARG A 1 8  ? 9.608   8.063   -3.891 1.00 0.00 ? 210 ARG A HG3  2  
ATOM 1265  H HD2  . ARG A 1 8  ? 9.708   9.594   -5.544 1.00 0.00 ? 210 ARG A HD2  2  
ATOM 1266  H HD3  . ARG A 1 8  ? 11.275  9.023   -6.117 1.00 0.00 ? 210 ARG A HD3  2  
ATOM 1267  H HE   . ARG A 1 8  ? 10.180  7.779   -7.679 1.00 0.00 ? 210 ARG A HE   2  
ATOM 1268  H HH11 . ARG A 1 8  ? 7.940   8.514   -5.106 1.00 0.00 ? 210 ARG A HH11 2  
ATOM 1269  H HH12 . ARG A 1 8  ? 6.584   7.802   -5.914 1.00 0.00 ? 210 ARG A HH12 2  
ATOM 1270  H HH21 . ARG A 1 8  ? 8.398   6.843   -8.744 1.00 0.00 ? 210 ARG A HH21 2  
ATOM 1271  H HH22 . ARG A 1 8  ? 6.844   6.853   -7.979 1.00 0.00 ? 210 ARG A HH22 2  
ATOM 1272  N N    . GLU A 1 9  ? 10.865  8.360   -0.347 1.00 0.00 ? 211 GLU A N    2  
ATOM 1273  C CA   . GLU A 1 9  ? 10.811  7.586   0.886  1.00 0.00 ? 211 GLU A CA   2  
ATOM 1274  C C    . GLU A 1 9  ? 10.374  6.150   0.609  1.00 0.00 ? 211 GLU A C    2  
ATOM 1275  O O    . GLU A 1 9  ? 11.193  5.232   0.595  1.00 0.00 ? 211 GLU A O    2  
ATOM 1276  C CB   . GLU A 1 9  ? 9.854   8.241   1.884  1.00 0.00 ? 211 GLU A CB   2  
ATOM 1277  C CG   . GLU A 1 9  ? 10.522  9.274   2.778  1.00 0.00 ? 211 GLU A CG   2  
ATOM 1278  C CD   . GLU A 1 9  ? 10.116  9.137   4.233  1.00 0.00 ? 211 GLU A CD   2  
ATOM 1279  O OE1  . GLU A 1 9  ? 8.938   8.815   4.493  1.00 0.00 ? 211 GLU A OE1  2  
ATOM 1280  O OE2  . GLU A 1 9  ? 10.977  9.353   5.111  1.00 0.00 ? 211 GLU A OE2  2  
ATOM 1281  H H    . GLU A 1 9  ? 10.306  9.160   -0.435 1.00 0.00 ? 211 GLU A H    2  
ATOM 1282  H HA   . GLU A 1 9  ? 11.803  7.570   1.311  1.00 0.00 ? 211 GLU A HA   2  
ATOM 1283  H HB2  . GLU A 1 9  ? 9.060   8.728   1.338  1.00 0.00 ? 211 GLU A HB2  2  
ATOM 1284  H HB3  . GLU A 1 9  ? 9.427   7.475   2.514  1.00 0.00 ? 211 GLU A HB3  2  
ATOM 1285  H HG2  . GLU A 1 9  ? 11.592  9.156   2.706  1.00 0.00 ? 211 GLU A HG2  2  
ATOM 1286  H HG3  . GLU A 1 9  ? 10.245  10.260  2.433  1.00 0.00 ? 211 GLU A HG3  2  
ATOM 1287  N N    . LEU A 1 10 ? 9.075   5.964   0.389  1.00 0.00 ? 212 LEU A N    2  
ATOM 1288  C CA   . LEU A 1 10 ? 8.531   4.639   0.112  1.00 0.00 ? 212 LEU A CA   2  
ATOM 1289  C C    . LEU A 1 10 ? 7.975   4.564   -1.305 1.00 0.00 ? 212 LEU A C    2  
ATOM 1290  O O    . LEU A 1 10 ? 7.446   5.545   -1.830 1.00 0.00 ? 212 LEU A O    2  
ATOM 1291  C CB   . LEU A 1 10 ? 7.432   4.295   1.119  1.00 0.00 ? 212 LEU A CB   2  
ATOM 1292  C CG   . LEU A 1 10 ? 7.905   4.141   2.566  1.00 0.00 ? 212 LEU A CG   2  
ATOM 1293  C CD1  . LEU A 1 10 ? 6.739   3.776   3.472  1.00 0.00 ? 212 LEU A CD1  2  
ATOM 1294  C CD2  . LEU A 1 10 ? 9.003   3.091   2.656  1.00 0.00 ? 212 LEU A CD2  2  
ATOM 1295  H H    . LEU A 1 10 ? 8.470   6.734   0.414  1.00 0.00 ? 212 LEU A H    2  
ATOM 1296  H HA   . LEU A 1 10 ? 9.332   3.923   0.210  1.00 0.00 ? 212 LEU A HA   2  
ATOM 1297  H HB2  . LEU A 1 10 ? 6.686   5.075   1.087  1.00 0.00 ? 212 LEU A HB2  2  
ATOM 1298  H HB3  . LEU A 1 10 ? 6.971   3.367   0.815  1.00 0.00 ? 212 LEU A HB3  2  
ATOM 1299  H HG   . LEU A 1 10 ? 8.311   5.081   2.908  1.00 0.00 ? 212 LEU A HG   2  
ATOM 1300  H HD11 . LEU A 1 10 ? 6.220   4.675   3.770  1.00 0.00 ? 212 LEU A HD11 2  
ATOM 1301  H HD12 . LEU A 1 10 ? 6.060   3.126   2.941  1.00 0.00 ? 212 LEU A HD12 2  
ATOM 1302  H HD13 . LEU A 1 10 ? 7.112   3.268   4.350  1.00 0.00 ? 212 LEU A HD13 2  
ATOM 1303  H HD21 . LEU A 1 10 ? 9.172   2.836   3.692  1.00 0.00 ? 212 LEU A HD21 2  
ATOM 1304  H HD22 . LEU A 1 10 ? 8.703   2.209   2.112  1.00 0.00 ? 212 LEU A HD22 2  
ATOM 1305  H HD23 . LEU A 1 10 ? 9.914   3.485   2.230  1.00 0.00 ? 212 LEU A HD23 2  
ATOM 1306  N N    . LYS A 1 11 ? 8.096   3.392   -1.919 1.00 0.00 ? 213 LYS A N    2  
ATOM 1307  C CA   . LYS A 1 11 ? 7.606   3.184   -3.277 1.00 0.00 ? 213 LYS A CA   2  
ATOM 1308  C C    . LYS A 1 11 ? 6.792   1.898   -3.365 1.00 0.00 ? 213 LYS A C    2  
ATOM 1309  O O    . LYS A 1 11 ? 7.059   0.933   -2.650 1.00 0.00 ? 213 LYS A O    2  
ATOM 1310  C CB   . LYS A 1 11 ? 8.773   3.132   -4.262 1.00 0.00 ? 213 LYS A CB   2  
ATOM 1311  C CG   . LYS A 1 11 ? 9.694   4.340   -4.180 1.00 0.00 ? 213 LYS A CG   2  
ATOM 1312  C CD   . LYS A 1 11 ? 11.104  3.943   -3.770 1.00 0.00 ? 213 LYS A CD   2  
ATOM 1313  C CE   . LYS A 1 11 ? 11.975  3.654   -4.981 1.00 0.00 ? 213 LYS A CE   2  
ATOM 1314  N NZ   . LYS A 1 11 ? 11.988  4.794   -5.940 1.00 0.00 ? 213 LYS A NZ   2  
ATOM 1315  H H    . LYS A 1 11 ? 8.527   2.648   -1.448 1.00 0.00 ? 213 LYS A H    2  
ATOM 1316  H HA   . LYS A 1 11 ? 6.968   4.019   -3.530 1.00 0.00 ? 213 LYS A HA   2  
ATOM 1317  H HB2  . LYS A 1 11 ? 9.356   2.245   -4.066 1.00 0.00 ? 213 LYS A HB2  2  
ATOM 1318  H HB3  . LYS A 1 11 ? 8.377   3.077   -5.267 1.00 0.00 ? 213 LYS A HB3  2  
ATOM 1319  H HG2  . LYS A 1 11 ? 9.733   4.817   -5.146 1.00 0.00 ? 213 LYS A HG2  2  
ATOM 1320  H HG3  . LYS A 1 11 ? 9.298   5.031   -3.450 1.00 0.00 ? 213 LYS A HG3  2  
ATOM 1321  H HD2  . LYS A 1 11 ? 11.546  4.750   -3.206 1.00 0.00 ? 213 LYS A HD2  2  
ATOM 1322  H HD3  . LYS A 1 11 ? 11.052  3.056   -3.155 1.00 0.00 ? 213 LYS A HD3  2  
ATOM 1323  H HE2  . LYS A 1 11 ? 12.985  3.466   -4.647 1.00 0.00 ? 213 LYS A HE2  2  
ATOM 1324  H HE3  . LYS A 1 11 ? 11.594  2.777   -5.483 1.00 0.00 ? 213 LYS A HE3  2  
ATOM 1325  H HZ1  . LYS A 1 11 ? 11.921  5.695   -5.424 1.00 0.00 ? 213 LYS A HZ1  2  
ATOM 1326  H HZ2  . LYS A 1 11 ? 11.183  4.720   -6.594 1.00 0.00 ? 213 LYS A HZ2  2  
ATOM 1327  H HZ3  . LYS A 1 11 ? 12.870  4.788   -6.491 1.00 0.00 ? 213 LYS A HZ3  2  
ATOM 1328  N N    . ILE A 1 12 ? 5.796   1.891   -4.245 1.00 0.00 ? 214 ILE A N    2  
ATOM 1329  C CA   . ILE A 1 12 ? 4.944   0.722   -4.423 1.00 0.00 ? 214 ILE A CA   2  
ATOM 1330  C C    . ILE A 1 12 ? 5.765   -0.489  -4.857 1.00 0.00 ? 214 ILE A C    2  
ATOM 1331  O O    . ILE A 1 12 ? 6.630   -0.389  -5.727 1.00 0.00 ? 214 ILE A O    2  
ATOM 1332  C CB   . ILE A 1 12 ? 3.838   0.984   -5.464 1.00 0.00 ? 214 ILE A CB   2  
ATOM 1333  C CG1  . ILE A 1 12 ? 3.040   2.234   -5.085 1.00 0.00 ? 214 ILE A CG1  2  
ATOM 1334  C CG2  . ILE A 1 12 ? 2.917   -0.224  -5.580 1.00 0.00 ? 214 ILE A CG2  2  
ATOM 1335  C CD1  . ILE A 1 12 ? 1.946   2.574   -6.073 1.00 0.00 ? 214 ILE A CD1  2  
ATOM 1336  H H    . ILE A 1 12 ? 5.631   2.691   -4.786 1.00 0.00 ? 214 ILE A H    2  
ATOM 1337  H HA   . ILE A 1 12 ? 4.475   0.505   -3.474 1.00 0.00 ? 214 ILE A HA   2  
ATOM 1338  H HB   . ILE A 1 12 ? 4.307   1.142   -6.423 1.00 0.00 ? 214 ILE A HB   2  
ATOM 1339  H HG12 . ILE A 1 12 ? 2.580   2.080   -4.121 1.00 0.00 ? 214 ILE A HG12 2  
ATOM 1340  H HG13 . ILE A 1 12 ? 3.711   3.078   -5.030 1.00 0.00 ? 214 ILE A HG13 2  
ATOM 1341  H HG21 . ILE A 1 12 ? 2.958   -0.797  -4.664 1.00 0.00 ? 214 ILE A HG21 2  
ATOM 1342  H HG22 . ILE A 1 12 ? 1.904   0.110   -5.751 1.00 0.00 ? 214 ILE A HG22 2  
ATOM 1343  H HG23 . ILE A 1 12 ? 3.238   -0.842  -6.405 1.00 0.00 ? 214 ILE A HG23 2  
ATOM 1344  H HD11 . ILE A 1 12 ? 1.932   3.640   -6.242 1.00 0.00 ? 214 ILE A HD11 2  
ATOM 1345  H HD12 . ILE A 1 12 ? 2.134   2.063   -7.007 1.00 0.00 ? 214 ILE A HD12 2  
ATOM 1346  H HD13 . ILE A 1 12 ? 0.993   2.259   -5.675 1.00 0.00 ? 214 ILE A HD13 2  
ATOM 1347  N N    . GLY A 1 13 ? 5.490   -1.635  -4.239 1.00 0.00 ? 215 GLY A N    2  
ATOM 1348  C CA   . GLY A 1 13 ? 6.212   -2.848  -4.571 1.00 0.00 ? 215 GLY A CA   2  
ATOM 1349  C C    . GLY A 1 13 ? 7.420   -3.073  -3.680 1.00 0.00 ? 215 GLY A C    2  
ATOM 1350  O O    . GLY A 1 13 ? 8.111   -4.083  -3.806 1.00 0.00 ? 215 GLY A O    2  
ATOM 1351  H H    . GLY A 1 13 ? 4.792   -1.654  -3.553 1.00 0.00 ? 215 GLY A H    2  
ATOM 1352  H HA2  . GLY A 1 13 ? 5.542   -3.690  -4.469 1.00 0.00 ? 215 GLY A HA2  2  
ATOM 1353  H HA3  . GLY A 1 13 ? 6.541   -2.787  -5.598 1.00 0.00 ? 215 GLY A HA3  2  
ATOM 1354  N N    . ASP A 1 14 ? 7.679   -2.129  -2.777 1.00 0.00 ? 216 ASP A N    2  
ATOM 1355  C CA   . ASP A 1 14 ? 8.815   -2.233  -1.869 1.00 0.00 ? 216 ASP A CA   2  
ATOM 1356  C C    . ASP A 1 14 ? 8.400   -2.861  -0.543 1.00 0.00 ? 216 ASP A C    2  
ATOM 1357  O O    . ASP A 1 14 ? 7.300   -2.617  -0.046 1.00 0.00 ? 216 ASP A O    2  
ATOM 1358  C CB   . ASP A 1 14 ? 9.427   -0.854  -1.623 1.00 0.00 ? 216 ASP A CB   2  
ATOM 1359  C CG   . ASP A 1 14 ? 10.286  -0.386  -2.782 1.00 0.00 ? 216 ASP A CG   2  
ATOM 1360  O OD1  . ASP A 1 14 ? 10.654  -1.230  -3.627 1.00 0.00 ? 216 ASP A OD1  2  
ATOM 1361  O OD2  . ASP A 1 14 ? 10.591  0.823   -2.845 1.00 0.00 ? 216 ASP A OD2  2  
ATOM 1362  H H    . ASP A 1 14 ? 7.097   -1.344  -2.722 1.00 0.00 ? 216 ASP A H    2  
ATOM 1363  H HA   . ASP A 1 14 ? 9.554   -2.865  -2.335 1.00 0.00 ? 216 ASP A HA   2  
ATOM 1364  H HB2  . ASP A 1 14 ? 8.635   -0.136  -1.474 1.00 0.00 ? 216 ASP A HB2  2  
ATOM 1365  H HB3  . ASP A 1 14 ? 10.042  -0.893  -0.736 1.00 0.00 ? 216 ASP A HB3  2  
ATOM 1366  N N    . ARG A 1 15 ? 9.291   -3.666  0.028  1.00 0.00 ? 217 ARG A N    2  
ATOM 1367  C CA   . ARG A 1 15 ? 9.020   -4.324  1.301  1.00 0.00 ? 217 ARG A CA   2  
ATOM 1368  C C    . ARG A 1 15 ? 9.172   -3.338  2.452  1.00 0.00 ? 217 ARG A C    2  
ATOM 1369  O O    . ARG A 1 15 ? 10.173  -2.630  2.548  1.00 0.00 ? 217 ARG A O    2  
ATOM 1370  C CB   . ARG A 1 15 ? 9.964   -5.511  1.498  1.00 0.00 ? 217 ARG A CB   2  
ATOM 1371  C CG   . ARG A 1 15 ? 9.323   -6.688  2.212  1.00 0.00 ? 217 ARG A CG   2  
ATOM 1372  C CD   . ARG A 1 15 ? 8.828   -7.734  1.225  1.00 0.00 ? 217 ARG A CD   2  
ATOM 1373  N NE   . ARG A 1 15 ? 9.910   -8.261  0.398  1.00 0.00 ? 217 ARG A NE   2  
ATOM 1374  C CZ   . ARG A 1 15 ? 9.791   -9.332  -0.385 1.00 0.00 ? 217 ARG A CZ   2  
ATOM 1375  N NH1  . ARG A 1 15 ? 8.641   -9.990  -0.451 1.00 0.00 ? 217 ARG A NH1  2  
ATOM 1376  N NH2  . ARG A 1 15 ? 10.826  -9.744  -1.104 1.00 0.00 ? 217 ARG A NH2  2  
ATOM 1377  H H    . ARG A 1 15 ? 10.151  -3.818  -0.414 1.00 0.00 ? 217 ARG A H    2  
ATOM 1378  H HA   . ARG A 1 15 ? 8.000   -4.681  1.282  1.00 0.00 ? 217 ARG A HA   2  
ATOM 1379  H HB2  . ARG A 1 15 ? 10.308  -5.847  0.531  1.00 0.00 ? 217 ARG A HB2  2  
ATOM 1380  H HB3  . ARG A 1 15 ? 10.814  -5.186  2.080  1.00 0.00 ? 217 ARG A HB3  2  
ATOM 1381  H HG2  . ARG A 1 15 ? 10.051  -7.142  2.867  1.00 0.00 ? 217 ARG A HG2  2  
ATOM 1382  H HG3  . ARG A 1 15 ? 8.486   -6.331  2.795  1.00 0.00 ? 217 ARG A HG3  2  
ATOM 1383  H HD2  . ARG A 1 15 ? 8.380   -8.548  1.777  1.00 0.00 ? 217 ARG A HD2  2  
ATOM 1384  H HD3  . ARG A 1 15 ? 8.084   -7.282  0.585  1.00 0.00 ? 217 ARG A HD3  2  
ATOM 1385  H HE   . ARG A 1 15 ? 10.771  -7.795  0.429  1.00 0.00 ? 217 ARG A HE   2  
ATOM 1386  H HH11 . ARG A 1 15 ? 7.857   -9.683  0.087  1.00 0.00 ? 217 ARG A HH11 2  
ATOM 1387  H HH12 . ARG A 1 15 ? 8.558   -10.792 -1.042 1.00 0.00 ? 217 ARG A HH12 2  
ATOM 1388  H HH21 . ARG A 1 15 ? 11.696  -9.252  -1.057 1.00 0.00 ? 217 ARG A HH21 2  
ATOM 1389  H HH22 . ARG A 1 15 ? 10.737  -10.548 -1.693 1.00 0.00 ? 217 ARG A HH22 2  
ATOM 1390  N N    . VAL A 1 16 ? 8.168   -3.291  3.318  1.00 0.00 ? 218 VAL A N    2  
ATOM 1391  C CA   . VAL A 1 16 ? 8.188   -2.383  4.454  1.00 0.00 ? 218 VAL A CA   2  
ATOM 1392  C C    . VAL A 1 16 ? 7.436   -2.960  5.646  1.00 0.00 ? 218 VAL A C    2  
ATOM 1393  O O    . VAL A 1 16 ? 6.949   -4.090  5.602  1.00 0.00 ? 218 VAL A O    2  
ATOM 1394  C CB   . VAL A 1 16 ? 7.558   -1.024  4.087  1.00 0.00 ? 218 VAL A CB   2  
ATOM 1395  C CG1  . VAL A 1 16 ? 8.193   -0.464  2.822  1.00 0.00 ? 218 VAL A CG1  2  
ATOM 1396  C CG2  . VAL A 1 16 ? 6.050   -1.161  3.919  1.00 0.00 ? 218 VAL A CG2  2  
ATOM 1397  H H    . VAL A 1 16 ? 7.393   -3.876  3.185  1.00 0.00 ? 218 VAL A H    2  
ATOM 1398  H HA   . VAL A 1 16 ? 9.218   -2.215  4.733  1.00 0.00 ? 218 VAL A HA   2  
ATOM 1399  H HB   . VAL A 1 16 ? 7.749   -0.333  4.894  1.00 0.00 ? 218 VAL A HB   2  
ATOM 1400  H HG11 . VAL A 1 16 ? 9.250   -0.320  2.983  1.00 0.00 ? 218 VAL A HG11 2  
ATOM 1401  H HG12 . VAL A 1 16 ? 8.044   -1.158  2.007  1.00 0.00 ? 218 VAL A HG12 2  
ATOM 1402  H HG13 . VAL A 1 16 ? 7.733   0.481   2.578  1.00 0.00 ? 218 VAL A HG13 2  
ATOM 1403  H HG21 . VAL A 1 16 ? 5.590   -1.272  4.891  1.00 0.00 ? 218 VAL A HG21 2  
ATOM 1404  H HG22 . VAL A 1 16 ? 5.659   -0.277  3.438  1.00 0.00 ? 218 VAL A HG22 2  
ATOM 1405  H HG23 . VAL A 1 16 ? 5.829   -2.028  3.316  1.00 0.00 ? 218 VAL A HG23 2  
ATOM 1406  N N    . LEU A 1 17 ? 7.330   -2.161  6.700  1.00 0.00 ? 219 LEU A N    2  
ATOM 1407  C CA   . LEU A 1 17 ? 6.618   -2.569  7.901  1.00 0.00 ? 219 LEU A CA   2  
ATOM 1408  C C    . LEU A 1 17 ? 5.532   -1.558  8.234  1.00 0.00 ? 219 LEU A C    2  
ATOM 1409  O O    . LEU A 1 17 ? 5.815   -0.381  8.447  1.00 0.00 ? 219 LEU A O    2  
ATOM 1410  C CB   . LEU A 1 17 ? 7.573   -2.695  9.087  1.00 0.00 ? 219 LEU A CB   2  
ATOM 1411  C CG   . LEU A 1 17 ? 8.677   -3.743  8.937  1.00 0.00 ? 219 LEU A CG   2  
ATOM 1412  C CD1  . LEU A 1 17 ? 9.405   -3.932  10.260 1.00 0.00 ? 219 LEU A CD1  2  
ATOM 1413  C CD2  . LEU A 1 17 ? 8.100   -5.065  8.449  1.00 0.00 ? 219 LEU A CD2  2  
ATOM 1414  H H    . LEU A 1 17 ? 7.729   -1.267  6.664  1.00 0.00 ? 219 LEU A H    2  
ATOM 1415  H HA   . LEU A 1 17 ? 6.160   -3.526  7.710  1.00 0.00 ? 219 LEU A HA   2  
ATOM 1416  H HB2  . LEU A 1 17 ? 8.039   -1.735  9.250  1.00 0.00 ? 219 LEU A HB2  2  
ATOM 1417  H HB3  . LEU A 1 17 ? 6.989   -2.946  9.961  1.00 0.00 ? 219 LEU A HB3  2  
ATOM 1418  H HG   . LEU A 1 17 ? 9.395   -3.400  8.206  1.00 0.00 ? 219 LEU A HG   2  
ATOM 1419  H HD11 . LEU A 1 17 ? 10.138  -3.150  10.382 1.00 0.00 ? 219 LEU A HD11 2  
ATOM 1420  H HD12 . LEU A 1 17 ? 8.693   -3.889  11.070 1.00 0.00 ? 219 LEU A HD12 2  
ATOM 1421  H HD13 . LEU A 1 17 ? 9.898   -4.894  10.266 1.00 0.00 ? 219 LEU A HD13 2  
ATOM 1422  H HD21 . LEU A 1 17 ? 7.175   -5.266  8.967  1.00 0.00 ? 219 LEU A HD21 2  
ATOM 1423  H HD22 . LEU A 1 17 ? 7.914   -5.005  7.387  1.00 0.00 ? 219 LEU A HD22 2  
ATOM 1424  H HD23 . LEU A 1 17 ? 8.804   -5.860  8.647  1.00 0.00 ? 219 LEU A HD23 2  
ATOM 1425  N N    . VAL A 1 18 ? 4.293   -2.019  8.288  1.00 0.00 ? 220 VAL A N    2  
ATOM 1426  C CA   . VAL A 1 18 ? 3.174   -1.141  8.607  1.00 0.00 ? 220 VAL A CA   2  
ATOM 1427  C C    . VAL A 1 18 ? 2.961   -1.088  10.115 1.00 0.00 ? 220 VAL A C    2  
ATOM 1428  O O    . VAL A 1 18 ? 2.573   -2.078  10.736 1.00 0.00 ? 220 VAL A O    2  
ATOM 1429  C CB   . VAL A 1 18 ? 1.860   -1.577  7.910  1.00 0.00 ? 220 VAL A CB   2  
ATOM 1430  C CG1  . VAL A 1 18 ? 1.287   -0.433  7.087  1.00 0.00 ? 220 VAL A CG1  2  
ATOM 1431  C CG2  . VAL A 1 18 ? 2.077   -2.807  7.038  1.00 0.00 ? 220 VAL A CG2  2  
ATOM 1432  H H    . VAL A 1 18 ? 4.129   -2.970  8.119  1.00 0.00 ? 220 VAL A H    2  
ATOM 1433  H HA   . VAL A 1 18 ? 3.429   -0.150  8.261  1.00 0.00 ? 220 VAL A HA   2  
ATOM 1434  H HB   . VAL A 1 18 ? 1.139   -1.828  8.670  1.00 0.00 ? 220 VAL A HB   2  
ATOM 1435  H HG11 . VAL A 1 18 ? 0.476   0.030   7.629  1.00 0.00 ? 220 VAL A HG11 2  
ATOM 1436  H HG12 . VAL A 1 18 ? 2.059   0.301   6.902  1.00 0.00 ? 220 VAL A HG12 2  
ATOM 1437  H HG13 . VAL A 1 18 ? 0.920   -0.813  6.145  1.00 0.00 ? 220 VAL A HG13 2  
ATOM 1438  H HG21 . VAL A 1 18 ? 2.317   -3.654  7.665  1.00 0.00 ? 220 VAL A HG21 2  
ATOM 1439  H HG22 . VAL A 1 18 ? 1.177   -3.016  6.480  1.00 0.00 ? 220 VAL A HG22 2  
ATOM 1440  H HG23 . VAL A 1 18 ? 2.892   -2.624  6.354  1.00 0.00 ? 220 VAL A HG23 2  
ATOM 1441  N N    . GLY A 1 19 ? 3.240   0.073   10.698 1.00 0.00 ? 221 GLY A N    2  
ATOM 1442  C CA   . GLY A 1 19 ? 3.093   0.239   12.132 1.00 0.00 ? 221 GLY A CA   2  
ATOM 1443  C C    . GLY A 1 19 ? 4.337   -0.183  12.896 1.00 0.00 ? 221 GLY A C    2  
ATOM 1444  O O    . GLY A 1 19 ? 4.420   0.006   14.109 1.00 0.00 ? 221 GLY A O    2  
ATOM 1445  H H    . GLY A 1 19 ? 3.558   0.822   10.152 1.00 0.00 ? 221 GLY A H    2  
ATOM 1446  H HA2  . GLY A 1 19 ? 2.889   1.279   12.344 1.00 0.00 ? 221 GLY A HA2  2  
ATOM 1447  H HA3  . GLY A 1 19 ? 2.258   -0.357  12.469 1.00 0.00 ? 221 GLY A HA3  2  
ATOM 1448  N N    . GLY A 1 20 ? 5.307   -0.757  12.184 1.00 0.00 ? 222 GLY A N    2  
ATOM 1449  C CA   . GLY A 1 20 ? 6.538   -1.197  12.821 1.00 0.00 ? 222 GLY A CA   2  
ATOM 1450  C C    . GLY A 1 20 ? 6.466   -2.634  13.300 1.00 0.00 ? 222 GLY A C    2  
ATOM 1451  O O    . GLY A 1 20 ? 7.488   -3.311  13.404 1.00 0.00 ? 222 GLY A O    2  
ATOM 1452  H H    . GLY A 1 20 ? 5.189   -0.884  11.221 1.00 0.00 ? 222 GLY A H    2  
ATOM 1453  H HA2  . GLY A 1 20 ? 7.346   -1.110  12.111 1.00 0.00 ? 222 GLY A HA2  2  
ATOM 1454  H HA3  . GLY A 1 20 ? 6.745   -0.557  13.664 1.00 0.00 ? 222 GLY A HA3  2  
ATOM 1455  N N    . THR A 1 21 ? 5.258   -3.099  13.595 1.00 0.00 ? 223 THR A N    2  
ATOM 1456  C CA   . THR A 1 21 ? 5.058   -4.462  14.067 1.00 0.00 ? 223 THR A CA   2  
ATOM 1457  C C    . THR A 1 21 ? 4.602   -5.371  12.933 1.00 0.00 ? 223 THR A C    2  
ATOM 1458  O O    . THR A 1 21 ? 4.854   -6.575  12.948 1.00 0.00 ? 223 THR A O    2  
ATOM 1459  C CB   . THR A 1 21 ? 4.027   -4.480  15.195 1.00 0.00 ? 223 THR A CB   2  
ATOM 1460  O OG1  . THR A 1 21 ? 2.840   -3.814  14.800 1.00 0.00 ? 223 THR A OG1  2  
ATOM 1461  C CG2  . THR A 1 21 ? 4.522   -3.820  16.463 1.00 0.00 ? 223 THR A CG2  2  
ATOM 1462  H H    . THR A 1 21 ? 4.481   -2.513  13.494 1.00 0.00 ? 223 THR A H    2  
ATOM 1463  H HA   . THR A 1 21 ? 6.001   -4.824  14.447 1.00 0.00 ? 223 THR A HA   2  
ATOM 1464  H HB   . THR A 1 21 ? 3.779   -5.506  15.428 1.00 0.00 ? 223 THR A HB   2  
ATOM 1465  H HG1  . THR A 1 21 ? 2.136   -4.456  14.686 1.00 0.00 ? 223 THR A HG1  2  
ATOM 1466  H HG21 . THR A 1 21 ? 4.481   -2.747  16.350 1.00 0.00 ? 223 THR A HG21 2  
ATOM 1467  H HG22 . THR A 1 21 ? 5.543   -4.122  16.651 1.00 0.00 ? 223 THR A HG22 2  
ATOM 1468  H HG23 . THR A 1 21 ? 3.898   -4.119  17.293 1.00 0.00 ? 223 THR A HG23 2  
ATOM 1469  N N    . LYS A 1 22 ? 3.928   -4.786  11.948 1.00 0.00 ? 224 LYS A N    2  
ATOM 1470  C CA   . LYS A 1 22 ? 3.435   -5.544  10.806 1.00 0.00 ? 224 LYS A CA   2  
ATOM 1471  C C    . LYS A 1 22 ? 4.364   -5.379  9.606  1.00 0.00 ? 224 LYS A C    2  
ATOM 1472  O O    . LYS A 1 22 ? 4.980   -4.329  9.431  1.00 0.00 ? 224 LYS A O    2  
ATOM 1473  C CB   . LYS A 1 22 ? 2.019   -5.090  10.436 1.00 0.00 ? 224 LYS A CB   2  
ATOM 1474  C CG   . LYS A 1 22 ? 1.143   -4.764  11.637 1.00 0.00 ? 224 LYS A CG   2  
ATOM 1475  C CD   . LYS A 1 22 ? 0.513   -6.014  12.230 1.00 0.00 ? 224 LYS A CD   2  
ATOM 1476  C CE   . LYS A 1 22 ? 1.509   -6.789  13.077 1.00 0.00 ? 224 LYS A CE   2  
ATOM 1477  N NZ   . LYS A 1 22 ? 0.869   -7.381  14.284 1.00 0.00 ? 224 LYS A NZ   2  
ATOM 1478  H H    . LYS A 1 22 ? 3.757   -3.822  11.992 1.00 0.00 ? 224 LYS A H    2  
ATOM 1479  H HA   . LYS A 1 22 ? 3.408   -6.587  11.087 1.00 0.00 ? 224 LYS A HA   2  
ATOM 1480  H HB2  . LYS A 1 22 ? 2.089   -4.207  9.820  1.00 0.00 ? 224 LYS A HB2  2  
ATOM 1481  H HB3  . LYS A 1 22 ? 1.539   -5.876  9.871  1.00 0.00 ? 224 LYS A HB3  2  
ATOM 1482  H HG2  . LYS A 1 22 ? 1.745   -4.285  12.393 1.00 0.00 ? 224 LYS A HG2  2  
ATOM 1483  H HG3  . LYS A 1 22 ? 0.357   -4.092  11.324 1.00 0.00 ? 224 LYS A HG3  2  
ATOM 1484  H HD2  . LYS A 1 22 ? -0.322  -5.726  12.850 1.00 0.00 ? 224 LYS A HD2  2  
ATOM 1485  H HD3  . LYS A 1 22 ? 0.168   -6.647  11.427 1.00 0.00 ? 224 LYS A HD3  2  
ATOM 1486  H HE2  . LYS A 1 22 ? 1.931   -7.584  12.478 1.00 0.00 ? 224 LYS A HE2  2  
ATOM 1487  H HE3  . LYS A 1 22 ? 2.294   -6.117  13.388 1.00 0.00 ? 224 LYS A HE3  2  
ATOM 1488  H HZ1  . LYS A 1 22 ? 0.049   -6.810  14.570 1.00 0.00 ? 224 LYS A HZ1  2  
ATOM 1489  H HZ2  . LYS A 1 22 ? 1.549   -7.410  15.071 1.00 0.00 ? 224 LYS A HZ2  2  
ATOM 1490  H HZ3  . LYS A 1 22 ? 0.549   -8.350  14.081 1.00 0.00 ? 224 LYS A HZ3  2  
ATOM 1491  N N    . ALA A 1 23 ? 4.463   -6.421  8.787  1.00 0.00 ? 225 ALA A N    2  
ATOM 1492  C CA   . ALA A 1 23 ? 5.319   -6.384  7.608  1.00 0.00 ? 225 ALA A CA   2  
ATOM 1493  C C    . ALA A 1 23 ? 4.510   -6.607  6.337  1.00 0.00 ? 225 ALA A C    2  
ATOM 1494  O O    . ALA A 1 23 ? 3.545   -7.369  6.333  1.00 0.00 ? 225 ALA A O    2  
ATOM 1495  C CB   . ALA A 1 23 ? 6.419   -7.425  7.713  1.00 0.00 ? 225 ALA A CB   2  
ATOM 1496  H H    . ALA A 1 23 ? 3.949   -7.233  8.981  1.00 0.00 ? 225 ALA A H    2  
ATOM 1497  H HA   . ALA A 1 23 ? 5.781   -5.409  7.559  1.00 0.00 ? 225 ALA A HA   2  
ATOM 1498  H HB1  . ALA A 1 23 ? 6.662   -7.589  8.752  1.00 0.00 ? 225 ALA A HB1  2  
ATOM 1499  H HB2  . ALA A 1 23 ? 6.082   -8.351  7.271  1.00 0.00 ? 225 ALA A HB2  2  
ATOM 1500  H HB3  . ALA A 1 23 ? 7.297   -7.075  7.190  1.00 0.00 ? 225 ALA A HB3  2  
ATOM 1501  N N    . GLY A 1 24 ? 4.912   -5.939  5.262  1.00 0.00 ? 226 GLY A N    2  
ATOM 1502  C CA   . GLY A 1 24 ? 4.211   -6.081  4.001  1.00 0.00 ? 226 GLY A CA   2  
ATOM 1503  C C    . GLY A 1 24 ? 4.881   -5.328  2.871  1.00 0.00 ? 226 GLY A C    2  
ATOM 1504  O O    . GLY A 1 24 ? 6.023   -4.886  2.999  1.00 0.00 ? 226 GLY A O    2  
ATOM 1505  H H    . GLY A 1 24 ? 5.689   -5.346  5.326  1.00 0.00 ? 226 GLY A H    2  
ATOM 1506  H HA2  . GLY A 1 24 ? 4.168   -7.129  3.744  1.00 0.00 ? 226 GLY A HA2  2  
ATOM 1507  H HA3  . GLY A 1 24 ? 3.205   -5.710  4.120  1.00 0.00 ? 226 GLY A HA3  2  
ATOM 1508  N N    . VAL A 1 25 ? 4.167   -5.183  1.760  1.00 0.00 ? 227 VAL A N    2  
ATOM 1509  C CA   . VAL A 1 25 ? 4.691   -4.479  0.596  1.00 0.00 ? 227 VAL A CA   2  
ATOM 1510  C C    . VAL A 1 25 ? 3.799   -3.297  0.227  1.00 0.00 ? 227 VAL A C    2  
ATOM 1511  O O    . VAL A 1 25 ? 2.578   -3.428  0.157  1.00 0.00 ? 227 VAL A O    2  
ATOM 1512  C CB   . VAL A 1 25 ? 4.813   -5.424  -0.618 1.00 0.00 ? 227 VAL A CB   2  
ATOM 1513  C CG1  . VAL A 1 25 ? 5.171   -4.649  -1.878 1.00 0.00 ? 227 VAL A CG1  2  
ATOM 1514  C CG2  . VAL A 1 25 ? 5.841   -6.512  -0.345 1.00 0.00 ? 227 VAL A CG2  2  
ATOM 1515  H H    . VAL A 1 25 ? 3.262   -5.559  1.721  1.00 0.00 ? 227 VAL A H    2  
ATOM 1516  H HA   . VAL A 1 25 ? 5.677   -4.111  0.843  1.00 0.00 ? 227 VAL A HA   2  
ATOM 1517  H HB   . VAL A 1 25 ? 3.855   -5.897  -0.776 1.00 0.00 ? 227 VAL A HB   2  
ATOM 1518  H HG11 . VAL A 1 25 ? 5.687   -3.740  -1.608 1.00 0.00 ? 227 VAL A HG11 2  
ATOM 1519  H HG12 . VAL A 1 25 ? 5.810   -5.254  -2.503 1.00 0.00 ? 227 VAL A HG12 2  
ATOM 1520  H HG13 . VAL A 1 25 ? 4.268   -4.403  -2.418 1.00 0.00 ? 227 VAL A HG13 2  
ATOM 1521  H HG21 . VAL A 1 25 ? 5.704   -7.321  -1.045 1.00 0.00 ? 227 VAL A HG21 2  
ATOM 1522  H HG22 . VAL A 1 25 ? 6.834   -6.104  -0.454 1.00 0.00 ? 227 VAL A HG22 2  
ATOM 1523  H HG23 . VAL A 1 25 ? 5.713   -6.883  0.662  1.00 0.00 ? 227 VAL A HG23 2  
ATOM 1524  N N    . VAL A 1 26 ? 4.417   -2.148  -0.019 1.00 0.00 ? 228 VAL A N    2  
ATOM 1525  C CA   . VAL A 1 26 ? 3.673   -0.950  -0.388 1.00 0.00 ? 228 VAL A CA   2  
ATOM 1526  C C    . VAL A 1 26 ? 2.892   -1.178  -1.678 1.00 0.00 ? 228 VAL A C    2  
ATOM 1527  O O    . VAL A 1 26 ? 3.435   -1.681  -2.661 1.00 0.00 ? 228 VAL A O    2  
ATOM 1528  C CB   . VAL A 1 26 ? 4.607   0.260   -0.567 1.00 0.00 ? 228 VAL A CB   2  
ATOM 1529  C CG1  . VAL A 1 26 ? 3.803   1.531   -0.777 1.00 0.00 ? 228 VAL A CG1  2  
ATOM 1530  C CG2  . VAL A 1 26 ? 5.536   0.396   0.634  1.00 0.00 ? 228 VAL A CG2  2  
ATOM 1531  H H    . VAL A 1 26 ? 5.393   -2.105  0.043  1.00 0.00 ? 228 VAL A H    2  
ATOM 1532  H HA   . VAL A 1 26 ? 2.977   -0.730  0.408  1.00 0.00 ? 228 VAL A HA   2  
ATOM 1533  H HB   . VAL A 1 26 ? 5.213   0.095   -1.446 1.00 0.00 ? 228 VAL A HB   2  
ATOM 1534  H HG11 . VAL A 1 26 ? 4.447   2.391   -0.658 1.00 0.00 ? 228 VAL A HG11 2  
ATOM 1535  H HG12 . VAL A 1 26 ? 3.383   1.533   -1.773 1.00 0.00 ? 228 VAL A HG12 2  
ATOM 1536  H HG13 . VAL A 1 26 ? 3.004   1.577   -0.052 1.00 0.00 ? 228 VAL A HG13 2  
ATOM 1537  H HG21 . VAL A 1 26 ? 6.549   0.540   0.290  1.00 0.00 ? 228 VAL A HG21 2  
ATOM 1538  H HG22 . VAL A 1 26 ? 5.232   1.243   1.228  1.00 0.00 ? 228 VAL A HG22 2  
ATOM 1539  H HG23 . VAL A 1 26 ? 5.484   -0.502  1.233  1.00 0.00 ? 228 VAL A HG23 2  
ATOM 1540  N N    . ARG A 1 27 ? 1.615   -0.817  -1.665 1.00 0.00 ? 229 ARG A N    2  
ATOM 1541  C CA   . ARG A 1 27 ? 0.763   -0.997  -2.834 1.00 0.00 ? 229 ARG A CA   2  
ATOM 1542  C C    . ARG A 1 27 ? 0.203   0.335   -3.323 1.00 0.00 ? 229 ARG A C    2  
ATOM 1543  O O    . ARG A 1 27 ? 0.078   0.560   -4.527 1.00 0.00 ? 229 ARG A O    2  
ATOM 1544  C CB   . ARG A 1 27 ? -0.377  -1.962  -2.502 1.00 0.00 ? 229 ARG A CB   2  
ATOM 1545  C CG   . ARG A 1 27 ? 0.099   -3.289  -1.931 1.00 0.00 ? 229 ARG A CG   2  
ATOM 1546  C CD   . ARG A 1 27 ? 1.172   -3.922  -2.805 1.00 0.00 ? 229 ARG A CD   2  
ATOM 1547  N NE   . ARG A 1 27 ? 0.983   -5.363  -2.945 1.00 0.00 ? 229 ARG A NE   2  
ATOM 1548  C CZ   . ARG A 1 27 ? 1.532   -6.092  -3.914 1.00 0.00 ? 229 ARG A CZ   2  
ATOM 1549  N NH1  . ARG A 1 27 ? 2.304   -5.520  -4.828 1.00 0.00 ? 229 ARG A NH1  2  
ATOM 1550  N NH2  . ARG A 1 27 ? 1.307   -7.398  -3.967 1.00 0.00 ? 229 ARG A NH2  2  
ATOM 1551  H H    . ARG A 1 27 ? 1.234   -0.431  -0.849 1.00 0.00 ? 229 ARG A H    2  
ATOM 1552  H HA   . ARG A 1 27 ? 1.367   -1.429  -3.619 1.00 0.00 ? 229 ARG A HA   2  
ATOM 1553  H HB2  . ARG A 1 27 ? -1.030  -1.497  -1.779 1.00 0.00 ? 229 ARG A HB2  2  
ATOM 1554  H HB3  . ARG A 1 27 ? -0.936  -2.164  -3.401 1.00 0.00 ? 229 ARG A HB3  2  
ATOM 1555  H HG2  . ARG A 1 27 ? 0.507   -3.120  -0.945 1.00 0.00 ? 229 ARG A HG2  2  
ATOM 1556  H HG3  . ARG A 1 27 ? -0.741  -3.964  -1.862 1.00 0.00 ? 229 ARG A HG3  2  
ATOM 1557  H HD2  . ARG A 1 27 ? 1.135   -3.468  -3.784 1.00 0.00 ? 229 ARG A HD2  2  
ATOM 1558  H HD3  . ARG A 1 27 ? 2.138   -3.736  -2.359 1.00 0.00 ? 229 ARG A HD3  2  
ATOM 1559  H HE   . ARG A 1 27 ? 0.417   -5.810  -2.284 1.00 0.00 ? 229 ARG A HE   2  
ATOM 1560  H HH11 . ARG A 1 27 ? 2.478   -4.537  -4.794 1.00 0.00 ? 229 ARG A HH11 2  
ATOM 1561  H HH12 . ARG A 1 27 ? 2.714   -6.074  -5.554 1.00 0.00 ? 229 ARG A HH12 2  
ATOM 1562  H HH21 . ARG A 1 27 ? 0.725   -7.835  -3.280 1.00 0.00 ? 229 ARG A HH21 2  
ATOM 1563  H HH22 . ARG A 1 27 ? 1.719   -7.947  -4.695 1.00 0.00 ? 229 ARG A HH22 2  
ATOM 1564  N N    . PHE A 1 28 ? -0.129  1.217   -2.388 1.00 0.00 ? 230 PHE A N    2  
ATOM 1565  C CA   . PHE A 1 28 ? -0.672  2.526   -2.730 1.00 0.00 ? 230 PHE A CA   2  
ATOM 1566  C C    . PHE A 1 28 ? -0.345  3.547   -1.646 1.00 0.00 ? 230 PHE A C    2  
ATOM 1567  O O    . PHE A 1 28 ? -0.236  3.200   -0.476 1.00 0.00 ? 230 PHE A O    2  
ATOM 1568  C CB   . PHE A 1 28 ? -2.186  2.440   -2.928 1.00 0.00 ? 230 PHE A CB   2  
ATOM 1569  C CG   . PHE A 1 28 ? -2.763  3.615   -3.665 1.00 0.00 ? 230 PHE A CG   2  
ATOM 1570  C CD1  . PHE A 1 28 ? -2.611  3.731   -5.038 1.00 0.00 ? 230 PHE A CD1  2  
ATOM 1571  C CD2  . PHE A 1 28 ? -3.457  4.603   -2.985 1.00 0.00 ? 230 PHE A CD2  2  
ATOM 1572  C CE1  . PHE A 1 28 ? -3.141  4.810   -5.718 1.00 0.00 ? 230 PHE A CE1  2  
ATOM 1573  C CE2  . PHE A 1 28 ? -3.989  5.685   -3.660 1.00 0.00 ? 230 PHE A CE2  2  
ATOM 1574  C CZ   . PHE A 1 28 ? -3.831  5.789   -5.029 1.00 0.00 ? 230 PHE A CZ   2  
ATOM 1575  H H    . PHE A 1 28 ? -0.006  0.983   -1.444 1.00 0.00 ? 230 PHE A H    2  
ATOM 1576  H HA   . PHE A 1 28 ? -0.214  2.842   -3.654 1.00 0.00 ? 230 PHE A HA   2  
ATOM 1577  H HB2  . PHE A 1 28 ? -2.418  1.550   -3.492 1.00 0.00 ? 230 PHE A HB2  2  
ATOM 1578  H HB3  . PHE A 1 28 ? -2.666  2.385   -1.962 1.00 0.00 ? 230 PHE A HB3  2  
ATOM 1579  H HD1  . PHE A 1 28 ? -2.072  2.968   -5.577 1.00 0.00 ? 230 PHE A HD1  2  
ATOM 1580  H HD2  . PHE A 1 28 ? -3.581  4.523   -1.915 1.00 0.00 ? 230 PHE A HD2  2  
ATOM 1581  H HE1  . PHE A 1 28 ? -3.016  4.890   -6.787 1.00 0.00 ? 230 PHE A HE1  2  
ATOM 1582  H HE2  . PHE A 1 28 ? -4.528  6.448   -3.119 1.00 0.00 ? 230 PHE A HE2  2  
ATOM 1583  H HZ   . PHE A 1 28 ? -4.246  6.634   -5.559 1.00 0.00 ? 230 PHE A HZ   2  
ATOM 1584  N N    . LEU A 1 29 ? -0.191  4.804   -2.041 1.00 0.00 ? 231 LEU A N    2  
ATOM 1585  C CA   . LEU A 1 29 ? 0.121   5.865   -1.087 1.00 0.00 ? 231 LEU A CA   2  
ATOM 1586  C C    . LEU A 1 29 ? -0.760  7.087   -1.321 1.00 0.00 ? 231 LEU A C    2  
ATOM 1587  O O    . LEU A 1 29 ? -0.805  7.632   -2.423 1.00 0.00 ? 231 LEU A O    2  
ATOM 1588  C CB   . LEU A 1 29 ? 1.597   6.253   -1.183 1.00 0.00 ? 231 LEU A CB   2  
ATOM 1589  C CG   . LEU A 1 29 ? 2.578   5.077   -1.161 1.00 0.00 ? 231 LEU A CG   2  
ATOM 1590  C CD1  . LEU A 1 29 ? 3.390   5.030   -2.445 1.00 0.00 ? 231 LEU A CD1  2  
ATOM 1591  C CD2  . LEU A 1 29 ? 3.499   5.167   0.047  1.00 0.00 ? 231 LEU A CD2  2  
ATOM 1592  H H    . LEU A 1 29 ? -0.291  5.027   -2.990 1.00 0.00 ? 231 LEU A H    2  
ATOM 1593  H HA   . LEU A 1 29 ? -0.075  5.482   -0.095 1.00 0.00 ? 231 LEU A HA   2  
ATOM 1594  H HB2  . LEU A 1 29 ? 1.744   6.803   -2.099 1.00 0.00 ? 231 LEU A HB2  2  
ATOM 1595  H HB3  . LEU A 1 29 ? 1.830   6.904   -0.353 1.00 0.00 ? 231 LEU A HB3  2  
ATOM 1596  H HG   . LEU A 1 29 ? 2.020   4.154   -1.088 1.00 0.00 ? 231 LEU A HG   2  
ATOM 1597  H HD11 . LEU A 1 29 ? 2.722   5.052   -3.294 1.00 0.00 ? 231 LEU A HD11 2  
ATOM 1598  H HD12 . LEU A 1 29 ? 4.051   5.883   -2.485 1.00 0.00 ? 231 LEU A HD12 2  
ATOM 1599  H HD13 . LEU A 1 29 ? 3.973   4.121   -2.469 1.00 0.00 ? 231 LEU A HD13 2  
ATOM 1600  H HD21 . LEU A 1 29 ? 2.940   5.530   0.898  1.00 0.00 ? 231 LEU A HD21 2  
ATOM 1601  H HD22 . LEU A 1 29 ? 3.898   4.189   0.270  1.00 0.00 ? 231 LEU A HD22 2  
ATOM 1602  H HD23 . LEU A 1 29 ? 4.308   5.847   -0.168 1.00 0.00 ? 231 LEU A HD23 2  
ATOM 1603  N N    . GLY A 1 30 ? -1.461  7.515   -0.274 1.00 0.00 ? 232 GLY A N    2  
ATOM 1604  C CA   . GLY A 1 30 ? -2.332  8.669   -0.385 1.00 0.00 ? 232 GLY A CA   2  
ATOM 1605  C C    . GLY A 1 30 ? -3.216  8.848   0.832  1.00 0.00 ? 232 GLY A C    2  
ATOM 1606  O O    . GLY A 1 30 ? -3.087  8.117   1.814  1.00 0.00 ? 232 GLY A O    2  
ATOM 1607  H H    . GLY A 1 30 ? -1.385  7.040   0.580  1.00 0.00 ? 232 GLY A H    2  
ATOM 1608  H HA2  . GLY A 1 30 ? -1.724  9.555   -0.509 1.00 0.00 ? 232 GLY A HA2  2  
ATOM 1609  H HA3  . GLY A 1 30 ? -2.957  8.551   -1.259 1.00 0.00 ? 232 GLY A HA3  2  
ATOM 1610  N N    . GLU A 1 31 ? -4.118  9.822   0.769  1.00 0.00 ? 233 GLU A N    2  
ATOM 1611  C CA   . GLU A 1 31 ? -5.027  10.095  1.876  1.00 0.00 ? 233 GLU A CA   2  
ATOM 1612  C C    . GLU A 1 31 ? -6.193  9.111   1.876  1.00 0.00 ? 233 GLU A C    2  
ATOM 1613  O O    . GLU A 1 31 ? -6.497  8.493   0.855  1.00 0.00 ? 233 GLU A O    2  
ATOM 1614  C CB   . GLU A 1 31 ? -5.554  11.527  1.789  1.00 0.00 ? 233 GLU A CB   2  
ATOM 1615  C CG   . GLU A 1 31 ? -4.470  12.560  1.527  1.00 0.00 ? 233 GLU A CG   2  
ATOM 1616  C CD   . GLU A 1 31 ? -5.006  13.977  1.504  1.00 0.00 ? 233 GLU A CD   2  
ATOM 1617  O OE1  . GLU A 1 31 ? -5.817  14.320  2.390  1.00 0.00 ? 233 GLU A OE1  2  
ATOM 1618  O OE2  . GLU A 1 31 ? -4.613  14.747  0.601  1.00 0.00 ? 233 GLU A OE2  2  
ATOM 1619  H H    . GLU A 1 31 ? -4.171  10.371  -0.041 1.00 0.00 ? 233 GLU A H    2  
ATOM 1620  H HA   . GLU A 1 31 ? -4.474  9.980   2.796  1.00 0.00 ? 233 GLU A HA   2  
ATOM 1621  H HB2  . GLU A 1 31 ? -6.278  11.586  0.988  1.00 0.00 ? 233 GLU A HB2  2  
ATOM 1622  H HB3  . GLU A 1 31 ? -6.041  11.778  2.720  1.00 0.00 ? 233 GLU A HB3  2  
ATOM 1623  H HG2  . GLU A 1 31 ? -3.724  12.485  2.304  1.00 0.00 ? 233 GLU A HG2  2  
ATOM 1624  H HG3  . GLU A 1 31 ? -4.014  12.348  0.569  1.00 0.00 ? 233 GLU A HG3  2  
ATOM 1625  N N    . THR A 1 32 ? -6.842  8.970   3.028  1.00 0.00 ? 234 THR A N    2  
ATOM 1626  C CA   . THR A 1 32 ? -7.974  8.062   3.160  1.00 0.00 ? 234 THR A CA   2  
ATOM 1627  C C    . THR A 1 32 ? -9.285  8.836   3.250  1.00 0.00 ? 234 THR A C    2  
ATOM 1628  O O    . THR A 1 32 ? -9.291  10.037  3.522  1.00 0.00 ? 234 THR A O    2  
ATOM 1629  C CB   . THR A 1 32 ? -7.806  7.177   4.396  1.00 0.00 ? 234 THR A CB   2  
ATOM 1630  O OG1  . THR A 1 32 ? -7.927  7.943   5.582  1.00 0.00 ? 234 THR A OG1  2  
ATOM 1631  C CG2  . THR A 1 32 ? -6.472  6.464   4.444  1.00 0.00 ? 234 THR A CG2  2  
ATOM 1632  H H    . THR A 1 32 ? -6.554  9.490   3.806  1.00 0.00 ? 234 THR A H    2  
ATOM 1633  H HA   . THR A 1 32 ? -8.001  7.435   2.282  1.00 0.00 ? 234 THR A HA   2  
ATOM 1634  H HB   . THR A 1 32 ? -8.582  6.426   4.398  1.00 0.00 ? 234 THR A HB   2  
ATOM 1635  H HG1  . THR A 1 32 ? -7.298  8.668   5.561  1.00 0.00 ? 234 THR A HG1  2  
ATOM 1636  H HG21 . THR A 1 32 ? -6.496  5.707   5.215  1.00 0.00 ? 234 THR A HG21 2  
ATOM 1637  H HG22 . THR A 1 32 ? -5.691  7.176   4.663  1.00 0.00 ? 234 THR A HG22 2  
ATOM 1638  H HG23 . THR A 1 32 ? -6.277  5.999   3.489  1.00 0.00 ? 234 THR A HG23 2  
ATOM 1639  N N    . ASP A 1 33 ? -10.394 8.141   3.018  1.00 0.00 ? 235 ASP A N    2  
ATOM 1640  C CA   . ASP A 1 33 ? -11.712 8.763   3.072  1.00 0.00 ? 235 ASP A CA   2  
ATOM 1641  C C    . ASP A 1 33 ? -12.283 8.743   4.489  1.00 0.00 ? 235 ASP A C    2  
ATOM 1642  O O    . ASP A 1 33 ? -13.347 9.308   4.743  1.00 0.00 ? 235 ASP A O    2  
ATOM 1643  C CB   . ASP A 1 33 ? -12.671 8.053   2.115  1.00 0.00 ? 235 ASP A CB   2  
ATOM 1644  C CG   . ASP A 1 33 ? -13.811 8.947   1.668  1.00 0.00 ? 235 ASP A CG   2  
ATOM 1645  O OD1  . ASP A 1 33 ? -14.764 9.130   2.454  1.00 0.00 ? 235 ASP A OD1  2  
ATOM 1646  O OD2  . ASP A 1 33 ? -13.751 9.462   0.533  1.00 0.00 ? 235 ASP A OD2  2  
ATOM 1647  H H    . ASP A 1 33 ? -10.325 7.186   2.805  1.00 0.00 ? 235 ASP A H    2  
ATOM 1648  H HA   . ASP A 1 33 ? -11.604 9.791   2.757  1.00 0.00 ? 235 ASP A HA   2  
ATOM 1649  H HB2  . ASP A 1 33 ? -12.126 7.732   1.240  1.00 0.00 ? 235 ASP A HB2  2  
ATOM 1650  H HB3  . ASP A 1 33 ? -13.089 7.188   2.612  1.00 0.00 ? 235 ASP A HB3  2  
ATOM 1651  N N    . PHE A 1 34 ? -11.578 8.091   5.411  1.00 0.00 ? 236 PHE A N    2  
ATOM 1652  C CA   . PHE A 1 34 ? -12.031 8.007   6.796  1.00 0.00 ? 236 PHE A CA   2  
ATOM 1653  C C    . PHE A 1 34 ? -10.993 8.587   7.760  1.00 0.00 ? 236 PHE A C    2  
ATOM 1654  O O    . PHE A 1 34 ? -11.307 8.888   8.911  1.00 0.00 ? 236 PHE A O    2  
ATOM 1655  C CB   . PHE A 1 34 ? -12.340 6.550   7.172  1.00 0.00 ? 236 PHE A CB   2  
ATOM 1656  C CG   . PHE A 1 34 ? -11.127 5.736   7.535  1.00 0.00 ? 236 PHE A CG   2  
ATOM 1657  C CD1  . PHE A 1 34 ? -10.109 5.527   6.617  1.00 0.00 ? 236 PHE A CD1  2  
ATOM 1658  C CD2  . PHE A 1 34 ? -11.007 5.183   8.799  1.00 0.00 ? 236 PHE A CD2  2  
ATOM 1659  C CE1  . PHE A 1 34 ? -8.995  4.781   6.954  1.00 0.00 ? 236 PHE A CE1  2  
ATOM 1660  C CE2  . PHE A 1 34 ? -9.895  4.436   9.142  1.00 0.00 ? 236 PHE A CE2  2  
ATOM 1661  C CZ   . PHE A 1 34 ? -8.889  4.235   8.219  1.00 0.00 ? 236 PHE A CZ   2  
ATOM 1662  H H    . PHE A 1 34 ? -10.740 7.658   5.154  1.00 0.00 ? 236 PHE A H    2  
ATOM 1663  H HA   . PHE A 1 34 ? -12.938 8.586   6.879  1.00 0.00 ? 236 PHE A HA   2  
ATOM 1664  H HB2  . PHE A 1 34 ? -13.009 6.541   8.018  1.00 0.00 ? 236 PHE A HB2  2  
ATOM 1665  H HB3  . PHE A 1 34 ? -12.824 6.069   6.334  1.00 0.00 ? 236 PHE A HB3  2  
ATOM 1666  H HD1  . PHE A 1 34 ? -10.190 5.952   5.629  1.00 0.00 ? 236 PHE A HD1  2  
ATOM 1667  H HD2  . PHE A 1 34 ? -11.794 5.339   9.522  1.00 0.00 ? 236 PHE A HD2  2  
ATOM 1668  H HE1  . PHE A 1 34 ? -8.211  4.625   6.230  1.00 0.00 ? 236 PHE A HE1  2  
ATOM 1669  H HE2  . PHE A 1 34 ? -9.815  4.010   10.131 1.00 0.00 ? 236 PHE A HE2  2  
ATOM 1670  H HZ   . PHE A 1 34 ? -8.019  3.651   8.484  1.00 0.00 ? 236 PHE A HZ   2  
ATOM 1671  N N    . ALA A 1 35 ? -9.758  8.742   7.288  1.00 0.00 ? 237 ALA A N    2  
ATOM 1672  C CA   . ALA A 1 35 ? -8.688  9.282   8.117  1.00 0.00 ? 237 ALA A CA   2  
ATOM 1673  C C    . ALA A 1 35 ? -8.109  10.554  7.507  1.00 0.00 ? 237 ALA A C    2  
ATOM 1674  O O    . ALA A 1 35 ? -7.934  10.650  6.293  1.00 0.00 ? 237 ALA A O    2  
ATOM 1675  C CB   . ALA A 1 35 ? -7.595  8.241   8.310  1.00 0.00 ? 237 ALA A CB   2  
ATOM 1676  H H    . ALA A 1 35 ? -9.559  8.484   6.364  1.00 0.00 ? 237 ALA A H    2  
ATOM 1677  H HA   . ALA A 1 35 ? -9.105  9.516   9.084  1.00 0.00 ? 237 ALA A HA   2  
ATOM 1678  H HB1  . ALA A 1 35 ? -7.112  8.401   9.263  1.00 0.00 ? 237 ALA A HB1  2  
ATOM 1679  H HB2  . ALA A 1 35 ? -8.030  7.254   8.287  1.00 0.00 ? 237 ALA A HB2  2  
ATOM 1680  H HB3  . ALA A 1 35 ? -6.867  8.333   7.518  1.00 0.00 ? 237 ALA A HB3  2  
ATOM 1681  N N    . LYS A 1 36 ? -7.809  11.529  8.360  1.00 0.00 ? 238 LYS A N    2  
ATOM 1682  C CA   . LYS A 1 36 ? -7.246  12.795  7.906  1.00 0.00 ? 238 LYS A CA   2  
ATOM 1683  C C    . LYS A 1 36 ? -5.731  12.694  7.757  1.00 0.00 ? 238 LYS A C    2  
ATOM 1684  O O    . LYS A 1 36 ? -5.066  12.005  8.530  1.00 0.00 ? 238 LYS A O    2  
ATOM 1685  C CB   . LYS A 1 36 ? -7.600  13.915  8.886  1.00 0.00 ? 238 LYS A CB   2  
ATOM 1686  C CG   . LYS A 1 36 ? -9.094  14.088  9.099  1.00 0.00 ? 238 LYS A CG   2  
ATOM 1687  C CD   . LYS A 1 36 ? -9.415  15.435  9.725  1.00 0.00 ? 238 LYS A CD   2  
ATOM 1688  C CE   . LYS A 1 36 ? -10.875 15.809  9.522  1.00 0.00 ? 238 LYS A CE   2  
ATOM 1689  N NZ   . LYS A 1 36 ? -11.794 14.810  10.131 1.00 0.00 ? 238 LYS A NZ   2  
ATOM 1690  H H    . LYS A 1 36 ? -7.969  11.393  9.317  1.00 0.00 ? 238 LYS A H    2  
ATOM 1691  H HA   . LYS A 1 36 ? -7.676  13.023  6.942  1.00 0.00 ? 238 LYS A HA   2  
ATOM 1692  H HB2  . LYS A 1 36 ? -7.144  13.699  9.842  1.00 0.00 ? 238 LYS A HB2  2  
ATOM 1693  H HB3  . LYS A 1 36 ? -7.201  14.846  8.510  1.00 0.00 ? 238 LYS A HB3  2  
ATOM 1694  H HG2  . LYS A 1 36 ? -9.594  14.015  8.145  1.00 0.00 ? 238 LYS A HG2  2  
ATOM 1695  H HG3  . LYS A 1 36 ? -9.448  13.304  9.754  1.00 0.00 ? 238 LYS A HG3  2  
ATOM 1696  H HD2  . LYS A 1 36 ? -9.210  15.388  10.783 1.00 0.00 ? 238 LYS A HD2  2  
ATOM 1697  H HD3  . LYS A 1 36 ? -8.792  16.190  9.269  1.00 0.00 ? 238 LYS A HD3  2  
ATOM 1698  H HE2  . LYS A 1 36 ? -11.053 16.773  9.978  1.00 0.00 ? 238 LYS A HE2  2  
ATOM 1699  H HE3  . LYS A 1 36 ? -11.074 15.870  8.462  1.00 0.00 ? 238 LYS A HE3  2  
ATOM 1700  H HZ1  . LYS A 1 36 ? -11.486 13.846  9.888  1.00 0.00 ? 238 LYS A HZ1  2  
ATOM 1701  H HZ2  . LYS A 1 36 ? -12.762 14.952  9.777  1.00 0.00 ? 238 LYS A HZ2  2  
ATOM 1702  H HZ3  . LYS A 1 36 ? -11.799 14.910  11.166 1.00 0.00 ? 238 LYS A HZ3  2  
ATOM 1703  N N    . GLY A 1 37 ? -5.192  13.386  6.758  1.00 0.00 ? 239 GLY A N    2  
ATOM 1704  C CA   . GLY A 1 37 ? -3.759  13.362  6.528  1.00 0.00 ? 239 GLY A CA   2  
ATOM 1705  C C    . GLY A 1 37 ? -3.364  12.396  5.427  1.00 0.00 ? 239 GLY A C    2  
ATOM 1706  O O    . GLY A 1 37 ? -4.217  11.909  4.683  1.00 0.00 ? 239 GLY A O    2  
ATOM 1707  H H    . GLY A 1 37 ? -5.772  13.919  6.176  1.00 0.00 ? 239 GLY A H    2  
ATOM 1708  H HA2  . GLY A 1 37 ? -3.433  14.353  6.255  1.00 0.00 ? 239 GLY A HA2  2  
ATOM 1709  H HA3  . GLY A 1 37 ? -3.263  13.070  7.442  1.00 0.00 ? 239 GLY A HA3  2  
ATOM 1710  N N    . GLU A 1 38 ? -2.068  12.121  5.322  1.00 0.00 ? 240 GLU A N    2  
ATOM 1711  C CA   . GLU A 1 38 ? -1.560  11.208  4.305  1.00 0.00 ? 240 GLU A CA   2  
ATOM 1712  C C    . GLU A 1 38 ? -1.382  9.804   4.873  1.00 0.00 ? 240 GLU A C    2  
ATOM 1713  O O    . GLU A 1 38 ? -0.855  9.631   5.971  1.00 0.00 ? 240 GLU A O    2  
ATOM 1714  C CB   . GLU A 1 38 ? -0.229  11.719  3.751  1.00 0.00 ? 240 GLU A CB   2  
ATOM 1715  C CG   . GLU A 1 38 ? 0.784   12.069  4.828  1.00 0.00 ? 240 GLU A CG   2  
ATOM 1716  C CD   . GLU A 1 38 ? 2.201   12.141  4.294  1.00 0.00 ? 240 GLU A CD   2  
ATOM 1717  O OE1  . GLU A 1 38 ? 2.555   11.310  3.432  1.00 0.00 ? 240 GLU A OE1  2  
ATOM 1718  O OE2  . GLU A 1 38 ? 2.958   13.031  4.739  1.00 0.00 ? 240 GLU A OE2  2  
ATOM 1719  H H    . GLU A 1 38 ? -1.438  12.541  5.944  1.00 0.00 ? 240 GLU A H    2  
ATOM 1720  H HA   . GLU A 1 38 ? -2.284  11.170  3.504  1.00 0.00 ? 240 GLU A HA   2  
ATOM 1721  H HB2  . GLU A 1 38 ? 0.200   10.957  3.116  1.00 0.00 ? 240 GLU A HB2  2  
ATOM 1722  H HB3  . GLU A 1 38 ? -0.414  12.603  3.160  1.00 0.00 ? 240 GLU A HB3  2  
ATOM 1723  H HG2  . GLU A 1 38 ? 0.526   13.028  5.250  1.00 0.00 ? 240 GLU A HG2  2  
ATOM 1724  H HG3  . GLU A 1 38 ? 0.744   11.315  5.600  1.00 0.00 ? 240 GLU A HG3  2  
ATOM 1725  N N    . TRP A 1 39 ? -1.826  8.804   4.118  1.00 0.00 ? 241 TRP A N    2  
ATOM 1726  C CA   . TRP A 1 39 ? -1.714  7.415   4.548  1.00 0.00 ? 241 TRP A CA   2  
ATOM 1727  C C    . TRP A 1 39 ? -1.077  6.556   3.459  1.00 0.00 ? 241 TRP A C    2  
ATOM 1728  O O    . TRP A 1 39 ? -0.926  6.995   2.319  1.00 0.00 ? 241 TRP A O    2  
ATOM 1729  C CB   . TRP A 1 39 ? -3.094  6.863   4.914  1.00 0.00 ? 241 TRP A CB   2  
ATOM 1730  C CG   . TRP A 1 39 ? -3.685  7.510   6.130  1.00 0.00 ? 241 TRP A CG   2  
ATOM 1731  C CD1  . TRP A 1 39 ? -4.166  8.783   6.227  1.00 0.00 ? 241 TRP A CD1  2  
ATOM 1732  C CD2  . TRP A 1 39 ? -3.853  6.916   7.421  1.00 0.00 ? 241 TRP A CD2  2  
ATOM 1733  N NE1  . TRP A 1 39 ? -4.625  9.020   7.501  1.00 0.00 ? 241 TRP A NE1  2  
ATOM 1734  C CE2  . TRP A 1 39 ? -4.442  7.888   8.254  1.00 0.00 ? 241 TRP A CE2  2  
ATOM 1735  C CE3  . TRP A 1 39 ? -3.564  5.658   7.957  1.00 0.00 ? 241 TRP A CE3  2  
ATOM 1736  C CZ2  . TRP A 1 39 ? -4.748  7.639   9.589  1.00 0.00 ? 241 TRP A CZ2  2  
ATOM 1737  C CZ3  . TRP A 1 39 ? -3.867  5.412   9.283  1.00 0.00 ? 241 TRP A CZ3  2  
ATOM 1738  C CH2  . TRP A 1 39 ? -4.454  6.399   10.087 1.00 0.00 ? 241 TRP A CH2  2  
ATOM 1739  H H    . TRP A 1 39 ? -2.237  9.005   3.251  1.00 0.00 ? 241 TRP A H    2  
ATOM 1740  H HA   . TRP A 1 39 ? -1.084  7.390   5.423  1.00 0.00 ? 241 TRP A HA   2  
ATOM 1741  H HB2  . TRP A 1 39 ? -3.770  7.023   4.087  1.00 0.00 ? 241 TRP A HB2  2  
ATOM 1742  H HB3  . TRP A 1 39 ? -3.011  5.803   5.105  1.00 0.00 ? 241 TRP A HB3  2  
ATOM 1743  H HD1  . TRP A 1 39 ? -4.178  9.494   5.412  1.00 0.00 ? 241 TRP A HD1  2  
ATOM 1744  H HE1  . TRP A 1 39 ? -5.017  9.858   7.819  1.00 0.00 ? 241 TRP A HE1  2  
ATOM 1745  H HE3  . TRP A 1 39 ? -3.112  4.885   7.353  1.00 0.00 ? 241 TRP A HE3  2  
ATOM 1746  H HZ2  . TRP A 1 39 ? -5.201  8.388   10.222 1.00 0.00 ? 241 TRP A HZ2  2  
ATOM 1747  H HZ3  . TRP A 1 39 ? -3.650  4.447   9.713  1.00 0.00 ? 241 TRP A HZ3  2  
ATOM 1748  H HH2  . TRP A 1 39 ? -4.671  6.163   11.118 1.00 0.00 ? 241 TRP A HH2  2  
ATOM 1749  N N    . CYS A 1 40 ? -0.701  5.333   3.819  1.00 0.00 ? 242 CYS A N    2  
ATOM 1750  C CA   . CYS A 1 40 ? -0.077  4.417   2.872  1.00 0.00 ? 242 CYS A CA   2  
ATOM 1751  C C    . CYS A 1 40 ? -0.691  3.023   2.971  1.00 0.00 ? 242 CYS A C    2  
ATOM 1752  O O    . CYS A 1 40 ? -1.243  2.644   4.005  1.00 0.00 ? 242 CYS A O    2  
ATOM 1753  C CB   . CYS A 1 40 ? 1.433   4.349   3.117  1.00 0.00 ? 242 CYS A CB   2  
ATOM 1754  S SG   . CYS A 1 40 ? 2.299   3.100   2.134  1.00 0.00 ? 242 CYS A SG   2  
ATOM 1755  H H    . CYS A 1 40 ? -0.846  5.040   4.744  1.00 0.00 ? 242 CYS A H    2  
ATOM 1756  H HA   . CYS A 1 40 ? -0.252  4.801   1.877  1.00 0.00 ? 242 CYS A HA   2  
ATOM 1757  H HB2  . CYS A 1 40 ? 1.869   5.308   2.877  1.00 0.00 ? 242 CYS A HB2  2  
ATOM 1758  H HB3  . CYS A 1 40 ? 1.612   4.131   4.159  1.00 0.00 ? 242 CYS A HB3  2  
ATOM 1759  H HG   . CYS A 1 40 ? 1.853   3.027   1.287  1.00 0.00 ? 242 CYS A HG   2  
ATOM 1760  N N    . GLY A 1 41 ? -0.588  2.267   1.884  1.00 0.00 ? 243 GLY A N    2  
ATOM 1761  C CA   . GLY A 1 41 ? -1.128  0.923   1.845  1.00 0.00 ? 243 GLY A CA   2  
ATOM 1762  C C    . GLY A 1 41 ? -0.044  -0.123  1.690  1.00 0.00 ? 243 GLY A C    2  
ATOM 1763  O O    . GLY A 1 41 ? 0.772   -0.050  0.772  1.00 0.00 ? 243 GLY A O    2  
ATOM 1764  H H    . GLY A 1 41 ? -0.136  2.630   1.094  1.00 0.00 ? 243 GLY A H    2  
ATOM 1765  H HA2  . GLY A 1 41 ? -1.672  0.736   2.759  1.00 0.00 ? 243 GLY A HA2  2  
ATOM 1766  H HA3  . GLY A 1 41 ? -1.808  0.846   1.009  1.00 0.00 ? 243 GLY A HA3  2  
ATOM 1767  N N    . VAL A 1 42 ? -0.031  -1.098  2.592  1.00 0.00 ? 244 VAL A N    2  
ATOM 1768  C CA   . VAL A 1 42 ? 0.964   -2.160  2.550  1.00 0.00 ? 244 VAL A CA   2  
ATOM 1769  C C    . VAL A 1 42 ? 0.306   -3.533  2.624  1.00 0.00 ? 244 VAL A C    2  
ATOM 1770  O O    . VAL A 1 42 ? -0.559  -3.774  3.466  1.00 0.00 ? 244 VAL A O    2  
ATOM 1771  C CB   . VAL A 1 42 ? 1.974   -2.032  3.712  1.00 0.00 ? 244 VAL A CB   2  
ATOM 1772  C CG1  . VAL A 1 42 ? 3.201   -2.892  3.457  1.00 0.00 ? 244 VAL A CG1  2  
ATOM 1773  C CG2  . VAL A 1 42 ? 2.373   -0.579  3.928  1.00 0.00 ? 244 VAL A CG2  2  
ATOM 1774  H H    . VAL A 1 42 ? -0.707  -1.102  3.302  1.00 0.00 ? 244 VAL A H    2  
ATOM 1775  H HA   . VAL A 1 42 ? 1.505   -2.079  1.615  1.00 0.00 ? 244 VAL A HA   2  
ATOM 1776  H HB   . VAL A 1 42 ? 1.498   -2.388  4.613  1.00 0.00 ? 244 VAL A HB   2  
ATOM 1777  H HG11 . VAL A 1 42 ? 3.846   -2.866  4.322  1.00 0.00 ? 244 VAL A HG11 2  
ATOM 1778  H HG12 . VAL A 1 42 ? 2.894   -3.910  3.268  1.00 0.00 ? 244 VAL A HG12 2  
ATOM 1779  H HG13 . VAL A 1 42 ? 3.738   -2.513  2.599  1.00 0.00 ? 244 VAL A HG13 2  
ATOM 1780  H HG21 . VAL A 1 42 ? 1.515   -0.014  4.259  1.00 0.00 ? 244 VAL A HG21 2  
ATOM 1781  H HG22 . VAL A 1 42 ? 3.150   -0.527  4.679  1.00 0.00 ? 244 VAL A HG22 2  
ATOM 1782  H HG23 . VAL A 1 42 ? 2.743   -0.164  3.002  1.00 0.00 ? 244 VAL A HG23 2  
ATOM 1783  N N    . GLU A 1 43 ? 0.727   -4.435  1.743  1.00 0.00 ? 245 GLU A N    2  
ATOM 1784  C CA   . GLU A 1 43 ? 0.188   -5.787  1.716  1.00 0.00 ? 245 GLU A CA   2  
ATOM 1785  C C    . GLU A 1 43 ? 0.920   -6.659  2.726  1.00 0.00 ? 245 GLU A C    2  
ATOM 1786  O O    . GLU A 1 43 ? 2.102   -6.959  2.560  1.00 0.00 ? 245 GLU A O    2  
ATOM 1787  C CB   . GLU A 1 43 ? 0.312   -6.386  0.315  1.00 0.00 ? 245 GLU A CB   2  
ATOM 1788  C CG   . GLU A 1 43 ? -0.293  -7.774  0.190  1.00 0.00 ? 245 GLU A CG   2  
ATOM 1789  C CD   . GLU A 1 43 ? -0.782  -8.073  -1.212 1.00 0.00 ? 245 GLU A CD   2  
ATOM 1790  O OE1  . GLU A 1 43 ? -1.380  -7.172  -1.838 1.00 0.00 ? 245 GLU A OE1  2  
ATOM 1791  O OE2  . GLU A 1 43 ? -0.567  -9.210  -1.687 1.00 0.00 ? 245 GLU A OE2  2  
ATOM 1792  H H    . GLU A 1 43 ? 1.425   -4.186  1.101  1.00 0.00 ? 245 GLU A H    2  
ATOM 1793  H HA   . GLU A 1 43 ? -0.857  -5.736  1.990  1.00 0.00 ? 245 GLU A HA   2  
ATOM 1794  H HB2  . GLU A 1 43 ? -0.185  -5.735  -0.389 1.00 0.00 ? 245 GLU A HB2  2  
ATOM 1795  H HB3  . GLU A 1 43 ? 1.359   -6.448  0.054  1.00 0.00 ? 245 GLU A HB3  2  
ATOM 1796  H HG2  . GLU A 1 43 ? 0.457   -8.504  0.456  1.00 0.00 ? 245 GLU A HG2  2  
ATOM 1797  H HG3  . GLU A 1 43 ? -1.127  -7.851  0.872  1.00 0.00 ? 245 GLU A HG3  2  
ATOM 1798  N N    . LEU A 1 44 ? 0.219   -7.047  3.783  1.00 0.00 ? 246 LEU A N    2  
ATOM 1799  C CA   . LEU A 1 44 ? 0.811   -7.865  4.831  1.00 0.00 ? 246 LEU A CA   2  
ATOM 1800  C C    . LEU A 1 44 ? 1.141   -9.266  4.329  1.00 0.00 ? 246 LEU A C    2  
ATOM 1801  O O    . LEU A 1 44 ? 0.426   -9.829  3.498  1.00 0.00 ? 246 LEU A O    2  
ATOM 1802  C CB   . LEU A 1 44 ? -0.135  -7.952  6.030  1.00 0.00 ? 246 LEU A CB   2  
ATOM 1803  C CG   . LEU A 1 44 ? -0.481  -6.611  6.677  1.00 0.00 ? 246 LEU A CG   2  
ATOM 1804  C CD1  . LEU A 1 44 ? -1.573  -6.789  7.718  1.00 0.00 ? 246 LEU A CD1  2  
ATOM 1805  C CD2  . LEU A 1 44 ? 0.757   -5.985  7.302  1.00 0.00 ? 246 LEU A CD2  2  
ATOM 1806  H H    . LEU A 1 44 ? -0.717  -6.764  3.866  1.00 0.00 ? 246 LEU A H    2  
ATOM 1807  H HA   . LEU A 1 44 ? 1.725   -7.385  5.143  1.00 0.00 ? 246 LEU A HA   2  
ATOM 1808  H HB2  . LEU A 1 44 ? -1.053  -8.421  5.705  1.00 0.00 ? 246 LEU A HB2  2  
ATOM 1809  H HB3  . LEU A 1 44 ? 0.323   -8.579  6.779  1.00 0.00 ? 246 LEU A HB3  2  
ATOM 1810  H HG   . LEU A 1 44 ? -0.850  -5.937  5.917  1.00 0.00 ? 246 LEU A HG   2  
ATOM 1811  H HD11 . LEU A 1 44 ? -2.486  -7.103  7.233  1.00 0.00 ? 246 LEU A HD11 2  
ATOM 1812  H HD12 . LEU A 1 44 ? -1.269  -7.538  8.432  1.00 0.00 ? 246 LEU A HD12 2  
ATOM 1813  H HD13 . LEU A 1 44 ? -1.741  -5.852  8.229  1.00 0.00 ? 246 LEU A HD13 2  
ATOM 1814  H HD21 . LEU A 1 44 ? 1.456   -6.763  7.570  1.00 0.00 ? 246 LEU A HD21 2  
ATOM 1815  H HD22 . LEU A 1 44 ? 1.219   -5.316  6.592  1.00 0.00 ? 246 LEU A HD22 2  
ATOM 1816  H HD23 . LEU A 1 44 ? 0.475   -5.434  8.186  1.00 0.00 ? 246 LEU A HD23 2  
ATOM 1817  N N    . ASP A 1 45 ? 2.236   -9.818  4.840  1.00 0.00 ? 247 ASP A N    2  
ATOM 1818  C CA   . ASP A 1 45 ? 2.682   -11.150 4.455  1.00 0.00 ? 247 ASP A CA   2  
ATOM 1819  C C    . ASP A 1 45 ? 1.766   -12.227 5.034  1.00 0.00 ? 247 ASP A C    2  
ATOM 1820  O O    . ASP A 1 45 ? 1.684   -13.335 4.502  1.00 0.00 ? 247 ASP A O    2  
ATOM 1821  C CB   . ASP A 1 45 ? 4.119   -11.378 4.926  1.00 0.00 ? 247 ASP A CB   2  
ATOM 1822  C CG   . ASP A 1 45 ? 5.138   -10.739 4.001  1.00 0.00 ? 247 ASP A CG   2  
ATOM 1823  O OD1  . ASP A 1 45 ? 5.267   -11.204 2.848  1.00 0.00 ? 247 ASP A OD1  2  
ATOM 1824  O OD2  . ASP A 1 45 ? 5.807   -9.775  4.429  1.00 0.00 ? 247 ASP A OD2  2  
ATOM 1825  H H    . ASP A 1 45 ? 2.760   -9.312  5.497  1.00 0.00 ? 247 ASP A H    2  
ATOM 1826  H HA   . ASP A 1 45 ? 2.652   -11.211 3.378  1.00 0.00 ? 247 ASP A HA   2  
ATOM 1827  H HB2  . ASP A 1 45 ? 4.240   -10.950 5.910  1.00 0.00 ? 247 ASP A HB2  2  
ATOM 1828  H HB3  . ASP A 1 45 ? 4.315   -12.438 4.972  1.00 0.00 ? 247 ASP A HB3  2  
ATOM 1829  N N    . GLU A 1 46 ? 1.079   -11.897 6.123  1.00 0.00 ? 248 GLU A N    2  
ATOM 1830  C CA   . GLU A 1 46 ? 0.172   -12.839 6.771  1.00 0.00 ? 248 GLU A CA   2  
ATOM 1831  C C    . GLU A 1 46 ? -1.125  -12.149 7.189  1.00 0.00 ? 248 GLU A C    2  
ATOM 1832  O O    . GLU A 1 46 ? -1.220  -10.922 7.159  1.00 0.00 ? 248 GLU A O    2  
ATOM 1833  C CB   . GLU A 1 46 ? 0.850   -13.470 7.989  1.00 0.00 ? 248 GLU A CB   2  
ATOM 1834  C CG   . GLU A 1 46 ? 1.330   -14.893 7.751  1.00 0.00 ? 248 GLU A CG   2  
ATOM 1835  C CD   . GLU A 1 46 ? 1.903   -15.531 9.000  1.00 0.00 ? 248 GLU A CD   2  
ATOM 1836  O OE1  . GLU A 1 46 ? 1.201   -15.552 10.033 1.00 0.00 ? 248 GLU A OE1  2  
ATOM 1837  O OE2  . GLU A 1 46 ? 3.055   -16.010 8.946  1.00 0.00 ? 248 GLU A OE2  2  
ATOM 1838  H H    . GLU A 1 46 ? 1.184   -11.000 6.502  1.00 0.00 ? 248 GLU A H    2  
ATOM 1839  H HA   . GLU A 1 46 ? -0.062  -13.617 6.058  1.00 0.00 ? 248 GLU A HA   2  
ATOM 1840  H HB2  . GLU A 1 46 ? 1.704   -12.867 8.263  1.00 0.00 ? 248 GLU A HB2  2  
ATOM 1841  H HB3  . GLU A 1 46 ? 0.152   -13.482 8.813  1.00 0.00 ? 248 GLU A HB3  2  
ATOM 1842  H HG2  . GLU A 1 46 ? 0.495   -15.488 7.412  1.00 0.00 ? 248 GLU A HG2  2  
ATOM 1843  H HG3  . GLU A 1 46 ? 2.094   -14.878 6.988  1.00 0.00 ? 248 GLU A HG3  2  
ATOM 1844  N N    . PRO A 1 47 ? -2.146  -12.930 7.587  1.00 0.00 ? 249 PRO A N    2  
ATOM 1845  C CA   . PRO A 1 47 ? -3.440  -12.383 8.011  1.00 0.00 ? 249 PRO A CA   2  
ATOM 1846  C C    . PRO A 1 47 ? -3.330  -11.584 9.307  1.00 0.00 ? 249 PRO A C    2  
ATOM 1847  O O    . PRO A 1 47 ? -3.828  -12.000 10.352 1.00 0.00 ? 249 PRO A O    2  
ATOM 1848  C CB   . PRO A 1 47 ? -4.309  -13.627 8.219  1.00 0.00 ? 249 PRO A CB   2  
ATOM 1849  C CG   . PRO A 1 47 ? -3.343  -14.733 8.465  1.00 0.00 ? 249 PRO A CG   2  
ATOM 1850  C CD   . PRO A 1 47 ? -2.122  -14.404 7.652  1.00 0.00 ? 249 PRO A CD   2  
ATOM 1851  H HA   . PRO A 1 47 ? -3.875  -11.760 7.243  1.00 0.00 ? 249 PRO A HA   2  
ATOM 1852  H HB2  . PRO A 1 47 ? -4.961  -13.475 9.067  1.00 0.00 ? 249 PRO A HB2  2  
ATOM 1853  H HB3  . PRO A 1 47 ? -4.898  -13.809 7.333  1.00 0.00 ? 249 PRO A HB3  2  
ATOM 1854  H HG2  . PRO A 1 47 ? -3.092  -14.776 9.514  1.00 0.00 ? 249 PRO A HG2  2  
ATOM 1855  H HG3  . PRO A 1 47 ? -3.766  -15.672 8.140  1.00 0.00 ? 249 PRO A HG3  2  
ATOM 1856  H HD2  . PRO A 1 47 ? -1.232  -14.755 8.151  1.00 0.00 ? 249 PRO A HD2  2  
ATOM 1857  H HD3  . PRO A 1 47 ? -2.198  -14.835 6.665  1.00 0.00 ? 249 PRO A HD3  2  
ATOM 1858  N N    . LEU A 1 48 ? -2.672  -10.433 9.224  1.00 0.00 ? 250 LEU A N    2  
ATOM 1859  C CA   . LEU A 1 48 ? -2.491  -9.568  10.385 1.00 0.00 ? 250 LEU A CA   2  
ATOM 1860  C C    . LEU A 1 48 ? -2.971  -8.149  10.091 1.00 0.00 ? 250 LEU A C    2  
ATOM 1861  O O    . LEU A 1 48 ? -2.519  -7.190  10.718 1.00 0.00 ? 250 LEU A O    2  
ATOM 1862  C CB   . LEU A 1 48 ? -1.020  -9.546  10.805 1.00 0.00 ? 250 LEU A CB   2  
ATOM 1863  C CG   . LEU A 1 48 ? -0.013  -9.523  9.648  1.00 0.00 ? 250 LEU A CG   2  
ATOM 1864  C CD1  . LEU A 1 48 ? 0.903   -8.315  9.754  1.00 0.00 ? 250 LEU A CD1  2  
ATOM 1865  C CD2  . LEU A 1 48 ? 0.801   -10.808 9.623  1.00 0.00 ? 250 LEU A CD2  2  
ATOM 1866  H H    . LEU A 1 48 ? -2.301  -10.156 8.361  1.00 0.00 ? 250 LEU A H    2  
ATOM 1867  H HA   . LEU A 1 48 ? -3.081  -9.973  11.194 1.00 0.00 ? 250 LEU A HA   2  
ATOM 1868  H HB2  . LEU A 1 48 ? -0.857  -8.669  11.415 1.00 0.00 ? 250 LEU A HB2  2  
ATOM 1869  H HB3  . LEU A 1 48 ? -0.826  -10.422 11.404 1.00 0.00 ? 250 LEU A HB3  2  
ATOM 1870  H HG   . LEU A 1 48 ? -0.550  -9.450  8.714  1.00 0.00 ? 250 LEU A HG   2  
ATOM 1871  H HD11 . LEU A 1 48 ? 1.356   -8.290  10.733 1.00 0.00 ? 250 LEU A HD11 2  
ATOM 1872  H HD12 . LEU A 1 48 ? 1.675   -8.381  9.002  1.00 0.00 ? 250 LEU A HD12 2  
ATOM 1873  H HD13 . LEU A 1 48 ? 0.329   -7.412  9.601  1.00 0.00 ? 250 LEU A HD13 2  
ATOM 1874  H HD21 . LEU A 1 48 ? 1.186   -10.971 8.626  1.00 0.00 ? 250 LEU A HD21 2  
ATOM 1875  H HD22 . LEU A 1 48 ? 1.625   -10.726 10.317 1.00 0.00 ? 250 LEU A HD22 2  
ATOM 1876  H HD23 . LEU A 1 48 ? 0.173   -11.638 9.907  1.00 0.00 ? 250 LEU A HD23 2  
ATOM 1877  N N    . GLY A 1 49 ? -3.883  -8.020  9.133  1.00 0.00 ? 251 GLY A N    2  
ATOM 1878  C CA   . GLY A 1 49 ? -4.401  -6.712  8.776  1.00 0.00 ? 251 GLY A CA   2  
ATOM 1879  C C    . GLY A 1 49 ? -5.827  -6.502  9.245  1.00 0.00 ? 251 GLY A C    2  
ATOM 1880  O O    . GLY A 1 49 ? -6.433  -7.400  9.832  1.00 0.00 ? 251 GLY A O    2  
ATOM 1881  H H    . GLY A 1 49 ? -4.207  -8.817  8.663  1.00 0.00 ? 251 GLY A H    2  
ATOM 1882  H HA2  . GLY A 1 49 ? -3.773  -5.955  9.222  1.00 0.00 ? 251 GLY A HA2  2  
ATOM 1883  H HA3  . GLY A 1 49 ? -4.368  -6.604  7.702  1.00 0.00 ? 251 GLY A HA3  2  
ATOM 1884  N N    . LYS A 1 50 ? -6.364  -5.314  8.988  1.00 0.00 ? 252 LYS A N    2  
ATOM 1885  C CA   . LYS A 1 50 ? -7.728  -4.987  9.391  1.00 0.00 ? 252 LYS A CA   2  
ATOM 1886  C C    . LYS A 1 50 ? -8.638  -4.840  8.174  1.00 0.00 ? 252 LYS A C    2  
ATOM 1887  O O    . LYS A 1 50 ? -9.846  -5.061  8.261  1.00 0.00 ? 252 LYS A O    2  
ATOM 1888  C CB   . LYS A 1 50 ? -7.747  -3.694  10.211 1.00 0.00 ? 252 LYS A CB   2  
ATOM 1889  C CG   . LYS A 1 50 ? -6.587  -3.569  11.187 1.00 0.00 ? 252 LYS A CG   2  
ATOM 1890  C CD   . LYS A 1 50 ? -6.797  -4.434  12.418 1.00 0.00 ? 252 LYS A CD   2  
ATOM 1891  C CE   . LYS A 1 50 ? -5.547  -4.487  13.280 1.00 0.00 ? 252 LYS A CE   2  
ATOM 1892  N NZ   . LYS A 1 50 ? -5.787  -5.200  14.565 1.00 0.00 ? 252 LYS A NZ   2  
ATOM 1893  H H    . LYS A 1 50 ? -5.830  -4.640  8.520  1.00 0.00 ? 252 LYS A H    2  
ATOM 1894  H HA   . LYS A 1 50 ? -8.096  -5.797  10.004 1.00 0.00 ? 252 LYS A HA   2  
ATOM 1895  H HB2  . LYS A 1 50 ? -7.712  -2.854  9.535  1.00 0.00 ? 252 LYS A HB2  2  
ATOM 1896  H HB3  . LYS A 1 50 ? -8.668  -3.653  10.773 1.00 0.00 ? 252 LYS A HB3  2  
ATOM 1897  H HG2  . LYS A 1 50 ? -5.678  -3.877  10.693 1.00 0.00 ? 252 LYS A HG2  2  
ATOM 1898  H HG3  . LYS A 1 50 ? -6.500  -2.537  11.494 1.00 0.00 ? 252 LYS A HG3  2  
ATOM 1899  H HD2  . LYS A 1 50 ? -7.608  -4.023  13.001 1.00 0.00 ? 252 LYS A HD2  2  
ATOM 1900  H HD3  . LYS A 1 50 ? -7.050  -5.436  12.103 1.00 0.00 ? 252 LYS A HD3  2  
ATOM 1901  H HE2  . LYS A 1 50 ? -4.770  -4.999  12.734 1.00 0.00 ? 252 LYS A HE2  2  
ATOM 1902  H HE3  . LYS A 1 50 ? -5.229  -3.475  13.493 1.00 0.00 ? 252 LYS A HE3  2  
ATOM 1903  H HZ1  . LYS A 1 50 ? -6.129  -4.534  15.286 1.00 0.00 ? 252 LYS A HZ1  2  
ATOM 1904  H HZ2  . LYS A 1 50 ? -4.905  -5.636  14.901 1.00 0.00 ? 252 LYS A HZ2  2  
ATOM 1905  H HZ3  . LYS A 1 50 ? -6.500  -5.945  14.432 1.00 0.00 ? 252 LYS A HZ3  2  
ATOM 1906  N N    . ASN A 1 51 ? -8.053  -4.462  7.041  1.00 0.00 ? 253 ASN A N    2  
ATOM 1907  C CA   . ASN A 1 51 ? -8.817  -4.283  5.811  1.00 0.00 ? 253 ASN A CA   2  
ATOM 1908  C C    . ASN A 1 51 ? -8.348  -5.250  4.726  1.00 0.00 ? 253 ASN A C    2  
ATOM 1909  O O    . ASN A 1 51 ? -7.236  -5.775  4.787  1.00 0.00 ? 253 ASN A O    2  
ATOM 1910  C CB   . ASN A 1 51 ? -8.694  -2.840  5.315  1.00 0.00 ? 253 ASN A CB   2  
ATOM 1911  C CG   . ASN A 1 51 ? -7.293  -2.507  4.834  1.00 0.00 ? 253 ASN A CG   2  
ATOM 1912  O OD1  . ASN A 1 51 ? -7.040  -2.427  3.632  1.00 0.00 ? 253 ASN A OD1  2  
ATOM 1913  N ND2  . ASN A 1 51 ? -6.375  -2.312  5.773  1.00 0.00 ? 253 ASN A ND2  2  
ATOM 1914  H H    . ASN A 1 51 ? -7.088  -4.299  7.030  1.00 0.00 ? 253 ASN A H    2  
ATOM 1915  H HA   . ASN A 1 51 ? -9.854  -4.489  6.033  1.00 0.00 ? 253 ASN A HA   2  
ATOM 1916  H HB2  . ASN A 1 51 ? -9.380  -2.687  4.495  1.00 0.00 ? 253 ASN A HB2  2  
ATOM 1917  H HB3  . ASN A 1 51 ? -8.947  -2.166  6.120  1.00 0.00 ? 253 ASN A HB3  2  
ATOM 1918  H HD21 . ASN A 1 51 ? -6.650  -2.392  6.713  1.00 0.00 ? 253 ASN A HD21 2  
ATOM 1919  H HD22 . ASN A 1 51 ? -5.460  -2.097  5.490  1.00 0.00 ? 253 ASN A HD22 2  
ATOM 1920  N N    . ASP A 1 52 ? -9.203  -5.478  3.735  1.00 0.00 ? 254 ASP A N    2  
ATOM 1921  C CA   . ASP A 1 52 ? -8.878  -6.378  2.635  1.00 0.00 ? 254 ASP A CA   2  
ATOM 1922  C C    . ASP A 1 52 ? -8.461  -5.597  1.391  1.00 0.00 ? 254 ASP A C    2  
ATOM 1923  O O    . ASP A 1 52 ? -8.595  -6.083  0.269  1.00 0.00 ? 254 ASP A O    2  
ATOM 1924  C CB   . ASP A 1 52 ? -10.075 -7.275  2.312  1.00 0.00 ? 254 ASP A CB   2  
ATOM 1925  C CG   . ASP A 1 52 ? -11.280 -6.484  1.843  1.00 0.00 ? 254 ASP A CG   2  
ATOM 1926  O OD1  . ASP A 1 52 ? -11.350 -5.274  2.143  1.00 0.00 ? 254 ASP A OD1  2  
ATOM 1927  O OD2  . ASP A 1 52 ? -12.154 -7.076  1.175  1.00 0.00 ? 254 ASP A OD2  2  
ATOM 1928  H H    . ASP A 1 52 ? -10.074 -5.029  3.744  1.00 0.00 ? 254 ASP A H    2  
ATOM 1929  H HA   . ASP A 1 52 ? -8.051  -6.998  2.949  1.00 0.00 ? 254 ASP A HA   2  
ATOM 1930  H HB2  . ASP A 1 52 ? -9.798  -7.970  1.534  1.00 0.00 ? 254 ASP A HB2  2  
ATOM 1931  H HB3  . ASP A 1 52 ? -10.352 -7.827  3.200  1.00 0.00 ? 254 ASP A HB3  2  
ATOM 1932  N N    . GLY A 1 53 ? -7.955  -4.384  1.598  1.00 0.00 ? 255 GLY A N    2  
ATOM 1933  C CA   . GLY A 1 53 ? -7.527  -3.560  0.483  1.00 0.00 ? 255 GLY A CA   2  
ATOM 1934  C C    . GLY A 1 53 ? -8.489  -2.423  0.182  1.00 0.00 ? 255 GLY A C    2  
ATOM 1935  O O    . GLY A 1 53 ? -8.291  -1.673  -0.773 1.00 0.00 ? 255 GLY A O    2  
ATOM 1936  H H    . GLY A 1 53 ? -7.867  -4.048  2.514  1.00 0.00 ? 255 GLY A H    2  
ATOM 1937  H HA2  . GLY A 1 53 ? -6.557  -3.144  0.709  1.00 0.00 ? 255 GLY A HA2  2  
ATOM 1938  H HA3  . GLY A 1 53 ? -7.440  -4.183  -0.397 1.00 0.00 ? 255 GLY A HA3  2  
ATOM 1939  N N    . ALA A 1 54 ? -9.533  -2.294  0.997  1.00 0.00 ? 256 ALA A N    2  
ATOM 1940  C CA   . ALA A 1 54 ? -10.521 -1.240  0.807  1.00 0.00 ? 256 ALA A CA   2  
ATOM 1941  C C    . ALA A 1 54 ? -10.812 -0.513  2.114  1.00 0.00 ? 256 ALA A C    2  
ATOM 1942  O O    . ALA A 1 54 ? -10.566 -1.042  3.198  1.00 0.00 ? 256 ALA A O    2  
ATOM 1943  C CB   . ALA A 1 54 ? -11.802 -1.816  0.223  1.00 0.00 ? 256 ALA A CB   2  
ATOM 1944  H H    . ALA A 1 54 ? -9.641  -2.919  1.744  1.00 0.00 ? 256 ALA A H    2  
ATOM 1945  H HA   . ALA A 1 54 ? -10.119 -0.531  0.098  1.00 0.00 ? 256 ALA A HA   2  
ATOM 1946  H HB1  . ALA A 1 54 ? -11.586 -2.287  -0.726 1.00 0.00 ? 256 ALA A HB1  2  
ATOM 1947  H HB2  . ALA A 1 54 ? -12.210 -2.549  0.903  1.00 0.00 ? 256 ALA A HB2  2  
ATOM 1948  H HB3  . ALA A 1 54 ? -12.519 -1.023  0.075  1.00 0.00 ? 256 ALA A HB3  2  
ATOM 1949  N N    . VAL A 1 55 ? -11.338 0.702   2.003  1.00 0.00 ? 257 VAL A N    2  
ATOM 1950  C CA   . VAL A 1 55 ? -11.665 1.505   3.175  1.00 0.00 ? 257 VAL A CA   2  
ATOM 1951  C C    . VAL A 1 55 ? -12.920 2.339   2.935  1.00 0.00 ? 257 VAL A C    2  
ATOM 1952  O O    . VAL A 1 55 ? -12.976 3.141   2.003  1.00 0.00 ? 257 VAL A O    2  
ATOM 1953  C CB   . VAL A 1 55 ? -10.499 2.442   3.554  1.00 0.00 ? 257 VAL A CB   2  
ATOM 1954  C CG1  . VAL A 1 55 ? -10.835 3.249   4.800  1.00 0.00 ? 257 VAL A CG1  2  
ATOM 1955  C CG2  . VAL A 1 55 ? -9.218  1.644   3.754  1.00 0.00 ? 257 VAL A CG2  2  
ATOM 1956  H H    . VAL A 1 55 ? -11.511 1.069   1.110  1.00 0.00 ? 257 VAL A H    2  
ATOM 1957  H HA   . VAL A 1 55 ? -11.842 0.833   4.001  1.00 0.00 ? 257 VAL A HA   2  
ATOM 1958  H HB   . VAL A 1 55 ? -10.341 3.134   2.739  1.00 0.00 ? 257 VAL A HB   2  
ATOM 1959  H HG11 . VAL A 1 55 ? -10.116 3.032   5.576  1.00 0.00 ? 257 VAL A HG11 2  
ATOM 1960  H HG12 . VAL A 1 55 ? -10.804 4.303   4.565  1.00 0.00 ? 257 VAL A HG12 2  
ATOM 1961  H HG13 . VAL A 1 55 ? -11.824 2.986   5.144  1.00 0.00 ? 257 VAL A HG13 2  
ATOM 1962  H HG21 . VAL A 1 55 ? -9.351  0.952   4.572  1.00 0.00 ? 257 VAL A HG21 2  
ATOM 1963  H HG22 . VAL A 1 55 ? -8.990  1.097   2.851  1.00 0.00 ? 257 VAL A HG22 2  
ATOM 1964  H HG23 . VAL A 1 55 ? -8.406  2.319   3.980  1.00 0.00 ? 257 VAL A HG23 2  
ATOM 1965  N N    . ALA A 1 56 ? -13.924 2.142   3.782  1.00 0.00 ? 258 ALA A N    2  
ATOM 1966  C CA   . ALA A 1 56 ? -15.180 2.875   3.664  1.00 0.00 ? 258 ALA A CA   2  
ATOM 1967  C C    . ALA A 1 56 ? -15.827 2.645   2.301  1.00 0.00 ? 258 ALA A C    2  
ATOM 1968  O O    . ALA A 1 56 ? -16.574 3.491   1.809  1.00 0.00 ? 258 ALA A O    2  
ATOM 1969  C CB   . ALA A 1 56 ? -14.947 4.360   3.896  1.00 0.00 ? 258 ALA A CB   2  
ATOM 1970  H H    . ALA A 1 56 ? -13.819 1.488   4.505  1.00 0.00 ? 258 ALA A H    2  
ATOM 1971  H HA   . ALA A 1 56 ? -15.848 2.515   4.432  1.00 0.00 ? 258 ALA A HA   2  
ATOM 1972  H HB1  . ALA A 1 56 ? -14.672 4.525   4.927  1.00 0.00 ? 258 ALA A HB1  2  
ATOM 1973  H HB2  . ALA A 1 56 ? -14.150 4.703   3.253  1.00 0.00 ? 258 ALA A HB2  2  
ATOM 1974  H HB3  . ALA A 1 56 ? -15.851 4.905   3.671  1.00 0.00 ? 258 ALA A HB3  2  
ATOM 1975  N N    . GLY A 1 57 ? -15.535 1.498   1.697  1.00 0.00 ? 259 GLY A N    2  
ATOM 1976  C CA   . GLY A 1 57 ? -16.097 1.182   0.397  1.00 0.00 ? 259 GLY A CA   2  
ATOM 1977  C C    . GLY A 1 57 ? -15.217 1.644   -0.752 1.00 0.00 ? 259 GLY A C    2  
ATOM 1978  O O    . GLY A 1 57 ? -15.635 1.619   -1.909 1.00 0.00 ? 259 GLY A O    2  
ATOM 1979  H H    . GLY A 1 57 ? -14.933 0.861   2.134  1.00 0.00 ? 259 GLY A H    2  
ATOM 1980  H HA2  . GLY A 1 57 ? -16.227 0.112   0.324  1.00 0.00 ? 259 GLY A HA2  2  
ATOM 1981  H HA3  . GLY A 1 57 ? -17.062 1.658   0.308  1.00 0.00 ? 259 GLY A HA3  2  
ATOM 1982  N N    . THR A 1 58 ? -13.997 2.068   -0.434 1.00 0.00 ? 260 THR A N    2  
ATOM 1983  C CA   . THR A 1 58 ? -13.061 2.535   -1.450 1.00 0.00 ? 260 THR A CA   2  
ATOM 1984  C C    . THR A 1 58 ? -11.822 1.647   -1.499 1.00 0.00 ? 260 THR A C    2  
ATOM 1985  O O    . THR A 1 58 ? -11.060 1.576   -0.535 1.00 0.00 ? 260 THR A O    2  
ATOM 1986  C CB   . THR A 1 58 ? -12.654 3.983   -1.169 1.00 0.00 ? 260 THR A CB   2  
ATOM 1987  O OG1  . THR A 1 58 ? -13.793 4.781   -0.900 1.00 0.00 ? 260 THR A OG1  2  
ATOM 1988  C CG2  . THR A 1 58 ? -11.902 4.627   -2.315 1.00 0.00 ? 260 THR A CG2  2  
ATOM 1989  H H    . THR A 1 58 ? -13.716 2.065   0.504  1.00 0.00 ? 260 THR A H    2  
ATOM 1990  H HA   . THR A 1 58 ? -13.559 2.490   -2.405 1.00 0.00 ? 260 THR A HA   2  
ATOM 1991  H HB   . THR A 1 58 ? -12.012 4.004   -0.300 1.00 0.00 ? 260 THR A HB   2  
ATOM 1992  H HG1  . THR A 1 58 ? -13.618 5.344   -0.144 1.00 0.00 ? 260 THR A HG1  2  
ATOM 1993  H HG21 . THR A 1 58 ? -11.765 5.678   -2.109 1.00 0.00 ? 260 THR A HG21 2  
ATOM 1994  H HG22 . THR A 1 58 ? -12.467 4.509   -3.228 1.00 0.00 ? 260 THR A HG22 2  
ATOM 1995  H HG23 . THR A 1 58 ? -10.939 4.151   -2.425 1.00 0.00 ? 260 THR A HG23 2  
ATOM 1996  N N    . ARG A 1 59 ? -11.627 0.972   -2.627 1.00 0.00 ? 261 ARG A N    2  
ATOM 1997  C CA   . ARG A 1 59 ? -10.478 0.089   -2.798 1.00 0.00 ? 261 ARG A CA   2  
ATOM 1998  C C    . ARG A 1 59 ? -9.289  0.856   -3.367 1.00 0.00 ? 261 ARG A C    2  
ATOM 1999  O O    . ARG A 1 59 ? -9.307  1.283   -4.521 1.00 0.00 ? 261 ARG A O    2  
ATOM 2000  C CB   . ARG A 1 59 ? -10.837 -1.080  -3.716 1.00 0.00 ? 261 ARG A CB   2  
ATOM 2001  C CG   . ARG A 1 59 ? -9.770  -2.162  -3.764 1.00 0.00 ? 261 ARG A CG   2  
ATOM 2002  C CD   . ARG A 1 59 ? -10.195 -3.330  -4.641 1.00 0.00 ? 261 ARG A CD   2  
ATOM 2003  N NE   . ARG A 1 59 ? -10.933 -4.340  -3.886 1.00 0.00 ? 261 ARG A NE   2  
ATOM 2004  C CZ   . ARG A 1 59 ? -12.255 -4.329  -3.718 1.00 0.00 ? 261 ARG A CZ   2  
ATOM 2005  N NH1  . ARG A 1 59 ? -12.994 -3.361  -4.248 1.00 0.00 ? 261 ARG A NH1  2  
ATOM 2006  N NH2  . ARG A 1 59 ? -12.840 -5.289  -3.016 1.00 0.00 ? 261 ARG A NH2  2  
ATOM 2007  H H    . ARG A 1 59 ? -12.267 1.070   -3.361 1.00 0.00 ? 261 ARG A H    2  
ATOM 2008  H HA   . ARG A 1 59 ? -10.211 -0.296  -1.828 1.00 0.00 ? 261 ARG A HA   2  
ATOM 2009  H HB2  . ARG A 1 59 ? -11.756 -1.528  -3.369 1.00 0.00 ? 261 ARG A HB2  2  
ATOM 2010  H HB3  . ARG A 1 59 ? -10.985 -0.705  -4.718 1.00 0.00 ? 261 ARG A HB3  2  
ATOM 2011  H HG2  . ARG A 1 59 ? -8.860  -1.739  -4.165 1.00 0.00 ? 261 ARG A HG2  2  
ATOM 2012  H HG3  . ARG A 1 59 ? -9.591  -2.522  -2.762 1.00 0.00 ? 261 ARG A HG3  2  
ATOM 2013  H HD2  . ARG A 1 59 ? -10.820 -2.958  -5.438 1.00 0.00 ? 261 ARG A HD2  2  
ATOM 2014  H HD3  . ARG A 1 59 ? -9.310  -3.785  -5.063 1.00 0.00 ? 261 ARG A HD3  2  
ATOM 2015  H HE   . ARG A 1 59 ? -10.416 -5.068  -3.483 1.00 0.00 ? 261 ARG A HE   2  
ATOM 2016  H HH11 . ARG A 1 59 ? -12.563 -2.634  -4.779 1.00 0.00 ? 261 ARG A HH11 2  
ATOM 2017  H HH12 . ARG A 1 59 ? -13.984 -3.362  -4.115 1.00 0.00 ? 261 ARG A HH12 2  
ATOM 2018  H HH21 . ARG A 1 59 ? -12.290 -6.021  -2.614 1.00 0.00 ? 261 ARG A HH21 2  
ATOM 2019  H HH22 . ARG A 1 59 ? -13.832 -5.282  -2.888 1.00 0.00 ? 261 ARG A HH22 2  
ATOM 2020  N N    . TYR A 1 60 ? -8.257  1.026   -2.547 1.00 0.00 ? 262 TYR A N    2  
ATOM 2021  C CA   . TYR A 1 60 ? -7.058  1.744   -2.968 1.00 0.00 ? 262 TYR A CA   2  
ATOM 2022  C C    . TYR A 1 60 ? -6.112  0.821   -3.728 1.00 0.00 ? 262 TYR A C    2  
ATOM 2023  O O    . TYR A 1 60 ? -5.416  1.250   -4.649 1.00 0.00 ? 262 TYR A O    2  
ATOM 2024  C CB   . TYR A 1 60 ? -6.348  2.346   -1.754 1.00 0.00 ? 262 TYR A CB   2  
ATOM 2025  C CG   . TYR A 1 60 ? -7.142  3.439   -1.074 1.00 0.00 ? 262 TYR A CG   2  
ATOM 2026  C CD1  . TYR A 1 60 ? -8.243  3.135   -0.283 1.00 0.00 ? 262 TYR A CD1  2  
ATOM 2027  C CD2  . TYR A 1 60 ? -6.793  4.775   -1.225 1.00 0.00 ? 262 TYR A CD2  2  
ATOM 2028  C CE1  . TYR A 1 60 ? -8.973  4.131   0.337  1.00 0.00 ? 262 TYR A CE1  2  
ATOM 2029  C CE2  . TYR A 1 60 ? -7.516  5.776   -0.608 1.00 0.00 ? 262 TYR A CE2  2  
ATOM 2030  C CZ   . TYR A 1 60 ? -8.605  5.450   0.172  1.00 0.00 ? 262 TYR A CZ   2  
ATOM 2031  O OH   . TYR A 1 60 ? -9.331  6.444   0.788  1.00 0.00 ? 262 TYR A OH   2  
ATOM 2032  H H    . TYR A 1 60 ? -8.301  0.664   -1.638 1.00 0.00 ? 262 TYR A H    2  
ATOM 2033  H HA   . TYR A 1 60 ? -7.367  2.543   -3.626 1.00 0.00 ? 262 TYR A HA   2  
ATOM 2034  H HB2  . TYR A 1 60 ? -6.167  1.567   -1.029 1.00 0.00 ? 262 TYR A HB2  2  
ATOM 2035  H HB3  . TYR A 1 60 ? -5.405  2.767   -2.070 1.00 0.00 ? 262 TYR A HB3  2  
ATOM 2036  H HD1  . TYR A 1 60 ? -8.529  2.102   -0.154 1.00 0.00 ? 262 TYR A HD1  2  
ATOM 2037  H HD2  . TYR A 1 60 ? -5.939  5.027   -1.838 1.00 0.00 ? 262 TYR A HD2  2  
ATOM 2038  H HE1  . TYR A 1 60 ? -9.826  3.876   0.949  1.00 0.00 ? 262 TYR A HE1  2  
ATOM 2039  H HE2  . TYR A 1 60 ? -7.229  6.809   -0.738 1.00 0.00 ? 262 TYR A HE2  2  
ATOM 2040  H HH   . TYR A 1 60 ? -9.584  7.105   0.138  1.00 0.00 ? 262 TYR A HH   2  
ATOM 2041  N N    . PHE A 1 61 ? -6.091  -0.448  -3.337 1.00 0.00 ? 263 PHE A N    2  
ATOM 2042  C CA   . PHE A 1 61 ? -5.233  -1.433  -3.983 1.00 0.00 ? 263 PHE A CA   2  
ATOM 2043  C C    . PHE A 1 61 ? -5.800  -2.838  -3.810 1.00 0.00 ? 263 PHE A C    2  
ATOM 2044  O O    . PHE A 1 61 ? -6.804  -3.032  -3.124 1.00 0.00 ? 263 PHE A O    2  
ATOM 2045  C CB   . PHE A 1 61 ? -3.816  -1.366  -3.411 1.00 0.00 ? 263 PHE A CB   2  
ATOM 2046  C CG   . PHE A 1 61 ? -3.773  -1.329  -1.910 1.00 0.00 ? 263 PHE A CG   2  
ATOM 2047  C CD1  . PHE A 1 61 ? -3.963  -0.137  -1.229 1.00 0.00 ? 263 PHE A CD1  2  
ATOM 2048  C CD2  . PHE A 1 61 ? -3.539  -2.482  -1.181 1.00 0.00 ? 263 PHE A CD2  2  
ATOM 2049  C CE1  . PHE A 1 61 ? -3.921  -0.098  0.150  1.00 0.00 ? 263 PHE A CE1  2  
ATOM 2050  C CE2  . PHE A 1 61 ? -3.495  -2.448  0.200  1.00 0.00 ? 263 PHE A CE2  2  
ATOM 2051  C CZ   . PHE A 1 61 ? -3.688  -1.255  0.867  1.00 0.00 ? 263 PHE A CZ   2  
ATOM 2052  H H    . PHE A 1 61 ? -6.671  -0.730  -2.599 1.00 0.00 ? 263 PHE A H    2  
ATOM 2053  H HA   . PHE A 1 61 ? -5.197  -1.200  -5.037 1.00 0.00 ? 263 PHE A HA   2  
ATOM 2054  H HB2  . PHE A 1 61 ? -3.262  -2.235  -3.736 1.00 0.00 ? 263 PHE A HB2  2  
ATOM 2055  H HB3  . PHE A 1 61 ? -3.327  -0.475  -3.779 1.00 0.00 ? 263 PHE A HB3  2  
ATOM 2056  H HD1  . PHE A 1 61 ? -4.146  0.769   -1.789 1.00 0.00 ? 263 PHE A HD1  2  
ATOM 2057  H HD2  . PHE A 1 61 ? -3.388  -3.417  -1.701 1.00 0.00 ? 263 PHE A HD2  2  
ATOM 2058  H HE1  . PHE A 1 61 ? -4.072  0.838   0.668  1.00 0.00 ? 263 PHE A HE1  2  
ATOM 2059  H HE2  . PHE A 1 61 ? -3.312  -3.355  0.758  1.00 0.00 ? 263 PHE A HE2  2  
ATOM 2060  H HZ   . PHE A 1 61 ? -3.655  -1.226  1.945  1.00 0.00 ? 263 PHE A HZ   2  
ATOM 2061  N N    . GLN A 1 62 ? -5.155  -3.816  -4.439 1.00 0.00 ? 264 GLN A N    2  
ATOM 2062  C CA   . GLN A 1 62 ? -5.602  -5.201  -4.352 1.00 0.00 ? 264 GLN A CA   2  
ATOM 2063  C C    . GLN A 1 62 ? -4.698  -6.007  -3.426 1.00 0.00 ? 264 GLN A C    2  
ATOM 2064  O O    . GLN A 1 62 ? -3.476  -5.996  -3.571 1.00 0.00 ? 264 GLN A O    2  
ATOM 2065  C CB   . GLN A 1 62 ? -5.629  -5.838  -5.743 1.00 0.00 ? 264 GLN A CB   2  
ATOM 2066  C CG   . GLN A 1 62 ? -6.236  -7.231  -5.763 1.00 0.00 ? 264 GLN A CG   2  
ATOM 2067  C CD   . GLN A 1 62 ? -7.722  -7.223  -5.453 1.00 0.00 ? 264 GLN A CD   2  
ATOM 2068  O OE1  . GLN A 1 62 ? -8.510  -6.601  -6.162 1.00 0.00 ? 264 GLN A OE1  2  
ATOM 2069  N NE2  . GLN A 1 62 ? -8.107  -7.919  -4.389 1.00 0.00 ? 264 GLN A NE2  2  
ATOM 2070  H H    . GLN A 1 62 ? -4.363  -3.600  -4.972 1.00 0.00 ? 264 GLN A H    2  
ATOM 2071  H HA   . GLN A 1 62 ? -6.604  -5.201  -3.948 1.00 0.00 ? 264 GLN A HA   2  
ATOM 2072  H HB2  . GLN A 1 62 ? -6.206  -5.207  -6.404 1.00 0.00 ? 264 GLN A HB2  2  
ATOM 2073  H HB3  . GLN A 1 62 ? -4.617  -5.904  -6.116 1.00 0.00 ? 264 GLN A HB3  2  
ATOM 2074  H HG2  . GLN A 1 62 ? -6.092  -7.659  -6.742 1.00 0.00 ? 264 GLN A HG2  2  
ATOM 2075  H HG3  . GLN A 1 62 ? -5.733  -7.840  -5.026 1.00 0.00 ? 264 GLN A HG3  2  
ATOM 2076  H HE21 . GLN A 1 62 ? -7.422  -8.390  -3.871 1.00 0.00 ? 264 GLN A HE21 2  
ATOM 2077  H HE22 . GLN A 1 62 ? -9.061  -7.931  -4.166 1.00 0.00 ? 264 GLN A HE22 2  
ATOM 2078  N N    . CYS A 1 63 ? -5.310  -6.707  -2.476 1.00 0.00 ? 265 CYS A N    2  
ATOM 2079  C CA   . CYS A 1 63 ? -4.563  -7.520  -1.524 1.00 0.00 ? 265 CYS A CA   2  
ATOM 2080  C C    . CYS A 1 63 ? -5.421  -8.661  -0.992 1.00 0.00 ? 265 CYS A C    2  
ATOM 2081  O O    . CYS A 1 63 ? -6.650  -8.599  -1.030 1.00 0.00 ? 265 CYS A O    2  
ATOM 2082  C CB   . CYS A 1 63 ? -4.063  -6.657  -0.364 1.00 0.00 ? 265 CYS A CB   2  
ATOM 2083  S SG   . CYS A 1 63 ? -5.384  -5.929  0.635  1.00 0.00 ? 265 CYS A SG   2  
ATOM 2084  H H    . CYS A 1 63 ? -6.287  -6.675  -2.414 1.00 0.00 ? 265 CYS A H    2  
ATOM 2085  H HA   . CYS A 1 63 ? -3.711  -7.937  -2.043 1.00 0.00 ? 265 CYS A HA   2  
ATOM 2086  H HB2  . CYS A 1 63 ? -3.454  -7.263  0.290  1.00 0.00 ? 265 CYS A HB2  2  
ATOM 2087  H HB3  . CYS A 1 63 ? -3.465  -5.849  -0.758 1.00 0.00 ? 265 CYS A HB3  2  
ATOM 2088  H HG   . CYS A 1 63 ? -5.321  -6.294  1.520  1.00 0.00 ? 265 CYS A HG   2  
ATOM 2089  N N    . GLN A 1 64 ? -4.766  -9.706  -0.495 1.00 0.00 ? 266 GLN A N    2  
ATOM 2090  C CA   . GLN A 1 64 ? -5.469  -10.863 0.046  1.00 0.00 ? 266 GLN A CA   2  
ATOM 2091  C C    . GLN A 1 64 ? -6.347  -10.464 1.230  1.00 0.00 ? 266 GLN A C    2  
ATOM 2092  O O    . GLN A 1 64 ? -6.203  -9.374  1.780  1.00 0.00 ? 266 GLN A O    2  
ATOM 2093  C CB   . GLN A 1 64 ? -4.468  -11.936 0.479  1.00 0.00 ? 266 GLN A CB   2  
ATOM 2094  C CG   . GLN A 1 64 ? -3.984  -12.814 -0.663 1.00 0.00 ? 266 GLN A CG   2  
ATOM 2095  C CD   . GLN A 1 64 ? -5.000  -13.867 -1.059 1.00 0.00 ? 266 GLN A CD   2  
ATOM 2096  O OE1  . GLN A 1 64 ? -4.967  -14.994 -0.565 1.00 0.00 ? 266 GLN A OE1  2  
ATOM 2097  N NE2  . GLN A 1 64 ? -5.909  -13.505 -1.956 1.00 0.00 ? 266 GLN A NE2  2  
ATOM 2098  H H    . GLN A 1 64 ? -3.786  -9.697  -0.493 1.00 0.00 ? 266 GLN A H    2  
ATOM 2099  H HA   . GLN A 1 64 ? -6.097  -11.264 -0.735 1.00 0.00 ? 266 GLN A HA   2  
ATOM 2100  H HB2  . GLN A 1 64 ? -3.610  -11.453 0.922  1.00 0.00 ? 266 GLN A HB2  2  
ATOM 2101  H HB3  . GLN A 1 64 ? -4.935  -12.570 1.219  1.00 0.00 ? 266 GLN A HB3  2  
ATOM 2102  H HG2  . GLN A 1 64 ? -3.783  -12.189 -1.521 1.00 0.00 ? 266 GLN A HG2  2  
ATOM 2103  H HG3  . GLN A 1 64 ? -3.073  -13.309 -0.359 1.00 0.00 ? 266 GLN A HG3  2  
ATOM 2104  H HE21 . GLN A 1 64 ? -5.874  -12.590 -2.307 1.00 0.00 ? 266 GLN A HE21 2  
ATOM 2105  H HE22 . GLN A 1 64 ? -6.579  -14.165 -2.231 1.00 0.00 ? 266 GLN A HE22 2  
ATOM 2106  N N    . PRO A 1 65 ? -7.277  -11.346 1.634  1.00 0.00 ? 267 PRO A N    2  
ATOM 2107  C CA   . PRO A 1 65 ? -8.181  -11.082 2.757  1.00 0.00 ? 267 PRO A CA   2  
ATOM 2108  C C    . PRO A 1 65 ? -7.431  -10.927 4.077  1.00 0.00 ? 267 PRO A C    2  
ATOM 2109  O O    . PRO A 1 65 ? -6.555  -11.730 4.401  1.00 0.00 ? 267 PRO A O    2  
ATOM 2110  C CB   . PRO A 1 65 ? -9.088  -12.320 2.801  1.00 0.00 ? 267 PRO A CB   2  
ATOM 2111  C CG   . PRO A 1 65 ? -8.921  -12.977 1.473  1.00 0.00 ? 267 PRO A CG   2  
ATOM 2112  C CD   . PRO A 1 65 ? -7.521  -12.665 1.033  1.00 0.00 ? 267 PRO A CD   2  
ATOM 2113  H HA   . PRO A 1 65 ? -8.781  -10.200 2.582  1.00 0.00 ? 267 PRO A HA   2  
ATOM 2114  H HB2  . PRO A 1 65 ? -8.772  -12.969 3.604  1.00 0.00 ? 267 PRO A HB2  2  
ATOM 2115  H HB3  . PRO A 1 65 ? -10.110 -12.013 2.963  1.00 0.00 ? 267 PRO A HB3  2  
ATOM 2116  H HG2  . PRO A 1 65 ? -9.055  -14.045 1.571  1.00 0.00 ? 267 PRO A HG2  2  
ATOM 2117  H HG3  . PRO A 1 65 ? -9.633  -12.571 0.770  1.00 0.00 ? 267 PRO A HG3  2  
ATOM 2118  H HD2  . PRO A 1 65 ? -6.830  -13.402 1.419  1.00 0.00 ? 267 PRO A HD2  2  
ATOM 2119  H HD3  . PRO A 1 65 ? -7.464  -12.615 -0.044 1.00 0.00 ? 267 PRO A HD3  2  
ATOM 2120  N N    . LYS A 1 66 ? -7.780  -9.892  4.833  1.00 0.00 ? 268 LYS A N    2  
ATOM 2121  C CA   . LYS A 1 66 ? -7.141  -9.633  6.120  1.00 0.00 ? 268 LYS A CA   2  
ATOM 2122  C C    . LYS A 1 66 ? -5.636  -9.428  5.956  1.00 0.00 ? 268 LYS A C    2  
ATOM 2123  O O    . LYS A 1 66 ? -4.870  -9.622  6.899  1.00 0.00 ? 268 LYS A O    2  
ATOM 2124  C CB   . LYS A 1 66 ? -7.406  -10.789 7.085  1.00 0.00 ? 268 LYS A CB   2  
ATOM 2125  C CG   . LYS A 1 66 ? -8.759  -10.707 7.774  1.00 0.00 ? 268 LYS A CG   2  
ATOM 2126  C CD   . LYS A 1 66 ? -8.677  -9.912  9.068  1.00 0.00 ? 268 LYS A CD   2  
ATOM 2127  C CE   . LYS A 1 66 ? -9.890  -9.011  9.248  1.00 0.00 ? 268 LYS A CE   2  
ATOM 2128  N NZ   . LYS A 1 66 ? -9.500  -7.581  9.386  1.00 0.00 ? 268 LYS A NZ   2  
ATOM 2129  H H    . LYS A 1 66 ? -8.487  -9.289  4.522  1.00 0.00 ? 268 LYS A H    2  
ATOM 2130  H HA   . LYS A 1 66 ? -7.572  -8.732  6.526  1.00 0.00 ? 268 LYS A HA   2  
ATOM 2131  H HB2  . LYS A 1 66 ? -7.360  -11.719 6.538  1.00 0.00 ? 268 LYS A HB2  2  
ATOM 2132  H HB3  . LYS A 1 66 ? -6.638  -10.792 7.845  1.00 0.00 ? 268 LYS A HB3  2  
ATOM 2133  H HG2  . LYS A 1 66 ? -9.460  -10.225 7.111  1.00 0.00 ? 268 LYS A HG2  2  
ATOM 2134  H HG3  . LYS A 1 66 ? -9.099  -11.708 7.997  1.00 0.00 ? 268 LYS A HG3  2  
ATOM 2135  H HD2  . LYS A 1 66 ? -8.628  -10.599 9.899  1.00 0.00 ? 268 LYS A HD2  2  
ATOM 2136  H HD3  . LYS A 1 66 ? -7.786  -9.302  9.049  1.00 0.00 ? 268 LYS A HD3  2  
ATOM 2137  H HE2  . LYS A 1 66 ? -10.535 -9.118  8.390  1.00 0.00 ? 268 LYS A HE2  2  
ATOM 2138  H HE3  . LYS A 1 66 ? -10.420 -9.318  10.138 1.00 0.00 ? 268 LYS A HE3  2  
ATOM 2139  H HZ1  . LYS A 1 66 ? -9.344  -7.346  10.387 1.00 0.00 ? 268 LYS A HZ1  2  
ATOM 2140  H HZ2  . LYS A 1 66 ? -10.254 -6.968  9.012  1.00 0.00 ? 268 LYS A HZ2  2  
ATOM 2141  H HZ3  . LYS A 1 66 ? -8.625  -7.395  8.858  1.00 0.00 ? 268 LYS A HZ3  2  
ATOM 2142  N N    . TYR A 1 67 ? -5.220  -9.033  4.756  1.00 0.00 ? 269 TYR A N    2  
ATOM 2143  C CA   . TYR A 1 67 ? -3.805  -8.800  4.478  1.00 0.00 ? 269 TYR A CA   2  
ATOM 2144  C C    . TYR A 1 67 ? -3.529  -7.317  4.238  1.00 0.00 ? 269 TYR A C    2  
ATOM 2145  O O    . TYR A 1 67 ? -2.385  -6.873  4.310  1.00 0.00 ? 269 TYR A O    2  
ATOM 2146  C CB   . TYR A 1 67 ? -3.362  -9.612  3.258  1.00 0.00 ? 269 TYR A CB   2  
ATOM 2147  C CG   . TYR A 1 67 ? -2.822  -10.983 3.601  1.00 0.00 ? 269 TYR A CG   2  
ATOM 2148  C CD1  . TYR A 1 67 ? -3.438  -11.774 4.561  1.00 0.00 ? 269 TYR A CD1  2  
ATOM 2149  C CD2  . TYR A 1 67 ? -1.697  -11.486 2.959  1.00 0.00 ? 269 TYR A CD2  2  
ATOM 2150  C CE1  . TYR A 1 67 ? -2.950  -13.028 4.873  1.00 0.00 ? 269 TYR A CE1  2  
ATOM 2151  C CE2  . TYR A 1 67 ? -1.201  -12.738 3.267  1.00 0.00 ? 269 TYR A CE2  2  
ATOM 2152  C CZ   . TYR A 1 67 ? -1.830  -13.506 4.224  1.00 0.00 ? 269 TYR A CZ   2  
ATOM 2153  O OH   . TYR A 1 67 ? -1.342  -14.753 4.532  1.00 0.00 ? 269 TYR A OH   2  
ATOM 2154  H H    . TYR A 1 67 ? -5.875  -8.893  4.043  1.00 0.00 ? 269 TYR A H    2  
ATOM 2155  H HA   . TYR A 1 67 ? -3.240  -9.124  5.338  1.00 0.00 ? 269 TYR A HA   2  
ATOM 2156  H HB2  . TYR A 1 67 ? -4.203  -9.746  2.599  1.00 0.00 ? 269 TYR A HB2  2  
ATOM 2157  H HB3  . TYR A 1 67 ? -2.586  -9.070  2.738  1.00 0.00 ? 269 TYR A HB3  2  
ATOM 2158  H HD1  . TYR A 1 67 ? -4.313  -11.398 5.069  1.00 0.00 ? 269 TYR A HD1  2  
ATOM 2159  H HD2  . TYR A 1 67 ? -1.205  -10.882 2.211  1.00 0.00 ? 269 TYR A HD2  2  
ATOM 2160  H HE1  . TYR A 1 67 ? -3.443  -13.628 5.623  1.00 0.00 ? 269 TYR A HE1  2  
ATOM 2161  H HE2  . TYR A 1 67 ? -0.325  -13.113 2.758  1.00 0.00 ? 269 TYR A HE2  2  
ATOM 2162  H HH   . TYR A 1 67 ? -1.553  -15.366 3.822  1.00 0.00 ? 269 TYR A HH   2  
ATOM 2163  N N    . GLY A 1 68 ? -4.581  -6.555  3.951  1.00 0.00 ? 270 GLY A N    2  
ATOM 2164  C CA   . GLY A 1 68 ? -4.418  -5.134  3.703  1.00 0.00 ? 270 GLY A CA   2  
ATOM 2165  C C    . GLY A 1 68 ? -4.291  -4.328  4.982  1.00 0.00 ? 270 GLY A C    2  
ATOM 2166  O O    . GLY A 1 68 ? -5.053  -4.527  5.929  1.00 0.00 ? 270 GLY A O    2  
ATOM 2167  H H    . GLY A 1 68 ? -5.472  -6.958  3.906  1.00 0.00 ? 270 GLY A H    2  
ATOM 2168  H HA2  . GLY A 1 68 ? -3.531  -4.983  3.107  1.00 0.00 ? 270 GLY A HA2  2  
ATOM 2169  H HA3  . GLY A 1 68 ? -5.275  -4.776  3.150  1.00 0.00 ? 270 GLY A HA3  2  
ATOM 2170  N N    . LEU A 1 69 ? -3.326  -3.415  5.007  1.00 0.00 ? 271 LEU A N    2  
ATOM 2171  C CA   . LEU A 1 69 ? -3.098  -2.570  6.174  1.00 0.00 ? 271 LEU A CA   2  
ATOM 2172  C C    . LEU A 1 69 ? -2.813  -1.132  5.749  1.00 0.00 ? 271 LEU A C    2  
ATOM 2173  O O    . LEU A 1 69 ? -1.923  -0.881  4.937  1.00 0.00 ? 271 LEU A O    2  
ATOM 2174  C CB   . LEU A 1 69 ? -1.935  -3.115  7.006  1.00 0.00 ? 271 LEU A CB   2  
ATOM 2175  C CG   . LEU A 1 69 ? -2.008  -2.810  8.503  1.00 0.00 ? 271 LEU A CG   2  
ATOM 2176  C CD1  . LEU A 1 69 ? -3.263  -3.418  9.115  1.00 0.00 ? 271 LEU A CD1  2  
ATOM 2177  C CD2  . LEU A 1 69 ? -0.763  -3.325  9.212  1.00 0.00 ? 271 LEU A CD2  2  
ATOM 2178  H H    . LEU A 1 69 ? -2.753  -3.305  4.219  1.00 0.00 ? 271 LEU A H    2  
ATOM 2179  H HA   . LEU A 1 69 ? -3.996  -2.584  6.773  1.00 0.00 ? 271 LEU A HA   2  
ATOM 2180  H HB2  . LEU A 1 69 ? -1.901  -4.188  6.878  1.00 0.00 ? 271 LEU A HB2  2  
ATOM 2181  H HB3  . LEU A 1 69 ? -1.017  -2.695  6.620  1.00 0.00 ? 271 LEU A HB3  2  
ATOM 2182  H HG   . LEU A 1 69 ? -2.055  -1.739  8.644  1.00 0.00 ? 271 LEU A HG   2  
ATOM 2183  H HD11 . LEU A 1 69 ? -2.986  -4.220  9.782  1.00 0.00 ? 271 LEU A HD11 2  
ATOM 2184  H HD12 . LEU A 1 69 ? -3.797  -2.660  9.666  1.00 0.00 ? 271 LEU A HD12 2  
ATOM 2185  H HD13 . LEU A 1 69 ? -3.896  -3.806  8.331  1.00 0.00 ? 271 LEU A HD13 2  
ATOM 2186  H HD21 . LEU A 1 69 ? -0.447  -2.604  9.952  1.00 0.00 ? 271 LEU A HD21 2  
ATOM 2187  H HD22 . LEU A 1 69 ? -0.987  -4.264  9.696  1.00 0.00 ? 271 LEU A HD22 2  
ATOM 2188  H HD23 . LEU A 1 69 ? 0.027   -3.470  8.491  1.00 0.00 ? 271 LEU A HD23 2  
ATOM 2189  N N    . PHE A 1 70 ? -3.579  -0.195  6.296  1.00 0.00 ? 272 PHE A N    2  
ATOM 2190  C CA   . PHE A 1 70 ? -3.416  1.217   5.968  1.00 0.00 ? 272 PHE A CA   2  
ATOM 2191  C C    . PHE A 1 70 ? -2.732  1.973   7.103  1.00 0.00 ? 272 PHE A C    2  
ATOM 2192  O O    . PHE A 1 70 ? -3.308  2.143   8.176  1.00 0.00 ? 272 PHE A O    2  
ATOM 2193  C CB   . PHE A 1 70 ? -4.780  1.849   5.683  1.00 0.00 ? 272 PHE A CB   2  
ATOM 2194  C CG   . PHE A 1 70 ? -5.305  1.569   4.304  1.00 0.00 ? 272 PHE A CG   2  
ATOM 2195  C CD1  . PHE A 1 70 ? -5.321  0.278   3.804  1.00 0.00 ? 272 PHE A CD1  2  
ATOM 2196  C CD2  . PHE A 1 70 ? -5.788  2.598   3.510  1.00 0.00 ? 272 PHE A CD2  2  
ATOM 2197  C CE1  . PHE A 1 70 ? -5.809  0.017   2.538  1.00 0.00 ? 272 PHE A CE1  2  
ATOM 2198  C CE2  . PHE A 1 70 ? -6.275  2.343   2.243  1.00 0.00 ? 272 PHE A CE2  2  
ATOM 2199  C CZ   . PHE A 1 70 ? -6.287  1.051   1.756  1.00 0.00 ? 272 PHE A CZ   2  
ATOM 2200  H H    . PHE A 1 70 ? -4.277  -0.461  6.932  1.00 0.00 ? 272 PHE A H    2  
ATOM 2201  H HA   . PHE A 1 70 ? -2.804  1.286   5.082  1.00 0.00 ? 272 PHE A HA   2  
ATOM 2202  H HB2  . PHE A 1 70 ? -5.499  1.469   6.393  1.00 0.00 ? 272 PHE A HB2  2  
ATOM 2203  H HB3  . PHE A 1 70 ? -4.703  2.920   5.799  1.00 0.00 ? 272 PHE A HB3  2  
ATOM 2204  H HD1  . PHE A 1 70 ? -4.948  -0.531  4.414  1.00 0.00 ? 272 PHE A HD1  2  
ATOM 2205  H HD2  . PHE A 1 70 ? -5.778  3.608   3.891  1.00 0.00 ? 272 PHE A HD2  2  
ATOM 2206  H HE1  . PHE A 1 70 ? -5.816  -0.995  2.160  1.00 0.00 ? 272 PHE A HE1  2  
ATOM 2207  H HE2  . PHE A 1 70 ? -6.648  3.153   1.634  1.00 0.00 ? 272 PHE A HE2  2  
ATOM 2208  H HZ   . PHE A 1 70 ? -6.668  0.850   0.766  1.00 0.00 ? 272 PHE A HZ   2  
ATOM 2209  N N    . ALA A 1 71 ? -1.511  2.441   6.856  1.00 0.00 ? 273 ALA A N    2  
ATOM 2210  C CA   . ALA A 1 71 ? -0.767  3.195   7.861  1.00 0.00 ? 273 ALA A CA   2  
ATOM 2211  C C    . ALA A 1 71 ? 0.009   4.345   7.223  1.00 0.00 ? 273 ALA A C    2  
ATOM 2212  O O    . ALA A 1 71 ? 0.446   4.253   6.076  1.00 0.00 ? 273 ALA A O    2  
ATOM 2213  C CB   . ALA A 1 71 ? 0.179   2.286   8.634  1.00 0.00 ? 273 ALA A CB   2  
ATOM 2214  H H    . ALA A 1 71 ? -1.106  2.286   5.977  1.00 0.00 ? 273 ALA A H    2  
ATOM 2215  H HA   . ALA A 1 71 ? -1.482  3.603   8.560  1.00 0.00 ? 273 ALA A HA   2  
ATOM 2216  H HB1  . ALA A 1 71 ? 0.493   2.783   9.543  1.00 0.00 ? 273 ALA A HB1  2  
ATOM 2217  H HB2  . ALA A 1 71 ? -0.327  1.366   8.886  1.00 0.00 ? 273 ALA A HB2  2  
ATOM 2218  H HB3  . ALA A 1 71 ? 1.046   2.068   8.028  1.00 0.00 ? 273 ALA A HB3  2  
ATOM 2219  N N    . PRO A 1 72 ? 0.188   5.450   7.966  1.00 0.00 ? 274 PRO A N    2  
ATOM 2220  C CA   . PRO A 1 72 ? 0.910   6.630   7.480  1.00 0.00 ? 274 PRO A CA   2  
ATOM 2221  C C    . PRO A 1 72 ? 2.248   6.280   6.840  1.00 0.00 ? 274 PRO A C    2  
ATOM 2222  O O    . PRO A 1 72 ? 2.783   5.191   7.047  1.00 0.00 ? 274 PRO A O    2  
ATOM 2223  C CB   . PRO A 1 72 ? 1.137   7.449   8.748  1.00 0.00 ? 274 PRO A CB   2  
ATOM 2224  C CG   . PRO A 1 72 ? 0.027   7.065   9.659  1.00 0.00 ? 274 PRO A CG   2  
ATOM 2225  C CD   . PRO A 1 72 ? -0.309  5.633   9.342  1.00 0.00 ? 274 PRO A CD   2  
ATOM 2226  H HA   . PRO A 1 72 ? 0.316   7.200   6.783  1.00 0.00 ? 274 PRO A HA   2  
ATOM 2227  H HB2  . PRO A 1 72 ? 2.097   7.195   9.169  1.00 0.00 ? 274 PRO A HB2  2  
ATOM 2228  H HB3  . PRO A 1 72 ? 1.109   8.502   8.510  1.00 0.00 ? 274 PRO A HB3  2  
ATOM 2229  H HG2  . PRO A 1 72 ? 0.352   7.153   10.684 1.00 0.00 ? 274 PRO A HG2  2  
ATOM 2230  H HG3  . PRO A 1 72 ? -0.830  7.699   9.482  1.00 0.00 ? 274 PRO A HG3  2  
ATOM 2231  H HD2  . PRO A 1 72 ? 0.200   4.968   10.023 1.00 0.00 ? 274 PRO A HD2  2  
ATOM 2232  H HD3  . PRO A 1 72 ? -1.376  5.478   9.386  1.00 0.00 ? 274 PRO A HD3  2  
ATOM 2233  N N    . VAL A 1 73 ? 2.788   7.217   6.067  1.00 0.00 ? 275 VAL A N    2  
ATOM 2234  C CA   . VAL A 1 73 ? 4.067   7.016   5.402  1.00 0.00 ? 275 VAL A CA   2  
ATOM 2235  C C    . VAL A 1 73 ? 5.212   7.017   6.413  1.00 0.00 ? 275 VAL A C    2  
ATOM 2236  O O    . VAL A 1 73 ? 6.202   6.305   6.243  1.00 0.00 ? 275 VAL A O    2  
ATOM 2237  C CB   . VAL A 1 73 ? 4.327   8.103   4.340  1.00 0.00 ? 275 VAL A CB   2  
ATOM 2238  C CG1  . VAL A 1 73 ? 4.370   9.483   4.981  1.00 0.00 ? 275 VAL A CG1  2  
ATOM 2239  C CG2  . VAL A 1 73 ? 5.615   7.818   3.583  1.00 0.00 ? 275 VAL A CG2  2  
ATOM 2240  H H    . VAL A 1 73 ? 2.314   8.067   5.945  1.00 0.00 ? 275 VAL A H    2  
ATOM 2241  H HA   . VAL A 1 73 ? 4.038   6.056   4.906  1.00 0.00 ? 275 VAL A HA   2  
ATOM 2242  H HB   . VAL A 1 73 ? 3.509   8.088   3.633  1.00 0.00 ? 275 VAL A HB   2  
ATOM 2243  H HG11 . VAL A 1 73 ? 3.440   9.667   5.501  1.00 0.00 ? 275 VAL A HG11 2  
ATOM 2244  H HG12 . VAL A 1 73 ? 5.189   9.528   5.682  1.00 0.00 ? 275 VAL A HG12 2  
ATOM 2245  H HG13 . VAL A 1 73 ? 4.507   10.231  4.215  1.00 0.00 ? 275 VAL A HG13 2  
ATOM 2246  H HG21 . VAL A 1 73 ? 6.414   7.635   4.286  1.00 0.00 ? 275 VAL A HG21 2  
ATOM 2247  H HG22 . VAL A 1 73 ? 5.479   6.948   2.956  1.00 0.00 ? 275 VAL A HG22 2  
ATOM 2248  H HG23 . VAL A 1 73 ? 5.867   8.669   2.967  1.00 0.00 ? 275 VAL A HG23 2  
ATOM 2249  N N    . HIS A 1 74 ? 5.067   7.817   7.466  1.00 0.00 ? 276 HIS A N    2  
ATOM 2250  C CA   . HIS A 1 74 ? 6.091   7.905   8.501  1.00 0.00 ? 276 HIS A CA   2  
ATOM 2251  C C    . HIS A 1 74 ? 6.035   6.691   9.427  1.00 0.00 ? 276 HIS A C    2  
ATOM 2252  O O    . HIS A 1 74 ? 7.036   6.326   10.044 1.00 0.00 ? 276 HIS A O    2  
ATOM 2253  C CB   . HIS A 1 74 ? 5.936   9.194   9.313  1.00 0.00 ? 276 HIS A CB   2  
ATOM 2254  C CG   . HIS A 1 74 ? 4.528   9.491   9.727  1.00 0.00 ? 276 HIS A CG   2  
ATOM 2255  N ND1  . HIS A 1 74 ? 3.950   10.735  9.584  1.00 0.00 ? 276 HIS A ND1  2  
ATOM 2256  C CD2  . HIS A 1 74 ? 3.580   8.701   10.285 1.00 0.00 ? 276 HIS A CD2  2  
ATOM 2257  C CE1  . HIS A 1 74 ? 2.711   10.698  10.039 1.00 0.00 ? 276 HIS A CE1  2  
ATOM 2258  N NE2  . HIS A 1 74 ? 2.462   9.475   10.469 1.00 0.00 ? 276 HIS A NE2  2  
ATOM 2259  H H    . HIS A 1 74 ? 4.255   8.359   7.547  1.00 0.00 ? 276 HIS A H    2  
ATOM 2260  H HA   . HIS A 1 74 ? 7.053   7.916   8.010  1.00 0.00 ? 276 HIS A HA   2  
ATOM 2261  H HB2  . HIS A 1 74 ? 6.534   9.119   10.209 1.00 0.00 ? 276 HIS A HB2  2  
ATOM 2262  H HB3  . HIS A 1 74 ? 6.292   10.025  8.722  1.00 0.00 ? 276 HIS A HB3  2  
ATOM 2263  H HD1  . HIS A 1 74 ? 4.385   11.529  9.206  1.00 0.00 ? 276 HIS A HD1  2  
ATOM 2264  H HD2  . HIS A 1 74 ? 3.681   7.653   10.533 1.00 0.00 ? 276 HIS A HD2  2  
ATOM 2265  H HE1  . HIS A 1 74 ? 2.018   11.527  10.054 1.00 0.00 ? 276 HIS A HE1  2  
ATOM 2266  H HE2  . HIS A 1 74 ? 1.592   9.154   10.784 1.00 0.00 ? 276 HIS A HE2  2  
ATOM 2267  N N    . LYS A 1 75 ? 4.864   6.066   9.515  1.00 0.00 ? 277 LYS A N    2  
ATOM 2268  C CA   . LYS A 1 75 ? 4.693   4.889   10.358 1.00 0.00 ? 277 LYS A CA   2  
ATOM 2269  C C    . LYS A 1 75 ? 5.273   3.652   9.686  1.00 0.00 ? 277 LYS A C    2  
ATOM 2270  O O    . LYS A 1 75 ? 5.570   2.657   10.346 1.00 0.00 ? 277 LYS A O    2  
ATOM 2271  C CB   . LYS A 1 75 ? 3.211   4.658   10.664 1.00 0.00 ? 277 LYS A CB   2  
ATOM 2272  C CG   . LYS A 1 75 ? 2.678   5.522   11.793 1.00 0.00 ? 277 LYS A CG   2  
ATOM 2273  C CD   . LYS A 1 75 ? 2.228   4.677   12.974 1.00 0.00 ? 277 LYS A CD   2  
ATOM 2274  C CE   . LYS A 1 75 ? 3.404   4.266   13.847 1.00 0.00 ? 277 LYS A CE   2  
ATOM 2275  N NZ   . LYS A 1 75 ? 3.945   5.414   14.627 1.00 0.00 ? 277 LYS A NZ   2  
ATOM 2276  H H    . LYS A 1 75 ? 4.104   6.398   8.995  1.00 0.00 ? 277 LYS A H    2  
ATOM 2277  H HA   . LYS A 1 75 ? 5.221   5.064   11.285 1.00 0.00 ? 277 LYS A HA   2  
ATOM 2278  H HB2  . LYS A 1 75 ? 2.637   4.870   9.774  1.00 0.00 ? 277 LYS A HB2  2  
ATOM 2279  H HB3  . LYS A 1 75 ? 3.071   3.622   10.933 1.00 0.00 ? 277 LYS A HB3  2  
ATOM 2280  H HG2  . LYS A 1 75 ? 3.456   6.196   12.119 1.00 0.00 ? 277 LYS A HG2  2  
ATOM 2281  H HG3  . LYS A 1 75 ? 1.834   6.090   11.428 1.00 0.00 ? 277 LYS A HG3  2  
ATOM 2282  H HD2  . LYS A 1 75 ? 1.535   5.249   13.570 1.00 0.00 ? 277 LYS A HD2  2  
ATOM 2283  H HD3  . LYS A 1 75 ? 1.741   3.787   12.601 1.00 0.00 ? 277 LYS A HD3  2  
ATOM 2284  H HE2  . LYS A 1 75 ? 3.074   3.502   14.535 1.00 0.00 ? 277 LYS A HE2  2  
ATOM 2285  H HE3  . LYS A 1 75 ? 4.184   3.869   13.216 1.00 0.00 ? 277 LYS A HE3  2  
ATOM 2286  H HZ1  . LYS A 1 75 ? 4.096   6.232   14.000 1.00 0.00 ? 277 LYS A HZ1  2  
ATOM 2287  H HZ2  . LYS A 1 75 ? 4.852   5.153   15.063 1.00 0.00 ? 277 LYS A HZ2  2  
ATOM 2288  H HZ3  . LYS A 1 75 ? 3.278   5.685   15.376 1.00 0.00 ? 277 LYS A HZ3  2  
ATOM 2289  N N    . VAL A 1 76 ? 5.437   3.722   8.370  1.00 0.00 ? 278 VAL A N    2  
ATOM 2290  C CA   . VAL A 1 76 ? 5.984   2.606   7.615  1.00 0.00 ? 278 VAL A CA   2  
ATOM 2291  C C    . VAL A 1 76 ? 7.477   2.782   7.373  1.00 0.00 ? 278 VAL A C    2  
ATOM 2292  O O    . VAL A 1 76 ? 7.957   3.896   7.163  1.00 0.00 ? 278 VAL A O    2  
ATOM 2293  C CB   . VAL A 1 76 ? 5.273   2.429   6.262  1.00 0.00 ? 278 VAL A CB   2  
ATOM 2294  C CG1  . VAL A 1 76 ? 5.705   1.132   5.603  1.00 0.00 ? 278 VAL A CG1  2  
ATOM 2295  C CG2  . VAL A 1 76 ? 3.763   2.460   6.438  1.00 0.00 ? 278 VAL A CG2  2  
ATOM 2296  H H    . VAL A 1 76 ? 5.181   4.542   7.897  1.00 0.00 ? 278 VAL A H    2  
ATOM 2297  H HA   . VAL A 1 76 ? 5.832   1.710   8.196  1.00 0.00 ? 278 VAL A HA   2  
ATOM 2298  H HB   . VAL A 1 76 ? 5.557   3.247   5.617  1.00 0.00 ? 278 VAL A HB   2  
ATOM 2299  H HG11 . VAL A 1 76 ? 6.548   1.318   4.957  1.00 0.00 ? 278 VAL A HG11 2  
ATOM 2300  H HG12 . VAL A 1 76 ? 5.985   0.417   6.363  1.00 0.00 ? 278 VAL A HG12 2  
ATOM 2301  H HG13 . VAL A 1 76 ? 4.885   0.735   5.021  1.00 0.00 ? 278 VAL A HG13 2  
ATOM 2302  H HG21 . VAL A 1 76 ? 3.333   1.568   6.007  1.00 0.00 ? 278 VAL A HG21 2  
ATOM 2303  H HG22 . VAL A 1 76 ? 3.524   2.503   7.490  1.00 0.00 ? 278 VAL A HG22 2  
ATOM 2304  H HG23 . VAL A 1 76 ? 3.362   3.329   5.940  1.00 0.00 ? 278 VAL A HG23 2  
ATOM 2305  N N    . THR A 1 77 ? 8.205   1.673   7.405  1.00 0.00 ? 279 THR A N    2  
ATOM 2306  C CA   . THR A 1 77 ? 9.645   1.697   7.191  1.00 0.00 ? 279 THR A CA   2  
ATOM 2307  C C    . THR A 1 77 ? 10.095  0.481   6.388  1.00 0.00 ? 279 THR A C    2  
ATOM 2308  O O    . THR A 1 77 ? 9.587   -0.623  6.580  1.00 0.00 ? 279 THR A O    2  
ATOM 2309  C CB   . THR A 1 77 ? 10.379  1.737   8.533  1.00 0.00 ? 279 THR A CB   2  
ATOM 2310  O OG1  . THR A 1 77 ? 9.504   2.142   9.572  1.00 0.00 ? 279 THR A OG1  2  
ATOM 2311  C CG2  . THR A 1 77 ? 11.564  2.677   8.540  1.00 0.00 ? 279 THR A CG2  2  
ATOM 2312  H H    . THR A 1 77 ? 7.763   0.816   7.578  1.00 0.00 ? 279 THR A H    2  
ATOM 2313  H HA   . THR A 1 77 ? 9.884   2.590   6.633  1.00 0.00 ? 279 THR A HA   2  
ATOM 2314  H HB   . THR A 1 77 ? 10.741  0.745   8.763  1.00 0.00 ? 279 THR A HB   2  
ATOM 2315  H HG1  . THR A 1 77 ? 9.095   2.979   9.337  1.00 0.00 ? 279 THR A HG1  2  
ATOM 2316  H HG21 . THR A 1 77 ? 11.396  3.461   9.262  1.00 0.00 ? 279 THR A HG21 2  
ATOM 2317  H HG22 . THR A 1 77 ? 11.684  3.110   7.558  1.00 0.00 ? 279 THR A HG22 2  
ATOM 2318  H HG23 . THR A 1 77 ? 12.456  2.129   8.804  1.00 0.00 ? 279 THR A HG23 2  
ATOM 2319  N N    . LYS A 1 78 ? 11.052  0.690   5.491  1.00 0.00 ? 280 LYS A N    2  
ATOM 2320  C CA   . LYS A 1 78 ? 11.568  -0.393  4.663  1.00 0.00 ? 280 LYS A CA   2  
ATOM 2321  C C    . LYS A 1 78 ? 12.283  -1.435  5.517  1.00 0.00 ? 280 LYS A C    2  
ATOM 2322  O O    . LYS A 1 78 ? 13.155  -1.103  6.320  1.00 0.00 ? 280 LYS A O    2  
ATOM 2323  C CB   . LYS A 1 78 ? 12.519  0.158   3.597  1.00 0.00 ? 280 LYS A CB   2  
ATOM 2324  C CG   . LYS A 1 78 ? 11.978  0.039   2.180  1.00 0.00 ? 280 LYS A CG   2  
ATOM 2325  C CD   . LYS A 1 78 ? 13.045  -0.453  1.212  1.00 0.00 ? 280 LYS A CD   2  
ATOM 2326  C CE   . LYS A 1 78 ? 12.524  -1.579  0.330  1.00 0.00 ? 280 LYS A CE   2  
ATOM 2327  N NZ   . LYS A 1 78 ? 12.832  -1.344  -1.109 1.00 0.00 ? 280 LYS A NZ   2  
ATOM 2328  H H    . LYS A 1 78 ? 11.420  1.591   5.385  1.00 0.00 ? 280 LYS A H    2  
ATOM 2329  H HA   . LYS A 1 78 ? 10.729  -0.862  4.174  1.00 0.00 ? 280 LYS A HA   2  
ATOM 2330  H HB2  . LYS A 1 78 ? 12.703  1.204   3.802  1.00 0.00 ? 280 LYS A HB2  2  
ATOM 2331  H HB3  . LYS A 1 78 ? 13.454  -0.379  3.651  1.00 0.00 ? 280 LYS A HB3  2  
ATOM 2332  H HG2  . LYS A 1 78 ? 11.155  -0.660  2.177  1.00 0.00 ? 280 LYS A HG2  2  
ATOM 2333  H HG3  . LYS A 1 78 ? 11.630  1.008   1.856  1.00 0.00 ? 280 LYS A HG3  2  
ATOM 2334  H HD2  . LYS A 1 78 ? 13.351  0.369   0.582  1.00 0.00 ? 280 LYS A HD2  2  
ATOM 2335  H HD3  . LYS A 1 78 ? 13.893  -0.812  1.775  1.00 0.00 ? 280 LYS A HD3  2  
ATOM 2336  H HE2  . LYS A 1 78 ? 12.987  -2.504  0.640  1.00 0.00 ? 280 LYS A HE2  2  
ATOM 2337  H HE3  . LYS A 1 78 ? 11.454  -1.652  0.454  1.00 0.00 ? 280 LYS A HE3  2  
ATOM 2338  H HZ1  . LYS A 1 78 ? 13.825  -1.584  -1.305 1.00 0.00 ? 280 LYS A HZ1  2  
ATOM 2339  H HZ2  . LYS A 1 78 ? 12.674  -0.344  -1.349 1.00 0.00 ? 280 LYS A HZ2  2  
ATOM 2340  H HZ3  . LYS A 1 78 ? 12.219  -1.933  -1.706 1.00 0.00 ? 280 LYS A HZ3  2  
ATOM 2341  N N    . ILE A 1 79 ? 11.907  -2.697  5.337  1.00 0.00 ? 281 ILE A N    2  
ATOM 2342  C CA   . ILE A 1 79 ? 12.513  -3.789  6.088  1.00 0.00 ? 281 ILE A CA   2  
ATOM 2343  C C    . ILE A 1 79 ? 13.935  -4.066  5.607  1.00 0.00 ? 281 ILE A C    2  
ATOM 2344  O O    . ILE A 1 79 ? 14.756  -4.606  6.348  1.00 0.00 ? 281 ILE A O    2  
ATOM 2345  C CB   . ILE A 1 79 ? 11.673  -5.078  5.974  1.00 0.00 ? 281 ILE A CB   2  
ATOM 2346  C CG1  . ILE A 1 79 ? 12.285  -6.196  6.821  1.00 0.00 ? 281 ILE A CG1  2  
ATOM 2347  C CG2  . ILE A 1 79 ? 11.556  -5.510  4.520  1.00 0.00 ? 281 ILE A CG2  2  
ATOM 2348  C CD1  . ILE A 1 79 ? 11.278  -7.229  7.275  1.00 0.00 ? 281 ILE A CD1  2  
ATOM 2349  H H    . ILE A 1 79 ? 11.208  -2.897  4.680  1.00 0.00 ? 281 ILE A H    2  
ATOM 2350  H HA   . ILE A 1 79 ? 12.546  -3.498  7.129  1.00 0.00 ? 281 ILE A HA   2  
ATOM 2351  H HB   . ILE A 1 79 ? 10.681  -4.865  6.339  1.00 0.00 ? 281 ILE A HB   2  
ATOM 2352  H HG12 . ILE A 1 79 ? 13.042  -6.703  6.242  1.00 0.00 ? 281 ILE A HG12 2  
ATOM 2353  H HG13 . ILE A 1 79 ? 12.740  -5.763  7.701  1.00 0.00 ? 281 ILE A HG13 2  
ATOM 2354  H HG21 . ILE A 1 79 ? 12.462  -5.249  3.992  1.00 0.00 ? 281 ILE A HG21 2  
ATOM 2355  H HG22 . ILE A 1 79 ? 11.409  -6.578  4.472  1.00 0.00 ? 281 ILE A HG22 2  
ATOM 2356  H HG23 . ILE A 1 79 ? 10.716  -5.010  4.063  1.00 0.00 ? 281 ILE A HG23 2  
ATOM 2357  H HD11 . ILE A 1 79 ? 11.213  -8.016  6.538  1.00 0.00 ? 281 ILE A HD11 2  
ATOM 2358  H HD12 . ILE A 1 79 ? 11.593  -7.646  8.220  1.00 0.00 ? 281 ILE A HD12 2  
ATOM 2359  H HD13 . ILE A 1 79 ? 10.311  -6.763  7.391  1.00 0.00 ? 281 ILE A HD13 2  
ATOM 2360  N N    . GLY A 1 80 ? 14.221  -3.690  4.364  1.00 0.00 ? 282 GLY A N    2  
ATOM 2361  C CA   . GLY A 1 80 ? 15.544  -3.906  3.808  1.00 0.00 ? 282 GLY A CA   2  
ATOM 2362  C C    . GLY A 1 80 ? 16.113  -2.655  3.168  1.00 0.00 ? 282 GLY A C    2  
ATOM 2363  O O    . GLY A 1 80 ? 16.515  -2.674  2.005  1.00 0.00 ? 282 GLY A O    2  
ATOM 2364  H H    . GLY A 1 80 ? 13.527  -3.263  3.819  1.00 0.00 ? 282 GLY A H    2  
ATOM 2365  H HA2  . GLY A 1 80 ? 16.207  -4.225  4.600  1.00 0.00 ? 282 GLY A HA2  2  
ATOM 2366  H HA3  . GLY A 1 80 ? 15.488  -4.685  3.064  1.00 0.00 ? 282 GLY A HA3  2  
ATOM 2367  N N    . PHE A 1 81 ? 16.146  -1.564  3.928  1.00 0.00 ? 283 PHE A N    2  
ATOM 2368  C CA   . PHE A 1 81 ? 16.668  -0.298  3.426  1.00 0.00 ? 283 PHE A CA   2  
ATOM 2369  C C    . PHE A 1 81 ? 18.187  -0.236  3.582  1.00 0.00 ? 283 PHE A C    2  
ATOM 2370  O O    . PHE A 1 81 ? 18.732  -0.677  4.593  1.00 0.00 ? 283 PHE A O    2  
ATOM 2371  C CB   . PHE A 1 81 ? 16.020  0.873   4.169  1.00 0.00 ? 283 PHE A CB   2  
ATOM 2372  C CG   . PHE A 1 81 ? 15.942  2.131   3.352  1.00 0.00 ? 283 PHE A CG   2  
ATOM 2373  C CD1  . PHE A 1 81 ? 14.978  2.275   2.368  1.00 0.00 ? 283 PHE A CD1  2  
ATOM 2374  C CD2  . PHE A 1 81 ? 16.833  3.171   3.571  1.00 0.00 ? 283 PHE A CD2  2  
ATOM 2375  C CE1  . PHE A 1 81 ? 14.903  3.432   1.616  1.00 0.00 ? 283 PHE A CE1  2  
ATOM 2376  C CE2  . PHE A 1 81 ? 16.762  4.330   2.821  1.00 0.00 ? 283 PHE A CE2  2  
ATOM 2377  C CZ   . PHE A 1 81 ? 15.797  4.461   1.843  1.00 0.00 ? 283 PHE A CZ   2  
ATOM 2378  H H    . PHE A 1 81 ? 15.810  -1.613  4.846  1.00 0.00 ? 283 PHE A H    2  
ATOM 2379  H HA   . PHE A 1 81 ? 16.420  -0.230  2.378  1.00 0.00 ? 283 PHE A HA   2  
ATOM 2380  H HB2  . PHE A 1 81 ? 15.015  0.599   4.452  1.00 0.00 ? 283 PHE A HB2  2  
ATOM 2381  H HB3  . PHE A 1 81 ? 16.595  1.087   5.058  1.00 0.00 ? 283 PHE A HB3  2  
ATOM 2382  H HD1  . PHE A 1 81 ? 14.279  1.472   2.190  1.00 0.00 ? 283 PHE A HD1  2  
ATOM 2383  H HD2  . PHE A 1 81 ? 17.588  3.069   4.336  1.00 0.00 ? 283 PHE A HD2  2  
ATOM 2384  H HE1  . PHE A 1 81 ? 14.148  3.532   0.851  1.00 0.00 ? 283 PHE A HE1  2  
ATOM 2385  H HE2  . PHE A 1 81 ? 17.464  5.133   3.001  1.00 0.00 ? 283 PHE A HE2  2  
ATOM 2386  H HZ   . PHE A 1 81 ? 15.740  5.366   1.256  1.00 0.00 ? 283 PHE A HZ   2  
ATOM 2387  N N    . GLY B 2 29 ? 1.437   1.730   24.971 1.00 0.00 ? 444 GLY B N    2  
ATOM 2388  C CA   . GLY B 2 29 ? 1.027   2.538   23.836 1.00 0.00 ? 444 GLY B CA   2  
ATOM 2389  C C    . GLY B 2 29 ? 1.726   3.883   23.797 1.00 0.00 ? 444 GLY B C    2  
ATOM 2390  O O    . GLY B 2 29 ? 1.835   4.563   24.817 1.00 0.00 ? 444 GLY B O    2  
ATOM 2391  H HA2  . GLY B 2 29 ? 1.251   2.001   22.926 1.00 0.00 ? 444 GLY B HA2  2  
ATOM 2392  H HA3  . GLY B 2 29 ? -0.040  2.700   23.891 1.00 0.00 ? 444 GLY B HA3  2  
ATOM 2393  N N    . GLU B 2 30 ? 2.200   4.266   22.617 1.00 0.00 ? 445 GLU B N    2  
ATOM 2394  C CA   . GLU B 2 30 ? 2.893   5.538   22.446 1.00 0.00 ? 445 GLU B CA   2  
ATOM 2395  C C    . GLU B 2 30 ? 2.792   6.023   21.004 1.00 0.00 ? 445 GLU B C    2  
ATOM 2396  O O    . GLU B 2 30 ? 2.459   7.182   20.750 1.00 0.00 ? 445 GLU B O    2  
ATOM 2397  C CB   . GLU B 2 30 ? 4.362   5.400   22.850 1.00 0.00 ? 445 GLU B CB   2  
ATOM 2398  C CG   . GLU B 2 30 ? 4.617   5.676   24.323 1.00 0.00 ? 445 GLU B CG   2  
ATOM 2399  C CD   . GLU B 2 30 ? 6.080   5.540   24.696 1.00 0.00 ? 445 GLU B CD   2  
ATOM 2400  O OE1  . GLU B 2 30 ? 6.837   6.512   24.490 1.00 0.00 ? 445 GLU B OE1  2  
ATOM 2401  O OE2  . GLU B 2 30 ? 6.469   4.464   25.196 1.00 0.00 ? 445 GLU B OE2  2  
ATOM 2402  H H    . GLU B 2 30 ? 2.081   3.680   21.840 1.00 0.00 ? 445 GLU B H    2  
ATOM 2403  H HA   . GLU B 2 30 ? 2.418   6.262   23.092 1.00 0.00 ? 445 GLU B HA   2  
ATOM 2404  H HB2  . GLU B 2 30 ? 4.692   4.396   22.631 1.00 0.00 ? 445 GLU B HB2  2  
ATOM 2405  H HB3  . GLU B 2 30 ? 4.949   6.098   22.269 1.00 0.00 ? 445 GLU B HB3  2  
ATOM 2406  H HG2  . GLU B 2 30 ? 4.295   6.679   24.551 1.00 0.00 ? 445 GLU B HG2  2  
ATOM 2407  H HG3  . GLU B 2 30 ? 4.045   4.972   24.911 1.00 0.00 ? 445 GLU B HG3  2  
ATOM 2408  N N    . GLU B 2 31 ? 3.082   5.130   20.064 1.00 0.00 ? 446 GLU B N    2  
ATOM 2409  C CA   . GLU B 2 31 ? 3.023   5.467   18.646 1.00 0.00 ? 446 GLU B CA   2  
ATOM 2410  C C    . GLU B 2 31 ? 2.287   4.385   17.862 1.00 0.00 ? 446 GLU B C    2  
ATOM 2411  O O    . GLU B 2 31 ? 2.593   4.133   16.696 1.00 0.00 ? 446 GLU B O    2  
ATOM 2412  C CB   . GLU B 2 31 ? 4.434   5.651   18.086 1.00 0.00 ? 446 GLU B CB   2  
ATOM 2413  C CG   . GLU B 2 31 ? 5.026   7.022   18.367 1.00 0.00 ? 446 GLU B CG   2  
ATOM 2414  C CD   . GLU B 2 31 ? 6.035   7.000   19.500 1.00 0.00 ? 446 GLU B CD   2  
ATOM 2415  O OE1  . GLU B 2 31 ? 6.015   6.037   20.294 1.00 0.00 ? 446 GLU B OE1  2  
ATOM 2416  O OE2  . GLU B 2 31 ? 6.847   7.945   19.589 1.00 0.00 ? 446 GLU B OE2  2  
ATOM 2417  H H    . GLU B 2 31 ? 3.340   4.224   20.329 1.00 0.00 ? 446 GLU B H    2  
ATOM 2418  H HA   . GLU B 2 31 ? 2.481   6.396   18.548 1.00 0.00 ? 446 GLU B HA   2  
ATOM 2419  H HB2  . GLU B 2 31 ? 5.082   4.906   18.521 1.00 0.00 ? 446 GLU B HB2  2  
ATOM 2420  H HB3  . GLU B 2 31 ? 4.405   5.509   17.015 1.00 0.00 ? 446 GLU B HB3  2  
ATOM 2421  H HG2  . GLU B 2 31 ? 5.518   7.379   17.475 1.00 0.00 ? 446 GLU B HG2  2  
ATOM 2422  H HG3  . GLU B 2 31 ? 4.226   7.699   18.631 1.00 0.00 ? 446 GLU B HG3  2  
ATOM 2423  N N    . GLU B 2 32 ? 1.319   3.748   18.512 1.00 0.00 ? 447 GLU B N    2  
ATOM 2424  C CA   . GLU B 2 32 ? 0.537   2.691   17.879 1.00 0.00 ? 447 GLU B CA   2  
ATOM 2425  C C    . GLU B 2 32 ? -0.918  3.116   17.715 1.00 0.00 ? 447 GLU B C    2  
ATOM 2426  O O    . GLU B 2 32 ? -1.375  4.062   18.359 1.00 0.00 ? 447 GLU B O    2  
ATOM 2427  C CB   . GLU B 2 32 ? 0.617   1.404   18.702 1.00 0.00 ? 447 GLU B CB   2  
ATOM 2428  C CG   . GLU B 2 32 ? 2.026   1.064   19.163 1.00 0.00 ? 447 GLU B CG   2  
ATOM 2429  C CD   . GLU B 2 32 ? 2.039   0.107   20.339 1.00 0.00 ? 447 GLU B CD   2  
ATOM 2430  O OE1  . GLU B 2 32 ? 1.040   0.071   21.086 1.00 0.00 ? 447 GLU B OE1  2  
ATOM 2431  O OE2  . GLU B 2 32 ? 3.049   -0.606  20.512 1.00 0.00 ? 447 GLU B OE2  2  
ATOM 2432  H H    . GLU B 2 32 ? 1.124   3.995   19.440 1.00 0.00 ? 447 GLU B H    2  
ATOM 2433  H HA   . GLU B 2 32 ? 0.958   2.509   16.901 1.00 0.00 ? 447 GLU B HA   2  
ATOM 2434  H HB2  . GLU B 2 32 ? -0.008  1.510   19.576 1.00 0.00 ? 447 GLU B HB2  2  
ATOM 2435  H HB3  . GLU B 2 32 ? 0.249   0.584   18.104 1.00 0.00 ? 447 GLU B HB3  2  
ATOM 2436  H HG2  . GLU B 2 32 ? 2.559   0.608   18.342 1.00 0.00 ? 447 GLU B HG2  2  
ATOM 2437  H HG3  . GLU B 2 32 ? 2.527   1.976   19.454 1.00 0.00 ? 447 GLU B HG3  2  
ATOM 2438  N N    . GLY B 2 33 ? -1.643  2.412   16.852 1.00 0.00 ? 448 GLY B N    2  
ATOM 2439  C CA   . GLY B 2 33 ? -3.039  2.733   16.621 1.00 0.00 ? 448 GLY B CA   2  
ATOM 2440  C C    . GLY B 2 33 ? -3.233  3.699   15.467 1.00 0.00 ? 448 GLY B C    2  
ATOM 2441  O O    . GLY B 2 33 ? -4.297  4.302   15.328 1.00 0.00 ? 448 GLY B O    2  
ATOM 2442  H H    . GLY B 2 33 ? -1.228  1.667   16.368 1.00 0.00 ? 448 GLY B H    2  
ATOM 2443  H HA2  . GLY B 2 33 ? -3.575  1.820   16.405 1.00 0.00 ? 448 GLY B HA2  2  
ATOM 2444  H HA3  . GLY B 2 33 ? -3.448  3.174   17.517 1.00 0.00 ? 448 GLY B HA3  2  
ATOM 2445  N N    . GLU B 2 34 ? -2.205  3.848   14.637 1.00 0.00 ? 449 GLU B N    2  
ATOM 2446  C CA   . GLU B 2 34 ? -2.269  4.749   13.493 1.00 0.00 ? 449 GLU B CA   2  
ATOM 2447  C C    . GLU B 2 34 ? -2.400  3.968   12.194 1.00 0.00 ? 449 GLU B C    2  
ATOM 2448  O O    . GLU B 2 34 ? -1.943  4.418   11.147 1.00 0.00 ? 449 GLU B O    2  
ATOM 2449  C CB   . GLU B 2 34 ? -1.022  5.630   13.429 1.00 0.00 ? 449 GLU B CB   2  
ATOM 2450  C CG   . GLU B 2 34 ? -0.474  6.022   14.794 1.00 0.00 ? 449 GLU B CG   2  
ATOM 2451  C CD   . GLU B 2 34 ? 0.199   7.381   14.784 1.00 0.00 ? 449 GLU B CD   2  
ATOM 2452  O OE1  . GLU B 2 34 ? -0.331  8.300   14.125 1.00 0.00 ? 449 GLU B OE1  2  
ATOM 2453  O OE2  . GLU B 2 34 ? 1.255   7.526   15.436 1.00 0.00 ? 449 GLU B OE2  2  
ATOM 2454  H H    . GLU B 2 34 ? -1.383  3.341   14.801 1.00 0.00 ? 449 GLU B H    2  
ATOM 2455  H HA   . GLU B 2 34 ? -3.140  5.378   13.612 1.00 0.00 ? 449 GLU B HA   2  
ATOM 2456  H HB2  . GLU B 2 34 ? -0.250  5.097   12.890 1.00 0.00 ? 449 GLU B HB2  2  
ATOM 2457  H HB3  . GLU B 2 34 ? -1.263  6.534   12.890 1.00 0.00 ? 449 GLU B HB3  2  
ATOM 2458  H HG2  . GLU B 2 34 ? -1.290  6.046   15.501 1.00 0.00 ? 449 GLU B HG2  2  
ATOM 2459  H HG3  . GLU B 2 34 ? 0.248   5.280   15.103 1.00 0.00 ? 449 GLU B HG3  2  
ATOM 2460  N N    . GLU B 2 35 ? -3.017  2.797   12.261 1.00 0.00 ? 450 GLU B N    2  
ATOM 2461  C CA   . GLU B 2 35 ? -3.187  1.973   11.073 1.00 0.00 ? 450 GLU B CA   2  
ATOM 2462  C C    . GLU B 2 35 ? -4.546  1.280   11.072 1.00 0.00 ? 450 GLU B C    2  
ATOM 2463  O O    . GLU B 2 35 ? -5.142  1.052   12.125 1.00 0.00 ? 450 GLU B O    2  
ATOM 2464  C CB   . GLU B 2 35 ? -2.054  0.946   10.972 1.00 0.00 ? 450 GLU B CB   2  
ATOM 2465  C CG   . GLU B 2 35 ? -2.239  -0.272  11.863 1.00 0.00 ? 450 GLU B CG   2  
ATOM 2466  C CD   . GLU B 2 35 ? -0.970  -0.656  12.598 1.00 0.00 ? 450 GLU B CD   2  
ATOM 2467  O OE1  . GLU B 2 35 ? -0.683  -0.044  13.647 1.00 0.00 ? 450 GLU B OE1  2  
ATOM 2468  O OE2  . GLU B 2 35 ? -0.262  -1.569  12.123 1.00 0.00 ? 450 GLU B OE2  2  
ATOM 2469  H H    . GLU B 2 35 ? -3.361  2.480   13.121 1.00 0.00 ? 450 GLU B H    2  
ATOM 2470  H HA   . GLU B 2 35 ? -3.136  2.628   10.219 1.00 0.00 ? 450 GLU B HA   2  
ATOM 2471  H HB2  . GLU B 2 35 ? -1.982  0.611   9.948  1.00 0.00 ? 450 GLU B HB2  2  
ATOM 2472  H HB3  . GLU B 2 35 ? -1.126  1.429   11.247 1.00 0.00 ? 450 GLU B HB3  2  
ATOM 2473  H HG2  . GLU B 2 35 ? -3.007  -0.057  12.592 1.00 0.00 ? 450 GLU B HG2  2  
ATOM 2474  H HG3  . GLU B 2 35 ? -2.549  -1.106  11.249 1.00 0.00 ? 450 GLU B HG3  2  
ATOM 2475  N N    . TYR B 2 36 ? -5.031  0.949   9.878  1.00 0.00 ? 451 TYR B N    2  
ATOM 2476  C CA   . TYR B 2 36 ? -6.321  0.285   9.733  1.00 0.00 ? 451 TYR B CA   2  
ATOM 2477  C C    . TYR B 2 36 ? -6.246  -0.828  8.694  1.00 0.00 ? 451 TYR B C    2  
ATOM 2478  O O    . TYR B 2 36 ? -5.133  -1.340  8.454  1.00 0.00 ? 451 TYR B O    2  
ATOM 2479  C CB   . TYR B 2 36 ? -7.393  1.300   9.331  1.00 0.00 ? 451 TYR B CB   2  
ATOM 2480  C CG   . TYR B 2 36 ? -7.892  2.142   10.485 1.00 0.00 ? 451 TYR B CG   2  
ATOM 2481  C CD1  . TYR B 2 36 ? -7.183  3.259   10.909 1.00 0.00 ? 451 TYR B CD1  2  
ATOM 2482  C CD2  . TYR B 2 36 ? -9.069  1.820   11.147 1.00 0.00 ? 451 TYR B CD2  2  
ATOM 2483  C CE1  . TYR B 2 36 ? -7.634  4.031   11.964 1.00 0.00 ? 451 TYR B CE1  2  
ATOM 2484  C CE2  . TYR B 2 36 ? -9.527  2.589   12.201 1.00 0.00 ? 451 TYR B CE2  2  
ATOM 2485  C CZ   . TYR B 2 36 ? -8.806  3.692   12.605 1.00 0.00 ? 451 TYR B CZ   2  
ATOM 2486  O OH   . TYR B 2 36 ? -9.259  4.459   13.655 1.00 0.00 ? 451 TYR B OH   2  
ATOM 2487  O OXT  . TYR B 2 36 ? -7.303  -1.177  8.129  1.00 0.00 ? 451 TYR B OXT  2  
ATOM 2488  H H    . TYR B 2 36 ? -4.508  1.160   9.076  1.00 0.00 ? 451 TYR B H    2  
ATOM 2489  H HA   . TYR B 2 36 ? -6.583  -0.145  10.688 1.00 0.00 ? 451 TYR B HA   2  
ATOM 2490  H HB2  . TYR B 2 36 ? -6.987  1.966   8.585  1.00 0.00 ? 451 TYR B HB2  2  
ATOM 2491  H HB3  . TYR B 2 36 ? -8.237  0.773   8.913  1.00 0.00 ? 451 TYR B HB3  2  
ATOM 2492  H HD1  . TYR B 2 36 ? -6.265  3.523   10.405 1.00 0.00 ? 451 TYR B HD1  2  
ATOM 2493  H HD2  . TYR B 2 36 ? -9.631  0.955   10.828 1.00 0.00 ? 451 TYR B HD2  2  
ATOM 2494  H HE1  . TYR B 2 36 ? -7.069  4.896   12.280 1.00 0.00 ? 451 TYR B HE1  2  
ATOM 2495  H HE2  . TYR B 2 36 ? -10.445 2.322   12.704 1.00 0.00 ? 451 TYR B HE2  2  
ATOM 2496  H HH   . TYR B 2 36 ? -8.520  4.692   14.223 1.00 0.00 ? 451 TYR B HH   2  
ATOM 2497  N N    . ARG A 1 8  ? 12.586  9.114   3.240  1.00 0.00 ? 210 ARG A N    3  
ATOM 2498  C CA   . ARG A 1 8  ? 11.311  9.617   3.738  1.00 0.00 ? 210 ARG A CA   3  
ATOM 2499  C C    . ARG A 1 8  ? 10.150  9.064   2.918  1.00 0.00 ? 210 ARG A C    3  
ATOM 2500  O O    . ARG A 1 8  ? 9.222   8.466   3.463  1.00 0.00 ? 210 ARG A O    3  
ATOM 2501  C CB   . ARG A 1 8  ? 11.296  11.148  3.706  1.00 0.00 ? 210 ARG A CB   3  
ATOM 2502  C CG   . ARG A 1 8  ? 10.829  11.778  5.008  1.00 0.00 ? 210 ARG A CG   3  
ATOM 2503  C CD   . ARG A 1 8  ? 11.867  11.620  6.110  1.00 0.00 ? 210 ARG A CD   3  
ATOM 2504  N NE   . ARG A 1 8  ? 11.430  10.681  7.139  1.00 0.00 ? 210 ARG A NE   3  
ATOM 2505  C CZ   . ARG A 1 8  ? 10.574  10.992  8.111  1.00 0.00 ? 210 ARG A CZ   3  
ATOM 2506  N NH1  . ARG A 1 8  ? 10.061  12.213  8.189  1.00 0.00 ? 210 ARG A NH1  3  
ATOM 2507  N NH2  . ARG A 1 8  ? 10.230  10.076  9.008  1.00 0.00 ? 210 ARG A NH2  3  
ATOM 2508  H HA   . ARG A 1 8  ? 11.204  9.288   4.760  1.00 0.00 ? 210 ARG A HA   3  
ATOM 2509  H HB2  . ARG A 1 8  ? 12.295  11.503  3.498  1.00 0.00 ? 210 ARG A HB2  3  
ATOM 2510  H HB3  . ARG A 1 8  ? 10.636  11.474  2.915  1.00 0.00 ? 210 ARG A HB3  3  
ATOM 2511  H HG2  . ARG A 1 8  ? 10.653  12.831  4.843  1.00 0.00 ? 210 ARG A HG2  3  
ATOM 2512  H HG3  . ARG A 1 8  ? 9.911   11.302  5.319  1.00 0.00 ? 210 ARG A HG3  3  
ATOM 2513  H HD2  . ARG A 1 8  ? 12.785  11.258  5.674  1.00 0.00 ? 210 ARG A HD2  3  
ATOM 2514  H HD3  . ARG A 1 8  ? 12.039  12.584  6.564  1.00 0.00 ? 210 ARG A HD3  3  
ATOM 2515  H HE   . ARG A 1 8  ? 11.794  9.771   7.107  1.00 0.00 ? 210 ARG A HE   3  
ATOM 2516  H HH11 . ARG A 1 8  ? 10.316  12.907  7.516  1.00 0.00 ? 210 ARG A HH11 3  
ATOM 2517  H HH12 . ARG A 1 8  ? 9.419   12.440  8.921  1.00 0.00 ? 210 ARG A HH12 3  
ATOM 2518  H HH21 . ARG A 1 8  ? 10.614  9.155   8.954  1.00 0.00 ? 210 ARG A HH21 3  
ATOM 2519  H HH22 . ARG A 1 8  ? 9.588   10.309  9.738  1.00 0.00 ? 210 ARG A HH22 3  
ATOM 2520  N N    . GLU A 1 9  ? 10.210  9.269   1.607  1.00 0.00 ? 211 GLU A N    3  
ATOM 2521  C CA   . GLU A 1 9  ? 9.163   8.791   0.711  1.00 0.00 ? 211 GLU A CA   3  
ATOM 2522  C C    . GLU A 1 9  ? 9.319   7.297   0.441  1.00 0.00 ? 211 GLU A C    3  
ATOM 2523  O O    . GLU A 1 9  ? 10.416  6.750   0.543  1.00 0.00 ? 211 GLU A O    3  
ATOM 2524  C CB   . GLU A 1 9  ? 9.196   9.565   -0.606 1.00 0.00 ? 211 GLU A CB   3  
ATOM 2525  C CG   . GLU A 1 9  ? 8.906   11.049  -0.448 1.00 0.00 ? 211 GLU A CG   3  
ATOM 2526  C CD   . GLU A 1 9  ? 9.486   11.881  -1.575 1.00 0.00 ? 211 GLU A CD   3  
ATOM 2527  O OE1  . GLU A 1 9  ? 10.585  11.539  -2.061 1.00 0.00 ? 211 GLU A OE1  3  
ATOM 2528  O OE2  . GLU A 1 9  ? 8.841   12.874  -1.974 1.00 0.00 ? 211 GLU A OE2  3  
ATOM 2529  H H    . GLU A 1 9  ? 10.974  9.753   1.232  1.00 0.00 ? 211 GLU A H    3  
ATOM 2530  H HA   . GLU A 1 9  ? 8.210   8.959   1.192  1.00 0.00 ? 211 GLU A HA   3  
ATOM 2531  H HB2  . GLU A 1 9  ? 10.175  9.458   -1.049 1.00 0.00 ? 211 GLU A HB2  3  
ATOM 2532  H HB3  . GLU A 1 9  ? 8.460   9.147   -1.277 1.00 0.00 ? 211 GLU A HB3  3  
ATOM 2533  H HG2  . GLU A 1 9  ? 7.836   11.195  -0.428 1.00 0.00 ? 211 GLU A HG2  3  
ATOM 2534  H HG3  . GLU A 1 9  ? 9.332   11.389  0.485  1.00 0.00 ? 211 GLU A HG3  3  
ATOM 2535  N N    . LEU A 1 10 ? 8.214   6.646   0.090  1.00 0.00 ? 212 LEU A N    3  
ATOM 2536  C CA   . LEU A 1 10 ? 8.229   5.216   -0.196 1.00 0.00 ? 212 LEU A CA   3  
ATOM 2537  C C    . LEU A 1 10 ? 7.725   4.941   -1.610 1.00 0.00 ? 212 LEU A C    3  
ATOM 2538  O O    . LEU A 1 10 ? 6.923   5.699   -2.153 1.00 0.00 ? 212 LEU A O    3  
ATOM 2539  C CB   . LEU A 1 10 ? 7.370   4.461   0.819  1.00 0.00 ? 212 LEU A CB   3  
ATOM 2540  C CG   . LEU A 1 10 ? 8.019   4.254   2.189  1.00 0.00 ? 212 LEU A CG   3  
ATOM 2541  C CD1  . LEU A 1 10 ? 6.977   3.840   3.216  1.00 0.00 ? 212 LEU A CD1  3  
ATOM 2542  C CD2  . LEU A 1 10 ? 9.126   3.214   2.100  1.00 0.00 ? 212 LEU A CD2  3  
ATOM 2543  H H    . LEU A 1 10 ? 7.369   7.138   0.025  1.00 0.00 ? 212 LEU A H    3  
ATOM 2544  H HA   . LEU A 1 10 ? 9.250   4.872   -0.118 1.00 0.00 ? 212 LEU A HA   3  
ATOM 2545  H HB2  . LEU A 1 10 ? 6.450   5.010   0.959  1.00 0.00 ? 212 LEU A HB2  3  
ATOM 2546  H HB3  . LEU A 1 10 ? 7.132   3.491   0.409  1.00 0.00 ? 212 LEU A HB3  3  
ATOM 2547  H HG   . LEU A 1 10 ? 8.459   5.185   2.516  1.00 0.00 ? 212 LEU A HG   3  
ATOM 2548  H HD11 . LEU A 1 10 ? 6.759   2.788   3.103  1.00 0.00 ? 212 LEU A HD11 3  
ATOM 2549  H HD12 . LEU A 1 10 ? 7.358   4.024   4.210  1.00 0.00 ? 212 LEU A HD12 3  
ATOM 2550  H HD13 . LEU A 1 10 ? 6.075   4.413   3.065  1.00 0.00 ? 212 LEU A HD13 3  
ATOM 2551  H HD21 . LEU A 1 10 ? 9.819   3.491   1.320  1.00 0.00 ? 212 LEU A HD21 3  
ATOM 2552  H HD22 . LEU A 1 10 ? 9.649   3.163   3.044  1.00 0.00 ? 212 LEU A HD22 3  
ATOM 2553  H HD23 . LEU A 1 10 ? 8.696   2.249   1.874  1.00 0.00 ? 212 LEU A HD23 3  
ATOM 2554  N N    . LYS A 1 11 ? 8.203   3.850   -2.200 1.00 0.00 ? 213 LYS A N    3  
ATOM 2555  C CA   . LYS A 1 11 ? 7.800   3.473   -3.550 1.00 0.00 ? 213 LYS A CA   3  
ATOM 2556  C C    . LYS A 1 11 ? 6.925   2.224   -3.529 1.00 0.00 ? 213 LYS A C    3  
ATOM 2557  O O    . LYS A 1 11 ? 7.161   1.302   -2.749 1.00 0.00 ? 213 LYS A O    3  
ATOM 2558  C CB   . LYS A 1 11 ? 9.035   3.232   -4.423 1.00 0.00 ? 213 LYS A CB   3  
ATOM 2559  C CG   . LYS A 1 11 ? 10.083  4.326   -4.310 1.00 0.00 ? 213 LYS A CG   3  
ATOM 2560  C CD   . LYS A 1 11 ? 11.195  3.937   -3.350 1.00 0.00 ? 213 LYS A CD   3  
ATOM 2561  C CE   . LYS A 1 11 ? 12.230  3.051   -4.026 1.00 0.00 ? 213 LYS A CE   3  
ATOM 2562  N NZ   . LYS A 1 11 ? 12.804  3.693   -5.239 1.00 0.00 ? 213 LYS A NZ   3  
ATOM 2563  H H    . LYS A 1 11 ? 8.839   3.285   -1.716 1.00 0.00 ? 213 LYS A H    3  
ATOM 2564  H HA   . LYS A 1 11 ? 7.232   4.291   -3.967 1.00 0.00 ? 213 LYS A HA   3  
ATOM 2565  H HB2  . LYS A 1 11 ? 9.489   2.295   -4.132 1.00 0.00 ? 213 LYS A HB2  3  
ATOM 2566  H HB3  . LYS A 1 11 ? 8.723   3.164   -5.455 1.00 0.00 ? 213 LYS A HB3  3  
ATOM 2567  H HG2  . LYS A 1 11 ? 10.510  4.504   -5.286 1.00 0.00 ? 213 LYS A HG2  3  
ATOM 2568  H HG3  . LYS A 1 11 ? 9.610   5.229   -3.953 1.00 0.00 ? 213 LYS A HG3  3  
ATOM 2569  H HD2  . LYS A 1 11 ? 11.681  4.833   -2.994 1.00 0.00 ? 213 LYS A HD2  3  
ATOM 2570  H HD3  . LYS A 1 11 ? 10.766  3.401   -2.515 1.00 0.00 ? 213 LYS A HD3  3  
ATOM 2571  H HE2  . LYS A 1 11 ? 13.027  2.852   -3.325 1.00 0.00 ? 213 LYS A HE2  3  
ATOM 2572  H HE3  . LYS A 1 11 ? 11.759  2.121   -4.308 1.00 0.00 ? 213 LYS A HE3  3  
ATOM 2573  H HZ1  . LYS A 1 11 ? 12.301  3.366   -6.089 1.00 0.00 ? 213 LYS A HZ1  3  
ATOM 2574  H HZ2  . LYS A 1 11 ? 13.811  3.452   -5.330 1.00 0.00 ? 213 LYS A HZ2  3  
ATOM 2575  H HZ3  . LYS A 1 11 ? 12.712  4.727   -5.175 1.00 0.00 ? 213 LYS A HZ3  3  
ATOM 2576  N N    . ILE A 1 12 ? 5.913   2.202   -4.390 1.00 0.00 ? 214 ILE A N    3  
ATOM 2577  C CA   . ILE A 1 12 ? 5.003   1.068   -4.470 1.00 0.00 ? 214 ILE A CA   3  
ATOM 2578  C C    . ILE A 1 12 ? 5.737   -0.197  -4.905 1.00 0.00 ? 214 ILE A C    3  
ATOM 2579  O O    . ILE A 1 12 ? 6.642   -0.145  -5.738 1.00 0.00 ? 214 ILE A O    3  
ATOM 2580  C CB   . ILE A 1 12 ? 3.844   1.343   -5.449 1.00 0.00 ? 214 ILE A CB   3  
ATOM 2581  C CG1  . ILE A 1 12 ? 3.149   2.658   -5.088 1.00 0.00 ? 214 ILE A CG1  3  
ATOM 2582  C CG2  . ILE A 1 12 ? 2.849   0.188   -5.441 1.00 0.00 ? 214 ILE A CG2  3  
ATOM 2583  C CD1  . ILE A 1 12 ? 1.961   2.978   -5.968 1.00 0.00 ? 214 ILE A CD1  3  
ATOM 2584  H H    . ILE A 1 12 ? 5.775   2.968   -4.986 1.00 0.00 ? 214 ILE A H    3  
ATOM 2585  H HA   . ILE A 1 12 ? 4.584   0.907   -3.485 1.00 0.00 ? 214 ILE A HA   3  
ATOM 2586  H HB   . ILE A 1 12 ? 4.255   1.424   -6.444 1.00 0.00 ? 214 ILE A HB   3  
ATOM 2587  H HG12 . ILE A 1 12 ? 2.799   2.605   -4.068 1.00 0.00 ? 214 ILE A HG12 3  
ATOM 2588  H HG13 . ILE A 1 12 ? 3.858   3.468   -5.178 1.00 0.00 ? 214 ILE A HG13 3  
ATOM 2589  H HG21 . ILE A 1 12 ? 3.071   -0.473  -4.616 1.00 0.00 ? 214 ILE A HG21 3  
ATOM 2590  H HG22 . ILE A 1 12 ? 1.847   0.575   -5.331 1.00 0.00 ? 214 ILE A HG22 3  
ATOM 2591  H HG23 . ILE A 1 12 ? 2.925   -0.359  -6.369 1.00 0.00 ? 214 ILE A HG23 3  
ATOM 2592  H HD11 . ILE A 1 12 ? 2.309   3.318   -6.933 1.00 0.00 ? 214 ILE A HD11 3  
ATOM 2593  H HD12 . ILE A 1 12 ? 1.358   2.091   -6.094 1.00 0.00 ? 214 ILE A HD12 3  
ATOM 2594  H HD13 . ILE A 1 12 ? 1.369   3.755   -5.505 1.00 0.00 ? 214 ILE A HD13 3  
ATOM 2595  N N    . GLY A 1 13 ? 5.343   -1.328  -4.331 1.00 0.00 ? 215 GLY A N    3  
ATOM 2596  C CA   . GLY A 1 13 ? 5.977   -2.590  -4.668 1.00 0.00 ? 215 GLY A CA   3  
ATOM 2597  C C    . GLY A 1 13 ? 7.200   -2.878  -3.816 1.00 0.00 ? 215 GLY A C    3  
ATOM 2598  O O    . GLY A 1 13 ? 7.844   -3.914  -3.978 1.00 0.00 ? 215 GLY A O    3  
ATOM 2599  H H    . GLY A 1 13 ? 4.619   -1.307  -3.671 1.00 0.00 ? 215 GLY A H    3  
ATOM 2600  H HA2  . GLY A 1 13 ? 5.261   -3.387  -4.530 1.00 0.00 ? 215 GLY A HA2  3  
ATOM 2601  H HA3  . GLY A 1 13 ? 6.274   -2.564  -5.706 1.00 0.00 ? 215 GLY A HA3  3  
ATOM 2602  N N    . ASP A 1 14 ? 7.524   -1.961  -2.908 1.00 0.00 ? 216 ASP A N    3  
ATOM 2603  C CA   . ASP A 1 14 ? 8.679   -2.125  -2.034 1.00 0.00 ? 216 ASP A CA   3  
ATOM 2604  C C    . ASP A 1 14 ? 8.277   -2.756  -0.705 1.00 0.00 ? 216 ASP A C    3  
ATOM 2605  O O    . ASP A 1 14 ? 7.181   -2.516  -0.199 1.00 0.00 ? 216 ASP A O    3  
ATOM 2606  C CB   . ASP A 1 14 ? 9.352   -0.774  -1.786 1.00 0.00 ? 216 ASP A CB   3  
ATOM 2607  C CG   . ASP A 1 14 ? 9.958   -0.189  -3.046 1.00 0.00 ? 216 ASP A CG   3  
ATOM 2608  O OD1  . ASP A 1 14 ? 9.323   -0.298  -4.116 1.00 0.00 ? 216 ASP A OD1  3  
ATOM 2609  O OD2  . ASP A 1 14 ? 11.068  0.379   -2.964 1.00 0.00 ? 216 ASP A OD2  3  
ATOM 2610  H H    . ASP A 1 14 ? 6.976   -1.152  -2.825 1.00 0.00 ? 216 ASP A H    3  
ATOM 2611  H HA   . ASP A 1 14 ? 9.379   -2.778  -2.530 1.00 0.00 ? 216 ASP A HA   3  
ATOM 2612  H HB2  . ASP A 1 14 ? 8.621   -0.079  -1.404 1.00 0.00 ? 216 ASP A HB2  3  
ATOM 2613  H HB3  . ASP A 1 14 ? 10.139  -0.900  -1.055 1.00 0.00 ? 216 ASP A HB3  3  
ATOM 2614  N N    . ARG A 1 15 ? 9.175   -3.560  -0.144 1.00 0.00 ? 217 ARG A N    3  
ATOM 2615  C CA   . ARG A 1 15 ? 8.917   -4.221  1.130  1.00 0.00 ? 217 ARG A CA   3  
ATOM 2616  C C    . ARG A 1 15 ? 9.074   -3.237  2.281  1.00 0.00 ? 217 ARG A C    3  
ATOM 2617  O O    . ARG A 1 15 ? 10.027  -2.458  2.319  1.00 0.00 ? 217 ARG A O    3  
ATOM 2618  C CB   . ARG A 1 15 ? 9.868   -5.404  1.318  1.00 0.00 ? 217 ARG A CB   3  
ATOM 2619  C CG   . ARG A 1 15 ? 9.474   -6.327  2.459  1.00 0.00 ? 217 ARG A CG   3  
ATOM 2620  C CD   . ARG A 1 15 ? 8.416   -7.328  2.025  1.00 0.00 ? 217 ARG A CD   3  
ATOM 2621  N NE   . ARG A 1 15 ? 9.007   -8.575  1.544  1.00 0.00 ? 217 ARG A NE   3  
ATOM 2622  C CZ   . ARG A 1 15 ? 8.337   -9.721  1.438  1.00 0.00 ? 217 ARG A CZ   3  
ATOM 2623  N NH1  . ARG A 1 15 ? 7.056   -9.782  1.779  1.00 0.00 ? 217 ARG A NH1  3  
ATOM 2624  N NH2  . ARG A 1 15 ? 8.950   -10.807 0.989  1.00 0.00 ? 217 ARG A NH2  3  
ATOM 2625  H H    . ARG A 1 15 ? 10.032  -3.708  -0.595 1.00 0.00 ? 217 ARG A H    3  
ATOM 2626  H HA   . ARG A 1 15 ? 7.900   -4.582  1.117  1.00 0.00 ? 217 ARG A HA   3  
ATOM 2627  H HB2  . ARG A 1 15 ? 9.890   -5.982  0.407  1.00 0.00 ? 217 ARG A HB2  3  
ATOM 2628  H HB3  . ARG A 1 15 ? 10.860  -5.025  1.517  1.00 0.00 ? 217 ARG A HB3  3  
ATOM 2629  H HG2  . ARG A 1 15 ? 10.348  -6.866  2.793  1.00 0.00 ? 217 ARG A HG2  3  
ATOM 2630  H HG3  . ARG A 1 15 ? 9.084   -5.733  3.272  1.00 0.00 ? 217 ARG A HG3  3  
ATOM 2631  H HD2  . ARG A 1 15 ? 7.777   -7.548  2.868  1.00 0.00 ? 217 ARG A HD2  3  
ATOM 2632  H HD3  . ARG A 1 15 ? 7.828   -6.889  1.233  1.00 0.00 ? 217 ARG A HD3  3  
ATOM 2633  H HE   . ARG A 1 15 ? 9.952   -8.558  1.284  1.00 0.00 ? 217 ARG A HE   3  
ATOM 2634  H HH11 . ARG A 1 15 ? 6.587   -8.966  2.118  1.00 0.00 ? 217 ARG A HH11 3  
ATOM 2635  H HH12 . ARG A 1 15 ? 6.558   -10.646 1.698  1.00 0.00 ? 217 ARG A HH12 3  
ATOM 2636  H HH21 . ARG A 1 15 ? 9.914   -10.767 0.730  1.00 0.00 ? 217 ARG A HH21 3  
ATOM 2637  H HH22 . ARG A 1 15 ? 8.447   -11.669 0.910  1.00 0.00 ? 217 ARG A HH22 3  
ATOM 2638  N N    . VAL A 1 16 ? 8.129   -3.267  3.213  1.00 0.00 ? 218 VAL A N    3  
ATOM 2639  C CA   . VAL A 1 16 ? 8.164   -2.366  4.356  1.00 0.00 ? 218 VAL A CA   3  
ATOM 2640  C C    . VAL A 1 16 ? 7.427   -2.952  5.554  1.00 0.00 ? 218 VAL A C    3  
ATOM 2641  O O    . VAL A 1 16 ? 6.940   -4.082  5.511  1.00 0.00 ? 218 VAL A O    3  
ATOM 2642  C CB   . VAL A 1 16 ? 7.531   -1.004  4.010  1.00 0.00 ? 218 VAL A CB   3  
ATOM 2643  C CG1  . VAL A 1 16 ? 8.146   -0.434  2.741  1.00 0.00 ? 218 VAL A CG1  3  
ATOM 2644  C CG2  . VAL A 1 16 ? 6.017   -1.134  3.866  1.00 0.00 ? 218 VAL A CG2  3  
ATOM 2645  H H    . VAL A 1 16 ? 7.388   -3.904  3.126  1.00 0.00 ? 218 VAL A H    3  
ATOM 2646  H HA   . VAL A 1 16 ? 9.197   -2.201  4.625  1.00 0.00 ? 218 VAL A HA   3  
ATOM 2647  H HB   . VAL A 1 16 ? 7.734   -0.319  4.819  1.00 0.00 ? 218 VAL A HB   3  
ATOM 2648  H HG11 . VAL A 1 16 ? 9.221   -0.407  2.843  1.00 0.00 ? 218 VAL A HG11 3  
ATOM 2649  H HG12 . VAL A 1 16 ? 7.880   -1.058  1.899  1.00 0.00 ? 218 VAL A HG12 3  
ATOM 2650  H HG13 . VAL A 1 16 ? 7.774   0.566   2.577  1.00 0.00 ? 218 VAL A HG13 3  
ATOM 2651  H HG21 . VAL A 1 16 ? 5.784   -1.993  3.255  1.00 0.00 ? 218 VAL A HG21 3  
ATOM 2652  H HG22 . VAL A 1 16 ? 5.574   -1.258  4.844  1.00 0.00 ? 218 VAL A HG22 3  
ATOM 2653  H HG23 . VAL A 1 16 ? 5.620   -0.243  3.402  1.00 0.00 ? 218 VAL A HG23 3  
ATOM 2654  N N    . LEU A 1 17 ? 7.332   -2.158  6.614  1.00 0.00 ? 219 LEU A N    3  
ATOM 2655  C CA   . LEU A 1 17 ? 6.637   -2.571  7.821  1.00 0.00 ? 219 LEU A CA   3  
ATOM 2656  C C    . LEU A 1 17 ? 5.552   -1.567  8.172  1.00 0.00 ? 219 LEU A C    3  
ATOM 2657  O O    . LEU A 1 17 ? 5.833   -0.388  8.384  1.00 0.00 ? 219 LEU A O    3  
ATOM 2658  C CB   . LEU A 1 17 ? 7.610   -2.699  8.994  1.00 0.00 ? 219 LEU A CB   3  
ATOM 2659  C CG   . LEU A 1 17 ? 8.729   -3.726  8.815  1.00 0.00 ? 219 LEU A CG   3  
ATOM 2660  C CD1  . LEU A 1 17 ? 9.496   -3.897  10.116 1.00 0.00 ? 219 LEU A CD1  3  
ATOM 2661  C CD2  . LEU A 1 17 ? 8.163   -5.058  8.347  1.00 0.00 ? 219 LEU A CD2  3  
ATOM 2662  H H    . LEU A 1 17 ? 7.728   -1.263  6.575  1.00 0.00 ? 219 LEU A H    3  
ATOM 2663  H HA   . LEU A 1 17 ? 6.180   -3.530  7.634  1.00 0.00 ? 219 LEU A HA   3  
ATOM 2664  H HB2  . LEU A 1 17 ? 8.061   -1.732  9.163  1.00 0.00 ? 219 LEU A HB2  3  
ATOM 2665  H HB3  . LEU A 1 17 ? 7.041   -2.969  9.871  1.00 0.00 ? 219 LEU A HB3  3  
ATOM 2666  H HG   . LEU A 1 17 ? 9.420   -3.371  8.063  1.00 0.00 ? 219 LEU A HG   3  
ATOM 2667  H HD11 . LEU A 1 17 ? 9.961   -4.871  10.134 1.00 0.00 ? 219 LEU A HD11 3  
ATOM 2668  H HD12 . LEU A 1 17 ? 10.257  -3.132  10.190 1.00 0.00 ? 219 LEU A HD12 3  
ATOM 2669  H HD13 . LEU A 1 17 ? 8.815   -3.807  10.949 1.00 0.00 ? 219 LEU A HD13 3  
ATOM 2670  H HD21 . LEU A 1 17 ? 8.892   -5.836  8.510  1.00 0.00 ? 219 LEU A HD21 3  
ATOM 2671  H HD22 . LEU A 1 17 ? 7.264   -5.282  8.903  1.00 0.00 ? 219 LEU A HD22 3  
ATOM 2672  H HD23 . LEU A 1 17 ? 7.929   -5.000  7.294  1.00 0.00 ? 219 LEU A HD23 3  
ATOM 2673  N N    . VAL A 1 18 ? 4.315   -2.032  8.244  1.00 0.00 ? 220 VAL A N    3  
ATOM 2674  C CA   . VAL A 1 18 ? 3.199   -1.160  8.580  1.00 0.00 ? 220 VAL A CA   3  
ATOM 2675  C C    . VAL A 1 18 ? 3.025   -1.091  10.094 1.00 0.00 ? 220 VAL A C    3  
ATOM 2676  O O    . VAL A 1 18 ? 2.656   -2.076  10.736 1.00 0.00 ? 220 VAL A O    3  
ATOM 2677  C CB   . VAL A 1 18 ? 1.869   -1.613  7.924  1.00 0.00 ? 220 VAL A CB   3  
ATOM 2678  C CG1  . VAL A 1 18 ? 1.262   -0.477  7.114  1.00 0.00 ? 220 VAL A CG1  3  
ATOM 2679  C CG2  . VAL A 1 18 ? 2.073   -2.843  7.049  1.00 0.00 ? 220 VAL A CG2  3  
ATOM 2680  H H    . VAL A 1 18 ? 4.152   -2.985  8.075  1.00 0.00 ? 220 VAL A H    3  
ATOM 2681  H HA   . VAL A 1 18 ? 3.437   -0.171  8.218  1.00 0.00 ? 220 VAL A HA   3  
ATOM 2682  H HB   . VAL A 1 18 ? 1.173   -1.869  8.705  1.00 0.00 ? 220 VAL A HB   3  
ATOM 2683  H HG11 . VAL A 1 18 ? 0.856   -0.867  6.191  1.00 0.00 ? 220 VAL A HG11 3  
ATOM 2684  H HG12 . VAL A 1 18 ? 0.473   -0.009  7.685  1.00 0.00 ? 220 VAL A HG12 3  
ATOM 2685  H HG13 . VAL A 1 18 ? 2.025   0.254   6.890  1.00 0.00 ? 220 VAL A HG13 3  
ATOM 2686  H HG21 . VAL A 1 18 ? 2.873   -2.655  6.347  1.00 0.00 ? 220 VAL A HG21 3  
ATOM 2687  H HG22 . VAL A 1 18 ? 2.331   -3.687  7.672  1.00 0.00 ? 220 VAL A HG22 3  
ATOM 2688  H HG23 . VAL A 1 18 ? 1.163   -3.056  6.510  1.00 0.00 ? 220 VAL A HG23 3  
ATOM 2689  N N    . GLY A 1 19 ? 3.314   0.078   10.658 1.00 0.00 ? 221 GLY A N    3  
ATOM 2690  C CA   . GLY A 1 19 ? 3.203   0.259   12.093 1.00 0.00 ? 221 GLY A CA   3  
ATOM 2691  C C    . GLY A 1 19 ? 4.468   -0.146  12.830 1.00 0.00 ? 221 GLY A C    3  
ATOM 2692  O O    . GLY A 1 19 ? 4.581   0.058   14.038 1.00 0.00 ? 221 GLY A O    3  
ATOM 2693  H H    . GLY A 1 19 ? 3.615   0.822   10.095 1.00 0.00 ? 221 GLY A H    3  
ATOM 2694  H HA2  . GLY A 1 19 ? 2.996   1.299   12.298 1.00 0.00 ? 221 GLY A HA2  3  
ATOM 2695  H HA3  . GLY A 1 19 ? 2.381   -0.339  12.458 1.00 0.00 ? 221 GLY A HA3  3  
ATOM 2696  N N    . GLY A 1 20 ? 5.424   -0.722  12.102 1.00 0.00 ? 222 GLY A N    3  
ATOM 2697  C CA   . GLY A 1 20 ? 6.674   -1.144  12.710 1.00 0.00 ? 222 GLY A CA   3  
ATOM 2698  C C    . GLY A 1 20 ? 6.629   -2.575  13.208 1.00 0.00 ? 222 GLY A C    3  
ATOM 2699  O O    . GLY A 1 20 ? 7.660   -3.243  13.290 1.00 0.00 ? 222 GLY A O    3  
ATOM 2700  H H    . GLY A 1 20 ? 5.283   -0.860  11.142 1.00 0.00 ? 222 GLY A H    3  
ATOM 2701  H HA2  . GLY A 1 20 ? 7.464   -1.057  11.981 1.00 0.00 ? 222 GLY A HA2  3  
ATOM 2702  H HA3  . GLY A 1 20 ? 6.896   -0.494  13.542 1.00 0.00 ? 222 GLY A HA3  3  
ATOM 2703  N N    . THR A 1 21 ? 5.433   -3.048  13.539 1.00 0.00 ? 223 THR A N    3  
ATOM 2704  C CA   . THR A 1 21 ? 5.258   -4.407  14.031 1.00 0.00 ? 223 THR A CA   3  
ATOM 2705  C C    . THR A 1 21 ? 4.782   -5.330  12.916 1.00 0.00 ? 223 THR A C    3  
ATOM 2706  O O    . THR A 1 21 ? 5.049   -6.533  12.935 1.00 0.00 ? 223 THR A O    3  
ATOM 2707  C CB   . THR A 1 21 ? 4.256   -4.423  15.186 1.00 0.00 ? 223 THR A CB   3  
ATOM 2708  O OG1  . THR A 1 21 ? 3.049   -3.783  14.812 1.00 0.00 ? 223 THR A OG1  3  
ATOM 2709  C CG2  . THR A 1 21 ? 4.774   -3.739  16.431 1.00 0.00 ? 223 THR A CG2  3  
ATOM 2710  H H    . THR A 1 21 ? 4.649   -2.470  13.452 1.00 0.00 ? 223 THR A H    3  
ATOM 2711  H HA   . THR A 1 21 ? 6.215   -4.757  14.390 1.00 0.00 ? 223 THR A HA   3  
ATOM 2712  H HB   . THR A 1 21 ? 4.031   -5.449  15.439 1.00 0.00 ? 223 THR A HB   3  
ATOM 2713  H HG1  . THR A 1 21 ? 3.194   -2.836  14.751 1.00 0.00 ? 223 THR A HG1  3  
ATOM 2714  H HG21 . THR A 1 21 ? 4.784   -2.670  16.277 1.00 0.00 ? 223 THR A HG21 3  
ATOM 2715  H HG22 . THR A 1 21 ? 5.777   -4.082  16.640 1.00 0.00 ? 223 THR A HG22 3  
ATOM 2716  H HG23 . THR A 1 21 ? 4.132   -3.976  17.266 1.00 0.00 ? 223 THR A HG23 3  
ATOM 2717  N N    . LYS A 1 22 ? 4.074   -4.762  11.947 1.00 0.00 ? 224 LYS A N    3  
ATOM 2718  C CA   . LYS A 1 22 ? 3.558   -5.534  10.824 1.00 0.00 ? 224 LYS A CA   3  
ATOM 2719  C C    . LYS A 1 22 ? 4.450   -5.366  9.599  1.00 0.00 ? 224 LYS A C    3  
ATOM 2720  O O    . LYS A 1 22 ? 5.050   -4.310  9.399  1.00 0.00 ? 224 LYS A O    3  
ATOM 2721  C CB   . LYS A 1 22 ? 2.126   -5.100  10.493 1.00 0.00 ? 224 LYS A CB   3  
ATOM 2722  C CG   . LYS A 1 22 ? 1.287   -4.756  11.717 1.00 0.00 ? 224 LYS A CG   3  
ATOM 2723  C CD   . LYS A 1 22 ? 0.674   -5.997  12.344 1.00 0.00 ? 224 LYS A CD   3  
ATOM 2724  C CE   . LYS A 1 22 ? 1.699   -6.775  13.154 1.00 0.00 ? 224 LYS A CE   3  
ATOM 2725  N NZ   . LYS A 1 22 ? 1.111   -7.336  14.401 1.00 0.00 ? 224 LYS A NZ   3  
ATOM 2726  H H    . LYS A 1 22 ? 3.892   -3.800  11.988 1.00 0.00 ? 224 LYS A H    3  
ATOM 2727  H HA   . LYS A 1 22 ? 3.551   -6.575  11.112 1.00 0.00 ? 224 LYS A HA   3  
ATOM 2728  H HB2  . LYS A 1 22 ? 2.166   -4.229  9.857  1.00 0.00 ? 224 LYS A HB2  3  
ATOM 2729  H HB3  . LYS A 1 22 ? 1.634   -5.901  9.961  1.00 0.00 ? 224 LYS A HB3  3  
ATOM 2730  H HG2  . LYS A 1 22 ? 1.913   -4.268  12.447 1.00 0.00 ? 224 LYS A HG2  3  
ATOM 2731  H HG3  . LYS A 1 22 ? 0.494   -4.086  11.419 1.00 0.00 ? 224 LYS A HG3  3  
ATOM 2732  H HD2  . LYS A 1 22 ? -0.132  -5.697  12.997 1.00 0.00 ? 224 LYS A HD2  3  
ATOM 2733  H HD3  . LYS A 1 22 ? 0.289   -6.632  11.562 1.00 0.00 ? 224 LYS A HD3  3  
ATOM 2734  H HE2  . LYS A 1 22 ? 2.076   -7.586  12.548 1.00 0.00 ? 224 LYS A HE2  3  
ATOM 2735  H HE3  . LYS A 1 22 ? 2.510   -6.113  13.414 1.00 0.00 ? 224 LYS A HE3  3  
ATOM 2736  H HZ1  . LYS A 1 22 ? 0.272   -6.789  14.680 1.00 0.00 ? 224 LYS A HZ1  3  
ATOM 2737  H HZ2  . LYS A 1 22 ? 1.809   -7.300  15.172 1.00 0.00 ? 224 LYS A HZ2  3  
ATOM 2738  H HZ3  . LYS A 1 22 ? 0.830   -8.326  14.251 1.00 0.00 ? 224 LYS A HZ3  3  
ATOM 2739  N N    . ALA A 1 23 ? 4.537   -6.411  8.782  1.00 0.00 ? 225 ALA A N    3  
ATOM 2740  C CA   . ALA A 1 23 ? 5.359   -6.371  7.577  1.00 0.00 ? 225 ALA A CA   3  
ATOM 2741  C C    . ALA A 1 23 ? 4.514   -6.582  6.330  1.00 0.00 ? 225 ALA A C    3  
ATOM 2742  O O    . ALA A 1 23 ? 3.519   -7.303  6.358  1.00 0.00 ? 225 ALA A O    3  
ATOM 2743  C CB   . ALA A 1 23 ? 6.459   -7.417  7.647  1.00 0.00 ? 225 ALA A CB   3  
ATOM 2744  H H    . ALA A 1 23 ? 4.038   -7.227  8.993  1.00 0.00 ? 225 ALA A H    3  
ATOM 2745  H HA   . ALA A 1 23 ? 5.824   -5.398  7.524  1.00 0.00 ? 225 ALA A HA   3  
ATOM 2746  H HB1  . ALA A 1 23 ? 6.778   -7.537  8.670  1.00 0.00 ? 225 ALA A HB1  3  
ATOM 2747  H HB2  . ALA A 1 23 ? 6.084   -8.357  7.272  1.00 0.00 ? 225 ALA A HB2  3  
ATOM 2748  H HB3  . ALA A 1 23 ? 7.296   -7.097  7.042  1.00 0.00 ? 225 ALA A HB3  3  
ATOM 2749  N N    . GLY A 1 24 ? 4.922   -5.951  5.233  1.00 0.00 ? 226 GLY A N    3  
ATOM 2750  C CA   . GLY A 1 24 ? 4.188   -6.088  3.991  1.00 0.00 ? 226 GLY A CA   3  
ATOM 2751  C C    . GLY A 1 24 ? 4.827   -5.321  2.849  1.00 0.00 ? 226 GLY A C    3  
ATOM 2752  O O    . GLY A 1 24 ? 5.951   -4.834  2.970  1.00 0.00 ? 226 GLY A O    3  
ATOM 2753  H H    . GLY A 1 24 ? 5.724   -5.391  5.270  1.00 0.00 ? 226 GLY A H    3  
ATOM 2754  H HA2  . GLY A 1 24 ? 4.143   -7.133  3.726  1.00 0.00 ? 226 GLY A HA2  3  
ATOM 2755  H HA3  . GLY A 1 24 ? 3.184   -5.719  4.137  1.00 0.00 ? 226 GLY A HA3  3  
ATOM 2756  N N    . VAL A 1 25 ? 4.105   -5.215  1.740  1.00 0.00 ? 227 VAL A N    3  
ATOM 2757  C CA   . VAL A 1 25 ? 4.600   -4.505  0.567  1.00 0.00 ? 227 VAL A CA   3  
ATOM 2758  C C    . VAL A 1 25 ? 3.697   -3.325  0.225  1.00 0.00 ? 227 VAL A C    3  
ATOM 2759  O O    . VAL A 1 25 ? 2.474   -3.450  0.211  1.00 0.00 ? 227 VAL A O    3  
ATOM 2760  C CB   . VAL A 1 25 ? 4.697   -5.446  -0.654 1.00 0.00 ? 227 VAL A CB   3  
ATOM 2761  C CG1  . VAL A 1 25 ? 5.001   -4.664  -1.924 1.00 0.00 ? 227 VAL A CG1  3  
ATOM 2762  C CG2  . VAL A 1 25 ? 5.750   -6.517  -0.416 1.00 0.00 ? 227 VAL A CG2  3  
ATOM 2763  H H    . VAL A 1 25 ? 3.217   -5.626  1.708  1.00 0.00 ? 227 VAL A H    3  
ATOM 2764  H HA   . VAL A 1 25 ? 5.590   -4.137  0.793  1.00 0.00 ? 227 VAL A HA   3  
ATOM 2765  H HB   . VAL A 1 25 ? 3.742   -5.935  -0.780 1.00 0.00 ? 227 VAL A HB   3  
ATOM 2766  H HG11 . VAL A 1 25 ? 5.625   -5.259  -2.572 1.00 0.00 ? 227 VAL A HG11 3  
ATOM 2767  H HG12 . VAL A 1 25 ? 4.076   -4.431  -2.430 1.00 0.00 ? 227 VAL A HG12 3  
ATOM 2768  H HG13 . VAL A 1 25 ? 5.513   -3.748  -1.669 1.00 0.00 ? 227 VAL A HG13 3  
ATOM 2769  H HG21 . VAL A 1 25 ? 5.416   -7.451  -0.845 1.00 0.00 ? 227 VAL A HG21 3  
ATOM 2770  H HG22 . VAL A 1 25 ? 6.679   -6.219  -0.881 1.00 0.00 ? 227 VAL A HG22 3  
ATOM 2771  H HG23 . VAL A 1 25 ? 5.903   -6.644  0.646  1.00 0.00 ? 227 VAL A HG23 3  
ATOM 2772  N N    . VAL A 1 26 ? 4.307   -2.182  -0.061 1.00 0.00 ? 228 VAL A N    3  
ATOM 2773  C CA   . VAL A 1 26 ? 3.553   -0.987  -0.413 1.00 0.00 ? 228 VAL A CA   3  
ATOM 2774  C C    . VAL A 1 26 ? 2.763   -1.213  -1.697 1.00 0.00 ? 228 VAL A C    3  
ATOM 2775  O O    . VAL A 1 26 ? 3.322   -1.611  -2.718 1.00 0.00 ? 228 VAL A O    3  
ATOM 2776  C CB   . VAL A 1 26 ? 4.478   0.230   -0.592 1.00 0.00 ? 228 VAL A CB   3  
ATOM 2777  C CG1  . VAL A 1 26 ? 3.664   1.500   -0.796 1.00 0.00 ? 228 VAL A CG1  3  
ATOM 2778  C CG2  . VAL A 1 26 ? 5.409   0.368   0.605  1.00 0.00 ? 228 VAL A CG2  3  
ATOM 2779  H H    . VAL A 1 26 ? 5.286   -2.142  -0.044 1.00 0.00 ? 228 VAL A H    3  
ATOM 2780  H HA   . VAL A 1 26 ? 2.862   -0.777  0.391  1.00 0.00 ? 228 VAL A HA   3  
ATOM 2781  H HB   . VAL A 1 26 ? 5.079   0.071   -1.474 1.00 0.00 ? 228 VAL A HB   3  
ATOM 2782  H HG11 . VAL A 1 26 ? 3.768   2.139   0.068  1.00 0.00 ? 228 VAL A HG11 3  
ATOM 2783  H HG12 . VAL A 1 26 ? 4.024   2.020   -1.674 1.00 0.00 ? 228 VAL A HG12 3  
ATOM 2784  H HG13 . VAL A 1 26 ? 2.624   1.244   -0.933 1.00 0.00 ? 228 VAL A HG13 3  
ATOM 2785  H HG21 . VAL A 1 26 ? 5.417   -0.555  1.165  1.00 0.00 ? 228 VAL A HG21 3  
ATOM 2786  H HG22 . VAL A 1 26 ? 6.409   0.586   0.258  1.00 0.00 ? 228 VAL A HG22 3  
ATOM 2787  H HG23 . VAL A 1 26 ? 5.065   1.171   1.239  1.00 0.00 ? 228 VAL A HG23 3  
ATOM 2788  N N    . ARG A 1 27 ? 1.459   -0.973  -1.637 1.00 0.00 ? 229 ARG A N    3  
ATOM 2789  C CA   . ARG A 1 27 ? 0.594   -1.166  -2.794 1.00 0.00 ? 229 ARG A CA   3  
ATOM 2790  C C    . ARG A 1 27 ? 0.036   0.161   -3.300 1.00 0.00 ? 229 ARG A C    3  
ATOM 2791  O O    . ARG A 1 27 ? -0.228  0.320   -4.492 1.00 0.00 ? 229 ARG A O    3  
ATOM 2792  C CB   . ARG A 1 27 ? -0.550  -2.119  -2.440 1.00 0.00 ? 229 ARG A CB   3  
ATOM 2793  C CG   . ARG A 1 27 ? -0.114  -3.307  -1.599 1.00 0.00 ? 229 ARG A CG   3  
ATOM 2794  C CD   . ARG A 1 27 ? 0.963   -4.119  -2.297 1.00 0.00 ? 229 ARG A CD   3  
ATOM 2795  N NE   . ARG A 1 27 ? 0.400   -5.236  -3.049 1.00 0.00 ? 229 ARG A NE   3  
ATOM 2796  C CZ   . ARG A 1 27 ? -0.010  -5.155  -4.313 1.00 0.00 ? 229 ARG A CZ   3  
ATOM 2797  N NH1  . ARG A 1 27 ? 0.071   -4.007  -4.975 1.00 0.00 ? 229 ARG A NH1  3  
ATOM 2798  N NH2  . ARG A 1 27 ? -0.505  -6.225  -4.918 1.00 0.00 ? 229 ARG A NH2  3  
ATOM 2799  H H    . ARG A 1 27 ? 1.066   -0.668  -0.792 1.00 0.00 ? 229 ARG A H    3  
ATOM 2800  H HA   . ARG A 1 27 ? 1.189   -1.612  -3.578 1.00 0.00 ? 229 ARG A HA   3  
ATOM 2801  H HB2  . ARG A 1 27 ? -1.300  -1.573  -1.889 1.00 0.00 ? 229 ARG A HB2  3  
ATOM 2802  H HB3  . ARG A 1 27 ? -0.987  -2.493  -3.351 1.00 0.00 ? 229 ARG A HB3  3  
ATOM 2803  H HG2  . ARG A 1 27 ? 0.275   -2.945  -0.658 1.00 0.00 ? 229 ARG A HG2  3  
ATOM 2804  H HG3  . ARG A 1 27 ? -0.970  -3.940  -1.417 1.00 0.00 ? 229 ARG A HG3  3  
ATOM 2805  H HD2  . ARG A 1 27 ? 1.504   -3.475  -2.973 1.00 0.00 ? 229 ARG A HD2  3  
ATOM 2806  H HD3  . ARG A 1 27 ? 1.642   -4.507  -1.552 1.00 0.00 ? 229 ARG A HD3  3  
ATOM 2807  H HE   . ARG A 1 27 ? 0.324   -6.096  -2.587 1.00 0.00 ? 229 ARG A HE   3  
ATOM 2808  H HH11 . ARG A 1 27 ? 0.441   -3.194  -4.527 1.00 0.00 ? 229 ARG A HH11 3  
ATOM 2809  H HH12 . ARG A 1 27 ? -0.240  -3.956  -5.924 1.00 0.00 ? 229 ARG A HH12 3  
ATOM 2810  H HH21 . ARG A 1 27 ? -0.571  -7.093  -4.424 1.00 0.00 ? 229 ARG A HH21 3  
ATOM 2811  H HH22 . ARG A 1 27 ? -0.815  -6.166  -5.866 1.00 0.00 ? 229 ARG A HH22 3  
ATOM 2812  N N    . PHE A 1 28 ? -0.141  1.113   -2.389 1.00 0.00 ? 230 PHE A N    3  
ATOM 2813  C CA   . PHE A 1 28 ? -0.667  2.424   -2.748 1.00 0.00 ? 230 PHE A CA   3  
ATOM 2814  C C    . PHE A 1 28 ? -0.353  3.448   -1.664 1.00 0.00 ? 230 PHE A C    3  
ATOM 2815  O O    . PHE A 1 28 ? -0.220  3.102   -0.497 1.00 0.00 ? 230 PHE A O    3  
ATOM 2816  C CB   . PHE A 1 28 ? -2.178  2.346   -2.971 1.00 0.00 ? 230 PHE A CB   3  
ATOM 2817  C CG   . PHE A 1 28 ? -2.726  3.487   -3.779 1.00 0.00 ? 230 PHE A CG   3  
ATOM 2818  C CD1  . PHE A 1 28 ? -2.266  3.728   -5.063 1.00 0.00 ? 230 PHE A CD1  3  
ATOM 2819  C CD2  . PHE A 1 28 ? -3.703  4.319   -3.254 1.00 0.00 ? 230 PHE A CD2  3  
ATOM 2820  C CE1  . PHE A 1 28 ? -2.769  4.778   -5.809 1.00 0.00 ? 230 PHE A CE1  3  
ATOM 2821  C CE2  . PHE A 1 28 ? -4.210  5.370   -3.995 1.00 0.00 ? 230 PHE A CE2  3  
ATOM 2822  C CZ   . PHE A 1 28 ? -3.742  5.599   -5.274 1.00 0.00 ? 230 PHE A CZ   3  
ATOM 2823  H H    . PHE A 1 28 ? 0.089   0.928   -1.454 1.00 0.00 ? 230 PHE A H    3  
ATOM 2824  H HA   . PHE A 1 28 ? -0.192  2.731   -3.666 1.00 0.00 ? 230 PHE A HA   3  
ATOM 2825  H HB2  . PHE A 1 28 ? -2.412  1.429   -3.491 1.00 0.00 ? 230 PHE A HB2  3  
ATOM 2826  H HB3  . PHE A 1 28 ? -2.676  2.347   -2.012 1.00 0.00 ? 230 PHE A HB3  3  
ATOM 2827  H HD1  . PHE A 1 28 ? -1.504  3.087   -5.483 1.00 0.00 ? 230 PHE A HD1  3  
ATOM 2828  H HD2  . PHE A 1 28 ? -4.069  4.140   -2.253 1.00 0.00 ? 230 PHE A HD2  3  
ATOM 2829  H HE1  . PHE A 1 28 ? -2.401  4.955   -6.809 1.00 0.00 ? 230 PHE A HE1  3  
ATOM 2830  H HE2  . PHE A 1 28 ? -4.971  6.010   -3.575 1.00 0.00 ? 230 PHE A HE2  3  
ATOM 2831  H HZ   . PHE A 1 28 ? -4.137  6.420   -5.855 1.00 0.00 ? 230 PHE A HZ   3  
ATOM 2832  N N    . LEU A 1 29 ? -0.237  4.712   -2.056 1.00 0.00 ? 231 LEU A N    3  
ATOM 2833  C CA   . LEU A 1 29 ? 0.055   5.776   -1.101 1.00 0.00 ? 231 LEU A CA   3  
ATOM 2834  C C    . LEU A 1 29 ? -0.856  6.978   -1.329 1.00 0.00 ? 231 LEU A C    3  
ATOM 2835  O O    . LEU A 1 29 ? -0.959  7.490   -2.443 1.00 0.00 ? 231 LEU A O    3  
ATOM 2836  C CB   . LEU A 1 29 ? 1.521   6.201   -1.202 1.00 0.00 ? 231 LEU A CB   3  
ATOM 2837  C CG   . LEU A 1 29 ? 2.531   5.049   -1.187 1.00 0.00 ? 231 LEU A CG   3  
ATOM 2838  C CD1  . LEU A 1 29 ? 3.198   4.903   -2.546 1.00 0.00 ? 231 LEU A CD1  3  
ATOM 2839  C CD2  . LEU A 1 29 ? 3.573   5.265   -0.100 1.00 0.00 ? 231 LEU A CD2  3  
ATOM 2840  H H    . LEU A 1 29 ? -0.356  4.936   -3.002 1.00 0.00 ? 231 LEU A H    3  
ATOM 2841  H HA   . LEU A 1 29 ? -0.127  5.388   -0.110 1.00 0.00 ? 231 LEU A HA   3  
ATOM 2842  H HB2  . LEU A 1 29 ? 1.649   6.756   -2.119 1.00 0.00 ? 231 LEU A HB2  3  
ATOM 2843  H HB3  . LEU A 1 29 ? 1.742   6.854   -0.373 1.00 0.00 ? 231 LEU A HB3  3  
ATOM 2844  H HG   . LEU A 1 29 ? 2.009   4.127   -0.971 1.00 0.00 ? 231 LEU A HG   3  
ATOM 2845  H HD11 . LEU A 1 29 ? 2.484   5.127   -3.324 1.00 0.00 ? 231 LEU A HD11 3  
ATOM 2846  H HD12 . LEU A 1 29 ? 4.031   5.588   -2.613 1.00 0.00 ? 231 LEU A HD12 3  
ATOM 2847  H HD13 . LEU A 1 29 ? 3.555   3.890   -2.665 1.00 0.00 ? 231 LEU A HD13 3  
ATOM 2848  H HD21 . LEU A 1 29 ? 3.103   5.709   0.766  1.00 0.00 ? 231 LEU A HD21 3  
ATOM 2849  H HD22 . LEU A 1 29 ? 4.011   4.316   0.174  1.00 0.00 ? 231 LEU A HD22 3  
ATOM 2850  H HD23 . LEU A 1 29 ? 4.346   5.925   -0.469 1.00 0.00 ? 231 LEU A HD23 3  
ATOM 2851  N N    . GLY A 1 30 ? -1.516  7.422   -0.264 1.00 0.00 ? 232 GLY A N    3  
ATOM 2852  C CA   . GLY A 1 30 ? -2.411  8.559   -0.368 1.00 0.00 ? 232 GLY A CA   3  
ATOM 2853  C C    . GLY A 1 30 ? -3.279  8.729   0.863  1.00 0.00 ? 232 GLY A C    3  
ATOM 2854  O O    . GLY A 1 30 ? -3.111  8.017   1.852  1.00 0.00 ? 232 GLY A O    3  
ATOM 2855  H H    . GLY A 1 30 ? -1.395  6.974   0.598  1.00 0.00 ? 232 GLY A H    3  
ATOM 2856  H HA2  . GLY A 1 30 ? -1.823  9.455   -0.506 1.00 0.00 ? 232 GLY A HA2  3  
ATOM 2857  H HA3  . GLY A 1 30 ? -3.048  8.425   -1.230 1.00 0.00 ? 232 GLY A HA3  3  
ATOM 2858  N N    . GLU A 1 31 ? -4.210  9.675   0.802  1.00 0.00 ? 233 GLU A N    3  
ATOM 2859  C CA   . GLU A 1 31 ? -5.107  9.937   1.922  1.00 0.00 ? 233 GLU A CA   3  
ATOM 2860  C C    . GLU A 1 31 ? -6.244  8.919   1.958  1.00 0.00 ? 233 GLU A C    3  
ATOM 2861  O O    . GLU A 1 31 ? -6.460  8.182   0.996  1.00 0.00 ? 233 GLU A O    3  
ATOM 2862  C CB   . GLU A 1 31 ? -5.678  11.352  1.824  1.00 0.00 ? 233 GLU A CB   3  
ATOM 2863  C CG   . GLU A 1 31 ? -4.624  12.417  1.567  1.00 0.00 ? 233 GLU A CG   3  
ATOM 2864  C CD   . GLU A 1 31 ? -5.025  13.381  0.466  1.00 0.00 ? 233 GLU A CD   3  
ATOM 2865  O OE1  . GLU A 1 31 ? -5.900  14.237  0.717  1.00 0.00 ? 233 GLU A OE1  3  
ATOM 2866  O OE2  . GLU A 1 31 ? -4.464  13.279  -0.645 1.00 0.00 ? 233 GLU A OE2  3  
ATOM 2867  H H    . GLU A 1 31 ? -4.294  10.211  -0.015 1.00 0.00 ? 233 GLU A H    3  
ATOM 2868  H HA   . GLU A 1 31 ? -4.534  9.851   2.832  1.00 0.00 ? 233 GLU A HA   3  
ATOM 2869  H HB2  . GLU A 1 31 ? -6.397  11.384  1.017  1.00 0.00 ? 233 GLU A HB2  3  
ATOM 2870  H HB3  . GLU A 1 31 ? -6.180  11.590  2.751  1.00 0.00 ? 233 GLU A HB3  3  
ATOM 2871  H HG2  . GLU A 1 31 ? -4.469  12.978  2.475  1.00 0.00 ? 233 GLU A HG2  3  
ATOM 2872  H HG3  . GLU A 1 31 ? -3.703  11.932  1.281  1.00 0.00 ? 233 GLU A HG3  3  
ATOM 2873  N N    . THR A 1 32 ? -6.966  8.887   3.072  1.00 0.00 ? 234 THR A N    3  
ATOM 2874  C CA   . THR A 1 32 ? -8.081  7.961   3.235  1.00 0.00 ? 234 THR A CA   3  
ATOM 2875  C C    . THR A 1 32 ? -9.404  8.713   3.315  1.00 0.00 ? 234 THR A C    3  
ATOM 2876  O O    . THR A 1 32 ? -9.430  9.921   3.551  1.00 0.00 ? 234 THR A O    3  
ATOM 2877  C CB   . THR A 1 32 ? -7.888  7.111   4.491  1.00 0.00 ? 234 THR A CB   3  
ATOM 2878  O OG1  . THR A 1 32 ? -8.030  7.902   5.658  1.00 0.00 ? 234 THR A OG1  3  
ATOM 2879  C CG2  . THR A 1 32 ? -6.535  6.437   4.557  1.00 0.00 ? 234 THR A CG2  3  
ATOM 2880  H H    . THR A 1 32 ? -6.745  9.500   3.805  1.00 0.00 ? 234 THR A H    3  
ATOM 2881  H HA   . THR A 1 32 ? -8.101  7.312   2.372  1.00 0.00 ? 234 THR A HA   3  
ATOM 2882  H HB   . THR A 1 32 ? -8.643  6.338   4.511  1.00 0.00 ? 234 THR A HB   3  
ATOM 2883  H HG1  . THR A 1 32 ? -7.420  8.641   5.620  1.00 0.00 ? 234 THR A HG1  3  
ATOM 2884  H HG21 . THR A 1 32 ? -5.960  6.862   5.368  1.00 0.00 ? 234 THR A HG21 3  
ATOM 2885  H HG22 . THR A 1 32 ? -6.010  6.590   3.626  1.00 0.00 ? 234 THR A HG22 3  
ATOM 2886  H HG23 . THR A 1 32 ? -6.667  5.378   4.726  1.00 0.00 ? 234 THR A HG23 3  
ATOM 2887  N N    . ASP A 1 33 ? -10.502 7.991   3.121  1.00 0.00 ? 235 ASP A N    3  
ATOM 2888  C CA   . ASP A 1 33 ? -11.832 8.590   3.172  1.00 0.00 ? 235 ASP A CA   3  
ATOM 2889  C C    . ASP A 1 33 ? -12.373 8.618   4.600  1.00 0.00 ? 235 ASP A C    3  
ATOM 2890  O O    . ASP A 1 33 ? -13.435 9.187   4.856  1.00 0.00 ? 235 ASP A O    3  
ATOM 2891  C CB   . ASP A 1 33 ? -12.794 7.821   2.267  1.00 0.00 ? 235 ASP A CB   3  
ATOM 2892  C CG   . ASP A 1 33 ? -12.591 8.143   0.799  1.00 0.00 ? 235 ASP A CG   3  
ATOM 2893  O OD1  . ASP A 1 33 ? -12.098 9.250   0.497  1.00 0.00 ? 235 ASP A OD1  3  
ATOM 2894  O OD2  . ASP A 1 33 ? -12.922 7.287   -0.048 1.00 0.00 ? 235 ASP A OD2  3  
ATOM 2895  H H    . ASP A 1 33 ? -10.417 7.031   2.937  1.00 0.00 ? 235 ASP A H    3  
ATOM 2896  H HA   . ASP A 1 33 ? -11.749 9.605   2.812  1.00 0.00 ? 235 ASP A HA   3  
ATOM 2897  H HB2  . ASP A 1 33 ? -12.643 6.760   2.407  1.00 0.00 ? 235 ASP A HB2  3  
ATOM 2898  H HB3  . ASP A 1 33 ? -13.809 8.072   2.534  1.00 0.00 ? 235 ASP A HB3  3  
ATOM 2899  N N    . PHE A 1 34 ? -11.643 8.005   5.531  1.00 0.00 ? 236 PHE A N    3  
ATOM 2900  C CA   . PHE A 1 34 ? -12.064 7.970   6.929  1.00 0.00 ? 236 PHE A CA   3  
ATOM 2901  C C    . PHE A 1 34 ? -11.022 8.617   7.841  1.00 0.00 ? 236 PHE A C    3  
ATOM 2902  O O    . PHE A 1 34 ? -11.317 8.958   8.987  1.00 0.00 ? 236 PHE A O    3  
ATOM 2903  C CB   . PHE A 1 34 ? -12.326 6.524   7.370  1.00 0.00 ? 236 PHE A CB   3  
ATOM 2904  C CG   . PHE A 1 34 ? -11.081 5.757   7.738  1.00 0.00 ? 236 PHE A CG   3  
ATOM 2905  C CD1  . PHE A 1 34 ? -10.084 5.534   6.803  1.00 0.00 ? 236 PHE A CD1  3  
ATOM 2906  C CD2  . PHE A 1 34 ? -10.914 5.265   9.021  1.00 0.00 ? 236 PHE A CD2  3  
ATOM 2907  C CE1  . PHE A 1 34 ? -8.942  4.833   7.142  1.00 0.00 ? 236 PHE A CE1  3  
ATOM 2908  C CE2  . PHE A 1 34 ? -9.773  4.563   9.367  1.00 0.00 ? 236 PHE A CE2  3  
ATOM 2909  C CZ   . PHE A 1 34 ? -8.787  4.347   8.425  1.00 0.00 ? 236 PHE A CZ   3  
ATOM 2910  H H    . PHE A 1 34 ? -10.807 7.571   5.272  1.00 0.00 ? 236 PHE A H    3  
ATOM 2911  H HA   . PHE A 1 34 ? -12.984 8.529   7.007  1.00 0.00 ? 236 PHE A HA   3  
ATOM 2912  H HB2  . PHE A 1 34 ? -12.973 6.533   8.234  1.00 0.00 ? 236 PHE A HB2  3  
ATOM 2913  H HB3  . PHE A 1 34 ? -12.816 5.996   6.566  1.00 0.00 ? 236 PHE A HB3  3  
ATOM 2914  H HD1  . PHE A 1 34 ? -10.202 5.913   5.800  1.00 0.00 ? 236 PHE A HD1  3  
ATOM 2915  H HD2  . PHE A 1 34 ? -11.684 5.433   9.758  1.00 0.00 ? 236 PHE A HD2  3  
ATOM 2916  H HE1  . PHE A 1 34 ? -8.172  4.666   6.403  1.00 0.00 ? 236 PHE A HE1  3  
ATOM 2917  H HE2  . PHE A 1 34 ? -9.656  4.183   10.371 1.00 0.00 ? 236 PHE A HE2  3  
ATOM 2918  H HZ   . PHE A 1 34 ? -7.896  3.800   8.691  1.00 0.00 ? 236 PHE A HZ   3  
ATOM 2919  N N    . ALA A 1 35 ? -9.801  8.779   7.335  1.00 0.00 ? 237 ALA A N    3  
ATOM 2920  C CA   . ALA A 1 35 ? -8.726  9.379   8.116  1.00 0.00 ? 237 ALA A CA   3  
ATOM 2921  C C    . ALA A 1 35 ? -8.190  10.638  7.441  1.00 0.00 ? 237 ALA A C    3  
ATOM 2922  O O    . ALA A 1 35 ? -8.069  10.694  6.217  1.00 0.00 ? 237 ALA A O    3  
ATOM 2923  C CB   . ALA A 1 35 ? -7.604  8.375   8.326  1.00 0.00 ? 237 ALA A CB   3  
ATOM 2924  H H    . ALA A 1 35 ? -9.617  8.486   6.419  1.00 0.00 ? 237 ALA A H    3  
ATOM 2925  H HA   . ALA A 1 35 ? -9.126  9.644   9.082  1.00 0.00 ? 237 ALA A HA   3  
ATOM 2926  H HB1  . ALA A 1 35 ? -6.876  8.477   7.535  1.00 0.00 ? 237 ALA A HB1  3  
ATOM 2927  H HB2  . ALA A 1 35 ? -7.130  8.559   9.279  1.00 0.00 ? 237 ALA A HB2  3  
ATOM 2928  H HB3  . ALA A 1 35 ? -8.010  7.373   8.315  1.00 0.00 ? 237 ALA A HB3  3  
ATOM 2929  N N    . LYS A 1 36 ? -7.867  11.642  8.247  1.00 0.00 ? 238 LYS A N    3  
ATOM 2930  C CA   . LYS A 1 36 ? -7.341  12.900  7.729  1.00 0.00 ? 238 LYS A CA   3  
ATOM 2931  C C    . LYS A 1 36 ? -5.818  12.864  7.661  1.00 0.00 ? 238 LYS A C    3  
ATOM 2932  O O    . LYS A 1 36 ? -5.157  12.383  8.582  1.00 0.00 ? 238 LYS A O    3  
ATOM 2933  C CB   . LYS A 1 36 ? -7.795  14.068  8.607  1.00 0.00 ? 238 LYS A CB   3  
ATOM 2934  C CG   . LYS A 1 36 ? -7.509  15.432  8.000  1.00 0.00 ? 238 LYS A CG   3  
ATOM 2935  C CD   . LYS A 1 36 ? -8.096  16.552  8.844  1.00 0.00 ? 238 LYS A CD   3  
ATOM 2936  C CE   . LYS A 1 36 ? -7.041  17.193  9.730  1.00 0.00 ? 238 LYS A CE   3  
ATOM 2937  N NZ   . LYS A 1 36 ? -7.232  18.666  9.844  1.00 0.00 ? 238 LYS A NZ   3  
ATOM 2938  H H    . LYS A 1 36 ? -7.985  11.536  9.215  1.00 0.00 ? 238 LYS A H    3  
ATOM 2939  H HA   . LYS A 1 36 ? -7.731  13.038  6.732  1.00 0.00 ? 238 LYS A HA   3  
ATOM 2940  H HB2  . LYS A 1 36 ? -8.860  13.987  8.770  1.00 0.00 ? 238 LYS A HB2  3  
ATOM 2941  H HB3  . LYS A 1 36 ? -7.289  14.007  9.558  1.00 0.00 ? 238 LYS A HB3  3  
ATOM 2942  H HG2  . LYS A 1 36 ? -6.440  15.568  7.933  1.00 0.00 ? 238 LYS A HG2  3  
ATOM 2943  H HG3  . LYS A 1 36 ? -7.940  15.473  7.011  1.00 0.00 ? 238 LYS A HG3  3  
ATOM 2944  H HD2  . LYS A 1 36 ? -8.507  17.305  8.188  1.00 0.00 ? 238 LYS A HD2  3  
ATOM 2945  H HD3  . LYS A 1 36 ? -8.880  16.147  9.467  1.00 0.00 ? 238 LYS A HD3  3  
ATOM 2946  H HE2  . LYS A 1 36 ? -7.100  16.754  10.714 1.00 0.00 ? 238 LYS A HE2  3  
ATOM 2947  H HE3  . LYS A 1 36 ? -6.065  16.998  9.308  1.00 0.00 ? 238 LYS A HE3  3  
ATOM 2948  H HZ1  . LYS A 1 36 ? -6.379  19.107  10.244 1.00 0.00 ? 238 LYS A HZ1  3  
ATOM 2949  H HZ2  . LYS A 1 36 ? -8.040  18.874  10.465 1.00 0.00 ? 238 LYS A HZ2  3  
ATOM 2950  H HZ3  . LYS A 1 36 ? -7.415  19.076  8.907  1.00 0.00 ? 238 LYS A HZ3  3  
ATOM 2951  N N    . GLY A 1 37 ? -5.267  13.375  6.564  1.00 0.00 ? 239 GLY A N    3  
ATOM 2952  C CA   . GLY A 1 37 ? -3.825  13.389  6.398  1.00 0.00 ? 239 GLY A CA   3  
ATOM 2953  C C    . GLY A 1 37 ? -3.358  12.440  5.311  1.00 0.00 ? 239 GLY A C    3  
ATOM 2954  O O    . GLY A 1 37 ? -4.147  12.008  4.472  1.00 0.00 ? 239 GLY A O    3  
ATOM 2955  H H    . GLY A 1 37 ? -5.844  13.743  5.863  1.00 0.00 ? 239 GLY A H    3  
ATOM 2956  H HA2  . GLY A 1 37 ? -3.514  14.391  6.143  1.00 0.00 ? 239 GLY A HA2  3  
ATOM 2957  H HA3  . GLY A 1 37 ? -3.362  13.106  7.331  1.00 0.00 ? 239 GLY A HA3  3  
ATOM 2958  N N    . GLU A 1 38 ? -2.068  12.118  5.325  1.00 0.00 ? 240 GLU A N    3  
ATOM 2959  C CA   . GLU A 1 38 ? -1.495  11.215  4.332  1.00 0.00 ? 240 GLU A CA   3  
ATOM 2960  C C    . GLU A 1 38 ? -1.348  9.807   4.898  1.00 0.00 ? 240 GLU A C    3  
ATOM 2961  O O    . GLU A 1 38 ? -0.847  9.620   6.007  1.00 0.00 ? 240 GLU A O    3  
ATOM 2962  C CB   . GLU A 1 38 ? -0.134  11.734  3.865  1.00 0.00 ? 240 GLU A CB   3  
ATOM 2963  C CG   . GLU A 1 38 ? 0.915   11.770  4.965  1.00 0.00 ? 240 GLU A CG   3  
ATOM 2964  C CD   . GLU A 1 38 ? 2.162   12.528  4.557  1.00 0.00 ? 240 GLU A CD   3  
ATOM 2965  O OE1  . GLU A 1 38 ? 2.594   12.379  3.394  1.00 0.00 ? 240 GLU A OE1  3  
ATOM 2966  O OE2  . GLU A 1 38 ? 2.707   13.272  5.399  1.00 0.00 ? 240 GLU A OE2  3  
ATOM 2967  H H    . GLU A 1 38 ? -1.488  12.496  6.018  1.00 0.00 ? 240 GLU A H    3  
ATOM 2968  H HA   . GLU A 1 38 ? -2.167  11.182  3.488  1.00 0.00 ? 240 GLU A HA   3  
ATOM 2969  H HB2  . GLU A 1 38 ? 0.229   11.097  3.072  1.00 0.00 ? 240 GLU A HB2  3  
ATOM 2970  H HB3  . GLU A 1 38 ? -0.256  12.737  3.482  1.00 0.00 ? 240 GLU A HB3  3  
ATOM 2971  H HG2  . GLU A 1 38 ? 0.491   12.247  5.835  1.00 0.00 ? 240 GLU A HG2  3  
ATOM 2972  H HG3  . GLU A 1 38 ? 1.192   10.755  5.212  1.00 0.00 ? 240 GLU A HG3  3  
ATOM 2973  N N    . TRP A 1 39 ? -1.789  8.817   4.128  1.00 0.00 ? 241 TRP A N    3  
ATOM 2974  C CA   . TRP A 1 39 ? -1.707  7.423   4.551  1.00 0.00 ? 241 TRP A CA   3  
ATOM 2975  C C    . TRP A 1 39 ? -1.078  6.561   3.462  1.00 0.00 ? 241 TRP A C    3  
ATOM 2976  O O    . TRP A 1 39 ? -0.898  7.009   2.329  1.00 0.00 ? 241 TRP A O    3  
ATOM 2977  C CB   . TRP A 1 39 ? -3.099  6.892   4.902  1.00 0.00 ? 241 TRP A CB   3  
ATOM 2978  C CG   . TRP A 1 39 ? -3.681  7.525   6.130  1.00 0.00 ? 241 TRP A CG   3  
ATOM 2979  C CD1  . TRP A 1 39 ? -4.120  8.810   6.260  1.00 0.00 ? 241 TRP A CD1  3  
ATOM 2980  C CD2  . TRP A 1 39 ? -3.883  6.900   7.402  1.00 0.00 ? 241 TRP A CD2  3  
ATOM 2981  N NE1  . TRP A 1 39 ? -4.583  9.024   7.536  1.00 0.00 ? 241 TRP A NE1  3  
ATOM 2982  C CE2  . TRP A 1 39 ? -4.449  7.866   8.256  1.00 0.00 ? 241 TRP A CE2  3  
ATOM 2983  C CE3  . TRP A 1 39 ? -3.643  5.617   7.903  1.00 0.00 ? 241 TRP A CE3  3  
ATOM 2984  C CZ2  . TRP A 1 39 ? -4.777  7.588   9.581  1.00 0.00 ? 241 TRP A CZ2  3  
ATOM 2985  C CZ3  . TRP A 1 39 ? -3.967  5.344   9.218  1.00 0.00 ? 241 TRP A CZ3  3  
ATOM 2986  C CH2  . TRP A 1 39 ? -4.529  6.324   10.044 1.00 0.00 ? 241 TRP A CH2  3  
ATOM 2987  H H    . TRP A 1 39 ? -2.179  9.029   3.254  1.00 0.00 ? 241 TRP A H    3  
ATOM 2988  H HA   . TRP A 1 39 ? -1.083  7.380   5.431  1.00 0.00 ? 241 TRP A HA   3  
ATOM 2989  H HB2  . TRP A 1 39 ? -3.769  7.086   4.077  1.00 0.00 ? 241 TRP A HB2  3  
ATOM 2990  H HB3  . TRP A 1 39 ? -3.039  5.827   5.070  1.00 0.00 ? 241 TRP A HB3  3  
ATOM 2991  H HD1  . TRP A 1 39 ? -4.100  9.544   5.467  1.00 0.00 ? 241 TRP A HD1  3  
ATOM 2992  H HE1  . TRP A 1 39 ? -4.951  9.867   7.874  1.00 0.00 ? 241 TRP A HE1  3  
ATOM 2993  H HE3  . TRP A 1 39 ? -3.211  4.848   7.281  1.00 0.00 ? 241 TRP A HE3  3  
ATOM 2994  H HZ2  . TRP A 1 39 ? -5.210  8.333   10.231 1.00 0.00 ? 241 TRP A HZ2  3  
ATOM 2995  H HZ3  . TRP A 1 39 ? -3.789  4.359   9.621  1.00 0.00 ? 241 TRP A HZ3  3  
ATOM 2996  H HH2  . TRP A 1 39 ? -4.766  6.065   11.066 1.00 0.00 ? 241 TRP A HH2  3  
ATOM 2997  N N    . CYS A 1 40 ? -0.743  5.322   3.809  1.00 0.00 ? 242 CYS A N    3  
ATOM 2998  C CA   . CYS A 1 40 ? -0.133  4.402   2.856  1.00 0.00 ? 242 CYS A CA   3  
ATOM 2999  C C    . CYS A 1 40 ? -0.746  3.008   2.968  1.00 0.00 ? 242 CYS A C    3  
ATOM 3000  O O    . CYS A 1 40 ? -1.285  2.633   4.010  1.00 0.00 ? 242 CYS A O    3  
ATOM 3001  C CB   . CYS A 1 40 ? 1.382   4.334   3.076  1.00 0.00 ? 242 CYS A CB   3  
ATOM 3002  S SG   . CYS A 1 40 ? 2.235   3.138   2.020  1.00 0.00 ? 242 CYS A SG   3  
ATOM 3003  H H    . CYS A 1 40 ? -0.910  5.020   4.727  1.00 0.00 ? 242 CYS A H    3  
ATOM 3004  H HA   . CYS A 1 40 ? -0.324  4.784   1.864  1.00 0.00 ? 242 CYS A HA   3  
ATOM 3005  H HB2  . CYS A 1 40 ? 1.808   5.305   2.876  1.00 0.00 ? 242 CYS A HB2  3  
ATOM 3006  H HB3  . CYS A 1 40 ? 1.577   4.065   4.105  1.00 0.00 ? 242 CYS A HB3  3  
ATOM 3007  H HG   . CYS A 1 40 ? 2.111   3.408   1.108  1.00 0.00 ? 242 CYS A HG   3  
ATOM 3008  N N    . GLY A 1 41 ? -0.656  2.250   1.883  1.00 0.00 ? 243 GLY A N    3  
ATOM 3009  C CA   . GLY A 1 41 ? -1.198  0.905   1.855  1.00 0.00 ? 243 GLY A CA   3  
ATOM 3010  C C    . GLY A 1 41 ? -0.116  -0.146  1.713  1.00 0.00 ? 243 GLY A C    3  
ATOM 3011  O O    . GLY A 1 41 ? 0.697   -0.088  0.791  1.00 0.00 ? 243 GLY A O    3  
ATOM 3012  H H    . GLY A 1 41 ? -0.215  2.610   1.084  1.00 0.00 ? 243 GLY A H    3  
ATOM 3013  H HA2  . GLY A 1 41 ? -1.744  0.727   2.769  1.00 0.00 ? 243 GLY A HA2  3  
ATOM 3014  H HA3  . GLY A 1 41 ? -1.877  0.821   1.017  1.00 0.00 ? 243 GLY A HA3  3  
ATOM 3015  N N    . VAL A 1 42 ? -0.103  -1.107  2.628  1.00 0.00 ? 244 VAL A N    3  
ATOM 3016  C CA   . VAL A 1 42 ? 0.891   -2.173  2.599  1.00 0.00 ? 244 VAL A CA   3  
ATOM 3017  C C    . VAL A 1 42 ? 0.228   -3.543  2.694  1.00 0.00 ? 244 VAL A C    3  
ATOM 3018  O O    . VAL A 1 42 ? -0.625  -3.772  3.551  1.00 0.00 ? 244 VAL A O    3  
ATOM 3019  C CB   . VAL A 1 42 ? 1.908   -2.031  3.752  1.00 0.00 ? 244 VAL A CB   3  
ATOM 3020  C CG1  . VAL A 1 42 ? 3.137   -2.888  3.495  1.00 0.00 ? 244 VAL A CG1  3  
ATOM 3021  C CG2  . VAL A 1 42 ? 2.303   -0.575  3.954  1.00 0.00 ? 244 VAL A CG2  3  
ATOM 3022  H H    . VAL A 1 42 ? -0.775  -1.100  3.341  1.00 0.00 ? 244 VAL A H    3  
ATOM 3023  H HA   . VAL A 1 42 ? 1.426   -2.106  1.660  1.00 0.00 ? 244 VAL A HA   3  
ATOM 3024  H HB   . VAL A 1 42 ? 1.439   -2.383  4.660  1.00 0.00 ? 244 VAL A HB   3  
ATOM 3025  H HG11 . VAL A 1 42 ? 2.831   -3.892  3.243  1.00 0.00 ? 244 VAL A HG11 3  
ATOM 3026  H HG12 . VAL A 1 42 ? 3.705   -2.468  2.677  1.00 0.00 ? 244 VAL A HG12 3  
ATOM 3027  H HG13 . VAL A 1 42 ? 3.752   -2.912  4.384  1.00 0.00 ? 244 VAL A HG13 3  
ATOM 3028  H HG21 . VAL A 1 42 ? 1.417   0.019   4.115  1.00 0.00 ? 244 VAL A HG21 3  
ATOM 3029  H HG22 . VAL A 1 42 ? 2.951   -0.495  4.816  1.00 0.00 ? 244 VAL A HG22 3  
ATOM 3030  H HG23 . VAL A 1 42 ? 2.823   -0.218  3.079  1.00 0.00 ? 244 VAL A HG23 3  
ATOM 3031  N N    . GLU A 1 43 ? 0.634   -4.454  1.816  1.00 0.00 ? 245 GLU A N    3  
ATOM 3032  C CA   . GLU A 1 43 ? 0.087   -5.803  1.808  1.00 0.00 ? 245 GLU A CA   3  
ATOM 3033  C C    . GLU A 1 43 ? 0.829   -6.669  2.820  1.00 0.00 ? 245 GLU A C    3  
ATOM 3034  O O    . GLU A 1 43 ? 2.009   -6.969  2.645  1.00 0.00 ? 245 GLU A O    3  
ATOM 3035  C CB   . GLU A 1 43 ? 0.196   -6.418  0.413  1.00 0.00 ? 245 GLU A CB   3  
ATOM 3036  C CG   . GLU A 1 43 ? -0.400  -7.813  0.313  1.00 0.00 ? 245 GLU A CG   3  
ATOM 3037  C CD   . GLU A 1 43 ? -0.805  -8.175  -1.103 1.00 0.00 ? 245 GLU A CD   3  
ATOM 3038  O OE1  . GLU A 1 43 ? -0.172  -7.664  -2.050 1.00 0.00 ? 245 GLU A OE1  3  
ATOM 3039  O OE2  . GLU A 1 43 ? -1.756  -8.968  -1.262 1.00 0.00 ? 245 GLU A OE2  3  
ATOM 3040  H H    . GLU A 1 43 ? 1.323   -4.213  1.161  1.00 0.00 ? 245 GLU A H    3  
ATOM 3041  H HA   . GLU A 1 43 ? -0.953  -5.746  2.093  1.00 0.00 ? 245 GLU A HA   3  
ATOM 3042  H HB2  . GLU A 1 43 ? -0.320  -5.779  -0.291 1.00 0.00 ? 245 GLU A HB2  3  
ATOM 3043  H HB3  . GLU A 1 43 ? 1.238   -6.473  0.135  1.00 0.00 ? 245 GLU A HB3  3  
ATOM 3044  H HG2  . GLU A 1 43 ? 0.333   -8.529  0.655  1.00 0.00 ? 245 GLU A HG2  3  
ATOM 3045  H HG3  . GLU A 1 43 ? -1.273  -7.863  0.946  1.00 0.00 ? 245 GLU A HG3  3  
ATOM 3046  N N    . LEU A 1 44 ? 0.136   -7.049  3.885  1.00 0.00 ? 246 LEU A N    3  
ATOM 3047  C CA   . LEU A 1 44 ? 0.739   -7.861  4.933  1.00 0.00 ? 246 LEU A CA   3  
ATOM 3048  C C    . LEU A 1 44 ? 1.063   -9.264  4.434  1.00 0.00 ? 246 LEU A C    3  
ATOM 3049  O O    . LEU A 1 44 ? 0.368   -9.811  3.579  1.00 0.00 ? 246 LEU A O    3  
ATOM 3050  C CB   . LEU A 1 44 ? -0.190  -7.935  6.143  1.00 0.00 ? 246 LEU A CB   3  
ATOM 3051  C CG   . LEU A 1 44 ? -0.472  -6.595  6.823  1.00 0.00 ? 246 LEU A CG   3  
ATOM 3052  C CD1  . LEU A 1 44 ? -1.515  -6.759  7.915  1.00 0.00 ? 246 LEU A CD1  3  
ATOM 3053  C CD2  . LEU A 1 44 ? 0.810   -6.007  7.392  1.00 0.00 ? 246 LEU A CD2  3  
ATOM 3054  H H    . LEU A 1 44 ? -0.798  -6.768  3.974  1.00 0.00 ? 246 LEU A H    3  
ATOM 3055  H HA   . LEU A 1 44 ? 1.658   -7.377  5.228  1.00 0.00 ? 246 LEU A HA   3  
ATOM 3056  H HB2  . LEU A 1 44 ? -1.132  -8.359  5.823  1.00 0.00 ? 246 LEU A HB2  3  
ATOM 3057  H HB3  . LEU A 1 44 ? 0.253   -8.597  6.873  1.00 0.00 ? 246 LEU A HB3  3  
ATOM 3058  H HG   . LEU A 1 44 ? -0.862  -5.901  6.091  1.00 0.00 ? 246 LEU A HG   3  
ATOM 3059  H HD11 . LEU A 1 44 ? -1.231  -7.576  8.562  1.00 0.00 ? 246 LEU A HD11 3  
ATOM 3060  H HD12 . LEU A 1 44 ? -1.582  -5.850  8.491  1.00 0.00 ? 246 LEU A HD12 3  
ATOM 3061  H HD13 . LEU A 1 44 ? -2.475  -6.971  7.466  1.00 0.00 ? 246 LEU A HD13 3  
ATOM 3062  H HD21 . LEU A 1 44 ? 1.352   -6.775  7.926  1.00 0.00 ? 246 LEU A HD21 3  
ATOM 3063  H HD22 . LEU A 1 44 ? 1.423   -5.629  6.588  1.00 0.00 ? 246 LEU A HD22 3  
ATOM 3064  H HD23 . LEU A 1 44 ? 0.568   -5.201  8.069  1.00 0.00 ? 246 LEU A HD23 3  
ATOM 3065  N N    . ASP A 1 45 ? 2.132   -9.837  4.980  1.00 0.00 ? 247 ASP A N    3  
ATOM 3066  C CA   . ASP A 1 45 ? 2.569   -11.175 4.601  1.00 0.00 ? 247 ASP A CA   3  
ATOM 3067  C C    . ASP A 1 45 ? 1.649   -12.243 5.187  1.00 0.00 ? 247 ASP A C    3  
ATOM 3068  O O    . ASP A 1 45 ? 1.507   -13.329 4.625  1.00 0.00 ? 247 ASP A O    3  
ATOM 3069  C CB   . ASP A 1 45 ? 4.007   -11.407 5.069  1.00 0.00 ? 247 ASP A CB   3  
ATOM 3070  C CG   . ASP A 1 45 ? 5.027   -10.781 4.139  1.00 0.00 ? 247 ASP A CG   3  
ATOM 3071  O OD1  . ASP A 1 45 ? 5.262   -11.344 3.049  1.00 0.00 ? 247 ASP A OD1  3  
ATOM 3072  O OD2  . ASP A 1 45 ? 5.589   -9.726  4.500  1.00 0.00 ? 247 ASP A OD2  3  
ATOM 3073  H H    . ASP A 1 45 ? 2.643   -9.343  5.654  1.00 0.00 ? 247 ASP A H    3  
ATOM 3074  H HA   . ASP A 1 45 ? 2.537   -11.242 3.523  1.00 0.00 ? 247 ASP A HA   3  
ATOM 3075  H HB2  . ASP A 1 45 ? 4.132   -10.977 6.052  1.00 0.00 ? 247 ASP A HB2  3  
ATOM 3076  H HB3  . ASP A 1 45 ? 4.197   -12.468 5.121  1.00 0.00 ? 247 ASP A HB3  3  
ATOM 3077  N N    . GLU A 1 46 ? 1.028   -11.930 6.319  1.00 0.00 ? 248 GLU A N    3  
ATOM 3078  C CA   . GLU A 1 46 ? 0.122   -12.865 6.980  1.00 0.00 ? 248 GLU A CA   3  
ATOM 3079  C C    . GLU A 1 46 ? -1.174  -12.170 7.390  1.00 0.00 ? 248 GLU A C    3  
ATOM 3080  O O    . GLU A 1 46 ? -1.278  -10.945 7.320  1.00 0.00 ? 248 GLU A O    3  
ATOM 3081  C CB   . GLU A 1 46 ? 0.798   -13.481 8.208  1.00 0.00 ? 248 GLU A CB   3  
ATOM 3082  C CG   . GLU A 1 46 ? 1.409   -14.848 7.944  1.00 0.00 ? 248 GLU A CG   3  
ATOM 3083  C CD   . GLU A 1 46 ? 2.925   -14.823 7.958  1.00 0.00 ? 248 GLU A CD   3  
ATOM 3084  O OE1  . GLU A 1 46 ? 3.505   -14.542 9.028  1.00 0.00 ? 248 GLU A OE1  3  
ATOM 3085  O OE2  . GLU A 1 46 ? 3.533   -15.083 6.899  1.00 0.00 ? 248 GLU A OE2  3  
ATOM 3086  H H    . GLU A 1 46 ? 1.180   -11.050 6.722  1.00 0.00 ? 248 GLU A H    3  
ATOM 3087  H HA   . GLU A 1 46 ? -0.112  -13.651 6.276  1.00 0.00 ? 248 GLU A HA   3  
ATOM 3088  H HB2  . GLU A 1 46 ? 1.583   -12.818 8.542  1.00 0.00 ? 248 GLU A HB2  3  
ATOM 3089  H HB3  . GLU A 1 46 ? 0.066   -13.583 8.995  1.00 0.00 ? 248 GLU A HB3  3  
ATOM 3090  H HG2  . GLU A 1 46 ? 1.069   -15.532 8.707  1.00 0.00 ? 248 GLU A HG2  3  
ATOM 3091  H HG3  . GLU A 1 46 ? 1.078   -15.195 6.977  1.00 0.00 ? 248 GLU A HG3  3  
ATOM 3092  N N    . PRO A 1 47 ? -2.184  -12.944 7.828  1.00 0.00 ? 249 PRO A N    3  
ATOM 3093  C CA   . PRO A 1 47 ? -3.473  -12.394 8.252  1.00 0.00 ? 249 PRO A CA   3  
ATOM 3094  C C    . PRO A 1 47 ? -3.345  -11.557 9.522  1.00 0.00 ? 249 PRO A C    3  
ATOM 3095  O O    . PRO A 1 47 ? -3.829  -11.941 10.588 1.00 0.00 ? 249 PRO A O    3  
ATOM 3096  C CB   . PRO A 1 47 ? -4.345  -13.634 8.513  1.00 0.00 ? 249 PRO A CB   3  
ATOM 3097  C CG   . PRO A 1 47 ? -3.596  -14.792 7.937  1.00 0.00 ? 249 PRO A CG   3  
ATOM 3098  C CD   . PRO A 1 47 ? -2.144  -14.409 7.946  1.00 0.00 ? 249 PRO A CD   3  
ATOM 3099  H HA   . PRO A 1 47 ? -3.919  -11.793 7.472  1.00 0.00 ? 249 PRO A HA   3  
ATOM 3100  H HB2  . PRO A 1 47 ? -4.494  -13.756 9.574  1.00 0.00 ? 249 PRO A HB2  3  
ATOM 3101  H HB3  . PRO A 1 47 ? -5.302  -13.508 8.027  1.00 0.00 ? 249 PRO A HB3  3  
ATOM 3102  H HG2  . PRO A 1 47 ? -3.753  -15.668 8.549  1.00 0.00 ? 249 PRO A HG2  3  
ATOM 3103  H HG3  . PRO A 1 47 ? -3.928  -14.978 6.926  1.00 0.00 ? 249 PRO A HG3  3  
ATOM 3104  H HD2  . PRO A 1 47 ? -1.680  -14.709 8.875  1.00 0.00 ? 249 PRO A HD2  3  
ATOM 3105  H HD3  . PRO A 1 47 ? -1.630  -14.850 7.106  1.00 0.00 ? 249 PRO A HD3  3  
ATOM 3106  N N    . LEU A 1 48 ? -2.686  -10.410 9.401  1.00 0.00 ? 250 LEU A N    3  
ATOM 3107  C CA   . LEU A 1 48 ? -2.490  -9.516  10.536 1.00 0.00 ? 250 LEU A CA   3  
ATOM 3108  C C    . LEU A 1 48 ? -2.973  -8.104  10.218 1.00 0.00 ? 250 LEU A C    3  
ATOM 3109  O O    . LEU A 1 48 ? -2.483  -7.128  10.786 1.00 0.00 ? 250 LEU A O    3  
ATOM 3110  C CB   . LEU A 1 48 ? -1.013  -9.486  10.939 1.00 0.00 ? 250 LEU A CB   3  
ATOM 3111  C CG   . LEU A 1 48 ? -0.021  -9.497  9.771  1.00 0.00 ? 250 LEU A CG   3  
ATOM 3112  C CD1  . LEU A 1 48 ? 0.923   -8.307  9.853  1.00 0.00 ? 250 LEU A CD1  3  
ATOM 3113  C CD2  . LEU A 1 48 ? 0.767   -10.799 9.750  1.00 0.00 ? 250 LEU A CD2  3  
ATOM 3114  H H    . LEU A 1 48 ? -2.324  -10.159 8.527  1.00 0.00 ? 250 LEU A H    3  
ATOM 3115  H HA   . LEU A 1 48 ? -3.069  -9.900  11.363 1.00 0.00 ? 250 LEU A HA   3  
ATOM 3116  H HB2  . LEU A 1 48 ? -0.842  -8.594  11.524 1.00 0.00 ? 250 LEU A HB2  3  
ATOM 3117  H HB3  . LEU A 1 48 ? -0.815  -10.346 11.559 1.00 0.00 ? 250 LEU A HB3  3  
ATOM 3118  H HG   . LEU A 1 48 ? -0.566  -9.422  8.842  1.00 0.00 ? 250 LEU A HG   3  
ATOM 3119  H HD11 . LEU A 1 48 ? 0.360   -7.393  9.731  1.00 0.00 ? 250 LEU A HD11 3  
ATOM 3120  H HD12 . LEU A 1 48 ? 1.412   -8.302  10.817 1.00 0.00 ? 250 LEU A HD12 3  
ATOM 3121  H HD13 . LEU A 1 48 ? 1.665   -8.381  9.072  1.00 0.00 ? 250 LEU A HD13 3  
ATOM 3122  H HD21 . LEU A 1 48 ? 1.383   -10.860 10.634 1.00 0.00 ? 250 LEU A HD21 3  
ATOM 3123  H HD22 . LEU A 1 48 ? 0.082   -11.633 9.729  1.00 0.00 ? 250 LEU A HD22 3  
ATOM 3124  H HD23 . LEU A 1 48 ? 1.394   -10.826 8.872  1.00 0.00 ? 250 LEU A HD23 3  
ATOM 3125  N N    . GLY A 1 49 ? -3.936  -8.001  9.307  1.00 0.00 ? 251 GLY A N    3  
ATOM 3126  C CA   . GLY A 1 49 ? -4.466  -6.702  8.933  1.00 0.00 ? 251 GLY A CA   3  
ATOM 3127  C C    . GLY A 1 49 ? -5.884  -6.491  9.426  1.00 0.00 ? 251 GLY A C    3  
ATOM 3128  O O    . GLY A 1 49 ? -6.403  -7.293  10.200 1.00 0.00 ? 251 GLY A O    3  
ATOM 3129  H H    . GLY A 1 49 ? -4.290  -8.811  8.887  1.00 0.00 ? 251 GLY A H    3  
ATOM 3130  H HA2  . GLY A 1 49 ? -3.833  -5.935  9.354  1.00 0.00 ? 251 GLY A HA2  3  
ATOM 3131  H HA3  . GLY A 1 49 ? -4.451  -6.615  7.858  1.00 0.00 ? 251 GLY A HA3  3  
ATOM 3132  N N    . LYS A 1 50 ? -6.509  -5.406  8.980  1.00 0.00 ? 252 LYS A N    3  
ATOM 3133  C CA   . LYS A 1 50 ? -7.874  -5.093  9.386  1.00 0.00 ? 252 LYS A CA   3  
ATOM 3134  C C    . LYS A 1 50 ? -8.830  -5.146  8.197  1.00 0.00 ? 252 LYS A C    3  
ATOM 3135  O O    . LYS A 1 50 ? -10.001 -5.495  8.348  1.00 0.00 ? 252 LYS A O    3  
ATOM 3136  C CB   . LYS A 1 50 ? -7.928  -3.708  10.034 1.00 0.00 ? 252 LYS A CB   3  
ATOM 3137  C CG   . LYS A 1 50 ? -6.814  -3.464  11.039 1.00 0.00 ? 252 LYS A CG   3  
ATOM 3138  C CD   . LYS A 1 50 ? -7.044  -4.243  12.324 1.00 0.00 ? 252 LYS A CD   3  
ATOM 3139  C CE   . LYS A 1 50 ? -5.850  -4.140  13.261 1.00 0.00 ? 252 LYS A CE   3  
ATOM 3140  N NZ   . LYS A 1 50 ? -6.268  -3.877  14.666 1.00 0.00 ? 252 LYS A NZ   3  
ATOM 3141  H H    . LYS A 1 50 ? -6.040  -4.802  8.367  1.00 0.00 ? 252 LYS A H    3  
ATOM 3142  H HA   . LYS A 1 50 ? -8.182  -5.831  10.111 1.00 0.00 ? 252 LYS A HA   3  
ATOM 3143  H HB2  . LYS A 1 50 ? -7.857  -2.958  9.262  1.00 0.00 ? 252 LYS A HB2  3  
ATOM 3144  H HB3  . LYS A 1 50 ? -8.874  -3.600  10.545 1.00 0.00 ? 252 LYS A HB3  3  
ATOM 3145  H HG2  . LYS A 1 50 ? -5.875  -3.773  10.606 1.00 0.00 ? 252 LYS A HG2  3  
ATOM 3146  H HG3  . LYS A 1 50 ? -6.777  -2.409  11.271 1.00 0.00 ? 252 LYS A HG3  3  
ATOM 3147  H HD2  . LYS A 1 50 ? -7.915  -3.847  12.825 1.00 0.00 ? 252 LYS A HD2  3  
ATOM 3148  H HD3  . LYS A 1 50 ? -7.208  -5.282  12.079 1.00 0.00 ? 252 LYS A HD3  3  
ATOM 3149  H HE2  . LYS A 1 50 ? -5.300  -5.068  13.228 1.00 0.00 ? 252 LYS A HE2  3  
ATOM 3150  H HE3  . LYS A 1 50 ? -5.213  -3.334  12.927 1.00 0.00 ? 252 LYS A HE3  3  
ATOM 3151  H HZ1  . LYS A 1 50 ? -6.631  -2.906  14.755 1.00 0.00 ? 252 LYS A HZ1  3  
ATOM 3152  H HZ2  . LYS A 1 50 ? -5.457  -3.992  15.308 1.00 0.00 ? 252 LYS A HZ2  3  
ATOM 3153  H HZ3  . LYS A 1 50 ? -7.016  -4.542  14.948 1.00 0.00 ? 252 LYS A HZ3  3  
ATOM 3154  N N    . ASN A 1 51 ? -8.328  -4.795  7.017  1.00 0.00 ? 253 ASN A N    3  
ATOM 3155  C CA   . ASN A 1 51 ? -9.146  -4.804  5.809  1.00 0.00 ? 253 ASN A CA   3  
ATOM 3156  C C    . ASN A 1 51 ? -8.507  -5.658  4.718  1.00 0.00 ? 253 ASN A C    3  
ATOM 3157  O O    . ASN A 1 51 ? -7.341  -6.040  4.815  1.00 0.00 ? 253 ASN A O    3  
ATOM 3158  C CB   . ASN A 1 51 ? -9.358  -3.374  5.300  1.00 0.00 ? 253 ASN A CB   3  
ATOM 3159  C CG   . ASN A 1 51 ? -8.078  -2.743  4.786  1.00 0.00 ? 253 ASN A CG   3  
ATOM 3160  O OD1  . ASN A 1 51 ? -7.896  -2.573  3.580  1.00 0.00 ? 253 ASN A OD1  3  
ATOM 3161  N ND2  . ASN A 1 51 ? -7.181  -2.393  5.701  1.00 0.00 ? 253 ASN A ND2  3  
ATOM 3162  H H    . ASN A 1 51 ? -7.389  -4.524  6.956  1.00 0.00 ? 253 ASN A H    3  
ATOM 3163  H HA   . ASN A 1 51 ? -10.105 -5.228  6.063  1.00 0.00 ? 253 ASN A HA   3  
ATOM 3164  H HB2  . ASN A 1 51 ? -10.077 -3.389  4.494  1.00 0.00 ? 253 ASN A HB2  3  
ATOM 3165  H HB3  . ASN A 1 51 ? -9.740  -2.767  6.105  1.00 0.00 ? 253 ASN A HB3  3  
ATOM 3166  H HD21 . ASN A 1 51 ? -7.395  -2.559  6.644  1.00 0.00 ? 253 ASN A HD21 3  
ATOM 3167  H HD22 . ASN A 1 51 ? -6.344  -1.983  5.394  1.00 0.00 ? 253 ASN A HD22 3  
ATOM 3168  N N    . ASP A 1 52 ? -9.283  -5.953  3.679  1.00 0.00 ? 254 ASP A N    3  
ATOM 3169  C CA   . ASP A 1 52 ? -8.799  -6.761  2.567  1.00 0.00 ? 254 ASP A CA   3  
ATOM 3170  C C    . ASP A 1 52 ? -8.360  -5.880  1.399  1.00 0.00 ? 254 ASP A C    3  
ATOM 3171  O O    . ASP A 1 52 ? -8.369  -6.312  0.245  1.00 0.00 ? 254 ASP A O    3  
ATOM 3172  C CB   . ASP A 1 52 ? -9.886  -7.739  2.109  1.00 0.00 ? 254 ASP A CB   3  
ATOM 3173  C CG   . ASP A 1 52 ? -11.092 -7.032  1.520  1.00 0.00 ? 254 ASP A CG   3  
ATOM 3174  O OD1  . ASP A 1 52 ? -10.925 -6.308  0.515  1.00 0.00 ? 254 ASP A OD1  3  
ATOM 3175  O OD2  . ASP A 1 52 ? -12.203 -7.204  2.063  1.00 0.00 ? 254 ASP A OD2  3  
ATOM 3176  H H    . ASP A 1 52 ? -10.204 -5.618  3.662  1.00 0.00 ? 254 ASP A H    3  
ATOM 3177  H HA   . ASP A 1 52 ? -7.948  -7.326  2.915  1.00 0.00 ? 254 ASP A HA   3  
ATOM 3178  H HB2  . ASP A 1 52 ? -9.477  -8.398  1.357  1.00 0.00 ? 254 ASP A HB2  3  
ATOM 3179  H HB3  . ASP A 1 52 ? -10.212 -8.325  2.954  1.00 0.00 ? 254 ASP A HB3  3  
ATOM 3180  N N    . GLY A 1 53 ? -7.971  -4.645  1.705  1.00 0.00 ? 255 GLY A N    3  
ATOM 3181  C CA   . GLY A 1 53 ? -7.529  -3.729  0.670  1.00 0.00 ? 255 GLY A CA   3  
ATOM 3182  C C    . GLY A 1 53 ? -8.539  -2.630  0.383  1.00 0.00 ? 255 GLY A C    3  
ATOM 3183  O O    . GLY A 1 53 ? -8.477  -1.980  -0.661 1.00 0.00 ? 255 GLY A O    3  
ATOM 3184  H H    . GLY A 1 53 ? -7.978  -4.356  2.641  1.00 0.00 ? 255 GLY A H    3  
ATOM 3185  H HA2  . GLY A 1 53 ? -6.601  -3.272  0.980  1.00 0.00 ? 255 GLY A HA2  3  
ATOM 3186  H HA3  . GLY A 1 53 ? -7.356  -4.287  -0.238 1.00 0.00 ? 255 GLY A HA3  3  
ATOM 3187  N N    . ALA A 1 54 ? -9.472  -2.421  1.308  1.00 0.00 ? 256 ALA A N    3  
ATOM 3188  C CA   . ALA A 1 54 ? -10.492 -1.393  1.142  1.00 0.00 ? 256 ALA A CA   3  
ATOM 3189  C C    . ALA A 1 54 ? -10.730 -0.636  2.443  1.00 0.00 ? 256 ALA A C    3  
ATOM 3190  O O    . ALA A 1 54 ? -10.413 -1.127  3.527  1.00 0.00 ? 256 ALA A O    3  
ATOM 3191  C CB   . ALA A 1 54 ? -11.788 -2.012  0.642  1.00 0.00 ? 256 ALA A CB   3  
ATOM 3192  H H    . ALA A 1 54 ? -9.473  -2.968  2.122  1.00 0.00 ? 256 ALA A H    3  
ATOM 3193  H HA   . ALA A 1 54 ? -10.141 -0.697  0.395  1.00 0.00 ? 256 ALA A HA   3  
ATOM 3194  H HB1  . ALA A 1 54 ? -11.759 -2.087  -0.436 1.00 0.00 ? 256 ALA A HB1  3  
ATOM 3195  H HB2  . ALA A 1 54 ? -11.905 -2.997  1.067  1.00 0.00 ? 256 ALA A HB2  3  
ATOM 3196  H HB3  . ALA A 1 54 ? -12.621 -1.391  0.937  1.00 0.00 ? 256 ALA A HB3  3  
ATOM 3197  N N    . VAL A 1 55 ? -11.290 0.565   2.329  1.00 0.00 ? 257 VAL A N    3  
ATOM 3198  C CA   . VAL A 1 55 ? -11.570 1.394   3.495  1.00 0.00 ? 257 VAL A CA   3  
ATOM 3199  C C    . VAL A 1 55 ? -12.890 2.142   3.333  1.00 0.00 ? 257 VAL A C    3  
ATOM 3200  O O    . VAL A 1 55 ? -13.060 2.928   2.401  1.00 0.00 ? 257 VAL A O    3  
ATOM 3201  C CB   . VAL A 1 55 ? -10.440 2.411   3.742  1.00 0.00 ? 257 VAL A CB   3  
ATOM 3202  C CG1  . VAL A 1 55 ? -10.713 3.228   4.999  1.00 0.00 ? 257 VAL A CG1  3  
ATOM 3203  C CG2  . VAL A 1 55 ? -9.097  1.703   3.838  1.00 0.00 ? 257 VAL A CG2  3  
ATOM 3204  H H    . VAL A 1 55 ? -11.519 0.900   1.437  1.00 0.00 ? 257 VAL A H    3  
ATOM 3205  H HA   . VAL A 1 55 ? -11.639 0.744   4.357  1.00 0.00 ? 257 VAL A HA   3  
ATOM 3206  H HB   . VAL A 1 55 ? -10.404 3.090   2.902  1.00 0.00 ? 257 VAL A HB   3  
ATOM 3207  H HG11 . VAL A 1 55 ? -11.671 2.948   5.411  1.00 0.00 ? 257 VAL A HG11 3  
ATOM 3208  H HG12 . VAL A 1 55 ? -9.938  3.039   5.728  1.00 0.00 ? 257 VAL A HG12 3  
ATOM 3209  H HG13 . VAL A 1 55 ? -10.722 4.278   4.749  1.00 0.00 ? 257 VAL A HG13 3  
ATOM 3210  H HG21 . VAL A 1 55 ? -8.394  2.330   4.366  1.00 0.00 ? 257 VAL A HG21 3  
ATOM 3211  H HG22 . VAL A 1 55 ? -9.219  0.771   4.372  1.00 0.00 ? 257 VAL A HG22 3  
ATOM 3212  H HG23 . VAL A 1 55 ? -8.724  1.503   2.845  1.00 0.00 ? 257 VAL A HG23 3  
ATOM 3213  N N    . ALA A 1 56 ? -13.821 1.894   4.251  1.00 0.00 ? 258 ALA A N    3  
ATOM 3214  C CA   . ALA A 1 56 ? -15.126 2.545   4.214  1.00 0.00 ? 258 ALA A CA   3  
ATOM 3215  C C    . ALA A 1 56 ? -15.833 2.298   2.886  1.00 0.00 ? 258 ALA A C    3  
ATOM 3216  O O    . ALA A 1 56 ? -16.650 3.109   2.448  1.00 0.00 ? 258 ALA A O    3  
ATOM 3217  C CB   . ALA A 1 56 ? -14.974 4.039   4.462  1.00 0.00 ? 258 ALA A CB   3  
ATOM 3218  H H    . ALA A 1 56 ? -13.624 1.259   4.971  1.00 0.00 ? 258 ALA A H    3  
ATOM 3219  H HA   . ALA A 1 56 ? -15.725 2.132   5.013  1.00 0.00 ? 258 ALA A HA   3  
ATOM 3220  H HB1  . ALA A 1 56 ? -14.986 4.564   3.518  1.00 0.00 ? 258 ALA A HB1  3  
ATOM 3221  H HB2  . ALA A 1 56 ? -15.790 4.387   5.077  1.00 0.00 ? 258 ALA A HB2  3  
ATOM 3222  H HB3  . ALA A 1 56 ? -14.039 4.228   4.967  1.00 0.00 ? 258 ALA A HB3  3  
ATOM 3223  N N    . GLY A 1 57 ? -15.517 1.175   2.251  1.00 0.00 ? 259 GLY A N    3  
ATOM 3224  C CA   . GLY A 1 57 ? -16.133 0.846   0.979  1.00 0.00 ? 259 GLY A CA   3  
ATOM 3225  C C    . GLY A 1 57 ? -15.318 1.322   -0.211 1.00 0.00 ? 259 GLY A C    3  
ATOM 3226  O O    . GLY A 1 57 ? -15.752 1.193   -1.356 1.00 0.00 ? 259 GLY A O    3  
ATOM 3227  H H    . GLY A 1 57 ? -14.858 0.566   2.647  1.00 0.00 ? 259 GLY A H    3  
ATOM 3228  H HA2  . GLY A 1 57 ? -16.247 -0.227  0.915  1.00 0.00 ? 259 GLY A HA2  3  
ATOM 3229  H HA3  . GLY A 1 57 ? -17.110 1.303   0.937  1.00 0.00 ? 259 GLY A HA3  3  
ATOM 3230  N N    . THR A 1 58 ? -14.136 1.870   0.055  1.00 0.00 ? 260 THR A N    3  
ATOM 3231  C CA   . THR A 1 58 ? -13.266 2.363   -1.007 1.00 0.00 ? 260 THR A CA   3  
ATOM 3232  C C    . THR A 1 58 ? -12.008 1.508   -1.116 1.00 0.00 ? 260 THR A C    3  
ATOM 3233  O O    . THR A 1 58 ? -11.179 1.485   -0.206 1.00 0.00 ? 260 THR A O    3  
ATOM 3234  C CB   . THR A 1 58 ? -12.884 3.821   -0.746 1.00 0.00 ? 260 THR A CB   3  
ATOM 3235  O OG1  . THR A 1 58 ? -14.037 4.603   -0.488 1.00 0.00 ? 260 THR A OG1  3  
ATOM 3236  C CG2  . THR A 1 58 ? -12.145 4.462   -1.901 1.00 0.00 ? 260 THR A CG2  3  
ATOM 3237  H H    . THR A 1 58 ? -13.840 1.946   0.987  1.00 0.00 ? 260 THR A H    3  
ATOM 3238  H HA   . THR A 1 58 ? -13.811 2.304   -1.936 1.00 0.00 ? 260 THR A HA   3  
ATOM 3239  H HB   . THR A 1 58 ? -12.243 3.866   0.122  1.00 0.00 ? 260 THR A HB   3  
ATOM 3240  H HG1  . THR A 1 58 ? -13.776 5.511   -0.314 1.00 0.00 ? 260 THR A HG1  3  
ATOM 3241  H HG21 . THR A 1 58 ? -11.105 4.167   -1.869 1.00 0.00 ? 260 THR A HG21 3  
ATOM 3242  H HG22 . THR A 1 58 ? -12.217 5.535   -1.825 1.00 0.00 ? 260 THR A HG22 3  
ATOM 3243  H HG23 . THR A 1 58 ? -12.582 4.137   -2.833 1.00 0.00 ? 260 THR A HG23 3  
ATOM 3244  N N    . ARG A 1 59 ? -11.871 0.806   -2.237 1.00 0.00 ? 261 ARG A N    3  
ATOM 3245  C CA   . ARG A 1 59 ? -10.714 -0.050  -2.465 1.00 0.00 ? 261 ARG A CA   3  
ATOM 3246  C C    . ARG A 1 59 ? -9.565  0.743   -3.078 1.00 0.00 ? 261 ARG A C    3  
ATOM 3247  O O    . ARG A 1 59 ? -9.709  1.343   -4.142 1.00 0.00 ? 261 ARG A O    3  
ATOM 3248  C CB   . ARG A 1 59 ? -11.087 -1.219  -3.377 1.00 0.00 ? 261 ARG A CB   3  
ATOM 3249  C CG   . ARG A 1 59 ? -9.962  -2.223  -3.570 1.00 0.00 ? 261 ARG A CG   3  
ATOM 3250  C CD   . ARG A 1 59 ? -9.863  -2.687  -5.015 1.00 0.00 ? 261 ARG A CD   3  
ATOM 3251  N NE   . ARG A 1 59 ? -9.454  -1.608  -5.911 1.00 0.00 ? 261 ARG A NE   3  
ATOM 3252  C CZ   . ARG A 1 59 ? -10.293 -0.899  -6.665 1.00 0.00 ? 261 ARG A CZ   3  
ATOM 3253  N NH1  . ARG A 1 59 ? -11.600 -1.136  -6.631 1.00 0.00 ? 261 ARG A NH1  3  
ATOM 3254  N NH2  . ARG A 1 59 ? -9.826  0.060   -7.454 1.00 0.00 ? 261 ARG A NH2  3  
ATOM 3255  H H    . ARG A 1 59 ? -12.565 0.867   -2.928 1.00 0.00 ? 261 ARG A H    3  
ATOM 3256  H HA   . ARG A 1 59 ? -10.396 -0.439  -1.510 1.00 0.00 ? 261 ARG A HA   3  
ATOM 3257  H HB2  . ARG A 1 59 ? -11.934 -1.735  -2.953 1.00 0.00 ? 261 ARG A HB2  3  
ATOM 3258  H HB3  . ARG A 1 59 ? -11.363 -0.828  -4.345 1.00 0.00 ? 261 ARG A HB3  3  
ATOM 3259  H HG2  . ARG A 1 59 ? -9.029  -1.762  -3.287 1.00 0.00 ? 261 ARG A HG2  3  
ATOM 3260  H HG3  . ARG A 1 59 ? -10.148 -3.080  -2.939 1.00 0.00 ? 261 ARG A HG3  3  
ATOM 3261  H HD2  . ARG A 1 59 ? -9.137  -3.483  -5.073 1.00 0.00 ? 261 ARG A HD2  3  
ATOM 3262  H HD3  . ARG A 1 59 ? -10.827 -3.060  -5.327 1.00 0.00 ? 261 ARG A HD3  3  
ATOM 3263  H HE   . ARG A 1 59 ? -8.496  -1.400  -5.958 1.00 0.00 ? 261 ARG A HE   3  
ATOM 3264  H HH11 . ARG A 1 59 ? -11.964 -1.853  -6.039 1.00 0.00 ? 261 ARG A HH11 3  
ATOM 3265  H HH12 . ARG A 1 59 ? -12.221 -0.599  -7.202 1.00 0.00 ? 261 ARG A HH12 3  
ATOM 3266  H HH21 . ARG A 1 59 ? -8.845  0.248   -7.483 1.00 0.00 ? 261 ARG A HH21 3  
ATOM 3267  H HH22 . ARG A 1 59 ? -10.454 0.593   -8.020 1.00 0.00 ? 261 ARG A HH22 3  
ATOM 3268  N N    . TYR A 1 60 ? -8.422  0.743   -2.398 1.00 0.00 ? 262 TYR A N    3  
ATOM 3269  C CA   . TYR A 1 60 ? -7.248  1.465   -2.876 1.00 0.00 ? 262 TYR A CA   3  
ATOM 3270  C C    . TYR A 1 60 ? -6.320  0.537   -3.653 1.00 0.00 ? 262 TYR A C    3  
ATOM 3271  O O    . TYR A 1 60 ? -5.733  0.931   -4.661 1.00 0.00 ? 262 TYR A O    3  
ATOM 3272  C CB   . TYR A 1 60 ? -6.498  2.096   -1.702 1.00 0.00 ? 262 TYR A CB   3  
ATOM 3273  C CG   . TYR A 1 60 ? -7.255  3.224   -1.038 1.00 0.00 ? 262 TYR A CG   3  
ATOM 3274  C CD1  . TYR A 1 60 ? -8.322  2.965   -0.186 1.00 0.00 ? 262 TYR A CD1  3  
ATOM 3275  C CD2  . TYR A 1 60 ? -6.903  4.549   -1.265 1.00 0.00 ? 262 TYR A CD2  3  
ATOM 3276  C CE1  . TYR A 1 60 ? -9.016  3.995   0.422  1.00 0.00 ? 262 TYR A CE1  3  
ATOM 3277  C CE2  . TYR A 1 60 ? -7.592  5.584   -0.661 1.00 0.00 ? 262 TYR A CE2  3  
ATOM 3278  C CZ   . TYR A 1 60 ? -8.647  5.302   0.180  1.00 0.00 ? 262 TYR A CZ   3  
ATOM 3279  O OH   . TYR A 1 60 ? -9.336  6.330   0.783  1.00 0.00 ? 262 TYR A OH   3  
ATOM 3280  H H    . TYR A 1 60 ? -8.367  0.247   -1.555 1.00 0.00 ? 262 TYR A H    3  
ATOM 3281  H HA   . TYR A 1 60 ? -7.589  2.248   -3.537 1.00 0.00 ? 262 TYR A HA   3  
ATOM 3282  H HB2  . TYR A 1 60 ? -6.311  1.339   -0.955 1.00 0.00 ? 262 TYR A HB2  3  
ATOM 3283  H HB3  . TYR A 1 60 ? -5.555  2.488   -2.055 1.00 0.00 ? 262 TYR A HB3  3  
ATOM 3284  H HD1  . TYR A 1 60 ? -8.608  1.942   0.001  1.00 0.00 ? 262 TYR A HD1  3  
ATOM 3285  H HD2  . TYR A 1 60 ? -6.076  4.767   -1.924 1.00 0.00 ? 262 TYR A HD2  3  
ATOM 3286  H HE1  . TYR A 1 60 ? -9.842  3.774   1.080  1.00 0.00 ? 262 TYR A HE1  3  
ATOM 3287  H HE2  . TYR A 1 60 ? -7.302  6.607   -0.849 1.00 0.00 ? 262 TYR A HE2  3  
ATOM 3288  H HH   . TYR A 1 60 ? -10.272 6.120   0.801  1.00 0.00 ? 262 TYR A HH   3  
ATOM 3289  N N    . PHE A 1 61 ? -6.196  -0.697  -3.179 1.00 0.00 ? 263 PHE A N    3  
ATOM 3290  C CA   . PHE A 1 61 ? -5.342  -1.685  -3.829 1.00 0.00 ? 263 PHE A CA   3  
ATOM 3291  C C    . PHE A 1 61 ? -5.907  -3.091  -3.650 1.00 0.00 ? 263 PHE A C    3  
ATOM 3292  O O    . PHE A 1 61 ? -6.860  -3.295  -2.897 1.00 0.00 ? 263 PHE A O    3  
ATOM 3293  C CB   . PHE A 1 61 ? -3.920  -1.613  -3.269 1.00 0.00 ? 263 PHE A CB   3  
ATOM 3294  C CG   . PHE A 1 61 ? -3.865  -1.506  -1.771 1.00 0.00 ? 263 PHE A CG   3  
ATOM 3295  C CD1  . PHE A 1 61 ? -4.053  -0.285  -1.145 1.00 0.00 ? 263 PHE A CD1  3  
ATOM 3296  C CD2  . PHE A 1 61 ? -3.621  -2.625  -0.992 1.00 0.00 ? 263 PHE A CD2  3  
ATOM 3297  C CE1  . PHE A 1 61 ? -4.001  -0.181  0.231  1.00 0.00 ? 263 PHE A CE1  3  
ATOM 3298  C CE2  . PHE A 1 61 ? -3.567  -2.527  0.387  1.00 0.00 ? 263 PHE A CE2  3  
ATOM 3299  C CZ   . PHE A 1 61 ? -3.756  -1.304  0.999  1.00 0.00 ? 263 PHE A CZ   3  
ATOM 3300  H H    . PHE A 1 61 ? -6.692  -0.952  -2.372 1.00 0.00 ? 263 PHE A H    3  
ATOM 3301  H HA   . PHE A 1 61 ? -5.316  -1.454  -4.882 1.00 0.00 ? 263 PHE A HA   3  
ATOM 3302  H HB2  . PHE A 1 61 ? -3.381  -2.503  -3.556 1.00 0.00 ? 263 PHE A HB2  3  
ATOM 3303  H HB3  . PHE A 1 61 ? -3.422  -0.749  -3.682 1.00 0.00 ? 263 PHE A HB3  3  
ATOM 3304  H HD1  . PHE A 1 61 ? -4.244  0.593   -1.743 1.00 0.00 ? 263 PHE A HD1  3  
ATOM 3305  H HD2  . PHE A 1 61 ? -3.471  -3.582  -1.469 1.00 0.00 ? 263 PHE A HD2  3  
ATOM 3306  H HE1  . PHE A 1 61 ? -4.148  0.777   0.707  1.00 0.00 ? 263 PHE A HE1  3  
ATOM 3307  H HE2  . PHE A 1 61 ? -3.376  -3.406  0.983  1.00 0.00 ? 263 PHE A HE2  3  
ATOM 3308  H HZ   . PHE A 1 61 ? -3.714  -1.225  2.075  1.00 0.00 ? 263 PHE A HZ   3  
ATOM 3309  N N    . GLN A 1 62 ? -5.316  -4.055  -4.347 1.00 0.00 ? 264 GLN A N    3  
ATOM 3310  C CA   . GLN A 1 62 ? -5.767  -5.441  -4.264 1.00 0.00 ? 264 GLN A CA   3  
ATOM 3311  C C    . GLN A 1 62 ? -4.806  -6.278  -3.427 1.00 0.00 ? 264 GLN A C    3  
ATOM 3312  O O    . GLN A 1 62 ? -3.596  -6.269  -3.655 1.00 0.00 ? 264 GLN A O    3  
ATOM 3313  C CB   . GLN A 1 62 ? -5.898  -6.041  -5.666 1.00 0.00 ? 264 GLN A CB   3  
ATOM 3314  C CG   . GLN A 1 62 ? -6.579  -7.399  -5.683 1.00 0.00 ? 264 GLN A CG   3  
ATOM 3315  C CD   . GLN A 1 62 ? -8.086  -7.297  -5.558 1.00 0.00 ? 264 GLN A CD   3  
ATOM 3316  O OE1  . GLN A 1 62 ? -8.772  -6.888  -6.495 1.00 0.00 ? 264 GLN A OE1  3  
ATOM 3317  N NE2  . GLN A 1 62 ? -8.610  -7.668  -4.396 1.00 0.00 ? 264 GLN A NE2  3  
ATOM 3318  H H    . GLN A 1 62 ? -4.563  -3.831  -4.932 1.00 0.00 ? 264 GLN A H    3  
ATOM 3319  H HA   . GLN A 1 62 ? -6.737  -5.444  -3.789 1.00 0.00 ? 264 GLN A HA   3  
ATOM 3320  H HB2  . GLN A 1 62 ? -6.472  -5.366  -6.282 1.00 0.00 ? 264 GLN A HB2  3  
ATOM 3321  H HB3  . GLN A 1 62 ? -4.911  -6.151  -6.090 1.00 0.00 ? 264 GLN A HB3  3  
ATOM 3322  H HG2  . GLN A 1 62 ? -6.343  -7.893  -6.614 1.00 0.00 ? 264 GLN A HG2  3  
ATOM 3323  H HG3  . GLN A 1 62 ? -6.203  -7.988  -4.859 1.00 0.00 ? 264 GLN A HG3  3  
ATOM 3324  H HE21 . GLN A 1 62 ? -8.004  -7.982  -3.694 1.00 0.00 ? 264 GLN A HE21 3  
ATOM 3325  H HE22 . GLN A 1 62 ? -9.583  -7.612  -4.288 1.00 0.00 ? 264 GLN A HE22 3  
ATOM 3326  N N    . CYS A 1 63 ? -5.355  -7.002  -2.458 1.00 0.00 ? 265 CYS A N    3  
ATOM 3327  C CA   . CYS A 1 63 ? -4.551  -7.848  -1.585 1.00 0.00 ? 265 CYS A CA   3  
ATOM 3328  C C    . CYS A 1 63 ? -5.382  -8.998  -1.026 1.00 0.00 ? 265 CYS A C    3  
ATOM 3329  O O    . CYS A 1 63 ? -6.612  -8.952  -1.041 1.00 0.00 ? 265 CYS A O    3  
ATOM 3330  C CB   . CYS A 1 63 ? -3.963  -7.023  -0.439 1.00 0.00 ? 265 CYS A CB   3  
ATOM 3331  S SG   . CYS A 1 63 ? -5.183  -6.042  0.465  1.00 0.00 ? 265 CYS A SG   3  
ATOM 3332  H H    . CYS A 1 63 ? -6.326  -6.968  -2.327 1.00 0.00 ? 265 CYS A H    3  
ATOM 3333  H HA   . CYS A 1 63 ? -3.742  -8.256  -2.174 1.00 0.00 ? 265 CYS A HA   3  
ATOM 3334  H HB2  . CYS A 1 63 ? -3.488  -7.687  0.268  1.00 0.00 ? 265 CYS A HB2  3  
ATOM 3335  H HB3  . CYS A 1 63 ? -3.224  -6.343  -0.836 1.00 0.00 ? 265 CYS A HB3  3  
ATOM 3336  H HG   . CYS A 1 63 ? -4.720  -5.533  1.133  1.00 0.00 ? 265 CYS A HG   3  
ATOM 3337  N N    . GLN A 1 64 ? -4.701  -10.027 -0.532 1.00 0.00 ? 266 GLN A N    3  
ATOM 3338  C CA   . GLN A 1 64 ? -5.380  -11.188 0.032  1.00 0.00 ? 266 GLN A CA   3  
ATOM 3339  C C    . GLN A 1 64 ? -6.242  -10.785 1.227  1.00 0.00 ? 266 GLN A C    3  
ATOM 3340  O O    . GLN A 1 64 ? -6.099  -9.687  1.764  1.00 0.00 ? 266 GLN A O    3  
ATOM 3341  C CB   . GLN A 1 64 ? -4.358  -12.243 0.461  1.00 0.00 ? 266 GLN A CB   3  
ATOM 3342  C CG   . GLN A 1 64 ? -3.861  -13.110 -0.683 1.00 0.00 ? 266 GLN A CG   3  
ATOM 3343  C CD   . GLN A 1 64 ? -4.969  -13.932 -1.314 1.00 0.00 ? 266 GLN A CD   3  
ATOM 3344  O OE1  . GLN A 1 64 ? -5.289  -15.025 -0.848 1.00 0.00 ? 266 GLN A OE1  3  
ATOM 3345  N NE2  . GLN A 1 64 ? -5.558  -13.409 -2.383 1.00 0.00 ? 266 GLN A NE2  3  
ATOM 3346  H H    . GLN A 1 64 ? -3.722  -10.007 -0.548 1.00 0.00 ? 266 GLN A H    3  
ATOM 3347  H HA   . GLN A 1 64 ? -6.017  -11.605 -0.733 1.00 0.00 ? 266 GLN A HA   3  
ATOM 3348  H HB2  . GLN A 1 64 ? -3.507  -11.745 0.902  1.00 0.00 ? 266 GLN A HB2  3  
ATOM 3349  H HB3  . GLN A 1 64 ? -4.809  -12.886 1.202  1.00 0.00 ? 266 GLN A HB3  3  
ATOM 3350  H HG2  . GLN A 1 64 ? -3.431  -12.473 -1.441 1.00 0.00 ? 266 GLN A HG2  3  
ATOM 3351  H HG3  . GLN A 1 64 ? -3.104  -13.782 -0.307 1.00 0.00 ? 266 GLN A HG3  3  
ATOM 3352  H HE21 . GLN A 1 64 ? -5.250  -12.534 -2.698 1.00 0.00 ? 266 GLN A HE21 3  
ATOM 3353  H HE22 . GLN A 1 64 ? -6.278  -13.918 -2.810 1.00 0.00 ? 266 GLN A HE22 3  
ATOM 3354  N N    . PRO A 1 65 ? -7.154  -11.673 1.657  1.00 0.00 ? 267 PRO A N    3  
ATOM 3355  C CA   . PRO A 1 65 ? -8.041  -11.402 2.793  1.00 0.00 ? 267 PRO A CA   3  
ATOM 3356  C C    . PRO A 1 65 ? -7.266  -11.156 4.083  1.00 0.00 ? 267 PRO A C    3  
ATOM 3357  O O    . PRO A 1 65 ? -6.405  -11.952 4.462  1.00 0.00 ? 267 PRO A O    3  
ATOM 3358  C CB   . PRO A 1 65 ? -8.884  -12.677 2.912  1.00 0.00 ? 267 PRO A CB   3  
ATOM 3359  C CG   . PRO A 1 65 ? -8.761  -13.352 1.590  1.00 0.00 ? 267 PRO A CG   3  
ATOM 3360  C CD   . PRO A 1 65 ? -7.394  -13.003 1.075  1.00 0.00 ? 267 PRO A CD   3  
ATOM 3361  H HA   . PRO A 1 65 ? -8.686  -10.557 2.599  1.00 0.00 ? 267 PRO A HA   3  
ATOM 3362  H HB2  . PRO A 1 65 ? -8.494  -13.295 3.709  1.00 0.00 ? 267 PRO A HB2  3  
ATOM 3363  H HB3  . PRO A 1 65 ? -9.910  -12.415 3.126  1.00 0.00 ? 267 PRO A HB3  3  
ATOM 3364  H HG2  . PRO A 1 65 ? -8.854  -14.421 1.713  1.00 0.00 ? 267 PRO A HG2  3  
ATOM 3365  H HG3  . PRO A 1 65 ? -9.520  -12.982 0.916  1.00 0.00 ? 267 PRO A HG3  3  
ATOM 3366  H HD2  . PRO A 1 65 ? -6.665  -13.717 1.426  1.00 0.00 ? 267 PRO A HD2  3  
ATOM 3367  H HD3  . PRO A 1 65 ? -7.396  -12.958 -0.004 1.00 0.00 ? 267 PRO A HD3  3  
ATOM 3368  N N    . LYS A 1 66 ? -7.574  -10.052 4.753  1.00 0.00 ? 268 LYS A N    3  
ATOM 3369  C CA   . LYS A 1 66 ? -6.908  -9.701  6.002  1.00 0.00 ? 268 LYS A CA   3  
ATOM 3370  C C    . LYS A 1 66 ? -5.416  -9.456  5.784  1.00 0.00 ? 268 LYS A C    3  
ATOM 3371  O O    . LYS A 1 66 ? -4.624  -9.525  6.725  1.00 0.00 ? 268 LYS A O    3  
ATOM 3372  C CB   . LYS A 1 66 ? -7.108  -10.807 7.042  1.00 0.00 ? 268 LYS A CB   3  
ATOM 3373  C CG   . LYS A 1 66 ? -8.536  -11.321 7.116  1.00 0.00 ? 268 LYS A CG   3  
ATOM 3374  C CD   . LYS A 1 66 ? -9.457  -10.308 7.776  1.00 0.00 ? 268 LYS A CD   3  
ATOM 3375  C CE   . LYS A 1 66 ? -10.910 -10.749 7.705  1.00 0.00 ? 268 LYS A CE   3  
ATOM 3376  N NZ   . LYS A 1 66 ? -11.281 -11.620 8.854  1.00 0.00 ? 268 LYS A NZ   3  
ATOM 3377  H H    . LYS A 1 66 ? -8.271  -9.459  4.400  1.00 0.00 ? 268 LYS A H    3  
ATOM 3378  H HA   . LYS A 1 66 ? -7.356  -8.791  6.371  1.00 0.00 ? 268 LYS A HA   3  
ATOM 3379  H HB2  . LYS A 1 66 ? -6.460  -11.637 6.796  1.00 0.00 ? 268 LYS A HB2  3  
ATOM 3380  H HB3  . LYS A 1 66 ? -6.833  -10.424 8.014  1.00 0.00 ? 268 LYS A HB3  3  
ATOM 3381  H HG2  . LYS A 1 66 ? -8.890  -11.516 6.115  1.00 0.00 ? 268 LYS A HG2  3  
ATOM 3382  H HG3  . LYS A 1 66 ? -8.549  -12.235 7.691  1.00 0.00 ? 268 LYS A HG3  3  
ATOM 3383  H HD2  . LYS A 1 66 ? -9.174  -10.200 8.812  1.00 0.00 ? 268 LYS A HD2  3  
ATOM 3384  H HD3  . LYS A 1 66 ? -9.353  -9.359  7.271  1.00 0.00 ? 268 LYS A HD3  3  
ATOM 3385  H HE2  . LYS A 1 66 ? -11.539 -9.871  7.712  1.00 0.00 ? 268 LYS A HE2  3  
ATOM 3386  H HE3  . LYS A 1 66 ? -11.063 -11.295 6.786  1.00 0.00 ? 268 LYS A HE3  3  
ATOM 3387  H HZ1  . LYS A 1 66 ? -11.363 -11.052 9.722  1.00 0.00 ? 268 LYS A HZ1  3  
ATOM 3388  H HZ2  . LYS A 1 66 ? -10.557 -12.351 8.998  1.00 0.00 ? 268 LYS A HZ2  3  
ATOM 3389  H HZ3  . LYS A 1 66 ? -12.194 -12.084 8.670  1.00 0.00 ? 268 LYS A HZ3  3  
ATOM 3390  N N    . TYR A 1 67 ? -5.036  -9.167  4.543  1.00 0.00 ? 269 TYR A N    3  
ATOM 3391  C CA   . TYR A 1 67 ? -3.637  -8.908  4.214  1.00 0.00 ? 269 TYR A CA   3  
ATOM 3392  C C    . TYR A 1 67 ? -3.427  -7.445  3.830  1.00 0.00 ? 269 TYR A C    3  
ATOM 3393  O O    . TYR A 1 67 ? -2.451  -7.106  3.162  1.00 0.00 ? 269 TYR A O    3  
ATOM 3394  C CB   . TYR A 1 67 ? -3.181  -9.810  3.066  1.00 0.00 ? 269 TYR A CB   3  
ATOM 3395  C CG   . TYR A 1 67 ? -2.655  -11.154 3.516  1.00 0.00 ? 269 TYR A CG   3  
ATOM 3396  C CD1  . TYR A 1 67 ? -3.298  -11.875 4.512  1.00 0.00 ? 269 TYR A CD1  3  
ATOM 3397  C CD2  . TYR A 1 67 ? -1.515  -11.702 2.941  1.00 0.00 ? 269 TYR A CD2  3  
ATOM 3398  C CE1  . TYR A 1 67 ? -2.822  -13.103 4.927  1.00 0.00 ? 269 TYR A CE1  3  
ATOM 3399  C CE2  . TYR A 1 67 ? -1.031  -12.931 3.349  1.00 0.00 ? 269 TYR A CE2  3  
ATOM 3400  C CZ   . TYR A 1 67 ? -1.688  -13.627 4.341  1.00 0.00 ? 269 TYR A CZ   3  
ATOM 3401  O OH   . TYR A 1 67 ? -1.210  -14.851 4.749  1.00 0.00 ? 269 TYR A OH   3  
ATOM 3402  H H    . TYR A 1 67 ? -5.709  -9.122  3.833  1.00 0.00 ? 269 TYR A H    3  
ATOM 3403  H HA   . TYR A 1 67 ? -3.045  -9.129  5.090  1.00 0.00 ? 269 TYR A HA   3  
ATOM 3404  H HB2  . TYR A 1 67 ? -4.013  -9.987  2.403  1.00 0.00 ? 269 TYR A HB2  3  
ATOM 3405  H HB3  . TYR A 1 67 ? -2.393  -9.312  2.519  1.00 0.00 ? 269 TYR A HB3  3  
ATOM 3406  H HD1  . TYR A 1 67 ? -4.186  -11.461 4.970  1.00 0.00 ? 269 TYR A HD1  3  
ATOM 3407  H HD2  . TYR A 1 67 ? -1.003  -11.155 2.165  1.00 0.00 ? 269 TYR A HD2  3  
ATOM 3408  H HE1  . TYR A 1 67 ? -3.335  -13.647 5.703  1.00 0.00 ? 269 TYR A HE1  3  
ATOM 3409  H HE2  . TYR A 1 67 ? -0.144  -13.341 2.889  1.00 0.00 ? 269 TYR A HE2  3  
ATOM 3410  H HH   . TYR A 1 67 ? -1.937  -15.477 4.801  1.00 0.00 ? 269 TYR A HH   3  
ATOM 3411  N N    . GLY A 1 68 ? -4.349  -6.583  4.250  1.00 0.00 ? 270 GLY A N    3  
ATOM 3412  C CA   . GLY A 1 68 ? -4.240  -5.173  3.931  1.00 0.00 ? 270 GLY A CA   3  
ATOM 3413  C C    . GLY A 1 68 ? -4.249  -4.292  5.166  1.00 0.00 ? 270 GLY A C    3  
ATOM 3414  O O    . GLY A 1 68 ? -5.179  -4.349  5.970  1.00 0.00 ? 270 GLY A O    3  
ATOM 3415  H H    . GLY A 1 68 ? -5.108  -6.907  4.777  1.00 0.00 ? 270 GLY A H    3  
ATOM 3416  H HA2  . GLY A 1 68 ? -3.318  -5.005  3.393  1.00 0.00 ? 270 GLY A HA2  3  
ATOM 3417  H HA3  . GLY A 1 68 ? -5.069  -4.892  3.298  1.00 0.00 ? 270 GLY A HA3  3  
ATOM 3418  N N    . LEU A 1 69 ? -3.213  -3.475  5.313  1.00 0.00 ? 271 LEU A N    3  
ATOM 3419  C CA   . LEU A 1 69 ? -3.104  -2.576  6.454  1.00 0.00 ? 271 LEU A CA   3  
ATOM 3420  C C    . LEU A 1 69 ? -2.786  -1.157  5.993  1.00 0.00 ? 271 LEU A C    3  
ATOM 3421  O O    . LEU A 1 69 ? -1.822  -0.933  5.262  1.00 0.00 ? 271 LEU A O    3  
ATOM 3422  C CB   . LEU A 1 69 ? -2.024  -3.068  7.419  1.00 0.00 ? 271 LEU A CB   3  
ATOM 3423  C CG   . LEU A 1 69 ? -2.249  -2.703  8.887  1.00 0.00 ? 271 LEU A CG   3  
ATOM 3424  C CD1  . LEU A 1 69 ? -3.512  -3.366  9.417  1.00 0.00 ? 271 LEU A CD1  3  
ATOM 3425  C CD2  . LEU A 1 69 ? -1.042  -3.100  9.724  1.00 0.00 ? 271 LEU A CD2  3  
ATOM 3426  H H    . LEU A 1 69 ? -2.505  -3.476  4.636  1.00 0.00 ? 271 LEU A H    3  
ATOM 3427  H HA   . LEU A 1 69 ? -4.056  -2.571  6.964  1.00 0.00 ? 271 LEU A HA   3  
ATOM 3428  H HB2  . LEU A 1 69 ? -1.967  -4.146  7.341  1.00 0.00 ? 271 LEU A HB2  3  
ATOM 3429  H HB3  . LEU A 1 69 ? -1.077  -2.652  7.108  1.00 0.00 ? 271 LEU A HB3  3  
ATOM 3430  H HG   . LEU A 1 69 ? -2.376  -1.633  8.968  1.00 0.00 ? 271 LEU A HG   3  
ATOM 3431  H HD11 . LEU A 1 69 ? -3.243  -4.189  10.062 1.00 0.00 ? 271 LEU A HD11 3  
ATOM 3432  H HD12 . LEU A 1 69 ? -4.090  -2.645  9.977  1.00 0.00 ? 271 LEU A HD12 3  
ATOM 3433  H HD13 . LEU A 1 69 ? -4.101  -3.734  8.590  1.00 0.00 ? 271 LEU A HD13 3  
ATOM 3434  H HD21 . LEU A 1 69 ? -0.490  -3.876  9.215  1.00 0.00 ? 271 LEU A HD21 3  
ATOM 3435  H HD22 . LEU A 1 69 ? -0.405  -2.240  9.868  1.00 0.00 ? 271 LEU A HD22 3  
ATOM 3436  H HD23 . LEU A 1 69 ? -1.375  -3.467  10.685 1.00 0.00 ? 271 LEU A HD23 3  
ATOM 3437  N N    . PHE A 1 70 ? -3.610  -0.205  6.418  1.00 0.00 ? 272 PHE A N    3  
ATOM 3438  C CA   . PHE A 1 70 ? -3.422  1.193   6.043  1.00 0.00 ? 272 PHE A CA   3  
ATOM 3439  C C    . PHE A 1 70 ? -2.730  1.972   7.156  1.00 0.00 ? 272 PHE A C    3  
ATOM 3440  O O    . PHE A 1 70 ? -3.308  2.188   8.219  1.00 0.00 ? 272 PHE A O    3  
ATOM 3441  C CB   . PHE A 1 70 ? -4.774  1.838   5.729  1.00 0.00 ? 272 PHE A CB   3  
ATOM 3442  C CG   . PHE A 1 70 ? -5.317  1.478   4.375  1.00 0.00 ? 272 PHE A CG   3  
ATOM 3443  C CD1  . PHE A 1 70 ? -5.414  0.154   3.981  1.00 0.00 ? 272 PHE A CD1  3  
ATOM 3444  C CD2  . PHE A 1 70 ? -5.734  2.468   3.498  1.00 0.00 ? 272 PHE A CD2  3  
ATOM 3445  C CE1  . PHE A 1 70 ? -5.920  -0.179  2.738  1.00 0.00 ? 272 PHE A CE1  3  
ATOM 3446  C CE2  . PHE A 1 70 ? -6.239  2.142   2.254  1.00 0.00 ? 272 PHE A CE2  3  
ATOM 3447  C CZ   . PHE A 1 70 ? -6.332  0.818   1.873  1.00 0.00 ? 272 PHE A CZ   3  
ATOM 3448  H H    . PHE A 1 70 ? -4.364  -0.447  6.995  1.00 0.00 ? 272 PHE A H    3  
ATOM 3449  H HA   . PHE A 1 70 ? -2.803  1.221   5.158  1.00 0.00 ? 272 PHE A HA   3  
ATOM 3450  H HB2  . PHE A 1 70 ? -5.493  1.521   6.469  1.00 0.00 ? 272 PHE A HB2  3  
ATOM 3451  H HB3  . PHE A 1 70 ? -4.670  2.910   5.773  1.00 0.00 ? 272 PHE A HB3  3  
ATOM 3452  H HD1  . PHE A 1 70 ? -5.094  -0.625  4.657  1.00 0.00 ? 272 PHE A HD1  3  
ATOM 3453  H HD2  . PHE A 1 70 ? -5.661  3.504   3.795  1.00 0.00 ? 272 PHE A HD2  3  
ATOM 3454  H HE1  . PHE A 1 70 ? -5.990  -1.214  2.443  1.00 0.00 ? 272 PHE A HE1  3  
ATOM 3455  H HE2  . PHE A 1 70 ? -6.559  2.922   1.580  1.00 0.00 ? 272 PHE A HE2  3  
ATOM 3456  H HZ   . PHE A 1 70 ? -6.727  0.560   0.902  1.00 0.00 ? 272 PHE A HZ   3  
ATOM 3457  N N    . ALA A 1 71 ? -1.498  2.404   6.904  1.00 0.00 ? 273 ALA A N    3  
ATOM 3458  C CA   . ALA A 1 71 ? -0.741  3.170   7.888  1.00 0.00 ? 273 ALA A CA   3  
ATOM 3459  C C    . ALA A 1 71 ? 0.025   4.314   7.227  1.00 0.00 ? 273 ALA A C    3  
ATOM 3460  O O    . ALA A 1 71 ? 0.426   4.218   6.067  1.00 0.00 ? 273 ALA A O    3  
ATOM 3461  C CB   . ALA A 1 71 ? 0.213   2.271   8.661  1.00 0.00 ? 273 ALA A CB   3  
ATOM 3462  H H    . ALA A 1 71 ? -1.090  2.208   6.034  1.00 0.00 ? 273 ALA A H    3  
ATOM 3463  H HA   . ALA A 1 71 ? -1.448  3.588   8.593  1.00 0.00 ? 273 ALA A HA   3  
ATOM 3464  H HB1  . ALA A 1 71 ? -0.292  1.357   8.933  1.00 0.00 ? 273 ALA A HB1  3  
ATOM 3465  H HB2  . ALA A 1 71 ? 1.070   2.041   8.045  1.00 0.00 ? 273 ALA A HB2  3  
ATOM 3466  H HB3  . ALA A 1 71 ? 0.542   2.780   9.556  1.00 0.00 ? 273 ALA A HB3  3  
ATOM 3467  N N    . PRO A 1 72 ? 0.236   5.416   7.965  1.00 0.00 ? 274 PRO A N    3  
ATOM 3468  C CA   . PRO A 1 72 ? 0.954   6.589   7.458  1.00 0.00 ? 274 PRO A CA   3  
ATOM 3469  C C    . PRO A 1 72 ? 2.305   6.233   6.849  1.00 0.00 ? 274 PRO A C    3  
ATOM 3470  O O    . PRO A 1 72 ? 2.842   5.152   7.093  1.00 0.00 ? 274 PRO A O    3  
ATOM 3471  C CB   . PRO A 1 72 ? 1.156   7.452   8.702  1.00 0.00 ? 274 PRO A CB   3  
ATOM 3472  C CG   . PRO A 1 72 ? 0.069   7.049   9.636  1.00 0.00 ? 274 PRO A CG   3  
ATOM 3473  C CD   . PRO A 1 72 ? -0.217  5.601   9.354  1.00 0.00 ? 274 PRO A CD   3  
ATOM 3474  H HA   . PRO A 1 72 ? 0.366   7.131   6.732  1.00 0.00 ? 274 PRO A HA   3  
ATOM 3475  H HB2  . PRO A 1 72 ? 2.129   7.250   9.121  1.00 0.00 ? 274 PRO A HB2  3  
ATOM 3476  H HB3  . PRO A 1 72 ? 1.082   8.495   8.436  1.00 0.00 ? 274 PRO A HB3  3  
ATOM 3477  H HG2  . PRO A 1 72 ? 0.403   7.171   10.655 1.00 0.00 ? 274 PRO A HG2  3  
ATOM 3478  H HG3  . PRO A 1 72 ? -0.811  7.648   9.454  1.00 0.00 ? 274 PRO A HG3  3  
ATOM 3479  H HD2  . PRO A 1 72 ? 0.342   4.969   10.027 1.00 0.00 ? 274 PRO A HD2  3  
ATOM 3480  H HD3  . PRO A 1 72 ? -1.274  5.403   9.440  1.00 0.00 ? 274 PRO A HD3  3  
ATOM 3481  N N    . VAL A 1 73 ? 2.850   7.153   6.062  1.00 0.00 ? 275 VAL A N    3  
ATOM 3482  C CA   . VAL A 1 73 ? 4.142   6.943   5.424  1.00 0.00 ? 275 VAL A CA   3  
ATOM 3483  C C    . VAL A 1 73 ? 5.270   6.991   6.451  1.00 0.00 ? 275 VAL A C    3  
ATOM 3484  O O    . VAL A 1 73 ? 6.285   6.310   6.304  1.00 0.00 ? 275 VAL A O    3  
ATOM 3485  C CB   . VAL A 1 73 ? 4.407   7.998   4.329  1.00 0.00 ? 275 VAL A CB   3  
ATOM 3486  C CG1  . VAL A 1 73 ? 4.426   9.397   4.926  1.00 0.00 ? 275 VAL A CG1  3  
ATOM 3487  C CG2  . VAL A 1 73 ? 5.711   7.700   3.604  1.00 0.00 ? 275 VAL A CG2  3  
ATOM 3488  H H    . VAL A 1 73 ? 2.374   7.997   5.910  1.00 0.00 ? 275 VAL A H    3  
ATOM 3489  H HA   . VAL A 1 73 ? 4.132   5.967   4.960  1.00 0.00 ? 275 VAL A HA   3  
ATOM 3490  H HB   . VAL A 1 73 ? 3.602   7.948   3.611  1.00 0.00 ? 275 VAL A HB   3  
ATOM 3491  H HG11 . VAL A 1 73 ? 5.077   9.413   5.787  1.00 0.00 ? 275 VAL A HG11 3  
ATOM 3492  H HG12 . VAL A 1 73 ? 4.789   10.097  4.187  1.00 0.00 ? 275 VAL A HG12 3  
ATOM 3493  H HG13 . VAL A 1 73 ? 3.427   9.674   5.225  1.00 0.00 ? 275 VAL A HG13 3  
ATOM 3494  H HG21 . VAL A 1 73 ? 5.976   6.663   3.750  1.00 0.00 ? 275 VAL A HG21 3  
ATOM 3495  H HG22 . VAL A 1 73 ? 5.587   7.894   2.548  1.00 0.00 ? 275 VAL A HG22 3  
ATOM 3496  H HG23 . VAL A 1 73 ? 6.493   8.331   3.996  1.00 0.00 ? 275 VAL A HG23 3  
ATOM 3497  N N    . HIS A 1 74 ? 5.084   7.798   7.493  1.00 0.00 ? 276 HIS A N    3  
ATOM 3498  C CA   . HIS A 1 74 ? 6.087   7.930   8.543  1.00 0.00 ? 276 HIS A CA   3  
ATOM 3499  C C    . HIS A 1 74 ? 6.070   6.717   9.468  1.00 0.00 ? 276 HIS A C    3  
ATOM 3500  O O    . HIS A 1 74 ? 7.080   6.383   10.088 1.00 0.00 ? 276 HIS A O    3  
ATOM 3501  C CB   . HIS A 1 74 ? 5.861   9.210   9.350  1.00 0.00 ? 276 HIS A CB   3  
ATOM 3502  C CG   . HIS A 1 74 ? 4.450   9.393   9.819  1.00 0.00 ? 276 HIS A CG   3  
ATOM 3503  N ND1  . HIS A 1 74 ? 3.745   10.565  9.642  1.00 0.00 ? 276 HIS A ND1  3  
ATOM 3504  C CD2  . HIS A 1 74 ? 3.612   8.548   10.467 1.00 0.00 ? 276 HIS A CD2  3  
ATOM 3505  C CE1  . HIS A 1 74 ? 2.537   10.434  10.162 1.00 0.00 ? 276 HIS A CE1  3  
ATOM 3506  N NE2  . HIS A 1 74 ? 2.432   9.220   10.668 1.00 0.00 ? 276 HIS A NE2  3  
ATOM 3507  H H    . HIS A 1 74 ? 4.253   8.314   7.555  1.00 0.00 ? 276 HIS A H    3  
ATOM 3508  H HA   . HIS A 1 74 ? 7.055   7.985   8.066  1.00 0.00 ? 276 HIS A HA   3  
ATOM 3509  H HB2  . HIS A 1 74 ? 6.498   9.195   10.221 1.00 0.00 ? 276 HIS A HB2  3  
ATOM 3510  H HB3  . HIS A 1 74 ? 6.120   10.062  8.737  1.00 0.00 ? 276 HIS A HB3  3  
ATOM 3511  H HD1  . HIS A 1 74 ? 4.080   11.374  9.201  1.00 0.00 ? 276 HIS A HD1  3  
ATOM 3512  H HD2  . HIS A 1 74 ? 3.829   7.530   10.764 1.00 0.00 ? 276 HIS A HD2  3  
ATOM 3513  H HE1  . HIS A 1 74 ? 1.767   11.191  10.169 1.00 0.00 ? 276 HIS A HE1  3  
ATOM 3514  H HE2  . HIS A 1 74 ? 1.673   8.892   11.195 1.00 0.00 ? 276 HIS A HE2  3  
ATOM 3515  N N    . LYS A 1 75 ? 4.920   6.053   9.551  1.00 0.00 ? 277 LYS A N    3  
ATOM 3516  C CA   . LYS A 1 75 ? 4.781   4.873   10.396 1.00 0.00 ? 277 LYS A CA   3  
ATOM 3517  C C    . LYS A 1 75 ? 5.358   3.643   9.706  1.00 0.00 ? 277 LYS A C    3  
ATOM 3518  O O    . LYS A 1 75 ? 5.676   2.647   10.355 1.00 0.00 ? 277 LYS A O    3  
ATOM 3519  C CB   . LYS A 1 75 ? 3.312   4.627   10.743 1.00 0.00 ? 277 LYS A CB   3  
ATOM 3520  C CG   . LYS A 1 75 ? 2.800   5.487   11.887 1.00 0.00 ? 277 LYS A CG   3  
ATOM 3521  C CD   . LYS A 1 75 ? 2.382   4.638   13.078 1.00 0.00 ? 277 LYS A CD   3  
ATOM 3522  C CE   . LYS A 1 75 ? 3.463   4.594   14.145 1.00 0.00 ? 277 LYS A CE   3  
ATOM 3523  N NZ   . LYS A 1 75 ? 4.819   4.405   13.560 1.00 0.00 ? 277 LYS A NZ   3  
ATOM 3524  H H    . LYS A 1 75 ? 4.149   6.361   9.030  1.00 0.00 ? 277 LYS A H    3  
ATOM 3525  H HA   . LYS A 1 75 ? 5.331   5.051   11.307 1.00 0.00 ? 277 LYS A HA   3  
ATOM 3526  H HB2  . LYS A 1 75 ? 2.709   4.834   9.870  1.00 0.00 ? 277 LYS A HB2  3  
ATOM 3527  H HB3  . LYS A 1 75 ? 3.187   3.589   11.015 1.00 0.00 ? 277 LYS A HB3  3  
ATOM 3528  H HG2  . LYS A 1 75 ? 3.584   6.160   12.197 1.00 0.00 ? 277 LYS A HG2  3  
ATOM 3529  H HG3  . LYS A 1 75 ? 1.949   6.055   11.545 1.00 0.00 ? 277 LYS A HG3  3  
ATOM 3530  H HD2  . LYS A 1 75 ? 1.485   5.056   13.508 1.00 0.00 ? 277 LYS A HD2  3  
ATOM 3531  H HD3  . LYS A 1 75 ? 2.182   3.631   12.737 1.00 0.00 ? 277 LYS A HD3  3  
ATOM 3532  H HE2  . LYS A 1 75 ? 3.445   5.522   14.697 1.00 0.00 ? 277 LYS A HE2  3  
ATOM 3533  H HE3  . LYS A 1 75 ? 3.253   3.773   14.818 1.00 0.00 ? 277 LYS A HE3  3  
ATOM 3534  H HZ1  . LYS A 1 75 ? 5.214   5.323   13.270 1.00 0.00 ? 277 LYS A HZ1  3  
ATOM 3535  H HZ2  . LYS A 1 75 ? 4.766   3.784   12.727 1.00 0.00 ? 277 LYS A HZ2  3  
ATOM 3536  H HZ3  . LYS A 1 75 ? 5.455   3.973   14.260 1.00 0.00 ? 277 LYS A HZ3  3  
ATOM 3537  N N    . VAL A 1 76 ? 5.496   3.720   8.385  1.00 0.00 ? 278 VAL A N    3  
ATOM 3538  C CA   . VAL A 1 76 ? 6.037   2.611   7.615  1.00 0.00 ? 278 VAL A CA   3  
ATOM 3539  C C    . VAL A 1 76 ? 7.519   2.810   7.331  1.00 0.00 ? 278 VAL A C    3  
ATOM 3540  O O    . VAL A 1 76 ? 7.967   3.922   7.055  1.00 0.00 ? 278 VAL A O    3  
ATOM 3541  C CB   . VAL A 1 76 ? 5.292   2.423   6.282  1.00 0.00 ? 278 VAL A CB   3  
ATOM 3542  C CG1  . VAL A 1 76 ? 5.714   1.122   5.618  1.00 0.00 ? 278 VAL A CG1  3  
ATOM 3543  C CG2  . VAL A 1 76 ? 3.786   2.451   6.496  1.00 0.00 ? 278 VAL A CG2  3  
ATOM 3544  H H    . VAL A 1 76 ? 5.225   4.540   7.921  1.00 0.00 ? 278 VAL A H    3  
ATOM 3545  H HA   . VAL A 1 76 ? 5.916   1.714   8.201  1.00 0.00 ? 278 VAL A HA   3  
ATOM 3546  H HB   . VAL A 1 76 ? 5.557   3.238   5.626  1.00 0.00 ? 278 VAL A HB   3  
ATOM 3547  H HG11 . VAL A 1 76 ? 4.902   0.411   5.672  1.00 0.00 ? 278 VAL A HG11 3  
ATOM 3548  H HG12 . VAL A 1 76 ? 5.959   1.310   4.584  1.00 0.00 ? 278 VAL A HG12 3  
ATOM 3549  H HG13 . VAL A 1 76 ? 6.577   0.719   6.125  1.00 0.00 ? 278 VAL A HG13 3  
ATOM 3550  H HG21 . VAL A 1 76 ? 3.353   1.533   6.127  1.00 0.00 ? 278 VAL A HG21 3  
ATOM 3551  H HG22 . VAL A 1 76 ? 3.575   2.551   7.550  1.00 0.00 ? 278 VAL A HG22 3  
ATOM 3552  H HG23 . VAL A 1 76 ? 3.365   3.289   5.962  1.00 0.00 ? 278 VAL A HG23 3  
ATOM 3553  N N    . THR A 1 77 ? 8.274   1.721   7.404  1.00 0.00 ? 279 THR A N    3  
ATOM 3554  C CA   . THR A 1 77 ? 9.708   1.766   7.158  1.00 0.00 ? 279 THR A CA   3  
ATOM 3555  C C    . THR A 1 77 ? 10.159  0.557   6.348  1.00 0.00 ? 279 THR A C    3  
ATOM 3556  O O    . THR A 1 77 ? 9.668   -0.555  6.549  1.00 0.00 ? 279 THR A O    3  
ATOM 3557  C CB   . THR A 1 77 ? 10.465  1.820   8.484  1.00 0.00 ? 279 THR A CB   3  
ATOM 3558  O OG1  . THR A 1 77 ? 9.612   2.248   9.533  1.00 0.00 ? 279 THR A OG1  3  
ATOM 3559  C CG2  . THR A 1 77 ? 11.658  2.748   8.457  1.00 0.00 ? 279 THR A CG2  3  
ATOM 3560  H H    . THR A 1 77 ? 7.855   0.865   7.631  1.00 0.00 ? 279 THR A H    3  
ATOM 3561  H HA   . THR A 1 77 ? 9.921   2.663   6.595  1.00 0.00 ? 279 THR A HA   3  
ATOM 3562  H HB   . THR A 1 77 ? 10.821  0.827   8.722  1.00 0.00 ? 279 THR A HB   3  
ATOM 3563  H HG1  . THR A 1 77 ? 9.112   3.015   9.245  1.00 0.00 ? 279 THR A HG1  3  
ATOM 3564  H HG21 . THR A 1 77 ? 11.485  3.534   7.736  1.00 0.00 ? 279 THR A HG21 3  
ATOM 3565  H HG22 . THR A 1 77 ? 12.541  2.192   8.179  1.00 0.00 ? 279 THR A HG22 3  
ATOM 3566  H HG23 . THR A 1 77 ? 11.799  3.183   9.436  1.00 0.00 ? 279 THR A HG23 3  
ATOM 3567  N N    . LYS A 1 78 ? 11.099  0.776   5.436  1.00 0.00 ? 280 LYS A N    3  
ATOM 3568  C CA   . LYS A 1 78 ? 11.616  -0.299  4.600  1.00 0.00 ? 280 LYS A CA   3  
ATOM 3569  C C    . LYS A 1 78 ? 12.352  -1.334  5.445  1.00 0.00 ? 280 LYS A C    3  
ATOM 3570  O O    . LYS A 1 78 ? 13.247  -0.993  6.219  1.00 0.00 ? 280 LYS A O    3  
ATOM 3571  C CB   . LYS A 1 78 ? 12.547  0.265   3.524  1.00 0.00 ? 280 LYS A CB   3  
ATOM 3572  C CG   . LYS A 1 78 ? 12.110  -0.066  2.106  1.00 0.00 ? 280 LYS A CG   3  
ATOM 3573  C CD   . LYS A 1 78 ? 13.207  0.241   1.100  1.00 0.00 ? 280 LYS A CD   3  
ATOM 3574  C CE   . LYS A 1 78 ? 14.069  -0.980  0.825  1.00 0.00 ? 280 LYS A CE   3  
ATOM 3575  N NZ   . LYS A 1 78 ? 15.370  -0.613  0.203  1.00 0.00 ? 280 LYS A NZ   3  
ATOM 3576  H H    . LYS A 1 78 ? 11.453  1.682   5.322  1.00 0.00 ? 280 LYS A H    3  
ATOM 3577  H HA   . LYS A 1 78 ? 10.775  -0.779  4.120  1.00 0.00 ? 280 LYS A HA   3  
ATOM 3578  H HB2  . LYS A 1 78 ? 12.584  1.339   3.624  1.00 0.00 ? 280 LYS A HB2  3  
ATOM 3579  H HB3  . LYS A 1 78 ? 13.539  -0.136  3.673  1.00 0.00 ? 280 LYS A HB3  3  
ATOM 3580  H HG2  . LYS A 1 78 ? 11.867  -1.116  2.050  1.00 0.00 ? 280 LYS A HG2  3  
ATOM 3581  H HG3  . LYS A 1 78 ? 11.236  0.521   1.864  1.00 0.00 ? 280 LYS A HG3  3  
ATOM 3582  H HD2  . LYS A 1 78 ? 12.752  0.563   0.174  1.00 0.00 ? 280 LYS A HD2  3  
ATOM 3583  H HD3  . LYS A 1 78 ? 13.830  1.030   1.490  1.00 0.00 ? 280 LYS A HD3  3  
ATOM 3584  H HE2  . LYS A 1 78 ? 14.257  -1.489  1.760  1.00 0.00 ? 280 LYS A HE2  3  
ATOM 3585  H HE3  . LYS A 1 78 ? 13.533  -1.641  0.159  1.00 0.00 ? 280 LYS A HE3  3  
ATOM 3586  H HZ1  . LYS A 1 78 ? 15.804  -1.450  -0.238 1.00 0.00 ? 280 LYS A HZ1  3  
ATOM 3587  H HZ2  . LYS A 1 78 ? 16.019  -0.238  0.925  1.00 0.00 ? 280 LYS A HZ2  3  
ATOM 3588  H HZ3  . LYS A 1 78 ? 15.224  0.112   -0.527 1.00 0.00 ? 280 LYS A HZ3  3  
ATOM 3589  N N    . ILE A 1 79 ? 11.971  -2.596  5.292  1.00 0.00 ? 281 ILE A N    3  
ATOM 3590  C CA   . ILE A 1 79 ? 12.596  -3.680  6.042  1.00 0.00 ? 281 ILE A CA   3  
ATOM 3591  C C    . ILE A 1 79 ? 14.037  -3.903  5.592  1.00 0.00 ? 281 ILE A C    3  
ATOM 3592  O O    . ILE A 1 79 ? 14.865  -4.401  6.354  1.00 0.00 ? 281 ILE A O    3  
ATOM 3593  C CB   . ILE A 1 79 ? 11.804  -4.995  5.889  1.00 0.00 ? 281 ILE A CB   3  
ATOM 3594  C CG1  . ILE A 1 79 ? 12.435  -6.103  6.735  1.00 0.00 ? 281 ILE A CG1  3  
ATOM 3595  C CG2  . ILE A 1 79 ? 11.738  -5.410  4.427  1.00 0.00 ? 281 ILE A CG2  3  
ATOM 3596  C CD1  . ILE A 1 79 ? 11.422  -6.989  7.424  1.00 0.00 ? 281 ILE A CD1  3  
ATOM 3597  H H    . ILE A 1 79 ? 11.252  -2.805  4.659  1.00 0.00 ? 281 ILE A H    3  
ATOM 3598  H HA   . ILE A 1 79 ? 12.594  -3.404  7.086  1.00 0.00 ? 281 ILE A HA   3  
ATOM 3599  H HB   . ILE A 1 79 ? 10.796  -4.822  6.233  1.00 0.00 ? 281 ILE A HB   3  
ATOM 3600  H HG12 . ILE A 1 79 ? 13.046  -6.729  6.101  1.00 0.00 ? 281 ILE A HG12 3  
ATOM 3601  H HG13 . ILE A 1 79 ? 13.058  -5.656  7.497  1.00 0.00 ? 281 ILE A HG13 3  
ATOM 3602  H HG21 . ILE A 1 79 ? 10.951  -4.857  3.933  1.00 0.00 ? 281 ILE A HG21 3  
ATOM 3603  H HG22 . ILE A 1 79 ? 12.681  -5.197  3.949  1.00 0.00 ? 281 ILE A HG22 3  
ATOM 3604  H HG23 . ILE A 1 79 ? 11.530  -6.467  4.362  1.00 0.00 ? 281 ILE A HG23 3  
ATOM 3605  H HD11 . ILE A 1 79 ? 10.578  -7.148  6.769  1.00 0.00 ? 281 ILE A HD11 3  
ATOM 3606  H HD12 . ILE A 1 79 ? 11.876  -7.940  7.662  1.00 0.00 ? 281 ILE A HD12 3  
ATOM 3607  H HD13 . ILE A 1 79 ? 11.085  -6.513  8.334  1.00 0.00 ? 281 ILE A HD13 3  
ATOM 3608  N N    . GLY A 1 80 ? 14.330  -3.530  4.349  1.00 0.00 ? 282 GLY A N    3  
ATOM 3609  C CA   . GLY A 1 80 ? 15.673  -3.697  3.822  1.00 0.00 ? 282 GLY A CA   3  
ATOM 3610  C C    . GLY A 1 80 ? 16.714  -2.962  4.644  1.00 0.00 ? 282 GLY A C    3  
ATOM 3611  O O    . GLY A 1 80 ? 16.439  -2.530  5.763  1.00 0.00 ? 282 GLY A O    3  
ATOM 3612  H H    . GLY A 1 80 ? 13.633  -3.138  3.785  1.00 0.00 ? 282 GLY A H    3  
ATOM 3613  H HA2  . GLY A 1 80 ? 15.915  -4.749  3.814  1.00 0.00 ? 282 GLY A HA2  3  
ATOM 3614  H HA3  . GLY A 1 80 ? 15.700  -3.324  2.810  1.00 0.00 ? 282 GLY A HA3  3  
ATOM 3615  N N    . PHE A 1 81 ? 17.912  -2.817  4.087  1.00 0.00 ? 283 PHE A N    3  
ATOM 3616  C CA   . PHE A 1 81 ? 18.998  -2.130  4.775  1.00 0.00 ? 283 PHE A CA   3  
ATOM 3617  C C    . PHE A 1 81 ? 19.204  -0.728  4.203  1.00 0.00 ? 283 PHE A C    3  
ATOM 3618  O O    . PHE A 1 81 ? 19.142  -0.531  2.990  1.00 0.00 ? 283 PHE A O    3  
ATOM 3619  C CB   . PHE A 1 81 ? 20.293  -2.936  4.661  1.00 0.00 ? 283 PHE A CB   3  
ATOM 3620  C CG   . PHE A 1 81 ? 21.277  -2.652  5.761  1.00 0.00 ? 283 PHE A CG   3  
ATOM 3621  C CD1  . PHE A 1 81 ? 22.215  -1.643  5.623  1.00 0.00 ? 283 PHE A CD1  3  
ATOM 3622  C CD2  . PHE A 1 81 ? 21.262  -3.395  6.930  1.00 0.00 ? 283 PHE A CD2  3  
ATOM 3623  C CE1  . PHE A 1 81 ? 23.121  -1.378  6.632  1.00 0.00 ? 283 PHE A CE1  3  
ATOM 3624  C CE2  . PHE A 1 81 ? 22.166  -3.136  7.943  1.00 0.00 ? 283 PHE A CE2  3  
ATOM 3625  C CZ   . PHE A 1 81 ? 23.096  -2.125  7.793  1.00 0.00 ? 283 PHE A CZ   3  
ATOM 3626  H H    . PHE A 1 81 ? 18.071  -3.184  3.191  1.00 0.00 ? 283 PHE A H    3  
ATOM 3627  H HA   . PHE A 1 81 ? 18.726  -2.047  5.817  1.00 0.00 ? 283 PHE A HA   3  
ATOM 3628  H HB2  . PHE A 1 81 ? 20.056  -3.989  4.692  1.00 0.00 ? 283 PHE A HB2  3  
ATOM 3629  H HB3  . PHE A 1 81 ? 20.769  -2.707  3.720  1.00 0.00 ? 283 PHE A HB3  3  
ATOM 3630  H HD1  . PHE A 1 81 ? 22.236  -1.058  4.715  1.00 0.00 ? 283 PHE A HD1  3  
ATOM 3631  H HD2  . PHE A 1 81 ? 20.535  -4.185  7.047  1.00 0.00 ? 283 PHE A HD2  3  
ATOM 3632  H HE1  . PHE A 1 81 ? 23.848  -0.588  6.513  1.00 0.00 ? 283 PHE A HE1  3  
ATOM 3633  H HE2  . PHE A 1 81 ? 22.144  -3.721  8.850  1.00 0.00 ? 283 PHE A HE2  3  
ATOM 3634  H HZ   . PHE A 1 81 ? 23.804  -1.920  8.584  1.00 0.00 ? 283 PHE A HZ   3  
ATOM 3635  N N    . GLY B 2 29 ? 9.385   2.896   21.055 1.00 0.00 ? 444 GLY B N    3  
ATOM 3636  C CA   . GLY B 2 29 ? 8.247   3.433   21.778 1.00 0.00 ? 444 GLY B CA   3  
ATOM 3637  C C    . GLY B 2 29 ? 6.956   2.709   21.449 1.00 0.00 ? 444 GLY B C    3  
ATOM 3638  O O    . GLY B 2 29 ? 6.968   1.678   20.778 1.00 0.00 ? 444 GLY B O    3  
ATOM 3639  H HA2  . GLY B 2 29 ? 8.435   3.348   22.838 1.00 0.00 ? 444 GLY B HA2  3  
ATOM 3640  H HA3  . GLY B 2 29 ? 8.134   4.477   21.525 1.00 0.00 ? 444 GLY B HA3  3  
ATOM 3641  N N    . GLU B 2 30 ? 5.840   3.251   21.925 1.00 0.00 ? 445 GLU B N    3  
ATOM 3642  C CA   . GLU B 2 30 ? 4.534   2.650   21.680 1.00 0.00 ? 445 GLU B CA   3  
ATOM 3643  C C    . GLU B 2 30 ? 3.784   3.405   20.585 1.00 0.00 ? 445 GLU B C    3  
ATOM 3644  O O    . GLU B 2 30 ? 2.833   4.136   20.859 1.00 0.00 ? 445 GLU B O    3  
ATOM 3645  C CB   . GLU B 2 30 ? 3.705   2.637   22.966 1.00 0.00 ? 445 GLU B CB   3  
ATOM 3646  C CG   . GLU B 2 30 ? 2.752   1.457   23.064 1.00 0.00 ? 445 GLU B CG   3  
ATOM 3647  C CD   . GLU B 2 30 ? 1.366   1.864   23.527 1.00 0.00 ? 445 GLU B CD   3  
ATOM 3648  O OE1  . GLU B 2 30 ? 0.811   2.830   22.962 1.00 0.00 ? 445 GLU B OE1  3  
ATOM 3649  O OE2  . GLU B 2 30 ? 0.837   1.216   24.455 1.00 0.00 ? 445 GLU B OE2  3  
ATOM 3650  H H    . GLU B 2 30 ? 5.895   4.073   22.455 1.00 0.00 ? 445 GLU B H    3  
ATOM 3651  H HA   . GLU B 2 30 ? 4.693   1.633   21.354 1.00 0.00 ? 445 GLU B HA   3  
ATOM 3652  H HB2  . GLU B 2 30 ? 4.376   2.600   23.812 1.00 0.00 ? 445 GLU B HB2  3  
ATOM 3653  H HB3  . GLU B 2 30 ? 3.126   3.547   23.016 1.00 0.00 ? 445 GLU B HB3  3  
ATOM 3654  H HG2  . GLU B 2 30 ? 2.667   0.997   22.090 1.00 0.00 ? 445 GLU B HG2  3  
ATOM 3655  H HG3  . GLU B 2 30 ? 3.154   0.743   23.765 1.00 0.00 ? 445 GLU B HG3  3  
ATOM 3656  N N    . GLU B 2 31 ? 4.221   3.221   19.343 1.00 0.00 ? 446 GLU B N    3  
ATOM 3657  C CA   . GLU B 2 31 ? 3.592   3.884   18.207 1.00 0.00 ? 446 GLU B CA   3  
ATOM 3658  C C    . GLU B 2 31 ? 2.629   2.941   17.493 1.00 0.00 ? 446 GLU B C    3  
ATOM 3659  O O    . GLU B 2 31 ? 2.987   2.309   16.498 1.00 0.00 ? 446 GLU B O    3  
ATOM 3660  C CB   . GLU B 2 31 ? 4.655   4.385   17.229 1.00 0.00 ? 446 GLU B CB   3  
ATOM 3661  C CG   . GLU B 2 31 ? 5.781   5.158   17.897 1.00 0.00 ? 446 GLU B CG   3  
ATOM 3662  C CD   . GLU B 2 31 ? 6.884   5.536   16.929 1.00 0.00 ? 446 GLU B CD   3  
ATOM 3663  O OE1  . GLU B 2 31 ? 7.464   4.624   16.304 1.00 0.00 ? 446 GLU B OE1  3  
ATOM 3664  O OE2  . GLU B 2 31 ? 7.168   6.745   16.796 1.00 0.00 ? 446 GLU B OE2  3  
ATOM 3665  H H    . GLU B 2 31 ? 4.984   2.626   19.187 1.00 0.00 ? 446 GLU B H    3  
ATOM 3666  H HA   . GLU B 2 31 ? 3.035   4.729   18.583 1.00 0.00 ? 446 GLU B HA   3  
ATOM 3667  H HB2  . GLU B 2 31 ? 5.085   3.536   16.717 1.00 0.00 ? 446 GLU B HB2  3  
ATOM 3668  H HB3  . GLU B 2 31 ? 4.185   5.031   16.503 1.00 0.00 ? 446 GLU B HB3  3  
ATOM 3669  H HG2  . GLU B 2 31 ? 5.374   6.061   18.327 1.00 0.00 ? 446 GLU B HG2  3  
ATOM 3670  H HG3  . GLU B 2 31 ? 6.203   4.547   18.682 1.00 0.00 ? 446 GLU B HG3  3  
ATOM 3671  N N    . GLU B 2 32 ? 1.407   2.851   18.007 1.00 0.00 ? 447 GLU B N    3  
ATOM 3672  C CA   . GLU B 2 32 ? 0.390   1.985   17.420 1.00 0.00 ? 447 GLU B CA   3  
ATOM 3673  C C    . GLU B 2 32 ? -0.973  2.670   17.422 1.00 0.00 ? 447 GLU B C    3  
ATOM 3674  O O    . GLU B 2 32 ? -1.189  3.642   18.146 1.00 0.00 ? 447 GLU B O    3  
ATOM 3675  C CB   . GLU B 2 32 ? 0.314   0.664   18.187 1.00 0.00 ? 447 GLU B CB   3  
ATOM 3676  C CG   . GLU B 2 32 ? 1.673   0.056   18.488 1.00 0.00 ? 447 GLU B CG   3  
ATOM 3677  C CD   . GLU B 2 32 ? 1.684   -1.452  18.338 1.00 0.00 ? 447 GLU B CD   3  
ATOM 3678  O OE1  . GLU B 2 32 ? 1.434   -1.939  17.215 1.00 0.00 ? 447 GLU B OE1  3  
ATOM 3679  O OE2  . GLU B 2 32 ? 1.941   -2.148  19.343 1.00 0.00 ? 447 GLU B OE2  3  
ATOM 3680  H H    . GLU B 2 32 ? 1.183   3.380   18.801 1.00 0.00 ? 447 GLU B H    3  
ATOM 3681  H HA   . GLU B 2 32 ? 0.677   1.783   16.400 1.00 0.00 ? 447 GLU B HA   3  
ATOM 3682  H HB2  . GLU B 2 32 ? -0.197  0.834   19.123 1.00 0.00 ? 447 GLU B HB2  3  
ATOM 3683  H HB3  . GLU B 2 32 ? -0.252  -0.045  17.601 1.00 0.00 ? 447 GLU B HB3  3  
ATOM 3684  H HG2  . GLU B 2 32 ? 2.400   0.474   17.809 1.00 0.00 ? 447 GLU B HG2  3  
ATOM 3685  H HG3  . GLU B 2 32 ? 1.947   0.305   19.504 1.00 0.00 ? 447 GLU B HG3  3  
ATOM 3686  N N    . GLY B 2 33 ? -1.889  2.156   16.609 1.00 0.00 ? 448 GLY B N    3  
ATOM 3687  C CA   . GLY B 2 33 ? -3.219  2.733   16.534 1.00 0.00 ? 448 GLY B CA   3  
ATOM 3688  C C    . GLY B 2 33 ? -3.391  3.664   15.347 1.00 0.00 ? 448 GLY B C    3  
ATOM 3689  O O    . GLY B 2 33 ? -4.500  4.119   15.064 1.00 0.00 ? 448 GLY B O    3  
ATOM 3690  H H    . GLY B 2 33 ? -1.664  1.380   16.055 1.00 0.00 ? 448 GLY B H    3  
ATOM 3691  H HA2  . GLY B 2 33 ? -3.941  1.934   16.454 1.00 0.00 ? 448 GLY B HA2  3  
ATOM 3692  H HA3  . GLY B 2 33 ? -3.410  3.286   17.441 1.00 0.00 ? 448 GLY B HA3  3  
ATOM 3693  N N    . GLU B 2 34 ? -2.292  3.956   14.654 1.00 0.00 ? 449 GLU B N    3  
ATOM 3694  C CA   . GLU B 2 34 ? -2.333  4.844   13.496 1.00 0.00 ? 449 GLU B CA   3  
ATOM 3695  C C    . GLU B 2 34 ? -2.487  4.054   12.203 1.00 0.00 ? 449 GLU B C    3  
ATOM 3696  O O    . GLU B 2 34 ? -2.165  4.553   11.128 1.00 0.00 ? 449 GLU B O    3  
ATOM 3697  C CB   . GLU B 2 34 ? -1.056  5.683   13.417 1.00 0.00 ? 449 GLU B CB   3  
ATOM 3698  C CG   . GLU B 2 34 ? -0.489  6.070   14.774 1.00 0.00 ? 449 GLU B CG   3  
ATOM 3699  C CD   . GLU B 2 34 ? 0.148   7.447   14.769 1.00 0.00 ? 449 GLU B CD   3  
ATOM 3700  O OE1  . GLU B 2 34 ? 1.128   7.645   14.020 1.00 0.00 ? 449 GLU B OE1  3  
ATOM 3701  O OE2  . GLU B 2 34 ? -0.335  8.326   15.513 1.00 0.00 ? 449 GLU B OE2  3  
ATOM 3702  H H    . GLU B 2 34 ? -1.436  3.569   14.927 1.00 0.00 ? 449 GLU B H    3  
ATOM 3703  H HA   . GLU B 2 34 ? -3.181  5.501   13.606 1.00 0.00 ? 449 GLU B HA   3  
ATOM 3704  H HB2  . GLU B 2 34 ? -0.305  5.121   12.879 1.00 0.00 ? 449 GLU B HB2  3  
ATOM 3705  H HB3  . GLU B 2 34 ? -1.271  6.590   12.870 1.00 0.00 ? 449 GLU B HB3  3  
ATOM 3706  H HG2  . GLU B 2 34 ? -1.288  6.063   15.499 1.00 0.00 ? 449 GLU B HG2  3  
ATOM 3707  H HG3  . GLU B 2 34 ? 0.260   5.345   15.056 1.00 0.00 ? 449 GLU B HG3  3  
ATOM 3708  N N    . GLU B 2 35 ? -2.975  2.823   12.303 1.00 0.00 ? 450 GLU B N    3  
ATOM 3709  C CA   . GLU B 2 35 ? -3.152  1.993   11.121 1.00 0.00 ? 450 GLU B CA   3  
ATOM 3710  C C    . GLU B 2 35 ? -4.513  1.304   11.125 1.00 0.00 ? 450 GLU B C    3  
ATOM 3711  O O    . GLU B 2 35 ? -5.097  1.063   12.182 1.00 0.00 ? 450 GLU B O    3  
ATOM 3712  C CB   . GLU B 2 35 ? -2.026  0.961   11.023 1.00 0.00 ? 450 GLU B CB   3  
ATOM 3713  C CG   . GLU B 2 35 ? -2.158  -0.193  12.003 1.00 0.00 ? 450 GLU B CG   3  
ATOM 3714  C CD   . GLU B 2 35 ? -2.015  0.249   13.447 1.00 0.00 ? 450 GLU B CD   3  
ATOM 3715  O OE1  . GLU B 2 35 ? -2.974  0.841   13.984 1.00 0.00 ? 450 GLU B OE1  3  
ATOM 3716  O OE2  . GLU B 2 35 ? -0.944  0.002   14.040 1.00 0.00 ? 450 GLU B OE2  3  
ATOM 3717  H H    . GLU B 2 35 ? -3.215  2.467   13.182 1.00 0.00 ? 450 GLU B H    3  
ATOM 3718  H HA   . GLU B 2 35 ? -3.101  2.643   10.262 1.00 0.00 ? 450 GLU B HA   3  
ATOM 3719  H HB2  . GLU B 2 35 ? -2.014  0.556   10.022 1.00 0.00 ? 450 GLU B HB2  3  
ATOM 3720  H HB3  . GLU B 2 35 ? -1.084  1.457   11.209 1.00 0.00 ? 450 GLU B HB3  3  
ATOM 3721  H HG2  . GLU B 2 35 ? -3.129  -0.648  11.877 1.00 0.00 ? 450 GLU B HG2  3  
ATOM 3722  H HG3  . GLU B 2 35 ? -1.390  -0.921  11.787 1.00 0.00 ? 450 GLU B HG3  3  
ATOM 3723  N N    . TYR B 2 36 ? -5.012  0.994   9.934  1.00 0.00 ? 451 TYR B N    3  
ATOM 3724  C CA   . TYR B 2 36 ? -6.305  0.336   9.790  1.00 0.00 ? 451 TYR B CA   3  
ATOM 3725  C C    . TYR B 2 36 ? -6.239  -0.773  8.747  1.00 0.00 ? 451 TYR B C    3  
ATOM 3726  O O    . TYR B 2 36 ? -5.134  -1.309  8.521  1.00 0.00 ? 451 TYR B O    3  
ATOM 3727  C CB   . TYR B 2 36 ? -7.373  1.358   9.397  1.00 0.00 ? 451 TYR B CB   3  
ATOM 3728  C CG   . TYR B 2 36 ? -7.898  2.163   10.565 1.00 0.00 ? 451 TYR B CG   3  
ATOM 3729  C CD1  . TYR B 2 36 ? -7.209  3.274   11.034 1.00 0.00 ? 451 TYR B CD1  3  
ATOM 3730  C CD2  . TYR B 2 36 ? -9.085  1.812   11.198 1.00 0.00 ? 451 TYR B CD2  3  
ATOM 3731  C CE1  . TYR B 2 36 ? -7.687  4.013   12.100 1.00 0.00 ? 451 TYR B CE1  3  
ATOM 3732  C CE2  . TYR B 2 36 ? -9.568  2.546   12.264 1.00 0.00 ? 451 TYR B CE2  3  
ATOM 3733  C CZ   . TYR B 2 36 ? -8.866  3.645   12.711 1.00 0.00 ? 451 TYR B CZ   3  
ATOM 3734  O OH   . TYR B 2 36 ? -9.345  4.378   13.773 1.00 0.00 ? 451 TYR B OH   3  
ATOM 3735  O OXT  . TYR B 2 36 ? -7.295  -1.097  8.163  1.00 0.00 ? 451 TYR B OXT  3  
ATOM 3736  H H    . TYR B 2 36 ? -4.497  1.214   9.130  1.00 0.00 ? 451 TYR B H    3  
ATOM 3737  H HA   . TYR B 2 36 ? -6.565  -0.097  10.745 1.00 0.00 ? 451 TYR B HA   3  
ATOM 3738  H HB2  . TYR B 2 36 ? -6.954  2.047   8.681  1.00 0.00 ? 451 TYR B HB2  3  
ATOM 3739  H HB3  . TYR B 2 36 ? -8.207  0.840   8.947  1.00 0.00 ? 451 TYR B HB3  3  
ATOM 3740  H HD1  . TYR B 2 36 ? -6.285  3.560   10.552 1.00 0.00 ? 451 TYR B HD1  3  
ATOM 3741  H HD2  . TYR B 2 36 ? -9.632  0.950   10.846 1.00 0.00 ? 451 TYR B HD2  3  
ATOM 3742  H HE1  . TYR B 2 36 ? -7.136  4.874   12.449 1.00 0.00 ? 451 TYR B HE1  3  
ATOM 3743  H HE2  . TYR B 2 36 ? -10.493 2.257   12.742 1.00 0.00 ? 451 TYR B HE2  3  
ATOM 3744  H HH   . TYR B 2 36 ? -9.592  5.256   13.472 1.00 0.00 ? 451 TYR B HH   3  
ATOM 3745  N N    . ARG A 1 8  ? 13.200  10.761  2.586  1.00 0.00 ? 210 ARG A N    4  
ATOM 3746  C CA   . ARG A 1 8  ? 12.805  9.377   2.823  1.00 0.00 ? 210 ARG A CA   4  
ATOM 3747  C C    . ARG A 1 8  ? 11.344  9.156   2.439  1.00 0.00 ? 210 ARG A C    4  
ATOM 3748  O O    . ARG A 1 8  ? 10.435  9.671   3.090  1.00 0.00 ? 210 ARG A O    4  
ATOM 3749  C CB   . ARG A 1 8  ? 13.023  9.007   4.292  1.00 0.00 ? 210 ARG A CB   4  
ATOM 3750  C CG   . ARG A 1 8  ? 13.736  7.678   4.484  1.00 0.00 ? 210 ARG A CG   4  
ATOM 3751  C CD   . ARG A 1 8  ? 14.563  7.669   5.761  1.00 0.00 ? 210 ARG A CD   4  
ATOM 3752  N NE   . ARG A 1 8  ? 14.894  6.312   6.189  1.00 0.00 ? 210 ARG A NE   4  
ATOM 3753  C CZ   . ARG A 1 8  ? 14.029  5.487   6.776  1.00 0.00 ? 210 ARG A CZ   4  
ATOM 3754  N NH1  . ARG A 1 8  ? 12.782  5.877   7.005  1.00 0.00 ? 210 ARG A NH1  4  
ATOM 3755  N NH2  . ARG A 1 8  ? 14.414  4.270   7.133  1.00 0.00 ? 210 ARG A NH2  4  
ATOM 3756  H HA   . ARG A 1 8  ? 13.426  8.746   2.205  1.00 0.00 ? 210 ARG A HA   4  
ATOM 3757  H HB2  . ARG A 1 8  ? 13.615  9.779   4.761  1.00 0.00 ? 210 ARG A HB2  4  
ATOM 3758  H HB3  . ARG A 1 8  ? 12.065  8.952   4.786  1.00 0.00 ? 210 ARG A HB3  4  
ATOM 3759  H HG2  . ARG A 1 8  ? 13.000  6.890   4.539  1.00 0.00 ? 210 ARG A HG2  4  
ATOM 3760  H HG3  . ARG A 1 8  ? 14.389  7.505   3.641  1.00 0.00 ? 210 ARG A HG3  4  
ATOM 3761  H HD2  . ARG A 1 8  ? 15.478  8.214   5.586  1.00 0.00 ? 210 ARG A HD2  4  
ATOM 3762  H HD3  . ARG A 1 8  ? 13.999  8.157   6.543  1.00 0.00 ? 210 ARG A HD3  4  
ATOM 3763  H HE   . ARG A 1 8  ? 15.810  5.999   6.032  1.00 0.00 ? 210 ARG A HE   4  
ATOM 3764  H HH11 . ARG A 1 8  ? 12.486  6.795   6.737  1.00 0.00 ? 210 ARG A HH11 4  
ATOM 3765  H HH12 . ARG A 1 8  ? 12.137  5.252   7.446  1.00 0.00 ? 210 ARG A HH12 4  
ATOM 3766  H HH21 . ARG A 1 8  ? 15.353  3.972   6.963  1.00 0.00 ? 210 ARG A HH21 4  
ATOM 3767  H HH22 . ARG A 1 8  ? 13.764  3.650   7.575  1.00 0.00 ? 210 ARG A HH22 4  
ATOM 3768  N N    . GLU A 1 9  ? 11.128  8.383   1.380  1.00 0.00 ? 211 GLU A N    4  
ATOM 3769  C CA   . GLU A 1 9  ? 9.778   8.092   0.910  1.00 0.00 ? 211 GLU A CA   4  
ATOM 3770  C C    . GLU A 1 9  ? 9.630   6.614   0.563  1.00 0.00 ? 211 GLU A C    4  
ATOM 3771  O O    . GLU A 1 9  ? 10.614  5.878   0.505  1.00 0.00 ? 211 GLU A O    4  
ATOM 3772  C CB   . GLU A 1 9  ? 9.445   8.949   -0.312 1.00 0.00 ? 211 GLU A CB   4  
ATOM 3773  C CG   . GLU A 1 9  ? 8.965   10.347  0.039  1.00 0.00 ? 211 GLU A CG   4  
ATOM 3774  C CD   . GLU A 1 9  ? 7.542   10.361  0.568  1.00 0.00 ? 211 GLU A CD   4  
ATOM 3775  O OE1  . GLU A 1 9  ? 7.119   9.343   1.154  1.00 0.00 ? 211 GLU A OE1  4  
ATOM 3776  O OE2  . GLU A 1 9  ? 6.854   11.389  0.395  1.00 0.00 ? 211 GLU A OE2  4  
ATOM 3777  H H    . GLU A 1 9  ? 11.893  8.000   0.903  1.00 0.00 ? 211 GLU A H    4  
ATOM 3778  H HA   . GLU A 1 9  ? 9.090   8.334   1.706  1.00 0.00 ? 211 GLU A HA   4  
ATOM 3779  H HB2  . GLU A 1 9  ? 10.329  9.040   -0.926 1.00 0.00 ? 211 GLU A HB2  4  
ATOM 3780  H HB3  . GLU A 1 9  ? 8.671   8.459   -0.882 1.00 0.00 ? 211 GLU A HB3  4  
ATOM 3781  H HG2  . GLU A 1 9  ? 9.616   10.761  0.793  1.00 0.00 ? 211 GLU A HG2  4  
ATOM 3782  H HG3  . GLU A 1 9  ? 9.009   10.963  -0.849 1.00 0.00 ? 211 GLU A HG3  4  
ATOM 3783  N N    . LEU A 1 10 ? 8.392   6.186   0.334  1.00 0.00 ? 212 LEU A N    4  
ATOM 3784  C CA   . LEU A 1 10 ? 8.114   4.796   -0.006 1.00 0.00 ? 212 LEU A CA   4  
ATOM 3785  C C    . LEU A 1 10 ? 7.567   4.684   -1.425 1.00 0.00 ? 212 LEU A C    4  
ATOM 3786  O O    . LEU A 1 10 ? 7.037   5.650   -1.976 1.00 0.00 ? 212 LEU A O    4  
ATOM 3787  C CB   . LEU A 1 10 ? 7.116   4.195   0.984  1.00 0.00 ? 212 LEU A CB   4  
ATOM 3788  C CG   . LEU A 1 10 ? 7.669   3.946   2.389  1.00 0.00 ? 212 LEU A CG   4  
ATOM 3789  C CD1  . LEU A 1 10 ? 6.571   3.440   3.311  1.00 0.00 ? 212 LEU A CD1  4  
ATOM 3790  C CD2  . LEU A 1 10 ? 8.825   2.957   2.340  1.00 0.00 ? 212 LEU A CD2  4  
ATOM 3791  H H    . LEU A 1 10 ? 7.647   6.821   0.396  1.00 0.00 ? 212 LEU A H    4  
ATOM 3792  H HA   . LEU A 1 10 ? 9.042   4.248   0.053  1.00 0.00 ? 212 LEU A HA   4  
ATOM 3793  H HB2  . LEU A 1 10 ? 6.272   4.864   1.065  1.00 0.00 ? 212 LEU A HB2  4  
ATOM 3794  H HB3  . LEU A 1 10 ? 6.770   3.252   0.587  1.00 0.00 ? 212 LEU A HB3  4  
ATOM 3795  H HG   . LEU A 1 10 ? 8.040   4.878   2.793  1.00 0.00 ? 212 LEU A HG   4  
ATOM 3796  H HD11 . LEU A 1 10 ? 5.933   2.755   2.772  1.00 0.00 ? 212 LEU A HD11 4  
ATOM 3797  H HD12 . LEU A 1 10 ? 7.016   2.931   4.155  1.00 0.00 ? 212 LEU A HD12 4  
ATOM 3798  H HD13 . LEU A 1 10 ? 5.984   4.276   3.665  1.00 0.00 ? 212 LEU A HD13 4  
ATOM 3799  H HD21 . LEU A 1 10 ? 9.736   3.482   2.092  1.00 0.00 ? 212 LEU A HD21 4  
ATOM 3800  H HD22 . LEU A 1 10 ? 8.933   2.482   3.303  1.00 0.00 ? 212 LEU A HD22 4  
ATOM 3801  H HD23 . LEU A 1 10 ? 8.626   2.209   1.587  1.00 0.00 ? 212 LEU A HD23 4  
ATOM 3802  N N    . LYS A 1 11 ? 7.699   3.499   -2.014 1.00 0.00 ? 213 LYS A N    4  
ATOM 3803  C CA   . LYS A 1 11 ? 7.217   3.261   -3.368 1.00 0.00 ? 213 LYS A CA   4  
ATOM 3804  C C    . LYS A 1 11 ? 6.497   1.921   -3.463 1.00 0.00 ? 213 LYS A C    4  
ATOM 3805  O O    . LYS A 1 11 ? 6.868   0.956   -2.796 1.00 0.00 ? 213 LYS A O    4  
ATOM 3806  C CB   . LYS A 1 11 ? 8.383   3.298   -4.360 1.00 0.00 ? 213 LYS A CB   4  
ATOM 3807  C CG   . LYS A 1 11 ? 9.284   4.511   -4.194 1.00 0.00 ? 213 LYS A CG   4  
ATOM 3808  C CD   . LYS A 1 11 ? 10.566  4.155   -3.459 1.00 0.00 ? 213 LYS A CD   4  
ATOM 3809  C CE   . LYS A 1 11 ? 11.596  3.546   -4.396 1.00 0.00 ? 213 LYS A CE   4  
ATOM 3810  N NZ   . LYS A 1 11 ? 12.616  2.751   -3.659 1.00 0.00 ? 213 LYS A NZ   4  
ATOM 3811  H H    . LYS A 1 11 ? 8.130   2.768   -1.524 1.00 0.00 ? 213 LYS A H    4  
ATOM 3812  H HA   . LYS A 1 11 ? 6.522   4.048   -3.616 1.00 0.00 ? 213 LYS A HA   4  
ATOM 3813  H HB2  . LYS A 1 11 ? 8.981   2.409   -4.227 1.00 0.00 ? 213 LYS A HB2  4  
ATOM 3814  H HB3  . LYS A 1 11 ? 7.985   3.306   -5.363 1.00 0.00 ? 213 LYS A HB3  4  
ATOM 3815  H HG2  . LYS A 1 11 ? 9.536   4.895   -5.171 1.00 0.00 ? 213 LYS A HG2  4  
ATOM 3816  H HG3  . LYS A 1 11 ? 8.755   5.267   -3.633 1.00 0.00 ? 213 LYS A HG3  4  
ATOM 3817  H HD2  . LYS A 1 11 ? 10.980  5.053   -3.022 1.00 0.00 ? 213 LYS A HD2  4  
ATOM 3818  H HD3  . LYS A 1 11 ? 10.338  3.446   -2.678 1.00 0.00 ? 213 LYS A HD3  4  
ATOM 3819  H HE2  . LYS A 1 11 ? 11.088  2.901   -5.098 1.00 0.00 ? 213 LYS A HE2  4  
ATOM 3820  H HE3  . LYS A 1 11 ? 12.091  4.342   -4.933 1.00 0.00 ? 213 LYS A HE3  4  
ATOM 3821  H HZ1  . LYS A 1 11 ? 12.150  2.102   -2.992 1.00 0.00 ? 213 LYS A HZ1  4  
ATOM 3822  H HZ2  . LYS A 1 11 ? 13.249  3.382   -3.129 1.00 0.00 ? 213 LYS A HZ2  4  
ATOM 3823  H HZ3  . LYS A 1 11 ? 13.184  2.191   -4.328 1.00 0.00 ? 213 LYS A HZ3  4  
ATOM 3824  N N    . ILE A 1 12 ? 5.464   1.870   -4.298 1.00 0.00 ? 214 ILE A N    4  
ATOM 3825  C CA   . ILE A 1 12 ? 4.689   0.648   -4.483 1.00 0.00 ? 214 ILE A CA   4  
ATOM 3826  C C    . ILE A 1 12 ? 5.578   -0.499  -4.953 1.00 0.00 ? 214 ILE A C    4  
ATOM 3827  O O    . ILE A 1 12 ? 6.445   -0.317  -5.808 1.00 0.00 ? 214 ILE A O    4  
ATOM 3828  C CB   . ILE A 1 12 ? 3.549   0.861   -5.500 1.00 0.00 ? 214 ILE A CB   4  
ATOM 3829  C CG1  . ILE A 1 12 ? 2.655   2.021   -5.058 1.00 0.00 ? 214 ILE A CG1  4  
ATOM 3830  C CG2  . ILE A 1 12 ? 2.730   -0.412  -5.664 1.00 0.00 ? 214 ILE A CG2  4  
ATOM 3831  C CD1  . ILE A 1 12 ? 2.269   2.952   -6.186 1.00 0.00 ? 214 ILE A CD1  4  
ATOM 3832  H H    . ILE A 1 12 ? 5.218   2.673   -4.803 1.00 0.00 ? 214 ILE A H    4  
ATOM 3833  H HA   . ILE A 1 12 ? 4.250   0.386   -3.532 1.00 0.00 ? 214 ILE A HA   4  
ATOM 3834  H HB   . ILE A 1 12 ? 3.990   1.101   -6.456 1.00 0.00 ? 214 ILE A HB   4  
ATOM 3835  H HG12 . ILE A 1 12 ? 1.747   1.626   -4.630 1.00 0.00 ? 214 ILE A HG12 4  
ATOM 3836  H HG13 . ILE A 1 12 ? 3.175   2.603   -4.310 1.00 0.00 ? 214 ILE A HG13 4  
ATOM 3837  H HG21 . ILE A 1 12 ? 2.872   -1.047  -4.802 1.00 0.00 ? 214 ILE A HG21 4  
ATOM 3838  H HG22 . ILE A 1 12 ? 1.683   -0.160  -5.756 1.00 0.00 ? 214 ILE A HG22 4  
ATOM 3839  H HG23 . ILE A 1 12 ? 3.051   -0.937  -6.552 1.00 0.00 ? 214 ILE A HG23 4  
ATOM 3840  H HD11 . ILE A 1 12 ? 1.593   3.707   -5.814 1.00 0.00 ? 214 ILE A HD11 4  
ATOM 3841  H HD12 . ILE A 1 12 ? 3.158   3.426   -6.579 1.00 0.00 ? 214 ILE A HD12 4  
ATOM 3842  H HD13 . ILE A 1 12 ? 1.786   2.388   -6.968 1.00 0.00 ? 214 ILE A HD13 4  
ATOM 3843  N N    . GLY A 1 13 ? 5.360   -1.680  -4.384 1.00 0.00 ? 215 GLY A N    4  
ATOM 3844  C CA   . GLY A 1 13 ? 6.150   -2.839  -4.753 1.00 0.00 ? 215 GLY A CA   4  
ATOM 3845  C C    . GLY A 1 13 ? 7.357   -3.034  -3.853 1.00 0.00 ? 215 GLY A C    4  
ATOM 3846  O O    . GLY A 1 13 ? 8.064   -4.036  -3.963 1.00 0.00 ? 215 GLY A O    4  
ATOM 3847  H H    . GLY A 1 13 ? 4.658   -1.764  -3.706 1.00 0.00 ? 215 GLY A H    4  
ATOM 3848  H HA2  . GLY A 1 13 ? 5.526   -3.720  -4.694 1.00 0.00 ? 215 GLY A HA2  4  
ATOM 3849  H HA3  . GLY A 1 13 ? 6.490   -2.721  -5.771 1.00 0.00 ? 215 GLY A HA3  4  
ATOM 3850  N N    . ASP A 1 14 ? 7.600   -2.075  -2.963 1.00 0.00 ? 216 ASP A N    4  
ATOM 3851  C CA   . ASP A 1 14 ? 8.732   -2.152  -2.048 1.00 0.00 ? 216 ASP A CA   4  
ATOM 3852  C C    . ASP A 1 14 ? 8.320   -2.766  -0.715 1.00 0.00 ? 216 ASP A C    4  
ATOM 3853  O O    . ASP A 1 14 ? 7.222   -2.520  -0.218 1.00 0.00 ? 216 ASP A O    4  
ATOM 3854  C CB   . ASP A 1 14 ? 9.324   -0.760  -1.818 1.00 0.00 ? 216 ASP A CB   4  
ATOM 3855  C CG   . ASP A 1 14 ? 10.057  -0.234  -3.037 1.00 0.00 ? 216 ASP A CG   4  
ATOM 3856  O OD1  . ASP A 1 14 ? 10.385  -1.045  -3.929 1.00 0.00 ? 216 ASP A OD1  4  
ATOM 3857  O OD2  . ASP A 1 14 ? 10.305  0.988   -3.100 1.00 0.00 ? 216 ASP A OD2  4  
ATOM 3858  H H    . ASP A 1 14 ? 7.005   -1.298  -2.920 1.00 0.00 ? 216 ASP A H    4  
ATOM 3859  H HA   . ASP A 1 14 ? 9.481   -2.779  -2.501 1.00 0.00 ? 216 ASP A HA   4  
ATOM 3860  H HB2  . ASP A 1 14 ? 8.527   -0.071  -1.577 1.00 0.00 ? 216 ASP A HB2  4  
ATOM 3861  H HB3  . ASP A 1 14 ? 10.019  -0.803  -0.993 1.00 0.00 ? 216 ASP A HB3  4  
ATOM 3862  N N    . ARG A 1 15 ? 9.214   -3.566  -0.139 1.00 0.00 ? 217 ARG A N    4  
ATOM 3863  C CA   . ARG A 1 15 ? 8.947   -4.213  1.139  1.00 0.00 ? 217 ARG A CA   4  
ATOM 3864  C C    . ARG A 1 15 ? 9.100   -3.219  2.283  1.00 0.00 ? 217 ARG A C    4  
ATOM 3865  O O    . ARG A 1 15 ? 10.056  -2.444  2.321  1.00 0.00 ? 217 ARG A O    4  
ATOM 3866  C CB   . ARG A 1 15 ? 9.894   -5.399  1.344  1.00 0.00 ? 217 ARG A CB   4  
ATOM 3867  C CG   . ARG A 1 15 ? 9.382   -6.419  2.347  1.00 0.00 ? 217 ARG A CG   4  
ATOM 3868  C CD   . ARG A 1 15 ? 8.318   -7.316  1.735  1.00 0.00 ? 217 ARG A CD   4  
ATOM 3869  N NE   . ARG A 1 15 ? 8.867   -8.198  0.707  1.00 0.00 ? 217 ARG A NE   4  
ATOM 3870  C CZ   . ARG A 1 15 ? 8.242   -9.278  0.246  1.00 0.00 ? 217 ARG A CZ   4  
ATOM 3871  N NH1  . ARG A 1 15 ? 7.047   -9.614  0.715  1.00 0.00 ? 217 ARG A NH1  4  
ATOM 3872  N NH2  . ARG A 1 15 ? 8.814   -10.025 -0.689 1.00 0.00 ? 217 ARG A NH2  4  
ATOM 3873  H H    . ARG A 1 15 ? 10.073  -3.720  -0.583 1.00 0.00 ? 217 ARG A H    4  
ATOM 3874  H HA   . ARG A 1 15 ? 7.929   -4.573  1.125  1.00 0.00 ? 217 ARG A HA   4  
ATOM 3875  H HB2  . ARG A 1 15 ? 10.038  -5.896  0.397  1.00 0.00 ? 217 ARG A HB2  4  
ATOM 3876  H HB3  . ARG A 1 15 ? 10.845  -5.028  1.695  1.00 0.00 ? 217 ARG A HB3  4  
ATOM 3877  H HG2  . ARG A 1 15 ? 10.207  -7.032  2.676  1.00 0.00 ? 217 ARG A HG2  4  
ATOM 3878  H HG3  . ARG A 1 15 ? 8.957   -5.898  3.192  1.00 0.00 ? 217 ARG A HG3  4  
ATOM 3879  H HD2  . ARG A 1 15 ? 7.881   -7.920  2.517  1.00 0.00 ? 217 ARG A HD2  4  
ATOM 3880  H HD3  . ARG A 1 15 ? 7.553   -6.695  1.292  1.00 0.00 ? 217 ARG A HD3  4  
ATOM 3881  H HE   . ARG A 1 15 ? 9.749   -7.973  0.343  1.00 0.00 ? 217 ARG A HE   4  
ATOM 3882  H HH11 . ARG A 1 15 ? 6.610   -9.054  1.420  1.00 0.00 ? 217 ARG A HH11 4  
ATOM 3883  H HH12 . ARG A 1 15 ? 6.582   -10.426 0.364  1.00 0.00 ? 217 ARG A HH12 4  
ATOM 3884  H HH21 . ARG A 1 15 ? 9.714   -9.776  -1.046 1.00 0.00 ? 217 ARG A HH21 4  
ATOM 3885  H HH22 . ARG A 1 15 ? 8.345   -10.837 -1.037 1.00 0.00 ? 217 ARG A HH22 4  
ATOM 3886  N N    . VAL A 1 16 ? 8.150   -3.240  3.210  1.00 0.00 ? 218 VAL A N    4  
ATOM 3887  C CA   . VAL A 1 16 ? 8.177   -2.333  4.347  1.00 0.00 ? 218 VAL A CA   4  
ATOM 3888  C C    . VAL A 1 16 ? 7.436   -2.916  5.543  1.00 0.00 ? 218 VAL A C    4  
ATOM 3889  O O    . VAL A 1 16 ? 6.952   -4.048  5.499  1.00 0.00 ? 218 VAL A O    4  
ATOM 3890  C CB   . VAL A 1 16 ? 7.541   -0.975  3.988  1.00 0.00 ? 218 VAL A CB   4  
ATOM 3891  C CG1  . VAL A 1 16 ? 8.158   -0.414  2.716  1.00 0.00 ? 218 VAL A CG1  4  
ATOM 3892  C CG2  . VAL A 1 16 ? 6.029   -1.110  3.844  1.00 0.00 ? 218 VAL A CG2  4  
ATOM 3893  H H    . VAL A 1 16 ? 7.409   -3.877  3.121  1.00 0.00 ? 218 VAL A H    4  
ATOM 3894  H HA   . VAL A 1 16 ? 9.209   -2.165  4.619  1.00 0.00 ? 218 VAL A HA   4  
ATOM 3895  H HB   . VAL A 1 16 ? 7.744   -0.283  4.794  1.00 0.00 ? 218 VAL A HB   4  
ATOM 3896  H HG11 . VAL A 1 16 ? 7.771   0.579   2.536  1.00 0.00 ? 218 VAL A HG11 4  
ATOM 3897  H HG12 . VAL A 1 16 ? 9.231   -0.368  2.826  1.00 0.00 ? 218 VAL A HG12 4  
ATOM 3898  H HG13 . VAL A 1 16 ? 7.908   -1.054  1.883  1.00 0.00 ? 218 VAL A HG13 4  
ATOM 3899  H HG21 . VAL A 1 16 ? 5.801   -1.973  3.236  1.00 0.00 ? 218 VAL A HG21 4  
ATOM 3900  H HG22 . VAL A 1 16 ? 5.585   -1.231  4.821  1.00 0.00 ? 218 VAL A HG22 4  
ATOM 3901  H HG23 . VAL A 1 16 ? 5.630   -0.223  3.375  1.00 0.00 ? 218 VAL A HG23 4  
ATOM 3902  N N    . LEU A 1 17 ? 7.334   -2.122  6.601  1.00 0.00 ? 219 LEU A N    4  
ATOM 3903  C CA   . LEU A 1 17 ? 6.632   -2.538  7.805  1.00 0.00 ? 219 LEU A CA   4  
ATOM 3904  C C    . LEU A 1 17 ? 5.543   -1.536  8.150  1.00 0.00 ? 219 LEU A C    4  
ATOM 3905  O O    . LEU A 1 17 ? 5.819   -0.359  8.364  1.00 0.00 ? 219 LEU A O    4  
ATOM 3906  C CB   . LEU A 1 17 ? 7.596   -2.660  8.986  1.00 0.00 ? 219 LEU A CB   4  
ATOM 3907  C CG   . LEU A 1 17 ? 8.723   -3.678  8.816  1.00 0.00 ? 219 LEU A CG   4  
ATOM 3908  C CD1  . LEU A 1 17 ? 9.473   -3.856  10.127 1.00 0.00 ? 219 LEU A CD1  4  
ATOM 3909  C CD2  . LEU A 1 17 ? 8.171   -5.011  8.329  1.00 0.00 ? 219 LEU A CD2  4  
ATOM 3910  H H    . LEU A 1 17 ? 7.728   -1.225  6.564  1.00 0.00 ? 219 LEU A H    4  
ATOM 3911  H HA   . LEU A 1 17 ? 6.181   -3.498  7.614  1.00 0.00 ? 219 LEU A HA   4  
ATOM 3912  H HB2  . LEU A 1 17 ? 8.040   -1.691  9.161  1.00 0.00 ? 219 LEU A HB2  4  
ATOM 3913  H HB3  . LEU A 1 17 ? 7.022   -2.935  9.857  1.00 0.00 ? 219 LEU A HB3  4  
ATOM 3914  H HG   . LEU A 1 17 ? 9.422   -3.313  8.078  1.00 0.00 ? 219 LEU A HG   4  
ATOM 3915  H HD11 . LEU A 1 17 ? 9.359   -2.965  10.729 1.00 0.00 ? 219 LEU A HD11 4  
ATOM 3916  H HD12 . LEU A 1 17 ? 9.069   -4.702  10.661 1.00 0.00 ? 219 LEU A HD12 4  
ATOM 3917  H HD13 . LEU A 1 17 ? 10.520  -4.022  9.924  1.00 0.00 ? 219 LEU A HD13 4  
ATOM 3918  H HD21 . LEU A 1 17 ? 8.902   -5.787  8.500  1.00 0.00 ? 219 LEU A HD21 4  
ATOM 3919  H HD22 . LEU A 1 17 ? 7.264   -5.244  8.869  1.00 0.00 ? 219 LEU A HD22 4  
ATOM 3920  H HD23 . LEU A 1 17 ? 7.955   -4.947  7.274  1.00 0.00 ? 219 LEU A HD23 4  
ATOM 3921  N N    . VAL A 1 18 ? 4.306   -2.008  8.215  1.00 0.00 ? 220 VAL A N    4  
ATOM 3922  C CA   . VAL A 1 18 ? 3.187   -1.137  8.549  1.00 0.00 ? 220 VAL A CA   4  
ATOM 3923  C C    . VAL A 1 18 ? 2.992   -1.089  10.060 1.00 0.00 ? 220 VAL A C    4  
ATOM 3924  O O    . VAL A 1 18 ? 2.624   -2.086  10.684 1.00 0.00 ? 220 VAL A O    4  
ATOM 3925  C CB   . VAL A 1 18 ? 1.866   -1.580  7.866  1.00 0.00 ? 220 VAL A CB   4  
ATOM 3926  C CG1  . VAL A 1 18 ? 1.279   -0.439  7.049  1.00 0.00 ? 220 VAL A CG1  4  
ATOM 3927  C CG2  . VAL A 1 18 ? 2.078   -2.809  6.994  1.00 0.00 ? 220 VAL A CG2  4  
ATOM 3928  H H    . VAL A 1 18 ? 4.148   -2.959  8.046  1.00 0.00 ? 220 VAL A H    4  
ATOM 3929  H HA   . VAL A 1 18 ? 3.430   -0.143  8.202  1.00 0.00 ? 220 VAL A HA   4  
ATOM 3930  H HB   . VAL A 1 18 ? 1.156   -1.834  8.636  1.00 0.00 ? 220 VAL A HB   4  
ATOM 3931  H HG11 . VAL A 1 18 ? 0.885   -0.826  6.121  1.00 0.00 ? 220 VAL A HG11 4  
ATOM 3932  H HG12 . VAL A 1 18 ? 0.484   0.033   7.608  1.00 0.00 ? 220 VAL A HG12 4  
ATOM 3933  H HG13 . VAL A 1 18 ? 2.049   0.287   6.838  1.00 0.00 ? 220 VAL A HG13 4  
ATOM 3934  H HG21 . VAL A 1 18 ? 2.884   -2.622  6.298  1.00 0.00 ? 220 VAL A HG21 4  
ATOM 3935  H HG22 . VAL A 1 18 ? 2.331   -3.654  7.618  1.00 0.00 ? 220 VAL A HG22 4  
ATOM 3936  H HG23 . VAL A 1 18 ? 1.173   -3.024  6.446  1.00 0.00 ? 220 VAL A HG23 4  
ATOM 3937  N N    . GLY A 1 19 ? 3.263   0.074   10.644 1.00 0.00 ? 221 GLY A N    4  
ATOM 3938  C CA   . GLY A 1 19 ? 3.131   0.235   12.078 1.00 0.00 ? 221 GLY A CA   4  
ATOM 3939  C C    . GLY A 1 19 ? 4.390   -0.171  12.827 1.00 0.00 ? 221 GLY A C    4  
ATOM 3940  O O    . GLY A 1 19 ? 4.485   0.016   14.040 1.00 0.00 ? 221 GLY A O    4  
ATOM 3941  H H    . GLY A 1 19 ? 3.565   0.828   10.095 1.00 0.00 ? 221 GLY A H    4  
ATOM 3942  H HA2  . GLY A 1 19 ? 2.915   1.270   12.295 1.00 0.00 ? 221 GLY A HA2  4  
ATOM 3943  H HA3  . GLY A 1 19 ? 2.310   -0.374  12.424 1.00 0.00 ? 221 GLY A HA3  4  
ATOM 3944  N N    . GLY A 1 20 ? 5.361   -0.729  12.103 1.00 0.00 ? 222 GLY A N    4  
ATOM 3945  C CA   . GLY A 1 20 ? 6.605   -1.153  12.724 1.00 0.00 ? 222 GLY A CA   4  
ATOM 3946  C C    . GLY A 1 20 ? 6.561   -2.590  13.206 1.00 0.00 ? 222 GLY A C    4  
ATOM 3947  O O    . GLY A 1 20 ? 7.595   -3.250  13.307 1.00 0.00 ? 222 GLY A O    4  
ATOM 3948  H H    . GLY A 1 20 ? 5.234   -0.855  11.141 1.00 0.00 ? 222 GLY A H    4  
ATOM 3949  H HA2  . GLY A 1 20 ? 7.404   -1.054  12.005 1.00 0.00 ? 222 GLY A HA2  4  
ATOM 3950  H HA3  . GLY A 1 20 ? 6.814   -0.511  13.564 1.00 0.00 ? 222 GLY A HA3  4  
ATOM 3951  N N    . THR A 1 21 ? 5.362   -3.077  13.503 1.00 0.00 ? 223 THR A N    4  
ATOM 3952  C CA   . THR A 1 21 ? 5.188   -4.444  13.977 1.00 0.00 ? 223 THR A CA   4  
ATOM 3953  C C    . THR A 1 21 ? 4.727   -5.358  12.848 1.00 0.00 ? 223 THR A C    4  
ATOM 3954  O O    . THR A 1 21 ? 4.993   -6.560  12.862 1.00 0.00 ? 223 THR A O    4  
ATOM 3955  C CB   . THR A 1 21 ? 4.173   -4.475  15.120 1.00 0.00 ? 223 THR A CB   4  
ATOM 3956  O OG1  . THR A 1 21 ? 2.978   -3.814  14.748 1.00 0.00 ? 223 THR A OG1  4  
ATOM 3957  C CG2  . THR A 1 21 ? 4.683   -3.824  16.386 1.00 0.00 ? 223 THR A CG2  4  
ATOM 3958  H H    . THR A 1 21 ? 4.574   -2.505  13.403 1.00 0.00 ? 223 THR A H    4  
ATOM 3959  H HA   . THR A 1 21 ? 6.142   -4.792  14.344 1.00 0.00 ? 223 THR A HA   4  
ATOM 3960  H HB   . THR A 1 21 ? 3.935   -5.504  15.347 1.00 0.00 ? 223 THR A HB   4  
ATOM 3961  H HG1  . THR A 1 21 ? 2.356   -4.453  14.391 1.00 0.00 ? 223 THR A HG1  4  
ATOM 3962  H HG21 . THR A 1 21 ? 5.648   -3.375  16.196 1.00 0.00 ? 223 THR A HG21 4  
ATOM 3963  H HG22 . THR A 1 21 ? 4.781   -4.568  17.161 1.00 0.00 ? 223 THR A HG22 4  
ATOM 3964  H HG23 . THR A 1 21 ? 3.988   -3.060  16.704 1.00 0.00 ? 223 THR A HG23 4  
ATOM 3965  N N    . LYS A 1 22 ? 4.036   -4.781  11.871 1.00 0.00 ? 224 LYS A N    4  
ATOM 3966  C CA   . LYS A 1 22 ? 3.538   -5.546  10.734 1.00 0.00 ? 224 LYS A CA   4  
ATOM 3967  C C    . LYS A 1 22 ? 4.451   -5.369  9.527  1.00 0.00 ? 224 LYS A C    4  
ATOM 3968  O O    . LYS A 1 22 ? 5.043   -4.307  9.337  1.00 0.00 ? 224 LYS A O    4  
ATOM 3969  C CB   . LYS A 1 22 ? 2.113   -5.108  10.382 1.00 0.00 ? 224 LYS A CB   4  
ATOM 3970  C CG   . LYS A 1 22 ? 1.254   -4.759  11.590 1.00 0.00 ? 224 LYS A CG   4  
ATOM 3971  C CD   . LYS A 1 22 ? 0.611   -5.997  12.194 1.00 0.00 ? 224 LYS A CD   4  
ATOM 3972  C CE   . LYS A 1 22 ? 1.596   -6.778  13.048 1.00 0.00 ? 224 LYS A CE   4  
ATOM 3973  N NZ   . LYS A 1 22 ? 0.970   -7.281  14.301 1.00 0.00 ? 224 LYS A NZ   4  
ATOM 3974  H H    . LYS A 1 22 ? 3.854   -3.819  11.917 1.00 0.00 ? 224 LYS A H    4  
ATOM 3975  H HA   . LYS A 1 22 ? 3.527   -6.588  11.015 1.00 0.00 ? 224 LYS A HA   4  
ATOM 3976  H HB2  . LYS A 1 22 ? 2.165   -4.237  9.744  1.00 0.00 ? 224 LYS A HB2  4  
ATOM 3977  H HB3  . LYS A 1 22 ? 1.628   -5.908  9.840  1.00 0.00 ? 224 LYS A HB3  4  
ATOM 3978  H HG2  . LYS A 1 22 ? 1.871   -4.287  12.337 1.00 0.00 ? 224 LYS A HG2  4  
ATOM 3979  H HG3  . LYS A 1 22 ? 0.476   -4.077  11.280 1.00 0.00 ? 224 LYS A HG3  4  
ATOM 3980  H HD2  . LYS A 1 22 ? -0.221  -5.693  12.812 1.00 0.00 ? 224 LYS A HD2  4  
ATOM 3981  H HD3  . LYS A 1 22 ? 0.257   -6.633  11.398 1.00 0.00 ? 224 LYS A HD3  4  
ATOM 3982  H HE2  . LYS A 1 22 ? 1.963   -7.617  12.477 1.00 0.00 ? 224 LYS A HE2  4  
ATOM 3983  H HE3  . LYS A 1 22 ? 2.423   -6.129  13.303 1.00 0.00 ? 224 LYS A HE3  4  
ATOM 3984  H HZ1  . LYS A 1 22 ? 1.660   -7.265  15.079 1.00 0.00 ? 224 LYS A HZ1  4  
ATOM 3985  H HZ2  . LYS A 1 22 ? 0.638   -8.257  14.168 1.00 0.00 ? 224 LYS A HZ2  4  
ATOM 3986  H HZ3  . LYS A 1 22 ? 0.159   -6.684  14.561 1.00 0.00 ? 224 LYS A HZ3  4  
ATOM 3987  N N    . ALA A 1 23 ? 4.564   -6.413  8.711  1.00 0.00 ? 225 ALA A N    4  
ATOM 3988  C CA   . ALA A 1 23 ? 5.407   -6.365  7.521  1.00 0.00 ? 225 ALA A CA   4  
ATOM 3989  C C    . ALA A 1 23 ? 4.590   -6.601  6.261  1.00 0.00 ? 225 ALA A C    4  
ATOM 3990  O O    . ALA A 1 23 ? 3.654   -7.400  6.258  1.00 0.00 ? 225 ALA A O    4  
ATOM 3991  C CB   . ALA A 1 23 ? 6.524   -7.389  7.618  1.00 0.00 ? 225 ALA A CB   4  
ATOM 3992  H H    . ALA A 1 23 ? 4.067   -7.234  8.914  1.00 0.00 ? 225 ALA A H    4  
ATOM 3993  H HA   . ALA A 1 23 ? 5.854   -5.385  7.469  1.00 0.00 ? 225 ALA A HA   4  
ATOM 3994  H HB1  . ALA A 1 23 ? 7.334   -7.099  6.964  1.00 0.00 ? 225 ALA A HB1  4  
ATOM 3995  H HB2  . ALA A 1 23 ? 6.882   -7.440  8.634  1.00 0.00 ? 225 ALA A HB2  4  
ATOM 3996  H HB3  . ALA A 1 23 ? 6.150   -8.358  7.318  1.00 0.00 ? 225 ALA A HB3  4  
ATOM 3997  N N    . GLY A 1 24 ? 4.949   -5.903  5.189  1.00 0.00 ? 226 GLY A N    4  
ATOM 3998  C CA   . GLY A 1 24 ? 4.236   -6.054  3.938  1.00 0.00 ? 226 GLY A CA   4  
ATOM 3999  C C    . GLY A 1 24 ? 4.884   -5.297  2.797  1.00 0.00 ? 226 GLY A C    4  
ATOM 4000  O O    . GLY A 1 24 ? 6.027   -4.853  2.906  1.00 0.00 ? 226 GLY A O    4  
ATOM 4001  H H    . GLY A 1 24 ? 5.704   -5.281  5.251  1.00 0.00 ? 226 GLY A H    4  
ATOM 4002  H HA2  . GLY A 1 24 ? 4.199   -7.103  3.684  1.00 0.00 ? 226 GLY A HA2  4  
ATOM 4003  H HA3  . GLY A 1 24 ? 3.227   -5.692  4.069  1.00 0.00 ? 226 GLY A HA3  4  
ATOM 4004  N N    . VAL A 1 25 ? 4.150   -5.153  1.699  1.00 0.00 ? 227 VAL A N    4  
ATOM 4005  C CA   . VAL A 1 25 ? 4.653   -4.449  0.528  1.00 0.00 ? 227 VAL A CA   4  
ATOM 4006  C C    . VAL A 1 25 ? 3.755   -3.265  0.176  1.00 0.00 ? 227 VAL A C    4  
ATOM 4007  O O    . VAL A 1 25 ? 2.532   -3.396  0.125  1.00 0.00 ? 227 VAL A O    4  
ATOM 4008  C CB   . VAL A 1 25 ? 4.749   -5.390  -0.691 1.00 0.00 ? 227 VAL A CB   4  
ATOM 4009  C CG1  . VAL A 1 25 ? 5.083   -4.614  -1.957 1.00 0.00 ? 227 VAL A CG1  4  
ATOM 4010  C CG2  . VAL A 1 25 ? 5.781   -6.480  -0.442 1.00 0.00 ? 227 VAL A CG2  4  
ATOM 4011  H H    . VAL A 1 25 ? 3.247   -5.533  1.676  1.00 0.00 ? 227 VAL A H    4  
ATOM 4012  H HA   . VAL A 1 25 ? 5.643   -4.083  0.755  1.00 0.00 ? 227 VAL A HA   4  
ATOM 4013  H HB   . VAL A 1 25 ? 3.788   -5.863  -0.830 1.00 0.00 ? 227 VAL A HB   4  
ATOM 4014  H HG11 . VAL A 1 25 ? 4.266   -3.951  -2.198 1.00 0.00 ? 227 VAL A HG11 4  
ATOM 4015  H HG12 . VAL A 1 25 ? 5.981   -4.035  -1.798 1.00 0.00 ? 227 VAL A HG12 4  
ATOM 4016  H HG13 . VAL A 1 25 ? 5.238   -5.305  -2.773 1.00 0.00 ? 227 VAL A HG13 4  
ATOM 4017  H HG21 . VAL A 1 25 ? 5.615   -6.916  0.532  1.00 0.00 ? 227 VAL A HG21 4  
ATOM 4018  H HG22 . VAL A 1 25 ? 5.689   -7.245  -1.199 1.00 0.00 ? 227 VAL A HG22 4  
ATOM 4019  H HG23 . VAL A 1 25 ? 6.772   -6.053  -0.480 1.00 0.00 ? 227 VAL A HG23 4  
ATOM 4020  N N    . VAL A 1 26 ? 4.368   -2.116  -0.074 1.00 0.00 ? 228 VAL A N    4  
ATOM 4021  C CA   . VAL A 1 26 ? 3.619   -0.917  -0.432 1.00 0.00 ? 228 VAL A CA   4  
ATOM 4022  C C    . VAL A 1 26 ? 2.829   -1.140  -1.714 1.00 0.00 ? 228 VAL A C    4  
ATOM 4023  O O    . VAL A 1 26 ? 3.374   -1.595  -2.718 1.00 0.00 ? 228 VAL A O    4  
ATOM 4024  C CB   . VAL A 1 26 ? 4.552   0.292   -0.612 1.00 0.00 ? 228 VAL A CB   4  
ATOM 4025  C CG1  . VAL A 1 26 ? 3.747   1.570   -0.803 1.00 0.00 ? 228 VAL A CG1  4  
ATOM 4026  C CG2  . VAL A 1 26 ? 5.494   0.415   0.577  1.00 0.00 ? 228 VAL A CG2  4  
ATOM 4027  H H    . VAL A 1 26 ? 5.346   -2.073  -0.029 1.00 0.00 ? 228 VAL A H    4  
ATOM 4028  H HA   . VAL A 1 26 ? 2.931   -0.701  0.374  1.00 0.00 ? 228 VAL A HA   4  
ATOM 4029  H HB   . VAL A 1 26 ? 5.146   0.135   -1.500 1.00 0.00 ? 228 VAL A HB   4  
ATOM 4030  H HG11 . VAL A 1 26 ? 3.873   2.209   0.058  1.00 0.00 ? 228 VAL A HG11 4  
ATOM 4031  H HG12 . VAL A 1 26 ? 4.094   2.086   -1.687 1.00 0.00 ? 228 VAL A HG12 4  
ATOM 4032  H HG13 . VAL A 1 26 ? 2.702   1.325   -0.919 1.00 0.00 ? 228 VAL A HG13 4  
ATOM 4033  H HG21 . VAL A 1 26 ? 5.918   1.407   0.600  1.00 0.00 ? 228 VAL A HG21 4  
ATOM 4034  H HG22 . VAL A 1 26 ? 4.944   0.237   1.490  1.00 0.00 ? 228 VAL A HG22 4  
ATOM 4035  H HG23 . VAL A 1 26 ? 6.285   -0.314  0.486  1.00 0.00 ? 228 VAL A HG23 4  
ATOM 4036  N N    . ARG A 1 27 ? 1.537   -0.832  -1.671 1.00 0.00 ? 229 ARG A N    4  
ATOM 4037  C CA   . ARG A 1 27 ? 0.671   -1.017  -2.829 1.00 0.00 ? 229 ARG A CA   4  
ATOM 4038  C C    . ARG A 1 27 ? 0.097   0.312   -3.317 1.00 0.00 ? 229 ARG A C    4  
ATOM 4039  O O    . ARG A 1 27 ? -0.174  0.480   -4.508 1.00 0.00 ? 229 ARG A O    4  
ATOM 4040  C CB   . ARG A 1 27 ? -0.462  -1.984  -2.482 1.00 0.00 ? 229 ARG A CB   4  
ATOM 4041  C CG   . ARG A 1 27 ? 0.025   -3.304  -1.905 1.00 0.00 ? 229 ARG A CG   4  
ATOM 4042  C CD   . ARG A 1 27 ? 1.082   -3.946  -2.790 1.00 0.00 ? 229 ARG A CD   4  
ATOM 4043  N NE   . ARG A 1 27 ? 0.888   -5.388  -2.916 1.00 0.00 ? 229 ARG A NE   4  
ATOM 4044  C CZ   . ARG A 1 27 ? 1.417   -6.125  -3.892 1.00 0.00 ? 229 ARG A CZ   4  
ATOM 4045  N NH1  . ARG A 1 27 ? 2.172   -5.560  -4.826 1.00 0.00 ? 229 ARG A NH1  4  
ATOM 4046  N NH2  . ARG A 1 27 ? 1.190   -7.430  -3.932 1.00 0.00 ? 229 ARG A NH2  4  
ATOM 4047  H H    . ARG A 1 27 ? 1.154   -0.484  -0.838 1.00 0.00 ? 229 ARG A H    4  
ATOM 4048  H HA   . ARG A 1 27 ? 1.265   -1.447  -3.621 1.00 0.00 ? 229 ARG A HA   4  
ATOM 4049  H HB2  . ARG A 1 27 ? -1.111  -1.516  -1.757 1.00 0.00 ? 229 ARG A HB2  4  
ATOM 4050  H HB3  . ARG A 1 27 ? -1.027  -2.195  -3.375 1.00 0.00 ? 229 ARG A HB3  4  
ATOM 4051  H HG2  . ARG A 1 27 ? 0.448   -3.124  -0.928 1.00 0.00 ? 229 ARG A HG2  4  
ATOM 4052  H HG3  . ARG A 1 27 ? -0.816  -3.978  -1.815 1.00 0.00 ? 229 ARG A HG3  4  
ATOM 4053  H HD2  . ARG A 1 27 ? 1.031   -3.498  -3.771 1.00 0.00 ? 229 ARG A HD2  4  
ATOM 4054  H HD3  . ARG A 1 27 ? 2.055   -3.759  -2.360 1.00 0.00 ? 229 ARG A HD3  4  
ATOM 4055  H HE   . ARG A 1 27 ? 0.336   -5.830  -2.242 1.00 0.00 ? 229 ARG A HE   4  
ATOM 4056  H HH11 . ARG A 1 27 ? 2.348   -4.576  -4.800 1.00 0.00 ? 229 ARG A HH11 4  
ATOM 4057  H HH12 . ARG A 1 27 ? 2.566   -6.119  -5.555 1.00 0.00 ? 229 ARG A HH12 4  
ATOM 4058  H HH21 . ARG A 1 27 ? 0.623   -7.862  -3.231 1.00 0.00 ? 229 ARG A HH21 4  
ATOM 4059  H HH22 . ARG A 1 27 ? 1.587   -7.985  -4.664 1.00 0.00 ? 229 ARG A HH22 4  
ATOM 4060  N N    . PHE A 1 28 ? -0.086  1.255   -2.399 1.00 0.00 ? 230 PHE A N    4  
ATOM 4061  C CA   . PHE A 1 28 ? -0.626  2.565   -2.747 1.00 0.00 ? 230 PHE A CA   4  
ATOM 4062  C C    . PHE A 1 28 ? -0.320  3.584   -1.657 1.00 0.00 ? 230 PHE A C    4  
ATOM 4063  O O    . PHE A 1 28 ? -0.230  3.237   -0.484 1.00 0.00 ? 230 PHE A O    4  
ATOM 4064  C CB   . PHE A 1 28 ? -2.138  2.475   -2.971 1.00 0.00 ? 230 PHE A CB   4  
ATOM 4065  C CG   . PHE A 1 28 ? -2.718  3.694   -3.629 1.00 0.00 ? 230 PHE A CG   4  
ATOM 4066  C CD1  . PHE A 1 28 ? -2.464  3.966   -4.963 1.00 0.00 ? 230 PHE A CD1  4  
ATOM 4067  C CD2  . PHE A 1 28 ? -3.519  4.569   -2.911 1.00 0.00 ? 230 PHE A CD2  4  
ATOM 4068  C CE1  . PHE A 1 28 ? -2.997  5.087   -5.570 1.00 0.00 ? 230 PHE A CE1  4  
ATOM 4069  C CE2  . PHE A 1 28 ? -4.056  5.691   -3.512 1.00 0.00 ? 230 PHE A CE2  4  
ATOM 4070  C CZ   . PHE A 1 28 ? -3.793  5.951   -4.844 1.00 0.00 ? 230 PHE A CZ   4  
ATOM 4071  H H    . PHE A 1 28 ? 0.148   1.067   -1.466 1.00 0.00 ? 230 PHE A H    4  
ATOM 4072  H HA   . PHE A 1 28 ? -0.154  2.883   -3.663 1.00 0.00 ? 230 PHE A HA   4  
ATOM 4073  H HB2  . PHE A 1 28 ? -2.351  1.625   -3.601 1.00 0.00 ? 230 PHE A HB2  4  
ATOM 4074  H HB3  . PHE A 1 28 ? -2.628  2.344   -2.018 1.00 0.00 ? 230 PHE A HB3  4  
ATOM 4075  H HD1  . PHE A 1 28 ? -1.841  3.290   -5.532 1.00 0.00 ? 230 PHE A HD1  4  
ATOM 4076  H HD2  . PHE A 1 28 ? -3.724  4.367   -1.870 1.00 0.00 ? 230 PHE A HD2  4  
ATOM 4077  H HE1  . PHE A 1 28 ? -2.791  5.287   -6.612 1.00 0.00 ? 230 PHE A HE1  4  
ATOM 4078  H HE2  . PHE A 1 28 ? -4.678  6.364   -2.942 1.00 0.00 ? 230 PHE A HE2  4  
ATOM 4079  H HZ   . PHE A 1 28 ? -4.211  6.828   -5.317 1.00 0.00 ? 230 PHE A HZ   4  
ATOM 4080  N N    . LEU A 1 29 ? -0.163  4.844   -2.046 1.00 0.00 ? 231 LEU A N    4  
ATOM 4081  C CA   . LEU A 1 29 ? 0.130   5.902   -1.086 1.00 0.00 ? 231 LEU A CA   4  
ATOM 4082  C C    . LEU A 1 29 ? -0.748  7.124   -1.332 1.00 0.00 ? 231 LEU A C    4  
ATOM 4083  O O    . LEU A 1 29 ? -0.825  7.631   -2.452 1.00 0.00 ? 231 LEU A O    4  
ATOM 4084  C CB   . LEU A 1 29 ? 1.608   6.290   -1.154 1.00 0.00 ? 231 LEU A CB   4  
ATOM 4085  C CG   . LEU A 1 29 ? 2.583   5.111   -1.235 1.00 0.00 ? 231 LEU A CG   4  
ATOM 4086  C CD1  . LEU A 1 29 ? 3.238   5.052   -2.606 1.00 0.00 ? 231 LEU A CD1  4  
ATOM 4087  C CD2  . LEU A 1 29 ? 3.636   5.211   -0.142 1.00 0.00 ? 231 LEU A CD2  4  
ATOM 4088  H H    . LEU A 1 29 ? -0.247  5.067   -2.997 1.00 0.00 ? 231 LEU A H    4  
ATOM 4089  H HA   . LEU A 1 29 ? -0.084  5.518   -0.100 1.00 0.00 ? 231 LEU A HA   4  
ATOM 4090  H HB2  . LEU A 1 29 ? 1.754   6.916   -2.022 1.00 0.00 ? 231 LEU A HB2  4  
ATOM 4091  H HB3  . LEU A 1 29 ? 1.847   6.866   -0.273 1.00 0.00 ? 231 LEU A HB3  4  
ATOM 4092  H HG   . LEU A 1 29 ? 2.036   4.191   -1.090 1.00 0.00 ? 231 LEU A HG   4  
ATOM 4093  H HD11 . LEU A 1 29 ? 2.481   4.901   -3.361 1.00 0.00 ? 231 LEU A HD11 4  
ATOM 4094  H HD12 . LEU A 1 29 ? 3.758   5.979   -2.796 1.00 0.00 ? 231 LEU A HD12 4  
ATOM 4095  H HD13 . LEU A 1 29 ? 3.942   4.233   -2.632 1.00 0.00 ? 231 LEU A HD13 4  
ATOM 4096  H HD21 . LEU A 1 29 ? 4.128   4.255   -0.029 1.00 0.00 ? 231 LEU A HD21 4  
ATOM 4097  H HD22 . LEU A 1 29 ? 4.366   5.960   -0.413 1.00 0.00 ? 231 LEU A HD22 4  
ATOM 4098  H HD23 . LEU A 1 29 ? 3.165   5.486   0.789  1.00 0.00 ? 231 LEU A HD23 4  
ATOM 4099  N N    . GLY A 1 30 ? -1.409  7.592   -0.279 1.00 0.00 ? 232 GLY A N    4  
ATOM 4100  C CA   . GLY A 1 30 ? -2.275  8.750   -0.399 1.00 0.00 ? 232 GLY A CA   4  
ATOM 4101  C C    . GLY A 1 30 ? -3.173  8.930   0.809  1.00 0.00 ? 232 GLY A C    4  
ATOM 4102  O O    . GLY A 1 30 ? -3.041  8.212   1.802  1.00 0.00 ? 232 GLY A O    4  
ATOM 4103  H H    . GLY A 1 30 ? -1.309  7.145   0.588  1.00 0.00 ? 232 GLY A H    4  
ATOM 4104  H HA2  . GLY A 1 30 ? -1.662  9.633   -0.514 1.00 0.00 ? 232 GLY A HA2  4  
ATOM 4105  H HA3  . GLY A 1 30 ? -2.891  8.636   -1.279 1.00 0.00 ? 232 GLY A HA3  4  
ATOM 4106  N N    . GLU A 1 31 ? -4.087  9.891   0.728  1.00 0.00 ? 233 GLU A N    4  
ATOM 4107  C CA   . GLU A 1 31 ? -5.009  10.162  1.824  1.00 0.00 ? 233 GLU A CA   4  
ATOM 4108  C C    . GLU A 1 31 ? -6.161  9.162   1.826  1.00 0.00 ? 233 GLU A C    4  
ATOM 4109  O O    . GLU A 1 31 ? -6.381  8.453   0.845  1.00 0.00 ? 233 GLU A O    4  
ATOM 4110  C CB   . GLU A 1 31 ? -5.555  11.587  1.718  1.00 0.00 ? 233 GLU A CB   4  
ATOM 4111  C CG   . GLU A 1 31 ? -4.487  12.627  1.426  1.00 0.00 ? 233 GLU A CG   4  
ATOM 4112  C CD   . GLU A 1 31 ? -4.401  12.978  -0.046 1.00 0.00 ? 233 GLU A CD   4  
ATOM 4113  O OE1  . GLU A 1 31 ? -5.287  13.713  -0.534 1.00 0.00 ? 233 GLU A OE1  4  
ATOM 4114  O OE2  . GLU A 1 31 ? -3.451  12.520  -0.712 1.00 0.00 ? 233 GLU A OE2  4  
ATOM 4115  H H    . GLU A 1 31 ? -4.143  10.429  -0.089 1.00 0.00 ? 233 GLU A H    4  
ATOM 4116  H HA   . GLU A 1 31 ? -4.462  10.064  2.750  1.00 0.00 ? 233 GLU A HA   4  
ATOM 4117  H HB2  . GLU A 1 31 ? -6.287  11.622  0.925  1.00 0.00 ? 233 GLU A HB2  4  
ATOM 4118  H HB3  . GLU A 1 31 ? -6.035  11.847  2.650  1.00 0.00 ? 233 GLU A HB3  4  
ATOM 4119  H HG2  . GLU A 1 31 ? -4.715  13.525  1.982  1.00 0.00 ? 233 GLU A HG2  4  
ATOM 4120  H HG3  . GLU A 1 31 ? -3.530  12.242  1.746  1.00 0.00 ? 233 GLU A HG3  4  
ATOM 4121  N N    . THR A 1 32 ? -6.890  9.110   2.937  1.00 0.00 ? 234 THR A N    4  
ATOM 4122  C CA   . THR A 1 32 ? -8.020  8.195   3.067  1.00 0.00 ? 234 THR A CA   4  
ATOM 4123  C C    . THR A 1 32 ? -9.335  8.962   3.155  1.00 0.00 ? 234 THR A C    4  
ATOM 4124  O O    . THR A 1 32 ? -9.345  10.174  3.372  1.00 0.00 ? 234 THR A O    4  
ATOM 4125  C CB   . THR A 1 32 ? -7.848  7.313   4.304  1.00 0.00 ? 234 THR A CB   4  
ATOM 4126  O OG1  . THR A 1 32 ? -8.017  8.071   5.487  1.00 0.00 ? 234 THR A OG1  4  
ATOM 4127  C CG2  . THR A 1 32 ? -6.493  6.643   4.378  1.00 0.00 ? 234 THR A CG2  4  
ATOM 4128  H H    . THR A 1 32 ? -6.666  9.701   3.686  1.00 0.00 ? 234 THR A H    4  
ATOM 4129  H HA   . THR A 1 32 ? -8.041  7.568   2.189  1.00 0.00 ? 234 THR A HA   4  
ATOM 4130  H HB   . THR A 1 32 ? -8.599  6.537   4.287  1.00 0.00 ? 234 THR A HB   4  
ATOM 4131  H HG1  . THR A 1 32 ? -7.414  8.820   5.478  1.00 0.00 ? 234 THR A HG1  4  
ATOM 4132  H HG21 . THR A 1 32 ? -6.417  5.897   3.601  1.00 0.00 ? 234 THR A HG21 4  
ATOM 4133  H HG22 . THR A 1 32 ? -6.376  6.173   5.342  1.00 0.00 ? 234 THR A HG22 4  
ATOM 4134  H HG23 . THR A 1 32 ? -5.717  7.384   4.242  1.00 0.00 ? 234 THR A HG23 4  
ATOM 4135  N N    . ASP A 1 33 ? -10.441 8.247   2.987  1.00 0.00 ? 235 ASP A N    4  
ATOM 4136  C CA   . ASP A 1 33 ? -11.764 8.857   3.048  1.00 0.00 ? 235 ASP A CA   4  
ATOM 4137  C C    . ASP A 1 33 ? -12.322 8.826   4.472  1.00 0.00 ? 235 ASP A C    4  
ATOM 4138  O O    . ASP A 1 33 ? -13.387 9.383   4.739  1.00 0.00 ? 235 ASP A O    4  
ATOM 4139  C CB   . ASP A 1 33 ? -12.723 8.140   2.093  1.00 0.00 ? 235 ASP A CB   4  
ATOM 4140  C CG   . ASP A 1 33 ? -13.205 9.042   0.973  1.00 0.00 ? 235 ASP A CG   4  
ATOM 4141  O OD1  . ASP A 1 33 ? -13.853 10.066  1.274  1.00 0.00 ? 235 ASP A OD1  4  
ATOM 4142  O OD2  . ASP A 1 33 ? -12.931 8.725   -0.202 1.00 0.00 ? 235 ASP A OD2  4  
ATOM 4143  H H    . ASP A 1 33 ? -10.368 7.284   2.818  1.00 0.00 ? 235 ASP A H    4  
ATOM 4144  H HA   . ASP A 1 33 ? -11.666 9.886   2.737  1.00 0.00 ? 235 ASP A HA   4  
ATOM 4145  H HB2  . ASP A 1 33 ? -12.216 7.293   1.656  1.00 0.00 ? 235 ASP A HB2  4  
ATOM 4146  H HB3  . ASP A 1 33 ? -13.583 7.793   2.646  1.00 0.00 ? 235 ASP A HB3  4  
ATOM 4147  N N    . PHE A 1 34 ? -11.601 8.176   5.383  1.00 0.00 ? 236 PHE A N    4  
ATOM 4148  C CA   . PHE A 1 34 ? -12.037 8.082   6.773  1.00 0.00 ? 236 PHE A CA   4  
ATOM 4149  C C    . PHE A 1 34 ? -11.006 8.699   7.721  1.00 0.00 ? 236 PHE A C    4  
ATOM 4150  O O    . PHE A 1 34 ? -11.316 8.998   8.875  1.00 0.00 ? 236 PHE A O    4  
ATOM 4151  C CB   . PHE A 1 34 ? -12.295 6.618   7.155  1.00 0.00 ? 236 PHE A CB   4  
ATOM 4152  C CG   . PHE A 1 34 ? -11.053 5.841   7.505  1.00 0.00 ? 236 PHE A CG   4  
ATOM 4153  C CD1  . PHE A 1 34 ? -10.041 5.661   6.574  1.00 0.00 ? 236 PHE A CD1  4  
ATOM 4154  C CD2  . PHE A 1 34 ? -10.900 5.295   8.769  1.00 0.00 ? 236 PHE A CD2  4  
ATOM 4155  C CE1  . PHE A 1 34 ? -8.903  4.948   6.899  1.00 0.00 ? 236 PHE A CE1  4  
ATOM 4156  C CE2  . PHE A 1 34 ? -9.764  4.582   9.099  1.00 0.00 ? 236 PHE A CE2  4  
ATOM 4157  C CZ   . PHE A 1 34 ? -8.764  4.409   8.163  1.00 0.00 ? 236 PHE A CZ   4  
ATOM 4158  H H    . PHE A 1 34 ? -10.762 7.753   5.114  1.00 0.00 ? 236 PHE A H    4  
ATOM 4159  H HA   . PHE A 1 34 ? -12.961 8.633   6.864  1.00 0.00 ? 236 PHE A HA   4  
ATOM 4160  H HB2  . PHE A 1 34 ? -12.953 6.589   8.010  1.00 0.00 ? 236 PHE A HB2  4  
ATOM 4161  H HB3  . PHE A 1 34 ? -12.776 6.120   6.325  1.00 0.00 ? 236 PHE A HB3  4  
ATOM 4162  H HD1  . PHE A 1 34 ? -10.148 6.081   5.588  1.00 0.00 ? 236 PHE A HD1  4  
ATOM 4163  H HD2  . PHE A 1 34 ? -11.682 5.429   9.502  1.00 0.00 ? 236 PHE A HD2  4  
ATOM 4164  H HE1  . PHE A 1 34 ? -8.123  4.814   6.165  1.00 0.00 ? 236 PHE A HE1  4  
ATOM 4165  H HE2  . PHE A 1 34 ? -9.659  4.160   10.088 1.00 0.00 ? 236 PHE A HE2  4  
ATOM 4166  H HZ   . PHE A 1 34 ? -7.874  3.852   8.418  1.00 0.00 ? 236 PHE A HZ   4  
ATOM 4167  N N    . ALA A 1 35 ? -9.783  8.887   7.232  1.00 0.00 ? 237 ALA A N    4  
ATOM 4168  C CA   . ALA A 1 35 ? -8.719  9.466   8.043  1.00 0.00 ? 237 ALA A CA   4  
ATOM 4169  C C    . ALA A 1 35 ? -8.185  10.749  7.417  1.00 0.00 ? 237 ALA A C    4  
ATOM 4170  O O    . ALA A 1 35 ? -8.036  10.841  6.198  1.00 0.00 ? 237 ALA A O    4  
ATOM 4171  C CB   . ALA A 1 35 ? -7.593  8.459   8.230  1.00 0.00 ? 237 ALA A CB   4  
ATOM 4172  H H    . ALA A 1 35 ? -9.589  8.631   6.307  1.00 0.00 ? 237 ALA A H    4  
ATOM 4173  H HA   . ALA A 1 35 ? -9.129  9.694   9.016  1.00 0.00 ? 237 ALA A HA   4  
ATOM 4174  H HB1  . ALA A 1 35 ? -7.057  8.683   9.141  1.00 0.00 ? 237 ALA A HB1  4  
ATOM 4175  H HB2  . ALA A 1 35 ? -8.007  7.464   8.292  1.00 0.00 ? 237 ALA A HB2  4  
ATOM 4176  H HB3  . ALA A 1 35 ? -6.915  8.516   7.391  1.00 0.00 ? 237 ALA A HB3  4  
ATOM 4177  N N    . LYS A 1 36 ? -7.898  11.737  8.258  1.00 0.00 ? 238 LYS A N    4  
ATOM 4178  C CA   . LYS A 1 36 ? -7.379  13.016  7.785  1.00 0.00 ? 238 LYS A CA   4  
ATOM 4179  C C    . LYS A 1 36 ? -5.854  13.008  7.758  1.00 0.00 ? 238 LYS A C    4  
ATOM 4180  O O    . LYS A 1 36 ? -5.207  12.717  8.764  1.00 0.00 ? 238 LYS A O    4  
ATOM 4181  C CB   . LYS A 1 36 ? -7.879  14.154  8.679  1.00 0.00 ? 238 LYS A CB   4  
ATOM 4182  C CG   . LYS A 1 36 ? -7.638  13.916  10.159 1.00 0.00 ? 238 LYS A CG   4  
ATOM 4183  C CD   . LYS A 1 36 ? -7.512  15.226  10.920 1.00 0.00 ? 238 LYS A CD   4  
ATOM 4184  C CE   . LYS A 1 36 ? -6.485  15.125  12.036 1.00 0.00 ? 238 LYS A CE   4  
ATOM 4185  N NZ   . LYS A 1 36 ? -5.136  15.574  11.592 1.00 0.00 ? 238 LYS A NZ   4  
ATOM 4186  H H    . LYS A 1 36 ? -8.038  11.603  9.218  1.00 0.00 ? 238 LYS A H    4  
ATOM 4187  H HA   . LYS A 1 36 ? -7.745  13.171  6.782  1.00 0.00 ? 238 LYS A HA   4  
ATOM 4188  H HB2  . LYS A 1 36 ? -7.375  15.066  8.395  1.00 0.00 ? 238 LYS A HB2  4  
ATOM 4189  H HB3  . LYS A 1 36 ? -8.941  14.277  8.523  1.00 0.00 ? 238 LYS A HB3  4  
ATOM 4190  H HG2  . LYS A 1 36 ? -8.469  13.355  10.564 1.00 0.00 ? 238 LYS A HG2  4  
ATOM 4191  H HG3  . LYS A 1 36 ? -6.725  13.351  10.279 1.00 0.00 ? 238 LYS A HG3  4  
ATOM 4192  H HD2  . LYS A 1 36 ? -7.208  16.002  10.234 1.00 0.00 ? 238 LYS A HD2  4  
ATOM 4193  H HD3  . LYS A 1 36 ? -8.472  15.477  11.348 1.00 0.00 ? 238 LYS A HD3  4  
ATOM 4194  H HE2  . LYS A 1 36 ? -6.806  15.743  12.862 1.00 0.00 ? 238 LYS A HE2  4  
ATOM 4195  H HE3  . LYS A 1 36 ? -6.425  14.097  12.361 1.00 0.00 ? 238 LYS A HE3  4  
ATOM 4196  H HZ1  . LYS A 1 36 ? -4.408  15.216  12.244 1.00 0.00 ? 238 LYS A HZ1  4  
ATOM 4197  H HZ2  . LYS A 1 36 ? -5.092  16.614  11.577 1.00 0.00 ? 238 LYS A HZ2  4  
ATOM 4198  H HZ3  . LYS A 1 36 ? -4.937  15.216  10.637 1.00 0.00 ? 238 LYS A HZ3  4  
ATOM 4199  N N    . GLY A 1 37 ? -5.287  13.329  6.600  1.00 0.00 ? 239 GLY A N    4  
ATOM 4200  C CA   . GLY A 1 37 ? -3.841  13.354  6.463  1.00 0.00 ? 239 GLY A CA   4  
ATOM 4201  C C    . GLY A 1 37 ? -3.344  12.416  5.379  1.00 0.00 ? 239 GLY A C    4  
ATOM 4202  O O    . GLY A 1 37 ? -4.116  11.976  4.528  1.00 0.00 ? 239 GLY A O    4  
ATOM 4203  H H    . GLY A 1 37 ? -5.853  13.553  5.832  1.00 0.00 ? 239 GLY A H    4  
ATOM 4204  H HA2  . GLY A 1 37 ? -3.531  14.359  6.222  1.00 0.00 ? 239 GLY A HA2  4  
ATOM 4205  H HA3  . GLY A 1 37 ? -3.396  13.066  7.405  1.00 0.00 ? 239 GLY A HA3  4  
ATOM 4206  N N    . GLU A 1 38 ? -2.052  12.111  5.412  1.00 0.00 ? 240 GLU A N    4  
ATOM 4207  C CA   . GLU A 1 38 ? -1.451  11.222  4.425  1.00 0.00 ? 240 GLU A CA   4  
ATOM 4208  C C    . GLU A 1 38 ? -1.351  9.798   4.966  1.00 0.00 ? 240 GLU A C    4  
ATOM 4209  O O    . GLU A 1 38 ? -0.926  9.584   6.101  1.00 0.00 ? 240 GLU A O    4  
ATOM 4210  C CB   . GLU A 1 38 ? -0.062  11.728  4.029  1.00 0.00 ? 240 GLU A CB   4  
ATOM 4211  C CG   . GLU A 1 38 ? 0.944   11.707  5.169  1.00 0.00 ? 240 GLU A CG   4  
ATOM 4212  C CD   . GLU A 1 38 ? 2.150   12.583  4.899  1.00 0.00 ? 240 GLU A CD   4  
ATOM 4213  O OE1  . GLU A 1 38 ? 1.965   13.800  4.688  1.00 0.00 ? 240 GLU A OE1  4  
ATOM 4214  O OE2  . GLU A 1 38 ? 3.281   12.051  4.898  1.00 0.00 ? 240 GLU A OE2  4  
ATOM 4215  H H    . GLU A 1 38 ? -1.488  12.496  6.116  1.00 0.00 ? 240 GLU A H    4  
ATOM 4216  H HA   . GLU A 1 38 ? -2.085  11.219  3.552  1.00 0.00 ? 240 GLU A HA   4  
ATOM 4217  H HB2  . GLU A 1 38 ? 0.319   11.110  3.230  1.00 0.00 ? 240 GLU A HB2  4  
ATOM 4218  H HB3  . GLU A 1 38 ? -0.150  12.745  3.675  1.00 0.00 ? 240 GLU A HB3  4  
ATOM 4219  H HG2  . GLU A 1 38 ? 0.457   12.058  6.067  1.00 0.00 ? 240 GLU A HG2  4  
ATOM 4220  H HG3  . GLU A 1 38 ? 1.279   10.691  5.316  1.00 0.00 ? 240 GLU A HG3  4  
ATOM 4221  N N    . TRP A 1 39 ? -1.743  8.829   4.144  1.00 0.00 ? 241 TRP A N    4  
ATOM 4222  C CA   . TRP A 1 39 ? -1.697  7.426   4.541  1.00 0.00 ? 241 TRP A CA   4  
ATOM 4223  C C    . TRP A 1 39 ? -1.066  6.570   3.447  1.00 0.00 ? 241 TRP A C    4  
ATOM 4224  O O    . TRP A 1 39 ? -0.924  7.011   2.307  1.00 0.00 ? 241 TRP A O    4  
ATOM 4225  C CB   . TRP A 1 39 ? -3.105  6.921   4.858  1.00 0.00 ? 241 TRP A CB   4  
ATOM 4226  C CG   . TRP A 1 39 ? -3.703  7.560   6.074  1.00 0.00 ? 241 TRP A CG   4  
ATOM 4227  C CD1  . TRP A 1 39 ? -4.163  8.840   6.184  1.00 0.00 ? 241 TRP A CD1  4  
ATOM 4228  C CD2  . TRP A 1 39 ? -3.900  6.951   7.354  1.00 0.00 ? 241 TRP A CD2  4  
ATOM 4229  N NE1  . TRP A 1 39 ? -4.635  9.065   7.455  1.00 0.00 ? 241 TRP A NE1  4  
ATOM 4230  C CE2  . TRP A 1 39 ? -4.485  7.919   8.193  1.00 0.00 ? 241 TRP A CE2  4  
ATOM 4231  C CE3  . TRP A 1 39 ? -3.641  5.680   7.874  1.00 0.00 ? 241 TRP A CE3  4  
ATOM 4232  C CZ2  . TRP A 1 39 ? -4.813  7.656   9.520  1.00 0.00 ? 241 TRP A CZ2  4  
ATOM 4233  C CZ3  . TRP A 1 39 ? -3.967  5.420   9.192  1.00 0.00 ? 241 TRP A CZ3  4  
ATOM 4234  C CH2  . TRP A 1 39 ? -4.549  6.403   10.002 1.00 0.00 ? 241 TRP A CH2  4  
ATOM 4235  H H    . TRP A 1 39 ? -2.071  9.064   3.251  1.00 0.00 ? 241 TRP A H    4  
ATOM 4236  H HA   . TRP A 1 39 ? -1.092  7.356   5.432  1.00 0.00 ? 241 TRP A HA   4  
ATOM 4237  H HB2  . TRP A 1 39 ? -3.753  7.128   4.020  1.00 0.00 ? 241 TRP A HB2  4  
ATOM 4238  H HB3  . TRP A 1 39 ? -3.069  5.854   5.024  1.00 0.00 ? 241 TRP A HB3  4  
ATOM 4239  H HD1  . TRP A 1 39 ? -4.150  9.563   5.380  1.00 0.00 ? 241 TRP A HD1  4  
ATOM 4240  H HE1  . TRP A 1 39 ? -5.018  9.907   7.780  1.00 0.00 ? 241 TRP A HE1  4  
ATOM 4241  H HE3  . TRP A 1 39 ? -3.193  4.908   7.265  1.00 0.00 ? 241 TRP A HE3  4  
ATOM 4242  H HZ2  . TRP A 1 39 ? -5.262  8.403   10.157 1.00 0.00 ? 241 TRP A HZ2  4  
ATOM 4243  H HZ3  . TRP A 1 39 ? -3.774  4.444   9.609  1.00 0.00 ? 241 TRP A HZ3  4  
ATOM 4244  H HH2  . TRP A 1 39 ? -4.785  6.156   11.025 1.00 0.00 ? 241 TRP A HH2  4  
ATOM 4245  N N    . CYS A 1 40 ? -0.689  5.346   3.802  1.00 0.00 ? 242 CYS A N    4  
ATOM 4246  C CA   . CYS A 1 40 ? -0.073  4.431   2.847  1.00 0.00 ? 242 CYS A CA   4  
ATOM 4247  C C    . CYS A 1 40 ? -0.685  3.037   2.950  1.00 0.00 ? 242 CYS A C    4  
ATOM 4248  O O    . CYS A 1 40 ? -1.224  2.656   3.989  1.00 0.00 ? 242 CYS A O    4  
ATOM 4249  C CB   . CYS A 1 40 ? 1.440   4.361   3.077  1.00 0.00 ? 242 CYS A CB   4  
ATOM 4250  S SG   . CYS A 1 40 ? 2.305   3.217   1.974  1.00 0.00 ? 242 CYS A SG   4  
ATOM 4251  H H    . CYS A 1 40 ? -0.827  5.051   4.726  1.00 0.00 ? 242 CYS A H    4  
ATOM 4252  H HA   . CYS A 1 40 ? -0.257  4.818   1.855  1.00 0.00 ? 242 CYS A HA   4  
ATOM 4253  H HB2  . CYS A 1 40 ? 1.865   5.342   2.925  1.00 0.00 ? 242 CYS A HB2  4  
ATOM 4254  H HB3  . CYS A 1 40 ? 1.629   4.045   4.092  1.00 0.00 ? 242 CYS A HB3  4  
ATOM 4255  H HG   . CYS A 1 40 ? 2.167   2.325   2.304  1.00 0.00 ? 242 CYS A HG   4  
ATOM 4256  N N    . GLY A 1 41 ? -0.593  2.286   1.861  1.00 0.00 ? 243 GLY A N    4  
ATOM 4257  C CA   . GLY A 1 41 ? -1.134  0.941   1.824  1.00 0.00 ? 243 GLY A CA   4  
ATOM 4258  C C    . GLY A 1 41 ? -0.050  -0.108  1.676  1.00 0.00 ? 243 GLY A C    4  
ATOM 4259  O O    . GLY A 1 41 ? 0.763   -0.040  0.757  1.00 0.00 ? 243 GLY A O    4  
ATOM 4260  H H    . GLY A 1 41 ? -0.150  2.650   1.066  1.00 0.00 ? 243 GLY A H    4  
ATOM 4261  H HA2  . GLY A 1 41 ? -1.680  0.757   2.737  1.00 0.00 ? 243 GLY A HA2  4  
ATOM 4262  H HA3  . GLY A 1 41 ? -1.811  0.862   0.986  1.00 0.00 ? 243 GLY A HA3  4  
ATOM 4263  N N    . VAL A 1 42 ? -0.036  -1.076  2.584  1.00 0.00 ? 244 VAL A N    4  
ATOM 4264  C CA   . VAL A 1 42 ? 0.961   -2.139  2.546  1.00 0.00 ? 244 VAL A CA   4  
ATOM 4265  C C    . VAL A 1 42 ? 0.306   -3.512  2.636  1.00 0.00 ? 244 VAL A C    4  
ATOM 4266  O O    . VAL A 1 42 ? -0.537  -3.753  3.500  1.00 0.00 ? 244 VAL A O    4  
ATOM 4267  C CB   . VAL A 1 42 ? 1.980   -1.998  3.698  1.00 0.00 ? 244 VAL A CB   4  
ATOM 4268  C CG1  . VAL A 1 42 ? 3.211   -2.849  3.435  1.00 0.00 ? 244 VAL A CG1  4  
ATOM 4269  C CG2  . VAL A 1 42 ? 2.370   -0.542  3.908  1.00 0.00 ? 244 VAL A CG2  4  
ATOM 4270  H H    . VAL A 1 42 ? -0.710  -1.076  3.297  1.00 0.00 ? 244 VAL A H    4  
ATOM 4271  H HA   . VAL A 1 42 ? 1.495   -2.064  1.606  1.00 0.00 ? 244 VAL A HA   4  
ATOM 4272  H HB   . VAL A 1 42 ? 1.514   -2.355  4.605  1.00 0.00 ? 244 VAL A HB   4  
ATOM 4273  H HG11 . VAL A 1 42 ? 3.880   -2.785  4.281  1.00 0.00 ? 244 VAL A HG11 4  
ATOM 4274  H HG12 . VAL A 1 42 ? 2.913   -3.877  3.290  1.00 0.00 ? 244 VAL A HG12 4  
ATOM 4275  H HG13 . VAL A 1 42 ? 3.715   -2.491  2.550  1.00 0.00 ? 244 VAL A HG13 4  
ATOM 4276  H HG21 . VAL A 1 42 ? 1.478   0.058   4.018  1.00 0.00 ? 244 VAL A HG21 4  
ATOM 4277  H HG22 . VAL A 1 42 ? 2.972   -0.457  4.801  1.00 0.00 ? 244 VAL A HG22 4  
ATOM 4278  H HG23 . VAL A 1 42 ? 2.936   -0.195  3.057  1.00 0.00 ? 244 VAL A HG23 4  
ATOM 4279  N N    . GLU A 1 43 ? 0.708   -4.414  1.748  1.00 0.00 ? 245 GLU A N    4  
ATOM 4280  C CA   . GLU A 1 43 ? 0.170   -5.768  1.738  1.00 0.00 ? 245 GLU A CA   4  
ATOM 4281  C C    . GLU A 1 43 ? 0.932   -6.633  2.733  1.00 0.00 ? 245 GLU A C    4  
ATOM 4282  O O    . GLU A 1 43 ? 2.116   -6.913  2.545  1.00 0.00 ? 245 GLU A O    4  
ATOM 4283  C CB   . GLU A 1 43 ? 0.263   -6.372  0.336  1.00 0.00 ? 245 GLU A CB   4  
ATOM 4284  C CG   . GLU A 1 43 ? -0.296  -7.783  0.243  1.00 0.00 ? 245 GLU A CG   4  
ATOM 4285  C CD   . GLU A 1 43 ? -0.751  -8.138  -1.159 1.00 0.00 ? 245 GLU A CD   4  
ATOM 4286  O OE1  . GLU A 1 43 ? -0.993  -7.209  -1.959 1.00 0.00 ? 245 GLU A OE1  4  
ATOM 4287  O OE2  . GLU A 1 43 ? -0.864  -9.345  -1.459 1.00 0.00 ? 245 GLU A OE2  4  
ATOM 4288  H H    . GLU A 1 43 ? 1.391   -4.166  1.090  1.00 0.00 ? 245 GLU A H    4  
ATOM 4289  H HA   . GLU A 1 43 ? -0.867  -5.719  2.036  1.00 0.00 ? 245 GLU A HA   4  
ATOM 4290  H HB2  . GLU A 1 43 ? -0.285  -5.745  -0.351 1.00 0.00 ? 245 GLU A HB2  4  
ATOM 4291  H HB3  . GLU A 1 43 ? 1.301   -6.398  0.036  1.00 0.00 ? 245 GLU A HB3  4  
ATOM 4292  H HG2  . GLU A 1 43 ? 0.471   -8.481  0.543  1.00 0.00 ? 245 GLU A HG2  4  
ATOM 4293  H HG3  . GLU A 1 43 ? -1.139  -7.867  0.911  1.00 0.00 ? 245 GLU A HG3  4  
ATOM 4294  N N    . LEU A 1 44 ? 0.254   -7.036  3.801  1.00 0.00 ? 246 LEU A N    4  
ATOM 4295  C CA   . LEU A 1 44 ? 0.878   -7.846  4.836  1.00 0.00 ? 246 LEU A CA   4  
ATOM 4296  C C    . LEU A 1 44 ? 1.234   -9.236  4.322  1.00 0.00 ? 246 LEU A C    4  
ATOM 4297  O O    . LEU A 1 44 ? 0.606   -9.753  3.398  1.00 0.00 ? 246 LEU A O    4  
ATOM 4298  C CB   . LEU A 1 44 ? -0.049  -7.959  6.047  1.00 0.00 ? 246 LEU A CB   4  
ATOM 4299  C CG   . LEU A 1 44 ? -0.435  -6.626  6.689  1.00 0.00 ? 246 LEU A CG   4  
ATOM 4300  C CD1  . LEU A 1 44 ? -1.539  -6.829  7.714  1.00 0.00 ? 246 LEU A CD1  4  
ATOM 4301  C CD2  . LEU A 1 44 ? 0.779   -5.972  7.330  1.00 0.00 ? 246 LEU A CD2  4  
ATOM 4302  H H    . LEU A 1 44 ? -0.683  -6.768  3.901  1.00 0.00 ? 246 LEU A H    4  
ATOM 4303  H HA   . LEU A 1 44 ? 1.785   -7.347  5.138  1.00 0.00 ? 246 LEU A HA   4  
ATOM 4304  H HB2  . LEU A 1 44 ? -0.952  -8.464  5.736  1.00 0.00 ? 246 LEU A HB2  4  
ATOM 4305  H HB3  . LEU A 1 44 ? 0.441   -8.563  6.795  1.00 0.00 ? 246 LEU A HB3  4  
ATOM 4306  H HG   . LEU A 1 44 ? -0.809  -5.961  5.923  1.00 0.00 ? 246 LEU A HG   4  
ATOM 4307  H HD11 . LEU A 1 44 ? -1.710  -5.904  8.246  1.00 0.00 ? 246 LEU A HD11 4  
ATOM 4308  H HD12 . LEU A 1 44 ? -2.446  -7.128  7.211  1.00 0.00 ? 246 LEU A HD12 4  
ATOM 4309  H HD13 . LEU A 1 44 ? -1.243  -7.597  8.411  1.00 0.00 ? 246 LEU A HD13 4  
ATOM 4310  H HD21 . LEU A 1 44 ? 1.486   -6.734  7.620  1.00 0.00 ? 246 LEU A HD21 4  
ATOM 4311  H HD22 . LEU A 1 44 ? 1.242   -5.301  6.622  1.00 0.00 ? 246 LEU A HD22 4  
ATOM 4312  H HD23 . LEU A 1 44 ? 0.470   -5.417  8.203  1.00 0.00 ? 246 LEU A HD23 4  
ATOM 4313  N N    . ASP A 1 45 ? 2.255   -9.832  4.931  1.00 0.00 ? 247 ASP A N    4  
ATOM 4314  C CA   . ASP A 1 45 ? 2.715   -11.162 4.547  1.00 0.00 ? 247 ASP A CA   4  
ATOM 4315  C C    . ASP A 1 45 ? 1.779   -12.242 5.080  1.00 0.00 ? 247 ASP A C    4  
ATOM 4316  O O    . ASP A 1 45 ? 1.647   -13.311 4.484  1.00 0.00 ? 247 ASP A O    4  
ATOM 4317  C CB   . ASP A 1 45 ? 4.135   -11.394 5.069  1.00 0.00 ? 247 ASP A CB   4  
ATOM 4318  C CG   . ASP A 1 45 ? 5.083   -10.274 4.686  1.00 0.00 ? 247 ASP A CG   4  
ATOM 4319  O OD1  . ASP A 1 45 ? 5.626   -10.317 3.561  1.00 0.00 ? 247 ASP A OD1  4  
ATOM 4320  O OD2  . ASP A 1 45 ? 5.280   -9.354  5.507  1.00 0.00 ? 247 ASP A OD2  4  
ATOM 4321  H H    . ASP A 1 45 ? 2.714   -9.361  5.658  1.00 0.00 ? 247 ASP A H    4  
ATOM 4322  H HA   . ASP A 1 45 ? 2.726   -11.210 3.470  1.00 0.00 ? 247 ASP A HA   4  
ATOM 4323  H HB2  . ASP A 1 45 ? 4.108   -11.462 6.147  1.00 0.00 ? 247 ASP A HB2  4  
ATOM 4324  H HB3  . ASP A 1 45 ? 4.515   -12.317 4.664  1.00 0.00 ? 247 ASP A HB3  4  
ATOM 4325  N N    . GLU A 1 46 ? 1.134   -11.959 6.207  1.00 0.00 ? 248 GLU A N    4  
ATOM 4326  C CA   . GLU A 1 46 ? 0.210   -12.908 6.820  1.00 0.00 ? 248 GLU A CA   4  
ATOM 4327  C C    . GLU A 1 46 ? -1.084  -12.215 7.240  1.00 0.00 ? 248 GLU A C    4  
ATOM 4328  O O    . GLU A 1 46 ? -1.176  -10.988 7.209  1.00 0.00 ? 248 GLU A O    4  
ATOM 4329  C CB   . GLU A 1 46 ? 0.863   -13.576 8.032  1.00 0.00 ? 248 GLU A CB   4  
ATOM 4330  C CG   . GLU A 1 46 ? 1.589   -14.869 7.697  1.00 0.00 ? 248 GLU A CG   4  
ATOM 4331  C CD   . GLU A 1 46 ? 0.666   -16.071 7.695  1.00 0.00 ? 248 GLU A CD   4  
ATOM 4332  O OE1  . GLU A 1 46 ? 0.017   -16.324 8.732  1.00 0.00 ? 248 GLU A OE1  4  
ATOM 4333  O OE2  . GLU A 1 46 ? 0.590   -16.760 6.655  1.00 0.00 ? 248 GLU A OE2  4  
ATOM 4334  H H    . GLU A 1 46 ? 1.282   -11.092 6.637  1.00 0.00 ? 248 GLU A H    4  
ATOM 4335  H HA   . GLU A 1 46 ? -0.022  -13.665 6.087  1.00 0.00 ? 248 GLU A HA   4  
ATOM 4336  H HB2  . GLU A 1 46 ? 1.578   -12.890 8.465  1.00 0.00 ? 248 GLU A HB2  4  
ATOM 4337  H HB3  . GLU A 1 46 ? 0.100   -13.797 8.763  1.00 0.00 ? 248 GLU A HB3  4  
ATOM 4338  H HG2  . GLU A 1 46 ? 2.033   -14.775 6.718  1.00 0.00 ? 248 GLU A HG2  4  
ATOM 4339  H HG3  . GLU A 1 46 ? 2.365   -15.031 8.430  1.00 0.00 ? 248 GLU A HG3  4  
ATOM 4340  N N    . PRO A 1 47 ? -2.105  -12.996 7.639  1.00 0.00 ? 249 PRO A N    4  
ATOM 4341  C CA   . PRO A 1 47 ? -3.397  -12.451 8.065  1.00 0.00 ? 249 PRO A CA   4  
ATOM 4342  C C    . PRO A 1 47 ? -3.280  -11.623 9.344  1.00 0.00 ? 249 PRO A C    4  
ATOM 4343  O O    . PRO A 1 47 ? -3.758  -12.026 10.405 1.00 0.00 ? 249 PRO A O    4  
ATOM 4344  C CB   . PRO A 1 47 ? -4.265  -13.697 8.309  1.00 0.00 ? 249 PRO A CB   4  
ATOM 4345  C CG   . PRO A 1 47 ? -3.535  -14.827 7.662  1.00 0.00 ? 249 PRO A CG   4  
ATOM 4346  C CD   . PRO A 1 47 ? -2.079  -14.463 7.705  1.00 0.00 ? 249 PRO A CD   4  
ATOM 4347  H HA   . PRO A 1 47 ? -3.844  -11.846 7.290  1.00 0.00 ? 249 PRO A HA   4  
ATOM 4348  H HB2  . PRO A 1 47 ? -4.377  -13.858 9.370  1.00 0.00 ? 249 PRO A HB2  4  
ATOM 4349  H HB3  . PRO A 1 47 ? -5.237  -13.551 7.861  1.00 0.00 ? 249 PRO A HB3  4  
ATOM 4350  H HG2  . PRO A 1 47 ? -3.709  -15.739 8.214  1.00 0.00 ? 249 PRO A HG2  4  
ATOM 4351  H HG3  . PRO A 1 47 ? -3.864  -14.940 6.641  1.00 0.00 ? 249 PRO A HG3  4  
ATOM 4352  H HD2  . PRO A 1 47 ? -1.632  -14.802 8.627  1.00 0.00 ? 249 PRO A HD2  4  
ATOM 4353  H HD3  . PRO A 1 47 ? -1.560  -14.879 6.853  1.00 0.00 ? 249 PRO A HD3  4  
ATOM 4354  N N    . LEU A 1 48 ? -2.641  -10.464 9.234  1.00 0.00 ? 250 LEU A N    4  
ATOM 4355  C CA   . LEU A 1 48 ? -2.460  -9.578  10.379 1.00 0.00 ? 250 LEU A CA   4  
ATOM 4356  C C    . LEU A 1 48 ? -2.965  -8.170  10.073 1.00 0.00 ? 250 LEU A C    4  
ATOM 4357  O O    . LEU A 1 48 ? -2.556  -7.203  10.717 1.00 0.00 ? 250 LEU A O    4  
ATOM 4358  C CB   . LEU A 1 48 ? -0.985  -9.528  10.783 1.00 0.00 ? 250 LEU A CB   4  
ATOM 4359  C CG   . LEU A 1 48 ? 0.011   -9.511  9.617  1.00 0.00 ? 250 LEU A CG   4  
ATOM 4360  C CD1  . LEU A 1 48 ? 0.934   -8.305  9.715  1.00 0.00 ? 250 LEU A CD1  4  
ATOM 4361  C CD2  . LEU A 1 48 ? 0.819   -10.798 9.587  1.00 0.00 ? 250 LEU A CD2  4  
ATOM 4362  H H    . LEU A 1 48 ? -2.285  -10.196 8.360  1.00 0.00 ? 250 LEU A H    4  
ATOM 4363  H HA   . LEU A 1 48 ? -3.033  -9.980  11.199 1.00 0.00 ? 250 LEU A HA   4  
ATOM 4364  H HB2  . LEU A 1 48 ? -0.829  -8.641  11.379 1.00 0.00 ? 250 LEU A HB2  4  
ATOM 4365  H HB3  . LEU A 1 48 ? -0.773  -10.392 11.395 1.00 0.00 ? 250 LEU A HB3  4  
ATOM 4366  H HG   . LEU A 1 48 ? -0.535  -9.436  8.688  1.00 0.00 ? 250 LEU A HG   4  
ATOM 4367  H HD11 . LEU A 1 48 ? 0.362   -7.402  9.562  1.00 0.00 ? 250 LEU A HD11 4  
ATOM 4368  H HD12 . LEU A 1 48 ? 1.391   -8.280  10.692 1.00 0.00 ? 250 LEU A HD12 4  
ATOM 4369  H HD13 . LEU A 1 48 ? 1.702   -8.378  8.960  1.00 0.00 ? 250 LEU A HD13 4  
ATOM 4370  H HD21 . LEU A 1 48 ? 1.570   -10.771 10.362 1.00 0.00 ? 250 LEU A HD21 4  
ATOM 4371  H HD22 . LEU A 1 48 ? 0.163   -11.639 9.750  1.00 0.00 ? 250 LEU A HD22 4  
ATOM 4372  H HD23 . LEU A 1 48 ? 1.300   -10.899 8.624  1.00 0.00 ? 250 LEU A HD23 4  
ATOM 4373  N N    . GLY A 1 49 ? -3.853  -8.058  9.090  1.00 0.00 ? 251 GLY A N    4  
ATOM 4374  C CA   . GLY A 1 49 ? -4.393  -6.762  8.725  1.00 0.00 ? 251 GLY A CA   4  
ATOM 4375  C C    . GLY A 1 49 ? -5.819  -6.572  9.203  1.00 0.00 ? 251 GLY A C    4  
ATOM 4376  O O    . GLY A 1 49 ? -6.337  -7.387  9.965  1.00 0.00 ? 251 GLY A O    4  
ATOM 4377  H H    . GLY A 1 49 ? -4.146  -8.861  8.611  1.00 0.00 ? 251 GLY A H    4  
ATOM 4378  H HA2  . GLY A 1 49 ? -3.774  -5.991  9.160  1.00 0.00 ? 251 GLY A HA2  4  
ATOM 4379  H HA3  . GLY A 1 49 ? -4.368  -6.662  7.649  1.00 0.00 ? 251 GLY A HA3  4  
ATOM 4380  N N    . LYS A 1 50 ? -6.453  -5.491  8.761  1.00 0.00 ? 252 LYS A N    4  
ATOM 4381  C CA   . LYS A 1 50 ? -7.827  -5.198  9.153  1.00 0.00 ? 252 LYS A CA   4  
ATOM 4382  C C    . LYS A 1 50 ? -8.762  -5.215  7.948  1.00 0.00 ? 252 LYS A C    4  
ATOM 4383  O O    . LYS A 1 50 ? -9.915  -5.636  8.052  1.00 0.00 ? 252 LYS A O    4  
ATOM 4384  C CB   . LYS A 1 50 ? -7.900  -3.837  9.847  1.00 0.00 ? 252 LYS A CB   4  
ATOM 4385  C CG   . LYS A 1 50 ? -6.802  -3.615  10.874 1.00 0.00 ? 252 LYS A CG   4  
ATOM 4386  C CD   . LYS A 1 50 ? -7.141  -4.271  12.202 1.00 0.00 ? 252 LYS A CD   4  
ATOM 4387  C CE   . LYS A 1 50 ? -5.889  -4.576  13.009 1.00 0.00 ? 252 LYS A CE   4  
ATOM 4388  N NZ   . LYS A 1 50 ? -6.152  -5.561  14.094 1.00 0.00 ? 252 LYS A NZ   4  
ATOM 4389  H H    . LYS A 1 50 ? -5.988  -4.875  8.157  1.00 0.00 ? 252 LYS A H    4  
ATOM 4390  H HA   . LYS A 1 50 ? -8.143  -5.962  9.848  1.00 0.00 ? 252 LYS A HA   4  
ATOM 4391  H HB2  . LYS A 1 50 ? -7.826  -3.061  9.100  1.00 0.00 ? 252 LYS A HB2  4  
ATOM 4392  H HB3  . LYS A 1 50 ? -8.854  -3.751  10.347 1.00 0.00 ? 252 LYS A HB3  4  
ATOM 4393  H HG2  . LYS A 1 50 ? -5.882  -4.038  10.500 1.00 0.00 ? 252 LYS A HG2  4  
ATOM 4394  H HG3  . LYS A 1 50 ? -6.676  -2.553  11.029 1.00 0.00 ? 252 LYS A HG3  4  
ATOM 4395  H HD2  . LYS A 1 50 ? -7.770  -3.604  12.772 1.00 0.00 ? 252 LYS A HD2  4  
ATOM 4396  H HD3  . LYS A 1 50 ? -7.671  -5.195  12.013 1.00 0.00 ? 252 LYS A HD3  4  
ATOM 4397  H HE2  . LYS A 1 50 ? -5.138  -4.978  12.346 1.00 0.00 ? 252 LYS A HE2  4  
ATOM 4398  H HE3  . LYS A 1 50 ? -5.528  -3.657  13.447 1.00 0.00 ? 252 LYS A HE3  4  
ATOM 4399  H HZ1  . LYS A 1 50 ? -6.194  -6.523  13.702 1.00 0.00 ? 252 LYS A HZ1  4  
ATOM 4400  H HZ2  . LYS A 1 50 ? -7.059  -5.348  14.558 1.00 0.00 ? 252 LYS A HZ2  4  
ATOM 4401  H HZ3  . LYS A 1 50 ? -5.395  -5.520  14.806 1.00 0.00 ? 252 LYS A HZ3  4  
ATOM 4402  N N    . ASN A 1 51 ? -8.262  -4.755  6.805  1.00 0.00 ? 253 ASN A N    4  
ATOM 4403  C CA   . ASN A 1 51 ? -9.059  -4.718  5.583  1.00 0.00 ? 253 ASN A CA   4  
ATOM 4404  C C    . ASN A 1 51 ? -8.419  -5.560  4.484  1.00 0.00 ? 253 ASN A C    4  
ATOM 4405  O O    . ASN A 1 51 ? -7.245  -5.924  4.570  1.00 0.00 ? 253 ASN A O    4  
ATOM 4406  C CB   . ASN A 1 51 ? -9.230  -3.276  5.104  1.00 0.00 ? 253 ASN A CB   4  
ATOM 4407  C CG   . ASN A 1 51 ? -7.912  -2.636  4.709  1.00 0.00 ? 253 ASN A CG   4  
ATOM 4408  O OD1  . ASN A 1 51 ? -7.623  -2.465  3.524  1.00 0.00 ? 253 ASN A OD1  4  
ATOM 4409  N ND2  . ASN A 1 51 ? -7.106  -2.281  5.701  1.00 0.00 ? 253 ASN A ND2  4  
ATOM 4410  H H    . ASN A 1 51 ? -7.337  -4.432  6.783  1.00 0.00 ? 253 ASN A H    4  
ATOM 4411  H HA   . ASN A 1 51 ? -10.033 -5.128  5.810  1.00 0.00 ? 253 ASN A HA   4  
ATOM 4412  H HB2  . ASN A 1 51 ? -9.885  -3.262  4.246  1.00 0.00 ? 253 ASN A HB2  4  
ATOM 4413  H HB3  . ASN A 1 51 ? -9.669  -2.689  5.897  1.00 0.00 ? 253 ASN A HB3  4  
ATOM 4414  H HD21 . ASN A 1 51 ? -7.402  -2.449  6.621  1.00 0.00 ? 253 ASN A HD21 4  
ATOM 4415  H HD22 . ASN A 1 51 ? -6.245  -1.865  5.473  1.00 0.00 ? 253 ASN A HD22 4  
ATOM 4416  N N    . ASP A 1 52 ? -9.198  -5.862  3.451  1.00 0.00 ? 254 ASP A N    4  
ATOM 4417  C CA   . ASP A 1 52 ? -8.711  -6.660  2.331  1.00 0.00 ? 254 ASP A CA   4  
ATOM 4418  C C    . ASP A 1 52 ? -8.265  -5.767  1.174  1.00 0.00 ? 254 ASP A C    4  
ATOM 4419  O O    . ASP A 1 52 ? -8.269  -6.189  0.018  1.00 0.00 ? 254 ASP A O    4  
ATOM 4420  C CB   . ASP A 1 52 ? -9.797  -7.629  1.858  1.00 0.00 ? 254 ASP A CB   4  
ATOM 4421  C CG   . ASP A 1 52 ? -11.019 -6.911  1.318  1.00 0.00 ? 254 ASP A CG   4  
ATOM 4422  O OD1  . ASP A 1 52 ? -11.466 -5.936  1.959  1.00 0.00 ? 254 ASP A OD1  4  
ATOM 4423  O OD2  . ASP A 1 52 ? -11.529 -7.324  0.256  1.00 0.00 ? 254 ASP A OD2  4  
ATOM 4424  H H    . ASP A 1 52 ? -10.124 -5.543  3.443  1.00 0.00 ? 254 ASP A H    4  
ATOM 4425  H HA   . ASP A 1 52 ? -7.861  -7.229  2.676  1.00 0.00 ? 254 ASP A HA   4  
ATOM 4426  H HB2  . ASP A 1 52 ? -9.396  -8.254  1.074  1.00 0.00 ? 254 ASP A HB2  4  
ATOM 4427  H HB3  . ASP A 1 52 ? -10.102 -8.249  2.687  1.00 0.00 ? 254 ASP A HB3  4  
ATOM 4428  N N    . GLY A 1 53 ? -7.882  -4.535  1.494  1.00 0.00 ? 255 GLY A N    4  
ATOM 4429  C CA   . GLY A 1 53 ? -7.437  -3.608  0.467  1.00 0.00 ? 255 GLY A CA   4  
ATOM 4430  C C    . GLY A 1 53 ? -8.452  -2.518  0.180  1.00 0.00 ? 255 GLY A C    4  
ATOM 4431  O O    . GLY A 1 53 ? -8.391  -1.866  -0.863 1.00 0.00 ? 255 GLY A O    4  
ATOM 4432  H H    . GLY A 1 53 ? -7.894  -4.253  2.431  1.00 0.00 ? 255 GLY A H    4  
ATOM 4433  H HA2  . GLY A 1 53 ? -6.515  -3.148  0.790  1.00 0.00 ? 255 GLY A HA2  4  
ATOM 4434  H HA3  . GLY A 1 53 ? -7.252  -4.160  -0.442 1.00 0.00 ? 255 GLY A HA3  4  
ATOM 4435  N N    . ALA A 1 54 ? -9.387  -2.314  1.104  1.00 0.00 ? 256 ALA A N    4  
ATOM 4436  C CA   . ALA A 1 54 ? -10.413 -1.292  0.937  1.00 0.00 ? 256 ALA A CA   4  
ATOM 4437  C C    . ALA A 1 54 ? -10.658 -0.538  2.238  1.00 0.00 ? 256 ALA A C    4  
ATOM 4438  O O    . ALA A 1 54 ? -10.341 -1.028  3.322  1.00 0.00 ? 256 ALA A O    4  
ATOM 4439  C CB   . ALA A 1 54 ? -11.706 -1.920  0.435  1.00 0.00 ? 256 ALA A CB   4  
ATOM 4440  H H    . ALA A 1 54 ? -9.385  -2.862  1.917  1.00 0.00 ? 256 ALA A H    4  
ATOM 4441  H HA   . ALA A 1 54 ? -10.067 -0.595  0.189  1.00 0.00 ? 256 ALA A HA   4  
ATOM 4442  H HB1  . ALA A 1 54 ? -12.381 -2.064  1.265  1.00 0.00 ? 256 ALA A HB1  4  
ATOM 4443  H HB2  . ALA A 1 54 ? -12.164 -1.267  -0.292 1.00 0.00 ? 256 ALA A HB2  4  
ATOM 4444  H HB3  . ALA A 1 54 ? -11.489 -2.873  -0.023 1.00 0.00 ? 256 ALA A HB3  4  
ATOM 4445  N N    . VAL A 1 55 ? -11.222 0.661   2.122  1.00 0.00 ? 257 VAL A N    4  
ATOM 4446  C CA   . VAL A 1 55 ? -11.509 1.487   3.287  1.00 0.00 ? 257 VAL A CA   4  
ATOM 4447  C C    . VAL A 1 55 ? -12.836 2.225   3.124  1.00 0.00 ? 257 VAL A C    4  
ATOM 4448  O O    . VAL A 1 55 ? -12.991 3.050   2.224  1.00 0.00 ? 257 VAL A O    4  
ATOM 4449  C CB   . VAL A 1 55 ? -10.385 2.515   3.536  1.00 0.00 ? 257 VAL A CB   4  
ATOM 4450  C CG1  . VAL A 1 55 ? -10.685 3.361   4.766  1.00 0.00 ? 257 VAL A CG1  4  
ATOM 4451  C CG2  . VAL A 1 55 ? -9.043  1.812   3.678  1.00 0.00 ? 257 VAL A CG2  4  
ATOM 4452  H H    . VAL A 1 55 ? -11.449 0.996   1.230  1.00 0.00 ? 257 VAL A H    4  
ATOM 4453  H HA   . VAL A 1 55 ? -11.573 0.839   4.150  1.00 0.00 ? 257 VAL A HA   4  
ATOM 4454  H HB   . VAL A 1 55 ? -10.334 3.172   2.680  1.00 0.00 ? 257 VAL A HB   4  
ATOM 4455  H HG11 . VAL A 1 55 ? -9.959  3.148   5.536  1.00 0.00 ? 257 VAL A HG11 4  
ATOM 4456  H HG12 . VAL A 1 55 ? -10.633 4.407   4.502  1.00 0.00 ? 257 VAL A HG12 4  
ATOM 4457  H HG13 . VAL A 1 55 ? -11.676 3.132   5.131  1.00 0.00 ? 257 VAL A HG13 4  
ATOM 4458  H HG21 . VAL A 1 55 ? -9.187  0.858   4.162  1.00 0.00 ? 257 VAL A HG21 4  
ATOM 4459  H HG22 . VAL A 1 55 ? -8.611  1.659   2.700  1.00 0.00 ? 257 VAL A HG22 4  
ATOM 4460  H HG23 . VAL A 1 55 ? -8.379  2.421   4.273  1.00 0.00 ? 257 VAL A HG23 4  
ATOM 4461  N N    . ALA A 1 56 ? -13.787 1.919   4.000  1.00 0.00 ? 258 ALA A N    4  
ATOM 4462  C CA   . ALA A 1 56 ? -15.100 2.553   3.957  1.00 0.00 ? 258 ALA A CA   4  
ATOM 4463  C C    . ALA A 1 56 ? -15.782 2.325   2.611  1.00 0.00 ? 258 ALA A C    4  
ATOM 4464  O O    . ALA A 1 56 ? -16.621 3.120   2.188  1.00 0.00 ? 258 ALA A O    4  
ATOM 4465  C CB   . ALA A 1 56 ? -14.977 4.042   4.240  1.00 0.00 ? 258 ALA A CB   4  
ATOM 4466  H H    . ALA A 1 56 ? -13.602 1.253   4.694  1.00 0.00 ? 258 ALA A H    4  
ATOM 4467  H HA   . ALA A 1 56 ? -15.707 2.112   4.735  1.00 0.00 ? 258 ALA A HA   4  
ATOM 4468  H HB1  . ALA A 1 56 ? -14.720 4.562   3.328  1.00 0.00 ? 258 ALA A HB1  4  
ATOM 4469  H HB2  . ALA A 1 56 ? -15.916 4.416   4.618  1.00 0.00 ? 258 ALA A HB2  4  
ATOM 4470  H HB3  . ALA A 1 56 ? -14.201 4.204   4.976  1.00 0.00 ? 258 ALA A HB3  4  
ATOM 4471  N N    . GLY A 1 57 ? -15.417 1.236   1.940  1.00 0.00 ? 259 GLY A N    4  
ATOM 4472  C CA   . GLY A 1 57 ? -16.007 0.929   0.650  1.00 0.00 ? 259 GLY A CA   4  
ATOM 4473  C C    . GLY A 1 57 ? -15.145 1.384   -0.515 1.00 0.00 ? 259 GLY A C    4  
ATOM 4474  O O    . GLY A 1 57 ? -15.483 1.142   -1.673 1.00 0.00 ? 259 GLY A O    4  
ATOM 4475  H H    . GLY A 1 57 ? -14.742 0.637   2.323  1.00 0.00 ? 259 GLY A H    4  
ATOM 4476  H HA2  . GLY A 1 57 ? -16.152 -0.138  0.579  1.00 0.00 ? 259 GLY A HA2  4  
ATOM 4477  H HA3  . GLY A 1 57 ? -16.968 1.416   0.582  1.00 0.00 ? 259 GLY A HA3  4  
ATOM 4478  N N    . THR A 1 58 ? -14.029 2.043   -0.212 1.00 0.00 ? 260 THR A N    4  
ATOM 4479  C CA   . THR A 1 58 ? -13.123 2.526   -1.246 1.00 0.00 ? 260 THR A CA   4  
ATOM 4480  C C    . THR A 1 58 ? -11.886 1.640   -1.342 1.00 0.00 ? 260 THR A C    4  
ATOM 4481  O O    . THR A 1 58 ? -11.084 1.576   -0.410 1.00 0.00 ? 260 THR A O    4  
ATOM 4482  C CB   . THR A 1 58 ? -12.711 3.970   -0.958 1.00 0.00 ? 260 THR A CB   4  
ATOM 4483  O OG1  . THR A 1 58 ? -13.849 4.778   -0.715 1.00 0.00 ? 260 THR A OG1  4  
ATOM 4484  C CG2  . THR A 1 58 ? -11.928 4.607   -2.086 1.00 0.00 ? 260 THR A CG2  4  
ATOM 4485  H H    . THR A 1 58 ? -13.808 2.206   0.729  1.00 0.00 ? 260 THR A H    4  
ATOM 4486  H HA   . THR A 1 58 ? -13.649 2.493   -2.189 1.00 0.00 ? 260 THR A HA   4  
ATOM 4487  H HB   . THR A 1 58 ? -12.088 3.986   -0.075 1.00 0.00 ? 260 THR A HB   4  
ATOM 4488  H HG1  . THR A 1 58 ? -13.898 4.987   0.221  1.00 0.00 ? 260 THR A HG1  4  
ATOM 4489  H HG21 . THR A 1 58 ? -12.592 4.812   -2.914 1.00 0.00 ? 260 THR A HG21 4  
ATOM 4490  H HG22 . THR A 1 58 ? -11.149 3.932   -2.410 1.00 0.00 ? 260 THR A HG22 4  
ATOM 4491  H HG23 . THR A 1 58 ? -11.486 5.531   -1.743 1.00 0.00 ? 260 THR A HG23 4  
ATOM 4492  N N    . ARG A 1 59 ? -11.736 0.959   -2.473 1.00 0.00 ? 261 ARG A N    4  
ATOM 4493  C CA   . ARG A 1 59 ? -10.596 0.078   -2.687 1.00 0.00 ? 261 ARG A CA   4  
ATOM 4494  C C    . ARG A 1 59 ? -9.423  0.845   -3.292 1.00 0.00 ? 261 ARG A C    4  
ATOM 4495  O O    . ARG A 1 59 ? -9.537  1.420   -4.374 1.00 0.00 ? 261 ARG A O    4  
ATOM 4496  C CB   . ARG A 1 59 ? -10.987 -1.086  -3.600 1.00 0.00 ? 261 ARG A CB   4  
ATOM 4497  C CG   . ARG A 1 59 ? -9.846  -2.052  -3.880 1.00 0.00 ? 261 ARG A CG   4  
ATOM 4498  C CD   . ARG A 1 59 ? -10.310 -3.246  -4.699 1.00 0.00 ? 261 ARG A CD   4  
ATOM 4499  N NE   . ARG A 1 59 ? -11.295 -4.053  -3.983 1.00 0.00 ? 261 ARG A NE   4  
ATOM 4500  C CZ   . ARG A 1 59 ? -12.609 -3.825  -4.008 1.00 0.00 ? 261 ARG A CZ   4  
ATOM 4501  N NH1  . ARG A 1 59 ? -13.103 -2.811  -4.708 1.00 0.00 ? 261 ARG A NH1  4  
ATOM 4502  N NH2  . ARG A 1 59 ? -13.429 -4.614  -3.328 1.00 0.00 ? 261 ARG A NH2  4  
ATOM 4503  H H    . ARG A 1 59 ? -12.408 1.053   -3.181 1.00 0.00 ? 261 ARG A H    4  
ATOM 4504  H HA   . ARG A 1 59 ? -10.296 -0.315  -1.728 1.00 0.00 ? 261 ARG A HA   4  
ATOM 4505  H HB2  . ARG A 1 59 ? -11.792 -1.638  -3.136 1.00 0.00 ? 261 ARG A HB2  4  
ATOM 4506  H HB3  . ARG A 1 59 ? -11.332 -0.689  -4.543 1.00 0.00 ? 261 ARG A HB3  4  
ATOM 4507  H HG2  . ARG A 1 59 ? -9.073  -1.533  -4.425 1.00 0.00 ? 261 ARG A HG2  4  
ATOM 4508  H HG3  . ARG A 1 59 ? -9.450  -2.405  -2.939 1.00 0.00 ? 261 ARG A HG3  4  
ATOM 4509  H HD2  . ARG A 1 59 ? -10.751 -2.887  -5.618 1.00 0.00 ? 261 ARG A HD2  4  
ATOM 4510  H HD3  . ARG A 1 59 ? -9.453  -3.861  -4.930 1.00 0.00 ? 261 ARG A HD3  4  
ATOM 4511  H HE   . ARG A 1 59 ? -10.962 -4.810  -3.456 1.00 0.00 ? 261 ARG A HE   4  
ATOM 4512  H HH11 . ARG A 1 59 ? -12.491 -2.212  -5.223 1.00 0.00 ? 261 ARG A HH11 4  
ATOM 4513  H HH12 . ARG A 1 59 ? -14.089 -2.648  -4.720 1.00 0.00 ? 261 ARG A HH12 4  
ATOM 4514  H HH21 . ARG A 1 59 ? -13.064 -5.379  -2.799 1.00 0.00 ? 261 ARG A HH21 4  
ATOM 4515  H HH22 . ARG A 1 59 ? -14.414 -4.443  -3.346 1.00 0.00 ? 261 ARG A HH22 4  
ATOM 4516  N N    . TYR A 1 60 ? -8.298  0.846   -2.587 1.00 0.00 ? 262 TYR A N    4  
ATOM 4517  C CA   . TYR A 1 60 ? -7.104  1.542   -3.051 1.00 0.00 ? 262 TYR A CA   4  
ATOM 4518  C C    . TYR A 1 60 ? -6.188  0.595   -3.819 1.00 0.00 ? 262 TYR A C    4  
ATOM 4519  O O    . TYR A 1 60 ? -5.645  0.950   -4.864 1.00 0.00 ? 262 TYR A O    4  
ATOM 4520  C CB   . TYR A 1 60 ? -6.353  2.155   -1.869 1.00 0.00 ? 262 TYR A CB   4  
ATOM 4521  C CG   . TYR A 1 60 ? -7.099  3.289   -1.202 1.00 0.00 ? 262 TYR A CG   4  
ATOM 4522  C CD1  . TYR A 1 60 ? -8.176  3.038   -0.361 1.00 0.00 ? 262 TYR A CD1  4  
ATOM 4523  C CD2  . TYR A 1 60 ? -6.725  4.609   -1.415 1.00 0.00 ? 262 TYR A CD2  4  
ATOM 4524  C CE1  . TYR A 1 60 ? -8.861  4.073   0.248  1.00 0.00 ? 262 TYR A CE1  4  
ATOM 4525  C CE2  . TYR A 1 60 ? -7.405  5.649   -0.808 1.00 0.00 ? 262 TYR A CE2  4  
ATOM 4526  C CZ   . TYR A 1 60 ? -8.471  5.375   0.022  1.00 0.00 ? 262 TYR A CZ   4  
ATOM 4527  O OH   . TYR A 1 60 ? -9.150  6.406   0.627  1.00 0.00 ? 262 TYR A OH   4  
ATOM 4528  H H    . TYR A 1 60 ? -8.269  0.368   -1.730 1.00 0.00 ? 262 TYR A H    4  
ATOM 4529  H HA   . TYR A 1 60 ? -7.420  2.334   -3.714 1.00 0.00 ? 262 TYR A HA   4  
ATOM 4530  H HB2  . TYR A 1 60 ? -6.181  1.389   -1.126 1.00 0.00 ? 262 TYR A HB2  4  
ATOM 4531  H HB3  . TYR A 1 60 ? -5.404  2.537   -2.213 1.00 0.00 ? 262 TYR A HB3  4  
ATOM 4532  H HD1  . TYR A 1 60 ? -8.478  2.016   -0.184 1.00 0.00 ? 262 TYR A HD1  4  
ATOM 4533  H HD2  . TYR A 1 60 ? -5.891  4.820   -2.066 1.00 0.00 ? 262 TYR A HD2  4  
ATOM 4534  H HE1  . TYR A 1 60 ? -9.696  3.857   0.898  1.00 0.00 ? 262 TYR A HE1  4  
ATOM 4535  H HE2  . TYR A 1 60 ? -7.100  6.670   -0.987 1.00 0.00 ? 262 TYR A HE2  4  
ATOM 4536  H HH   . TYR A 1 60 ? -9.374  6.158   1.526  1.00 0.00 ? 262 TYR A HH   4  
ATOM 4537  N N    . PHE A 1 61 ? -6.025  -0.615  -3.294 1.00 0.00 ? 263 PHE A N    4  
ATOM 4538  C CA   . PHE A 1 61 ? -5.179  -1.617  -3.929 1.00 0.00 ? 263 PHE A CA   4  
ATOM 4539  C C    . PHE A 1 61 ? -5.771  -3.013  -3.756 1.00 0.00 ? 263 PHE A C    4  
ATOM 4540  O O    . PHE A 1 61 ? -6.756  -3.194  -3.041 1.00 0.00 ? 263 PHE A O    4  
ATOM 4541  C CB   . PHE A 1 61 ? -3.764  -1.571  -3.345 1.00 0.00 ? 263 PHE A CB   4  
ATOM 4542  C CG   . PHE A 1 61 ? -3.733  -1.472  -1.846 1.00 0.00 ? 263 PHE A CG   4  
ATOM 4543  C CD1  . PHE A 1 61 ? -3.949  -0.255  -1.218 1.00 0.00 ? 263 PHE A CD1  4  
ATOM 4544  C CD2  . PHE A 1 61 ? -3.483  -2.589  -1.068 1.00 0.00 ? 263 PHE A CD2  4  
ATOM 4545  C CE1  . PHE A 1 61 ? -3.919  -0.158  0.160  1.00 0.00 ? 263 PHE A CE1  4  
ATOM 4546  C CE2  . PHE A 1 61 ? -3.451  -2.497  0.311  1.00 0.00 ? 263 PHE A CE2  4  
ATOM 4547  C CZ   . PHE A 1 61 ? -3.669  -1.280  0.925  1.00 0.00 ? 263 PHE A CZ   4  
ATOM 4548  H H    . PHE A 1 61 ? -6.488  -0.839  -2.459 1.00 0.00 ? 263 PHE A H    4  
ATOM 4549  H HA   . PHE A 1 61 ? -5.130  -1.390  -4.984 1.00 0.00 ? 263 PHE A HA   4  
ATOM 4550  H HB2  . PHE A 1 61 ? -3.237  -2.469  -3.628 1.00 0.00 ? 263 PHE A HB2  4  
ATOM 4551  H HB3  . PHE A 1 61 ? -3.246  -0.714  -3.747 1.00 0.00 ? 263 PHE A HB3  4  
ATOM 4552  H HD1  . PHE A 1 61 ? -4.145  0.623   -1.815 1.00 0.00 ? 263 PHE A HD1  4  
ATOM 4553  H HD2  . PHE A 1 61 ? -3.313  -3.542  -1.548 1.00 0.00 ? 263 PHE A HD2  4  
ATOM 4554  H HE1  . PHE A 1 61 ? -4.088  0.796   0.637  1.00 0.00 ? 263 PHE A HE1  4  
ATOM 4555  H HE2  . PHE A 1 61 ? -3.256  -3.377  0.907  1.00 0.00 ? 263 PHE A HE2  4  
ATOM 4556  H HZ   . PHE A 1 61 ? -3.644  -1.206  2.003  1.00 0.00 ? 263 PHE A HZ   4  
ATOM 4557  N N    . GLN A 1 62 ? -5.166  -3.995  -4.414 1.00 0.00 ? 264 GLN A N    4  
ATOM 4558  C CA   . GLN A 1 62 ? -5.638  -5.372  -4.332 1.00 0.00 ? 264 GLN A CA   4  
ATOM 4559  C C    . GLN A 1 62 ? -4.724  -6.206  -3.443 1.00 0.00 ? 264 GLN A C    4  
ATOM 4560  O O    . GLN A 1 62 ? -3.511  -6.252  -3.652 1.00 0.00 ? 264 GLN A O    4  
ATOM 4561  C CB   . GLN A 1 62 ? -5.718  -5.992  -5.728 1.00 0.00 ? 264 GLN A CB   4  
ATOM 4562  C CG   . GLN A 1 62 ? -6.376  -7.362  -5.749 1.00 0.00 ? 264 GLN A CG   4  
ATOM 4563  C CD   . GLN A 1 62 ? -7.889  -7.284  -5.702 1.00 0.00 ? 264 GLN A CD   4  
ATOM 4564  O OE1  . GLN A 1 62 ? -8.550  -7.239  -6.739 1.00 0.00 ? 264 GLN A OE1  4  
ATOM 4565  N NE2  . GLN A 1 62 ? -8.445  -7.270  -4.496 1.00 0.00 ? 264 GLN A NE2  4  
ATOM 4566  H H    . GLN A 1 62 ? -4.385  -3.788  -4.970 1.00 0.00 ? 264 GLN A H    4  
ATOM 4567  H HA   . GLN A 1 62 ? -6.626  -5.357  -3.897 1.00 0.00 ? 264 GLN A HA   4  
ATOM 4568  H HB2  . GLN A 1 62 ? -6.290  -5.334  -6.368 1.00 0.00 ? 264 GLN A HB2  4  
ATOM 4569  H HB3  . GLN A 1 62 ? -4.720  -6.088  -6.125 1.00 0.00 ? 264 GLN A HB3  4  
ATOM 4570  H HG2  . GLN A 1 62 ? -6.083  -7.874  -6.653 1.00 0.00 ? 264 GLN A HG2  4  
ATOM 4571  H HG3  . GLN A 1 62 ? -6.032  -7.924  -4.892 1.00 0.00 ? 264 GLN A HG3  4  
ATOM 4572  H HE21 . GLN A 1 62 ? -7.855  -7.310  -3.714 1.00 0.00 ? 264 GLN A HE21 4  
ATOM 4573  H HE22 . GLN A 1 62 ? -9.421  -7.221  -4.437 1.00 0.00 ? 264 GLN A HE22 4  
ATOM 4574  N N    . CYS A 1 63 ? -5.313  -6.867  -2.452 1.00 0.00 ? 265 CYS A N    4  
ATOM 4575  C CA   . CYS A 1 63 ? -4.552  -7.702  -1.531 1.00 0.00 ? 265 CYS A CA   4  
ATOM 4576  C C    . CYS A 1 63 ? -5.428  -8.800  -0.937 1.00 0.00 ? 265 CYS A C    4  
ATOM 4577  O O    . CYS A 1 63 ? -6.652  -8.689  -0.917 1.00 0.00 ? 265 CYS A O    4  
ATOM 4578  C CB   . CYS A 1 63 ? -3.954  -6.847  -0.411 1.00 0.00 ? 265 CYS A CB   4  
ATOM 4579  S SG   . CYS A 1 63 ? -5.166  -5.835  0.471  1.00 0.00 ? 265 CYS A SG   4  
ATOM 4580  H H    . CYS A 1 63 ? -6.283  -6.791  -2.340 1.00 0.00 ? 265 CYS A H    4  
ATOM 4581  H HA   . CYS A 1 63 ? -3.748  -8.161  -2.086 1.00 0.00 ? 265 CYS A HA   4  
ATOM 4582  H HB2  . CYS A 1 63 ? -3.481  -7.495  0.313  1.00 0.00 ? 265 CYS A HB2  4  
ATOM 4583  H HB3  . CYS A 1 63 ? -3.214  -6.183  -0.830 1.00 0.00 ? 265 CYS A HB3  4  
ATOM 4584  H HG   . CYS A 1 63 ? -4.779  -4.968  0.615  1.00 0.00 ? 265 CYS A HG   4  
ATOM 4585  N N    . GLN A 1 64 ? -4.788  -9.860  -0.456 1.00 0.00 ? 266 GLN A N    4  
ATOM 4586  C CA   . GLN A 1 64 ? -5.503  -10.982 0.140  1.00 0.00 ? 266 GLN A CA   4  
ATOM 4587  C C    . GLN A 1 64 ? -6.307  -10.534 1.359  1.00 0.00 ? 266 GLN A C    4  
ATOM 4588  O O    . GLN A 1 64 ? -6.102  -9.438  1.880  1.00 0.00 ? 266 GLN A O    4  
ATOM 4589  C CB   . GLN A 1 64 ? -4.521  -12.085 0.539  1.00 0.00 ? 266 GLN A CB   4  
ATOM 4590  C CG   . GLN A 1 64 ? -4.177  -13.033 -0.597 1.00 0.00 ? 266 GLN A CG   4  
ATOM 4591  C CD   . GLN A 1 64 ? -3.782  -14.411 -0.105 1.00 0.00 ? 266 GLN A CD   4  
ATOM 4592  O OE1  . GLN A 1 64 ? -2.653  -14.857 -0.310 1.00 0.00 ? 266 GLN A OE1  4  
ATOM 4593  N NE2  . GLN A 1 64 ? -4.715  -15.096 0.546  1.00 0.00 ? 266 GLN A NE2  4  
ATOM 4594  H H    . GLN A 1 64 ? -3.810  -9.889  -0.501 1.00 0.00 ? 266 GLN A H    4  
ATOM 4595  H HA   . GLN A 1 64 ? -6.185  -11.372 -0.602 1.00 0.00 ? 266 GLN A HA   4  
ATOM 4596  H HB2  . GLN A 1 64 ? -3.608  -11.626 0.887  1.00 0.00 ? 266 GLN A HB2  4  
ATOM 4597  H HB3  . GLN A 1 64 ? -4.953  -12.661 1.344  1.00 0.00 ? 266 GLN A HB3  4  
ATOM 4598  H HG2  . GLN A 1 64 ? -5.038  -13.130 -1.241 1.00 0.00 ? 266 GLN A HG2  4  
ATOM 4599  H HG3  . GLN A 1 64 ? -3.353  -12.617 -1.158 1.00 0.00 ? 266 GLN A HG3  4  
ATOM 4600  H HE21 . GLN A 1 64 ? -5.593  -14.678 0.672  1.00 0.00 ? 266 GLN A HE21 4  
ATOM 4601  H HE22 . GLN A 1 64 ? -4.487  -15.990 0.876  1.00 0.00 ? 266 GLN A HE22 4  
ATOM 4602  N N    . PRO A 1 65 ? -7.238  -11.380 1.831  1.00 0.00 ? 267 PRO A N    4  
ATOM 4603  C CA   . PRO A 1 65 ? -8.073  -11.067 2.995  1.00 0.00 ? 267 PRO A CA   4  
ATOM 4604  C C    . PRO A 1 65 ? -7.247  -10.912 4.269  1.00 0.00 ? 267 PRO A C    4  
ATOM 4605  O O    . PRO A 1 65 ? -6.358  -11.717 4.545  1.00 0.00 ? 267 PRO A O    4  
ATOM 4606  C CB   . PRO A 1 65 ? -9.012  -12.276 3.111  1.00 0.00 ? 267 PRO A CB   4  
ATOM 4607  C CG   . PRO A 1 65 ? -8.938  -12.960 1.789  1.00 0.00 ? 267 PRO A CG   4  
ATOM 4608  C CD   . PRO A 1 65 ? -7.554  -12.703 1.269  1.00 0.00 ? 267 PRO A CD   4  
ATOM 4609  H HA   . PRO A 1 65 ? -8.653  -10.170 2.835  1.00 0.00 ? 267 PRO A HA   4  
ATOM 4610  H HB2  . PRO A 1 65 ? -8.673  -12.920 3.908  1.00 0.00 ? 267 PRO A HB2  4  
ATOM 4611  H HB3  . PRO A 1 65 ? -10.015 -11.934 3.321  1.00 0.00 ? 267 PRO A HB3  4  
ATOM 4612  H HG2  . PRO A 1 65 ? -9.099  -14.020 1.914  1.00 0.00 ? 267 PRO A HG2  4  
ATOM 4613  H HG3  . PRO A 1 65 ? -9.673  -12.543 1.117  1.00 0.00 ? 267 PRO A HG3  4  
ATOM 4614  H HD2  . PRO A 1 65 ? -6.866  -13.452 1.634  1.00 0.00 ? 267 PRO A HD2  4  
ATOM 4615  H HD3  . PRO A 1 65 ? -7.552  -12.674 0.191  1.00 0.00 ? 267 PRO A HD3  4  
ATOM 4616  N N    . LYS A 1 66 ? -7.550  -9.875  5.043  1.00 0.00 ? 268 LYS A N    4  
ATOM 4617  C CA   . LYS A 1 66 ? -6.838  -9.613  6.290  1.00 0.00 ? 268 LYS A CA   4  
ATOM 4618  C C    . LYS A 1 66 ? -5.360  -9.323  6.039  1.00 0.00 ? 268 LYS A C    4  
ATOM 4619  O O    . LYS A 1 66 ? -4.536  -9.437  6.945  1.00 0.00 ? 268 LYS A O    4  
ATOM 4620  C CB   . LYS A 1 66 ? -6.979  -10.805 7.242  1.00 0.00 ? 268 LYS A CB   4  
ATOM 4621  C CG   . LYS A 1 66 ? -8.422  -11.137 7.589  1.00 0.00 ? 268 LYS A CG   4  
ATOM 4622  C CD   . LYS A 1 66 ? -8.921  -10.307 8.764  1.00 0.00 ? 268 LYS A CD   4  
ATOM 4623  C CE   . LYS A 1 66 ? -9.224  -11.173 9.978  1.00 0.00 ? 268 LYS A CE   4  
ATOM 4624  N NZ   . LYS A 1 66 ? -8.545  -10.669 11.204 1.00 0.00 ? 268 LYS A NZ   4  
ATOM 4625  H H    . LYS A 1 66 ? -8.271  -9.270  4.769  1.00 0.00 ? 268 LYS A H    4  
ATOM 4626  H HA   . LYS A 1 66 ? -7.287  -8.746  6.750  1.00 0.00 ? 268 LYS A HA   4  
ATOM 4627  H HB2  . LYS A 1 66 ? -6.532  -11.674 6.783  1.00 0.00 ? 268 LYS A HB2  4  
ATOM 4628  H HB3  . LYS A 1 66 ? -6.454  -10.582 8.159  1.00 0.00 ? 268 LYS A HB3  4  
ATOM 4629  H HG2  . LYS A 1 66 ? -9.045  -10.935 6.730  1.00 0.00 ? 268 LYS A HG2  4  
ATOM 4630  H HG3  . LYS A 1 66 ? -8.487  -12.184 7.845  1.00 0.00 ? 268 LYS A HG3  4  
ATOM 4631  H HD2  . LYS A 1 66 ? -8.162  -9.586  9.031  1.00 0.00 ? 268 LYS A HD2  4  
ATOM 4632  H HD3  . LYS A 1 66 ? -9.822  -9.791  8.468  1.00 0.00 ? 268 LYS A HD3  4  
ATOM 4633  H HE2  . LYS A 1 66 ? -10.291 -11.176 10.144 1.00 0.00 ? 268 LYS A HE2  4  
ATOM 4634  H HE3  . LYS A 1 66 ? -8.889  -12.181 9.779  1.00 0.00 ? 268 LYS A HE3  4  
ATOM 4635  H HZ1  . LYS A 1 66 ? -9.166  -10.791 12.030 1.00 0.00 ? 268 LYS A HZ1  4  
ATOM 4636  H HZ2  . LYS A 1 66 ? -8.320  -9.660  11.097 1.00 0.00 ? 268 LYS A HZ2  4  
ATOM 4637  H HZ3  . LYS A 1 66 ? -7.664  -11.195 11.366 1.00 0.00 ? 268 LYS A HZ3  4  
ATOM 4638  N N    . TYR A 1 67 ? -5.029  -8.944  4.807  1.00 0.00 ? 269 TYR A N    4  
ATOM 4639  C CA   . TYR A 1 67 ? -3.648  -8.634  4.449  1.00 0.00 ? 269 TYR A CA   4  
ATOM 4640  C C    . TYR A 1 67 ? -3.472  -7.140  4.182  1.00 0.00 ? 269 TYR A C    4  
ATOM 4641  O O    . TYR A 1 67 ? -2.355  -6.624  4.207  1.00 0.00 ? 269 TYR A O    4  
ATOM 4642  C CB   . TYR A 1 67 ? -3.222  -9.432  3.215  1.00 0.00 ? 269 TYR A CB   4  
ATOM 4643  C CG   . TYR A 1 67 ? -2.670  -10.804 3.530  1.00 0.00 ? 269 TYR A CG   4  
ATOM 4644  C CD1  . TYR A 1 67 ? -3.245  -11.597 4.515  1.00 0.00 ? 269 TYR A CD1  4  
ATOM 4645  C CD2  . TYR A 1 67 ? -1.575  -11.306 2.838  1.00 0.00 ? 269 TYR A CD2  4  
ATOM 4646  C CE1  . TYR A 1 67 ? -2.742  -12.851 4.804  1.00 0.00 ? 269 TYR A CE1  4  
ATOM 4647  C CE2  . TYR A 1 67 ? -1.067  -12.560 3.120  1.00 0.00 ? 269 TYR A CE2  4  
ATOM 4648  C CZ   . TYR A 1 67 ? -1.654  -13.328 4.103  1.00 0.00 ? 269 TYR A CZ   4  
ATOM 4649  O OH   . TYR A 1 67 ? -1.152  -14.578 4.386  1.00 0.00 ? 269 TYR A OH   4  
ATOM 4650  H H    . TYR A 1 67 ? -5.728  -8.865  4.125  1.00 0.00 ? 269 TYR A H    4  
ATOM 4651  H HA   . TYR A 1 67 ? -3.019  -8.914  5.281  1.00 0.00 ? 269 TYR A HA   4  
ATOM 4652  H HB2  . TYR A 1 67 ? -4.075  -9.561  2.567  1.00 0.00 ? 269 TYR A HB2  4  
ATOM 4653  H HB3  . TYR A 1 67 ? -2.459  -8.880  2.685  1.00 0.00 ? 269 TYR A HB3  4  
ATOM 4654  H HD1  . TYR A 1 67 ? -4.096  -11.221 5.061  1.00 0.00 ? 269 TYR A HD1  4  
ATOM 4655  H HD2  . TYR A 1 67 ? -1.117  -10.702 2.071  1.00 0.00 ? 269 TYR A HD2  4  
ATOM 4656  H HE1  . TYR A 1 67 ? -3.203  -13.453 5.572  1.00 0.00 ? 269 TYR A HE1  4  
ATOM 4657  H HE2  . TYR A 1 67 ? -0.215  -12.934 2.572  1.00 0.00 ? 269 TYR A HE2  4  
ATOM 4658  H HH   . TYR A 1 67 ? -0.195  -14.564 4.314  1.00 0.00 ? 269 TYR A HH   4  
ATOM 4659  N N    . GLY A 1 68 ? -4.578  -6.448  3.920  1.00 0.00 ? 270 GLY A N    4  
ATOM 4660  C CA   . GLY A 1 68 ? -4.514  -5.025  3.648  1.00 0.00 ? 270 GLY A CA   4  
ATOM 4661  C C    . GLY A 1 68 ? -4.402  -4.191  4.909  1.00 0.00 ? 270 GLY A C    4  
ATOM 4662  O O    . GLY A 1 68 ? -5.293  -4.213  5.757  1.00 0.00 ? 270 GLY A O    4  
ATOM 4663  H H    . GLY A 1 68 ? -5.443  -6.907  3.911  1.00 0.00 ? 270 GLY A H    4  
ATOM 4664  H HA2  . GLY A 1 68 ? -3.655  -4.828  3.023  1.00 0.00 ? 270 GLY A HA2  4  
ATOM 4665  H HA3  . GLY A 1 68 ? -5.406  -4.731  3.113  1.00 0.00 ? 270 GLY A HA3  4  
ATOM 4666  N N    . LEU A 1 69 ? -3.306  -3.449  5.028  1.00 0.00 ? 271 LEU A N    4  
ATOM 4667  C CA   . LEU A 1 69 ? -3.077  -2.598  6.191  1.00 0.00 ? 271 LEU A CA   4  
ATOM 4668  C C    . LEU A 1 69 ? -2.786  -1.165  5.754  1.00 0.00 ? 271 LEU A C    4  
ATOM 4669  O O    . LEU A 1 69 ? -1.895  -0.923  4.938  1.00 0.00 ? 271 LEU A O    4  
ATOM 4670  C CB   . LEU A 1 69 ? -1.919  -3.142  7.028  1.00 0.00 ? 271 LEU A CB   4  
ATOM 4671  C CG   . LEU A 1 69 ? -1.999  -2.833  8.525  1.00 0.00 ? 271 LEU A CG   4  
ATOM 4672  C CD1  . LEU A 1 69 ? -3.243  -3.462  9.137  1.00 0.00 ? 271 LEU A CD1  4  
ATOM 4673  C CD2  . LEU A 1 69 ? -0.745  -3.323  9.236  1.00 0.00 ? 271 LEU A CD2  4  
ATOM 4674  H H    . LEU A 1 69 ? -2.634  -3.473  4.315  1.00 0.00 ? 271 LEU A H    4  
ATOM 4675  H HA   . LEU A 1 69 ? -3.977  -2.603  6.786  1.00 0.00 ? 271 LEU A HA   4  
ATOM 4676  H HB2  . LEU A 1 69 ? -1.887  -4.214  6.904  1.00 0.00 ? 271 LEU A HB2  4  
ATOM 4677  H HB3  . LEU A 1 69 ? -1.000  -2.726  6.646  1.00 0.00 ? 271 LEU A HB3  4  
ATOM 4678  H HG   . LEU A 1 69 ? -2.065  -1.764  8.661  1.00 0.00 ? 271 LEU A HG   4  
ATOM 4679  H HD11 . LEU A 1 69 ? -2.955  -4.290  9.769  1.00 0.00 ? 271 LEU A HD11 4  
ATOM 4680  H HD12 . LEU A 1 69 ? -3.763  -2.724  9.729  1.00 0.00 ? 271 LEU A HD12 4  
ATOM 4681  H HD13 . LEU A 1 69 ? -3.892  -3.818  8.351  1.00 0.00 ? 271 LEU A HD13 4  
ATOM 4682  H HD21 . LEU A 1 69 ? 0.041   -3.479  8.514  1.00 0.00 ? 271 LEU A HD21 4  
ATOM 4683  H HD22 . LEU A 1 69 ? -0.431  -2.585  9.960  1.00 0.00 ? 271 LEU A HD22 4  
ATOM 4684  H HD23 . LEU A 1 69 ? -0.959  -4.254  9.742  1.00 0.00 ? 271 LEU A HD23 4  
ATOM 4685  N N    . PHE A 1 70 ? -3.548  -0.219  6.293  1.00 0.00 ? 272 PHE A N    4  
ATOM 4686  C CA   . PHE A 1 70 ? -3.379  1.189   5.949  1.00 0.00 ? 272 PHE A CA   4  
ATOM 4687  C C    . PHE A 1 70 ? -2.697  1.961   7.076  1.00 0.00 ? 272 PHE A C    4  
ATOM 4688  O O    . PHE A 1 70 ? -3.273  2.144   8.146  1.00 0.00 ? 272 PHE A O    4  
ATOM 4689  C CB   . PHE A 1 70 ? -4.741  1.822   5.650  1.00 0.00 ? 272 PHE A CB   4  
ATOM 4690  C CG   . PHE A 1 70 ? -5.281  1.486   4.288  1.00 0.00 ? 272 PHE A CG   4  
ATOM 4691  C CD1  . PHE A 1 70 ? -5.362  0.169   3.866  1.00 0.00 ? 272 PHE A CD1  4  
ATOM 4692  C CD2  . PHE A 1 70 ? -5.712  2.489   3.435  1.00 0.00 ? 272 PHE A CD2  4  
ATOM 4693  C CE1  . PHE A 1 70 ? -5.863  -0.141  2.615  1.00 0.00 ? 272 PHE A CE1  4  
ATOM 4694  C CE2  . PHE A 1 70 ? -6.212  2.185   2.184  1.00 0.00 ? 272 PHE A CE2  4  
ATOM 4695  C CZ   . PHE A 1 70 ? -6.289  0.869   1.772  1.00 0.00 ? 272 PHE A CZ   4  
ATOM 4696  H H    . PHE A 1 70 ? -4.248  -0.475  6.930  1.00 0.00 ? 272 PHE A H    4  
ATOM 4697  H HA   . PHE A 1 70 ? -2.766  1.245   5.065  1.00 0.00 ? 272 PHE A HA   4  
ATOM 4698  H HB2  . PHE A 1 70 ? -5.457  1.478   6.382  1.00 0.00 ? 272 PHE A HB2  4  
ATOM 4699  H HB3  . PHE A 1 70 ? -4.653  2.896   5.719  1.00 0.00 ? 272 PHE A HB3  4  
ATOM 4700  H HD1  . PHE A 1 70 ? -5.029  -0.620  4.522  1.00 0.00 ? 272 PHE A HD1  4  
ATOM 4701  H HD2  . PHE A 1 70 ? -5.653  3.518   3.755  1.00 0.00 ? 272 PHE A HD2  4  
ATOM 4702  H HE1  . PHE A 1 70 ? -5.920  -1.171  2.296  1.00 0.00 ? 272 PHE A HE1  4  
ATOM 4703  H HE2  . PHE A 1 70 ? -6.545  2.976   1.527  1.00 0.00 ? 272 PHE A HE2  4  
ATOM 4704  H HZ   . PHE A 1 70 ? -6.679  0.628   0.796  1.00 0.00 ? 272 PHE A HZ   4  
ATOM 4705  N N    . ALA A 1 71 ? -1.476  2.425   6.822  1.00 0.00 ? 273 ALA A N    4  
ATOM 4706  C CA   . ALA A 1 71 ? -0.731  3.192   7.817  1.00 0.00 ? 273 ALA A CA   4  
ATOM 4707  C C    . ALA A 1 71 ? 0.064   4.319   7.161  1.00 0.00 ? 273 ALA A C    4  
ATOM 4708  O O    . ALA A 1 71 ? 0.507   4.198   6.019  1.00 0.00 ? 273 ALA A O    4  
ATOM 4709  C CB   . ALA A 1 71 ? 0.196   2.289   8.620  1.00 0.00 ? 273 ALA A CB   4  
ATOM 4710  H H    . ALA A 1 71 ? -1.071  2.258   5.946  1.00 0.00 ? 273 ALA A H    4  
ATOM 4711  H HA   . ALA A 1 71 ? -1.448  3.625   8.501  1.00 0.00 ? 273 ALA A HA   4  
ATOM 4712  H HB1  . ALA A 1 71 ? -0.317  1.372   8.867  1.00 0.00 ? 273 ALA A HB1  4  
ATOM 4713  H HB2  . ALA A 1 71 ? 1.076   2.065   8.036  1.00 0.00 ? 273 ALA A HB2  4  
ATOM 4714  H HB3  . ALA A 1 71 ? 0.489   2.795   9.530  1.00 0.00 ? 273 ALA A HB3  4  
ATOM 4715  N N    . PRO A 1 72 ? 0.251   5.435   7.883  1.00 0.00 ? 274 PRO A N    4  
ATOM 4716  C CA   . PRO A 1 72 ? 0.991   6.598   7.381  1.00 0.00 ? 274 PRO A CA   4  
ATOM 4717  C C    . PRO A 1 72 ? 2.338   6.222   6.776  1.00 0.00 ? 274 PRO A C    4  
ATOM 4718  O O    . PRO A 1 72 ? 2.861   5.135   7.018  1.00 0.00 ? 274 PRO A O    4  
ATOM 4719  C CB   . PRO A 1 72 ? 1.201   7.449   8.630  1.00 0.00 ? 274 PRO A CB   4  
ATOM 4720  C CG   . PRO A 1 72 ? 0.079   7.090   9.535  1.00 0.00 ? 274 PRO A CG   4  
ATOM 4721  C CD   . PRO A 1 72 ? -0.253  5.650   9.252  1.00 0.00 ? 274 PRO A CD   4  
ATOM 4722  H HA   . PRO A 1 72 ? 0.415   7.153   6.657  1.00 0.00 ? 274 PRO A HA   4  
ATOM 4723  H HB2  . PRO A 1 72 ? 2.156   7.209   9.070  1.00 0.00 ? 274 PRO A HB2  4  
ATOM 4724  H HB3  . PRO A 1 72 ? 1.175   8.496   8.364  1.00 0.00 ? 274 PRO A HB3  4  
ATOM 4725  H HG2  . PRO A 1 72 ? 0.390   7.203   10.564 1.00 0.00 ? 274 PRO A HG2  4  
ATOM 4726  H HG3  . PRO A 1 72 ? -0.775  7.719   9.332  1.00 0.00 ? 274 PRO A HG3  4  
ATOM 4727  H HD2  . PRO A 1 72 ? 0.252   5.002   9.953  1.00 0.00 ? 274 PRO A HD2  4  
ATOM 4728  H HD3  . PRO A 1 72 ? -1.319  5.495   9.294  1.00 0.00 ? 274 PRO A HD3  4  
ATOM 4729  N N    . VAL A 1 73 ? 2.899   7.137   5.992  1.00 0.00 ? 275 VAL A N    4  
ATOM 4730  C CA   . VAL A 1 73 ? 4.190   6.911   5.357  1.00 0.00 ? 275 VAL A CA   4  
ATOM 4731  C C    . VAL A 1 73 ? 5.317   6.956   6.385  1.00 0.00 ? 275 VAL A C    4  
ATOM 4732  O O    . VAL A 1 73 ? 6.324   6.262   6.247  1.00 0.00 ? 275 VAL A O    4  
ATOM 4733  C CB   . VAL A 1 73 ? 4.466   7.957   4.255  1.00 0.00 ? 275 VAL A CB   4  
ATOM 4734  C CG1  . VAL A 1 73 ? 4.496   9.360   4.842  1.00 0.00 ? 275 VAL A CG1  4  
ATOM 4735  C CG2  . VAL A 1 73 ? 5.768   7.642   3.532  1.00 0.00 ? 275 VAL A CG2  4  
ATOM 4736  H H    . VAL A 1 73 ? 2.435   7.988   5.841  1.00 0.00 ? 275 VAL A H    4  
ATOM 4737  H HA   . VAL A 1 73 ? 4.172   5.933   4.899  1.00 0.00 ? 275 VAL A HA   4  
ATOM 4738  H HB   . VAL A 1 73 ? 3.660   7.911   3.536  1.00 0.00 ? 275 VAL A HB   4  
ATOM 4739  H HG11 . VAL A 1 73 ? 4.862   10.053  4.097  1.00 0.00 ? 275 VAL A HG11 4  
ATOM 4740  H HG12 . VAL A 1 73 ? 3.500   9.647   5.143  1.00 0.00 ? 275 VAL A HG12 4  
ATOM 4741  H HG13 . VAL A 1 73 ? 5.151   9.377   5.701  1.00 0.00 ? 275 VAL A HG13 4  
ATOM 4742  H HG21 . VAL A 1 73 ? 6.020   6.603   3.679  1.00 0.00 ? 275 VAL A HG21 4  
ATOM 4743  H HG22 . VAL A 1 73 ? 5.649   7.839   2.477  1.00 0.00 ? 275 VAL A HG22 4  
ATOM 4744  H HG23 . VAL A 1 73 ? 6.558   8.263   3.927  1.00 0.00 ? 275 VAL A HG23 4  
ATOM 4745  N N    . HIS A 1 74 ? 5.137   7.773   7.420  1.00 0.00 ? 276 HIS A N    4  
ATOM 4746  C CA   . HIS A 1 74 ? 6.139   7.899   8.473  1.00 0.00 ? 276 HIS A CA   4  
ATOM 4747  C C    . HIS A 1 74 ? 6.086   6.702   9.417  1.00 0.00 ? 276 HIS A C    4  
ATOM 4748  O O    . HIS A 1 74 ? 7.088   6.346   10.038 1.00 0.00 ? 276 HIS A O    4  
ATOM 4749  C CB   . HIS A 1 74 ? 5.941   9.199   9.258  1.00 0.00 ? 276 HIS A CB   4  
ATOM 4750  C CG   . HIS A 1 74 ? 4.522   9.458   9.660  1.00 0.00 ? 276 HIS A CG   4  
ATOM 4751  N ND1  . HIS A 1 74 ? 3.882   10.657  9.427  1.00 0.00 ? 276 HIS A ND1  4  
ATOM 4752  C CD2  . HIS A 1 74 ? 3.618   8.667   10.288 1.00 0.00 ? 276 HIS A CD2  4  
ATOM 4753  C CE1  . HIS A 1 74 ? 2.648   10.594  9.895  1.00 0.00 ? 276 HIS A CE1  4  
ATOM 4754  N NE2  . HIS A 1 74 ? 2.463   9.398   10.422 1.00 0.00 ? 276 HIS A NE2  4  
ATOM 4755  H H    . HIS A 1 74 ? 4.313   8.298   7.478  1.00 0.00 ? 276 HIS A H    4  
ATOM 4756  H HA   . HIS A 1 74 ? 7.110   7.922   8.000  1.00 0.00 ? 276 HIS A HA   4  
ATOM 4757  H HB2  . HIS A 1 74 ? 6.536   9.162   10.157 1.00 0.00 ? 276 HIS A HB2  4  
ATOM 4758  H HB3  . HIS A 1 74 ? 6.270   10.031  8.650  1.00 0.00 ? 276 HIS A HB3  4  
ATOM 4759  H HD1  . HIS A 1 74 ? 4.273   11.440  8.986  1.00 0.00 ? 276 HIS A HD1  4  
ATOM 4760  H HD2  . HIS A 1 74 ? 3.774   7.650   10.615 1.00 0.00 ? 276 HIS A HD2  4  
ATOM 4761  H HE1  . HIS A 1 74 ? 1.914   11.385  9.854  1.00 0.00 ? 276 HIS A HE1  4  
ATOM 4762  H HE2  . HIS A 1 74 ? 1.659   9.109   10.901 1.00 0.00 ? 276 HIS A HE2  4  
ATOM 4763  N N    . LYS A 1 75 ? 4.915   6.077   9.514  1.00 0.00 ? 277 LYS A N    4  
ATOM 4764  C CA   . LYS A 1 75 ? 4.742   4.913   10.375 1.00 0.00 ? 277 LYS A CA   4  
ATOM 4765  C C    . LYS A 1 75 ? 5.323   3.668   9.721  1.00 0.00 ? 277 LYS A C    4  
ATOM 4766  O O    . LYS A 1 75 ? 5.612   2.678   10.393 1.00 0.00 ? 277 LYS A O    4  
ATOM 4767  C CB   . LYS A 1 75 ? 3.259   4.685   10.679 1.00 0.00 ? 277 LYS A CB   4  
ATOM 4768  C CG   . LYS A 1 75 ? 2.718   5.566   11.791 1.00 0.00 ? 277 LYS A CG   4  
ATOM 4769  C CD   . LYS A 1 75 ? 2.117   4.736   12.916 1.00 0.00 ? 277 LYS A CD   4  
ATOM 4770  C CE   . LYS A 1 75 ? 3.195   4.114   13.791 1.00 0.00 ? 277 LYS A CE   4  
ATOM 4771  N NZ   . LYS A 1 75 ? 2.616   3.240   14.847 1.00 0.00 ? 277 LYS A NZ   4  
ATOM 4772  H H    . LYS A 1 75 ? 4.154   6.403   8.989  1.00 0.00 ? 277 LYS A H    4  
ATOM 4773  H HA   . LYS A 1 75 ? 5.266   5.101   11.299 1.00 0.00 ? 277 LYS A HA   4  
ATOM 4774  H HB2  . LYS A 1 75 ? 2.688   4.882   9.784  1.00 0.00 ? 277 LYS A HB2  4  
ATOM 4775  H HB3  . LYS A 1 75 ? 3.119   3.652   10.965 1.00 0.00 ? 277 LYS A HB3  4  
ATOM 4776  H HG2  . LYS A 1 75 ? 3.523   6.166   12.190 1.00 0.00 ? 277 LYS A HG2  4  
ATOM 4777  H HG3  . LYS A 1 75 ? 1.952   6.211   11.385 1.00 0.00 ? 277 LYS A HG3  4  
ATOM 4778  H HD2  . LYS A 1 75 ? 1.496   5.372   13.526 1.00 0.00 ? 277 LYS A HD2  4  
ATOM 4779  H HD3  . LYS A 1 75 ? 1.516   3.947   12.485 1.00 0.00 ? 277 LYS A HD3  4  
ATOM 4780  H HE2  . LYS A 1 75 ? 3.851   3.525   13.168 1.00 0.00 ? 277 LYS A HE2  4  
ATOM 4781  H HE3  . LYS A 1 75 ? 3.760   4.907   14.260 1.00 0.00 ? 277 LYS A HE3  4  
ATOM 4782  H HZ1  . LYS A 1 75 ? 2.544   3.762   15.744 1.00 0.00 ? 277 LYS A HZ1  4  
ATOM 4783  H HZ2  . LYS A 1 75 ? 3.220   2.405   14.990 1.00 0.00 ? 277 LYS A HZ2  4  
ATOM 4784  H HZ3  . LYS A 1 75 ? 1.666   2.922   14.568 1.00 0.00 ? 277 LYS A HZ3  4  
ATOM 4785  N N    . VAL A 1 76 ? 5.492   3.720   8.404  1.00 0.00 ? 278 VAL A N    4  
ATOM 4786  C CA   . VAL A 1 76 ? 6.038   2.593   7.664  1.00 0.00 ? 278 VAL A CA   4  
ATOM 4787  C C    . VAL A 1 76 ? 7.541   2.734   7.470  1.00 0.00 ? 278 VAL A C    4  
ATOM 4788  O O    . VAL A 1 76 ? 8.049   3.829   7.229  1.00 0.00 ? 278 VAL A O    4  
ATOM 4789  C CB   . VAL A 1 76 ? 5.367   2.435   6.287  1.00 0.00 ? 278 VAL A CB   4  
ATOM 4790  C CG1  . VAL A 1 76 ? 5.761   1.113   5.654  1.00 0.00 ? 278 VAL A CG1  4  
ATOM 4791  C CG2  . VAL A 1 76 ? 3.855   2.540   6.403  1.00 0.00 ? 278 VAL A CG2  4  
ATOM 4792  H H    . VAL A 1 76 ? 5.240   4.535   7.920  1.00 0.00 ? 278 VAL A H    4  
ATOM 4793  H HA   . VAL A 1 76 ? 5.845   1.702   8.238  1.00 0.00 ? 278 VAL A HA   4  
ATOM 4794  H HB   . VAL A 1 76 ? 5.714   3.233   5.646  1.00 0.00 ? 278 VAL A HB   4  
ATOM 4795  H HG11 . VAL A 1 76 ? 4.939   0.415   5.735  1.00 0.00 ? 278 VAL A HG11 4  
ATOM 4796  H HG12 . VAL A 1 76 ? 5.998   1.269   4.612  1.00 0.00 ? 278 VAL A HG12 4  
ATOM 4797  H HG13 . VAL A 1 76 ? 6.625   0.711   6.162  1.00 0.00 ? 278 VAL A HG13 4  
ATOM 4798  H HG21 . VAL A 1 76 ? 3.494   3.287   5.714  1.00 0.00 ? 278 VAL A HG21 4  
ATOM 4799  H HG22 . VAL A 1 76 ? 3.409   1.585   6.165  1.00 0.00 ? 278 VAL A HG22 4  
ATOM 4800  H HG23 . VAL A 1 76 ? 3.589   2.820   7.411  1.00 0.00 ? 278 VAL A HG23 4  
ATOM 4801  N N    . THR A 1 77 ? 8.249   1.616   7.581  1.00 0.00 ? 279 THR A N    4  
ATOM 4802  C CA   . THR A 1 77 ? 9.696   1.606   7.421  1.00 0.00 ? 279 THR A CA   4  
ATOM 4803  C C    . THR A 1 77 ? 10.136  0.442   6.542  1.00 0.00 ? 279 THR A C    4  
ATOM 4804  O O    . THR A 1 77 ? 9.668   -0.686  6.706  1.00 0.00 ? 279 THR A O    4  
ATOM 4805  C CB   . THR A 1 77 ? 10.377  1.517   8.788  1.00 0.00 ? 279 THR A CB   4  
ATOM 4806  O OG1  . THR A 1 77 ? 9.478   1.873   9.822  1.00 0.00 ? 279 THR A OG1  4  
ATOM 4807  C CG2  . THR A 1 77 ? 11.591  2.410   8.910  1.00 0.00 ? 279 THR A CG2  4  
ATOM 4808  H H    . THR A 1 77 ? 7.783   0.775   7.777  1.00 0.00 ? 279 THR A H    4  
ATOM 4809  H HA   . THR A 1 77 ? 9.984   2.531   6.945  1.00 0.00 ? 279 THR A HA   4  
ATOM 4810  H HB   . THR A 1 77 ? 10.697  0.499   8.953  1.00 0.00 ? 279 THR A HB   4  
ATOM 4811  H HG1  . THR A 1 77 ? 9.004   2.670   9.574  1.00 0.00 ? 279 THR A HG1  4  
ATOM 4812  H HG21 . THR A 1 77 ? 11.424  3.322   8.356  1.00 0.00 ? 279 THR A HG21 4  
ATOM 4813  H HG22 . THR A 1 77 ? 12.455  1.900   8.511  1.00 0.00 ? 279 THR A HG22 4  
ATOM 4814  H HG23 . THR A 1 77 ? 11.761  2.646   9.950  1.00 0.00 ? 279 THR A HG23 4  
ATOM 4815  N N    . LYS A 1 78 ? 11.042  0.717   5.610  1.00 0.00 ? 280 LYS A N    4  
ATOM 4816  C CA   . LYS A 1 78 ? 11.545  -0.311  4.707  1.00 0.00 ? 280 LYS A CA   4  
ATOM 4817  C C    . LYS A 1 78 ? 12.263  -1.410  5.487  1.00 0.00 ? 280 LYS A C    4  
ATOM 4818  O O    . LYS A 1 78 ? 13.075  -1.132  6.369  1.00 0.00 ? 280 LYS A O    4  
ATOM 4819  C CB   . LYS A 1 78 ? 12.492  0.306   3.675  1.00 0.00 ? 280 LYS A CB   4  
ATOM 4820  C CG   . LYS A 1 78 ? 12.064  0.062   2.237  1.00 0.00 ? 280 LYS A CG   4  
ATOM 4821  C CD   . LYS A 1 78 ? 13.210  0.297   1.267  1.00 0.00 ? 280 LYS A CD   4  
ATOM 4822  C CE   . LYS A 1 78 ? 13.135  1.679   0.639  1.00 0.00 ? 280 LYS A CE   4  
ATOM 4823  N NZ   . LYS A 1 78 ? 12.988  2.748   1.665  1.00 0.00 ? 280 LYS A NZ   4  
ATOM 4824  H H    . LYS A 1 78 ? 11.381  1.633   5.527  1.00 0.00 ? 280 LYS A H    4  
ATOM 4825  H HA   . LYS A 1 78 ? 10.700  -0.744  4.194  1.00 0.00 ? 280 LYS A HA   4  
ATOM 4826  H HB2  . LYS A 1 78 ? 12.536  1.373   3.838  1.00 0.00 ? 280 LYS A HB2  4  
ATOM 4827  H HB3  . LYS A 1 78 ? 13.479  -0.110  3.809  1.00 0.00 ? 280 LYS A HB3  4  
ATOM 4828  H HG2  . LYS A 1 78 ? 11.728  -0.959  2.140  1.00 0.00 ? 280 LYS A HG2  4  
ATOM 4829  H HG3  . LYS A 1 78 ? 11.254  0.734   1.993  1.00 0.00 ? 280 LYS A HG3  4  
ATOM 4830  H HD2  . LYS A 1 78 ? 14.144  0.206   1.800  1.00 0.00 ? 280 LYS A HD2  4  
ATOM 4831  H HD3  . LYS A 1 78 ? 13.165  -0.446  0.485  1.00 0.00 ? 280 LYS A HD3  4  
ATOM 4832  H HE2  . LYS A 1 78 ? 14.039  1.855   0.076  1.00 0.00 ? 280 LYS A HE2  4  
ATOM 4833  H HE3  . LYS A 1 78 ? 12.285  1.713   -0.027 1.00 0.00 ? 280 LYS A HE3  4  
ATOM 4834  H HZ1  . LYS A 1 78 ? 11.987  2.861   1.923  1.00 0.00 ? 280 LYS A HZ1  4  
ATOM 4835  H HZ2  . LYS A 1 78 ? 13.344  3.653   1.293  1.00 0.00 ? 280 LYS A HZ2  4  
ATOM 4836  H HZ3  . LYS A 1 78 ? 13.528  2.501   2.519  1.00 0.00 ? 280 LYS A HZ3  4  
ATOM 4837  N N    . ILE A 1 79 ? 11.957  -2.659  5.154  1.00 0.00 ? 281 ILE A N    4  
ATOM 4838  C CA   . ILE A 1 79 ? 12.571  -3.800  5.822  1.00 0.00 ? 281 ILE A CA   4  
ATOM 4839  C C    . ILE A 1 79 ? 13.835  -4.249  5.093  1.00 0.00 ? 281 ILE A C    4  
ATOM 4840  O O    . ILE A 1 79 ? 14.759  -4.785  5.703  1.00 0.00 ? 281 ILE A O    4  
ATOM 4841  C CB   . ILE A 1 79 ? 11.592  -4.988  5.919  1.00 0.00 ? 281 ILE A CB   4  
ATOM 4842  C CG1  . ILE A 1 79 ? 12.216  -6.133  6.719  1.00 0.00 ? 281 ILE A CG1  4  
ATOM 4843  C CG2  . ILE A 1 79 ? 11.189  -5.462  4.530  1.00 0.00 ? 281 ILE A CG2  4  
ATOM 4844  C CD1  . ILE A 1 79 ? 11.201  -6.974  7.464  1.00 0.00 ? 281 ILE A CD1  4  
ATOM 4845  H H    . ILE A 1 79 ? 11.301  -2.818  4.442  1.00 0.00 ? 281 ILE A H    4  
ATOM 4846  H HA   . ILE A 1 79 ? 12.835  -3.496  6.824  1.00 0.00 ? 281 ILE A HA   4  
ATOM 4847  H HB   . ILE A 1 79 ? 10.701  -4.649  6.426  1.00 0.00 ? 281 ILE A HB   4  
ATOM 4848  H HG12 . ILE A 1 79 ? 12.753  -6.783  6.046  1.00 0.00 ? 281 ILE A HG12 4  
ATOM 4849  H HG13 . ILE A 1 79 ? 12.905  -5.724  7.443  1.00 0.00 ? 281 ILE A HG13 4  
ATOM 4850  H HG21 . ILE A 1 79 ? 10.617  -4.689  4.037  1.00 0.00 ? 281 ILE A HG21 4  
ATOM 4851  H HG22 . ILE A 1 79 ? 12.076  -5.678  3.953  1.00 0.00 ? 281 ILE A HG22 4  
ATOM 4852  H HG23 . ILE A 1 79 ? 10.588  -6.356  4.615  1.00 0.00 ? 281 ILE A HG23 4  
ATOM 4853  H HD11 . ILE A 1 79 ? 11.434  -8.020  7.331  1.00 0.00 ? 281 ILE A HD11 4  
ATOM 4854  H HD12 . ILE A 1 79 ? 11.233  -6.729  8.516  1.00 0.00 ? 281 ILE A HD12 4  
ATOM 4855  H HD13 . ILE A 1 79 ? 10.213  -6.772  7.078  1.00 0.00 ? 281 ILE A HD13 4  
ATOM 4856  N N    . GLY A 1 80 ? 13.867  -4.024  3.782  1.00 0.00 ? 282 GLY A N    4  
ATOM 4857  C CA   . GLY A 1 80 ? 15.020  -4.412  2.992  1.00 0.00 ? 282 GLY A CA   4  
ATOM 4858  C C    . GLY A 1 80 ? 14.647  -5.292  1.818  1.00 0.00 ? 282 GLY A C    4  
ATOM 4859  O O    . GLY A 1 80 ? 13.510  -5.262  1.346  1.00 0.00 ? 282 GLY A O    4  
ATOM 4860  H H    . GLY A 1 80 ? 13.100  -3.594  3.350  1.00 0.00 ? 282 GLY A H    4  
ATOM 4861  H HA2  . GLY A 1 80 ? 15.504  -3.519  2.621  1.00 0.00 ? 282 GLY A HA2  4  
ATOM 4862  H HA3  . GLY A 1 80 ? 15.714  -4.948  3.624  1.00 0.00 ? 282 GLY A HA3  4  
ATOM 4863  N N    . PHE A 1 81 ? 15.606  -6.080  1.342  1.00 0.00 ? 283 PHE A N    4  
ATOM 4864  C CA   . PHE A 1 81 ? 15.371  -6.974  0.214  1.00 0.00 ? 283 PHE A CA   4  
ATOM 4865  C C    . PHE A 1 81 ? 15.236  -8.421  0.686  1.00 0.00 ? 283 PHE A C    4  
ATOM 4866  O O    . PHE A 1 81 ? 15.912  -8.840  1.626  1.00 0.00 ? 283 PHE A O    4  
ATOM 4867  C CB   . PHE A 1 81 ? 16.512  -6.862  -0.799 1.00 0.00 ? 283 PHE A CB   4  
ATOM 4868  C CG   . PHE A 1 81 ? 17.876  -6.866  -0.173 1.00 0.00 ? 283 PHE A CG   4  
ATOM 4869  C CD1  . PHE A 1 81 ? 18.500  -8.060  0.151  1.00 0.00 ? 283 PHE A CD1  4  
ATOM 4870  C CD2  . PHE A 1 81 ? 18.535  -5.676  0.093  1.00 0.00 ? 283 PHE A CD2  4  
ATOM 4871  C CE1  . PHE A 1 81 ? 19.757  -8.067  0.728  1.00 0.00 ? 283 PHE A CE1  4  
ATOM 4872  C CE2  . PHE A 1 81 ? 19.790  -5.677  0.670  1.00 0.00 ? 283 PHE A CE2  4  
ATOM 4873  C CZ   . PHE A 1 81 ? 20.403  -6.874  0.988  1.00 0.00 ? 283 PHE A CZ   4  
ATOM 4874  H H    . PHE A 1 81 ? 16.492  -6.060  1.761  1.00 0.00 ? 283 PHE A H    4  
ATOM 4875  H HA   . PHE A 1 81 ? 14.449  -6.673  -0.258 1.00 0.00 ? 283 PHE A HA   4  
ATOM 4876  H HB2  . PHE A 1 81 ? 16.458  -7.695  -1.484 1.00 0.00 ? 283 PHE A HB2  4  
ATOM 4877  H HB3  . PHE A 1 81 ? 16.402  -5.941  -1.353 1.00 0.00 ? 283 PHE A HB3  4  
ATOM 4878  H HD1  . PHE A 1 81 ? 17.997  -8.994  -0.051 1.00 0.00 ? 283 PHE A HD1  4  
ATOM 4879  H HD2  . PHE A 1 81 ? 18.058  -4.740  -0.156 1.00 0.00 ? 283 PHE A HD2  4  
ATOM 4880  H HE1  . PHE A 1 81 ? 20.233  -9.005  0.975  1.00 0.00 ? 283 PHE A HE1  4  
ATOM 4881  H HE2  . PHE A 1 81 ? 20.294  -4.743  0.872  1.00 0.00 ? 283 PHE A HE2  4  
ATOM 4882  H HZ   . PHE A 1 81 ? 21.383  -6.877  1.439  1.00 0.00 ? 283 PHE A HZ   4  
ATOM 4883  N N    . GLY B 2 29 ? 0.644   9.577   25.399 1.00 0.00 ? 444 GLY B N    4  
ATOM 4884  C CA   . GLY B 2 29 ? 1.063   9.956   24.062 1.00 0.00 ? 444 GLY B CA   4  
ATOM 4885  C C    . GLY B 2 29 ? 0.496   9.041   22.995 1.00 0.00 ? 444 GLY B C    4  
ATOM 4886  O O    . GLY B 2 29 ? -0.174  8.055   23.305 1.00 0.00 ? 444 GLY B O    4  
ATOM 4887  H HA2  . GLY B 2 29 ? 0.735   10.966  23.867 1.00 0.00 ? 444 GLY B HA2  4  
ATOM 4888  H HA3  . GLY B 2 29 ? 2.142   9.924   24.012 1.00 0.00 ? 444 GLY B HA3  4  
ATOM 4889  N N    . GLU B 2 30 ? 0.765   9.366   21.735 1.00 0.00 ? 445 GLU B N    4  
ATOM 4890  C CA   . GLU B 2 30 ? 0.277   8.567   20.617 1.00 0.00 ? 445 GLU B CA   4  
ATOM 4891  C C    . GLU B 2 30 ? 1.437   8.005   19.801 1.00 0.00 ? 445 GLU B C    4  
ATOM 4892  O O    . GLU B 2 30 ? 2.036   8.708   18.987 1.00 0.00 ? 445 GLU B O    4  
ATOM 4893  C CB   . GLU B 2 30 ? -0.633  9.409   19.720 1.00 0.00 ? 445 GLU B CB   4  
ATOM 4894  C CG   . GLU B 2 30 ? -2.104  9.316   20.086 1.00 0.00 ? 445 GLU B CG   4  
ATOM 4895  C CD   . GLU B 2 30 ? -2.998  9.125   18.876 1.00 0.00 ? 445 GLU B CD   4  
ATOM 4896  O OE1  . GLU B 2 30 ? -2.812  8.124   18.154 1.00 0.00 ? 445 GLU B OE1  4  
ATOM 4897  O OE2  . GLU B 2 30 ? -3.883  9.979   18.651 1.00 0.00 ? 445 GLU B OE2  4  
ATOM 4898  H H    . GLU B 2 30 ? 1.305   10.164  21.551 1.00 0.00 ? 445 GLU B H    4  
ATOM 4899  H HA   . GLU B 2 30 ? -0.294  7.745   21.021 1.00 0.00 ? 445 GLU B HA   4  
ATOM 4900  H HB2  . GLU B 2 30 ? -0.331  10.443  19.790 1.00 0.00 ? 445 GLU B HB2  4  
ATOM 4901  H HB3  . GLU B 2 30 ? -0.517  9.078   18.697 1.00 0.00 ? 445 GLU B HB3  4  
ATOM 4902  H HG2  . GLU B 2 30 ? -2.244  8.478   20.752 1.00 0.00 ? 445 GLU B HG2  4  
ATOM 4903  H HG3  . GLU B 2 30 ? -2.395  10.227  20.590 1.00 0.00 ? 445 GLU B HG3  4  
ATOM 4904  N N    . GLU B 2 31 ? 1.750   6.732   20.026 1.00 0.00 ? 446 GLU B N    4  
ATOM 4905  C CA   . GLU B 2 31 ? 2.839   6.074   19.310 1.00 0.00 ? 446 GLU B CA   4  
ATOM 4906  C C    . GLU B 2 31 ? 2.301   4.997   18.374 1.00 0.00 ? 446 GLU B C    4  
ATOM 4907  O O    . GLU B 2 31 ? 2.839   4.781   17.287 1.00 0.00 ? 446 GLU B O    4  
ATOM 4908  C CB   . GLU B 2 31 ? 3.826   5.458   20.303 1.00 0.00 ? 446 GLU B CB   4  
ATOM 4909  C CG   . GLU B 2 31 ? 4.974   6.384   20.674 1.00 0.00 ? 446 GLU B CG   4  
ATOM 4910  C CD   . GLU B 2 31 ? 4.721   7.133   21.969 1.00 0.00 ? 446 GLU B CD   4  
ATOM 4911  O OE1  . GLU B 2 31 ? 4.027   8.171   21.928 1.00 0.00 ? 446 GLU B OE1  4  
ATOM 4912  O OE2  . GLU B 2 31 ? 5.216   6.682   23.022 1.00 0.00 ? 446 GLU B OE2  4  
ATOM 4913  H H    . GLU B 2 31 ? 1.235   6.223   20.686 1.00 0.00 ? 446 GLU B H    4  
ATOM 4914  H HA   . GLU B 2 31 ? 3.350   6.822   18.724 1.00 0.00 ? 446 GLU B HA   4  
ATOM 4915  H HB2  . GLU B 2 31 ? 3.296   5.196   21.207 1.00 0.00 ? 446 GLU B HB2  4  
ATOM 4916  H HB3  . GLU B 2 31 ? 4.244   4.561   19.869 1.00 0.00 ? 446 GLU B HB3  4  
ATOM 4917  H HG2  . GLU B 2 31 ? 5.872   5.796   20.787 1.00 0.00 ? 446 GLU B HG2  4  
ATOM 4918  H HG3  . GLU B 2 31 ? 5.111   7.103   19.880 1.00 0.00 ? 446 GLU B HG3  4  
ATOM 4919  N N    . GLU B 2 32 ? 1.238   4.326   18.801 1.00 0.00 ? 447 GLU B N    4  
ATOM 4920  C CA   . GLU B 2 32 ? 0.625   3.269   18.003 1.00 0.00 ? 447 GLU B CA   4  
ATOM 4921  C C    . GLU B 2 32 ? -0.866  3.523   17.820 1.00 0.00 ? 447 GLU B C    4  
ATOM 4922  O O    . GLU B 2 32 ? -1.466  4.316   18.548 1.00 0.00 ? 447 GLU B O    4  
ATOM 4923  C CB   . GLU B 2 32 ? 0.847   1.906   18.659 1.00 0.00 ? 447 GLU B CB   4  
ATOM 4924  C CG   . GLU B 2 32 ? 2.256   1.709   19.194 1.00 0.00 ? 447 GLU B CG   4  
ATOM 4925  C CD   . GLU B 2 32 ? 2.327   1.823   20.704 1.00 0.00 ? 447 GLU B CD   4  
ATOM 4926  O OE1  . GLU B 2 32 ? 1.333   1.472   21.374 1.00 0.00 ? 447 GLU B OE1  4  
ATOM 4927  O OE2  . GLU B 2 32 ? 3.377   2.262   21.219 1.00 0.00 ? 447 GLU B OE2  4  
ATOM 4928  H H    . GLU B 2 32 ? 0.855   4.544   19.676 1.00 0.00 ? 447 GLU B H    4  
ATOM 4929  H HA   . GLU B 2 32 ? 1.100   3.273   17.033 1.00 0.00 ? 447 GLU B HA   4  
ATOM 4930  H HB2  . GLU B 2 32 ? 0.154   1.797   19.480 1.00 0.00 ? 447 GLU B HB2  4  
ATOM 4931  H HB3  . GLU B 2 32 ? 0.652   1.132   17.930 1.00 0.00 ? 447 GLU B HB3  4  
ATOM 4932  H HG2  . GLU B 2 32 ? 2.604   0.728   18.907 1.00 0.00 ? 447 GLU B HG2  4  
ATOM 4933  H HG3  . GLU B 2 32 ? 2.901   2.460   18.760 1.00 0.00 ? 447 GLU B HG3  4  
ATOM 4934  N N    . GLY B 2 33 ? -1.463  2.849   16.842 1.00 0.00 ? 448 GLY B N    4  
ATOM 4935  C CA   . GLY B 2 33 ? -2.880  3.018   16.580 1.00 0.00 ? 448 GLY B CA   4  
ATOM 4936  C C    . GLY B 2 33 ? -3.147  3.945   15.410 1.00 0.00 ? 448 GLY B C    4  
ATOM 4937  O O    . GLY B 2 33 ? -4.236  4.508   15.290 1.00 0.00 ? 448 GLY B O    4  
ATOM 4938  H H    . GLY B 2 33 ? -0.937  2.230   16.293 1.00 0.00 ? 448 GLY B H    4  
ATOM 4939  H HA2  . GLY B 2 33 ? -3.314  2.052   16.367 1.00 0.00 ? 448 GLY B HA2  4  
ATOM 4940  H HA3  . GLY B 2 33 ? -3.353  3.426   17.462 1.00 0.00 ? 448 GLY B HA3  4  
ATOM 4941  N N    . GLU B 2 34 ? -2.151  4.105   14.545 1.00 0.00 ? 449 GLU B N    4  
ATOM 4942  C CA   . GLU B 2 34 ? -2.281  4.970   13.378 1.00 0.00 ? 449 GLU B CA   4  
ATOM 4943  C C    . GLU B 2 34 ? -2.423  4.152   12.105 1.00 0.00 ? 449 GLU B C    4  
ATOM 4944  O O    . GLU B 2 34 ? -2.057  4.609   11.026 1.00 0.00 ? 449 GLU B O    4  
ATOM 4945  C CB   . GLU B 2 34 ? -1.064  5.890   13.252 1.00 0.00 ? 449 GLU B CB   4  
ATOM 4946  C CG   . GLU B 2 34 ? -0.496  6.343   14.588 1.00 0.00 ? 449 GLU B CG   4  
ATOM 4947  C CD   . GLU B 2 34 ? -1.408  7.319   15.307 1.00 0.00 ? 449 GLU B CD   4  
ATOM 4948  O OE1  . GLU B 2 34 ? -2.599  6.990   15.494 1.00 0.00 ? 449 GLU B OE1  4  
ATOM 4949  O OE2  . GLU B 2 34 ? -0.930  8.411   15.684 1.00 0.00 ? 449 GLU B OE2  4  
ATOM 4950  H H    . GLU B 2 34 ? -1.306  3.631   14.696 1.00 0.00 ? 449 GLU B H    4  
ATOM 4951  H HA   . GLU B 2 34 ? -3.165  5.575   13.507 1.00 0.00 ? 449 GLU B HA   4  
ATOM 4952  H HB2  . GLU B 2 34 ? -0.288  5.363   12.710 1.00 0.00 ? 449 GLU B HB2  4  
ATOM 4953  H HB3  . GLU B 2 34 ? -1.349  6.767   12.690 1.00 0.00 ? 449 GLU B HB3  4  
ATOM 4954  H HG2  . GLU B 2 34 ? -0.352  5.478   15.217 1.00 0.00 ? 449 GLU B HG2  4  
ATOM 4955  H HG3  . GLU B 2 34 ? 0.456   6.824   14.415 1.00 0.00 ? 449 GLU B HG3  4  
ATOM 4956  N N    . GLU B 2 35 ? -2.950  2.942   12.225 1.00 0.00 ? 450 GLU B N    4  
ATOM 4957  C CA   . GLU B 2 35 ? -3.122  2.081   11.065 1.00 0.00 ? 450 GLU B CA   4  
ATOM 4958  C C    . GLU B 2 35 ? -4.475  1.376   11.091 1.00 0.00 ? 450 GLU B C    4  
ATOM 4959  O O    . GLU B 2 35 ? -5.024  1.103   12.159 1.00 0.00 ? 450 GLU B O    4  
ATOM 4960  C CB   . GLU B 2 35 ? -1.983  1.061   10.988 1.00 0.00 ? 450 GLU B CB   4  
ATOM 4961  C CG   . GLU B 2 35 ? -2.102  -0.074  11.993 1.00 0.00 ? 450 GLU B CG   4  
ATOM 4962  C CD   . GLU B 2 35 ? -1.933  0.396   13.425 1.00 0.00 ? 450 GLU B CD   4  
ATOM 4963  O OE1  . GLU B 2 35 ? -1.192  1.376   13.645 1.00 0.00 ? 450 GLU B OE1  4  
ATOM 4964  O OE2  . GLU B 2 35 ? -2.545  -0.216  14.326 1.00 0.00 ? 450 GLU B OE2  4  
ATOM 4965  H H    . GLU B 2 35 ? -3.226  2.621   13.110 1.00 0.00 ? 450 GLU B H    4  
ATOM 4966  H HA   . GLU B 2 35 ? -3.082  2.710   10.189 1.00 0.00 ? 450 GLU B HA   4  
ATOM 4967  H HB2  . GLU B 2 35 ? -1.965  0.637   9.996  1.00 0.00 ? 450 GLU B HB2  4  
ATOM 4968  H HB3  . GLU B 2 35 ? -1.048  1.573   11.165 1.00 0.00 ? 450 GLU B HB3  4  
ATOM 4969  H HG2  . GLU B 2 35 ? -3.074  -0.529  11.891 1.00 0.00 ? 450 GLU B HG2  4  
ATOM 4970  H HG3  . GLU B 2 35 ? -1.338  -0.807  11.778 1.00 0.00 ? 450 GLU B HG3  4  
ATOM 4971  N N    . TYR B 2 36 ? -5.005  1.090   9.907  1.00 0.00 ? 451 TYR B N    4  
ATOM 4972  C CA   . TYR B 2 36 ? -6.295  0.421   9.785  1.00 0.00 ? 451 TYR B CA   4  
ATOM 4973  C C    . TYR B 2 36 ? -6.213  -0.745  8.806  1.00 0.00 ? 451 TYR B C    4  
ATOM 4974  O O    . TYR B 2 36 ? -5.105  -1.298  8.637  1.00 0.00 ? 451 TYR B O    4  
ATOM 4975  C CB   . TYR B 2 36 ? -7.362  1.415   9.324  1.00 0.00 ? 451 TYR B CB   4  
ATOM 4976  C CG   . TYR B 2 36 ? -7.891  2.293   10.436 1.00 0.00 ? 451 TYR B CG   4  
ATOM 4977  C CD1  . TYR B 2 36 ? -7.229  3.461   10.798 1.00 0.00 ? 451 TYR B CD1  4  
ATOM 4978  C CD2  . TYR B 2 36 ? -9.048  1.955   11.126 1.00 0.00 ? 451 TYR B CD2  4  
ATOM 4979  C CE1  . TYR B 2 36 ? -7.707  4.265   11.815 1.00 0.00 ? 451 TYR B CE1  4  
ATOM 4980  C CE2  . TYR B 2 36 ? -9.533  2.754   12.143 1.00 0.00 ? 451 TYR B CE2  4  
ATOM 4981  C CZ   . TYR B 2 36 ? -8.859  3.908   12.484 1.00 0.00 ? 451 TYR B CZ   4  
ATOM 4982  O OH   . TYR B 2 36 ? -9.337  4.707   13.496 1.00 0.00 ? 451 TYR B OH   4  
ATOM 4983  O OXT  . TYR B 2 36 ? -7.257  -1.094  8.217  1.00 0.00 ? 451 TYR B OXT  4  
ATOM 4984  H H    . TYR B 2 36 ? -4.517  1.337   9.094  1.00 0.00 ? 451 TYR B H    4  
ATOM 4985  H HA   . TYR B 2 36 ? -6.565  0.041   10.759 1.00 0.00 ? 451 TYR B HA   4  
ATOM 4986  H HB2  . TYR B 2 36 ? -6.942  2.058   8.565  1.00 0.00 ? 451 TYR B HB2  4  
ATOM 4987  H HB3  . TYR B 2 36 ? -8.196  0.870   8.905  1.00 0.00 ? 451 TYR B HB3  4  
ATOM 4988  H HD1  . TYR B 2 36 ? -6.328  3.738   10.271 1.00 0.00 ? 451 TYR B HD1  4  
ATOM 4989  H HD2  . TYR B 2 36 ? -9.573  1.050   10.856 1.00 0.00 ? 451 TYR B HD2  4  
ATOM 4990  H HE1  . TYR B 2 36 ? -7.179  5.169   12.081 1.00 0.00 ? 451 TYR B HE1  4  
ATOM 4991  H HE2  . TYR B 2 36 ? -10.435 2.474   12.666 1.00 0.00 ? 451 TYR B HE2  4  
ATOM 4992  H HH   . TYR B 2 36 ? -9.099  4.326   14.345 1.00 0.00 ? 451 TYR B HH   4  
ATOM 4993  N N    . ARG A 1 8  ? 8.827   10.524  4.149  1.00 0.00 ? 210 ARG A N    5  
ATOM 4994  C CA   . ARG A 1 8  ? 9.606   9.319   3.884  1.00 0.00 ? 210 ARG A CA   5  
ATOM 4995  C C    . ARG A 1 8  ? 9.710   9.062   2.382  1.00 0.00 ? 210 ARG A C    5  
ATOM 4996  O O    . ARG A 1 8  ? 8.982   9.656   1.589  1.00 0.00 ? 210 ARG A O    5  
ATOM 4997  C CB   . ARG A 1 8  ? 8.974   8.112   4.581  1.00 0.00 ? 210 ARG A CB   5  
ATOM 4998  C CG   . ARG A 1 8  ? 9.849   7.511   5.668  1.00 0.00 ? 210 ARG A CG   5  
ATOM 4999  C CD   . ARG A 1 8  ? 9.376   7.913   7.055  1.00 0.00 ? 210 ARG A CD   5  
ATOM 5000  N NE   . ARG A 1 8  ? 10.492  8.144   7.970  1.00 0.00 ? 210 ARG A NE   5  
ATOM 5001  C CZ   . ARG A 1 8  ? 11.166  7.169   8.576  1.00 0.00 ? 210 ARG A CZ   5  
ATOM 5002  N NH1  . ARG A 1 8  ? 10.843  5.900   8.368  1.00 0.00 ? 210 ARG A NH1  5  
ATOM 5003  N NH2  . ARG A 1 8  ? 12.168  7.466   9.393  1.00 0.00 ? 210 ARG A NH2  5  
ATOM 5004  H HA   . ARG A 1 8  ? 10.600  9.473   4.279  1.00 0.00 ? 210 ARG A HA   5  
ATOM 5005  H HB2  . ARG A 1 8  ? 8.040   8.420   5.031  1.00 0.00 ? 210 ARG A HB2  5  
ATOM 5006  H HB3  . ARG A 1 8  ? 8.773   7.347   3.846  1.00 0.00 ? 210 ARG A HB3  5  
ATOM 5007  H HG2  . ARG A 1 8  ? 9.818   6.435   5.587  1.00 0.00 ? 210 ARG A HG2  5  
ATOM 5008  H HG3  . ARG A 1 8  ? 10.865  7.854   5.530  1.00 0.00 ? 210 ARG A HG3  5  
ATOM 5009  H HD2  . ARG A 1 8  ? 8.797   8.822   6.973  1.00 0.00 ? 210 ARG A HD2  5  
ATOM 5010  H HD3  . ARG A 1 8  ? 8.754   7.125   7.452  1.00 0.00 ? 210 ARG A HD3  5  
ATOM 5011  H HE   . ARG A 1 8  ? 10.751  9.072   8.141  1.00 0.00 ? 210 ARG A HE   5  
ATOM 5012  H HH11 . ARG A 1 8  ? 10.088  5.670   7.753  1.00 0.00 ? 210 ARG A HH11 5  
ATOM 5013  H HH12 . ARG A 1 8  ? 11.353  5.172   8.826  1.00 0.00 ? 210 ARG A HH12 5  
ATOM 5014  H HH21 . ARG A 1 8  ? 12.415  8.422   9.554  1.00 0.00 ? 210 ARG A HH21 5  
ATOM 5015  H HH22 . ARG A 1 8  ? 12.674  6.735   9.850  1.00 0.00 ? 210 ARG A HH22 5  
ATOM 5016  N N    . GLU A 1 9  ? 10.621  8.172   2.001  1.00 0.00 ? 211 GLU A N    5  
ATOM 5017  C CA   . GLU A 1 9  ? 10.820  7.835   0.597  1.00 0.00 ? 211 GLU A CA   5  
ATOM 5018  C C    . GLU A 1 9  ? 10.418  6.389   0.322  1.00 0.00 ? 211 GLU A C    5  
ATOM 5019  O O    . GLU A 1 9  ? 11.269  5.504   0.223  1.00 0.00 ? 211 GLU A O    5  
ATOM 5020  C CB   . GLU A 1 9  ? 12.282  8.060   0.200  1.00 0.00 ? 211 GLU A CB   5  
ATOM 5021  C CG   . GLU A 1 9  ? 12.482  9.245   -0.731 1.00 0.00 ? 211 GLU A CG   5  
ATOM 5022  C CD   . GLU A 1 9  ? 13.634  10.135  -0.305 1.00 0.00 ? 211 GLU A CD   5  
ATOM 5023  O OE1  . GLU A 1 9  ? 13.662  10.546  0.875  1.00 0.00 ? 211 GLU A OE1  5  
ATOM 5024  O OE2  . GLU A 1 9  ? 14.509  10.419  -1.149 1.00 0.00 ? 211 GLU A OE2  5  
ATOM 5025  H H    . GLU A 1 9  ? 11.173  7.731   2.683  1.00 0.00 ? 211 GLU A H    5  
ATOM 5026  H HA   . GLU A 1 9  ? 10.193  8.487   0.008  1.00 0.00 ? 211 GLU A HA   5  
ATOM 5027  H HB2  . GLU A 1 9  ? 12.864  8.230   1.095  1.00 0.00 ? 211 GLU A HB2  5  
ATOM 5028  H HB3  . GLU A 1 9  ? 12.651  7.175   -0.296 1.00 0.00 ? 211 GLU A HB3  5  
ATOM 5029  H HG2  . GLU A 1 9  ? 12.683  8.876   -1.726 1.00 0.00 ? 211 GLU A HG2  5  
ATOM 5030  H HG3  . GLU A 1 9  ? 11.578  9.834   -0.742 1.00 0.00 ? 211 GLU A HG3  5  
ATOM 5031  N N    . LEU A 1 10 ? 9.115   6.155   0.203  1.00 0.00 ? 212 LEU A N    5  
ATOM 5032  C CA   . LEU A 1 10 ? 8.599   4.816   -0.059 1.00 0.00 ? 212 LEU A CA   5  
ATOM 5033  C C    . LEU A 1 10 ? 8.026   4.720   -1.469 1.00 0.00 ? 212 LEU A C    5  
ATOM 5034  O O    . LEU A 1 10 ? 7.482   5.692   -1.997 1.00 0.00 ? 212 LEU A O    5  
ATOM 5035  C CB   . LEU A 1 10 ? 7.523   4.452   0.966  1.00 0.00 ? 212 LEU A CB   5  
ATOM 5036  C CG   . LEU A 1 10 ? 8.037   4.199   2.384  1.00 0.00 ? 212 LEU A CG   5  
ATOM 5037  C CD1  . LEU A 1 10 ? 6.884   3.853   3.314  1.00 0.00 ? 212 LEU A CD1  5  
ATOM 5038  C CD2  . LEU A 1 10 ? 9.076   3.087   2.384  1.00 0.00 ? 212 LEU A CD2  5  
ATOM 5039  H H    . LEU A 1 10 ? 8.485   6.900   0.294  1.00 0.00 ? 212 LEU A H    5  
ATOM 5040  H HA   . LEU A 1 10 ? 9.420   4.120   0.032  1.00 0.00 ? 212 LEU A HA   5  
ATOM 5041  H HB2  . LEU A 1 10 ? 6.805   5.258   1.003  1.00 0.00 ? 212 LEU A HB2  5  
ATOM 5042  H HB3  . LEU A 1 10 ? 7.020   3.560   0.626  1.00 0.00 ? 212 LEU A HB3  5  
ATOM 5043  H HG   . LEU A 1 10 ? 8.506   5.098   2.756  1.00 0.00 ? 212 LEU A HG   5  
ATOM 5044  H HD11 . LEU A 1 10 ? 6.389   4.760   3.628  1.00 0.00 ? 212 LEU A HD11 5  
ATOM 5045  H HD12 . LEU A 1 10 ? 6.180   3.220   2.795  1.00 0.00 ? 212 LEU A HD12 5  
ATOM 5046  H HD13 . LEU A 1 10 ? 7.264   3.333   4.180  1.00 0.00 ? 212 LEU A HD13 5  
ATOM 5047  H HD21 . LEU A 1 10 ? 8.904   2.435   1.542  1.00 0.00 ? 212 LEU A HD21 5  
ATOM 5048  H HD22 . LEU A 1 10 ? 10.063  3.519   2.309  1.00 0.00 ? 212 LEU A HD22 5  
ATOM 5049  H HD23 . LEU A 1 10 ? 8.998   2.521   3.300  1.00 0.00 ? 212 LEU A HD23 5  
ATOM 5050  N N    . LYS A 1 11 ? 8.147   3.543   -2.072 1.00 0.00 ? 213 LYS A N    5  
ATOM 5051  C CA   . LYS A 1 11 ? 7.640   3.317   -3.420 1.00 0.00 ? 213 LYS A CA   5  
ATOM 5052  C C    . LYS A 1 11 ? 6.812   2.038   -3.479 1.00 0.00 ? 213 LYS A C    5  
ATOM 5053  O O    . LYS A 1 11 ? 7.092   1.073   -2.767 1.00 0.00 ? 213 LYS A O    5  
ATOM 5054  C CB   . LYS A 1 11 ? 8.797   3.238   -4.418 1.00 0.00 ? 213 LYS A CB   5  
ATOM 5055  C CG   . LYS A 1 11 ? 9.768   4.403   -4.317 1.00 0.00 ? 213 LYS A CG   5  
ATOM 5056  C CD   . LYS A 1 11 ? 11.036  4.012   -3.574 1.00 0.00 ? 213 LYS A CD   5  
ATOM 5057  C CE   . LYS A 1 11 ? 12.170  3.696   -4.533 1.00 0.00 ? 213 LYS A CE   5  
ATOM 5058  N NZ   . LYS A 1 11 ? 12.682  4.920   -5.211 1.00 0.00 ? 213 LYS A NZ   5  
ATOM 5059  H H    . LYS A 1 11 ? 8.590   2.807   -1.598 1.00 0.00 ? 213 LYS A H    5  
ATOM 5060  H HA   . LYS A 1 11 ? 7.008   4.153   -3.680 1.00 0.00 ? 213 LYS A HA   5  
ATOM 5061  H HB2  . LYS A 1 11 ? 9.344   2.323   -4.245 1.00 0.00 ? 213 LYS A HB2  5  
ATOM 5062  H HB3  . LYS A 1 11 ? 8.392   3.221   -5.420 1.00 0.00 ? 213 LYS A HB3  5  
ATOM 5063  H HG2  . LYS A 1 11 ? 10.033  4.726   -5.313 1.00 0.00 ? 213 LYS A HG2  5  
ATOM 5064  H HG3  . LYS A 1 11 ? 9.289   5.215   -3.790 1.00 0.00 ? 213 LYS A HG3  5  
ATOM 5065  H HD2  . LYS A 1 11 ? 11.334  4.829   -2.936 1.00 0.00 ? 213 LYS A HD2  5  
ATOM 5066  H HD3  . LYS A 1 11 ? 10.831  3.138   -2.970 1.00 0.00 ? 213 LYS A HD3  5  
ATOM 5067  H HE2  . LYS A 1 11 ? 12.976  3.240   -3.981 1.00 0.00 ? 213 LYS A HE2  5  
ATOM 5068  H HE3  . LYS A 1 11 ? 11.810  3.006   -5.281 1.00 0.00 ? 213 LYS A HE3  5  
ATOM 5069  H HZ1  . LYS A 1 11 ? 13.215  4.660   -6.065 1.00 0.00 ? 213 LYS A HZ1  5  
ATOM 5070  H HZ2  . LYS A 1 11 ? 13.308  5.446   -4.570 1.00 0.00 ? 213 LYS A HZ2  5  
ATOM 5071  H HZ3  . LYS A 1 11 ? 11.889  5.535   -5.484 1.00 0.00 ? 213 LYS A HZ3  5  
ATOM 5072  N N    . ILE A 1 12 ? 5.793   2.035   -4.331 1.00 0.00 ? 214 ILE A N    5  
ATOM 5073  C CA   . ILE A 1 12 ? 4.926   0.873   -4.480 1.00 0.00 ? 214 ILE A CA   5  
ATOM 5074  C C    . ILE A 1 12 ? 5.722   -0.353  -4.915 1.00 0.00 ? 214 ILE A C    5  
ATOM 5075  O O    . ILE A 1 12 ? 6.621   -0.257  -5.752 1.00 0.00 ? 214 ILE A O    5  
ATOM 5076  C CB   . ILE A 1 12 ? 3.801   1.135   -5.501 1.00 0.00 ? 214 ILE A CB   5  
ATOM 5077  C CG1  . ILE A 1 12 ? 3.070   2.439   -5.169 1.00 0.00 ? 214 ILE A CG1  5  
ATOM 5078  C CG2  . ILE A 1 12 ? 2.825   -0.033  -5.528 1.00 0.00 ? 214 ILE A CG2  5  
ATOM 5079  C CD1  . ILE A 1 12 ? 2.562   2.504   -3.745 1.00 0.00 ? 214 ILE A CD1  5  
ATOM 5080  H H    . ILE A 1 12 ? 5.619   2.834   -4.871 1.00 0.00 ? 214 ILE A H    5  
ATOM 5081  H HA   . ILE A 1 12 ? 4.471   0.672   -3.519 1.00 0.00 ? 214 ILE A HA   5  
ATOM 5082  H HB   . ILE A 1 12 ? 4.247   1.221   -6.481 1.00 0.00 ? 214 ILE A HB   5  
ATOM 5083  H HG12 . ILE A 1 12 ? 3.741   3.270   -5.318 1.00 0.00 ? 214 ILE A HG12 5  
ATOM 5084  H HG13 . ILE A 1 12 ? 2.221   2.545   -5.831 1.00 0.00 ? 214 ILE A HG13 5  
ATOM 5085  H HG21 . ILE A 1 12 ? 2.161   0.072   -6.374 1.00 0.00 ? 214 ILE A HG21 5  
ATOM 5086  H HG22 . ILE A 1 12 ? 3.374   -0.959  -5.614 1.00 0.00 ? 214 ILE A HG22 5  
ATOM 5087  H HG23 . ILE A 1 12 ? 2.248   -0.039  -4.616 1.00 0.00 ? 214 ILE A HG23 5  
ATOM 5088  H HD11 . ILE A 1 12 ? 2.135   1.550   -3.471 1.00 0.00 ? 214 ILE A HD11 5  
ATOM 5089  H HD12 . ILE A 1 12 ? 3.380   2.738   -3.082 1.00 0.00 ? 214 ILE A HD12 5  
ATOM 5090  H HD13 . ILE A 1 12 ? 1.805   3.271   -3.669 1.00 0.00 ? 214 ILE A HD13 5  
ATOM 5091  N N    . GLY A 1 13 ? 5.389   -1.503  -4.340 1.00 0.00 ? 215 GLY A N    5  
ATOM 5092  C CA   . GLY A 1 13 ? 6.084   -2.730  -4.678 1.00 0.00 ? 215 GLY A CA   5  
ATOM 5093  C C    . GLY A 1 13 ? 7.293   -2.984  -3.794 1.00 0.00 ? 215 GLY A C    5  
ATOM 5094  O O    . GLY A 1 13 ? 7.959   -4.011  -3.925 1.00 0.00 ? 215 GLY A O    5  
ATOM 5095  H H    . GLY A 1 13 ? 4.667   -1.517  -3.679 1.00 0.00 ? 215 GLY A H    5  
ATOM 5096  H HA2  . GLY A 1 13 ? 5.398   -3.559  -4.575 1.00 0.00 ? 215 GLY A HA2  5  
ATOM 5097  H HA3  . GLY A 1 13 ? 6.410   -2.675  -5.706 1.00 0.00 ? 215 GLY A HA3  5  
ATOM 5098  N N    . ASP A 1 14 ? 7.580   -2.047  -2.892 1.00 0.00 ? 216 ASP A N    5  
ATOM 5099  C CA   . ASP A 1 14 ? 8.717   -2.180  -1.991 1.00 0.00 ? 216 ASP A CA   5  
ATOM 5100  C C    . ASP A 1 14 ? 8.297   -2.795  -0.661 1.00 0.00 ? 216 ASP A C    5  
ATOM 5101  O O    . ASP A 1 14 ? 7.193   -2.549  -0.173 1.00 0.00 ? 216 ASP A O    5  
ATOM 5102  C CB   . ASP A 1 14 ? 9.368   -0.815  -1.751 1.00 0.00 ? 216 ASP A CB   5  
ATOM 5103  C CG   . ASP A 1 14 ? 10.079  -0.287  -2.982 1.00 0.00 ? 216 ASP A CG   5  
ATOM 5104  O OD1  . ASP A 1 14 ? 10.217  -1.048  -3.963 1.00 0.00 ? 216 ASP A OD1  5  
ATOM 5105  O OD2  . ASP A 1 14 ? 10.500  0.889   -2.964 1.00 0.00 ? 216 ASP A OD2  5  
ATOM 5106  H H    . ASP A 1 14 ? 7.016   -1.249  -2.833 1.00 0.00 ? 216 ASP A H    5  
ATOM 5107  H HA   . ASP A 1 14 ? 9.436   -2.831  -2.460 1.00 0.00 ? 216 ASP A HA   5  
ATOM 5108  H HB2  . ASP A 1 14 ? 8.604   -0.105  -1.468 1.00 0.00 ? 216 ASP A HB2  5  
ATOM 5109  H HB3  . ASP A 1 14 ? 10.086  -0.901  -0.951 1.00 0.00 ? 216 ASP A HB3  5  
ATOM 5110  N N    . ARG A 1 15 ? 9.186   -3.590  -0.076 1.00 0.00 ? 217 ARG A N    5  
ATOM 5111  C CA   . ARG A 1 15 ? 8.912   -4.235  1.201  1.00 0.00 ? 217 ARG A CA   5  
ATOM 5112  C C    . ARG A 1 15 ? 9.053   -3.238  2.343  1.00 0.00 ? 217 ARG A C    5  
ATOM 5113  O O    . ARG A 1 15 ? 10.025  -2.483  2.404  1.00 0.00 ? 217 ARG A O    5  
ATOM 5114  C CB   . ARG A 1 15 ? 9.860   -5.418  1.415  1.00 0.00 ? 217 ARG A CB   5  
ATOM 5115  C CG   . ARG A 1 15 ? 9.258   -6.539  2.246  1.00 0.00 ? 217 ARG A CG   5  
ATOM 5116  C CD   . ARG A 1 15 ? 8.542   -7.559  1.373  1.00 0.00 ? 217 ARG A CD   5  
ATOM 5117  N NE   . ARG A 1 15 ? 9.381   -8.023  0.272  1.00 0.00 ? 217 ARG A NE   5  
ATOM 5118  C CZ   . ARG A 1 15 ? 10.339  -8.940  0.404  1.00 0.00 ? 217 ARG A CZ   5  
ATOM 5119  N NH1  . ARG A 1 15 ? 10.581  -9.491  1.586  1.00 0.00 ? 217 ARG A NH1  5  
ATOM 5120  N NH2  . ARG A 1 15 ? 11.054  -9.306  -0.651 1.00 0.00 ? 217 ARG A NH2  5  
ATOM 5121  H H    . ARG A 1 15 ? 10.051  -3.742  -0.513 1.00 0.00 ? 217 ARG A H    5  
ATOM 5122  H HA   . ARG A 1 15 ? 7.894   -4.597  1.180  1.00 0.00 ? 217 ARG A HA   5  
ATOM 5123  H HB2  . ARG A 1 15 ? 10.137  -5.820  0.453  1.00 0.00 ? 217 ARG A HB2  5  
ATOM 5124  H HB3  . ARG A 1 15 ? 10.749  -5.064  1.917  1.00 0.00 ? 217 ARG A HB3  5  
ATOM 5125  H HG2  . ARG A 1 15 ? 10.048  -7.037  2.788  1.00 0.00 ? 217 ARG A HG2  5  
ATOM 5126  H HG3  . ARG A 1 15 ? 8.550   -6.118  2.944  1.00 0.00 ? 217 ARG A HG3  5  
ATOM 5127  H HD2  . ARG A 1 15 ? 8.265   -8.405  1.984  1.00 0.00 ? 217 ARG A HD2  5  
ATOM 5128  H HD3  . ARG A 1 15 ? 7.652   -7.102  0.967  1.00 0.00 ? 217 ARG A HD3  5  
ATOM 5129  H HE   . ARG A 1 15 ? 9.224   -7.633  -0.613 1.00 0.00 ? 217 ARG A HE   5  
ATOM 5130  H HH11 . ARG A 1 15 ? 10.045  -9.219  2.385  1.00 0.00 ? 217 ARG A HH11 5  
ATOM 5131  H HH12 . ARG A 1 15 ? 11.302  -10.179 1.679  1.00 0.00 ? 217 ARG A HH12 5  
ATOM 5132  H HH21 . ARG A 1 15 ? 10.875  -8.896  -1.544 1.00 0.00 ? 217 ARG A HH21 5  
ATOM 5133  H HH22 . ARG A 1 15 ? 11.773  -9.995  -0.552 1.00 0.00 ? 217 ARG A HH22 5  
ATOM 5134  N N    . VAL A 1 16 ? 8.075   -3.229  3.239  1.00 0.00 ? 218 VAL A N    5  
ATOM 5135  C CA   . VAL A 1 16 ? 8.090   -2.313  4.370  1.00 0.00 ? 218 VAL A CA   5  
ATOM 5136  C C    . VAL A 1 16 ? 7.341   -2.887  5.566  1.00 0.00 ? 218 VAL A C    5  
ATOM 5137  O O    . VAL A 1 16 ? 6.863   -4.021  5.530  1.00 0.00 ? 218 VAL A O    5  
ATOM 5138  C CB   . VAL A 1 16 ? 7.453   -0.960  3.994  1.00 0.00 ? 218 VAL A CB   5  
ATOM 5139  C CG1  . VAL A 1 16 ? 8.076   -0.410  2.720  1.00 0.00 ? 218 VAL A CG1  5  
ATOM 5140  C CG2  . VAL A 1 16 ? 5.943   -1.102  3.838  1.00 0.00 ? 218 VAL A CG2  5  
ATOM 5141  H H    . VAL A 1 16 ? 7.323   -3.848  3.132  1.00 0.00 ? 218 VAL A H    5  
ATOM 5142  H HA   . VAL A 1 16 ? 9.119   -2.138  4.648  1.00 0.00 ? 218 VAL A HA   5  
ATOM 5143  H HB   . VAL A 1 16 ? 7.647   -0.260  4.793  1.00 0.00 ? 218 VAL A HB   5  
ATOM 5144  H HG11 . VAL A 1 16 ? 7.873   -1.083  1.900  1.00 0.00 ? 218 VAL A HG11 5  
ATOM 5145  H HG12 . VAL A 1 16 ? 7.654   0.559   2.502  1.00 0.00 ? 218 VAL A HG12 5  
ATOM 5146  H HG13 . VAL A 1 16 ? 9.144   -0.317  2.852  1.00 0.00 ? 218 VAL A HG13 5  
ATOM 5147  H HG21 . VAL A 1 16 ? 5.538   -0.199  3.409  1.00 0.00 ? 218 VAL A HG21 5  
ATOM 5148  H HG22 . VAL A 1 16 ? 5.722   -1.938  3.194  1.00 0.00 ? 218 VAL A HG22 5  
ATOM 5149  H HG23 . VAL A 1 16 ? 5.497   -1.269  4.810  1.00 0.00 ? 218 VAL A HG23 5  
ATOM 5150  N N    . LEU A 1 17 ? 7.227   -2.081  6.614  1.00 0.00 ? 219 LEU A N    5  
ATOM 5151  C CA   . LEU A 1 17 ? 6.516   -2.486  7.817  1.00 0.00 ? 219 LEU A CA   5  
ATOM 5152  C C    . LEU A 1 17 ? 5.422   -1.483  8.144  1.00 0.00 ? 219 LEU A C    5  
ATOM 5153  O O    . LEU A 1 17 ? 5.694   -0.302  8.349  1.00 0.00 ? 219 LEU A O    5  
ATOM 5154  C CB   . LEU A 1 17 ? 7.474   -2.595  9.004  1.00 0.00 ? 219 LEU A CB   5  
ATOM 5155  C CG   . LEU A 1 17 ? 8.593   -3.626  8.858  1.00 0.00 ? 219 LEU A CG   5  
ATOM 5156  C CD1  . LEU A 1 17 ? 9.331   -3.793  10.178 1.00 0.00 ? 219 LEU A CD1  5  
ATOM 5157  C CD2  . LEU A 1 17 ? 8.035   -4.960  8.382  1.00 0.00 ? 219 LEU A CD2  5  
ATOM 5158  H H    . LEU A 1 17 ? 7.617   -1.182  6.571  1.00 0.00 ? 219 LEU A H    5  
ATOM 5159  H HA   . LEU A 1 17 ? 6.068   -3.449  7.632  1.00 0.00 ? 219 LEU A HA   5  
ATOM 5160  H HB2  . LEU A 1 17 ? 7.925   -1.626  9.166  1.00 0.00 ? 219 LEU A HB2  5  
ATOM 5161  H HB3  . LEU A 1 17 ? 6.893   -2.852  9.878  1.00 0.00 ? 219 LEU A HB3  5  
ATOM 5162  H HG   . LEU A 1 17 ? 9.302   -3.276  8.121  1.00 0.00 ? 219 LEU A HG   5  
ATOM 5163  H HD11 . LEU A 1 17 ? 10.378  -3.973  9.986  1.00 0.00 ? 219 LEU A HD11 5  
ATOM 5164  H HD12 . LEU A 1 17 ? 9.222   -2.894  10.767 1.00 0.00 ? 219 LEU A HD12 5  
ATOM 5165  H HD13 . LEU A 1 17 ? 8.915   -4.631  10.719 1.00 0.00 ? 219 LEU A HD13 5  
ATOM 5166  H HD21 . LEU A 1 17 ? 7.113   -5.170  8.905  1.00 0.00 ? 219 LEU A HD21 5  
ATOM 5167  H HD22 . LEU A 1 17 ? 7.845   -4.911  7.320  1.00 0.00 ? 219 LEU A HD22 5  
ATOM 5168  H HD23 . LEU A 1 17 ? 8.750   -5.743  8.585  1.00 0.00 ? 219 LEU A HD23 5  
ATOM 5169  N N    . VAL A 1 18 ? 4.187   -1.955  8.203  1.00 0.00 ? 220 VAL A N    5  
ATOM 5170  C CA   . VAL A 1 18 ? 3.062   -1.085  8.519  1.00 0.00 ? 220 VAL A CA   5  
ATOM 5171  C C    . VAL A 1 18 ? 2.861   -1.009  10.027 1.00 0.00 ? 220 VAL A C    5  
ATOM 5172  O O    . VAL A 1 18 ? 2.478   -1.993  10.665 1.00 0.00 ? 220 VAL A O    5  
ATOM 5173  C CB   . VAL A 1 18 ? 1.745   -1.546  7.840  1.00 0.00 ? 220 VAL A CB   5  
ATOM 5174  C CG1  . VAL A 1 18 ? 1.162   -0.426  6.994  1.00 0.00 ? 220 VAL A CG1  5  
ATOM 5175  C CG2  . VAL A 1 18 ? 1.964   -2.795  6.997  1.00 0.00 ? 220 VAL A CG2  5  
ATOM 5176  H H    . VAL A 1 18 ? 4.032   -2.909  8.043  1.00 0.00 ? 220 VAL A H    5  
ATOM 5177  H HA   . VAL A 1 18 ? 3.302   -0.096  8.154  1.00 0.00 ? 220 VAL A HA   5  
ATOM 5178  H HB   . VAL A 1 18 ? 1.031   -1.782  8.612  1.00 0.00 ? 220 VAL A HB   5  
ATOM 5179  H HG11 . VAL A 1 18 ? 0.742   -0.838  6.087  1.00 0.00 ? 220 VAL A HG11 5  
ATOM 5180  H HG12 . VAL A 1 18 ? 0.387   0.080   7.551  1.00 0.00 ? 220 VAL A HG12 5  
ATOM 5181  H HG13 . VAL A 1 18 ? 1.940   0.279   6.741  1.00 0.00 ? 220 VAL A HG13 5  
ATOM 5182  H HG21 . VAL A 1 18 ? 1.063   -3.019  6.444  1.00 0.00 ? 220 VAL A HG21 5  
ATOM 5183  H HG22 . VAL A 1 18 ? 2.776   -2.626  6.308  1.00 0.00 ? 220 VAL A HG22 5  
ATOM 5184  H HG23 . VAL A 1 18 ? 2.206   -3.626  7.643  1.00 0.00 ? 220 VAL A HG23 5  
ATOM 5185  N N    . GLY A 1 19 ? 3.141   0.160   10.594 1.00 0.00 ? 221 GLY A N    5  
ATOM 5186  C CA   . GLY A 1 19 ? 3.003   0.346   12.026 1.00 0.00 ? 221 GLY A CA   5  
ATOM 5187  C C    . GLY A 1 19 ? 4.257   -0.050  12.788 1.00 0.00 ? 221 GLY A C    5  
ATOM 5188  O O    . GLY A 1 19 ? 4.344   0.158   13.998 1.00 0.00 ? 221 GLY A O    5  
ATOM 5189  H H    . GLY A 1 19 ? 3.453   0.902   10.034 1.00 0.00 ? 221 GLY A H    5  
ATOM 5190  H HA2  . GLY A 1 19 ? 2.786   1.385   12.223 1.00 0.00 ? 221 GLY A HA2  5  
ATOM 5191  H HA3  . GLY A 1 19 ? 2.177   -0.255  12.378 1.00 0.00 ? 221 GLY A HA3  5  
ATOM 5192  N N    . GLY A 1 20 ? 5.231   -0.622  12.080 1.00 0.00 ? 222 GLY A N    5  
ATOM 5193  C CA   . GLY A 1 20 ? 6.470   -1.037  12.717 1.00 0.00 ? 222 GLY A CA   5  
ATOM 5194  C C    . GLY A 1 20 ? 6.421   -2.466  13.214 1.00 0.00 ? 222 GLY A C    5  
ATOM 5195  O O    . GLY A 1 20 ? 7.455   -3.127  13.331 1.00 0.00 ? 222 GLY A O    5  
ATOM 5196  H H    . GLY A 1 20 ? 5.108   -0.765  11.119 1.00 0.00 ? 222 GLY A H    5  
ATOM 5197  H HA2  . GLY A 1 20 ? 7.274   -0.946  12.004 1.00 0.00 ? 222 GLY A HA2  5  
ATOM 5198  H HA3  . GLY A 1 20 ? 6.670   -0.384  13.552 1.00 0.00 ? 222 GLY A HA3  5  
ATOM 5199  N N    . THR A 1 21 ? 5.220   -2.947  13.511 1.00 0.00 ? 223 THR A N    5  
ATOM 5200  C CA   . THR A 1 21 ? 5.039   -4.307  13.999 1.00 0.00 ? 223 THR A CA   5  
ATOM 5201  C C    . THR A 1 21 ? 4.574   -5.231  12.880 1.00 0.00 ? 223 THR A C    5  
ATOM 5202  O O    . THR A 1 21 ? 4.823   -6.436  12.911 1.00 0.00 ? 223 THR A O    5  
ATOM 5203  C CB   . THR A 1 21 ? 4.025   -4.321  15.141 1.00 0.00 ? 223 THR A CB   5  
ATOM 5204  O OG1  . THR A 1 21 ? 2.852   -3.615  14.778 1.00 0.00 ? 223 THR A OG1  5  
ATOM 5205  C CG2  . THR A 1 21 ? 4.557   -3.703  16.415 1.00 0.00 ? 223 THR A CG2  5  
ATOM 5206  H H    . THR A 1 21 ? 4.433   -2.376  13.398 1.00 0.00 ? 223 THR A H    5  
ATOM 5207  H HA   . THR A 1 21 ? 5.990   -4.658  14.369 1.00 0.00 ? 223 THR A HA   5  
ATOM 5208  H HB   . THR A 1 21 ? 3.751   -5.343  15.357 1.00 0.00 ? 223 THR A HB   5  
ATOM 5209  H HG1  . THR A 1 21 ? 2.169   -4.238  14.518 1.00 0.00 ? 223 THR A HG1  5  
ATOM 5210  H HG21 . THR A 1 21 ? 5.351   -4.319  16.809 1.00 0.00 ? 223 THR A HG21 5  
ATOM 5211  H HG22 . THR A 1 21 ? 3.761   -3.629  17.140 1.00 0.00 ? 223 THR A HG22 5  
ATOM 5212  H HG23 . THR A 1 21 ? 4.941   -2.714  16.201 1.00 0.00 ? 223 THR A HG23 5  
ATOM 5213  N N    . LYS A 1 22 ? 3.895   -4.656  11.893 1.00 0.00 ? 224 LYS A N    5  
ATOM 5214  C CA   . LYS A 1 22 ? 3.392   -5.426  10.763 1.00 0.00 ? 224 LYS A CA   5  
ATOM 5215  C C    . LYS A 1 22 ? 4.315   -5.276  9.558  1.00 0.00 ? 224 LYS A C    5  
ATOM 5216  O O    . LYS A 1 22 ? 4.933   -4.230  9.367  1.00 0.00 ? 224 LYS A O    5  
ATOM 5217  C CB   . LYS A 1 22 ? 1.976   -4.968  10.395 1.00 0.00 ? 224 LYS A CB   5  
ATOM 5218  C CG   . LYS A 1 22 ? 1.133   -4.540  11.590 1.00 0.00 ? 224 LYS A CG   5  
ATOM 5219  C CD   . LYS A 1 22 ? 0.458   -5.727  12.256 1.00 0.00 ? 224 LYS A CD   5  
ATOM 5220  C CE   . LYS A 1 22 ? 1.475   -6.696  12.836 1.00 0.00 ? 224 LYS A CE   5  
ATOM 5221  N NZ   . LYS A 1 22 ? 0.901   -7.506  13.946 1.00 0.00 ? 224 LYS A NZ   5  
ATOM 5222  H H    . LYS A 1 22 ? 3.727   -3.691  11.926 1.00 0.00 ? 224 LYS A H    5  
ATOM 5223  H HA   . LYS A 1 22 ? 3.362   -6.463  11.054 1.00 0.00 ? 224 LYS A HA   5  
ATOM 5224  H HB2  . LYS A 1 22 ? 2.047   -4.130  9.718  1.00 0.00 ? 224 LYS A HB2  5  
ATOM 5225  H HB3  . LYS A 1 22 ? 1.467   -5.777  9.895  1.00 0.00 ? 224 LYS A HB3  5  
ATOM 5226  H HG2  . LYS A 1 22 ? 1.767   -4.050  12.313 1.00 0.00 ? 224 LYS A HG2  5  
ATOM 5227  H HG3  . LYS A 1 22 ? 0.373   -3.850  11.253 1.00 0.00 ? 224 LYS A HG3  5  
ATOM 5228  H HD2  . LYS A 1 22 ? -0.176  -5.369  13.054 1.00 0.00 ? 224 LYS A HD2  5  
ATOM 5229  H HD3  . LYS A 1 22 ? -0.143  -6.245  11.525 1.00 0.00 ? 224 LYS A HD3  5  
ATOM 5230  H HE2  . LYS A 1 22 ? 1.809   -7.361  12.054 1.00 0.00 ? 224 LYS A HE2  5  
ATOM 5231  H HE3  . LYS A 1 22 ? 2.315   -6.132  13.211 1.00 0.00 ? 224 LYS A HE3  5  
ATOM 5232  H HZ1  . LYS A 1 22 ? 0.399   -8.333  13.563 1.00 0.00 ? 224 LYS A HZ1  5  
ATOM 5233  H HZ2  . LYS A 1 22 ? 0.232   -6.932  14.498 1.00 0.00 ? 224 LYS A HZ2  5  
ATOM 5234  H HZ3  . LYS A 1 22 ? 1.659   -7.836  14.577 1.00 0.00 ? 224 LYS A HZ3  5  
ATOM 5235  N N    . ALA A 1 23 ? 4.410   -6.327  8.750  1.00 0.00 ? 225 ALA A N    5  
ATOM 5236  C CA   . ALA A 1 23 ? 5.262   -6.303  7.566  1.00 0.00 ? 225 ALA A CA   5  
ATOM 5237  C C    . ALA A 1 23 ? 4.453   -6.547  6.302  1.00 0.00 ? 225 ALA A C    5  
ATOM 5238  O O    . ALA A 1 23 ? 3.515   -7.343  6.299  1.00 0.00 ? 225 ALA A O    5  
ATOM 5239  C CB   . ALA A 1 23 ? 6.368   -7.339  7.684  1.00 0.00 ? 225 ALA A CB   5  
ATOM 5240  H H    . ALA A 1 23 ? 3.895   -7.136  8.954  1.00 0.00 ? 225 ALA A H    5  
ATOM 5241  H HA   . ALA A 1 23 ? 5.721   -5.328  7.505  1.00 0.00 ? 225 ALA A HA   5  
ATOM 5242  H HB1  . ALA A 1 23 ? 7.228   -7.012  7.118  1.00 0.00 ? 225 ALA A HB1  5  
ATOM 5243  H HB2  . ALA A 1 23 ? 6.643   -7.455  8.721  1.00 0.00 ? 225 ALA A HB2  5  
ATOM 5244  H HB3  . ALA A 1 23 ? 6.018   -8.284  7.295  1.00 0.00 ? 225 ALA A HB3  5  
ATOM 5245  N N    . GLY A 1 24 ? 4.822   -5.860  5.227  1.00 0.00 ? 226 GLY A N    5  
ATOM 5246  C CA   . GLY A 1 24 ? 4.117   -6.020  3.972  1.00 0.00 ? 226 GLY A CA   5  
ATOM 5247  C C    . GLY A 1 24 ? 4.775   -5.272  2.830  1.00 0.00 ? 226 GLY A C    5  
ATOM 5248  O O    . GLY A 1 24 ? 5.909   -4.808  2.949  1.00 0.00 ? 226 GLY A O    5  
ATOM 5249  H H    . GLY A 1 24 ? 5.579   -5.240  5.288  1.00 0.00 ? 226 GLY A H    5  
ATOM 5250  H HA2  . GLY A 1 24 ? 4.082   -7.071  3.724  1.00 0.00 ? 226 GLY A HA2  5  
ATOM 5251  H HA3  . GLY A 1 24 ? 3.109   -5.656  4.091  1.00 0.00 ? 226 GLY A HA3  5  
ATOM 5252  N N    . VAL A 1 25 ? 4.056   -5.155  1.716  1.00 0.00 ? 227 VAL A N    5  
ATOM 5253  C CA   . VAL A 1 25 ? 4.567   -4.459  0.541  1.00 0.00 ? 227 VAL A CA   5  
ATOM 5254  C C    . VAL A 1 25 ? 3.686   -3.266  0.185  1.00 0.00 ? 227 VAL A C    5  
ATOM 5255  O O    . VAL A 1 25 ? 2.463   -3.379  0.130  1.00 0.00 ? 227 VAL A O    5  
ATOM 5256  C CB   . VAL A 1 25 ? 4.655   -5.408  -0.674 1.00 0.00 ? 227 VAL A CB   5  
ATOM 5257  C CG1  . VAL A 1 25 ? 4.986   -4.638  -1.945 1.00 0.00 ? 227 VAL A CG1  5  
ATOM 5258  C CG2  . VAL A 1 25 ? 5.684   -6.501  -0.423 1.00 0.00 ? 227 VAL A CG2  5  
ATOM 5259  H H    . VAL A 1 25 ? 3.159   -5.546  1.684  1.00 0.00 ? 227 VAL A H    5  
ATOM 5260  H HA   . VAL A 1 25 ? 5.563   -4.107  0.768  1.00 0.00 ? 227 VAL A HA   5  
ATOM 5261  H HB   . VAL A 1 25 ? 3.691   -5.878  -0.806 1.00 0.00 ? 227 VAL A HB   5  
ATOM 5262  H HG11 . VAL A 1 25 ? 4.181   -3.954  -2.170 1.00 0.00 ? 227 VAL A HG11 5  
ATOM 5263  H HG12 . VAL A 1 25 ? 5.901   -4.084  -1.802 1.00 0.00 ? 227 VAL A HG12 5  
ATOM 5264  H HG13 . VAL A 1 25 ? 5.108   -5.332  -2.764 1.00 0.00 ? 227 VAL A HG13 5  
ATOM 5265  H HG21 . VAL A 1 25 ? 5.413   -7.385  -0.983 1.00 0.00 ? 227 VAL A HG21 5  
ATOM 5266  H HG22 . VAL A 1 25 ? 6.656   -6.157  -0.740 1.00 0.00 ? 227 VAL A HG22 5  
ATOM 5267  H HG23 . VAL A 1 25 ? 5.709   -6.734  0.631  1.00 0.00 ? 227 VAL A HG23 5  
ATOM 5268  N N    . VAL A 1 26 ? 4.317   -2.127  -0.070 1.00 0.00 ? 228 VAL A N    5  
ATOM 5269  C CA   . VAL A 1 26 ? 3.591   -0.918  -0.434 1.00 0.00 ? 228 VAL A CA   5  
ATOM 5270  C C    . VAL A 1 26 ? 2.795   -1.136  -1.717 1.00 0.00 ? 228 VAL A C    5  
ATOM 5271  O O    . VAL A 1 26 ? 3.351   -1.528  -2.742 1.00 0.00 ? 228 VAL A O    5  
ATOM 5272  C CB   . VAL A 1 26 ? 4.549   0.272   -0.620 1.00 0.00 ? 228 VAL A CB   5  
ATOM 5273  C CG1  . VAL A 1 26 ? 3.773   1.557   -0.859 1.00 0.00 ? 228 VAL A CG1  5  
ATOM 5274  C CG2  . VAL A 1 26 ? 5.463   0.406   0.588  1.00 0.00 ? 228 VAL A CG2  5  
ATOM 5275  H H    . VAL A 1 26 ? 5.297   -2.100  -0.023 1.00 0.00 ? 228 VAL A H    5  
ATOM 5276  H HA   . VAL A 1 26 ? 2.907   -0.684  0.369  1.00 0.00 ? 228 VAL A HA   5  
ATOM 5277  H HB   . VAL A 1 26 ? 5.162   0.082   -1.489 1.00 0.00 ? 228 VAL A HB   5  
ATOM 5278  H HG11 . VAL A 1 26 ? 2.866   1.336   -1.401 1.00 0.00 ? 228 VAL A HG11 5  
ATOM 5279  H HG12 . VAL A 1 26 ? 3.524   2.009   0.090  1.00 0.00 ? 228 VAL A HG12 5  
ATOM 5280  H HG13 . VAL A 1 26 ? 4.379   2.243   -1.434 1.00 0.00 ? 228 VAL A HG13 5  
ATOM 5281  H HG21 . VAL A 1 26 ? 5.947   1.369   0.568  1.00 0.00 ? 228 VAL A HG21 5  
ATOM 5282  H HG22 . VAL A 1 26 ? 4.880   0.314   1.492  1.00 0.00 ? 228 VAL A HG22 5  
ATOM 5283  H HG23 . VAL A 1 26 ? 6.209   -0.375  0.562  1.00 0.00 ? 228 VAL A HG23 5  
ATOM 5284  N N    . ARG A 1 27 ? 1.491   -0.894  -1.650 1.00 0.00 ? 229 ARG A N    5  
ATOM 5285  C CA   . ARG A 1 27 ? 0.621   -1.083  -2.806 1.00 0.00 ? 229 ARG A CA   5  
ATOM 5286  C C    . ARG A 1 27 ? 0.029   0.240   -3.289 1.00 0.00 ? 229 ARG A C    5  
ATOM 5287  O O    . ARG A 1 27 ? -0.360  0.365   -4.450 1.00 0.00 ? 229 ARG A O    5  
ATOM 5288  C CB   . ARG A 1 27 ? -0.498  -2.066  -2.458 1.00 0.00 ? 229 ARG A CB   5  
ATOM 5289  C CG   . ARG A 1 27 ? 0.009   -3.413  -1.969 1.00 0.00 ? 229 ARG A CG   5  
ATOM 5290  C CD   . ARG A 1 27 ? 0.994   -4.029  -2.951 1.00 0.00 ? 229 ARG A CD   5  
ATOM 5291  N NE   . ARG A 1 27 ? 0.776   -5.463  -3.118 1.00 0.00 ? 229 ARG A NE   5  
ATOM 5292  C CZ   . ARG A 1 27 ? 1.228   -6.167  -4.154 1.00 0.00 ? 229 ARG A CZ   5  
ATOM 5293  N NH1  . ARG A 1 27 ? 1.923   -5.574  -5.116 1.00 0.00 ? 229 ARG A NH1  5  
ATOM 5294  N NH2  . ARG A 1 27 ? 0.983   -7.467  -4.227 1.00 0.00 ? 229 ARG A NH2  5  
ATOM 5295  H H    . ARG A 1 27 ? 1.101   -0.595  -0.802 1.00 0.00 ? 229 ARG A H    5  
ATOM 5296  H HA   . ARG A 1 27 ? 1.218   -1.504  -3.601 1.00 0.00 ? 229 ARG A HA   5  
ATOM 5297  H HB2  . ARG A 1 27 ? -1.114  -1.633  -1.685 1.00 0.00 ? 229 ARG A HB2  5  
ATOM 5298  H HB3  . ARG A 1 27 ? -1.101  -2.232  -3.337 1.00 0.00 ? 229 ARG A HB3  5  
ATOM 5299  H HG2  . ARG A 1 27 ? 0.502   -3.277  -1.019 1.00 0.00 ? 229 ARG A HG2  5  
ATOM 5300  H HG3  . ARG A 1 27 ? -0.832  -4.081  -1.850 1.00 0.00 ? 229 ARG A HG3  5  
ATOM 5301  H HD2  . ARG A 1 27 ? 0.880   -3.543  -3.909 1.00 0.00 ? 229 ARG A HD2  5  
ATOM 5302  H HD3  . ARG A 1 27 ? 1.997   -3.867  -2.583 1.00 0.00 ? 229 ARG A HD3  5  
ATOM 5303  H HE   . ARG A 1 27 ? 0.267   -5.925  -2.422 1.00 0.00 ? 229 ARG A HE   5  
ATOM 5304  H HH11 . ARG A 1 27 ? 2.111   -4.593  -5.066 1.00 0.00 ? 229 ARG A HH11 5  
ATOM 5305  H HH12 . ARG A 1 27 ? 2.259   -6.109  -5.891 1.00 0.00 ? 229 ARG A HH12 5  
ATOM 5306  H HH21 . ARG A 1 27 ? 0.461   -7.919  -3.505 1.00 0.00 ? 229 ARG A HH21 5  
ATOM 5307  H HH22 . ARG A 1 27 ? 1.321   -7.997  -5.006 1.00 0.00 ? 229 ARG A HH22 5  
ATOM 5308  N N    . PHE A 1 28 ? -0.041  1.225   -2.399 1.00 0.00 ? 230 PHE A N    5  
ATOM 5309  C CA   . PHE A 1 28 ? -0.588  2.530   -2.749 1.00 0.00 ? 230 PHE A CA   5  
ATOM 5310  C C    . PHE A 1 28 ? -0.289  3.556   -1.662 1.00 0.00 ? 230 PHE A C    5  
ATOM 5311  O O    . PHE A 1 28 ? -0.155  3.208   -0.494 1.00 0.00 ? 230 PHE A O    5  
ATOM 5312  C CB   . PHE A 1 28 ? -2.099  2.431   -2.969 1.00 0.00 ? 230 PHE A CB   5  
ATOM 5313  C CG   . PHE A 1 28 ? -2.662  3.565   -3.778 1.00 0.00 ? 230 PHE A CG   5  
ATOM 5314  C CD1  . PHE A 1 28 ? -2.307  3.729   -5.107 1.00 0.00 ? 230 PHE A CD1  5  
ATOM 5315  C CD2  . PHE A 1 28 ? -3.545  4.468   -3.207 1.00 0.00 ? 230 PHE A CD2  5  
ATOM 5316  C CE1  . PHE A 1 28 ? -2.824  4.771   -5.852 1.00 0.00 ? 230 PHE A CE1  5  
ATOM 5317  C CE2  . PHE A 1 28 ? -4.064  5.513   -3.949 1.00 0.00 ? 230 PHE A CE2  5  
ATOM 5318  C CZ   . PHE A 1 28 ? -3.702  5.665   -5.273 1.00 0.00 ? 230 PHE A CZ   5  
ATOM 5319  H H    . PHE A 1 28 ? 0.284   1.070   -1.487 1.00 0.00 ? 230 PHE A H    5  
ATOM 5320  H HA   . PHE A 1 28 ? -0.121  2.849   -3.665 1.00 0.00 ? 230 PHE A HA   5  
ATOM 5321  H HB2  . PHE A 1 28 ? -2.320  1.511   -3.490 1.00 0.00 ? 230 PHE A HB2  5  
ATOM 5322  H HB3  . PHE A 1 28 ? -2.596  2.426   -2.010 1.00 0.00 ? 230 PHE A HB3  5  
ATOM 5323  H HD1  . PHE A 1 28 ? -1.620  3.031   -5.562 1.00 0.00 ? 230 PHE A HD1  5  
ATOM 5324  H HD2  . PHE A 1 28 ? -3.828  4.350   -2.170 1.00 0.00 ? 230 PHE A HD2  5  
ATOM 5325  H HE1  . PHE A 1 28 ? -2.539  4.887   -6.888 1.00 0.00 ? 230 PHE A HE1  5  
ATOM 5326  H HE2  . PHE A 1 28 ? -4.752  6.210   -3.493 1.00 0.00 ? 230 PHE A HE2  5  
ATOM 5327  H HZ   . PHE A 1 28 ? -4.107  6.481   -5.853 1.00 0.00 ? 230 PHE A HZ   5  
ATOM 5328  N N    . LEU A 1 29 ? -0.186  4.822   -2.051 1.00 0.00 ? 231 LEU A N    5  
ATOM 5329  C CA   . LEU A 1 29 ? 0.094   5.889   -1.096 1.00 0.00 ? 231 LEU A CA   5  
ATOM 5330  C C    . LEU A 1 29 ? -0.826  7.083   -1.325 1.00 0.00 ? 231 LEU A C    5  
ATOM 5331  O O    . LEU A 1 29 ? -0.879  7.635   -2.425 1.00 0.00 ? 231 LEU A O    5  
ATOM 5332  C CB   . LEU A 1 29 ? 1.557   6.324   -1.192 1.00 0.00 ? 231 LEU A CB   5  
ATOM 5333  C CG   . LEU A 1 29 ? 2.574   5.179   -1.167 1.00 0.00 ? 231 LEU A CG   5  
ATOM 5334  C CD1  . LEU A 1 29 ? 3.410   5.177   -2.435 1.00 0.00 ? 231 LEU A CD1  5  
ATOM 5335  C CD2  . LEU A 1 29 ? 3.468   5.283   0.061  1.00 0.00 ? 231 LEU A CD2  5  
ATOM 5336  H H    . LEU A 1 29 ? -0.305  5.044   -2.998 1.00 0.00 ? 231 LEU A H    5  
ATOM 5337  H HA   . LEU A 1 29 ? -0.088  5.498   -0.105 1.00 0.00 ? 231 LEU A HA   5  
ATOM 5338  H HB2  . LEU A 1 29 ? 1.685   6.876   -2.111 1.00 0.00 ? 231 LEU A HB2  5  
ATOM 5339  H HB3  . LEU A 1 29 ? 1.768   6.984   -0.365 1.00 0.00 ? 231 LEU A HB3  5  
ATOM 5340  H HG   . LEU A 1 29 ? 2.045   4.239   -1.115 1.00 0.00 ? 231 LEU A HG   5  
ATOM 5341  H HD11 . LEU A 1 29 ? 3.871   6.143   -2.564 1.00 0.00 ? 231 LEU A HD11 5  
ATOM 5342  H HD12 . LEU A 1 29 ? 4.175   4.419   -2.359 1.00 0.00 ? 231 LEU A HD12 5  
ATOM 5343  H HD13 . LEU A 1 29 ? 2.776   4.964   -3.283 1.00 0.00 ? 231 LEU A HD13 5  
ATOM 5344  H HD21 . LEU A 1 29 ? 3.881   4.310   0.289  1.00 0.00 ? 231 LEU A HD21 5  
ATOM 5345  H HD22 . LEU A 1 29 ? 4.272   5.975   -0.138 1.00 0.00 ? 231 LEU A HD22 5  
ATOM 5346  H HD23 . LEU A 1 29 ? 2.889   5.634   0.901  1.00 0.00 ? 231 LEU A HD23 5  
ATOM 5347  N N    . GLY A 1 30 ? -1.550  7.477   -0.283 1.00 0.00 ? 232 GLY A N    5  
ATOM 5348  C CA   . GLY A 1 30 ? -2.459  8.603   -0.391 1.00 0.00 ? 232 GLY A CA   5  
ATOM 5349  C C    . GLY A 1 30 ? -3.324  8.772   0.842  1.00 0.00 ? 232 GLY A C    5  
ATOM 5350  O O    . GLY A 1 30 ? -3.189  8.026   1.811  1.00 0.00 ? 232 GLY A O    5  
ATOM 5351  H H    . GLY A 1 30 ? -1.466  6.997   0.569  1.00 0.00 ? 232 GLY A H    5  
ATOM 5352  H HA2  . GLY A 1 30 ? -1.881  9.503   -0.540 1.00 0.00 ? 232 GLY A HA2  5  
ATOM 5353  H HA3  . GLY A 1 30 ? -3.098  8.453   -1.249 1.00 0.00 ? 232 GLY A HA3  5  
ATOM 5354  N N    . GLU A 1 31 ? -4.216  9.759   0.805  1.00 0.00 ? 233 GLU A N    5  
ATOM 5355  C CA   . GLU A 1 31 ? -5.106  10.025  1.929  1.00 0.00 ? 233 GLU A CA   5  
ATOM 5356  C C    . GLU A 1 31 ? -6.284  9.057   1.932  1.00 0.00 ? 233 GLU A C    5  
ATOM 5357  O O    . GLU A 1 31 ? -6.619  8.467   0.905  1.00 0.00 ? 233 GLU A O    5  
ATOM 5358  C CB   . GLU A 1 31 ? -5.615  11.466  1.872  1.00 0.00 ? 233 GLU A CB   5  
ATOM 5359  C CG   . GLU A 1 31 ? -4.513  12.497  1.691  1.00 0.00 ? 233 GLU A CG   5  
ATOM 5360  C CD   . GLU A 1 31 ? -4.914  13.623  0.759  1.00 0.00 ? 233 GLU A CD   5  
ATOM 5361  O OE1  . GLU A 1 31 ? -5.646  14.531  1.205  1.00 0.00 ? 233 GLU A OE1  5  
ATOM 5362  O OE2  . GLU A 1 31 ? -4.497  13.597  -0.419 1.00 0.00 ? 233 GLU A OE2  5  
ATOM 5363  H H    . GLU A 1 31 ? -4.273  10.320  0.004  1.00 0.00 ? 233 GLU A H    5  
ATOM 5364  H HA   . GLU A 1 31 ? -4.541  9.890   2.839  1.00 0.00 ? 233 GLU A HA   5  
ATOM 5365  H HB2  . GLU A 1 31 ? -6.305  11.559  1.045  1.00 0.00 ? 233 GLU A HB2  5  
ATOM 5366  H HB3  . GLU A 1 31 ? -6.139  11.687  2.790  1.00 0.00 ? 233 GLU A HB3  5  
ATOM 5367  H HG2  . GLU A 1 31 ? -4.269  12.918  2.654  1.00 0.00 ? 233 GLU A HG2  5  
ATOM 5368  H HG3  . GLU A 1 31 ? -3.642  12.004  1.282  1.00 0.00 ? 233 GLU A HG3  5  
ATOM 5369  N N    . THR A 1 32 ? -6.908  8.898   3.095  1.00 0.00 ? 234 THR A N    5  
ATOM 5370  C CA   . THR A 1 32 ? -8.051  8.001   3.232  1.00 0.00 ? 234 THR A CA   5  
ATOM 5371  C C    . THR A 1 32 ? -9.351  8.792   3.338  1.00 0.00 ? 234 THR A C    5  
ATOM 5372  O O    . THR A 1 32 ? -9.344  9.976   3.675  1.00 0.00 ? 234 THR A O    5  
ATOM 5373  C CB   . THR A 1 32 ? -7.880  7.110   4.463  1.00 0.00 ? 234 THR A CB   5  
ATOM 5374  O OG1  . THR A 1 32 ? -8.049  7.859   5.652  1.00 0.00 ? 234 THR A OG1  5  
ATOM 5375  C CG2  . THR A 1 32 ? -6.528  6.436   4.532  1.00 0.00 ? 234 THR A CG2  5  
ATOM 5376  H H    . THR A 1 32 ? -6.596  9.396   3.878  1.00 0.00 ? 234 THR A H    5  
ATOM 5377  H HA   . THR A 1 32 ? -8.092  7.379   2.351  1.00 0.00 ? 234 THR A HA   5  
ATOM 5378  H HB   . THR A 1 32 ? -8.635  6.336   4.441  1.00 0.00 ? 234 THR A HB   5  
ATOM 5379  H HG1  . THR A 1 32 ? -7.492  8.640   5.620  1.00 0.00 ? 234 THR A HG1  5  
ATOM 5380  H HG21 . THR A 1 32 ? -5.961  6.674   3.645  1.00 0.00 ? 234 THR A HG21 5  
ATOM 5381  H HG22 . THR A 1 32 ? -6.660  5.366   4.598  1.00 0.00 ? 234 THR A HG22 5  
ATOM 5382  H HG23 . THR A 1 32 ? -5.996  6.786   5.404  1.00 0.00 ? 234 THR A HG23 5  
ATOM 5383  N N    . ASP A 1 33 ? -10.465 8.129   3.047  1.00 0.00 ? 235 ASP A N    5  
ATOM 5384  C CA   . ASP A 1 33 ? -11.775 8.771   3.109  1.00 0.00 ? 235 ASP A CA   5  
ATOM 5385  C C    . ASP A 1 33 ? -12.349 8.735   4.525  1.00 0.00 ? 235 ASP A C    5  
ATOM 5386  O O    . ASP A 1 33 ? -13.447 9.234   4.767  1.00 0.00 ? 235 ASP A O    5  
ATOM 5387  C CB   . ASP A 1 33 ? -12.741 8.091   2.139  1.00 0.00 ? 235 ASP A CB   5  
ATOM 5388  C CG   . ASP A 1 33 ? -13.894 8.995   1.744  1.00 0.00 ? 235 ASP A CG   5  
ATOM 5389  O OD1  . ASP A 1 33 ? -13.683 9.890   0.899  1.00 0.00 ? 235 ASP A OD1  5  
ATOM 5390  O OD2  . ASP A 1 33 ? -15.006 8.806   2.280  1.00 0.00 ? 235 ASP A OD2  5  
ATOM 5391  H H    . ASP A 1 33 ? -10.407 7.187   2.783  1.00 0.00 ? 235 ASP A H    5  
ATOM 5392  H HA   . ASP A 1 33 ? -11.650 9.801   2.812  1.00 0.00 ? 235 ASP A HA   5  
ATOM 5393  H HB2  . ASP A 1 33 ? -12.207 7.809   1.243  1.00 0.00 ? 235 ASP A HB2  5  
ATOM 5394  H HB3  . ASP A 1 33 ? -13.146 7.205   2.606  1.00 0.00 ? 235 ASP A HB3  5  
ATOM 5395  N N    . PHE A 1 34 ? -11.606 8.143   5.459  1.00 0.00 ? 236 PHE A N    5  
ATOM 5396  C CA   . PHE A 1 34 ? -12.058 8.052   6.844  1.00 0.00 ? 236 PHE A CA   5  
ATOM 5397  C C    . PHE A 1 34 ? -11.038 8.664   7.808  1.00 0.00 ? 236 PHE A C    5  
ATOM 5398  O O    . PHE A 1 34 ? -11.362 8.959   8.958  1.00 0.00 ? 236 PHE A O    5  
ATOM 5399  C CB   . PHE A 1 34 ? -12.327 6.590   7.223  1.00 0.00 ? 236 PHE A CB   5  
ATOM 5400  C CG   . PHE A 1 34 ? -11.092 5.809   7.585  1.00 0.00 ? 236 PHE A CG   5  
ATOM 5401  C CD1  . PHE A 1 34 ? -10.071 5.629   6.664  1.00 0.00 ? 236 PHE A CD1  5  
ATOM 5402  C CD2  . PHE A 1 34 ? -10.952 5.259   8.849  1.00 0.00 ? 236 PHE A CD2  5  
ATOM 5403  C CE1  . PHE A 1 34 ? -8.936  4.915   6.998  1.00 0.00 ? 236 PHE A CE1  5  
ATOM 5404  C CE2  . PHE A 1 34 ? -9.820  4.544   9.189  1.00 0.00 ? 236 PHE A CE2  5  
ATOM 5405  C CZ   . PHE A 1 34 ? -8.810  4.371   8.261  1.00 0.00 ? 236 PHE A CZ   5  
ATOM 5406  H H    . PHE A 1 34 ? -10.740 7.762   5.211  1.00 0.00 ? 236 PHE A H    5  
ATOM 5407  H HA   . PHE A 1 34 ? -12.981 8.607   6.924  1.00 0.00 ? 236 PHE A HA   5  
ATOM 5408  H HB2  . PHE A 1 34 ? -12.993 6.564   8.072  1.00 0.00 ? 236 PHE A HB2  5  
ATOM 5409  H HB3  . PHE A 1 34 ? -12.800 6.094   6.388  1.00 0.00 ? 236 PHE A HB3  5  
ATOM 5410  H HD1  . PHE A 1 34 ? -10.167 6.052   5.677  1.00 0.00 ? 236 PHE A HD1  5  
ATOM 5411  H HD2  . PHE A 1 34 ? -11.741 5.393   9.574  1.00 0.00 ? 236 PHE A HD2  5  
ATOM 5412  H HE1  . PHE A 1 34 ? -8.148  4.781   6.273  1.00 0.00 ? 236 PHE A HE1  5  
ATOM 5413  H HE2  . PHE A 1 34 ? -9.724  4.119   10.177 1.00 0.00 ? 236 PHE A HE2  5  
ATOM 5414  H HZ   . PHE A 1 34 ? -7.925  3.813   8.524  1.00 0.00 ? 236 PHE A HZ   5  
ATOM 5415  N N    . ALA A 1 35 ? -9.807  8.850   7.337  1.00 0.00 ? 237 ALA A N    5  
ATOM 5416  C CA   . ALA A 1 35 ? -8.753  9.423   8.165  1.00 0.00 ? 237 ALA A CA   5  
ATOM 5417  C C    . ALA A 1 35 ? -8.208  10.709  7.556  1.00 0.00 ? 237 ALA A C    5  
ATOM 5418  O O    . ALA A 1 35 ? -8.038  10.809  6.341  1.00 0.00 ? 237 ALA A O    5  
ATOM 5419  C CB   . ALA A 1 35 ? -7.632  8.413   8.363  1.00 0.00 ? 237 ALA A CB   5  
ATOM 5420  H H    . ALA A 1 35 ? -9.599  8.596   6.415  1.00 0.00 ? 237 ALA A H    5  
ATOM 5421  H HA   . ALA A 1 35 ? -9.177  9.646   9.133  1.00 0.00 ? 237 ALA A HA   5  
ATOM 5422  H HB1  . ALA A 1 35 ? -6.939  8.479   7.537  1.00 0.00 ? 237 ALA A HB1  5  
ATOM 5423  H HB2  . ALA A 1 35 ? -7.113  8.627   9.285  1.00 0.00 ? 237 ALA A HB2  5  
ATOM 5424  H HB3  . ALA A 1 35 ? -8.048  7.417   8.407  1.00 0.00 ? 237 ALA A HB3  5  
ATOM 5425  N N    . LYS A 1 36 ? -7.932  11.690  8.408  1.00 0.00 ? 238 LYS A N    5  
ATOM 5426  C CA   . LYS A 1 36 ? -7.403  12.971  7.954  1.00 0.00 ? 238 LYS A CA   5  
ATOM 5427  C C    . LYS A 1 36 ? -5.881  12.926  7.855  1.00 0.00 ? 238 LYS A C    5  
ATOM 5428  O O    . LYS A 1 36 ? -5.203  12.481  8.781  1.00 0.00 ? 238 LYS A O    5  
ATOM 5429  C CB   . LYS A 1 36 ? -7.830  14.090  8.905  1.00 0.00 ? 238 LYS A CB   5  
ATOM 5430  C CG   . LYS A 1 36 ? -7.305  13.918  10.321 1.00 0.00 ? 238 LYS A CG   5  
ATOM 5431  C CD   . LYS A 1 36 ? -6.023  14.703  10.540 1.00 0.00 ? 238 LYS A CD   5  
ATOM 5432  C CE   . LYS A 1 36 ? -6.290  16.197  10.625 1.00 0.00 ? 238 LYS A CE   5  
ATOM 5433  N NZ   . LYS A 1 36 ? -5.162  16.995  10.071 1.00 0.00 ? 238 LYS A NZ   5  
ATOM 5434  H H    . LYS A 1 36 ? -8.087  11.551  9.366  1.00 0.00 ? 238 LYS A H    5  
ATOM 5435  H HA   . LYS A 1 36 ? -7.809  13.169  6.973  1.00 0.00 ? 238 LYS A HA   5  
ATOM 5436  H HB2  . LYS A 1 36 ? -7.467  15.032  8.522  1.00 0.00 ? 238 LYS A HB2  5  
ATOM 5437  H HB3  . LYS A 1 36 ? -8.909  14.120  8.945  1.00 0.00 ? 238 LYS A HB3  5  
ATOM 5438  H HG2  . LYS A 1 36 ? -8.054  14.270  11.017 1.00 0.00 ? 238 LYS A HG2  5  
ATOM 5439  H HG3  . LYS A 1 36 ? -7.111  12.871  10.497 1.00 0.00 ? 238 LYS A HG3  5  
ATOM 5440  H HD2  . LYS A 1 36 ? -5.565  14.377  11.463 1.00 0.00 ? 238 LYS A HD2  5  
ATOM 5441  H HD3  . LYS A 1 36 ? -5.351  14.512  9.716  1.00 0.00 ? 238 LYS A HD3  5  
ATOM 5442  H HE2  . LYS A 1 36 ? -7.186  16.421  10.064 1.00 0.00 ? 238 LYS A HE2  5  
ATOM 5443  H HE3  . LYS A 1 36 ? -6.437  16.465  11.660 1.00 0.00 ? 238 LYS A HE3  5  
ATOM 5444  H HZ1  . LYS A 1 36 ? -5.352  17.243  9.078  1.00 0.00 ? 238 LYS A HZ1  5  
ATOM 5445  H HZ2  . LYS A 1 36 ? -4.279  16.447  10.117 1.00 0.00 ? 238 LYS A HZ2  5  
ATOM 5446  H HZ3  . LYS A 1 36 ? -5.041  17.870  10.619 1.00 0.00 ? 238 LYS A HZ3  5  
ATOM 5447  N N    . GLY A 1 37 ? -5.352  13.390  6.727  1.00 0.00 ? 239 GLY A N    5  
ATOM 5448  C CA   . GLY A 1 37 ? -3.914  13.394  6.531  1.00 0.00 ? 239 GLY A CA   5  
ATOM 5449  C C    . GLY A 1 37 ? -3.473  12.438  5.439  1.00 0.00 ? 239 GLY A C    5  
ATOM 5450  O O    . GLY A 1 37 ? -4.298  11.937  4.673  1.00 0.00 ? 239 GLY A O    5  
ATOM 5451  H H    . GLY A 1 37 ? -5.942  13.734  6.024  1.00 0.00 ? 239 GLY A H    5  
ATOM 5452  H HA2  . GLY A 1 37 ? -3.600  14.393  6.264  1.00 0.00 ? 239 GLY A HA2  5  
ATOM 5453  H HA3  . GLY A 1 37 ? -3.433  13.112  7.455  1.00 0.00 ? 239 GLY A HA3  5  
ATOM 5454  N N    . GLU A 1 38 ? -2.171  12.183  5.369  1.00 0.00 ? 240 GLU A N    5  
ATOM 5455  C CA   . GLU A 1 38 ? -1.621  11.281  4.363  1.00 0.00 ? 240 GLU A CA   5  
ATOM 5456  C C    . GLU A 1 38 ? -1.466  9.870   4.924  1.00 0.00 ? 240 GLU A C    5  
ATOM 5457  O O    . GLU A 1 38 ? -1.013  9.686   6.053  1.00 0.00 ? 240 GLU A O    5  
ATOM 5458  C CB   . GLU A 1 38 ? -0.267  11.797  3.871  1.00 0.00 ? 240 GLU A CB   5  
ATOM 5459  C CG   . GLU A 1 38 ? 0.684   12.179  4.993  1.00 0.00 ? 240 GLU A CG   5  
ATOM 5460  C CD   . GLU A 1 38 ? 2.093   12.439  4.501  1.00 0.00 ? 240 GLU A CD   5  
ATOM 5461  O OE1  . GLU A 1 38 ? 2.692   11.521  3.903  1.00 0.00 ? 240 GLU A OE1  5  
ATOM 5462  O OE2  . GLU A 1 38 ? 2.599   13.561  4.714  1.00 0.00 ? 240 GLU A OE2  5  
ATOM 5463  H H    . GLU A 1 38 ? -1.564  12.613  6.007  1.00 0.00 ? 240 GLU A H    5  
ATOM 5464  H HA   . GLU A 1 38 ? -2.308  11.252  3.531  1.00 0.00 ? 240 GLU A HA   5  
ATOM 5465  H HB2  . GLU A 1 38 ? 0.204   11.028  3.276  1.00 0.00 ? 240 GLU A HB2  5  
ATOM 5466  H HB3  . GLU A 1 38 ? -0.429  12.669  3.254  1.00 0.00 ? 240 GLU A HB3  5  
ATOM 5467  H HG2  . GLU A 1 38 ? 0.315   13.076  5.472  1.00 0.00 ? 240 GLU A HG2  5  
ATOM 5468  H HG3  . GLU A 1 38 ? 0.712   11.374  5.714  1.00 0.00 ? 240 GLU A HG3  5  
ATOM 5469  N N    . TRP A 1 39 ? -1.846  8.877   4.126  1.00 0.00 ? 241 TRP A N    5  
ATOM 5470  C CA   . TRP A 1 39 ? -1.750  7.483   4.544  1.00 0.00 ? 241 TRP A CA   5  
ATOM 5471  C C    . TRP A 1 39 ? -1.115  6.629   3.450  1.00 0.00 ? 241 TRP A C    5  
ATOM 5472  O O    . TRP A 1 39 ? -0.947  7.079   2.316  1.00 0.00 ? 241 TRP A O    5  
ATOM 5473  C CB   . TRP A 1 39 ? -3.136  6.940   4.899  1.00 0.00 ? 241 TRP A CB   5  
ATOM 5474  C CG   . TRP A 1 39 ? -3.728  7.585   6.115  1.00 0.00 ? 241 TRP A CG   5  
ATOM 5475  C CD1  . TRP A 1 39 ? -4.214  8.857   6.214  1.00 0.00 ? 241 TRP A CD1  5  
ATOM 5476  C CD2  . TRP A 1 39 ? -3.895  6.989   7.407  1.00 0.00 ? 241 TRP A CD2  5  
ATOM 5477  N NE1  . TRP A 1 39 ? -4.672  9.089   7.489  1.00 0.00 ? 241 TRP A NE1  5  
ATOM 5478  C CE2  . TRP A 1 39 ? -4.487  7.959   8.240  1.00 0.00 ? 241 TRP A CE2  5  
ATOM 5479  C CE3  . TRP A 1 39 ? -3.602  5.732   7.941  1.00 0.00 ? 241 TRP A CE3  5  
ATOM 5480  C CZ2  . TRP A 1 39 ? -4.790  7.708   9.576  1.00 0.00 ? 241 TRP A CZ2  5  
ATOM 5481  C CZ3  . TRP A 1 39 ? -3.903  5.485   9.266  1.00 0.00 ? 241 TRP A CZ3  5  
ATOM 5482  C CH2  . TRP A 1 39 ? -4.493  6.468   10.072 1.00 0.00 ? 241 TRP A CH2  5  
ATOM 5483  H H    . TRP A 1 39 ? -2.201  9.087   3.236  1.00 0.00 ? 241 TRP A H    5  
ATOM 5484  H HA   . TRP A 1 39 ? -1.124  7.445   5.422  1.00 0.00 ? 241 TRP A HA   5  
ATOM 5485  H HB2  . TRP A 1 39 ? -3.807  7.112   4.070  1.00 0.00 ? 241 TRP A HB2  5  
ATOM 5486  H HB3  . TRP A 1 39 ? -3.064  5.878   5.084  1.00 0.00 ? 241 TRP A HB3  5  
ATOM 5487  H HD1  . TRP A 1 39 ? -4.229  9.568   5.400  1.00 0.00 ? 241 TRP A HD1  5  
ATOM 5488  H HE1  . TRP A 1 39 ? -5.067  9.928   7.807  1.00 0.00 ? 241 TRP A HE1  5  
ATOM 5489  H HE3  . TRP A 1 39 ? -3.147  4.961   7.337  1.00 0.00 ? 241 TRP A HE3  5  
ATOM 5490  H HZ2  . TRP A 1 39 ? -5.245  8.455   10.210 1.00 0.00 ? 241 TRP A HZ2  5  
ATOM 5491  H HZ3  . TRP A 1 39 ? -3.684  4.520   9.695  1.00 0.00 ? 241 TRP A HZ3  5  
ATOM 5492  H HH2  . TRP A 1 39 ? -4.709  6.230   11.103 1.00 0.00 ? 241 TRP A HH2  5  
ATOM 5493  N N    . CYS A 1 40 ? -0.761  5.396   3.798  1.00 0.00 ? 242 CYS A N    5  
ATOM 5494  C CA   . CYS A 1 40 ? -0.140  4.481   2.846  1.00 0.00 ? 242 CYS A CA   5  
ATOM 5495  C C    . CYS A 1 40 ? -0.757  3.087   2.945  1.00 0.00 ? 242 CYS A C    5  
ATOM 5496  O O    . CYS A 1 40 ? -1.310  2.710   3.979  1.00 0.00 ? 242 CYS A O    5  
ATOM 5497  C CB   . CYS A 1 40 ? 1.372   4.412   3.090  1.00 0.00 ? 242 CYS A CB   5  
ATOM 5498  S SG   . CYS A 1 40 ? 2.233   3.172   2.092  1.00 0.00 ? 242 CYS A SG   5  
ATOM 5499  H H    . CYS A 1 40 ? -0.917  5.095   4.717  1.00 0.00 ? 242 CYS A H    5  
ATOM 5500  H HA   . CYS A 1 40 ? -0.316  4.869   1.852  1.00 0.00 ? 242 CYS A HA   5  
ATOM 5501  H HB2  . CYS A 1 40 ? 1.808   5.372   2.859  1.00 0.00 ? 242 CYS A HB2  5  
ATOM 5502  H HB3  . CYS A 1 40 ? 1.551   4.182   4.128  1.00 0.00 ? 242 CYS A HB3  5  
ATOM 5503  H HG   . CYS A 1 40 ? 3.111   3.050   2.465  1.00 0.00 ? 242 CYS A HG   5  
ATOM 5504  N N    . GLY A 1 41 ? -0.654  2.331   1.858  1.00 0.00 ? 243 GLY A N    5  
ATOM 5505  C CA   . GLY A 1 41 ? -1.198  0.988   1.820  1.00 0.00 ? 243 GLY A CA   5  
ATOM 5506  C C    . GLY A 1 41 ? -0.117  -0.064  1.676  1.00 0.00 ? 243 GLY A C    5  
ATOM 5507  O O    . GLY A 1 41 ? 0.698   -0.001  0.756  1.00 0.00 ? 243 GLY A O    5  
ATOM 5508  H H    . GLY A 1 41 ? -0.201  2.692   1.068  1.00 0.00 ? 243 GLY A H    5  
ATOM 5509  H HA2  . GLY A 1 41 ? -1.748  0.804   2.731  1.00 0.00 ? 243 GLY A HA2  5  
ATOM 5510  H HA3  . GLY A 1 41 ? -1.873  0.910   0.979  1.00 0.00 ? 243 GLY A HA3  5  
ATOM 5511  N N    . VAL A 1 42 ? -0.106  -1.030  2.586  1.00 0.00 ? 244 VAL A N    5  
ATOM 5512  C CA   . VAL A 1 42 ? 0.888   -2.096  2.552  1.00 0.00 ? 244 VAL A CA   5  
ATOM 5513  C C    . VAL A 1 42 ? 0.225   -3.468  2.640  1.00 0.00 ? 244 VAL A C    5  
ATOM 5514  O O    . VAL A 1 42 ? -0.631  -3.700  3.493  1.00 0.00 ? 244 VAL A O    5  
ATOM 5515  C CB   . VAL A 1 42 ? 1.901   -1.959  3.709  1.00 0.00 ? 244 VAL A CB   5  
ATOM 5516  C CG1  . VAL A 1 42 ? 3.123   -2.827  3.459  1.00 0.00 ? 244 VAL A CG1  5  
ATOM 5517  C CG2  . VAL A 1 42 ? 2.308   -0.505  3.906  1.00 0.00 ? 244 VAL A CG2  5  
ATOM 5518  H H    . VAL A 1 42 ? -0.780  -1.026  3.298  1.00 0.00 ? 244 VAL A H    5  
ATOM 5519  H HA   . VAL A 1 42 ? 1.425   -2.025  1.616  1.00 0.00 ? 244 VAL A HA   5  
ATOM 5520  H HB   . VAL A 1 42 ? 1.426   -2.302  4.617  1.00 0.00 ? 244 VAL A HB   5  
ATOM 5521  H HG11 . VAL A 1 42 ? 2.810   -3.846  3.288  1.00 0.00 ? 244 VAL A HG11 5  
ATOM 5522  H HG12 . VAL A 1 42 ? 3.654   -2.463  2.593  1.00 0.00 ? 244 VAL A HG12 5  
ATOM 5523  H HG13 . VAL A 1 42 ? 3.773   -2.790  4.321  1.00 0.00 ? 244 VAL A HG13 5  
ATOM 5524  H HG21 . VAL A 1 42 ? 2.890   -0.414  4.812  1.00 0.00 ? 244 VAL A HG21 5  
ATOM 5525  H HG22 . VAL A 1 42 ? 2.900   -0.180  3.064  1.00 0.00 ? 244 VAL A HG22 5  
ATOM 5526  H HG23 . VAL A 1 42 ? 1.423   0.109   3.983  1.00 0.00 ? 244 VAL A HG23 5  
ATOM 5527  N N    . GLU A 1 43 ? 0.637   -4.374  1.761  1.00 0.00 ? 245 GLU A N    5  
ATOM 5528  C CA   . GLU A 1 43 ? 0.091   -5.727  1.747  1.00 0.00 ? 245 GLU A CA   5  
ATOM 5529  C C    . GLU A 1 43 ? 0.831   -6.597  2.754  1.00 0.00 ? 245 GLU A C    5  
ATOM 5530  O O    . GLU A 1 43 ? 2.007   -6.909  2.574  1.00 0.00 ? 245 GLU A O    5  
ATOM 5531  C CB   . GLU A 1 43 ? 0.202   -6.333  0.347  1.00 0.00 ? 245 GLU A CB   5  
ATOM 5532  C CG   . GLU A 1 43 ? -0.376  -7.734  0.242  1.00 0.00 ? 245 GLU A CG   5  
ATOM 5533  C CD   . GLU A 1 43 ? -0.666  -8.139  -1.189 1.00 0.00 ? 245 GLU A CD   5  
ATOM 5534  O OE1  . GLU A 1 43 ? -0.843  -7.239  -2.038 1.00 0.00 ? 245 GLU A OE1  5  
ATOM 5535  O OE2  . GLU A 1 43 ? -0.715  -9.357  -1.464 1.00 0.00 ? 245 GLU A OE2  5  
ATOM 5536  H H    . GLU A 1 43 ? 1.329   -4.132  1.112  1.00 0.00 ? 245 GLU A H    5  
ATOM 5537  H HA   . GLU A 1 43 ? -0.950  -5.670  2.029  1.00 0.00 ? 245 GLU A HA   5  
ATOM 5538  H HB2  . GLU A 1 43 ? -0.322  -5.697  -0.351 1.00 0.00 ? 245 GLU A HB2  5  
ATOM 5539  H HB3  . GLU A 1 43 ? 1.244   -6.375  0.067  1.00 0.00 ? 245 GLU A HB3  5  
ATOM 5540  H HG2  . GLU A 1 43 ? 0.330   -8.434  0.662  1.00 0.00 ? 245 GLU A HG2  5  
ATOM 5541  H HG3  . GLU A 1 43 ? -1.297  -7.773  0.806  1.00 0.00 ? 245 GLU A HG3  5  
ATOM 5542  N N    . LEU A 1 44 ? 0.139   -6.975  3.822  1.00 0.00 ? 246 LEU A N    5  
ATOM 5543  C CA   . LEU A 1 44 ? 0.738   -7.793  4.868  1.00 0.00 ? 246 LEU A CA   5  
ATOM 5544  C C    . LEU A 1 44 ? 1.059   -9.194  4.364  1.00 0.00 ? 246 LEU A C    5  
ATOM 5545  O O    . LEU A 1 44 ? 0.290   -9.789  3.608  1.00 0.00 ? 246 LEU A O    5  
ATOM 5546  C CB   . LEU A 1 44 ? -0.194  -7.873  6.078  1.00 0.00 ? 246 LEU A CB   5  
ATOM 5547  C CG   . LEU A 1 44 ? -0.514  -6.532  6.739  1.00 0.00 ? 246 LEU A CG   5  
ATOM 5548  C CD1  . LEU A 1 44 ? -1.499  -6.721  7.883  1.00 0.00 ? 246 LEU A CD1  5  
ATOM 5549  C CD2  . LEU A 1 44 ? 0.761   -5.867  7.235  1.00 0.00 ? 246 LEU A CD2  5  
ATOM 5550  H H    . LEU A 1 44 ? -0.793  -6.686  3.917  1.00 0.00 ? 246 LEU A H    5  
ATOM 5551  H HA   . LEU A 1 44 ? 1.658   -7.313  5.170  1.00 0.00 ? 246 LEU A HA   5  
ATOM 5552  H HB2  . LEU A 1 44 ? -1.123  -8.325  5.759  1.00 0.00 ? 246 LEU A HB2  5  
ATOM 5553  H HB3  . LEU A 1 44 ? 0.263   -8.513  6.816  1.00 0.00 ? 246 LEU A HB3  5  
ATOM 5554  H HG   . LEU A 1 44 ? -0.973  -5.880  6.011  1.00 0.00 ? 246 LEU A HG   5  
ATOM 5555  H HD11 . LEU A 1 44 ? -2.214  -5.912  7.880  1.00 0.00 ? 246 LEU A HD11 5  
ATOM 5556  H HD12 . LEU A 1 44 ? -2.016  -7.661  7.761  1.00 0.00 ? 246 LEU A HD12 5  
ATOM 5557  H HD13 . LEU A 1 44 ? -0.963  -6.726  8.821  1.00 0.00 ? 246 LEU A HD13 5  
ATOM 5558  H HD21 . LEU A 1 44 ? 0.552   -5.319  8.142  1.00 0.00 ? 246 LEU A HD21 5  
ATOM 5559  H HD22 . LEU A 1 44 ? 1.507   -6.621  7.433  1.00 0.00 ? 246 LEU A HD22 5  
ATOM 5560  H HD23 . LEU A 1 44 ? 1.128   -5.185  6.481  1.00 0.00 ? 246 LEU A HD23 5  
ATOM 5561  N N    . ASP A 1 45 ? 2.208   -9.713  4.789  1.00 0.00 ? 247 ASP A N    5  
ATOM 5562  C CA   . ASP A 1 45 ? 2.651   -11.041 4.389  1.00 0.00 ? 247 ASP A CA   5  
ATOM 5563  C C    . ASP A 1 45 ? 1.770   -12.129 5.002  1.00 0.00 ? 247 ASP A C    5  
ATOM 5564  O O    . ASP A 1 45 ? 1.677   -13.236 4.473  1.00 0.00 ? 247 ASP A O    5  
ATOM 5565  C CB   . ASP A 1 45 ? 4.107   -11.254 4.803  1.00 0.00 ? 247 ASP A CB   5  
ATOM 5566  C CG   . ASP A 1 45 ? 5.083   -10.611 3.839  1.00 0.00 ? 247 ASP A CG   5  
ATOM 5567  O OD1  . ASP A 1 45 ? 5.137   -11.048 2.669  1.00 0.00 ? 247 ASP A OD1  5  
ATOM 5568  O OD2  . ASP A 1 45 ? 5.793   -9.670  4.250  1.00 0.00 ? 247 ASP A OD2  5  
ATOM 5569  H H    . ASP A 1 45 ? 2.775   -9.182  5.388  1.00 0.00 ? 247 ASP A H    5  
ATOM 5570  H HA   . ASP A 1 45 ? 2.581   -11.104 3.314  1.00 0.00 ? 247 ASP A HA   5  
ATOM 5571  H HB2  . ASP A 1 45 ? 4.262   -10.823 5.781  1.00 0.00 ? 247 ASP A HB2  5  
ATOM 5572  H HB3  . ASP A 1 45 ? 4.315   -12.312 4.846  1.00 0.00 ? 247 ASP A HB3  5  
ATOM 5573  N N    . GLU A 1 46 ? 1.126   -11.808 6.122  1.00 0.00 ? 248 GLU A N    5  
ATOM 5574  C CA   . GLU A 1 46 ? 0.258   -12.763 6.803  1.00 0.00 ? 248 GLU A CA   5  
ATOM 5575  C C    . GLU A 1 46 ? -1.032  -12.092 7.267  1.00 0.00 ? 248 GLU A C    5  
ATOM 5576  O O    . GLU A 1 46 ? -1.151  -10.867 7.228  1.00 0.00 ? 248 GLU A O    5  
ATOM 5577  C CB   . GLU A 1 46 ? 0.992   -13.383 7.994  1.00 0.00 ? 248 GLU A CB   5  
ATOM 5578  C CG   . GLU A 1 46 ? 1.464   -14.806 7.743  1.00 0.00 ? 248 GLU A CG   5  
ATOM 5579  C CD   . GLU A 1 46 ? 2.083   -15.440 8.972  1.00 0.00 ? 248 GLU A CD   5  
ATOM 5580  O OE1  . GLU A 1 46 ? 2.998   -14.827 9.560  1.00 0.00 ? 248 GLU A OE1  5  
ATOM 5581  O OE2  . GLU A 1 46 ? 1.654   -16.552 9.348  1.00 0.00 ? 248 GLU A OE2  5  
ATOM 5582  H H    . GLU A 1 46 ? 1.239   -10.912 6.499  1.00 0.00 ? 248 GLU A H    5  
ATOM 5583  H HA   . GLU A 1 46 ? 0.009   -13.543 6.099  1.00 0.00 ? 248 GLU A HA   5  
ATOM 5584  H HB2  . GLU A 1 46 ? 1.854   -12.777 8.228  1.00 0.00 ? 248 GLU A HB2  5  
ATOM 5585  H HB3  . GLU A 1 46 ? 0.328   -13.393 8.848  1.00 0.00 ? 248 GLU A HB3  5  
ATOM 5586  H HG2  . GLU A 1 46 ? 0.619   -15.405 7.435  1.00 0.00 ? 248 GLU A HG2  5  
ATOM 5587  H HG3  . GLU A 1 46 ? 2.201   -14.792 6.953  1.00 0.00 ? 248 GLU A HG3  5  
ATOM 5588  N N    . PRO A 1 47 ? -2.023  -12.887 7.712  1.00 0.00 ? 249 PRO A N    5  
ATOM 5589  C CA   . PRO A 1 47 ? -3.309  -12.359 8.181  1.00 0.00 ? 249 PRO A CA   5  
ATOM 5590  C C    . PRO A 1 47 ? -3.167  -11.542 9.462  1.00 0.00 ? 249 PRO A C    5  
ATOM 5591  O O    . PRO A 1 47 ? -3.635  -11.946 10.526 1.00 0.00 ? 249 PRO A O    5  
ATOM 5592  C CB   . PRO A 1 47 ? -4.145  -13.617 8.437  1.00 0.00 ? 249 PRO A CB   5  
ATOM 5593  C CG   . PRO A 1 47 ? -3.150  -14.702 8.655  1.00 0.00 ? 249 PRO A CG   5  
ATOM 5594  C CD   . PRO A 1 47 ? -1.970  -14.360 7.790  1.00 0.00 ? 249 PRO A CD   5  
ATOM 5595  H HA   . PRO A 1 47 ? -3.786  -11.754 7.424  1.00 0.00 ? 249 PRO A HA   5  
ATOM 5596  H HB2  . PRO A 1 47 ? -4.766  -13.468 9.310  1.00 0.00 ? 249 PRO A HB2  5  
ATOM 5597  H HB3  . PRO A 1 47 ? -4.767  -13.820 7.577  1.00 0.00 ? 249 PRO A HB3  5  
ATOM 5598  H HG2  . PRO A 1 47 ? -2.858  -14.729 9.695  1.00 0.00 ? 249 PRO A HG2  5  
ATOM 5599  H HG3  . PRO A 1 47 ? -3.569  -15.651 8.357  1.00 0.00 ? 249 PRO A HG3  5  
ATOM 5600  H HD2  . PRO A 1 47 ? -1.055  -14.690 8.255  1.00 0.00 ? 249 PRO A HD2  5  
ATOM 5601  H HD3  . PRO A 1 47 ? -2.079  -14.801 6.810  1.00 0.00 ? 249 PRO A HD3  5  
ATOM 5602  N N    . LEU A 1 48 ? -2.517  -10.389 9.347  1.00 0.00 ? 250 LEU A N    5  
ATOM 5603  C CA   . LEU A 1 48 ? -2.309  -9.508  10.489 1.00 0.00 ? 250 LEU A CA   5  
ATOM 5604  C C    . LEU A 1 48 ? -2.810  -8.099  10.189 1.00 0.00 ? 250 LEU A C    5  
ATOM 5605  O O    . LEU A 1 48 ? -2.307  -7.120  10.740 1.00 0.00 ? 250 LEU A O    5  
ATOM 5606  C CB   . LEU A 1 48 ? -0.827  -9.467  10.865 1.00 0.00 ? 250 LEU A CB   5  
ATOM 5607  C CG   . LEU A 1 48 ? 0.142   -9.452  9.678  1.00 0.00 ? 250 LEU A CG   5  
ATOM 5608  C CD1  . LEU A 1 48 ? 1.191   -8.366  9.854  1.00 0.00 ? 250 LEU A CD1  5  
ATOM 5609  C CD2  . LEU A 1 48 ? 0.805   -10.811 9.515  1.00 0.00 ? 250 LEU A CD2  5  
ATOM 5610  H H    . LEU A 1 48 ? -2.170  -10.122 8.471  1.00 0.00 ? 250 LEU A H    5  
ATOM 5611  H HA   . LEU A 1 48 ? -2.872  -9.905  11.321 1.00 0.00 ? 250 LEU A HA   5  
ATOM 5612  H HB2  . LEU A 1 48 ? -0.655  -8.580  11.458 1.00 0.00 ? 250 LEU A HB2  5  
ATOM 5613  H HB3  . LEU A 1 48 ? -0.607  -10.333 11.473 1.00 0.00 ? 250 LEU A HB3  5  
ATOM 5614  H HG   . LEU A 1 48 ? -0.411  -9.239  8.775  1.00 0.00 ? 250 LEU A HG   5  
ATOM 5615  H HD11 . LEU A 1 48 ? 1.535   -8.038  8.885  1.00 0.00 ? 250 LEU A HD11 5  
ATOM 5616  H HD12 . LEU A 1 48 ? 0.757   -7.532  10.385 1.00 0.00 ? 250 LEU A HD12 5  
ATOM 5617  H HD13 . LEU A 1 48 ? 2.023   -8.758  10.420 1.00 0.00 ? 250 LEU A HD13 5  
ATOM 5618  H HD21 . LEU A 1 48 ? 1.165   -10.917 8.502  1.00 0.00 ? 250 LEU A HD21 5  
ATOM 5619  H HD22 . LEU A 1 48 ? 1.634   -10.893 10.202 1.00 0.00 ? 250 LEU A HD22 5  
ATOM 5620  H HD23 . LEU A 1 48 ? 0.086   -11.589 9.725  1.00 0.00 ? 250 LEU A HD23 5  
ATOM 5621  N N    . GLY A 1 49 ? -3.805  -8.002  9.312  1.00 0.00 ? 251 GLY A N    5  
ATOM 5622  C CA   . GLY A 1 49 ? -4.356  -6.708  8.955  1.00 0.00 ? 251 GLY A CA   5  
ATOM 5623  C C    . GLY A 1 49 ? -5.765  -6.514  9.478  1.00 0.00 ? 251 GLY A C    5  
ATOM 5624  O O    . GLY A 1 49 ? -6.187  -7.196  10.411 1.00 0.00 ? 251 GLY A O    5  
ATOM 5625  H H    . GLY A 1 49 ? -4.167  -8.816  8.904  1.00 0.00 ? 251 GLY A H    5  
ATOM 5626  H HA2  . GLY A 1 49 ? -3.723  -5.935  9.362  1.00 0.00 ? 251 GLY A HA2  5  
ATOM 5627  H HA3  . GLY A 1 49 ? -4.367  -6.619  7.878  1.00 0.00 ? 251 GLY A HA3  5  
ATOM 5628  N N    . LYS A 1 50 ? -6.495  -5.578  8.877  1.00 0.00 ? 252 LYS A N    5  
ATOM 5629  C CA   . LYS A 1 50 ? -7.865  -5.297  9.292  1.00 0.00 ? 252 LYS A CA   5  
ATOM 5630  C C    . LYS A 1 50 ? -8.828  -5.383  8.112  1.00 0.00 ? 252 LYS A C    5  
ATOM 5631  O O    . LYS A 1 50 ? -9.930  -5.916  8.237  1.00 0.00 ? 252 LYS A O    5  
ATOM 5632  C CB   . LYS A 1 50 ? -7.951  -3.911  9.935  1.00 0.00 ? 252 LYS A CB   5  
ATOM 5633  C CG   . LYS A 1 50 ? -6.825  -3.621  10.913 1.00 0.00 ? 252 LYS A CG   5  
ATOM 5634  C CD   . LYS A 1 50 ? -7.068  -4.288  12.257 1.00 0.00 ? 252 LYS A CD   5  
ATOM 5635  C CE   . LYS A 1 50 ? -5.799  -4.339  13.091 1.00 0.00 ? 252 LYS A CE   5  
ATOM 5636  N NZ   . LYS A 1 50 ? -6.081  -4.686  14.511 1.00 0.00 ? 252 LYS A NZ   5  
ATOM 5637  H H    . LYS A 1 50 ? -6.105  -5.066  8.141  1.00 0.00 ? 252 LYS A H    5  
ATOM 5638  H HA   . LYS A 1 50 ? -8.148  -6.039  10.025 1.00 0.00 ? 252 LYS A HA   5  
ATOM 5639  H HB2  . LYS A 1 50 ? -7.923  -3.165  9.156  1.00 0.00 ? 252 LYS A HB2  5  
ATOM 5640  H HB3  . LYS A 1 50 ? -8.889  -3.830  10.466 1.00 0.00 ? 252 LYS A HB3  5  
ATOM 5641  H HG2  . LYS A 1 50 ? -5.898  -3.992  10.501 1.00 0.00 ? 252 LYS A HG2  5  
ATOM 5642  H HG3  . LYS A 1 50 ? -6.754  -2.552  11.058 1.00 0.00 ? 252 LYS A HG3  5  
ATOM 5643  H HD2  . LYS A 1 50 ? -7.819  -3.729  12.795 1.00 0.00 ? 252 LYS A HD2  5  
ATOM 5644  H HD3  . LYS A 1 50 ? -7.419  -5.296  12.089 1.00 0.00 ? 252 LYS A HD3  5  
ATOM 5645  H HE2  . LYS A 1 50 ? -5.138  -5.085  12.673 1.00 0.00 ? 252 LYS A HE2  5  
ATOM 5646  H HE3  . LYS A 1 50 ? -5.319  -3.372  13.054 1.00 0.00 ? 252 LYS A HE3  5  
ATOM 5647  H HZ1  . LYS A 1 50 ? -6.978  -4.253  14.813 1.00 0.00 ? 252 LYS A HZ1  5  
ATOM 5648  H HZ2  . LYS A 1 50 ? -5.317  -4.336  15.125 1.00 0.00 ? 252 LYS A HZ2  5  
ATOM 5649  H HZ3  . LYS A 1 50 ? -6.153  -5.717  14.621 1.00 0.00 ? 252 LYS A HZ3  5  
ATOM 5650  N N    . ASN A 1 51 ? -8.407  -4.853  6.966  1.00 0.00 ? 253 ASN A N    5  
ATOM 5651  C CA   . ASN A 1 51 ? -9.239  -4.870  5.768  1.00 0.00 ? 253 ASN A CA   5  
ATOM 5652  C C    . ASN A 1 51 ? -8.591  -5.699  4.662  1.00 0.00 ? 253 ASN A C    5  
ATOM 5653  O O    . ASN A 1 51 ? -7.432  -6.100  4.769  1.00 0.00 ? 253 ASN A O    5  
ATOM 5654  C CB   . ASN A 1 51 ? -9.490  -3.442  5.275  1.00 0.00 ? 253 ASN A CB   5  
ATOM 5655  C CG   . ASN A 1 51 ? -8.231  -2.773  4.760  1.00 0.00 ? 253 ASN A CG   5  
ATOM 5656  O OD1  . ASN A 1 51 ? -8.030  -2.647  3.551  1.00 0.00 ? 253 ASN A OD1  5  
ATOM 5657  N ND2  . ASN A 1 51 ? -7.373  -2.340  5.676  1.00 0.00 ? 253 ASN A ND2  5  
ATOM 5658  H H    . ASN A 1 51 ? -7.520  -4.441  6.927  1.00 0.00 ? 253 ASN A H    5  
ATOM 5659  H HA   . ASN A 1 51 ? -10.185 -5.321  6.028  1.00 0.00 ? 253 ASN A HA   5  
ATOM 5660  H HB2  . ASN A 1 51 ? -10.213 -3.468  4.474  1.00 0.00 ? 253 ASN A HB2  5  
ATOM 5661  H HB3  . ASN A 1 51 ? -9.882  -2.851  6.089  1.00 0.00 ? 253 ASN A HB3  5  
ATOM 5662  H HD21 . ASN A 1 51 ? -7.598  -2.475  6.622  1.00 0.00 ? 253 ASN A HD21 5  
ATOM 5663  H HD22 . ASN A 1 51 ? -6.548  -1.903  5.369  1.00 0.00 ? 253 ASN A HD22 5  
ATOM 5664  N N    . ASP A 1 52 ? -9.350  -5.949  3.600  1.00 0.00 ? 254 ASP A N    5  
ATOM 5665  C CA   . ASP A 1 52 ? -8.853  -6.731  2.472  1.00 0.00 ? 254 ASP A CA   5  
ATOM 5666  C C    . ASP A 1 52 ? -8.416  -5.821  1.325  1.00 0.00 ? 254 ASP A C    5  
ATOM 5667  O O    . ASP A 1 52 ? -8.415  -6.231  0.164  1.00 0.00 ? 254 ASP A O    5  
ATOM 5668  C CB   . ASP A 1 52 ? -9.931  -7.702  1.986  1.00 0.00 ? 254 ASP A CB   5  
ATOM 5669  C CG   . ASP A 1 52 ? -11.162 -6.989  1.463  1.00 0.00 ? 254 ASP A CG   5  
ATOM 5670  O OD1  . ASP A 1 52 ? -11.609 -6.022  2.113  1.00 0.00 ? 254 ASP A OD1  5  
ATOM 5671  O OD2  . ASP A 1 52 ? -11.680 -7.399  0.402  1.00 0.00 ? 254 ASP A OD2  5  
ATOM 5672  H H    . ASP A 1 52 ? -10.265 -5.603  3.576  1.00 0.00 ? 254 ASP A H    5  
ATOM 5673  H HA   . ASP A 1 52 ? -8.000  -7.297  2.812  1.00 0.00 ? 254 ASP A HA   5  
ATOM 5674  H HB2  . ASP A 1 52 ? -9.526  -8.313  1.192  1.00 0.00 ? 254 ASP A HB2  5  
ATOM 5675  H HB3  . ASP A 1 52 ? -10.228 -8.340  2.807  1.00 0.00 ? 254 ASP A HB3  5  
ATOM 5676  N N    . GLY A 1 53 ? -8.040  -4.589  1.657  1.00 0.00 ? 255 GLY A N    5  
ATOM 5677  C CA   . GLY A 1 53 ? -7.604  -3.650  0.642  1.00 0.00 ? 255 GLY A CA   5  
ATOM 5678  C C    . GLY A 1 53 ? -8.633  -2.572  0.352  1.00 0.00 ? 255 GLY A C    5  
ATOM 5679  O O    . GLY A 1 53 ? -8.574  -1.914  -0.688 1.00 0.00 ? 255 GLY A O    5  
ATOM 5680  H H    . GLY A 1 53 ? -8.056  -4.319  2.598  1.00 0.00 ? 255 GLY A H    5  
ATOM 5681  H HA2  . GLY A 1 53 ? -6.691  -3.177  0.975  1.00 0.00 ? 255 GLY A HA2  5  
ATOM 5682  H HA3  . GLY A 1 53 ? -7.401  -4.192  -0.271 1.00 0.00 ? 255 GLY A HA3  5  
ATOM 5683  N N    . ALA A 1 54 ? -9.578  -2.390  1.269  1.00 0.00 ? 256 ALA A N    5  
ATOM 5684  C CA   . ALA A 1 54 ? -10.620 -1.384  1.100  1.00 0.00 ? 256 ALA A CA   5  
ATOM 5685  C C    . ALA A 1 54 ? -10.881 -0.636  2.402  1.00 0.00 ? 256 ALA A C    5  
ATOM 5686  O O    . ALA A 1 54 ? -10.663 -1.168  3.491  1.00 0.00 ? 256 ALA A O    5  
ATOM 5687  C CB   . ALA A 1 54 ? -11.900 -2.032  0.593  1.00 0.00 ? 256 ALA A CB   5  
ATOM 5688  H H    . ALA A 1 54 ? -9.575  -2.943  2.079  1.00 0.00 ? 256 ALA A H    5  
ATOM 5689  H HA   . ALA A 1 54 ? -10.282 -0.680  0.355  1.00 0.00 ? 256 ALA A HA   5  
ATOM 5690  H HB1  . ALA A 1 54 ? -12.574 -2.192  1.420  1.00 0.00 ? 256 ALA A HB1  5  
ATOM 5691  H HB2  . ALA A 1 54 ? -12.369 -1.382  -0.132 1.00 0.00 ? 256 ALA A HB2  5  
ATOM 5692  H HB3  . ALA A 1 54 ? -11.666 -2.978  0.128  1.00 0.00 ? 256 ALA A HB3  5  
ATOM 5693  N N    . VAL A 1 55 ? -11.348 0.602   2.279  1.00 0.00 ? 257 VAL A N    5  
ATOM 5694  C CA   . VAL A 1 55 ? -11.640 1.428   3.443  1.00 0.00 ? 257 VAL A CA   5  
ATOM 5695  C C    . VAL A 1 55 ? -12.979 2.142   3.286  1.00 0.00 ? 257 VAL A C    5  
ATOM 5696  O O    . VAL A 1 55 ? -13.153 2.970   2.393  1.00 0.00 ? 257 VAL A O    5  
ATOM 5697  C CB   . VAL A 1 55 ? -10.535 2.478   3.675  1.00 0.00 ? 257 VAL A CB   5  
ATOM 5698  C CG1  . VAL A 1 55 ? -10.803 3.272   4.947  1.00 0.00 ? 257 VAL A CG1  5  
ATOM 5699  C CG2  . VAL A 1 55 ? -9.170  1.808   3.733  1.00 0.00 ? 257 VAL A CG2  5  
ATOM 5700  H H    . VAL A 1 55 ? -11.500 0.968   1.383  1.00 0.00 ? 257 VAL A H    5  
ATOM 5701  H HA   . VAL A 1 55 ? -11.684 0.783   4.309  1.00 0.00 ? 257 VAL A HA   5  
ATOM 5702  H HB   . VAL A 1 55 ? -10.540 3.165   2.843  1.00 0.00 ? 257 VAL A HB   5  
ATOM 5703  H HG11 . VAL A 1 55 ? -10.869 4.323   4.706  1.00 0.00 ? 257 VAL A HG11 5  
ATOM 5704  H HG12 . VAL A 1 55 ? -11.733 2.945   5.388  1.00 0.00 ? 257 VAL A HG12 5  
ATOM 5705  H HG13 . VAL A 1 55 ? -9.997  3.114   5.648  1.00 0.00 ? 257 VAL A HG13 5  
ATOM 5706  H HG21 . VAL A 1 55 ? -9.116  1.034   2.982  1.00 0.00 ? 257 VAL A HG21 5  
ATOM 5707  H HG22 . VAL A 1 55 ? -8.400  2.543   3.545  1.00 0.00 ? 257 VAL A HG22 5  
ATOM 5708  H HG23 . VAL A 1 55 ? -9.021  1.373   4.710  1.00 0.00 ? 257 VAL A HG23 5  
ATOM 5709  N N    . ALA A 1 56 ? -13.924 1.813   4.163  1.00 0.00 ? 258 ALA A N    5  
ATOM 5710  C CA   . ALA A 1 56 ? -15.248 2.422   4.123  1.00 0.00 ? 258 ALA A CA   5  
ATOM 5711  C C    . ALA A 1 56 ? -15.931 2.178   2.780  1.00 0.00 ? 258 ALA A C    5  
ATOM 5712  O O    . ALA A 1 56 ? -16.815 2.935   2.376  1.00 0.00 ? 258 ALA A O    5  
ATOM 5713  C CB   . ALA A 1 56 ? -15.151 3.913   4.403  1.00 0.00 ? 258 ALA A CB   5  
ATOM 5714  H H    . ALA A 1 56 ? -13.726 1.145   4.851  1.00 0.00 ? 258 ALA A H    5  
ATOM 5715  H HA   . ALA A 1 56 ? -15.843 1.971   4.903  1.00 0.00 ? 258 ALA A HA   5  
ATOM 5716  H HB1  . ALA A 1 56 ? -14.226 4.122   4.923  1.00 0.00 ? 258 ALA A HB1  5  
ATOM 5717  H HB2  . ALA A 1 56 ? -15.169 4.457   3.470  1.00 0.00 ? 258 ALA A HB2  5  
ATOM 5718  H HB3  . ALA A 1 56 ? -15.984 4.220   5.016  1.00 0.00 ? 258 ALA A HB3  5  
ATOM 5719  N N    . GLY A 1 57 ? -15.519 1.118   2.090  1.00 0.00 ? 259 GLY A N    5  
ATOM 5720  C CA   . GLY A 1 57 ? -16.106 0.796   0.802  1.00 0.00 ? 259 GLY A CA   5  
ATOM 5721  C C    . GLY A 1 57 ? -15.269 1.289   -0.365 1.00 0.00 ? 259 GLY A C    5  
ATOM 5722  O O    . GLY A 1 57 ? -15.721 1.269   -1.510 1.00 0.00 ? 259 GLY A O    5  
ATOM 5723  H H    . GLY A 1 57 ? -14.813 0.548   2.459  1.00 0.00 ? 259 GLY A H    5  
ATOM 5724  H HA2  . GLY A 1 57 ? -16.212 -0.275  0.726  1.00 0.00 ? 259 GLY A HA2  5  
ATOM 5725  H HA3  . GLY A 1 57 ? -17.085 1.249   0.744  1.00 0.00 ? 259 GLY A HA3  5  
ATOM 5726  N N    . THR A 1 58 ? -14.047 1.734   -0.081 1.00 0.00 ? 260 THR A N    5  
ATOM 5727  C CA   . THR A 1 58 ? -13.153 2.230   -1.119 1.00 0.00 ? 260 THR A CA   5  
ATOM 5728  C C    . THR A 1 58 ? -11.900 1.364   -1.217 1.00 0.00 ? 260 THR A C    5  
ATOM 5729  O O    . THR A 1 58 ? -11.089 1.324   -0.292 1.00 0.00 ? 260 THR A O    5  
ATOM 5730  C CB   . THR A 1 58 ? -12.765 3.682   -0.835 1.00 0.00 ? 260 THR A CB   5  
ATOM 5731  O OG1  . THR A 1 58 ? -13.899 4.439   -0.455 1.00 0.00 ? 260 THR A OG1  5  
ATOM 5732  C CG2  . THR A 1 58 ? -12.128 4.373   -2.020 1.00 0.00 ? 260 THR A CG2  5  
ATOM 5733  H H    . THR A 1 58 ? -13.740 1.726   0.850  1.00 0.00 ? 260 THR A H    5  
ATOM 5734  H HA   . THR A 1 58 ? -13.681 2.186   -2.061 1.00 0.00 ? 260 THR A HA   5  
ATOM 5735  H HB   . THR A 1 58 ? -12.055 3.701   -0.020 1.00 0.00 ? 260 THR A HB   5  
ATOM 5736  H HG1  . THR A 1 58 ? -14.562 4.394   -1.149 1.00 0.00 ? 260 THR A HG1  5  
ATOM 5737  H HG21 . THR A 1 58 ? -12.672 4.125   -2.919 1.00 0.00 ? 260 THR A HG21 5  
ATOM 5738  H HG22 . THR A 1 58 ? -11.102 4.047   -2.119 1.00 0.00 ? 260 THR A HG22 5  
ATOM 5739  H HG23 . THR A 1 58 ? -12.153 5.443   -1.869 1.00 0.00 ? 260 THR A HG23 5  
ATOM 5740  N N    . ARG A 1 59 ? -11.747 0.675   -2.343 1.00 0.00 ? 261 ARG A N    5  
ATOM 5741  C CA   . ARG A 1 59 ? -10.589 -0.186  -2.558 1.00 0.00 ? 261 ARG A CA   5  
ATOM 5742  C C    . ARG A 1 59 ? -9.438  0.595   -3.183 1.00 0.00 ? 261 ARG A C    5  
ATOM 5743  O O    . ARG A 1 59 ? -9.502  0.986   -4.349 1.00 0.00 ? 261 ARG A O    5  
ATOM 5744  C CB   . ARG A 1 59 ? -10.965 -1.370  -3.451 1.00 0.00 ? 261 ARG A CB   5  
ATOM 5745  C CG   . ARG A 1 59 ? -9.810  -2.323  -3.716 1.00 0.00 ? 261 ARG A CG   5  
ATOM 5746  C CD   . ARG A 1 59 ? -10.146 -3.315  -4.819 1.00 0.00 ? 261 ARG A CD   5  
ATOM 5747  N NE   . ARG A 1 59 ? -10.174 -2.681  -6.135 1.00 0.00 ? 261 ARG A NE   5  
ATOM 5748  C CZ   . ARG A 1 59 ? -9.083  -2.397  -6.844 1.00 0.00 ? 261 ARG A CZ   5  
ATOM 5749  N NH1  . ARG A 1 59 ? -7.879  -2.686  -6.367 1.00 0.00 ? 261 ARG A NH1  5  
ATOM 5750  N NH2  . ARG A 1 59 ? -9.198  -1.822  -8.033 1.00 0.00 ? 261 ARG A NH2  5  
ATOM 5751  H H    . ARG A 1 59 ? -12.424 0.750   -3.047 1.00 0.00 ? 261 ARG A H    5  
ATOM 5752  H HA   . ARG A 1 59 ? -10.273 -0.560  -1.596 1.00 0.00 ? 261 ARG A HA   5  
ATOM 5753  H HB2  . ARG A 1 59 ? -11.761 -1.926  -2.977 1.00 0.00 ? 261 ARG A HB2  5  
ATOM 5754  H HB3  . ARG A 1 59 ? -11.317 -0.994  -4.400 1.00 0.00 ? 261 ARG A HB3  5  
ATOM 5755  H HG2  . ARG A 1 59 ? -8.945  -1.750  -4.012 1.00 0.00 ? 261 ARG A HG2  5  
ATOM 5756  H HG3  . ARG A 1 59 ? -9.590  -2.867  -2.809 1.00 0.00 ? 261 ARG A HG3  5  
ATOM 5757  H HD2  . ARG A 1 59 ? -9.400  -4.096  -4.823 1.00 0.00 ? 261 ARG A HD2  5  
ATOM 5758  H HD3  . ARG A 1 59 ? -11.115 -3.745  -4.615 1.00 0.00 ? 261 ARG A HD3  5  
ATOM 5759  H HE   . ARG A 1 59 ? -11.050 -2.456  -6.510 1.00 0.00 ? 261 ARG A HE   5  
ATOM 5760  H HH11 . ARG A 1 59 ? -7.786  -3.119  -5.471 1.00 0.00 ? 261 ARG A HH11 5  
ATOM 5761  H HH12 . ARG A 1 59 ? -7.065  -2.470  -6.905 1.00 0.00 ? 261 ARG A HH12 5  
ATOM 5762  H HH21 . ARG A 1 59 ? -10.103 -1.602  -8.397 1.00 0.00 ? 261 ARG A HH21 5  
ATOM 5763  H HH22 . ARG A 1 59 ? -8.379  -1.607  -8.566 1.00 0.00 ? 261 ARG A HH22 5  
ATOM 5764  N N    . TYR A 1 60 ? -8.386  0.817   -2.402 1.00 0.00 ? 262 TYR A N    5  
ATOM 5765  C CA   . TYR A 1 60 ? -7.221  1.550   -2.881 1.00 0.00 ? 262 TYR A CA   5  
ATOM 5766  C C    . TYR A 1 60 ? -6.281  0.629   -3.652 1.00 0.00 ? 262 TYR A C    5  
ATOM 5767  O O    . TYR A 1 60 ? -5.649  1.040   -4.625 1.00 0.00 ? 262 TYR A O    5  
ATOM 5768  C CB   . TYR A 1 60 ? -6.479  2.194   -1.708 1.00 0.00 ? 262 TYR A CB   5  
ATOM 5769  C CG   . TYR A 1 60 ? -7.255  3.303   -1.036 1.00 0.00 ? 262 TYR A CG   5  
ATOM 5770  C CD1  . TYR A 1 60 ? -8.322  3.019   -0.193 1.00 0.00 ? 262 TYR A CD1  5  
ATOM 5771  C CD2  . TYR A 1 60 ? -6.922  4.636   -1.245 1.00 0.00 ? 262 TYR A CD2  5  
ATOM 5772  C CE1  . TYR A 1 60 ? -9.036  4.031   0.421  1.00 0.00 ? 262 TYR A CE1  5  
ATOM 5773  C CE2  . TYR A 1 60 ? -7.630  5.653   -0.634 1.00 0.00 ? 262 TYR A CE2  5  
ATOM 5774  C CZ   . TYR A 1 60 ? -8.686  5.345   0.198  1.00 0.00 ? 262 TYR A CZ   5  
ATOM 5775  O OH   . TYR A 1 60 ? -9.393  6.356   0.808  1.00 0.00 ? 262 TYR A OH   5  
ATOM 5776  H H    . TYR A 1 60 ? -8.394  0.478   -1.482 1.00 0.00 ? 262 TYR A H    5  
ATOM 5777  H HA   . TYR A 1 60 ? -7.568  2.328   -3.546 1.00 0.00 ? 262 TYR A HA   5  
ATOM 5778  H HB2  . TYR A 1 60 ? -6.270  1.438   -0.966 1.00 0.00 ? 262 TYR A HB2  5  
ATOM 5779  H HB3  . TYR A 1 60 ? -5.547  2.608   -2.065 1.00 0.00 ? 262 TYR A HB3  5  
ATOM 5780  H HD1  . TYR A 1 60 ? -8.595  1.988   -0.019 1.00 0.00 ? 262 TYR A HD1  5  
ATOM 5781  H HD2  . TYR A 1 60 ? -6.097  4.874   -1.898 1.00 0.00 ? 262 TYR A HD2  5  
ATOM 5782  H HE1  . TYR A 1 60 ? -9.862  3.789   1.073  1.00 0.00 ? 262 TYR A HE1  5  
ATOM 5783  H HE2  . TYR A 1 60 ? -7.354  6.683   -0.810 1.00 0.00 ? 262 TYR A HE2  5  
ATOM 5784  H HH   . TYR A 1 60 ? -10.334 6.173   0.744  1.00 0.00 ? 262 TYR A HH   5  
ATOM 5785  N N    . PHE A 1 61 ? -6.200  -0.622  -3.211 1.00 0.00 ? 263 PHE A N    5  
ATOM 5786  C CA   . PHE A 1 61 ? -5.345  -1.610  -3.857 1.00 0.00 ? 263 PHE A CA   5  
ATOM 5787  C C    . PHE A 1 61 ? -5.907  -3.015  -3.668 1.00 0.00 ? 263 PHE A C    5  
ATOM 5788  O O    . PHE A 1 61 ? -6.885  -3.210  -2.947 1.00 0.00 ? 263 PHE A O    5  
ATOM 5789  C CB   . PHE A 1 61 ? -3.923  -1.531  -3.298 1.00 0.00 ? 263 PHE A CB   5  
ATOM 5790  C CG   . PHE A 1 61 ? -3.868  -1.419  -1.802 1.00 0.00 ? 263 PHE A CG   5  
ATOM 5791  C CD1  . PHE A 1 61 ? -4.051  -0.194  -1.181 1.00 0.00 ? 263 PHE A CD1  5  
ATOM 5792  C CD2  . PHE A 1 61 ? -3.629  -2.535  -1.017 1.00 0.00 ? 263 PHE A CD2  5  
ATOM 5793  C CE1  . PHE A 1 61 ? -3.999  -0.085  0.195  1.00 0.00 ? 263 PHE A CE1  5  
ATOM 5794  C CE2  . PHE A 1 61 ? -3.576  -2.432  0.360  1.00 0.00 ? 263 PHE A CE2  5  
ATOM 5795  C CZ   . PHE A 1 61 ? -3.761  -1.205  0.967  1.00 0.00 ? 263 PHE A CZ   5  
ATOM 5796  H H    . PHE A 1 61 ? -6.733  -0.889  -2.432 1.00 0.00 ? 263 PHE A H    5  
ATOM 5797  H HA   . PHE A 1 61 ? -5.320  -1.385  -4.914 1.00 0.00 ? 263 PHE A HA   5  
ATOM 5798  H HB2  . PHE A 1 61 ? -3.382  -2.422  -3.583 1.00 0.00 ? 263 PHE A HB2  5  
ATOM 5799  H HB3  . PHE A 1 61 ? -3.427  -0.666  -3.714 1.00 0.00 ? 263 PHE A HB3  5  
ATOM 5800  H HD1  . PHE A 1 61 ? -4.237  0.683   -1.783 1.00 0.00 ? 263 PHE A HD1  5  
ATOM 5801  H HD2  . PHE A 1 61 ? -3.484  -3.495  -1.490 1.00 0.00 ? 263 PHE A HD2  5  
ATOM 5802  H HE1  . PHE A 1 61 ? -4.143  0.876   0.666  1.00 0.00 ? 263 PHE A HE1  5  
ATOM 5803  H HE2  . PHE A 1 61 ? -3.389  -3.309  0.961  1.00 0.00 ? 263 PHE A HE2  5  
ATOM 5804  H HZ   . PHE A 1 61 ? -3.720  -1.122  2.043  1.00 0.00 ? 263 PHE A HZ   5  
ATOM 5805  N N    . GLN A 1 62 ? -5.287  -3.991  -4.323 1.00 0.00 ? 264 GLN A N    5  
ATOM 5806  C CA   . GLN A 1 62 ? -5.733  -5.375  -4.226 1.00 0.00 ? 264 GLN A CA   5  
ATOM 5807  C C    . GLN A 1 62 ? -4.801  -6.189  -3.336 1.00 0.00 ? 264 GLN A C    5  
ATOM 5808  O O    . GLN A 1 62 ? -3.584  -6.184  -3.524 1.00 0.00 ? 264 GLN A O    5  
ATOM 5809  C CB   . GLN A 1 62 ? -5.811  -6.007  -5.618 1.00 0.00 ? 264 GLN A CB   5  
ATOM 5810  C CG   . GLN A 1 62 ? -6.490  -7.367  -5.630 1.00 0.00 ? 264 GLN A CG   5  
ATOM 5811  C CD   . GLN A 1 62 ? -8.002  -7.263  -5.706 1.00 0.00 ? 264 GLN A CD   5  
ATOM 5812  O OE1  . GLN A 1 62 ? -8.595  -7.450  -6.767 1.00 0.00 ? 264 GLN A OE1  5  
ATOM 5813  N NE2  . GLN A 1 62 ? -8.630  -6.961  -4.576 1.00 0.00 ? 264 GLN A NE2  5  
ATOM 5814  H H    . GLN A 1 62 ? -4.515  -3.775  -4.886 1.00 0.00 ? 264 GLN A H    5  
ATOM 5815  H HA   . GLN A 1 62 ? -6.720  -5.375  -3.786 1.00 0.00 ? 264 GLN A HA   5  
ATOM 5816  H HB2  . GLN A 1 62 ? -6.362  -5.347  -6.269 1.00 0.00 ? 264 GLN A HB2  5  
ATOM 5817  H HB3  . GLN A 1 62 ? -4.809  -6.126  -6.003 1.00 0.00 ? 264 GLN A HB3  5  
ATOM 5818  H HG2  . GLN A 1 62 ? -6.141  -7.922  -6.487 1.00 0.00 ? 264 GLN A HG2  5  
ATOM 5819  H HG3  . GLN A 1 62 ? -6.225  -7.896  -4.727 1.00 0.00 ? 264 GLN A HG3  5  
ATOM 5820  H HE21 . GLN A 1 62 ? -8.093  -6.825  -3.768 1.00 0.00 ? 264 GLN A HE21 5  
ATOM 5821  H HE22 . GLN A 1 62 ? -9.609  -6.887  -4.597 1.00 0.00 ? 264 GLN A HE22 5  
ATOM 5822  N N    . CYS A 1 63 ? -5.381  -6.888  -2.366 1.00 0.00 ? 265 CYS A N    5  
ATOM 5823  C CA   . CYS A 1 63 ? -4.604  -7.709  -1.446 1.00 0.00 ? 265 CYS A CA   5  
ATOM 5824  C C    . CYS A 1 63 ? -5.451  -8.847  -0.884 1.00 0.00 ? 265 CYS A C    5  
ATOM 5825  O O    . CYS A 1 63 ? -6.681  -8.801  -0.928 1.00 0.00 ? 265 CYS A O    5  
ATOM 5826  C CB   . CYS A 1 63 ? -4.056  -6.853  -0.304 1.00 0.00 ? 265 CYS A CB   5  
ATOM 5827  S SG   . CYS A 1 63 ? -5.322  -5.935  0.605  1.00 0.00 ? 265 CYS A SG   5  
ATOM 5828  H H    . CYS A 1 63 ? -6.356  -6.851  -2.269 1.00 0.00 ? 265 CYS A H    5  
ATOM 5829  H HA   . CYS A 1 63 ? -3.777  -8.132  -1.995 1.00 0.00 ? 265 CYS A HA   5  
ATOM 5830  H HB2  . CYS A 1 63 ? -3.545  -7.490  0.402  1.00 0.00 ? 265 CYS A HB2  5  
ATOM 5831  H HB3  . CYS A 1 63 ? -3.355  -6.135  -0.706 1.00 0.00 ? 265 CYS A HB3  5  
ATOM 5832  H HG   . CYS A 1 63 ? -5.280  -6.203  1.525  1.00 0.00 ? 265 CYS A HG   5  
ATOM 5833  N N    . GLN A 1 64 ? -4.784  -9.865  -0.351 1.00 0.00 ? 266 GLN A N    5  
ATOM 5834  C CA   . GLN A 1 64 ? -5.471  -11.016 0.223  1.00 0.00 ? 266 GLN A CA   5  
ATOM 5835  C C    . GLN A 1 64 ? -6.363  -10.593 1.389  1.00 0.00 ? 266 GLN A C    5  
ATOM 5836  O O    . GLN A 1 64 ? -6.242  -9.480  1.899  1.00 0.00 ? 266 GLN A O    5  
ATOM 5837  C CB   . GLN A 1 64 ? -4.456  -12.059 0.694  1.00 0.00 ? 266 GLN A CB   5  
ATOM 5838  C CG   . GLN A 1 64 ? -4.046  -13.042 -0.392 1.00 0.00 ? 266 GLN A CG   5  
ATOM 5839  C CD   . GLN A 1 64 ? -5.128  -14.058 -0.699 1.00 0.00 ? 266 GLN A CD   5  
ATOM 5840  O OE1  . GLN A 1 64 ? -5.285  -15.049 0.014  1.00 0.00 ? 266 GLN A OE1  5  
ATOM 5841  N NE2  . GLN A 1 64 ? -5.883  -13.814 -1.763 1.00 0.00 ? 266 GLN A NE2  5  
ATOM 5842  H H    . GLN A 1 64 ? -3.804  -9.843  -0.344 1.00 0.00 ? 266 GLN A H    5  
ATOM 5843  H HA   . GLN A 1 64 ? -6.090  -11.450 -0.548 1.00 0.00 ? 266 GLN A HA   5  
ATOM 5844  H HB2  . GLN A 1 64 ? -3.570  -11.551 1.042  1.00 0.00 ? 266 GLN A HB2  5  
ATOM 5845  H HB3  . GLN A 1 64 ? -4.887  -12.619 1.511  1.00 0.00 ? 266 GLN A HB3  5  
ATOM 5846  H HG2  . GLN A 1 64 ? -3.825  -12.491 -1.293 1.00 0.00 ? 266 GLN A HG2  5  
ATOM 5847  H HG3  . GLN A 1 64 ? -3.160  -13.568 -0.067 1.00 0.00 ? 266 GLN A HG3  5  
ATOM 5848  H HE21 . GLN A 1 64 ? -5.701  -13.004 -2.285 1.00 0.00 ? 266 GLN A HE21 5  
ATOM 5849  H HE22 . GLN A 1 64 ? -6.591  -14.455 -1.986 1.00 0.00 ? 266 GLN A HE22 5  
ATOM 5850  N N    . PRO A 1 65 ? -7.273  -11.478 1.824  1.00 0.00 ? 267 PRO A N    5  
ATOM 5851  C CA   . PRO A 1 65 ? -8.187  -11.190 2.936  1.00 0.00 ? 267 PRO A CA   5  
ATOM 5852  C C    . PRO A 1 65 ? -7.440  -10.951 4.244  1.00 0.00 ? 267 PRO A C    5  
ATOM 5853  O O    . PRO A 1 65 ? -6.568  -11.733 4.624  1.00 0.00 ? 267 PRO A O    5  
ATOM 5854  C CB   . PRO A 1 65 ? -9.051  -12.454 3.039  1.00 0.00 ? 267 PRO A CB   5  
ATOM 5855  C CG   . PRO A 1 65 ? -8.876  -13.159 1.736  1.00 0.00 ? 267 PRO A CG   5  
ATOM 5856  C CD   . PRO A 1 65 ? -7.489  -12.825 1.272  1.00 0.00 ? 267 PRO A CD   5  
ATOM 5857  H HA   . PRO A 1 65 ? -8.814  -10.337 2.720  1.00 0.00 ? 267 PRO A HA   5  
ATOM 5858  H HB2  . PRO A 1 65 ? -8.709  -13.060 3.864  1.00 0.00 ? 267 PRO A HB2  5  
ATOM 5859  H HB3  . PRO A 1 65 ? -10.083 -12.173 3.198  1.00 0.00 ? 267 PRO A HB3  5  
ATOM 5860  H HG2  . PRO A 1 65 ? -8.978  -14.225 1.878  1.00 0.00 ? 267 PRO A HG2  5  
ATOM 5861  H HG3  . PRO A 1 65 ? -9.605  -12.802 1.024  1.00 0.00 ? 267 PRO A HG3  5  
ATOM 5862  H HD2  . PRO A 1 65 ? -6.775  -13.528 1.674  1.00 0.00 ? 267 PRO A HD2  5  
ATOM 5863  H HD3  . PRO A 1 65 ? -7.443  -12.811 0.193  1.00 0.00 ? 267 PRO A HD3  5  
ATOM 5864  N N    . LYS A 1 66 ? -7.789  -9.868  4.929  1.00 0.00 ? 268 LYS A N    5  
ATOM 5865  C CA   . LYS A 1 66 ? -7.154  -9.527  6.198  1.00 0.00 ? 268 LYS A CA   5  
ATOM 5866  C C    . LYS A 1 66 ? -5.654  -9.300  6.023  1.00 0.00 ? 268 LYS A C    5  
ATOM 5867  O O    . LYS A 1 66 ? -4.881  -9.443  6.969  1.00 0.00 ? 268 LYS A O    5  
ATOM 5868  C CB   . LYS A 1 66 ? -7.395  -10.634 7.226  1.00 0.00 ? 268 LYS A CB   5  
ATOM 5869  C CG   . LYS A 1 66 ? -8.847  -10.758 7.657  1.00 0.00 ? 268 LYS A CG   5  
ATOM 5870  C CD   . LYS A 1 66 ? -8.966  -11.061 9.142  1.00 0.00 ? 268 LYS A CD   5  
ATOM 5871  C CE   . LYS A 1 66 ? -10.358 -11.554 9.504  1.00 0.00 ? 268 LYS A CE   5  
ATOM 5872  N NZ   . LYS A 1 66 ? -10.341 -12.960 9.994  1.00 0.00 ? 268 LYS A NZ   5  
ATOM 5873  H H    . LYS A 1 66 ? -8.492  -9.285  4.576  1.00 0.00 ? 268 LYS A H    5  
ATOM 5874  H HA   . LYS A 1 66 ? -7.603  -8.612  6.556  1.00 0.00 ? 268 LYS A HA   5  
ATOM 5875  H HB2  . LYS A 1 66 ? -7.086  -11.577 6.801  1.00 0.00 ? 268 LYS A HB2  5  
ATOM 5876  H HB3  . LYS A 1 66 ? -6.798  -10.430 8.103  1.00 0.00 ? 268 LYS A HB3  5  
ATOM 5877  H HG2  . LYS A 1 66 ? -9.356  -9.828  7.448  1.00 0.00 ? 268 LYS A HG2  5  
ATOM 5878  H HG3  . LYS A 1 66 ? -9.311  -11.557 7.096  1.00 0.00 ? 268 LYS A HG3  5  
ATOM 5879  H HD2  . LYS A 1 66 ? -8.246  -11.824 9.402  1.00 0.00 ? 268 LYS A HD2  5  
ATOM 5880  H HD3  . LYS A 1 66 ? -8.755  -10.160 9.700  1.00 0.00 ? 268 LYS A HD3  5  
ATOM 5881  H HE2  . LYS A 1 66 ? -10.760 -10.918 10.280 1.00 0.00 ? 268 LYS A HE2  5  
ATOM 5882  H HE3  . LYS A 1 66 ? -10.988 -11.493 8.629  1.00 0.00 ? 268 LYS A HE3  5  
ATOM 5883  H HZ1  . LYS A 1 66 ? -9.652  -13.062 10.766 1.00 0.00 ? 268 LYS A HZ1  5  
ATOM 5884  H HZ2  . LYS A 1 66 ? -10.076 -13.604 9.220  1.00 0.00 ? 268 LYS A HZ2  5  
ATOM 5885  H HZ3  . LYS A 1 66 ? -11.282 -13.229 10.345 1.00 0.00 ? 268 LYS A HZ3  5  
ATOM 5886  N N    . TYR A 1 67 ? -5.247  -8.942  4.808  1.00 0.00 ? 269 TYR A N    5  
ATOM 5887  C CA   . TYR A 1 67 ? -3.838  -8.692  4.517  1.00 0.00 ? 269 TYR A CA   5  
ATOM 5888  C C    . TYR A 1 67 ? -3.590  -7.211  4.239  1.00 0.00 ? 269 TYR A C    5  
ATOM 5889  O O    . TYR A 1 67 ? -2.457  -6.739  4.319  1.00 0.00 ? 269 TYR A O    5  
ATOM 5890  C CB   . TYR A 1 67 ? -3.385  -9.524  3.314  1.00 0.00 ? 269 TYR A CB   5  
ATOM 5891  C CG   . TYR A 1 67 ? -2.853  -10.895 3.675  1.00 0.00 ? 269 TYR A CG   5  
ATOM 5892  C CD1  . TYR A 1 67 ? -3.411  -11.630 4.713  1.00 0.00 ? 269 TYR A CD1  5  
ATOM 5893  C CD2  . TYR A 1 67 ? -1.795  -11.454 2.970  1.00 0.00 ? 269 TYR A CD2  5  
ATOM 5894  C CE1  . TYR A 1 67 ? -2.926  -12.883 5.039  1.00 0.00 ? 269 TYR A CE1  5  
ATOM 5895  C CE2  . TYR A 1 67 ? -1.306  -12.705 3.290  1.00 0.00 ? 269 TYR A CE2  5  
ATOM 5896  C CZ   . TYR A 1 67 ? -1.875  -13.416 4.325  1.00 0.00 ? 269 TYR A CZ   5  
ATOM 5897  O OH   . TYR A 1 67 ? -1.392  -14.664 4.646  1.00 0.00 ? 269 TYR A OH   5  
ATOM 5898  H H    . TYR A 1 67 ? -5.908  -8.840  4.091  1.00 0.00 ? 269 TYR A H    5  
ATOM 5899  H HA   . TYR A 1 67 ? -3.264  -8.985  5.382  1.00 0.00 ? 269 TYR A HA   5  
ATOM 5900  H HB2  . TYR A 1 67 ? -4.221  -9.661  2.645  1.00 0.00 ? 269 TYR A HB2  5  
ATOM 5901  H HB3  . TYR A 1 67 ? -2.602  -8.990  2.794  1.00 0.00 ? 269 TYR A HB3  5  
ATOM 5902  H HD1  . TYR A 1 67 ? -4.233  -11.210 5.272  1.00 0.00 ? 269 TYR A HD1  5  
ATOM 5903  H HD2  . TYR A 1 67 ? -1.349  -10.894 2.160  1.00 0.00 ? 269 TYR A HD2  5  
ATOM 5904  H HE1  . TYR A 1 67 ? -3.373  -13.440 5.850  1.00 0.00 ? 269 TYR A HE1  5  
ATOM 5905  H HE2  . TYR A 1 67 ? -0.481  -13.122 2.730  1.00 0.00 ? 269 TYR A HE2  5  
ATOM 5906  H HH   . TYR A 1 67 ? -0.440  -14.680 4.527  1.00 0.00 ? 269 TYR A HH   5  
ATOM 5907  N N    . GLY A 1 68 ? -4.652  -6.480  3.911  1.00 0.00 ? 270 GLY A N    5  
ATOM 5908  C CA   . GLY A 1 68 ? -4.515  -5.064  3.626  1.00 0.00 ? 270 GLY A CA   5  
ATOM 5909  C C    . GLY A 1 68 ? -4.442  -4.217  4.881  1.00 0.00 ? 270 GLY A C    5  
ATOM 5910  O O    . GLY A 1 68 ? -5.317  -4.294  5.745  1.00 0.00 ? 270 GLY A O    5  
ATOM 5911  H H    . GLY A 1 68 ? -5.533  -6.904  3.862  1.00 0.00 ? 270 GLY A H    5  
ATOM 5912  H HA2  . GLY A 1 68 ? -3.616  -4.910  3.049  1.00 0.00 ? 270 GLY A HA2  5  
ATOM 5913  H HA3  . GLY A 1 68 ? -5.364  -4.743  3.038  1.00 0.00 ? 270 GLY A HA3  5  
ATOM 5914  N N    . LEU A 1 69 ? -3.396  -3.403  4.980  1.00 0.00 ? 271 LEU A N    5  
ATOM 5915  C CA   . LEU A 1 69 ? -3.209  -2.533  6.134  1.00 0.00 ? 271 LEU A CA   5  
ATOM 5916  C C    . LEU A 1 69 ? -2.914  -1.104  5.688  1.00 0.00 ? 271 LEU A C    5  
ATOM 5917  O O    . LEU A 1 69 ? -2.073  -0.877  4.818  1.00 0.00 ? 271 LEU A O    5  
ATOM 5918  C CB   . LEU A 1 69 ? -2.072  -3.053  7.015  1.00 0.00 ? 271 LEU A CB   5  
ATOM 5919  C CG   . LEU A 1 69 ? -2.176  -2.680  8.497  1.00 0.00 ? 271 LEU A CG   5  
ATOM 5920  C CD1  . LEU A 1 69 ? -3.436  -3.273  9.112  1.00 0.00 ? 271 LEU A CD1  5  
ATOM 5921  C CD2  . LEU A 1 69 ? -0.940  -3.148  9.252  1.00 0.00 ? 271 LEU A CD2  5  
ATOM 5922  H H    . LEU A 1 69 ? -2.735  -3.386  4.257  1.00 0.00 ? 271 LEU A H    5  
ATOM 5923  H HA   . LEU A 1 69 ? -4.125  -2.536  6.705  1.00 0.00 ? 271 LEU A HA   5  
ATOM 5924  H HB2  . LEU A 1 69 ? -2.048  -4.130  6.937  1.00 0.00 ? 271 LEU A HB2  5  
ATOM 5925  H HB3  . LEU A 1 69 ? -1.141  -2.661  6.634  1.00 0.00 ? 271 LEU A HB3  5  
ATOM 5926  H HG   . LEU A 1 69 ? -2.237  -1.605  8.586  1.00 0.00 ? 271 LEU A HG   5  
ATOM 5927  H HD11 . LEU A 1 69 ? -3.167  -4.074  9.785  1.00 0.00 ? 271 LEU A HD11 5  
ATOM 5928  H HD12 . LEU A 1 69 ? -3.964  -2.505  9.659  1.00 0.00 ? 271 LEU A HD12 5  
ATOM 5929  H HD13 . LEU A 1 69 ? -4.073  -3.660  8.331  1.00 0.00 ? 271 LEU A HD13 5  
ATOM 5930  H HD21 . LEU A 1 69 ? -1.182  -4.028  9.829  1.00 0.00 ? 271 LEU A HD21 5  
ATOM 5931  H HD22 . LEU A 1 69 ? -0.155  -3.385  8.548  1.00 0.00 ? 271 LEU A HD22 5  
ATOM 5932  H HD23 . LEU A 1 69 ? -0.604  -2.364  9.915  1.00 0.00 ? 271 LEU A HD23 5  
ATOM 5933  N N    . PHE A 1 70 ? -3.618  -0.146  6.280  1.00 0.00 ? 272 PHE A N    5  
ATOM 5934  C CA   . PHE A 1 70 ? -3.439  1.261   5.935  1.00 0.00 ? 272 PHE A CA   5  
ATOM 5935  C C    . PHE A 1 70 ? -2.759  2.025   7.065  1.00 0.00 ? 272 PHE A C    5  
ATOM 5936  O O    . PHE A 1 70 ? -3.342  2.218   8.129  1.00 0.00 ? 272 PHE A O    5  
ATOM 5937  C CB   . PHE A 1 70 ? -4.794  1.899   5.626  1.00 0.00 ? 272 PHE A CB   5  
ATOM 5938  C CG   . PHE A 1 70 ? -5.339  1.543   4.272  1.00 0.00 ? 272 PHE A CG   5  
ATOM 5939  C CD1  . PHE A 1 70 ? -5.529  0.219   3.914  1.00 0.00 ? 272 PHE A CD1  5  
ATOM 5940  C CD2  . PHE A 1 70 ? -5.666  2.534   3.361  1.00 0.00 ? 272 PHE A CD2  5  
ATOM 5941  C CE1  . PHE A 1 70 ? -6.035  -0.112  2.671  1.00 0.00 ? 272 PHE A CE1  5  
ATOM 5942  C CE2  . PHE A 1 70 ? -6.170  2.210   2.116  1.00 0.00 ? 272 PHE A CE2  5  
ATOM 5943  C CZ   . PHE A 1 70 ? -6.356  0.885   1.771  1.00 0.00 ? 272 PHE A CZ   5  
ATOM 5944  H H    . PHE A 1 70 ? -4.279  -0.390  6.961  1.00 0.00 ? 272 PHE A H    5  
ATOM 5945  H HA   . PHE A 1 70 ? -2.817  1.310   5.054  1.00 0.00 ? 272 PHE A HA   5  
ATOM 5946  H HB2  . PHE A 1 70 ? -5.510  1.576   6.366  1.00 0.00 ? 272 PHE A HB2  5  
ATOM 5947  H HB3  . PHE A 1 70 ? -4.696  2.974   5.675  1.00 0.00 ? 272 PHE A HB3  5  
ATOM 5948  H HD1  . PHE A 1 70 ? -5.278  -0.562  4.618  1.00 0.00 ? 272 PHE A HD1  5  
ATOM 5949  H HD2  . PHE A 1 70 ? -5.520  3.569   3.630  1.00 0.00 ? 272 PHE A HD2  5  
ATOM 5950  H HE1  . PHE A 1 70 ? -6.178  -1.148  2.405  1.00 0.00 ? 272 PHE A HE1  5  
ATOM 5951  H HE2  . PHE A 1 70 ? -6.420  2.992   1.414  1.00 0.00 ? 272 PHE A HE2  5  
ATOM 5952  H HZ   . PHE A 1 70 ? -6.752  0.630   0.799  1.00 0.00 ? 272 PHE A HZ   5  
ATOM 5953  N N    . ALA A 1 71 ? -1.530  2.476   6.824  1.00 0.00 ? 273 ALA A N    5  
ATOM 5954  C CA   . ALA A 1 71 ? -0.786  3.234   7.825  1.00 0.00 ? 273 ALA A CA   5  
ATOM 5955  C C    . ALA A 1 71 ? -0.014  4.384   7.181  1.00 0.00 ? 273 ALA A C    5  
ATOM 5956  O O    . ALA A 1 71 ? 0.405   4.296   6.028  1.00 0.00 ? 273 ALA A O    5  
ATOM 5957  C CB   . ALA A 1 71 ? 0.164   2.332   8.600  1.00 0.00 ? 273 ALA A CB   5  
ATOM 5958  H H    . ALA A 1 71 ? -1.117  2.301   5.952  1.00 0.00 ? 273 ALA A H    5  
ATOM 5959  H HA   . ALA A 1 71 ? -1.501  3.645   8.524  1.00 0.00 ? 273 ALA A HA   5  
ATOM 5960  H HB1  . ALA A 1 71 ? 0.943   1.977   7.942  1.00 0.00 ? 273 ALA A HB1  5  
ATOM 5961  H HB2  . ALA A 1 71 ? 0.607   2.890   9.413  1.00 0.00 ? 273 ALA A HB2  5  
ATOM 5962  H HB3  . ALA A 1 71 ? -0.382  1.491   8.999  1.00 0.00 ? 273 ALA A HB3  5  
ATOM 5963  N N    . PRO A 1 72 ? 0.183   5.483   7.928  1.00 0.00 ? 274 PRO A N    5  
ATOM 5964  C CA   . PRO A 1 72 ? 0.905   6.660   7.438  1.00 0.00 ? 274 PRO A CA   5  
ATOM 5965  C C    . PRO A 1 72 ? 2.238   6.305   6.792  1.00 0.00 ? 274 PRO A C    5  
ATOM 5966  O O    . PRO A 1 72 ? 2.769   5.213   6.996  1.00 0.00 ? 274 PRO A O    5  
ATOM 5967  C CB   . PRO A 1 72 ? 1.144   7.481   8.703  1.00 0.00 ? 274 PRO A CB   5  
ATOM 5968  C CG   . PRO A 1 72 ? 0.044   7.092   9.628  1.00 0.00 ? 274 PRO A CG   5  
ATOM 5969  C CD   . PRO A 1 72 ? -0.290  5.660   9.313  1.00 0.00 ? 274 PRO A CD   5  
ATOM 5970  H HA   . PRO A 1 72 ? 0.309   7.232   6.743  1.00 0.00 ? 274 PRO A HA   5  
ATOM 5971  H HB2  . PRO A 1 72 ? 2.109   7.232   9.115  1.00 0.00 ? 274 PRO A HB2  5  
ATOM 5972  H HB3  . PRO A 1 72 ? 1.107   8.534   8.467  1.00 0.00 ? 274 PRO A HB3  5  
ATOM 5973  H HG2  . PRO A 1 72 ? 0.382   7.179   10.649 1.00 0.00 ? 274 PRO A HG2  5  
ATOM 5974  H HG3  . PRO A 1 72 ? -0.817  7.723   9.461  1.00 0.00 ? 274 PRO A HG3  5  
ATOM 5975  H HD2  . PRO A 1 72 ? 0.233   4.994   9.984  1.00 0.00 ? 274 PRO A HD2  5  
ATOM 5976  H HD3  . PRO A 1 72 ? -1.356  5.499   9.374  1.00 0.00 ? 274 PRO A HD3  5  
ATOM 5977  N N    . VAL A 1 73 ? 2.779   7.240   6.017  1.00 0.00 ? 275 VAL A N    5  
ATOM 5978  C CA   . VAL A 1 73 ? 4.056   7.032   5.346  1.00 0.00 ? 275 VAL A CA   5  
ATOM 5979  C C    . VAL A 1 73 ? 5.206   7.061   6.348  1.00 0.00 ? 275 VAL A C    5  
ATOM 5980  O O    . VAL A 1 73 ? 6.217   6.383   6.167  1.00 0.00 ? 275 VAL A O    5  
ATOM 5981  C CB   . VAL A 1 73 ? 4.299   8.100   4.261  1.00 0.00 ? 275 VAL A CB   5  
ATOM 5982  C CG1  . VAL A 1 73 ? 4.326   9.493   4.872  1.00 0.00 ? 275 VAL A CG1  5  
ATOM 5983  C CG2  . VAL A 1 73 ? 5.591   7.814   3.508  1.00 0.00 ? 275 VAL A CG2  5  
ATOM 5984  H H    . VAL A 1 73 ? 2.310   8.093   5.897  1.00 0.00 ? 275 VAL A H    5  
ATOM 5985  H HA   . VAL A 1 73 ? 4.028   6.063   4.870  1.00 0.00 ? 275 VAL A HA   5  
ATOM 5986  H HB   . VAL A 1 73 ? 3.481   8.058   3.555  1.00 0.00 ? 275 VAL A HB   5  
ATOM 5987  H HG11 . VAL A 1 73 ? 4.550   10.219  4.106  1.00 0.00 ? 275 VAL A HG11 5  
ATOM 5988  H HG12 . VAL A 1 73 ? 3.361   9.714   5.307  1.00 0.00 ? 275 VAL A HG12 5  
ATOM 5989  H HG13 . VAL A 1 73 ? 5.083   9.534   5.641  1.00 0.00 ? 275 VAL A HG13 5  
ATOM 5990  H HG21 . VAL A 1 73 ? 5.448   8.022   2.458  1.00 0.00 ? 275 VAL A HG21 5  
ATOM 5991  H HG22 . VAL A 1 73 ? 6.378   8.444   3.895  1.00 0.00 ? 275 VAL A HG22 5  
ATOM 5992  H HG23 . VAL A 1 73 ? 5.860   6.778   3.637  1.00 0.00 ? 275 VAL A HG23 5  
ATOM 5993  N N    . HIS A 1 74 ? 5.043   7.847   7.411  1.00 0.00 ? 276 HIS A N    5  
ATOM 5994  C CA   . HIS A 1 74 ? 6.070   7.956   8.441  1.00 0.00 ? 276 HIS A CA   5  
ATOM 5995  C C    . HIS A 1 74 ? 6.044   6.743   9.367  1.00 0.00 ? 276 HIS A C    5  
ATOM 5996  O O    . HIS A 1 74 ? 7.061   6.384   9.961  1.00 0.00 ? 276 HIS A O    5  
ATOM 5997  C CB   . HIS A 1 74 ? 5.889   9.243   9.253  1.00 0.00 ? 276 HIS A CB   5  
ATOM 5998  C CG   . HIS A 1 74 ? 4.479   9.491   9.692  1.00 0.00 ? 276 HIS A CG   5  
ATOM 5999  N ND1  . HIS A 1 74 ? 3.838   10.698  9.510  1.00 0.00 ? 276 HIS A ND1  5  
ATOM 6000  C CD2  . HIS A 1 74 ? 3.586   8.683   10.314 1.00 0.00 ? 276 HIS A CD2  5  
ATOM 6001  C CE1  . HIS A 1 74 ? 2.614   10.623  10.003 1.00 0.00 ? 276 HIS A CE1  5  
ATOM 6002  N NE2  . HIS A 1 74 ? 2.437   9.411   10.494 1.00 0.00 ? 276 HIS A NE2  5  
ATOM 6003  H H    . HIS A 1 74 ? 4.214   8.360   7.503  1.00 0.00 ? 276 HIS A H    5  
ATOM 6004  H HA   . HIS A 1 74 ? 7.029   7.990   7.944  1.00 0.00 ? 276 HIS A HA   5  
ATOM 6005  H HB2  . HIS A 1 74 ? 6.505   9.188   10.138 1.00 0.00 ? 276 HIS A HB2  5  
ATOM 6006  H HB3  . HIS A 1 74 ? 6.203   10.083  8.653  1.00 0.00 ? 276 HIS A HB3  5  
ATOM 6007  H HD1  . HIS A 1 74 ? 4.223   11.493  9.085  1.00 0.00 ? 276 HIS A HD1  5  
ATOM 6008  H HD2  . HIS A 1 74 ? 3.746   7.655   10.606 1.00 0.00 ? 276 HIS A HD2  5  
ATOM 6009  H HE1  . HIS A 1 74 ? 1.883   11.417  10.000 1.00 0.00 ? 276 HIS A HE1  5  
ATOM 6010  H HE2  . HIS A 1 74 ? 1.653   9.118   11.004 1.00 0.00 ? 276 HIS A HE2  5  
ATOM 6011  N N    . LYS A 1 75 ? 4.881   6.107   9.476  1.00 0.00 ? 277 LYS A N    5  
ATOM 6012  C CA   . LYS A 1 75 ? 4.733   4.928   10.322 1.00 0.00 ? 277 LYS A CA   5  
ATOM 6013  C C    . LYS A 1 75 ? 5.310   3.697   9.636  1.00 0.00 ? 277 LYS A C    5  
ATOM 6014  O O    . LYS A 1 75 ? 5.617   2.698   10.287 1.00 0.00 ? 277 LYS A O    5  
ATOM 6015  C CB   . LYS A 1 75 ? 3.259   4.683   10.650 1.00 0.00 ? 277 LYS A CB   5  
ATOM 6016  C CG   . LYS A 1 75 ? 2.731   5.543   11.786 1.00 0.00 ? 277 LYS A CG   5  
ATOM 6017  C CD   . LYS A 1 75 ? 2.177   4.692   12.917 1.00 0.00 ? 277 LYS A CD   5  
ATOM 6018  C CE   . LYS A 1 75 ? 3.288   4.074   13.751 1.00 0.00 ? 277 LYS A CE   5  
ATOM 6019  N NZ   . LYS A 1 75 ? 4.142   5.108   14.401 1.00 0.00 ? 277 LYS A NZ   5  
ATOM 6020  H H    . LYS A 1 75 ? 4.107   6.435   8.972  1.00 0.00 ? 277 LYS A H    5  
ATOM 6021  H HA   . LYS A 1 75 ? 5.275   5.105   11.240 1.00 0.00 ? 277 LYS A HA   5  
ATOM 6022  H HB2  . LYS A 1 75 ? 2.669   4.888   9.769  1.00 0.00 ? 277 LYS A HB2  5  
ATOM 6023  H HB3  . LYS A 1 75 ? 3.132   3.645   10.923 1.00 0.00 ? 277 LYS A HB3  5  
ATOM 6024  H HG2  . LYS A 1 75 ? 3.535   6.155   12.168 1.00 0.00 ? 277 LYS A HG2  5  
ATOM 6025  H HG3  . LYS A 1 75 ? 1.942   6.178   11.406 1.00 0.00 ? 277 LYS A HG3  5  
ATOM 6026  H HD2  . LYS A 1 75 ? 1.566   5.313   13.555 1.00 0.00 ? 277 LYS A HD2  5  
ATOM 6027  H HD3  . LYS A 1 75 ? 1.572   3.901   12.496 1.00 0.00 ? 277 LYS A HD3  5  
ATOM 6028  H HE2  . LYS A 1 75 ? 2.844   3.456   14.517 1.00 0.00 ? 277 LYS A HE2  5  
ATOM 6029  H HE3  . LYS A 1 75 ? 3.904   3.461   13.110 1.00 0.00 ? 277 LYS A HE3  5  
ATOM 6030  H HZ1  . LYS A 1 75 ? 4.094   5.013   15.435 1.00 0.00 ? 277 LYS A HZ1  5  
ATOM 6031  H HZ2  . LYS A 1 75 ? 3.819   6.059   14.136 1.00 0.00 ? 277 LYS A HZ2  5  
ATOM 6032  H HZ3  . LYS A 1 75 ? 5.132   4.994   14.101 1.00 0.00 ? 277 LYS A HZ3  5  
ATOM 6033  N N    . VAL A 1 76 ? 5.455   3.773   8.317  1.00 0.00 ? 278 VAL A N    5  
ATOM 6034  C CA   . VAL A 1 76 ? 5.993   2.661   7.550  1.00 0.00 ? 278 VAL A CA   5  
ATOM 6035  C C    . VAL A 1 76 ? 7.489   2.826   7.307  1.00 0.00 ? 278 VAL A C    5  
ATOM 6036  O O    . VAL A 1 76 ? 7.981   3.938   7.123  1.00 0.00 ? 278 VAL A O    5  
ATOM 6037  C CB   . VAL A 1 76 ? 5.279   2.506   6.195  1.00 0.00 ? 278 VAL A CB   5  
ATOM 6038  C CG1  . VAL A 1 76 ? 5.683   1.202   5.530  1.00 0.00 ? 278 VAL A CG1  5  
ATOM 6039  C CG2  . VAL A 1 76 ? 3.770   2.568   6.368  1.00 0.00 ? 278 VAL A CG2  5  
ATOM 6040  H H    . VAL A 1 76 ? 5.191   4.593   7.851  1.00 0.00 ? 278 VAL A H    5  
ATOM 6041  H HA   . VAL A 1 76 ? 5.833   1.761   8.121  1.00 0.00 ? 278 VAL A HA   5  
ATOM 6042  H HB   . VAL A 1 76 ? 5.582   3.321   5.554  1.00 0.00 ? 278 VAL A HB   5  
ATOM 6043  H HG11 . VAL A 1 76 ? 6.024   0.506   6.282  1.00 0.00 ? 278 VAL A HG11 5  
ATOM 6044  H HG12 . VAL A 1 76 ? 4.832   0.785   5.013  1.00 0.00 ? 278 VAL A HG12 5  
ATOM 6045  H HG13 . VAL A 1 76 ? 6.478   1.389   4.824  1.00 0.00 ? 278 VAL A HG13 5  
ATOM 6046  H HG21 . VAL A 1 76 ? 3.357   1.575   6.268  1.00 0.00 ? 278 VAL A HG21 5  
ATOM 6047  H HG22 . VAL A 1 76 ? 3.534   2.960   7.345  1.00 0.00 ? 278 VAL A HG22 5  
ATOM 6048  H HG23 . VAL A 1 76 ? 3.349   3.209   5.609  1.00 0.00 ? 278 VAL A HG23 5  
ATOM 6049  N N    . THR A 1 77 ? 8.203   1.707   7.308  1.00 0.00 ? 279 THR A N    5  
ATOM 6050  C CA   . THR A 1 77 ? 9.644   1.718   7.088  1.00 0.00 ? 279 THR A CA   5  
ATOM 6051  C C    . THR A 1 77 ? 10.073  0.513   6.259  1.00 0.00 ? 279 THR A C    5  
ATOM 6052  O O    . THR A 1 77 ? 9.523   -0.578  6.402  1.00 0.00 ? 279 THR A O    5  
ATOM 6053  C CB   . THR A 1 77 ? 10.383  1.721   8.429  1.00 0.00 ? 279 THR A CB   5  
ATOM 6054  O OG1  . THR A 1 77 ? 9.516   2.106   9.480  1.00 0.00 ? 279 THR A OG1  5  
ATOM 6055  C CG2  . THR A 1 77 ? 11.575  2.654   8.451  1.00 0.00 ? 279 THR A CG2  5  
ATOM 6056  H H    . THR A 1 77 ? 7.749   0.852   7.461  1.00 0.00 ? 279 THR A H    5  
ATOM 6057  H HA   . THR A 1 77 ? 9.890   2.620   6.548  1.00 0.00 ? 279 THR A HA   5  
ATOM 6058  H HB   . THR A 1 77 ? 10.740  0.723   8.633  1.00 0.00 ? 279 THR A HB   5  
ATOM 6059  H HG1  . THR A 1 77 ? 9.080   2.931   9.249  1.00 0.00 ? 279 THR A HG1  5  
ATOM 6060  H HG21 . THR A 1 77 ? 11.712  3.035   9.452  1.00 0.00 ? 279 THR A HG21 5  
ATOM 6061  H HG22 . THR A 1 77 ? 11.401  3.475   7.773  1.00 0.00 ? 279 THR A HG22 5  
ATOM 6062  H HG23 . THR A 1 77 ? 12.459  2.114   8.145  1.00 0.00 ? 279 THR A HG23 5  
ATOM 6063  N N    . LYS A 1 78 ? 11.055  0.717   5.389  1.00 0.00 ? 280 LYS A N    5  
ATOM 6064  C CA   . LYS A 1 78 ? 11.555  -0.355  4.537  1.00 0.00 ? 280 LYS A CA   5  
ATOM 6065  C C    . LYS A 1 78 ? 12.151  -1.481  5.375  1.00 0.00 ? 280 LYS A C    5  
ATOM 6066  O O    . LYS A 1 78 ? 12.950  -1.239  6.282  1.00 0.00 ? 280 LYS A O    5  
ATOM 6067  C CB   . LYS A 1 78 ? 12.600  0.186   3.559  1.00 0.00 ? 280 LYS A CB   5  
ATOM 6068  C CG   . LYS A 1 78 ? 12.244  -0.050  2.100  1.00 0.00 ? 280 LYS A CG   5  
ATOM 6069  C CD   . LYS A 1 78 ? 13.461  -0.454  1.285  1.00 0.00 ? 280 LYS A CD   5  
ATOM 6070  C CE   . LYS A 1 78 ? 13.605  -1.965  1.212  1.00 0.00 ? 280 LYS A CE   5  
ATOM 6071  N NZ   . LYS A 1 78 ? 14.538  -2.383  0.130  1.00 0.00 ? 280 LYS A NZ   5  
ATOM 6072  H H    . LYS A 1 78 ? 11.455  1.611   5.319  1.00 0.00 ? 280 LYS A H    5  
ATOM 6073  H HA   . LYS A 1 78 ? 10.719  -0.745  3.977  1.00 0.00 ? 280 LYS A HA   5  
ATOM 6074  H HB2  . LYS A 1 78 ? 12.704  1.250   3.714  1.00 0.00 ? 280 LYS A HB2  5  
ATOM 6075  H HB3  . LYS A 1 78 ? 13.548  -0.292  3.757  1.00 0.00 ? 280 LYS A HB3  5  
ATOM 6076  H HG2  . LYS A 1 78 ? 11.506  -0.836  2.043  1.00 0.00 ? 280 LYS A HG2  5  
ATOM 6077  H HG3  . LYS A 1 78 ? 11.832  0.861   1.688  1.00 0.00 ? 280 LYS A HG3  5  
ATOM 6078  H HD2  . LYS A 1 78 ? 13.357  -0.065  0.283  1.00 0.00 ? 280 LYS A HD2  5  
ATOM 6079  H HD3  . LYS A 1 78 ? 14.344  -0.039  1.746  1.00 0.00 ? 280 LYS A HD3  5  
ATOM 6080  H HE2  . LYS A 1 78 ? 13.982  -2.323  2.158  1.00 0.00 ? 280 LYS A HE2  5  
ATOM 6081  H HE3  . LYS A 1 78 ? 12.633  -2.398  1.025  1.00 0.00 ? 280 LYS A HE3  5  
ATOM 6082  H HZ1  . LYS A 1 78 ? 15.474  -1.955  0.281  1.00 0.00 ? 280 LYS A HZ1  5  
ATOM 6083  H HZ2  . LYS A 1 78 ? 14.173  -2.075  -0.794 1.00 0.00 ? 280 LYS A HZ2  5  
ATOM 6084  H HZ3  . LYS A 1 78 ? 14.639  -3.417  0.124  1.00 0.00 ? 280 LYS A HZ3  5  
ATOM 6085  N N    . ILE A 1 79 ? 11.757  -2.711  5.068  1.00 0.00 ? 281 ILE A N    5  
ATOM 6086  C CA   . ILE A 1 79 ? 12.249  -3.877  5.791  1.00 0.00 ? 281 ILE A CA   5  
ATOM 6087  C C    . ILE A 1 79 ? 13.411  -4.538  5.052  1.00 0.00 ? 281 ILE A C    5  
ATOM 6088  O O    . ILE A 1 79 ? 14.242  -5.213  5.659  1.00 0.00 ? 281 ILE A O    5  
ATOM 6089  C CB   . ILE A 1 79 ? 11.131  -4.915  6.012  1.00 0.00 ? 281 ILE A CB   5  
ATOM 6090  C CG1  . ILE A 1 79 ? 11.638  -6.071  6.877  1.00 0.00 ? 281 ILE A CG1  5  
ATOM 6091  C CG2  . ILE A 1 79 ? 10.611  -5.432  4.678  1.00 0.00 ? 281 ILE A CG2  5  
ATOM 6092  C CD1  . ILE A 1 79 ? 10.550  -7.036  7.295  1.00 0.00 ? 281 ILE A CD1  5  
ATOM 6093  H H    . ILE A 1 79 ? 11.118  -2.839  4.335  1.00 0.00 ? 281 ILE A H    5  
ATOM 6094  H HA   . ILE A 1 79 ? 12.598  -3.545  6.759  1.00 0.00 ? 281 ILE A HA   5  
ATOM 6095  H HB   . ILE A 1 79 ? 10.315  -4.427  6.521  1.00 0.00 ? 281 ILE A HB   5  
ATOM 6096  H HG12 . ILE A 1 79 ? 12.379  -6.629  6.323  1.00 0.00 ? 281 ILE A HG12 5  
ATOM 6097  H HG13 . ILE A 1 79 ? 12.090  -5.671  7.773  1.00 0.00 ? 281 ILE A HG13 5  
ATOM 6098  H HG21 . ILE A 1 79 ? 11.009  -6.419  4.493  1.00 0.00 ? 281 ILE A HG21 5  
ATOM 6099  H HG22 . ILE A 1 79 ? 9.532   -5.480  4.706  1.00 0.00 ? 281 ILE A HG22 5  
ATOM 6100  H HG23 . ILE A 1 79 ? 10.920  -4.766  3.887  1.00 0.00 ? 281 ILE A HG23 5  
ATOM 6101  H HD11 . ILE A 1 79 ? 9.592   -6.662  6.965  1.00 0.00 ? 281 ILE A HD11 5  
ATOM 6102  H HD12 . ILE A 1 79 ? 10.733  -8.003  6.849  1.00 0.00 ? 281 ILE A HD12 5  
ATOM 6103  H HD13 . ILE A 1 79 ? 10.547  -7.131  8.371  1.00 0.00 ? 281 ILE A HD13 5  
ATOM 6104  N N    . GLY A 1 80 ? 13.460  -4.340  3.736  1.00 0.00 ? 282 GLY A N    5  
ATOM 6105  C CA   . GLY A 1 80 ? 14.523  -4.926  2.937  1.00 0.00 ? 282 GLY A CA   5  
ATOM 6106  C C    . GLY A 1 80 ? 15.903  -4.576  3.456  1.00 0.00 ? 282 GLY A C    5  
ATOM 6107  O O    . GLY A 1 80 ? 16.204  -3.410  3.706  1.00 0.00 ? 282 GLY A O    5  
ATOM 6108  H H    . GLY A 1 80 ? 12.770  -3.794  3.305  1.00 0.00 ? 282 GLY A H    5  
ATOM 6109  H HA2  . GLY A 1 80 ? 14.413  -6.001  2.942  1.00 0.00 ? 282 GLY A HA2  5  
ATOM 6110  H HA3  . GLY A 1 80 ? 14.433  -4.569  1.922  1.00 0.00 ? 282 GLY A HA3  5  
ATOM 6111  N N    . PHE A 1 81 ? 16.740  -5.594  3.615  1.00 0.00 ? 283 PHE A N    5  
ATOM 6112  C CA   . PHE A 1 81 ? 18.098  -5.396  4.103  1.00 0.00 ? 283 PHE A CA   5  
ATOM 6113  C C    . PHE A 1 81 ? 18.937  -4.654  3.062  1.00 0.00 ? 283 PHE A C    5  
ATOM 6114  O O    . PHE A 1 81 ? 18.786  -4.875  1.860  1.00 0.00 ? 283 PHE A O    5  
ATOM 6115  C CB   . PHE A 1 81 ? 18.728  -6.752  4.442  1.00 0.00 ? 283 PHE A CB   5  
ATOM 6116  C CG   . PHE A 1 81 ? 20.213  -6.702  4.662  1.00 0.00 ? 283 PHE A CG   5  
ATOM 6117  C CD1  . PHE A 1 81 ? 21.079  -6.698  3.584  1.00 0.00 ? 283 PHE A CD1  5  
ATOM 6118  C CD2  . PHE A 1 81 ? 20.738  -6.665  5.943  1.00 0.00 ? 283 PHE A CD2  5  
ATOM 6119  C CE1  . PHE A 1 81 ? 22.448  -6.657  3.778  1.00 0.00 ? 283 PHE A CE1  5  
ATOM 6120  C CE2  . PHE A 1 81 ? 22.105  -6.623  6.144  1.00 0.00 ? 283 PHE A CE2  5  
ATOM 6121  C CZ   . PHE A 1 81 ? 22.961  -6.620  5.060  1.00 0.00 ? 283 PHE A CZ   5  
ATOM 6122  H H    . PHE A 1 81 ? 16.439  -6.500  3.397  1.00 0.00 ? 283 PHE A H    5  
ATOM 6123  H HA   . PHE A 1 81 ? 18.043  -4.798  5.000  1.00 0.00 ? 283 PHE A HA   5  
ATOM 6124  H HB2  . PHE A 1 81 ? 18.275  -7.134  5.344  1.00 0.00 ? 283 PHE A HB2  5  
ATOM 6125  H HB3  . PHE A 1 81 ? 18.534  -7.440  3.633  1.00 0.00 ? 283 PHE A HB3  5  
ATOM 6126  H HD1  . PHE A 1 81 ? 20.676  -6.724  2.582  1.00 0.00 ? 283 PHE A HD1  5  
ATOM 6127  H HD2  . PHE A 1 81 ? 20.070  -6.668  6.791  1.00 0.00 ? 283 PHE A HD2  5  
ATOM 6128  H HE1  . PHE A 1 81 ? 23.114  -6.656  2.928  1.00 0.00 ? 283 PHE A HE1  5  
ATOM 6129  H HE2  . PHE A 1 81 ? 22.504  -6.594  7.148  1.00 0.00 ? 283 PHE A HE2  5  
ATOM 6130  H HZ   . PHE A 1 81 ? 24.030  -6.589  5.214  1.00 0.00 ? 283 PHE A HZ   5  
ATOM 6131  N N    . GLY B 2 29 ? 8.752   3.469   17.698 1.00 0.00 ? 444 GLY B N    5  
ATOM 6132  C CA   . GLY B 2 29 ? 7.563   3.766   16.920 1.00 0.00 ? 444 GLY B CA   5  
ATOM 6133  C C    . GLY B 2 29 ? 6.768   4.922   17.496 1.00 0.00 ? 444 GLY B C    5  
ATOM 6134  O O    . GLY B 2 29 ? 6.589   5.018   18.709 1.00 0.00 ? 444 GLY B O    5  
ATOM 6135  H HA2  . GLY B 2 29 ? 7.858   4.014   15.912 1.00 0.00 ? 444 GLY B HA2  5  
ATOM 6136  H HA3  . GLY B 2 29 ? 6.934   2.889   16.896 1.00 0.00 ? 444 GLY B HA3  5  
ATOM 6137  N N    . GLU B 2 30 ? 6.293   5.803   16.622 1.00 0.00 ? 445 GLU B N    5  
ATOM 6138  C CA   . GLU B 2 30 ? 5.513   6.959   17.050 1.00 0.00 ? 445 GLU B CA   5  
ATOM 6139  C C    . GLU B 2 30 ? 4.116   6.538   17.494 1.00 0.00 ? 445 GLU B C    5  
ATOM 6140  O O    . GLU B 2 30 ? 3.152   6.662   16.740 1.00 0.00 ? 445 GLU B O    5  
ATOM 6141  C CB   . GLU B 2 30 ? 5.415   7.982   15.917 1.00 0.00 ? 445 GLU B CB   5  
ATOM 6142  C CG   . GLU B 2 30 ? 4.941   9.352   16.375 1.00 0.00 ? 445 GLU B CG   5  
ATOM 6143  C CD   . GLU B 2 30 ? 5.958   10.060  17.248 1.00 0.00 ? 445 GLU B CD   5  
ATOM 6144  O OE1  . GLU B 2 30 ? 6.194   9.595   18.382 1.00 0.00 ? 445 GLU B OE1  5  
ATOM 6145  O OE2  . GLU B 2 30 ? 6.519   11.081  16.798 1.00 0.00 ? 445 GLU B OE2  5  
ATOM 6146  H H    . GLU B 2 30 ? 6.469   5.674   15.667 1.00 0.00 ? 445 GLU B H    5  
ATOM 6147  H HA   . GLU B 2 30 ? 6.024   7.410   17.887 1.00 0.00 ? 445 GLU B HA   5  
ATOM 6148  H HB2  . GLU B 2 30 ? 6.389   8.095   15.465 1.00 0.00 ? 445 GLU B HB2  5  
ATOM 6149  H HB3  . GLU B 2 30 ? 4.723   7.615   15.174 1.00 0.00 ? 445 GLU B HB3  5  
ATOM 6150  H HG2  . GLU B 2 30 ? 4.750   9.963   15.505 1.00 0.00 ? 445 GLU B HG2  5  
ATOM 6151  H HG3  . GLU B 2 30 ? 4.026   9.233   16.936 1.00 0.00 ? 445 GLU B HG3  5  
ATOM 6152  N N    . GLU B 2 31 ? 4.015   6.043   18.722 1.00 0.00 ? 446 GLU B N    5  
ATOM 6153  C CA   . GLU B 2 31 ? 2.736   5.604   19.269 1.00 0.00 ? 446 GLU B CA   5  
ATOM 6154  C C    . GLU B 2 31 ? 2.154   4.461   18.443 1.00 0.00 ? 446 GLU B C    5  
ATOM 6155  O O    . GLU B 2 31 ? 2.772   3.996   17.484 1.00 0.00 ? 446 GLU B O    5  
ATOM 6156  C CB   . GLU B 2 31 ? 1.748   6.772   19.312 1.00 0.00 ? 446 GLU B CB   5  
ATOM 6157  C CG   . GLU B 2 31 ? 1.801   7.566   20.607 1.00 0.00 ? 446 GLU B CG   5  
ATOM 6158  C CD   . GLU B 2 31 ? 2.313   8.978   20.406 1.00 0.00 ? 446 GLU B CD   5  
ATOM 6159  O OE1  . GLU B 2 31 ? 3.374   9.141   19.768 1.00 0.00 ? 446 GLU B OE1  5  
ATOM 6160  O OE2  . GLU B 2 31 ? 1.652   9.923   20.887 1.00 0.00 ? 446 GLU B OE2  5  
ATOM 6161  H H    . GLU B 2 31 ? 4.822   5.969   19.276 1.00 0.00 ? 446 GLU B H    5  
ATOM 6162  H HA   . GLU B 2 31 ? 2.909   5.253   20.274 1.00 0.00 ? 446 GLU B HA   5  
ATOM 6163  H HB2  . GLU B 2 31 ? 1.965   7.441   18.493 1.00 0.00 ? 446 GLU B HB2  5  
ATOM 6164  H HB3  . GLU B 2 31 ? 0.746   6.384   19.192 1.00 0.00 ? 446 GLU B HB3  5  
ATOM 6165  H HG2  . GLU B 2 31 ? 0.806   7.615   21.023 1.00 0.00 ? 446 GLU B HG2  5  
ATOM 6166  H HG3  . GLU B 2 31 ? 2.455   7.057   21.299 1.00 0.00 ? 446 GLU B HG3  5  
ATOM 6167  N N    . GLU B 2 32 ? 0.964   4.013   18.822 1.00 0.00 ? 447 GLU B N    5  
ATOM 6168  C CA   . GLU B 2 32 ? 0.294   2.925   18.119 1.00 0.00 ? 447 GLU B CA   5  
ATOM 6169  C C    . GLU B 2 32 ? -1.164  3.274   17.842 1.00 0.00 ? 447 GLU B C    5  
ATOM 6170  O O    . GLU B 2 32 ? -1.720  4.186   18.453 1.00 0.00 ? 447 GLU B O    5  
ATOM 6171  C CB   . GLU B 2 32 ? 0.377   1.632   18.933 1.00 0.00 ? 447 GLU B CB   5  
ATOM 6172  C CG   . GLU B 2 32 ? 1.741   1.391   19.559 1.00 0.00 ? 447 GLU B CG   5  
ATOM 6173  C CD   . GLU B 2 32 ? 1.769   1.709   21.041 1.00 0.00 ? 447 GLU B CD   5  
ATOM 6174  O OE1  . GLU B 2 32 ? 0.714   1.571   21.697 1.00 0.00 ? 447 GLU B OE1  5  
ATOM 6175  O OE2  . GLU B 2 32 ? 2.842   2.098   21.546 1.00 0.00 ? 447 GLU B OE2  5  
ATOM 6176  H H    . GLU B 2 32 ? 0.521   4.425   19.594 1.00 0.00 ? 447 GLU B H    5  
ATOM 6177  H HA   . GLU B 2 32 ? 0.802   2.778   17.177 1.00 0.00 ? 447 GLU B HA   5  
ATOM 6178  H HB2  . GLU B 2 32 ? -0.356  1.672   19.726 1.00 0.00 ? 447 GLU B HB2  5  
ATOM 6179  H HB3  . GLU B 2 32 ? 0.150   0.798   18.287 1.00 0.00 ? 447 GLU B HB3  5  
ATOM 6180  H HG2  . GLU B 2 32 ? 2.006   0.353   19.425 1.00 0.00 ? 447 GLU B HG2  5  
ATOM 6181  H HG3  . GLU B 2 32 ? 2.468   2.015   19.058 1.00 0.00 ? 447 GLU B HG3  5  
ATOM 6182  N N    . GLY B 2 33 ? -1.777  2.543   16.918 1.00 0.00 ? 448 GLY B N    5  
ATOM 6183  C CA   . GLY B 2 33 ? -3.166  2.792   16.577 1.00 0.00 ? 448 GLY B CA   5  
ATOM 6184  C C    . GLY B 2 33 ? -3.317  3.772   15.428 1.00 0.00 ? 448 GLY B C    5  
ATOM 6185  O O    . GLY B 2 33 ? -4.364  4.403   15.277 1.00 0.00 ? 448 GLY B O    5  
ATOM 6186  H H    . GLY B 2 33 ? -1.286  1.826   16.464 1.00 0.00 ? 448 GLY B H    5  
ATOM 6187  H HA2  . GLY B 2 33 ? -3.630  1.857   16.300 1.00 0.00 ? 448 GLY B HA2  5  
ATOM 6188  H HA3  . GLY B 2 33 ? -3.671  3.190   17.443 1.00 0.00 ? 448 GLY B HA3  5  
ATOM 6189  N N    . GLU B 2 34 ? -2.270  3.901   14.620 1.00 0.00 ? 449 GLU B N    5  
ATOM 6190  C CA   . GLU B 2 34 ? -2.294  4.811   13.480 1.00 0.00 ? 449 GLU B CA   5  
ATOM 6191  C C    . GLU B 2 34 ? -2.423  4.043   12.173 1.00 0.00 ? 449 GLU B C    5  
ATOM 6192  O O    . GLU B 2 34 ? -1.981  4.512   11.128 1.00 0.00 ? 449 GLU B O    5  
ATOM 6193  C CB   . GLU B 2 34 ? -1.019  5.658   13.438 1.00 0.00 ? 449 GLU B CB   5  
ATOM 6194  C CG   . GLU B 2 34 ? -0.473  6.020   14.811 1.00 0.00 ? 449 GLU B CG   5  
ATOM 6195  C CD   . GLU B 2 34 ? 0.141   7.406   14.847 1.00 0.00 ? 449 GLU B CD   5  
ATOM 6196  O OE1  . GLU B 2 34 ? 0.665   7.849   13.804 1.00 0.00 ? 449 GLU B OE1  5  
ATOM 6197  O OE2  . GLU B 2 34 ? 0.098   8.047   15.917 1.00 0.00 ? 449 GLU B OE2  5  
ATOM 6198  H H    . GLU B 2 34 ? -1.463  3.371   14.793 1.00 0.00 ? 449 GLU B H    5  
ATOM 6199  H HA   . GLU B 2 34 ? -3.147  5.464   13.589 1.00 0.00 ? 449 GLU B HA   5  
ATOM 6200  H HB2  . GLU B 2 34 ? -0.257  5.107   12.902 1.00 0.00 ? 449 GLU B HB2  5  
ATOM 6201  H HB3  . GLU B 2 34 ? -1.229  6.574   12.905 1.00 0.00 ? 449 GLU B HB3  5  
ATOM 6202  H HG2  . GLU B 2 34 ? -1.281  5.982   15.526 1.00 0.00 ? 449 GLU B HG2  5  
ATOM 6203  H HG3  . GLU B 2 34 ? 0.283   5.298   15.085 1.00 0.00 ? 449 GLU B HG3  5  
ATOM 6204  N N    . GLU B 2 35 ? -3.020  2.860   12.232 1.00 0.00 ? 450 GLU B N    5  
ATOM 6205  C CA   . GLU B 2 35 ? -3.186  2.047   11.037 1.00 0.00 ? 450 GLU B CA   5  
ATOM 6206  C C    . GLU B 2 35 ? -4.532  1.329   11.037 1.00 0.00 ? 450 GLU B C    5  
ATOM 6207  O O    . GLU B 2 35 ? -5.093  1.037   12.093 1.00 0.00 ? 450 GLU B O    5  
ATOM 6208  C CB   . GLU B 2 35 ? -2.037  1.041   10.920 1.00 0.00 ? 450 GLU B CB   5  
ATOM 6209  C CG   . GLU B 2 35 ? -2.128  -0.115  11.906 1.00 0.00 ? 450 GLU B CG   5  
ATOM 6210  C CD   . GLU B 2 35 ? -0.926  -0.189  12.829 1.00 0.00 ? 450 GLU B CD   5  
ATOM 6211  O OE1  . GLU B 2 35 ? -0.806  0.679   13.719 1.00 0.00 ? 450 GLU B OE1  5  
ATOM 6212  O OE2  . GLU B 2 35 ? -0.106  -1.116  12.662 1.00 0.00 ? 450 GLU B OE2  5  
ATOM 6213  H H    . GLU B 2 35 ? -3.351  2.527   13.091 1.00 0.00 ? 450 GLU B H    5  
ATOM 6214  H HA   . GLU B 2 35 ? -3.150  2.710   10.189 1.00 0.00 ? 450 GLU B HA   5  
ATOM 6215  H HB2  . GLU B 2 35 ? -2.034  0.634   9.920  1.00 0.00 ? 450 GLU B HB2  5  
ATOM 6216  H HB3  . GLU B 2 35 ? -1.105  1.560   11.089 1.00 0.00 ? 450 GLU B HB3  5  
ATOM 6217  H HG2  . GLU B 2 35 ? -3.016  0.010   12.507 1.00 0.00 ? 450 GLU B HG2  5  
ATOM 6218  H HG3  . GLU B 2 35 ? -2.195  -1.038  11.352 1.00 0.00 ? 450 GLU B HG3  5  
ATOM 6219  N N    . TYR B 2 36 ? -5.044  1.052   9.842  1.00 0.00 ? 451 TYR B N    5  
ATOM 6220  C CA   . TYR B 2 36 ? -6.326  0.374   9.695  1.00 0.00 ? 451 TYR B CA   5  
ATOM 6221  C C    . TYR B 2 36 ? -6.233  -0.748  8.668  1.00 0.00 ? 451 TYR B C    5  
ATOM 6222  O O    . TYR B 2 36 ? -5.100  -1.129  8.307  1.00 0.00 ? 451 TYR B O    5  
ATOM 6223  C CB   . TYR B 2 36 ? -7.406  1.374   9.278  1.00 0.00 ? 451 TYR B CB   5  
ATOM 6224  C CG   . TYR B 2 36 ? -7.957  2.184   10.430 1.00 0.00 ? 451 TYR B CG   5  
ATOM 6225  C CD1  . TYR B 2 36 ? -7.297  3.320   10.884 1.00 0.00 ? 451 TYR B CD1  5  
ATOM 6226  C CD2  . TYR B 2 36 ? -9.136  1.814   11.063 1.00 0.00 ? 451 TYR B CD2  5  
ATOM 6227  C CE1  . TYR B 2 36 ? -7.796  4.062   11.937 1.00 0.00 ? 451 TYR B CE1  5  
ATOM 6228  C CE2  . TYR B 2 36 ? -9.643  2.552   12.117 1.00 0.00 ? 451 TYR B CE2  5  
ATOM 6229  C CZ   . TYR B 2 36 ? -8.970  3.675   12.549 1.00 0.00 ? 451 TYR B CZ   5  
ATOM 6230  O OH   . TYR B 2 36 ? -9.471  4.412   13.597 1.00 0.00 ? 451 TYR B OH   5  
ATOM 6231  O OXT  . TYR B 2 36 ? -7.296  -1.237  8.231  1.00 0.00 ? 451 TYR B OXT  5  
ATOM 6232  H H    . TYR B 2 36 ? -4.547  1.315   9.040  1.00 0.00 ? 451 TYR B H    5  
ATOM 6233  H HA   . TYR B 2 36 ? -6.589  -0.049  10.652 1.00 0.00 ? 451 TYR B HA   5  
ATOM 6234  H HB2  . TYR B 2 36 ? -6.989  2.061   8.558  1.00 0.00 ? 451 TYR B HB2  5  
ATOM 6235  H HB3  . TYR B 2 36 ? -8.226  0.839   8.823  1.00 0.00 ? 451 TYR B HB3  5  
ATOM 6236  H HD1  . TYR B 2 36 ? -6.379  3.621   10.401 1.00 0.00 ? 451 TYR B HD1  5  
ATOM 6237  H HD2  . TYR B 2 36 ? -9.661  0.934   10.722 1.00 0.00 ? 451 TYR B HD2  5  
ATOM 6238  H HE1  . TYR B 2 36 ? -7.269  4.942   12.275 1.00 0.00 ? 451 TYR B HE1  5  
ATOM 6239  H HE2  . TYR B 2 36 ? -10.561 2.247   12.597 1.00 0.00 ? 451 TYR B HE2  5  
ATOM 6240  H HH   . TYR B 2 36 ? -10.427 4.462   13.525 1.00 0.00 ? 451 TYR B HH   5  
ATOM 6241  N N    . ARG A 1 8  ? 12.349  10.162  3.844  1.00 0.00 ? 210 ARG A N    6  
ATOM 6242  C CA   . ARG A 1 8  ? 11.862  8.795   3.991  1.00 0.00 ? 210 ARG A CA   6  
ATOM 6243  C C    . ARG A 1 8  ? 10.667  8.542   3.075  1.00 0.00 ? 210 ARG A C    6  
ATOM 6244  O O    . ARG A 1 8  ? 9.532   8.425   3.537  1.00 0.00 ? 210 ARG A O    6  
ATOM 6245  C CB   . ARG A 1 8  ? 11.478  8.524   5.446  1.00 0.00 ? 210 ARG A CB   6  
ATOM 6246  C CG   . ARG A 1 8  ? 10.926  7.127   5.684  1.00 0.00 ? 210 ARG A CG   6  
ATOM 6247  C CD   . ARG A 1 8  ? 11.346  6.583   7.041  1.00 0.00 ? 210 ARG A CD   6  
ATOM 6248  N NE   . ARG A 1 8  ? 10.314  6.779   8.056  1.00 0.00 ? 210 ARG A NE   6  
ATOM 6249  C CZ   . ARG A 1 8  ? 10.175  7.893   8.772  1.00 0.00 ? 210 ARG A CZ   6  
ATOM 6250  N NH1  . ARG A 1 8  ? 10.996  8.920   8.588  1.00 0.00 ? 210 ARG A NH1  6  
ATOM 6251  N NH2  . ARG A 1 8  ? 9.209   7.983   9.678  1.00 0.00 ? 210 ARG A NH2  6  
ATOM 6252  H HA   . ARG A 1 8  ? 12.663  8.127   3.709  1.00 0.00 ? 210 ARG A HA   6  
ATOM 6253  H HB2  . ARG A 1 8  ? 12.354  8.650   6.066  1.00 0.00 ? 210 ARG A HB2  6  
ATOM 6254  H HB3  . ARG A 1 8  ? 10.729  9.241   5.748  1.00 0.00 ? 210 ARG A HB3  6  
ATOM 6255  H HG2  . ARG A 1 8  ? 9.848   7.166   5.642  1.00 0.00 ? 210 ARG A HG2  6  
ATOM 6256  H HG3  . ARG A 1 8  ? 11.295  6.469   4.913  1.00 0.00 ? 210 ARG A HG3  6  
ATOM 6257  H HD2  . ARG A 1 8  ? 11.545  5.527   6.944  1.00 0.00 ? 210 ARG A HD2  6  
ATOM 6258  H HD3  . ARG A 1 8  ? 12.248  7.090   7.354  1.00 0.00 ? 210 ARG A HD3  6  
ATOM 6259  H HE   . ARG A 1 8  ? 9.691   6.040   8.214  1.00 0.00 ? 210 ARG A HE   6  
ATOM 6260  H HH11 . ARG A 1 8  ? 11.726  8.863   7.908  1.00 0.00 ? 210 ARG A HH11 6  
ATOM 6261  H HH12 . ARG A 1 8  ? 10.884  9.752   9.130  1.00 0.00 ? 210 ARG A HH12 6  
ATOM 6262  H HH21 . ARG A 1 8  ? 8.586   7.214   9.819  1.00 0.00 ? 210 ARG A HH21 6  
ATOM 6263  H HH22 . ARG A 1 8  ? 9.104   8.818   10.215 1.00 0.00 ? 210 ARG A HH22 6  
ATOM 6264  N N    . GLU A 1 9  ? 10.933  8.461   1.776  1.00 0.00 ? 211 GLU A N    6  
ATOM 6265  C CA   . GLU A 1 9  ? 9.881   8.223   0.793  1.00 0.00 ? 211 GLU A CA   6  
ATOM 6266  C C    . GLU A 1 9  ? 9.737   6.730   0.504  1.00 0.00 ? 211 GLU A C    6  
ATOM 6267  O O    . GLU A 1 9  ? 10.720  5.991   0.508  1.00 0.00 ? 211 GLU A O    6  
ATOM 6268  C CB   . GLU A 1 9  ? 10.184  8.978   -0.503 1.00 0.00 ? 211 GLU A CB   6  
ATOM 6269  C CG   . GLU A 1 9  ? 8.964   9.183   -1.386 1.00 0.00 ? 211 GLU A CG   6  
ATOM 6270  C CD   . GLU A 1 9  ? 8.506   10.629  -1.423 1.00 0.00 ? 211 GLU A CD   6  
ATOM 6271  O OE1  . GLU A 1 9  ? 8.019   11.123  -0.384 1.00 0.00 ? 211 GLU A OE1  6  
ATOM 6272  O OE2  . GLU A 1 9  ? 8.633   11.265  -2.490 1.00 0.00 ? 211 GLU A OE2  6  
ATOM 6273  H H    . GLU A 1 9  ? 11.858  8.563   1.469  1.00 0.00 ? 211 GLU A H    6  
ATOM 6274  H HA   . GLU A 1 9  ? 8.954   8.588   1.206  1.00 0.00 ? 211 GLU A HA   6  
ATOM 6275  H HB2  . GLU A 1 9  ? 10.589  9.947   -0.254 1.00 0.00 ? 211 GLU A HB2  6  
ATOM 6276  H HB3  . GLU A 1 9  ? 10.921  8.422   -1.066 1.00 0.00 ? 211 GLU A HB3  6  
ATOM 6277  H HG2  . GLU A 1 9  ? 9.207   8.875   -2.392 1.00 0.00 ? 211 GLU A HG2  6  
ATOM 6278  H HG3  . GLU A 1 9  ? 8.155   8.574   -1.010 1.00 0.00 ? 211 GLU A HG3  6  
ATOM 6279  N N    . LEU A 1 10 ? 8.505   6.296   0.258  1.00 0.00 ? 212 LEU A N    6  
ATOM 6280  C CA   . LEU A 1 10 ? 8.235   4.893   -0.030 1.00 0.00 ? 212 LEU A CA   6  
ATOM 6281  C C    . LEU A 1 10 ? 7.719   4.716   -1.455 1.00 0.00 ? 212 LEU A C    6  
ATOM 6282  O O    . LEU A 1 10 ? 7.080   5.610   -2.010 1.00 0.00 ? 212 LEU A O    6  
ATOM 6283  C CB   . LEU A 1 10 ? 7.214   4.334   0.964  1.00 0.00 ? 212 LEU A CB   6  
ATOM 6284  C CG   . LEU A 1 10 ? 7.733   4.160   2.393  1.00 0.00 ? 212 LEU A CG   6  
ATOM 6285  C CD1  . LEU A 1 10 ? 6.603   3.740   3.322  1.00 0.00 ? 212 LEU A CD1  6  
ATOM 6286  C CD2  . LEU A 1 10 ? 8.867   3.144   2.432  1.00 0.00 ? 212 LEU A CD2  6  
ATOM 6287  H H    . LEU A 1 10 ? 7.761   6.934   0.271  1.00 0.00 ? 212 LEU A H    6  
ATOM 6288  H HA   . LEU A 1 10 ? 9.160   4.348   0.075  1.00 0.00 ? 212 LEU A HA   6  
ATOM 6289  H HB2  . LEU A 1 10 ? 6.366   5.001   0.989  1.00 0.00 ? 212 LEU A HB2  6  
ATOM 6290  H HB3  . LEU A 1 10 ? 6.883   3.371   0.606  1.00 0.00 ? 212 LEU A HB3  6  
ATOM 6291  H HG   . LEU A 1 10 ? 8.118   5.107   2.746  1.00 0.00 ? 212 LEU A HG   6  
ATOM 6292  H HD11 . LEU A 1 10 ? 6.998   3.117   4.110  1.00 0.00 ? 212 LEU A HD11 6  
ATOM 6293  H HD12 . LEU A 1 10 ? 6.146   4.618   3.752  1.00 0.00 ? 212 LEU A HD12 6  
ATOM 6294  H HD13 . LEU A 1 10 ? 5.864   3.188   2.761  1.00 0.00 ? 212 LEU A HD13 6  
ATOM 6295  H HD21 . LEU A 1 10 ? 9.721   3.577   2.933  1.00 0.00 ? 212 LEU A HD21 6  
ATOM 6296  H HD22 . LEU A 1 10 ? 8.545   2.264   2.968  1.00 0.00 ? 212 LEU A HD22 6  
ATOM 6297  H HD23 . LEU A 1 10 ? 9.143   2.871   1.423  1.00 0.00 ? 212 LEU A HD23 6  
ATOM 6298  N N    . LYS A 1 11 ? 8.002   3.557   -2.041 1.00 0.00 ? 213 LYS A N    6  
ATOM 6299  C CA   . LYS A 1 11 ? 7.566   3.259   -3.399 1.00 0.00 ? 213 LYS A CA   6  
ATOM 6300  C C    . LYS A 1 11 ? 6.728   1.985   -3.432 1.00 0.00 ? 213 LYS A C    6  
ATOM 6301  O O    . LYS A 1 11 ? 6.972   1.052   -2.668 1.00 0.00 ? 213 LYS A O    6  
ATOM 6302  C CB   . LYS A 1 11 ? 8.776   3.112   -4.324 1.00 0.00 ? 213 LYS A CB   6  
ATOM 6303  C CG   . LYS A 1 11 ? 9.817   4.203   -4.143 1.00 0.00 ? 213 LYS A CG   6  
ATOM 6304  C CD   . LYS A 1 11 ? 10.684  3.952   -2.918 1.00 0.00 ? 213 LYS A CD   6  
ATOM 6305  C CE   . LYS A 1 11 ? 12.136  3.710   -3.299 1.00 0.00 ? 213 LYS A CE   6  
ATOM 6306  N NZ   . LYS A 1 11 ? 12.737  4.891   -3.977 1.00 0.00 ? 213 LYS A NZ   6  
ATOM 6307  H H    . LYS A 1 11 ? 8.513   2.884   -1.545 1.00 0.00 ? 213 LYS A H    6  
ATOM 6308  H HA   . LYS A 1 11 ? 6.959   4.084   -3.743 1.00 0.00 ? 213 LYS A HA   6  
ATOM 6309  H HB2  . LYS A 1 11 ? 9.247   2.158   -4.133 1.00 0.00 ? 213 LYS A HB2  6  
ATOM 6310  H HB3  . LYS A 1 11 ? 8.435   3.135   -5.350 1.00 0.00 ? 213 LYS A HB3  6  
ATOM 6311  H HG2  . LYS A 1 11 ? 10.448  4.234   -5.018 1.00 0.00 ? 213 LYS A HG2  6  
ATOM 6312  H HG3  . LYS A 1 11 ? 9.314   5.152   -4.028 1.00 0.00 ? 213 LYS A HG3  6  
ATOM 6313  H HD2  . LYS A 1 11 ? 10.633  4.815   -2.270 1.00 0.00 ? 213 LYS A HD2  6  
ATOM 6314  H HD3  . LYS A 1 11 ? 10.309  3.085   -2.394 1.00 0.00 ? 213 LYS A HD3  6  
ATOM 6315  H HE2  . LYS A 1 11 ? 12.698  3.495   -2.403 1.00 0.00 ? 213 LYS A HE2  6  
ATOM 6316  H HE3  . LYS A 1 11 ? 12.182  2.861   -3.964 1.00 0.00 ? 213 LYS A HE3  6  
ATOM 6317  H HZ1  . LYS A 1 11 ? 13.775  4.824   -3.958 1.00 0.00 ? 213 LYS A HZ1  6  
ATOM 6318  H HZ2  . LYS A 1 11 ? 12.448  5.767   -3.493 1.00 0.00 ? 213 LYS A HZ2  6  
ATOM 6319  H HZ3  . LYS A 1 11 ? 12.422  4.936   -4.966 1.00 0.00 ? 213 LYS A HZ3  6  
ATOM 6320  N N    . ILE A 1 12 ? 5.742   1.952   -4.323 1.00 0.00 ? 214 ILE A N    6  
ATOM 6321  C CA   . ILE A 1 12 ? 4.870   0.790   -4.451 1.00 0.00 ? 214 ILE A CA   6  
ATOM 6322  C C    . ILE A 1 12 ? 5.664   -0.446  -4.857 1.00 0.00 ? 214 ILE A C    6  
ATOM 6323  O O    . ILE A 1 12 ? 6.644   -0.353  -5.596 1.00 0.00 ? 214 ILE A O    6  
ATOM 6324  C CB   . ILE A 1 12 ? 3.752   1.039   -5.484 1.00 0.00 ? 214 ILE A CB   6  
ATOM 6325  C CG1  . ILE A 1 12 ? 2.981   2.313   -5.131 1.00 0.00 ? 214 ILE A CG1  6  
ATOM 6326  C CG2  . ILE A 1 12 ? 2.811   -0.156  -5.548 1.00 0.00 ? 214 ILE A CG2  6  
ATOM 6327  C CD1  . ILE A 1 12 ? 1.873   2.639   -6.107 1.00 0.00 ? 214 ILE A CD1  6  
ATOM 6328  H H    . ILE A 1 12 ? 5.597   2.727   -4.905 1.00 0.00 ? 214 ILE A H    6  
ATOM 6329  H HA   . ILE A 1 12 ? 4.411   0.610   -3.490 1.00 0.00 ? 214 ILE A HA   6  
ATOM 6330  H HB   . ILE A 1 12 ? 4.208   1.160   -6.453 1.00 0.00 ? 214 ILE A HB   6  
ATOM 6331  H HG12 . ILE A 1 12 ? 2.536   2.197   -4.154 1.00 0.00 ? 214 ILE A HG12 6  
ATOM 6332  H HG13 . ILE A 1 12 ? 3.665   3.148   -5.112 1.00 0.00 ? 214 ILE A HG13 6  
ATOM 6333  H HG21 . ILE A 1 12 ? 1.821   0.178   -5.824 1.00 0.00 ? 214 ILE A HG21 6  
ATOM 6334  H HG22 . ILE A 1 12 ? 3.172   -0.858  -6.285 1.00 0.00 ? 214 ILE A HG22 6  
ATOM 6335  H HG23 . ILE A 1 12 ? 2.772   -0.636  -4.581 1.00 0.00 ? 214 ILE A HG23 6  
ATOM 6336  H HD11 . ILE A 1 12 ? 1.976   2.023   -6.988 1.00 0.00 ? 214 ILE A HD11 6  
ATOM 6337  H HD12 . ILE A 1 12 ? 0.917   2.448   -5.644 1.00 0.00 ? 214 ILE A HD12 6  
ATOM 6338  H HD13 . ILE A 1 12 ? 1.935   3.681   -6.388 1.00 0.00 ? 214 ILE A HD13 6  
ATOM 6339  N N    . GLY A 1 13 ? 5.235   -1.605  -4.367 1.00 0.00 ? 215 GLY A N    6  
ATOM 6340  C CA   . GLY A 1 13 ? 5.918   -2.845  -4.686 1.00 0.00 ? 215 GLY A CA   6  
ATOM 6341  C C    . GLY A 1 13 ? 7.151   -3.073  -3.828 1.00 0.00 ? 215 GLY A C    6  
ATOM 6342  O O    . GLY A 1 13 ? 7.835   -4.085  -3.975 1.00 0.00 ? 215 GLY A O    6  
ATOM 6343  H H    . GLY A 1 13 ? 4.451   -1.617  -3.781 1.00 0.00 ? 215 GLY A H    6  
ATOM 6344  H HA2  . GLY A 1 13 ? 5.234   -3.668  -4.536 1.00 0.00 ? 215 GLY A HA2  6  
ATOM 6345  H HA3  . GLY A 1 13 ? 6.215   -2.822  -5.724 1.00 0.00 ? 215 GLY A HA3  6  
ATOM 6346  N N    . ASP A 1 14 ? 7.439   -2.131  -2.935 1.00 0.00 ? 216 ASP A N    6  
ATOM 6347  C CA   . ASP A 1 14 ? 8.599   -2.239  -2.059 1.00 0.00 ? 216 ASP A CA   6  
ATOM 6348  C C    . ASP A 1 14 ? 8.218   -2.862  -0.720 1.00 0.00 ? 216 ASP A C    6  
ATOM 6349  O O    . ASP A 1 14 ? 7.124   -2.632  -0.205 1.00 0.00 ? 216 ASP A O    6  
ATOM 6350  C CB   . ASP A 1 14 ? 9.225   -0.860  -1.832 1.00 0.00 ? 216 ASP A CB   6  
ATOM 6351  C CG   . ASP A 1 14 ? 9.655   -0.200  -3.127 1.00 0.00 ? 216 ASP A CG   6  
ATOM 6352  O OD1  . ASP A 1 14 ? 9.078   -0.530  -4.184 1.00 0.00 ? 216 ASP A OD1  6  
ATOM 6353  O OD2  . ASP A 1 14 ? 10.571  0.649   -3.084 1.00 0.00 ? 216 ASP A OD2  6  
ATOM 6354  H H    . ASP A 1 14 ? 6.861   -1.344  -2.862 1.00 0.00 ? 216 ASP A H    6  
ATOM 6355  H HA   . ASP A 1 14 ? 9.322   -2.874  -2.544 1.00 0.00 ? 216 ASP A HA   6  
ATOM 6356  H HB2  . ASP A 1 14 ? 8.503   -0.221  -1.347 1.00 0.00 ? 216 ASP A HB2  6  
ATOM 6357  H HB3  . ASP A 1 14 ? 10.091  -0.966  -1.197 1.00 0.00 ? 216 ASP A HB3  6  
ATOM 6358  N N    . ARG A 1 15 ? 9.130   -3.650  -0.159 1.00 0.00 ? 217 ARG A N    6  
ATOM 6359  C CA   . ARG A 1 15 ? 8.893   -4.300  1.123  1.00 0.00 ? 217 ARG A CA   6  
ATOM 6360  C C    . ARG A 1 15 ? 9.054   -3.303  2.263  1.00 0.00 ? 217 ARG A C    6  
ATOM 6361  O O    . ARG A 1 15 ? 10.018  -2.538  2.299  1.00 0.00 ? 217 ARG A O    6  
ATOM 6362  C CB   . ARG A 1 15 ? 9.853   -5.475  1.315  1.00 0.00 ? 217 ARG A CB   6  
ATOM 6363  C CG   . ARG A 1 15 ? 9.243   -6.646  2.067  1.00 0.00 ? 217 ARG A CG   6  
ATOM 6364  C CD   . ARG A 1 15 ? 8.285   -7.435  1.188  1.00 0.00 ? 217 ARG A CD   6  
ATOM 6365  N NE   . ARG A 1 15 ? 8.908   -8.634  0.635  1.00 0.00 ? 217 ARG A NE   6  
ATOM 6366  C CZ   . ARG A 1 15 ? 9.043   -9.776  1.304  1.00 0.00 ? 217 ARG A CZ   6  
ATOM 6367  N NH1  . ARG A 1 15 ? 8.606   -9.878  2.554  1.00 0.00 ? 217 ARG A NH1  6  
ATOM 6368  N NH2  . ARG A 1 15 ? 9.619   -10.819 0.723  1.00 0.00 ? 217 ARG A NH2  6  
ATOM 6369  H H    . ARG A 1 15 ? 9.985   -3.792  -0.615 1.00 0.00 ? 217 ARG A H    6  
ATOM 6370  H HA   . ARG A 1 15 ? 7.877   -4.670  1.126  1.00 0.00 ? 217 ARG A HA   6  
ATOM 6371  H HB2  . ARG A 1 15 ? 10.172  -5.826  0.344  1.00 0.00 ? 217 ARG A HB2  6  
ATOM 6372  H HB3  . ARG A 1 15 ? 10.718  -5.133  1.863  1.00 0.00 ? 217 ARG A HB3  6  
ATOM 6373  H HG2  . ARG A 1 15 ? 10.034  -7.302  2.397  1.00 0.00 ? 217 ARG A HG2  6  
ATOM 6374  H HG3  . ARG A 1 15 ? 8.703   -6.269  2.923  1.00 0.00 ? 217 ARG A HG3  6  
ATOM 6375  H HD2  . ARG A 1 15 ? 7.429   -7.725  1.781  1.00 0.00 ? 217 ARG A HD2  6  
ATOM 6376  H HD3  . ARG A 1 15 ? 7.958   -6.801  0.376  1.00 0.00 ? 217 ARG A HD3  6  
ATOM 6377  H HE   . ARG A 1 15 ? 9.243   -8.586  -0.284 1.00 0.00 ? 217 ARG A HE   6  
ATOM 6378  H HH11 . ARG A 1 15 ? 8.171   -9.095  2.998  1.00 0.00 ? 217 ARG A HH11 6  
ATOM 6379  H HH12 . ARG A 1 15 ? 8.711   -10.739 3.051  1.00 0.00 ? 217 ARG A HH12 6  
ATOM 6380  H HH21 . ARG A 1 15 ? 9.952   -10.749 -0.217 1.00 0.00 ? 217 ARG A HH21 6  
ATOM 6381  H HH22 . ARG A 1 15 ? 9.721   -11.679 1.227  1.00 0.00 ? 217 ARG A HH22 6  
ATOM 6382  N N    . VAL A 1 16 ? 8.102   -3.306  3.187  1.00 0.00 ? 218 VAL A N    6  
ATOM 6383  C CA   . VAL A 1 16 ? 8.138   -2.390  4.318  1.00 0.00 ? 218 VAL A CA   6  
ATOM 6384  C C    . VAL A 1 16 ? 7.402   -2.960  5.524  1.00 0.00 ? 218 VAL A C    6  
ATOM 6385  O O    . VAL A 1 16 ? 6.913   -4.091  5.491  1.00 0.00 ? 218 VAL A O    6  
ATOM 6386  C CB   . VAL A 1 16 ? 7.508   -1.032  3.952  1.00 0.00 ? 218 VAL A CB   6  
ATOM 6387  C CG1  . VAL A 1 16 ? 8.125   -0.483  2.673  1.00 0.00 ? 218 VAL A CG1  6  
ATOM 6388  C CG2  . VAL A 1 16 ? 5.996   -1.164  3.810  1.00 0.00 ? 218 VAL A CG2  6  
ATOM 6389  H H    . VAL A 1 16 ? 7.353   -3.933  3.101  1.00 0.00 ? 218 VAL A H    6  
ATOM 6390  H HA   . VAL A 1 16 ? 9.172   -2.224  4.583  1.00 0.00 ? 218 VAL A HA   6  
ATOM 6391  H HB   . VAL A 1 16 ? 7.713   -0.336  4.752  1.00 0.00 ? 218 VAL A HB   6  
ATOM 6392  H HG11 . VAL A 1 16 ? 7.875   -1.131  1.847  1.00 0.00 ? 218 VAL A HG11 6  
ATOM 6393  H HG12 . VAL A 1 16 ? 7.739   0.508   2.485  1.00 0.00 ? 218 VAL A HG12 6  
ATOM 6394  H HG13 . VAL A 1 16 ? 9.198   -0.435  2.784  1.00 0.00 ? 218 VAL A HG13 6  
ATOM 6395  H HG21 . VAL A 1 16 ? 5.761   -2.048  3.238  1.00 0.00 ? 218 VAL A HG21 6  
ATOM 6396  H HG22 . VAL A 1 16 ? 5.549   -1.244  4.792  1.00 0.00 ? 218 VAL A HG22 6  
ATOM 6397  H HG23 . VAL A 1 16 ? 5.603   -0.293  3.308  1.00 0.00 ? 218 VAL A HG23 6  
ATOM 6398  N N    . LEU A 1 17 ? 7.310   -2.159  6.577  1.00 0.00 ? 219 LEU A N    6  
ATOM 6399  C CA   . LEU A 1 17 ? 6.615   -2.565  7.789  1.00 0.00 ? 219 LEU A CA   6  
ATOM 6400  C C    . LEU A 1 17 ? 5.531   -1.555  8.138  1.00 0.00 ? 219 LEU A C    6  
ATOM 6401  O O    . LEU A 1 17 ? 5.818   -0.380  8.350  1.00 0.00 ? 219 LEU A O    6  
ATOM 6402  C CB   . LEU A 1 17 ? 7.586   -2.689  8.963  1.00 0.00 ? 219 LEU A CB   6  
ATOM 6403  C CG   . LEU A 1 17 ? 8.703   -3.719  8.793  1.00 0.00 ? 219 LEU A CG   6  
ATOM 6404  C CD1  . LEU A 1 17 ? 9.459   -3.895  10.101 1.00 0.00 ? 219 LEU A CD1  6  
ATOM 6405  C CD2  . LEU A 1 17 ? 8.136   -5.049  8.319  1.00 0.00 ? 219 LEU A CD2  6  
ATOM 6406  H H    . LEU A 1 17 ? 7.708   -1.265  6.533  1.00 0.00 ? 219 LEU A H    6  
ATOM 6407  H HA   . LEU A 1 17 ? 6.155   -3.523  7.606  1.00 0.00 ? 219 LEU A HA   6  
ATOM 6408  H HB2  . LEU A 1 17 ? 8.041   -1.723  9.128  1.00 0.00 ? 219 LEU A HB2  6  
ATOM 6409  H HB3  . LEU A 1 17 ? 7.016   -2.952  9.842  1.00 0.00 ? 219 LEU A HB3  6  
ATOM 6410  H HG   . LEU A 1 17 ? 9.402   -3.364  8.049  1.00 0.00 ? 219 LEU A HG   6  
ATOM 6411  H HD11 . LEU A 1 17 ? 10.279  -3.194  10.141 1.00 0.00 ? 219 LEU A HD11 6  
ATOM 6412  H HD12 . LEU A 1 17 ? 8.791   -3.712  10.930 1.00 0.00 ? 219 LEU A HD12 6  
ATOM 6413  H HD13 . LEU A 1 17 ? 9.843   -4.902  10.163 1.00 0.00 ? 219 LEU A HD13 6  
ATOM 6414  H HD21 . LEU A 1 17 ? 8.864   -5.829  8.484  1.00 0.00 ? 219 LEU A HD21 6  
ATOM 6415  H HD22 . LEU A 1 17 ? 7.236   -5.274  8.869  1.00 0.00 ? 219 LEU A HD22 6  
ATOM 6416  H HD23 . LEU A 1 17 ? 7.908   -4.988  7.264  1.00 0.00 ? 219 LEU A HD23 6  
ATOM 6417  N N    . VAL A 1 18 ? 4.293   -2.018  8.212  1.00 0.00 ? 220 VAL A N    6  
ATOM 6418  C CA   . VAL A 1 18 ? 3.180   -1.139  8.551  1.00 0.00 ? 220 VAL A CA   6  
ATOM 6419  C C    . VAL A 1 18 ? 2.998   -1.083  10.062 1.00 0.00 ? 220 VAL A C    6  
ATOM 6420  O O    . VAL A 1 18 ? 2.627   -2.075  10.693 1.00 0.00 ? 220 VAL A O    6  
ATOM 6421  C CB   . VAL A 1 18 ? 1.852   -1.577  7.884  1.00 0.00 ? 220 VAL A CB   6  
ATOM 6422  C CG1  . VAL A 1 18 ? 1.263   -0.436  7.068  1.00 0.00 ? 220 VAL A CG1  6  
ATOM 6423  C CG2  . VAL A 1 18 ? 2.051   -2.811  7.015  1.00 0.00 ? 220 VAL A CG2  6  
ATOM 6424  H H    . VAL A 1 18 ? 4.127   -2.969  8.045  1.00 0.00 ? 220 VAL A H    6  
ATOM 6425  H HA   . VAL A 1 18 ? 3.428   -0.149  8.196  1.00 0.00 ? 220 VAL A HA   6  
ATOM 6426  H HB   . VAL A 1 18 ? 1.148   -1.824  8.661  1.00 0.00 ? 220 VAL A HB   6  
ATOM 6427  H HG11 . VAL A 1 18 ? 0.473   0.038   7.632  1.00 0.00 ? 220 VAL A HG11 6  
ATOM 6428  H HG12 . VAL A 1 18 ? 2.034   0.289   6.852  1.00 0.00 ? 220 VAL A HG12 6  
ATOM 6429  H HG13 . VAL A 1 18 ? 0.862   -0.822  6.143  1.00 0.00 ? 220 VAL A HG13 6  
ATOM 6430  H HG21 . VAL A 1 18 ? 2.308   -3.653  7.640  1.00 0.00 ? 220 VAL A HG21 6  
ATOM 6431  H HG22 . VAL A 1 18 ? 1.138   -3.025  6.480  1.00 0.00 ? 220 VAL A HG22 6  
ATOM 6432  H HG23 . VAL A 1 18 ? 2.848   -2.630  6.309  1.00 0.00 ? 220 VAL A HG23 6  
ATOM 6433  N N    . GLY A 1 19 ? 3.278   0.081   10.637 1.00 0.00 ? 221 GLY A N    6  
ATOM 6434  C CA   . GLY A 1 19 ? 3.155   0.249   12.071 1.00 0.00 ? 221 GLY A CA   6  
ATOM 6435  C C    . GLY A 1 19 ? 4.414   -0.166  12.816 1.00 0.00 ? 221 GLY A C    6  
ATOM 6436  O O    . GLY A 1 19 ? 4.516   0.027   14.027 1.00 0.00 ? 221 GLY A O    6  
ATOM 6437  H H    . GLY A 1 19 ? 3.579   0.830   10.083 1.00 0.00 ? 221 GLY A H    6  
ATOM 6438  H HA2  . GLY A 1 19 ? 2.949   1.286   12.285 1.00 0.00 ? 221 GLY A HA2  6  
ATOM 6439  H HA3  . GLY A 1 19 ? 2.328   -0.352  12.423 1.00 0.00 ? 221 GLY A HA3  6  
ATOM 6440  N N    . GLY A 1 20 ? 5.375   -0.736  12.089 1.00 0.00 ? 222 GLY A N    6  
ATOM 6441  C CA   . GLY A 1 20 ? 6.618   -1.168  12.706 1.00 0.00 ? 222 GLY A CA   6  
ATOM 6442  C C    . GLY A 1 20 ? 6.561   -2.600  13.200 1.00 0.00 ? 222 GLY A C    6  
ATOM 6443  O O    . GLY A 1 20 ? 7.589   -3.267  13.308 1.00 0.00 ? 222 GLY A O    6  
ATOM 6444  H H    . GLY A 1 20 ? 5.241   -0.866  11.127 1.00 0.00 ? 222 GLY A H    6  
ATOM 6445  H HA2  . GLY A 1 20 ? 7.412   -1.084  11.981 1.00 0.00 ? 222 GLY A HA2  6  
ATOM 6446  H HA3  . GLY A 1 20 ? 6.839   -0.520  13.540 1.00 0.00 ? 222 GLY A HA3  6  
ATOM 6447  N N    . THR A 1 21 ? 5.357   -3.074  13.502 1.00 0.00 ? 223 THR A N    6  
ATOM 6448  C CA   . THR A 1 21 ? 5.173   -4.434  13.987 1.00 0.00 ? 223 THR A CA   6  
ATOM 6449  C C    . THR A 1 21 ? 4.711   -5.353  12.862 1.00 0.00 ? 223 THR A C    6  
ATOM 6450  O O    . THR A 1 21 ? 4.974   -6.555  12.880 1.00 0.00 ? 223 THR A O    6  
ATOM 6451  C CB   . THR A 1 21 ? 4.156   -4.452  15.128 1.00 0.00 ? 223 THR A CB   6  
ATOM 6452  O OG1  . THR A 1 21 ? 2.961   -3.794  14.745 1.00 0.00 ? 223 THR A OG1  6  
ATOM 6453  C CG2  . THR A 1 21 ? 4.664   -3.783  16.386 1.00 0.00 ? 223 THR A CG2  6  
ATOM 6454  H H    . THR A 1 21 ? 4.575   -2.497  13.397 1.00 0.00 ? 223 THR A H    6  
ATOM 6455  H HA   . THR A 1 21 ? 6.124   -4.787  14.358 1.00 0.00 ? 223 THR A HA   6  
ATOM 6456  H HB   . THR A 1 21 ? 3.917   -5.477  15.369 1.00 0.00 ? 223 THR A HB   6  
ATOM 6457  H HG1  . THR A 1 21 ? 2.296   -3.914  15.426 1.00 0.00 ? 223 THR A HG1  6  
ATOM 6458  H HG21 . THR A 1 21 ? 3.982   -2.998  16.677 1.00 0.00 ? 223 THR A HG21 6  
ATOM 6459  H HG22 . THR A 1 21 ? 5.642   -3.361  16.200 1.00 0.00 ? 223 THR A HG22 6  
ATOM 6460  H HG23 . THR A 1 21 ? 4.732   -4.513  17.180 1.00 0.00 ? 223 THR A HG23 6  
ATOM 6461  N N    . LYS A 1 22 ? 4.015   -4.779  11.886 1.00 0.00 ? 224 LYS A N    6  
ATOM 6462  C CA   . LYS A 1 22 ? 3.513   -5.548  10.755 1.00 0.00 ? 224 LYS A CA   6  
ATOM 6463  C C    . LYS A 1 22 ? 4.419   -5.377  9.540  1.00 0.00 ? 224 LYS A C    6  
ATOM 6464  O O    . LYS A 1 22 ? 5.007   -4.315  9.341  1.00 0.00 ? 224 LYS A O    6  
ATOM 6465  C CB   . LYS A 1 22 ? 2.086   -5.112  10.407 1.00 0.00 ? 224 LYS A CB   6  
ATOM 6466  C CG   . LYS A 1 22 ? 1.227   -4.785  11.620 1.00 0.00 ? 224 LYS A CG   6  
ATOM 6467  C CD   . LYS A 1 22 ? 0.610   -6.039  12.221 1.00 0.00 ? 224 LYS A CD   6  
ATOM 6468  C CE   . LYS A 1 22 ? 1.624   -6.825  13.033 1.00 0.00 ? 224 LYS A CE   6  
ATOM 6469  N NZ   . LYS A 1 22 ? 1.015   -7.424  14.253 1.00 0.00 ? 224 LYS A NZ   6  
ATOM 6470  H H    . LYS A 1 22 ? 3.834   -3.817  11.929 1.00 0.00 ? 224 LYS A H    6  
ATOM 6471  H HA   . LYS A 1 22 ? 3.502   -6.590  11.039 1.00 0.00 ? 224 LYS A HA   6  
ATOM 6472  H HB2  . LYS A 1 22 ? 2.135   -4.231  9.784  1.00 0.00 ? 224 LYS A HB2  6  
ATOM 6473  H HB3  . LYS A 1 22 ? 1.604   -5.905  9.855  1.00 0.00 ? 224 LYS A HB3  6  
ATOM 6474  H HG2  . LYS A 1 22 ? 1.840   -4.306  12.369 1.00 0.00 ? 224 LYS A HG2  6  
ATOM 6475  H HG3  . LYS A 1 22 ? 0.436   -4.115  11.318 1.00 0.00 ? 224 LYS A HG3  6  
ATOM 6476  H HD2  . LYS A 1 22 ? -0.208  -5.752  12.864 1.00 0.00 ? 224 LYS A HD2  6  
ATOM 6477  H HD3  . LYS A 1 22 ? 0.240   -6.662  11.423 1.00 0.00 ? 224 LYS A HD3  6  
ATOM 6478  H HE2  . LYS A 1 22 ? 2.026   -7.615  12.417 1.00 0.00 ? 224 LYS A HE2  6  
ATOM 6479  H HE3  . LYS A 1 22 ? 2.422   -6.160  13.329 1.00 0.00 ? 224 LYS A HE3  6  
ATOM 6480  H HZ1  . LYS A 1 22 ? 0.747   -8.413  14.069 1.00 0.00 ? 224 LYS A HZ1  6  
ATOM 6481  H HZ2  . LYS A 1 22 ? 0.166   -6.891  14.528 1.00 0.00 ? 224 LYS A HZ2  6  
ATOM 6482  H HZ3  . LYS A 1 22 ? 1.695   -7.401  15.040 1.00 0.00 ? 224 LYS A HZ3  6  
ATOM 6483  N N    . ALA A 1 23 ? 4.526   -6.427  8.731  1.00 0.00 ? 225 ALA A N    6  
ATOM 6484  C CA   . ALA A 1 23 ? 5.360   -6.385  7.534  1.00 0.00 ? 225 ALA A CA   6  
ATOM 6485  C C    . ALA A 1 23 ? 4.529   -6.611  6.282  1.00 0.00 ? 225 ALA A C    6  
ATOM 6486  O O    . ALA A 1 23 ? 3.598   -7.415  6.282  1.00 0.00 ? 225 ALA A O    6  
ATOM 6487  C CB   . ALA A 1 23 ? 6.468   -7.422  7.620  1.00 0.00 ? 225 ALA A CB   6  
ATOM 6488  H H    . ALA A 1 23 ? 4.032   -7.246  8.941  1.00 0.00 ? 225 ALA A H    6  
ATOM 6489  H HA   . ALA A 1 23 ? 5.817   -5.408  7.480  1.00 0.00 ? 225 ALA A HA   6  
ATOM 6490  H HB1  . ALA A 1 23 ? 6.086   -8.381  7.303  1.00 0.00 ? 225 ALA A HB1  6  
ATOM 6491  H HB2  . ALA A 1 23 ? 7.283   -7.128  6.975  1.00 0.00 ? 225 ALA A HB2  6  
ATOM 6492  H HB3  . ALA A 1 23 ? 6.819   -7.492  8.637  1.00 0.00 ? 225 ALA A HB3  6  
ATOM 6493  N N    . GLY A 1 24 ? 4.871   -5.900  5.213  1.00 0.00 ? 226 GLY A N    6  
ATOM 6494  C CA   . GLY A 1 24 ? 4.140   -6.046  3.970  1.00 0.00 ? 226 GLY A CA   6  
ATOM 6495  C C    . GLY A 1 24 ? 4.784   -5.304  2.816  1.00 0.00 ? 226 GLY A C    6  
ATOM 6496  O O    . GLY A 1 24 ? 5.926   -4.854  2.915  1.00 0.00 ? 226 GLY A O    6  
ATOM 6497  H H    . GLY A 1 24 ? 5.622   -5.275  5.268  1.00 0.00 ? 226 GLY A H    6  
ATOM 6498  H HA2  . GLY A 1 24 ? 4.084   -7.095  3.721  1.00 0.00 ? 226 GLY A HA2  6  
ATOM 6499  H HA3  . GLY A 1 24 ? 3.139   -5.669  4.112  1.00 0.00 ? 226 GLY A HA3  6  
ATOM 6500  N N    . VAL A 1 25 ? 4.047   -5.180  1.718  1.00 0.00 ? 227 VAL A N    6  
ATOM 6501  C CA   . VAL A 1 25 ? 4.540   -4.493  0.531  1.00 0.00 ? 227 VAL A CA   6  
ATOM 6502  C C    . VAL A 1 25 ? 3.659   -3.296  0.185  1.00 0.00 ? 227 VAL A C    6  
ATOM 6503  O O    . VAL A 1 25 ? 2.434   -3.410  0.136  1.00 0.00 ? 227 VAL A O    6  
ATOM 6504  C CB   . VAL A 1 25 ? 4.599   -5.449  -0.680 1.00 0.00 ? 227 VAL A CB   6  
ATOM 6505  C CG1  . VAL A 1 25 ? 4.912   -4.689  -1.962 1.00 0.00 ? 227 VAL A CG1  6  
ATOM 6506  C CG2  . VAL A 1 25 ? 5.623   -6.547  -0.441 1.00 0.00 ? 227 VAL A CG2  6  
ATOM 6507  H H    . VAL A 1 25 ? 3.145   -5.563  1.704  1.00 0.00 ? 227 VAL A H    6  
ATOM 6508  H HA   . VAL A 1 25 ? 5.542   -4.143  0.739  1.00 0.00 ? 227 VAL A HA   6  
ATOM 6509  H HB   . VAL A 1 25 ? 3.629   -5.911  -0.792 1.00 0.00 ? 227 VAL A HB   6  
ATOM 6510  H HG11 . VAL A 1 25 ? 3.990   -4.435  -2.462 1.00 0.00 ? 227 VAL A HG11 6  
ATOM 6511  H HG12 . VAL A 1 25 ? 5.453   -3.786  -1.723 1.00 0.00 ? 227 VAL A HG12 6  
ATOM 6512  H HG13 . VAL A 1 25 ? 5.514   -5.308  -2.610 1.00 0.00 ? 227 VAL A HG13 6  
ATOM 6513  H HG21 . VAL A 1 25 ? 5.821   -6.632  0.617  1.00 0.00 ? 227 VAL A HG21 6  
ATOM 6514  H HG22 . VAL A 1 25 ? 5.236   -7.485  -0.812 1.00 0.00 ? 227 VAL A HG22 6  
ATOM 6515  H HG23 . VAL A 1 25 ? 6.539   -6.305  -0.960 1.00 0.00 ? 227 VAL A HG23 6  
ATOM 6516  N N    . VAL A 1 26 ? 4.286   -2.154  -0.068 1.00 0.00 ? 228 VAL A N    6  
ATOM 6517  C CA   . VAL A 1 26 ? 3.552   -0.946  -0.420 1.00 0.00 ? 228 VAL A CA   6  
ATOM 6518  C C    . VAL A 1 26 ? 2.745   -1.163  -1.694 1.00 0.00 ? 228 VAL A C    6  
ATOM 6519  O O    . VAL A 1 26 ? 3.250   -1.711  -2.674 1.00 0.00 ? 228 VAL A O    6  
ATOM 6520  C CB   . VAL A 1 26 ? 4.499   0.252   -0.614 1.00 0.00 ? 228 VAL A CB   6  
ATOM 6521  C CG1  . VAL A 1 26 ? 3.705   1.534   -0.820 1.00 0.00 ? 228 VAL A CG1  6  
ATOM 6522  C CG2  . VAL A 1 26 ? 5.441   0.382   0.575  1.00 0.00 ? 228 VAL A CG2  6  
ATOM 6523  H H    . VAL A 1 26 ? 5.266   -2.125  -0.025 1.00 0.00 ? 228 VAL A H    6  
ATOM 6524  H HA   . VAL A 1 26 ? 2.875   -0.719  0.390  1.00 0.00 ? 228 VAL A HA   6  
ATOM 6525  H HB   . VAL A 1 26 ? 5.092   0.078   -1.500 1.00 0.00 ? 228 VAL A HB   6  
ATOM 6526  H HG11 . VAL A 1 26 ? 4.363   2.384   -0.722 1.00 0.00 ? 228 VAL A HG11 6  
ATOM 6527  H HG12 . VAL A 1 26 ? 3.264   1.530   -1.806 1.00 0.00 ? 228 VAL A HG12 6  
ATOM 6528  H HG13 . VAL A 1 26 ? 2.924   1.597   -0.077 1.00 0.00 ? 228 VAL A HG13 6  
ATOM 6529  H HG21 . VAL A 1 26 ? 5.417   -0.528  1.156  1.00 0.00 ? 228 VAL A HG21 6  
ATOM 6530  H HG22 . VAL A 1 26 ? 6.446   0.557   0.219  1.00 0.00 ? 228 VAL A HG22 6  
ATOM 6531  H HG23 . VAL A 1 26 ? 5.130   1.211   1.192  1.00 0.00 ? 228 VAL A HG23 6  
ATOM 6532  N N    . ARG A 1 27 ? 1.485   -0.747  -1.672 1.00 0.00 ? 229 ARG A N    6  
ATOM 6533  C CA   . ARG A 1 27 ? 0.609   -0.915  -2.824 1.00 0.00 ? 229 ARG A CA   6  
ATOM 6534  C C    . ARG A 1 27 ? 0.079   0.427   -3.320 1.00 0.00 ? 229 ARG A C    6  
ATOM 6535  O O    . ARG A 1 27 ? 0.069   0.695   -4.522 1.00 0.00 ? 229 ARG A O    6  
ATOM 6536  C CB   . ARG A 1 27 ? -0.552  -1.841  -2.458 1.00 0.00 ? 229 ARG A CB   6  
ATOM 6537  C CG   . ARG A 1 27 ? -0.102  -3.185  -1.912 1.00 0.00 ? 229 ARG A CG   6  
ATOM 6538  C CD   . ARG A 1 27 ? 0.880   -3.868  -2.853 1.00 0.00 ? 229 ARG A CD   6  
ATOM 6539  N NE   . ARG A 1 27 ? 0.556   -5.278  -3.052 1.00 0.00 ? 229 ARG A NE   6  
ATOM 6540  C CZ   . ARG A 1 27 ? 0.840   -5.960  -4.160 1.00 0.00 ? 229 ARG A CZ   6  
ATOM 6541  N NH1  . ARG A 1 27 ? 1.471   -5.372  -5.170 1.00 0.00 ? 229 ARG A NH1  6  
ATOM 6542  N NH2  . ARG A 1 27 ? 0.499   -7.238  -4.256 1.00 0.00 ? 229 ARG A NH2  6  
ATOM 6543  H H    . ARG A 1 27 ? 1.133   -0.329  -0.860 1.00 0.00 ? 229 ARG A H    6  
ATOM 6544  H HA   . ARG A 1 27 ? 1.185   -1.373  -3.615 1.00 0.00 ? 229 ARG A HA   6  
ATOM 6545  H HB2  . ARG A 1 27 ? -1.162  -1.357  -1.711 1.00 0.00 ? 229 ARG A HB2  6  
ATOM 6546  H HB3  . ARG A 1 27 ? -1.148  -2.018  -3.338 1.00 0.00 ? 229 ARG A HB3  6  
ATOM 6547  H HG2  . ARG A 1 27 ? 0.379   -3.033  -0.958 1.00 0.00 ? 229 ARG A HG2  6  
ATOM 6548  H HG3  . ARG A 1 27 ? -0.966  -3.820  -1.786 1.00 0.00 ? 229 ARG A HG3  6  
ATOM 6549  H HD2  . ARG A 1 27 ? 0.852   -3.364  -3.808 1.00 0.00 ? 229 ARG A HD2  6  
ATOM 6550  H HD3  . ARG A 1 27 ? 1.874   -3.793  -2.434 1.00 0.00 ? 229 ARG A HD3  6  
ATOM 6551  H HE   . ARG A 1 27 ? 0.097   -5.741  -2.322 1.00 0.00 ? 229 ARG A HE   6  
ATOM 6552  H HH11 . ARG A 1 27 ? 1.736   -4.412  -5.105 1.00 0.00 ? 229 ARG A HH11 6  
ATOM 6553  H HH12 . ARG A 1 27 ? 1.681   -5.893  -5.999 1.00 0.00 ? 229 ARG A HH12 6  
ATOM 6554  H HH21 . ARG A 1 27 ? 0.027   -7.687  -3.497 1.00 0.00 ? 229 ARG A HH21 6  
ATOM 6555  H HH22 . ARG A 1 27 ? 0.711   -7.753  -5.087 1.00 0.00 ? 229 ARG A HH22 6  
ATOM 6556  N N    . PHE A 1 28 ? -0.358  1.268   -2.391 1.00 0.00 ? 230 PHE A N    6  
ATOM 6557  C CA   . PHE A 1 28 ? -0.886  2.583   -2.738 1.00 0.00 ? 230 PHE A CA   6  
ATOM 6558  C C    . PHE A 1 28 ? -0.538  3.604   -1.662 1.00 0.00 ? 230 PHE A C    6  
ATOM 6559  O O    . PHE A 1 28 ? -0.503  3.278   -0.480 1.00 0.00 ? 230 PHE A O    6  
ATOM 6560  C CB   . PHE A 1 28 ? -2.403  2.512   -2.925 1.00 0.00 ? 230 PHE A CB   6  
ATOM 6561  C CG   . PHE A 1 28 ? -2.988  3.739   -3.568 1.00 0.00 ? 230 PHE A CG   6  
ATOM 6562  C CD1  . PHE A 1 28 ? -2.874  3.942   -4.935 1.00 0.00 ? 230 PHE A CD1  6  
ATOM 6563  C CD2  . PHE A 1 28 ? -3.653  4.685   -2.807 1.00 0.00 ? 230 PHE A CD2  6  
ATOM 6564  C CE1  . PHE A 1 28 ? -3.412  5.068   -5.528 1.00 0.00 ? 230 PHE A CE1  6  
ATOM 6565  C CE2  . PHE A 1 28 ? -4.194  5.814   -3.395 1.00 0.00 ? 230 PHE A CE2  6  
ATOM 6566  C CZ   . PHE A 1 28 ? -4.072  6.005   -4.758 1.00 0.00 ? 230 PHE A CZ   6  
ATOM 6567  H H    . PHE A 1 28 ? -0.323  1.000   -1.448 1.00 0.00 ? 230 PHE A H    6  
ATOM 6568  H HA   . PHE A 1 28 ? -0.431  2.887   -3.665 1.00 0.00 ? 230 PHE A HA   6  
ATOM 6569  H HB2  . PHE A 1 28 ? -2.643  1.664   -3.549 1.00 0.00 ? 230 PHE A HB2  6  
ATOM 6570  H HB3  . PHE A 1 28 ? -2.872  2.387   -1.960 1.00 0.00 ? 230 PHE A HB3  6  
ATOM 6571  H HD1  . PHE A 1 28 ? -2.357  3.210   -5.537 1.00 0.00 ? 230 PHE A HD1  6  
ATOM 6572  H HD2  . PHE A 1 28 ? -3.749  4.537   -1.742 1.00 0.00 ? 230 PHE A HD2  6  
ATOM 6573  H HE1  . PHE A 1 28 ? -3.315  5.214   -6.594 1.00 0.00 ? 230 PHE A HE1  6  
ATOM 6574  H HE2  . PHE A 1 28 ? -4.710  6.545   -2.791 1.00 0.00 ? 230 PHE A HE2  6  
ATOM 6575  H HZ   . PHE A 1 28 ? -4.493  6.886   -5.221 1.00 0.00 ? 230 PHE A HZ   6  
ATOM 6576  N N    . LEU A 1 29 ? -0.281  4.840   -2.071 1.00 0.00 ? 231 LEU A N    6  
ATOM 6577  C CA   . LEU A 1 29 ? 0.063   5.894   -1.124 1.00 0.00 ? 231 LEU A CA   6  
ATOM 6578  C C    . LEU A 1 29 ? -0.789  7.138   -1.355 1.00 0.00 ? 231 LEU A C    6  
ATOM 6579  O O    . LEU A 1 29 ? -0.796  7.706   -2.448 1.00 0.00 ? 231 LEU A O    6  
ATOM 6580  C CB   . LEU A 1 29 ? 1.549   6.248   -1.232 1.00 0.00 ? 231 LEU A CB   6  
ATOM 6581  C CG   . LEU A 1 29 ? 2.501   5.047   -1.241 1.00 0.00 ? 231 LEU A CG   6  
ATOM 6582  C CD1  . LEU A 1 29 ? 3.200   4.926   -2.586 1.00 0.00 ? 231 LEU A CD1  6  
ATOM 6583  C CD2  . LEU A 1 29 ? 3.521   5.166   -0.120 1.00 0.00 ? 231 LEU A CD2  6  
ATOM 6584  H H    . LEU A 1 29 ? -0.325  5.049   -3.028 1.00 0.00 ? 231 LEU A H    6  
ATOM 6585  H HA   . LEU A 1 29 ? -0.135  5.521   -0.130 1.00 0.00 ? 231 LEU A HA   6  
ATOM 6586  H HB2  . LEU A 1 29 ? 1.697   6.809   -2.142 1.00 0.00 ? 231 LEU A HB2  6  
ATOM 6587  H HB3  . LEU A 1 29 ? 1.807   6.878   -0.394 1.00 0.00 ? 231 LEU A HB3  6  
ATOM 6588  H HG   . LEU A 1 29 ? 1.930   4.144   -1.080 1.00 0.00 ? 231 LEU A HG   6  
ATOM 6589  H HD11 . LEU A 1 29 ? 4.196   4.534   -2.440 1.00 0.00 ? 231 LEU A HD11 6  
ATOM 6590  H HD12 . LEU A 1 29 ? 2.639   4.258   -3.224 1.00 0.00 ? 231 LEU A HD12 6  
ATOM 6591  H HD13 . LEU A 1 29 ? 3.259   5.900   -3.049 1.00 0.00 ? 231 LEU A HD13 6  
ATOM 6592  H HD21 . LEU A 1 29 ? 3.056   5.614   0.746  1.00 0.00 ? 231 LEU A HD21 6  
ATOM 6593  H HD22 . LEU A 1 29 ? 3.890   4.183   0.139  1.00 0.00 ? 231 LEU A HD22 6  
ATOM 6594  H HD23 . LEU A 1 29 ? 4.346   5.783   -0.446 1.00 0.00 ? 231 LEU A HD23 6  
ATOM 6595  N N    . GLY A 1 30 ? -1.507  7.550   -0.317 1.00 0.00 ? 232 GLY A N    6  
ATOM 6596  C CA   . GLY A 1 30 ? -2.357  8.722   -0.419 1.00 0.00 ? 232 GLY A CA   6  
ATOM 6597  C C    . GLY A 1 30 ? -3.244  8.899   0.797  1.00 0.00 ? 232 GLY A C    6  
ATOM 6598  O O    . GLY A 1 30 ? -3.089  8.192   1.793  1.00 0.00 ? 232 GLY A O    6  
ATOM 6599  H H    . GLY A 1 30 ? -1.462  7.055   0.526  1.00 0.00 ? 232 GLY A H    6  
ATOM 6600  H HA2  . GLY A 1 30 ? -1.734  9.597   -0.528 1.00 0.00 ? 232 GLY A HA2  6  
ATOM 6601  H HA3  . GLY A 1 30 ? -2.982  8.626   -1.296 1.00 0.00 ? 232 GLY A HA3  6  
ATOM 6602  N N    . GLU A 1 31 ? -4.175  9.843   0.719  1.00 0.00 ? 233 GLU A N    6  
ATOM 6603  C CA   . GLU A 1 31 ? -5.088  10.110  1.824  1.00 0.00 ? 233 GLU A CA   6  
ATOM 6604  C C    . GLU A 1 31 ? -6.226  9.095   1.847  1.00 0.00 ? 233 GLU A C    6  
ATOM 6605  O O    . GLU A 1 31 ? -6.511  8.443   0.843  1.00 0.00 ? 233 GLU A O    6  
ATOM 6606  C CB   . GLU A 1 31 ? -5.653  11.527  1.716  1.00 0.00 ? 233 GLU A CB   6  
ATOM 6607  C CG   . GLU A 1 31 ? -4.596  12.582  1.433  1.00 0.00 ? 233 GLU A CG   6  
ATOM 6608  C CD   . GLU A 1 31 ? -5.179  13.977  1.334  1.00 0.00 ? 233 GLU A CD   6  
ATOM 6609  O OE1  . GLU A 1 31 ? -6.047  14.320  2.165  1.00 0.00 ? 233 GLU A OE1  6  
ATOM 6610  O OE2  . GLU A 1 31 ? -4.769  14.730  0.425  1.00 0.00 ? 233 GLU A OE2  6  
ATOM 6611  H H    . GLU A 1 31 ? -4.247  10.375  -0.102 1.00 0.00 ? 233 GLU A H    6  
ATOM 6612  H HA   . GLU A 1 31 ? -4.528  10.025  2.744  1.00 0.00 ? 233 GLU A HA   6  
ATOM 6613  H HB2  . GLU A 1 31 ? -6.380  11.552  0.918  1.00 0.00 ? 233 GLU A HB2  6  
ATOM 6614  H HB3  . GLU A 1 31 ? -6.142  11.778  2.645  1.00 0.00 ? 233 GLU A HB3  6  
ATOM 6615  H HG2  . GLU A 1 31 ? -3.870  12.568  2.232  1.00 0.00 ? 233 GLU A HG2  6  
ATOM 6616  H HG3  . GLU A 1 31 ? -4.108  12.344  0.500  1.00 0.00 ? 233 GLU A HG3  6  
ATOM 6617  N N    . THR A 1 32 ? -6.875  8.966   3.002  1.00 0.00 ? 234 THR A N    6  
ATOM 6618  C CA   . THR A 1 32 ? -7.982  8.030   3.157  1.00 0.00 ? 234 THR A CA   6  
ATOM 6619  C C    . THR A 1 32 ? -9.311  8.772   3.252  1.00 0.00 ? 234 THR A C    6  
ATOM 6620  O O    . THR A 1 32 ? -9.348  9.963   3.555  1.00 0.00 ? 234 THR A O    6  
ATOM 6621  C CB   . THR A 1 32 ? -7.777  7.166   4.402  1.00 0.00 ? 234 THR A CB   6  
ATOM 6622  O OG1  . THR A 1 32 ? -7.919  7.942   5.580  1.00 0.00 ? 234 THR A OG1  6  
ATOM 6623  C CG2  . THR A 1 32 ? -6.418  6.501   4.453  1.00 0.00 ? 234 THR A CG2  6  
ATOM 6624  H H    . THR A 1 32 ? -6.601  9.513   3.767  1.00 0.00 ? 234 THR A H    6  
ATOM 6625  H HA   . THR A 1 32 ? -8.001  7.390   2.287  1.00 0.00 ? 234 THR A HA   6  
ATOM 6626  H HB   . THR A 1 32 ? -8.527  6.389   4.417  1.00 0.00 ? 234 THR A HB   6  
ATOM 6627  H HG1  . THR A 1 32 ? -7.342  8.708   5.531  1.00 0.00 ? 234 THR A HG1  6  
ATOM 6628  H HG21 . THR A 1 32 ? -5.758  6.977   3.741  1.00 0.00 ? 234 THR A HG21 6  
ATOM 6629  H HG22 . THR A 1 32 ? -6.521  5.454   4.204  1.00 0.00 ? 234 THR A HG22 6  
ATOM 6630  H HG23 . THR A 1 32 ? -6.006  6.596   5.446  1.00 0.00 ? 234 THR A HG23 6  
ATOM 6631  N N    . ASP A 1 33 ? -10.401 8.057   2.990  1.00 0.00 ? 235 ASP A N    6  
ATOM 6632  C CA   . ASP A 1 33 ? -11.733 8.647   3.045  1.00 0.00 ? 235 ASP A CA   6  
ATOM 6633  C C    . ASP A 1 33 ? -12.292 8.632   4.469  1.00 0.00 ? 235 ASP A C    6  
ATOM 6634  O O    . ASP A 1 33 ? -13.376 9.156   4.722  1.00 0.00 ? 235 ASP A O    6  
ATOM 6635  C CB   . ASP A 1 33 ? -12.683 7.899   2.107  1.00 0.00 ? 235 ASP A CB   6  
ATOM 6636  C CG   . ASP A 1 33 ? -12.797 8.565   0.750  1.00 0.00 ? 235 ASP A CG   6  
ATOM 6637  O OD1  . ASP A 1 33 ? -13.246 9.730   0.697  1.00 0.00 ? 235 ASP A OD1  6  
ATOM 6638  O OD2  . ASP A 1 33 ? -12.438 7.924   -0.259 1.00 0.00 ? 235 ASP A OD2  6  
ATOM 6639  H H    . ASP A 1 33 ? -10.307 7.111   2.754  1.00 0.00 ? 235 ASP A H    6  
ATOM 6640  H HA   . ASP A 1 33 ? -11.653 9.673   2.716  1.00 0.00 ? 235 ASP A HA   6  
ATOM 6641  H HB2  . ASP A 1 33 ? -12.317 6.894   1.964  1.00 0.00 ? 235 ASP A HB2  6  
ATOM 6642  H HB3  . ASP A 1 33 ? -13.665 7.861   2.554  1.00 0.00 ? 235 ASP A HB3  6  
ATOM 6643  N N    . PHE A 1 34 ? -11.551 8.030   5.397  1.00 0.00 ? 236 PHE A N    6  
ATOM 6644  C CA   . PHE A 1 34 ? -11.989 7.954   6.787  1.00 0.00 ? 236 PHE A CA   6  
ATOM 6645  C C    . PHE A 1 34 ? -10.970 8.597   7.731  1.00 0.00 ? 236 PHE A C    6  
ATOM 6646  O O    . PHE A 1 34 ? -11.289 8.907   8.879  1.00 0.00 ? 236 PHE A O    6  
ATOM 6647  C CB   . PHE A 1 34 ? -12.233 6.494   7.193  1.00 0.00 ? 236 PHE A CB   6  
ATOM 6648  C CG   . PHE A 1 34 ? -10.982 5.741   7.563  1.00 0.00 ? 236 PHE A CG   6  
ATOM 6649  C CD1  . PHE A 1 34 ? -9.966  5.554   6.641  1.00 0.00 ? 236 PHE A CD1  6  
ATOM 6650  C CD2  . PHE A 1 34 ? -10.827 5.222   8.839  1.00 0.00 ? 236 PHE A CD2  6  
ATOM 6651  C CE1  . PHE A 1 34 ? -8.817  4.865   6.982  1.00 0.00 ? 236 PHE A CE1  6  
ATOM 6652  C CE2  . PHE A 1 34 ? -9.682  4.530   9.187  1.00 0.00 ? 236 PHE A CE2  6  
ATOM 6653  C CZ   . PHE A 1 34 ? -8.676  4.351   8.257  1.00 0.00 ? 236 PHE A CZ   6  
ATOM 6654  H H    . PHE A 1 34 ? -10.697 7.627   5.142  1.00 0.00 ? 236 PHE A H    6  
ATOM 6655  H HA   . PHE A 1 34 ? -12.920 8.495   6.867  1.00 0.00 ? 236 PHE A HA   6  
ATOM 6656  H HB2  . PHE A 1 34 ? -12.893 6.472   8.047  1.00 0.00 ? 236 PHE A HB2  6  
ATOM 6657  H HB3  . PHE A 1 34 ? -12.701 5.975   6.370  1.00 0.00 ? 236 PHE A HB3  6  
ATOM 6658  H HD1  . PHE A 1 34 ? -10.074 5.953   5.644  1.00 0.00 ? 236 PHE A HD1  6  
ATOM 6659  H HD2  . PHE A 1 34 ? -11.614 5.360   9.566  1.00 0.00 ? 236 PHE A HD2  6  
ATOM 6660  H HE1  . PHE A 1 34 ? -8.032  4.726   6.254  1.00 0.00 ? 236 PHE A HE1  6  
ATOM 6661  H HE2  . PHE A 1 34 ? -9.573  4.130   10.183 1.00 0.00 ? 236 PHE A HE2  6  
ATOM 6662  H HZ   . PHE A 1 34 ? -7.780  3.813   8.526  1.00 0.00 ? 236 PHE A HZ   6  
ATOM 6663  N N    . ALA A 1 35 ? -9.746  8.794   7.247  1.00 0.00 ? 237 ALA A N    6  
ATOM 6664  C CA   . ALA A 1 35 ? -8.695  9.394   8.056  1.00 0.00 ? 237 ALA A CA   6  
ATOM 6665  C C    . ALA A 1 35 ? -8.170  10.677  7.421  1.00 0.00 ? 237 ALA A C    6  
ATOM 6666  O O    . ALA A 1 35 ? -8.026  10.764  6.201  1.00 0.00 ? 237 ALA A O    6  
ATOM 6667  C CB   . ALA A 1 35 ? -7.557  8.404   8.263  1.00 0.00 ? 237 ALA A CB   6  
ATOM 6668  H H    . ALA A 1 35 ? -9.544  8.525   6.327  1.00 0.00 ? 237 ALA A H    6  
ATOM 6669  H HA   . ALA A 1 35 ? -9.113  9.629   9.023  1.00 0.00 ? 237 ALA A HA   6  
ATOM 6670  H HB1  . ALA A 1 35 ? -7.953  7.399   8.276  1.00 0.00 ? 237 ALA A HB1  6  
ATOM 6671  H HB2  . ALA A 1 35 ? -6.845  8.500   7.457  1.00 0.00 ? 237 ALA A HB2  6  
ATOM 6672  H HB3  . ALA A 1 35 ? -7.068  8.611   9.203  1.00 0.00 ? 237 ALA A HB3  6  
ATOM 6673  N N    . LYS A 1 36 ? -7.885  11.671  8.256  1.00 0.00 ? 238 LYS A N    6  
ATOM 6674  C CA   . LYS A 1 36 ? -7.373  12.950  7.776  1.00 0.00 ? 238 LYS A CA   6  
ATOM 6675  C C    . LYS A 1 36 ? -5.849  12.936  7.711  1.00 0.00 ? 238 LYS A C    6  
ATOM 6676  O O    . LYS A 1 36 ? -5.180  12.552  8.672  1.00 0.00 ? 238 LYS A O    6  
ATOM 6677  C CB   . LYS A 1 36 ? -7.846  14.085  8.685  1.00 0.00 ? 238 LYS A CB   6  
ATOM 6678  C CG   . LYS A 1 36 ? -7.471  13.890  10.146 1.00 0.00 ? 238 LYS A CG   6  
ATOM 6679  C CD   . LYS A 1 36 ? -6.474  14.939  10.614 1.00 0.00 ? 238 LYS A CD   6  
ATOM 6680  C CE   . LYS A 1 36 ? -6.155  14.786  12.093 1.00 0.00 ? 238 LYS A CE   6  
ATOM 6681  N NZ   . LYS A 1 36 ? -4.708  14.997  12.376 1.00 0.00 ? 238 LYS A NZ   6  
ATOM 6682  H H    . LYS A 1 36 ? -8.019  11.541  9.217  1.00 0.00 ? 238 LYS A H    6  
ATOM 6683  H HA   . LYS A 1 36 ? -7.761  13.110  6.781  1.00 0.00 ? 238 LYS A HA   6  
ATOM 6684  H HB2  . LYS A 1 36 ? -7.408  15.012  8.343  1.00 0.00 ? 238 LYS A HB2  6  
ATOM 6685  H HB3  . LYS A 1 36 ? -8.921  14.161  8.618  1.00 0.00 ? 238 LYS A HB3  6  
ATOM 6686  H HG2  . LYS A 1 36 ? -8.365  13.966  10.750 1.00 0.00 ? 238 LYS A HG2  6  
ATOM 6687  H HG3  . LYS A 1 36 ? -7.035  12.911  10.268 1.00 0.00 ? 238 LYS A HG3  6  
ATOM 6688  H HD2  . LYS A 1 36 ? -5.561  14.830  10.047 1.00 0.00 ? 238 LYS A HD2  6  
ATOM 6689  H HD3  . LYS A 1 36 ? -6.891  15.920  10.444 1.00 0.00 ? 238 LYS A HD3  6  
ATOM 6690  H HE2  . LYS A 1 36 ? -6.731  15.511  12.649 1.00 0.00 ? 238 LYS A HE2  6  
ATOM 6691  H HE3  . LYS A 1 36 ? -6.434  13.790  12.407 1.00 0.00 ? 238 LYS A HE3  6  
ATOM 6692  H HZ1  . LYS A 1 36 ? -4.573  15.249  13.375 1.00 0.00 ? 238 LYS A HZ1  6  
ATOM 6693  H HZ2  . LYS A 1 36 ? -4.337  15.764  11.780 1.00 0.00 ? 238 LYS A HZ2  6  
ATOM 6694  H HZ3  . LYS A 1 36 ? -4.174  14.128  12.174 1.00 0.00 ? 238 LYS A HZ3  6  
ATOM 6695  N N    . GLY A 1 37 ? -5.304  13.353  6.572  1.00 0.00 ? 239 GLY A N    6  
ATOM 6696  C CA   . GLY A 1 37 ? -3.863  13.380  6.404  1.00 0.00 ? 239 GLY A CA   6  
ATOM 6697  C C    . GLY A 1 37 ? -3.386  12.426  5.327  1.00 0.00 ? 239 GLY A C    6  
ATOM 6698  O O    . GLY A 1 37 ? -4.183  11.935  4.526  1.00 0.00 ? 239 GLY A O    6  
ATOM 6699  H H    . GLY A 1 37 ? -5.887  13.647  5.842  1.00 0.00 ? 239 GLY A H    6  
ATOM 6700  H HA2  . GLY A 1 37 ? -3.560  14.382  6.140  1.00 0.00 ? 239 GLY A HA2  6  
ATOM 6701  H HA3  . GLY A 1 37 ? -3.397  13.110  7.341  1.00 0.00 ? 239 GLY A HA3  6  
ATOM 6702  N N    . GLU A 1 38 ? -2.084  12.161  5.307  1.00 0.00 ? 240 GLU A N    6  
ATOM 6703  C CA   . GLU A 1 38 ? -1.504  11.258  4.320  1.00 0.00 ? 240 GLU A CA   6  
ATOM 6704  C C    . GLU A 1 38 ? -1.371  9.846   4.882  1.00 0.00 ? 240 GLU A C    6  
ATOM 6705  O O    . GLU A 1 38 ? -0.918  9.658   6.011  1.00 0.00 ? 240 GLU A O    6  
ATOM 6706  C CB   . GLU A 1 38 ? -0.133  11.772  3.873  1.00 0.00 ? 240 GLU A CB   6  
ATOM 6707  C CG   . GLU A 1 38 ? 0.843   11.976  5.019  1.00 0.00 ? 240 GLU A CG   6  
ATOM 6708  C CD   . GLU A 1 38 ? 2.286   12.032  4.554  1.00 0.00 ? 240 GLU A CD   6  
ATOM 6709  O OE1  . GLU A 1 38 ? 2.511   12.297  3.355  1.00 0.00 ? 240 GLU A OE1  6  
ATOM 6710  O OE2  . GLU A 1 38 ? 3.188   11.812  5.388  1.00 0.00 ? 240 GLU A OE2  6  
ATOM 6711  H H    . GLU A 1 38 ? -1.500  12.581  5.971  1.00 0.00 ? 240 GLU A H    6  
ATOM 6712  H HA   . GLU A 1 38 ? -2.163  11.232  3.465  1.00 0.00 ? 240 GLU A HA   6  
ATOM 6713  H HB2  . GLU A 1 38 ? 0.298   11.061  3.183  1.00 0.00 ? 240 GLU A HB2  6  
ATOM 6714  H HB3  . GLU A 1 38 ? -0.262  12.717  3.366  1.00 0.00 ? 240 GLU A HB3  6  
ATOM 6715  H HG2  . GLU A 1 38 ? 0.606   12.903  5.516  1.00 0.00 ? 240 GLU A HG2  6  
ATOM 6716  H HG3  . GLU A 1 38 ? 0.737   11.158  5.715  1.00 0.00 ? 240 GLU A HG3  6  
ATOM 6717  N N    . TRP A 1 39 ? -1.773  8.858   4.091  1.00 0.00 ? 241 TRP A N    6  
ATOM 6718  C CA   . TRP A 1 39 ? -1.700  7.464   4.512  1.00 0.00 ? 241 TRP A CA   6  
ATOM 6719  C C    . TRP A 1 39 ? -1.082  6.596   3.421  1.00 0.00 ? 241 TRP A C    6  
ATOM 6720  O O    . TRP A 1 39 ? -0.934  7.030   2.278  1.00 0.00 ? 241 TRP A O    6  
ATOM 6721  C CB   . TRP A 1 39 ? -3.094  6.945   4.866  1.00 0.00 ? 241 TRP A CB   6  
ATOM 6722  C CG   . TRP A 1 39 ? -3.675  7.597   6.084  1.00 0.00 ? 241 TRP A CG   6  
ATOM 6723  C CD1  . TRP A 1 39 ? -4.133  8.879   6.189  1.00 0.00 ? 241 TRP A CD1  6  
ATOM 6724  C CD2  . TRP A 1 39 ? -3.855  6.998   7.373  1.00 0.00 ? 241 TRP A CD2  6  
ATOM 6725  N NE1  . TRP A 1 39 ? -4.589  9.113   7.463  1.00 0.00 ? 241 TRP A NE1  6  
ATOM 6726  C CE2  . TRP A 1 39 ? -4.429  7.975   8.210  1.00 0.00 ? 241 TRP A CE2  6  
ATOM 6727  C CE3  . TRP A 1 39 ? -3.588  5.732   7.900  1.00 0.00 ? 241 TRP A CE3  6  
ATOM 6728  C CZ2  . TRP A 1 39 ? -4.738  7.723   9.544  1.00 0.00 ? 241 TRP A CZ2  6  
ATOM 6729  C CZ3  . TRP A 1 39 ? -3.896  5.484   9.224  1.00 0.00 ? 241 TRP A CZ3  6  
ATOM 6730  C CH2  . TRP A 1 39 ? -4.466  6.475   10.033 1.00 0.00 ? 241 TRP A CH2  6  
ATOM 6731  H H    . TRP A 1 39 ? -2.127  9.072   3.202  1.00 0.00 ? 241 TRP A H    6  
ATOM 6732  H HA   . TRP A 1 39 ? -1.074  7.415   5.390  1.00 0.00 ? 241 TRP A HA   6  
ATOM 6733  H HB2  . TRP A 1 39 ? -3.762  7.132   4.038  1.00 0.00 ? 241 TRP A HB2  6  
ATOM 6734  H HB3  . TRP A 1 39 ? -3.041  5.882   5.048  1.00 0.00 ? 241 TRP A HB3  6  
ATOM 6735  H HD1  . TRP A 1 39 ? -4.132  9.593   5.379  1.00 0.00 ? 241 TRP A HD1  6  
ATOM 6736  H HE1  . TRP A 1 39 ? -4.966  9.958   7.786  1.00 0.00 ? 241 TRP A HE1  6  
ATOM 6737  H HE3  . TRP A 1 39 ? -3.149  4.955   7.292  1.00 0.00 ? 241 TRP A HE3  6  
ATOM 6738  H HZ2  . TRP A 1 39 ? -5.178  8.475   10.181 1.00 0.00 ? 241 TRP A HZ2  6  
ATOM 6739  H HZ3  . TRP A 1 39 ? -3.697  4.511   9.648  1.00 0.00 ? 241 TRP A HZ3  6  
ATOM 6740  H HH2  . TRP A 1 39 ? -4.688  6.236   11.062 1.00 0.00 ? 241 TRP A HH2  6  
ATOM 6741  N N    . CYS A 1 40 ? -0.724  5.367   3.779  1.00 0.00 ? 242 CYS A N    6  
ATOM 6742  C CA   . CYS A 1 40 ? -0.121  4.439   2.829  1.00 0.00 ? 242 CYS A CA   6  
ATOM 6743  C C    . CYS A 1 40 ? -0.737  3.048   2.954  1.00 0.00 ? 242 CYS A C    6  
ATOM 6744  O O    . CYS A 1 40 ? -1.267  2.681   4.002  1.00 0.00 ? 242 CYS A O    6  
ATOM 6745  C CB   . CYS A 1 40 ? 1.394   4.368   3.041  1.00 0.00 ? 242 CYS A CB   6  
ATOM 6746  S SG   . CYS A 1 40 ? 2.238   3.163   1.990  1.00 0.00 ? 242 CYS A SG   6  
ATOM 6747  H H    . CYS A 1 40 ? -0.867  5.077   4.705  1.00 0.00 ? 242 CYS A H    6  
ATOM 6748  H HA   . CYS A 1 40 ? -0.316  4.816   1.834  1.00 0.00 ? 242 CYS A HA   6  
ATOM 6749  H HB2  . CYS A 1 40 ? 1.823   5.336   2.834  1.00 0.00 ? 242 CYS A HB2  6  
ATOM 6750  H HB3  . CYS A 1 40 ? 1.593   4.104   4.070  1.00 0.00 ? 242 CYS A HB3  6  
ATOM 6751  H HG   . CYS A 1 40 ? 3.134   3.059   2.317  1.00 0.00 ? 242 CYS A HG   6  
ATOM 6752  N N    . GLY A 1 41 ? -0.656  2.283   1.872  1.00 0.00 ? 243 GLY A N    6  
ATOM 6753  C CA   . GLY A 1 41 ? -1.201  0.940   1.858  1.00 0.00 ? 243 GLY A CA   6  
ATOM 6754  C C    . GLY A 1 41 ? -0.122  -0.113  1.708  1.00 0.00 ? 243 GLY A C    6  
ATOM 6755  O O    . GLY A 1 41 ? 0.686   -0.051  0.783  1.00 0.00 ? 243 GLY A O    6  
ATOM 6756  H H    . GLY A 1 41 ? -0.220  2.635   1.069  1.00 0.00 ? 243 GLY A H    6  
ATOM 6757  H HA2  . GLY A 1 41 ? -1.736  0.767   2.781  1.00 0.00 ? 243 GLY A HA2  6  
ATOM 6758  H HA3  . GLY A 1 41 ? -1.890  0.853   1.030  1.00 0.00 ? 243 GLY A HA3  6  
ATOM 6759  N N    . VAL A 1 42 ? -0.103  -1.076  2.621  1.00 0.00 ? 244 VAL A N    6  
ATOM 6760  C CA   . VAL A 1 42 ? 0.892   -2.140  2.580  1.00 0.00 ? 244 VAL A CA   6  
ATOM 6761  C C    . VAL A 1 42 ? 0.237   -3.513  2.680  1.00 0.00 ? 244 VAL A C    6  
ATOM 6762  O O    . VAL A 1 42 ? -0.593  -3.753  3.556  1.00 0.00 ? 244 VAL A O    6  
ATOM 6763  C CB   . VAL A 1 42 ? 1.920   -1.996  3.723  1.00 0.00 ? 244 VAL A CB   6  
ATOM 6764  C CG1  . VAL A 1 42 ? 3.142   -2.858  3.459  1.00 0.00 ? 244 VAL A CG1  6  
ATOM 6765  C CG2  . VAL A 1 42 ? 2.322   -0.540  3.914  1.00 0.00 ? 244 VAL A CG2  6  
ATOM 6766  H H    . VAL A 1 42 ? -0.771  -1.072  3.338  1.00 0.00 ? 244 VAL A H    6  
ATOM 6767  H HA   . VAL A 1 42 ? 1.417   -2.070  1.636  1.00 0.00 ? 244 VAL A HA   6  
ATOM 6768  H HB   . VAL A 1 42 ? 1.458   -2.341  4.636  1.00 0.00 ? 244 VAL A HB   6  
ATOM 6769  H HG11 . VAL A 1 42 ? 3.803   -2.819  4.313  1.00 0.00 ? 244 VAL A HG11 6  
ATOM 6770  H HG12 . VAL A 1 42 ? 2.832   -3.878  3.290  1.00 0.00 ? 244 VAL A HG12 6  
ATOM 6771  H HG13 . VAL A 1 42 ? 3.661   -2.492  2.586  1.00 0.00 ? 244 VAL A HG13 6  
ATOM 6772  H HG21 . VAL A 1 42 ? 2.731   -0.156  2.993  1.00 0.00 ? 244 VAL A HG21 6  
ATOM 6773  H HG22 . VAL A 1 42 ? 1.456   0.039   4.195  1.00 0.00 ? 244 VAL A HG22 6  
ATOM 6774  H HG23 . VAL A 1 42 ? 3.068   -0.474  4.695  1.00 0.00 ? 244 VAL A HG23 6  
ATOM 6775  N N    . GLU A 1 43 ? 0.623   -4.414  1.784  1.00 0.00 ? 245 GLU A N    6  
ATOM 6776  C CA   . GLU A 1 43 ? 0.085   -5.767  1.779  1.00 0.00 ? 245 GLU A CA   6  
ATOM 6777  C C    . GLU A 1 43 ? 0.861   -6.637  2.759  1.00 0.00 ? 245 GLU A C    6  
ATOM 6778  O O    . GLU A 1 43 ? 2.039   -6.921  2.552  1.00 0.00 ? 245 GLU A O    6  
ATOM 6779  C CB   . GLU A 1 43 ? 0.159   -6.368  0.373  1.00 0.00 ? 245 GLU A CB   6  
ATOM 6780  C CG   . GLU A 1 43 ? -0.391  -7.781  0.285  1.00 0.00 ? 245 GLU A CG   6  
ATOM 6781  C CD   . GLU A 1 43 ? -1.068  -8.062  -1.042 1.00 0.00 ? 245 GLU A CD   6  
ATOM 6782  O OE1  . GLU A 1 43 ? -0.806  -7.320  -2.011 1.00 0.00 ? 245 GLU A OE1  6  
ATOM 6783  O OE2  . GLU A 1 43 ? -1.861  -9.025  -1.112 1.00 0.00 ? 245 GLU A OE2  6  
ATOM 6784  H H    . GLU A 1 43 ? 1.296   -4.165  1.114  1.00 0.00 ? 245 GLU A H    6  
ATOM 6785  H HA   . GLU A 1 43 ? -0.948  -5.718  2.092  1.00 0.00 ? 245 GLU A HA   6  
ATOM 6786  H HB2  . GLU A 1 43 ? -0.406  -5.742  -0.302 1.00 0.00 ? 245 GLU A HB2  6  
ATOM 6787  H HB3  . GLU A 1 43 ? 1.192   -6.386  0.057  1.00 0.00 ? 245 GLU A HB3  6  
ATOM 6788  H HG2  . GLU A 1 43 ? 0.423   -8.480  0.411  1.00 0.00 ? 245 GLU A HG2  6  
ATOM 6789  H HG3  . GLU A 1 43 ? -1.111  -7.924  1.078  1.00 0.00 ? 245 GLU A HG3  6  
ATOM 6790  N N    . LEU A 1 44 ? 0.200   -7.040  3.837  1.00 0.00 ? 246 LEU A N    6  
ATOM 6791  C CA   . LEU A 1 44 ? 0.839   -7.855  4.861  1.00 0.00 ? 246 LEU A CA   6  
ATOM 6792  C C    . LEU A 1 44 ? 1.181   -9.245  4.337  1.00 0.00 ? 246 LEU A C    6  
ATOM 6793  O O    . LEU A 1 44 ? 0.564   -9.737  3.391  1.00 0.00 ? 246 LEU A O    6  
ATOM 6794  C CB   . LEU A 1 44 ? -0.064  -7.970  6.089  1.00 0.00 ? 246 LEU A CB   6  
ATOM 6795  C CG   . LEU A 1 44 ? -0.450  -6.637  6.736  1.00 0.00 ? 246 LEU A CG   6  
ATOM 6796  C CD1  . LEU A 1 44 ? -1.609  -6.829  7.702  1.00 0.00 ? 246 LEU A CD1  6  
ATOM 6797  C CD2  . LEU A 1 44 ? 0.747   -6.027  7.447  1.00 0.00 ? 246 LEU A CD2  6  
ATOM 6798  H H    . LEU A 1 44 ? -0.735  -6.771  3.956  1.00 0.00 ? 246 LEU A H    6  
ATOM 6799  H HA   . LEU A 1 44 ? 1.754   -7.360  5.147  1.00 0.00 ? 246 LEU A HA   6  
ATOM 6800  H HB2  . LEU A 1 44 ? -0.971  -8.480  5.796  1.00 0.00 ? 246 LEU A HB2  6  
ATOM 6801  H HB3  . LEU A 1 44 ? 0.443   -8.570  6.829  1.00 0.00 ? 246 LEU A HB3  6  
ATOM 6802  H HG   . LEU A 1 44 ? -0.768  -5.951  5.964  1.00 0.00 ? 246 LEU A HG   6  
ATOM 6803  H HD11 . LEU A 1 44 ? -2.528  -6.523  7.225  1.00 0.00 ? 246 LEU A HD11 6  
ATOM 6804  H HD12 . LEU A 1 44 ? -1.677  -7.870  7.980  1.00 0.00 ? 246 LEU A HD12 6  
ATOM 6805  H HD13 . LEU A 1 44 ? -1.444  -6.230  8.585  1.00 0.00 ? 246 LEU A HD13 6  
ATOM 6806  H HD21 . LEU A 1 44 ? 1.259   -5.351  6.777  1.00 0.00 ? 246 LEU A HD21 6  
ATOM 6807  H HD22 . LEU A 1 44 ? 0.411   -5.484  8.318  1.00 0.00 ? 246 LEU A HD22 6  
ATOM 6808  H HD23 . LEU A 1 44 ? 1.425   -6.811  7.751  1.00 0.00 ? 246 LEU A HD23 6  
ATOM 6809  N N    . ASP A 1 45 ? 2.175   -9.868  4.961  1.00 0.00 ? 247 ASP A N    6  
ATOM 6810  C CA   . ASP A 1 45 ? 2.616   -11.201 4.569  1.00 0.00 ? 247 ASP A CA   6  
ATOM 6811  C C    . ASP A 1 45 ? 1.674   -12.273 5.110  1.00 0.00 ? 247 ASP A C    6  
ATOM 6812  O O    . ASP A 1 45 ? 1.541   -13.348 4.526  1.00 0.00 ? 247 ASP A O    6  
ATOM 6813  C CB   . ASP A 1 45 ? 4.041   -11.447 5.070  1.00 0.00 ? 247 ASP A CB   6  
ATOM 6814  C CG   . ASP A 1 45 ? 5.087   -10.814 4.174  1.00 0.00 ? 247 ASP A CG   6  
ATOM 6815  O OD1  . ASP A 1 45 ? 5.398   -11.403 3.117  1.00 0.00 ? 247 ASP A OD1  6  
ATOM 6816  O OD2  . ASP A 1 45 ? 5.594   -9.729  4.527  1.00 0.00 ? 247 ASP A OD2  6  
ATOM 6817  H H    . ASP A 1 45 ? 2.626   -9.416  5.703  1.00 0.00 ? 247 ASP A H    6  
ATOM 6818  H HA   . ASP A 1 45 ? 2.612   -11.247 3.491  1.00 0.00 ? 247 ASP A HA   6  
ATOM 6819  H HB2  . ASP A 1 45 ? 4.144   -11.028 6.062  1.00 0.00 ? 247 ASP A HB2  6  
ATOM 6820  H HB3  . ASP A 1 45 ? 4.225   -12.509 5.114  1.00 0.00 ? 247 ASP A HB3  6  
ATOM 6821  N N    . GLU A 1 46 ? 1.020   -11.972 6.229  1.00 0.00 ? 248 GLU A N    6  
ATOM 6822  C CA   . GLU A 1 46 ? 0.088   -12.909 6.846  1.00 0.00 ? 248 GLU A CA   6  
ATOM 6823  C C    . GLU A 1 46 ? -1.197  -12.198 7.264  1.00 0.00 ? 248 GLU A C    6  
ATOM 6824  O O    . GLU A 1 46 ? -1.274  -10.971 7.225  1.00 0.00 ? 248 GLU A O    6  
ATOM 6825  C CB   . GLU A 1 46 ? 0.735   -13.580 8.062  1.00 0.00 ? 248 GLU A CB   6  
ATOM 6826  C CG   . GLU A 1 46 ? 1.415   -14.898 7.738  1.00 0.00 ? 248 GLU A CG   6  
ATOM 6827  C CD   . GLU A 1 46 ? 1.187   -15.951 8.805  1.00 0.00 ? 248 GLU A CD   6  
ATOM 6828  O OE1  . GLU A 1 46 ? 1.132   -15.583 9.998  1.00 0.00 ? 248 GLU A OE1  6  
ATOM 6829  O OE2  . GLU A 1 46 ? 1.061   -17.141 8.447  1.00 0.00 ? 248 GLU A OE2  6  
ATOM 6830  H H    . GLU A 1 46 ? 1.166   -11.099 6.648  1.00 0.00 ? 248 GLU A H    6  
ATOM 6831  H HA   . GLU A 1 46 ? -0.154  -13.666 6.116  1.00 0.00 ? 248 GLU A HA   6  
ATOM 6832  H HB2  . GLU A 1 46 ? 1.473   -12.909 8.478  1.00 0.00 ? 248 GLU A HB2  6  
ATOM 6833  H HB3  . GLU A 1 46 ? -0.028  -13.765 8.803  1.00 0.00 ? 248 GLU A HB3  6  
ATOM 6834  H HG2  . GLU A 1 46 ? 1.030   -15.268 6.800  1.00 0.00 ? 248 GLU A HG2  6  
ATOM 6835  H HG3  . GLU A 1 46 ? 2.479   -14.726 7.646  1.00 0.00 ? 248 GLU A HG3  6  
ATOM 6836  N N    . PRO A 1 47 ? -2.226  -12.963 7.671  1.00 0.00 ? 249 PRO A N    6  
ATOM 6837  C CA   . PRO A 1 47 ? -3.511  -12.397 8.096  1.00 0.00 ? 249 PRO A CA   6  
ATOM 6838  C C    . PRO A 1 47 ? -3.378  -11.560 9.366  1.00 0.00 ? 249 PRO A C    6  
ATOM 6839  O O    . PRO A 1 47 ? -3.855  -11.945 10.433 1.00 0.00 ? 249 PRO A O    6  
ATOM 6840  C CB   . PRO A 1 47 ? -4.394  -13.629 8.357  1.00 0.00 ? 249 PRO A CB   6  
ATOM 6841  C CG   . PRO A 1 47 ? -3.683  -14.775 7.717  1.00 0.00 ? 249 PRO A CG   6  
ATOM 6842  C CD   . PRO A 1 47 ? -2.222  -14.431 7.747  1.00 0.00 ? 249 PRO A CD   6  
ATOM 6843  H HA   . PRO A 1 47 ? -3.953  -11.793 7.316  1.00 0.00 ? 249 PRO A HA   6  
ATOM 6844  H HB2  . PRO A 1 47 ? -4.501  -13.779 9.421  1.00 0.00 ? 249 PRO A HB2  6  
ATOM 6845  H HB3  . PRO A 1 47 ? -5.366  -13.474 7.913  1.00 0.00 ? 249 PRO A HB3  6  
ATOM 6846  H HG2  . PRO A 1 47 ? -3.865  -15.679 8.280  1.00 0.00 ? 249 PRO A HG2  6  
ATOM 6847  H HG3  . PRO A 1 47 ? -4.020  -14.894 6.698  1.00 0.00 ? 249 PRO A HG3  6  
ATOM 6848  H HD2  . PRO A 1 47 ? -1.772  -14.769 8.670  1.00 0.00 ? 249 PRO A HD2  6  
ATOM 6849  H HD3  . PRO A 1 47 ? -1.714  -14.859 6.897  1.00 0.00 ? 249 PRO A HD3  6  
ATOM 6850  N N    . LEU A 1 48 ? -2.721  -10.410 9.243  1.00 0.00 ? 250 LEU A N    6  
ATOM 6851  C CA   . LEU A 1 48 ? -2.520  -9.517  10.378 1.00 0.00 ? 250 LEU A CA   6  
ATOM 6852  C C    . LEU A 1 48 ? -3.007  -8.106  10.065 1.00 0.00 ? 250 LEU A C    6  
ATOM 6853  O O    . LEU A 1 48 ? -2.536  -7.132  10.652 1.00 0.00 ? 250 LEU A O    6  
ATOM 6854  C CB   . LEU A 1 48 ? -1.041  -9.483  10.773 1.00 0.00 ? 250 LEU A CB   6  
ATOM 6855  C CG   . LEU A 1 48 ? -0.054  -9.486  9.601  1.00 0.00 ? 250 LEU A CG   6  
ATOM 6856  C CD1  . LEU A 1 48 ? 0.890   -8.297  9.690  1.00 0.00 ? 250 LEU A CD1  6  
ATOM 6857  C CD2  . LEU A 1 48 ? 0.733   -10.788 9.566  1.00 0.00 ? 250 LEU A CD2  6  
ATOM 6858  H H    . LEU A 1 48 ? -2.365  -10.157 8.366  1.00 0.00 ? 250 LEU A H    6  
ATOM 6859  H HA   . LEU A 1 48 ? -3.094  -9.904  11.208 1.00 0.00 ? 250 LEU A HA   6  
ATOM 6860  H HB2  . LEU A 1 48 ? -0.869  -8.594  11.363 1.00 0.00 ? 250 LEU A HB2  6  
ATOM 6861  H HB3  . LEU A 1 48 ? -0.837  -10.346 11.390 1.00 0.00 ? 250 LEU A HB3  6  
ATOM 6862  H HG   . LEU A 1 48 ? -0.605  -9.401  8.676  1.00 0.00 ? 250 LEU A HG   6  
ATOM 6863  H HD11 . LEU A 1 48 ? 1.333   -8.263  10.674 1.00 0.00 ? 250 LEU A HD11 6  
ATOM 6864  H HD12 . LEU A 1 48 ? 1.667   -8.397  8.947  1.00 0.00 ? 250 LEU A HD12 6  
ATOM 6865  H HD13 . LEU A 1 48 ? 0.338   -7.386  9.513  1.00 0.00 ? 250 LEU A HD13 6  
ATOM 6866  H HD21 . LEU A 1 48 ? 1.412   -10.776 8.727  1.00 0.00 ? 250 LEU A HD21 6  
ATOM 6867  H HD22 . LEU A 1 48 ? 1.293   -10.895 10.482 1.00 0.00 ? 250 LEU A HD22 6  
ATOM 6868  H HD23 . LEU A 1 48 ? 0.049   -11.618 9.463  1.00 0.00 ? 250 LEU A HD23 6  
ATOM 6869  N N    . GLY A 1 49 ? -3.953  -8.000  9.136  1.00 0.00 ? 251 GLY A N    6  
ATOM 6870  C CA   . GLY A 1 49 ? -4.485  -6.701  8.766  1.00 0.00 ? 251 GLY A CA   6  
ATOM 6871  C C    . GLY A 1 49 ? -5.909  -6.504  9.247  1.00 0.00 ? 251 GLY A C    6  
ATOM 6872  O O    . GLY A 1 49 ? -6.440  -7.334  9.986  1.00 0.00 ? 251 GLY A O    6  
ATOM 6873  H H    . GLY A 1 49 ? -4.293  -8.808  8.701  1.00 0.00 ? 251 GLY A H    6  
ATOM 6874  H HA2  . GLY A 1 49 ? -3.862  -5.932  9.199  1.00 0.00 ? 251 GLY A HA2  6  
ATOM 6875  H HA3  . GLY A 1 49 ? -4.462  -6.605  7.690  1.00 0.00 ? 251 GLY A HA3  6  
ATOM 6876  N N    . LYS A 1 50 ? -6.529  -5.404  8.835  1.00 0.00 ? 252 LYS A N    6  
ATOM 6877  C CA   . LYS A 1 50 ? -7.900  -5.104  9.236  1.00 0.00 ? 252 LYS A CA   6  
ATOM 6878  C C    . LYS A 1 50 ? -8.842  -5.110  8.036  1.00 0.00 ? 252 LYS A C    6  
ATOM 6879  O O    . LYS A 1 50 ? -10.019 -5.446  8.163  1.00 0.00 ? 252 LYS A O    6  
ATOM 6880  C CB   . LYS A 1 50 ? -7.962  -3.747  9.939  1.00 0.00 ? 252 LYS A CB   6  
ATOM 6881  C CG   . LYS A 1 50 ? -6.842  -3.527  10.941 1.00 0.00 ? 252 LYS A CG   6  
ATOM 6882  C CD   . LYS A 1 50 ? -7.086  -4.300  12.227 1.00 0.00 ? 252 LYS A CD   6  
ATOM 6883  C CE   . LYS A 1 50 ? -5.786  -4.581  12.964 1.00 0.00 ? 252 LYS A CE   6  
ATOM 6884  N NZ   . LYS A 1 50 ? -6.011  -5.372  14.206 1.00 0.00 ? 252 LYS A NZ   6  
ATOM 6885  H H    . LYS A 1 50 ? -6.054  -4.777  8.249  1.00 0.00 ? 252 LYS A H    6  
ATOM 6886  H HA   . LYS A 1 50 ? -8.216  -5.870  9.928  1.00 0.00 ? 252 LYS A HA   6  
ATOM 6887  H HB2  . LYS A 1 50 ? -7.908  -2.966  9.194  1.00 0.00 ? 252 LYS A HB2  6  
ATOM 6888  H HB3  . LYS A 1 50 ? -8.904  -3.668  10.461 1.00 0.00 ? 252 LYS A HB3  6  
ATOM 6889  H HG2  . LYS A 1 50 ? -5.911  -3.858  10.506 1.00 0.00 ? 252 LYS A HG2  6  
ATOM 6890  H HG3  . LYS A 1 50 ? -6.779  -2.473  11.172 1.00 0.00 ? 252 LYS A HG3  6  
ATOM 6891  H HD2  . LYS A 1 50 ? -7.731  -3.719  12.868 1.00 0.00 ? 252 LYS A HD2  6  
ATOM 6892  H HD3  . LYS A 1 50 ? -7.564  -5.238  11.986 1.00 0.00 ? 252 LYS A HD3  6  
ATOM 6893  H HE2  . LYS A 1 50 ? -5.130  -5.135  12.309 1.00 0.00 ? 252 LYS A HE2  6  
ATOM 6894  H HE3  . LYS A 1 50 ? -5.324  -3.641  13.224 1.00 0.00 ? 252 LYS A HE3  6  
ATOM 6895  H HZ1  . LYS A 1 50 ? -6.189  -4.734  15.007 1.00 0.00 ? 252 LYS A HZ1  6  
ATOM 6896  H HZ2  . LYS A 1 50 ? -5.174  -5.952  14.415 1.00 0.00 ? 252 LYS A HZ2  6  
ATOM 6897  H HZ3  . LYS A 1 50 ? -6.832  -5.998  14.087 1.00 0.00 ? 252 LYS A HZ3  6  
ATOM 6898  N N    . ASN A 1 51 ? -8.320  -4.736  6.870  1.00 0.00 ? 253 ASN A N    6  
ATOM 6899  C CA   . ASN A 1 51 ? -9.124  -4.699  5.652  1.00 0.00 ? 253 ASN A CA   6  
ATOM 6900  C C    . ASN A 1 51 ? -8.507  -5.570  4.563  1.00 0.00 ? 253 ASN A C    6  
ATOM 6901  O O    . ASN A 1 51 ? -7.350  -5.980  4.659  1.00 0.00 ? 253 ASN A O    6  
ATOM 6902  C CB   . ASN A 1 51 ? -9.266  -3.259  5.154  1.00 0.00 ? 253 ASN A CB   6  
ATOM 6903  C CG   . ASN A 1 51 ? -7.944  -2.664  4.709  1.00 0.00 ? 253 ASN A CG   6  
ATOM 6904  O OD1  . ASN A 1 51 ? -7.695  -2.499  3.516  1.00 0.00 ? 253 ASN A OD1  6  
ATOM 6905  N ND2  . ASN A 1 51 ? -7.089  -2.340  5.671  1.00 0.00 ? 253 ASN A ND2  6  
ATOM 6906  H H    . ASN A 1 51 ? -7.377  -4.477  6.829  1.00 0.00 ? 253 ASN A H    6  
ATOM 6907  H HA   . ASN A 1 51 ? -10.104 -5.085  5.892  1.00 0.00 ? 253 ASN A HA   6  
ATOM 6908  H HB2  . ASN A 1 51 ? -9.947  -3.242  4.316  1.00 0.00 ? 253 ASN A HB2  6  
ATOM 6909  H HB3  . ASN A 1 51 ? -9.667  -2.647  5.949  1.00 0.00 ? 253 ASN A HB3  6  
ATOM 6910  H HD21 . ASN A 1 51 ? -7.357  -2.499  6.602  1.00 0.00 ? 253 ASN A HD21 6  
ATOM 6911  H HD22 . ASN A 1 51 ? -6.225  -1.953  5.411  1.00 0.00 ? 253 ASN A HD22 6  
ATOM 6912  N N    . ASP A 1 52 ? -9.290  -5.849  3.526  1.00 0.00 ? 254 ASP A N    6  
ATOM 6913  C CA   . ASP A 1 52 ? -8.828  -6.671  2.414  1.00 0.00 ? 254 ASP A CA   6  
ATOM 6914  C C    . ASP A 1 52 ? -8.354  -5.803  1.251  1.00 0.00 ? 254 ASP A C    6  
ATOM 6915  O O    . ASP A 1 52 ? -8.369  -6.234  0.097  1.00 0.00 ? 254 ASP A O    6  
ATOM 6916  C CB   . ASP A 1 52 ? -9.941  -7.609  1.948  1.00 0.00 ? 254 ASP A CB   6  
ATOM 6917  C CG   . ASP A 1 52 ? -11.138 -6.861  1.396  1.00 0.00 ? 254 ASP A CG   6  
ATOM 6918  O OD1  . ASP A 1 52 ? -11.946 -6.354  2.201  1.00 0.00 ? 254 ASP A OD1  6  
ATOM 6919  O OD2  . ASP A 1 52 ? -11.268 -6.781  0.156  1.00 0.00 ? 254 ASP A OD2  6  
ATOM 6920  H H    . ASP A 1 52 ? -10.204 -5.493  3.509  1.00 0.00 ? 254 ASP A H    6  
ATOM 6921  H HA   . ASP A 1 52 ? -7.996  -7.262  2.766  1.00 0.00 ? 254 ASP A HA   6  
ATOM 6922  H HB2  . ASP A 1 52 ? -9.557  -8.258  1.175  1.00 0.00 ? 254 ASP A HB2  6  
ATOM 6923  H HB3  . ASP A 1 52 ? -10.270 -8.210  2.784  1.00 0.00 ? 254 ASP A HB3  6  
ATOM 6924  N N    . GLY A 1 53 ? -7.929  -4.580  1.559  1.00 0.00 ? 255 GLY A N    6  
ATOM 6925  C CA   . GLY A 1 53 ? -7.453  -3.677  0.526  1.00 0.00 ? 255 GLY A CA   6  
ATOM 6926  C C    . GLY A 1 53 ? -8.435  -2.560  0.222  1.00 0.00 ? 255 GLY A C    6  
ATOM 6927  O O    . GLY A 1 53 ? -8.303  -1.872  -0.791 1.00 0.00 ? 255 GLY A O    6  
ATOM 6928  H H    . GLY A 1 53 ? -7.932  -4.291  2.495  1.00 0.00 ? 255 GLY A H    6  
ATOM 6929  H HA2  . GLY A 1 53 ? -6.520  -3.242  0.848  1.00 0.00 ? 255 GLY A HA2  6  
ATOM 6930  H HA3  . GLY A 1 53 ? -7.280  -4.243  -0.377 1.00 0.00 ? 255 GLY A HA3  6  
ATOM 6931  N N    . ALA A 1 54 ? -9.418  -2.374  1.097  1.00 0.00 ? 256 ALA A N    6  
ATOM 6932  C CA   . ALA A 1 54 ? -10.419 -1.329  0.908  1.00 0.00 ? 256 ALA A CA   6  
ATOM 6933  C C    . ALA A 1 54 ? -10.727 -0.619  2.222  1.00 0.00 ? 256 ALA A C    6  
ATOM 6934  O O    . ALA A 1 54 ? -10.479 -1.155  3.302  1.00 0.00 ? 256 ALA A O    6  
ATOM 6935  C CB   . ALA A 1 54 ? -11.687 -1.917  0.307  1.00 0.00 ? 256 ALA A CB   6  
ATOM 6936  H H    . ALA A 1 54 ? -9.474  -2.949  1.888  1.00 0.00 ? 256 ALA A H    6  
ATOM 6937  H HA   . ALA A 1 54 ? -10.017 -0.610  0.209  1.00 0.00 ? 256 ALA A HA   6  
ATOM 6938  H HB1  . ALA A 1 54 ? -12.425 -2.051  1.085  1.00 0.00 ? 256 ALA A HB1  6  
ATOM 6939  H HB2  . ALA A 1 54 ? -12.073 -1.244  -0.444 1.00 0.00 ? 256 ALA A HB2  6  
ATOM 6940  H HB3  . ALA A 1 54 ? -11.461 -2.871  -0.145 1.00 0.00 ? 256 ALA A HB3  6  
ATOM 6941  N N    . VAL A 1 55 ? -11.267 0.592   2.121  1.00 0.00 ? 257 VAL A N    6  
ATOM 6942  C CA   . VAL A 1 55 ? -11.608 1.379   3.301  1.00 0.00 ? 257 VAL A CA   6  
ATOM 6943  C C    . VAL A 1 55 ? -12.903 2.155   3.090  1.00 0.00 ? 257 VAL A C    6  
ATOM 6944  O O    . VAL A 1 55 ? -13.020 2.949   2.158  1.00 0.00 ? 257 VAL A O    6  
ATOM 6945  C CB   . VAL A 1 55 ? -10.480 2.368   3.659  1.00 0.00 ? 257 VAL A CB   6  
ATOM 6946  C CG1  . VAL A 1 55 ? -10.808 3.119   4.941  1.00 0.00 ? 257 VAL A CG1  6  
ATOM 6947  C CG2  . VAL A 1 55 ? -9.150  1.637   3.785  1.00 0.00 ? 257 VAL A CG2  6  
ATOM 6948  H H    . VAL A 1 55 ? -11.440 0.966   1.232  1.00 0.00 ? 257 VAL A H    6  
ATOM 6949  H HA   . VAL A 1 55 ? -11.738 0.698   4.130  1.00 0.00 ? 257 VAL A HA   6  
ATOM 6950  H HB   . VAL A 1 55 ? -10.396 3.088   2.859  1.00 0.00 ? 257 VAL A HB   6  
ATOM 6951  H HG11 . VAL A 1 55 ? -11.617 2.620   5.455  1.00 0.00 ? 257 VAL A HG11 6  
ATOM 6952  H HG12 . VAL A 1 55 ? -9.936  3.141   5.579  1.00 0.00 ? 257 VAL A HG12 6  
ATOM 6953  H HG13 . VAL A 1 55 ? -11.103 4.130   4.701  1.00 0.00 ? 257 VAL A HG13 6  
ATOM 6954  H HG21 . VAL A 1 55 ? -8.372  2.346   4.022  1.00 0.00 ? 257 VAL A HG21 6  
ATOM 6955  H HG22 . VAL A 1 55 ? -9.218  0.900   4.571  1.00 0.00 ? 257 VAL A HG22 6  
ATOM 6956  H HG23 . VAL A 1 55 ? -8.920  1.147   2.851  1.00 0.00 ? 257 VAL A HG23 6  
ATOM 6957  N N    . ALA A 1 56 ? -13.877 1.920   3.967  1.00 0.00 ? 258 ALA A N    6  
ATOM 6958  C CA   . ALA A 1 56 ? -15.166 2.599   3.880  1.00 0.00 ? 258 ALA A CA   6  
ATOM 6959  C C    . ALA A 1 56 ? -15.823 2.371   2.523  1.00 0.00 ? 258 ALA A C    6  
ATOM 6960  O O    . ALA A 1 56 ? -16.616 3.193   2.061  1.00 0.00 ? 258 ALA A O    6  
ATOM 6961  C CB   . ALA A 1 56 ? -14.996 4.088   4.141  1.00 0.00 ? 258 ALA A CB   6  
ATOM 6962  H H    . ALA A 1 56 ? -13.724 1.278   4.691  1.00 0.00 ? 258 ALA A H    6  
ATOM 6963  H HA   . ALA A 1 56 ? -15.807 2.194   4.651  1.00 0.00 ? 258 ALA A HA   6  
ATOM 6964  H HB1  . ALA A 1 56 ? -14.948 4.615   3.200  1.00 0.00 ? 258 ALA A HB1  6  
ATOM 6965  H HB2  . ALA A 1 56 ? -15.836 4.451   4.717  1.00 0.00 ? 258 ALA A HB2  6  
ATOM 6966  H HB3  . ALA A 1 56 ? -14.082 4.255   4.694  1.00 0.00 ? 258 ALA A HB3  6  
ATOM 6967  N N    . GLY A 1 57 ? -15.488 1.253   1.886  1.00 0.00 ? 259 GLY A N    6  
ATOM 6968  C CA   . GLY A 1 57 ? -16.055 0.942   0.587  1.00 0.00 ? 259 GLY A CA   6  
ATOM 6969  C C    . GLY A 1 57 ? -15.200 1.448   -0.560 1.00 0.00 ? 259 GLY A C    6  
ATOM 6970  O O    . GLY A 1 57 ? -15.636 1.451   -1.712 1.00 0.00 ? 259 GLY A O    6  
ATOM 6971  H H    . GLY A 1 57 ? -14.850 0.636   2.300  1.00 0.00 ? 259 GLY A H    6  
ATOM 6972  H HA2  . GLY A 1 57 ? -16.157 -0.129  0.500  1.00 0.00 ? 259 GLY A HA2  6  
ATOM 6973  H HA3  . GLY A 1 57 ? -17.034 1.393   0.517  1.00 0.00 ? 259 GLY A HA3  6  
ATOM 6974  N N    . THR A 1 58 ? -13.978 1.875   -0.250 1.00 0.00 ? 260 THR A N    6  
ATOM 6975  C CA   . THR A 1 58 ? -13.065 2.383   -1.266 1.00 0.00 ? 260 THR A CA   6  
ATOM 6976  C C    . THR A 1 58 ? -11.820 1.506   -1.358 1.00 0.00 ? 260 THR A C    6  
ATOM 6977  O O    . THR A 1 58 ? -11.024 1.440   -0.423 1.00 0.00 ? 260 THR A O    6  
ATOM 6978  C CB   . THR A 1 58 ? -12.666 3.824   -0.948 1.00 0.00 ? 260 THR A CB   6  
ATOM 6979  O OG1  . THR A 1 58 ? -13.770 4.548   -0.435 1.00 0.00 ? 260 THR A OG1  6  
ATOM 6980  C CG2  . THR A 1 58 ? -12.139 4.579   -2.150 1.00 0.00 ? 260 THR A CG2  6  
ATOM 6981  H H    . THR A 1 58 ? -13.683 1.847   0.684  1.00 0.00 ? 260 THR A H    6  
ATOM 6982  H HA   . THR A 1 58 ? -13.578 2.361   -2.216 1.00 0.00 ? 260 THR A HA   6  
ATOM 6983  H HB   . THR A 1 58 ? -11.888 3.815   -0.198 1.00 0.00 ? 260 THR A HB   6  
ATOM 6984  H HG1  . THR A 1 58 ? -14.435 4.644   -1.119 1.00 0.00 ? 260 THR A HG1  6  
ATOM 6985  H HG21 . THR A 1 58 ? -11.115 4.869   -1.973 1.00 0.00 ? 260 THR A HG21 6  
ATOM 6986  H HG22 . THR A 1 58 ? -12.740 5.463   -2.310 1.00 0.00 ? 260 THR A HG22 6  
ATOM 6987  H HG23 . THR A 1 58 ? -12.190 3.947   -3.023 1.00 0.00 ? 260 THR A HG23 6  
ATOM 6988  N N    . ARG A 1 59 ? -11.657 0.835   -2.494 1.00 0.00 ? 261 ARG A N    6  
ATOM 6989  C CA   . ARG A 1 59 ? -10.509 -0.038  -2.705 1.00 0.00 ? 261 ARG A CA   6  
ATOM 6990  C C    . ARG A 1 59 ? -9.329  0.745   -3.270 1.00 0.00 ? 261 ARG A C    6  
ATOM 6991  O O    . ARG A 1 59 ? -9.375  1.230   -4.400 1.00 0.00 ? 261 ARG A O    6  
ATOM 6992  C CB   . ARG A 1 59 ? -10.878 -1.182  -3.651 1.00 0.00 ? 261 ARG A CB   6  
ATOM 6993  C CG   . ARG A 1 59 ? -9.821  -2.270  -3.729 1.00 0.00 ? 261 ARG A CG   6  
ATOM 6994  C CD   . ARG A 1 59 ? -9.712  -2.838  -5.135 1.00 0.00 ? 261 ARG A CD   6  
ATOM 6995  N NE   . ARG A 1 59 ? -11.012 -3.237  -5.667 1.00 0.00 ? 261 ARG A NE   6  
ATOM 6996  C CZ   . ARG A 1 59 ? -11.168 -4.008  -6.741 1.00 0.00 ? 261 ARG A CZ   6  
ATOM 6997  N NH1  . ARG A 1 59 ? -10.109 -4.464  -7.399 1.00 0.00 ? 261 ARG A NH1  6  
ATOM 6998  N NH2  . ARG A 1 59 ? -12.386 -4.324  -7.158 1.00 0.00 ? 261 ARG A NH2  6  
ATOM 6999  H H    . ARG A 1 59 ? -12.324 0.928   -3.205 1.00 0.00 ? 261 ARG A H    6  
ATOM 7000  H HA   . ARG A 1 59 ? -10.226 -0.451  -1.749 1.00 0.00 ? 261 ARG A HA   6  
ATOM 7001  H HB2  . ARG A 1 59 ? -11.800 -1.629  -3.311 1.00 0.00 ? 261 ARG A HB2  6  
ATOM 7002  H HB3  . ARG A 1 59 ? -11.026 -0.780  -4.642 1.00 0.00 ? 261 ARG A HB3  6  
ATOM 7003  H HG2  . ARG A 1 59 ? -8.866  -1.853  -3.445 1.00 0.00 ? 261 ARG A HG2  6  
ATOM 7004  H HG3  . ARG A 1 59 ? -10.086 -3.067  -3.048 1.00 0.00 ? 261 ARG A HG3  6  
ATOM 7005  H HD2  . ARG A 1 59 ? -9.286  -2.084  -5.780 1.00 0.00 ? 261 ARG A HD2  6  
ATOM 7006  H HD3  . ARG A 1 59 ? -9.060  -3.700  -5.112 1.00 0.00 ? 261 ARG A HD3  6  
ATOM 7007  H HE   . ARG A 1 59 ? -11.810 -2.915  -5.199 1.00 0.00 ? 261 ARG A HE   6  
ATOM 7008  H HH11 . ARG A 1 59 ? -9.189  -4.231  -7.090 1.00 0.00 ? 261 ARG A HH11 6  
ATOM 7009  H HH12 . ARG A 1 59 ? -10.233 -5.042  -8.205 1.00 0.00 ? 261 ARG A HH12 6  
ATOM 7010  H HH21 . ARG A 1 59 ? -13.187 -3.983  -6.666 1.00 0.00 ? 261 ARG A HH21 6  
ATOM 7011  H HH22 . ARG A 1 59 ? -12.504 -4.901  -7.965 1.00 0.00 ? 261 ARG A HH22 6  
ATOM 7012  N N    . TYR A 1 60 ? -8.270  0.864   -2.475 1.00 0.00 ? 262 TYR A N    6  
ATOM 7013  C CA   . TYR A 1 60 ? -7.076  1.589   -2.895 1.00 0.00 ? 262 TYR A CA   6  
ATOM 7014  C C    . TYR A 1 60 ? -6.118  0.667   -3.645 1.00 0.00 ? 262 TYR A C    6  
ATOM 7015  O O    . TYR A 1 60 ? -5.392  1.106   -4.537 1.00 0.00 ? 262 TYR A O    6  
ATOM 7016  C CB   . TYR A 1 60 ? -6.374  2.200   -1.682 1.00 0.00 ? 262 TYR A CB   6  
ATOM 7017  C CG   . TYR A 1 60 ? -7.155  3.322   -1.034 1.00 0.00 ? 262 TYR A CG   6  
ATOM 7018  C CD1  . TYR A 1 60 ? -8.238  3.053   -0.207 1.00 0.00 ? 262 TYR A CD1  6  
ATOM 7019  C CD2  . TYR A 1 60 ? -6.808  4.649   -1.251 1.00 0.00 ? 262 TYR A CD2  6  
ATOM 7020  C CE1  . TYR A 1 60 ? -8.956  4.076   0.385  1.00 0.00 ? 262 TYR A CE1  6  
ATOM 7021  C CE2  . TYR A 1 60 ? -7.519  5.679   -0.662 1.00 0.00 ? 262 TYR A CE2  6  
ATOM 7022  C CZ   . TYR A 1 60 ? -8.591  5.386   0.155  1.00 0.00 ? 262 TYR A CZ   6  
ATOM 7023  O OH   . TYR A 1 60 ? -9.303  6.407   0.742  1.00 0.00 ? 262 TYR A OH   6  
ATOM 7024  H H    . TYR A 1 60 ? -8.292  0.455   -1.585 1.00 0.00 ? 262 TYR A H    6  
ATOM 7025  H HA   . TYR A 1 60 ? -7.387  2.383   -3.557 1.00 0.00 ? 262 TYR A HA   6  
ATOM 7026  H HB2  . TYR A 1 60 ? -6.220  1.432   -0.938 1.00 0.00 ? 262 TYR A HB2  6  
ATOM 7027  H HB3  . TYR A 1 60 ? -5.417  2.594   -1.989 1.00 0.00 ? 262 TYR A HB3  6  
ATOM 7028  H HD1  . TYR A 1 60 ? -8.522  2.027   -0.027 1.00 0.00 ? 262 TYR A HD1  6  
ATOM 7029  H HD2  . TYR A 1 60 ? -5.969  4.874   -1.890 1.00 0.00 ? 262 TYR A HD2  6  
ATOM 7030  H HE1  . TYR A 1 60 ? -9.795  3.848   1.025  1.00 0.00 ? 262 TYR A HE1  6  
ATOM 7031  H HE2  . TYR A 1 60 ? -7.234  6.704   -0.842 1.00 0.00 ? 262 TYR A HE2  6  
ATOM 7032  H HH   . TYR A 1 60 ? -10.239 6.200   0.720  1.00 0.00 ? 262 TYR A HH   6  
ATOM 7033  N N    . PHE A 1 61 ? -6.125  -0.609  -3.278 1.00 0.00 ? 263 PHE A N    6  
ATOM 7034  C CA   . PHE A 1 61 ? -5.260  -1.593  -3.916 1.00 0.00 ? 263 PHE A CA   6  
ATOM 7035  C C    . PHE A 1 61 ? -5.822  -3.002  -3.748 1.00 0.00 ? 263 PHE A C    6  
ATOM 7036  O O    . PHE A 1 61 ? -6.818  -3.201  -3.052 1.00 0.00 ? 263 PHE A O    6  
ATOM 7037  C CB   . PHE A 1 61 ? -3.847  -1.522  -3.333 1.00 0.00 ? 263 PHE A CB   6  
ATOM 7038  C CG   . PHE A 1 61 ? -3.820  -1.429  -1.833 1.00 0.00 ? 263 PHE A CG   6  
ATOM 7039  C CD1  . PHE A 1 61 ? -4.010  -0.213  -1.199 1.00 0.00 ? 263 PHE A CD1  6  
ATOM 7040  C CD2  . PHE A 1 61 ? -3.601  -2.559  -1.060 1.00 0.00 ? 263 PHE A CD2  6  
ATOM 7041  C CE1  . PHE A 1 61 ? -3.986  -0.124  0.178  1.00 0.00 ? 263 PHE A CE1  6  
ATOM 7042  C CE2  . PHE A 1 61 ? -3.574  -2.475  0.319  1.00 0.00 ? 263 PHE A CE2  6  
ATOM 7043  C CZ   . PHE A 1 61 ? -3.766  -1.256  0.940  1.00 0.00 ? 263 PHE A CZ   6  
ATOM 7044  H H    . PHE A 1 61 ? -6.728  -0.897  -2.561 1.00 0.00 ? 263 PHE A H    6  
ATOM 7045  H HA   . PHE A 1 61 ? -5.214  -1.361  -4.971 1.00 0.00 ? 263 PHE A HA   6  
ATOM 7046  H HB2  . PHE A 1 61 ? -3.300  -2.407  -3.619 1.00 0.00 ? 263 PHE A HB2  6  
ATOM 7047  H HB3  . PHE A 1 61 ? -3.345  -0.651  -3.728 1.00 0.00 ? 263 PHE A HB3  6  
ATOM 7048  H HD1  . PHE A 1 61 ? -4.182  0.673   -1.792 1.00 0.00 ? 263 PHE A HD1  6  
ATOM 7049  H HD2  . PHE A 1 61 ? -3.451  -3.512  -1.545 1.00 0.00 ? 263 PHE A HD2  6  
ATOM 7050  H HE1  . PHE A 1 61 ? -4.135  0.831   0.661  1.00 0.00 ? 263 PHE A HE1  6  
ATOM 7051  H HE2  . PHE A 1 61 ? -3.402  -3.361  0.911  1.00 0.00 ? 263 PHE A HE2  6  
ATOM 7052  H HZ   . PHE A 1 61 ? -3.745  -1.188  2.018  1.00 0.00 ? 263 PHE A HZ   6  
ATOM 7053  N N    . GLN A 1 62 ? -5.180  -3.973  -4.389 1.00 0.00 ? 264 GLN A N    6  
ATOM 7054  C CA   . GLN A 1 62 ? -5.620  -5.360  -4.309 1.00 0.00 ? 264 GLN A CA   6  
ATOM 7055  C C    . GLN A 1 62 ? -4.702  -6.169  -3.397 1.00 0.00 ? 264 GLN A C    6  
ATOM 7056  O O    . GLN A 1 62 ? -3.487  -6.188  -3.583 1.00 0.00 ? 264 GLN A O    6  
ATOM 7057  C CB   . GLN A 1 62 ? -5.656  -5.989  -5.702 1.00 0.00 ? 264 GLN A CB   6  
ATOM 7058  C CG   . GLN A 1 62 ? -6.345  -7.343  -5.740 1.00 0.00 ? 264 GLN A CG   6  
ATOM 7059  C CD   . GLN A 1 62 ? -7.857  -7.228  -5.789 1.00 0.00 ? 264 GLN A CD   6  
ATOM 7060  O OE1  . GLN A 1 62 ? -8.436  -6.953  -6.840 1.00 0.00 ? 264 GLN A OE1  6  
ATOM 7061  N NE2  . GLN A 1 62 ? -8.503  -7.437  -4.648 1.00 0.00 ? 264 GLN A NE2  6  
ATOM 7062  H H    . GLN A 1 62 ? -4.393  -3.750  -4.929 1.00 0.00 ? 264 GLN A H    6  
ATOM 7063  H HA   . GLN A 1 62 ? -6.616  -5.368  -3.893 1.00 0.00 ? 264 GLN A HA   6  
ATOM 7064  H HB2  . GLN A 1 62 ? -6.182  -5.323  -6.371 1.00 0.00 ? 264 GLN A HB2  6  
ATOM 7065  H HB3  . GLN A 1 62 ? -4.644  -6.114  -6.055 1.00 0.00 ? 264 GLN A HB3  6  
ATOM 7066  H HG2  . GLN A 1 62 ? -6.013  -7.878  -6.617 1.00 0.00 ? 264 GLN A HG2  6  
ATOM 7067  H HG3  . GLN A 1 62 ? -6.070  -7.898  -4.856 1.00 0.00 ? 264 GLN A HG3  6  
ATOM 7068  H HE21 . GLN A 1 62 ? -7.976  -7.650  -3.849 1.00 0.00 ? 264 GLN A HE21 6  
ATOM 7069  H HE22 . GLN A 1 62 ? -9.480  -7.369  -4.651 1.00 0.00 ? 264 GLN A HE22 6  
ATOM 7070  N N    . CYS A 1 63 ? -5.294  -6.836  -2.412 1.00 0.00 ? 265 CYS A N    6  
ATOM 7071  C CA   . CYS A 1 63 ? -4.530  -7.647  -1.472 1.00 0.00 ? 265 CYS A CA   6  
ATOM 7072  C C    . CYS A 1 63 ? -5.392  -8.760  -0.885 1.00 0.00 ? 265 CYS A C    6  
ATOM 7073  O O    . CYS A 1 63 ? -6.620  -8.672  -0.878 1.00 0.00 ? 265 CYS A O    6  
ATOM 7074  C CB   . CYS A 1 63 ? -3.970  -6.772  -0.349 1.00 0.00 ? 265 CYS A CB   6  
ATOM 7075  S SG   . CYS A 1 63 ? -5.235  -5.953  0.649  1.00 0.00 ? 265 CYS A SG   6  
ATOM 7076  H H    . CYS A 1 63 ? -6.269  -6.782  -2.317 1.00 0.00 ? 265 CYS A H    6  
ATOM 7077  H HA   . CYS A 1 63 ? -3.709  -8.091  -2.012 1.00 0.00 ? 265 CYS A HA   6  
ATOM 7078  H HB2  . CYS A 1 63 ? -3.377  -7.385  0.312  1.00 0.00 ? 265 CYS A HB2  6  
ATOM 7079  H HB3  . CYS A 1 63 ? -3.344  -6.005  -0.780 1.00 0.00 ? 265 CYS A HB3  6  
ATOM 7080  H HG   . CYS A 1 63 ? -5.416  -5.098  0.255  1.00 0.00 ? 265 CYS A HG   6  
ATOM 7081  N N    . GLN A 1 64 ? -4.738  -9.805  -0.392 1.00 0.00 ? 266 GLN A N    6  
ATOM 7082  C CA   . GLN A 1 64 ? -5.438  -10.939 0.200  1.00 0.00 ? 266 GLN A CA   6  
ATOM 7083  C C    . GLN A 1 64 ? -6.264  -10.503 1.407  1.00 0.00 ? 266 GLN A C    6  
ATOM 7084  O O    . GLN A 1 64 ? -6.090  -9.399  1.924  1.00 0.00 ? 266 GLN A O    6  
ATOM 7085  C CB   . GLN A 1 64 ? -4.438  -12.020 0.616  1.00 0.00 ? 266 GLN A CB   6  
ATOM 7086  C CG   . GLN A 1 64 ? -3.989  -12.907 -0.533 1.00 0.00 ? 266 GLN A CG   6  
ATOM 7087  C CD   . GLN A 1 64 ? -3.145  -14.080 -0.070 1.00 0.00 ? 266 GLN A CD   6  
ATOM 7088  O OE1  . GLN A 1 64 ? -2.023  -14.273 -0.535 1.00 0.00 ? 266 GLN A OE1  6  
ATOM 7089  N NE2  . GLN A 1 64 ? -3.685  -14.869 0.852  1.00 0.00 ? 266 GLN A NE2  6  
ATOM 7090  H H    . GLN A 1 64 ? -3.759  -9.815  -0.426 1.00 0.00 ? 266 GLN A H    6  
ATOM 7091  H HA   . GLN A 1 64 ? -6.102  -11.346 -0.548 1.00 0.00 ? 266 GLN A HA   6  
ATOM 7092  H HB2  . GLN A 1 64 ? -3.565  -11.543 1.038  1.00 0.00 ? 266 GLN A HB2  6  
ATOM 7093  H HB3  . GLN A 1 64 ? -4.894  -12.646 1.369  1.00 0.00 ? 266 GLN A HB3  6  
ATOM 7094  H HG2  . GLN A 1 64 ? -4.862  -13.290 -1.039 1.00 0.00 ? 266 GLN A HG2  6  
ATOM 7095  H HG3  . GLN A 1 64 ? -3.406  -12.313 -1.223 1.00 0.00 ? 266 GLN A HG3  6  
ATOM 7096  H HE21 . GLN A 1 64 ? -4.585  -14.654 1.176  1.00 0.00 ? 266 GLN A HE21 6  
ATOM 7097  H HE22 . GLN A 1 64 ? -3.162  -15.634 1.168  1.00 0.00 ? 266 GLN A HE22 6  
ATOM 7098  N N    . PRO A 1 65 ? -7.182  -11.366 1.871  1.00 0.00 ? 267 PRO A N    6  
ATOM 7099  C CA   . PRO A 1 65 ? -8.039  -11.064 3.023  1.00 0.00 ? 267 PRO A CA   6  
ATOM 7100  C C    . PRO A 1 65 ? -7.232  -10.884 4.306  1.00 0.00 ? 267 PRO A C    6  
ATOM 7101  O O    . PRO A 1 65 ? -6.319  -11.658 4.590  1.00 0.00 ? 267 PRO A O    6  
ATOM 7102  C CB   . PRO A 1 65 ? -8.952  -12.294 3.136  1.00 0.00 ? 267 PRO A CB   6  
ATOM 7103  C CG   . PRO A 1 65 ? -8.846  -12.984 1.818  1.00 0.00 ? 267 PRO A CG   6  
ATOM 7104  C CD   . PRO A 1 65 ? -7.463  -12.697 1.315  1.00 0.00 ? 267 PRO A CD   6  
ATOM 7105  H HA   . PRO A 1 65 ? -8.638  -10.183 2.850  1.00 0.00 ? 267 PRO A HA   6  
ATOM 7106  H HB2  . PRO A 1 65 ? -8.606  -12.926 3.941  1.00 0.00 ? 267 PRO A HB2  6  
ATOM 7107  H HB3  . PRO A 1 65 ? -9.964  -11.976 3.334  1.00 0.00 ? 267 PRO A HB3  6  
ATOM 7108  H HG2  . PRO A 1 65 ? -8.986  -14.047 1.949  1.00 0.00 ? 267 PRO A HG2  6  
ATOM 7109  H HG3  . PRO A 1 65 ? -9.584  -12.587 1.137  1.00 0.00 ? 267 PRO A HG3  6  
ATOM 7110  H HD2  . PRO A 1 65 ? -6.763  -13.429 1.689  1.00 0.00 ? 267 PRO A HD2  6  
ATOM 7111  H HD3  . PRO A 1 65 ? -7.449  -12.674 0.234  1.00 0.00 ? 267 PRO A HD3  6  
ATOM 7112  N N    . LYS A 1 66 ? -7.576  -9.857  5.076  1.00 0.00 ? 268 LYS A N    6  
ATOM 7113  C CA   . LYS A 1 66 ? -6.885  -9.573  6.331  1.00 0.00 ? 268 LYS A CA   6  
ATOM 7114  C C    . LYS A 1 66 ? -5.408  -9.267  6.095  1.00 0.00 ? 268 LYS A C    6  
ATOM 7115  O O    . LYS A 1 66 ? -4.597  -9.343  7.019  1.00 0.00 ? 268 LYS A O    6  
ATOM 7116  C CB   . LYS A 1 66 ? -7.024  -10.756 7.291  1.00 0.00 ? 268 LYS A CB   6  
ATOM 7117  C CG   . LYS A 1 66 ? -8.452  -11.005 7.750  1.00 0.00 ? 268 LYS A CG   6  
ATOM 7118  C CD   . LYS A 1 66 ? -8.917  -9.940  8.732  1.00 0.00 ? 268 LYS A CD   6  
ATOM 7119  C CE   . LYS A 1 66 ? -9.676  -10.550 9.898  1.00 0.00 ? 268 LYS A CE   6  
ATOM 7120  N NZ   . LYS A 1 66 ? -9.786  -9.606  11.044 1.00 0.00 ? 268 LYS A NZ   6  
ATOM 7121  H H    . LYS A 1 66 ? -8.314  -9.275  4.796  1.00 0.00 ? 268 LYS A H    6  
ATOM 7122  H HA   . LYS A 1 66 ? -7.352  -8.707  6.775  1.00 0.00 ? 268 LYS A HA   6  
ATOM 7123  H HB2  . LYS A 1 66 ? -6.664  -11.648 6.801  1.00 0.00 ? 268 LYS A HB2  6  
ATOM 7124  H HB3  . LYS A 1 66 ? -6.416  -10.567 8.164  1.00 0.00 ? 268 LYS A HB3  6  
ATOM 7125  H HG2  . LYS A 1 66 ? -9.103  -10.995 6.889  1.00 0.00 ? 268 LYS A HG2  6  
ATOM 7126  H HG3  . LYS A 1 66 ? -8.501  -11.971 8.230  1.00 0.00 ? 268 LYS A HG3  6  
ATOM 7127  H HD2  . LYS A 1 66 ? -8.053  -9.414  9.114  1.00 0.00 ? 268 LYS A HD2  6  
ATOM 7128  H HD3  . LYS A 1 66 ? -9.563  -9.247  8.215  1.00 0.00 ? 268 LYS A HD3  6  
ATOM 7129  H HE2  . LYS A 1 66 ? -10.668 -10.816 9.565  1.00 0.00 ? 268 LYS A HE2  6  
ATOM 7130  H HE3  . LYS A 1 66 ? -9.157  -11.440 10.224 1.00 0.00 ? 268 LYS A HE3  6  
ATOM 7131  H HZ1  . LYS A 1 66 ? -8.996  -9.752  11.705 1.00 0.00 ? 268 LYS A HZ1  6  
ATOM 7132  H HZ2  . LYS A 1 66 ? -10.682 -9.761  11.551 1.00 0.00 ? 268 LYS A HZ2  6  
ATOM 7133  H HZ3  . LYS A 1 66 ? -9.760  -8.624  10.703 1.00 0.00 ? 268 LYS A HZ3  6  
ATOM 7134  N N    . TYR A 1 67 ? -5.060  -8.917  4.859  1.00 0.00 ? 269 TYR A N    6  
ATOM 7135  C CA   . TYR A 1 67 ? -3.677  -8.597  4.518  1.00 0.00 ? 269 TYR A CA   6  
ATOM 7136  C C    . TYR A 1 67 ? -3.511  -7.102  4.252  1.00 0.00 ? 269 TYR A C    6  
ATOM 7137  O O    . TYR A 1 67 ? -2.399  -6.576  4.292  1.00 0.00 ? 269 TYR A O    6  
ATOM 7138  C CB   . TYR A 1 67 ? -3.229  -9.390  3.287  1.00 0.00 ? 269 TYR A CB   6  
ATOM 7139  C CG   . TYR A 1 67 ? -2.722  -10.780 3.602  1.00 0.00 ? 269 TYR A CG   6  
ATOM 7140  C CD1  . TYR A 1 67 ? -3.338  -11.565 4.567  1.00 0.00 ? 269 TYR A CD1  6  
ATOM 7141  C CD2  . TYR A 1 67 ? -1.625  -11.305 2.931  1.00 0.00 ? 269 TYR A CD2  6  
ATOM 7142  C CE1  . TYR A 1 67 ? -2.876  -12.835 4.855  1.00 0.00 ? 269 TYR A CE1  6  
ATOM 7143  C CE2  . TYR A 1 67 ? -1.157  -12.575 3.213  1.00 0.00 ? 269 TYR A CE2  6  
ATOM 7144  C CZ   . TYR A 1 67 ? -1.787  -13.335 4.175  1.00 0.00 ? 269 TYR A CZ   6  
ATOM 7145  O OH   . TYR A 1 67 ? -1.326  -14.600 4.459  1.00 0.00 ? 269 TYR A OH   6  
ATOM 7146  H H    . TYR A 1 67 ? -5.747  -8.869  4.162  1.00 0.00 ? 269 TYR A H    6  
ATOM 7147  H HA   . TYR A 1 67 ? -3.055  -8.872  5.357  1.00 0.00 ? 269 TYR A HA   6  
ATOM 7148  H HB2  . TYR A 1 67 ? -4.061  -9.490  2.610  1.00 0.00 ? 269 TYR A HB2  6  
ATOM 7149  H HB3  . TYR A 1 67 ? -2.435  -8.851  2.791  1.00 0.00 ? 269 TYR A HB3  6  
ATOM 7150  H HD1  . TYR A 1 67 ? -4.192  -11.170 5.098  1.00 0.00 ? 269 TYR A HD1  6  
ATOM 7151  H HD2  . TYR A 1 67 ? -1.133  -10.707 2.178  1.00 0.00 ? 269 TYR A HD2  6  
ATOM 7152  H HE1  . TYR A 1 67 ? -3.370  -13.430 5.608  1.00 0.00 ? 269 TYR A HE1  6  
ATOM 7153  H HE2  . TYR A 1 67 ? -0.303  -12.965 2.681  1.00 0.00 ? 269 TYR A HE2  6  
ATOM 7154  H HH   . TYR A 1 67 ? -1.825  -15.244 3.953  1.00 0.00 ? 269 TYR A HH   6  
ATOM 7155  N N    . GLY A 1 68 ? -4.621  -6.422  3.978  1.00 0.00 ? 270 GLY A N    6  
ATOM 7156  C CA   . GLY A 1 68 ? -4.569  -4.998  3.709  1.00 0.00 ? 270 GLY A CA   6  
ATOM 7157  C C    . GLY A 1 68 ? -4.442  -4.168  4.971  1.00 0.00 ? 270 GLY A C    6  
ATOM 7158  O O    . GLY A 1 68 ? -5.312  -4.210  5.840  1.00 0.00 ? 270 GLY A O    6  
ATOM 7159  H H    . GLY A 1 68 ? -5.482  -6.890  3.959  1.00 0.00 ? 270 GLY A H    6  
ATOM 7160  H HA2  . GLY A 1 68 ? -3.720  -4.794  3.071  1.00 0.00 ? 270 GLY A HA2  6  
ATOM 7161  H HA3  . GLY A 1 68 ? -5.471  -4.708  3.190  1.00 0.00 ? 270 GLY A HA3  6  
ATOM 7162  N N    . LEU A 1 69 ? -3.355  -3.409  5.067  1.00 0.00 ? 271 LEU A N    6  
ATOM 7163  C CA   . LEU A 1 69 ? -3.115  -2.560  6.227  1.00 0.00 ? 271 LEU A CA   6  
ATOM 7164  C C    . LEU A 1 69 ? -2.808  -1.132  5.787  1.00 0.00 ? 271 LEU A C    6  
ATOM 7165  O O    . LEU A 1 69 ? -1.925  -0.902  4.959  1.00 0.00 ? 271 LEU A O    6  
ATOM 7166  C CB   . LEU A 1 69 ? -1.959  -3.114  7.063  1.00 0.00 ? 271 LEU A CB   6  
ATOM 7167  C CG   . LEU A 1 69 ? -2.030  -2.797  8.558  1.00 0.00 ? 271 LEU A CG   6  
ATOM 7168  C CD1  . LEU A 1 69 ? -3.268  -3.426  9.182  1.00 0.00 ? 271 LEU A CD1  6  
ATOM 7169  C CD2  . LEU A 1 69 ? -0.772  -3.278  9.265  1.00 0.00 ? 271 LEU A CD2  6  
ATOM 7170  H H    . LEU A 1 69 ? -2.701  -3.418  4.339  1.00 0.00 ? 271 LEU A H    6  
ATOM 7171  H HA   . LEU A 1 69 ? -4.013  -2.554  6.827  1.00 0.00 ? 271 LEU A HA   6  
ATOM 7172  H HB2  . LEU A 1 69 ? -1.943  -4.189  6.944  1.00 0.00 ? 271 LEU A HB2  6  
ATOM 7173  H HB3  . LEU A 1 69 ? -1.037  -2.713  6.676  1.00 0.00 ? 271 LEU A HB3  6  
ATOM 7174  H HG   . LEU A 1 69 ? -2.101  -1.727  8.689  1.00 0.00 ? 271 LEU A HG   6  
ATOM 7175  H HD11 . LEU A 1 69 ? -3.780  -2.693  9.786  1.00 0.00 ? 271 LEU A HD11 6  
ATOM 7176  H HD12 . LEU A 1 69 ? -3.930  -3.774  8.402  1.00 0.00 ? 271 LEU A HD12 6  
ATOM 7177  H HD13 . LEU A 1 69 ? -2.974  -4.260  9.803  1.00 0.00 ? 271 LEU A HD13 6  
ATOM 7178  H HD21 . LEU A 1 69 ? 0.005   -3.456  8.536  1.00 0.00 ? 271 LEU A HD21 6  
ATOM 7179  H HD22 . LEU A 1 69 ? -0.441  -2.524  9.964  1.00 0.00 ? 271 LEU A HD22 6  
ATOM 7180  H HD23 . LEU A 1 69 ? -0.983  -4.194  9.797  1.00 0.00 ? 271 LEU A HD23 6  
ATOM 7181  N N    . PHE A 1 70 ? -3.551  -0.176  6.334  1.00 0.00 ? 272 PHE A N    6  
ATOM 7182  C CA   . PHE A 1 70 ? -3.369  1.229   5.985  1.00 0.00 ? 272 PHE A CA   6  
ATOM 7183  C C    . PHE A 1 70 ? -2.675  1.997   7.105  1.00 0.00 ? 272 PHE A C    6  
ATOM 7184  O O    . PHE A 1 70 ? -3.246  2.195   8.175  1.00 0.00 ? 272 PHE A O    6  
ATOM 7185  C CB   . PHE A 1 70 ? -4.727  1.873   5.692  1.00 0.00 ? 272 PHE A CB   6  
ATOM 7186  C CG   . PHE A 1 70 ? -5.277  1.533   4.336  1.00 0.00 ? 272 PHE A CG   6  
ATOM 7187  C CD1  . PHE A 1 70 ? -5.392  0.214   3.931  1.00 0.00 ? 272 PHE A CD1  6  
ATOM 7188  C CD2  . PHE A 1 70 ? -5.684  2.536   3.472  1.00 0.00 ? 272 PHE A CD2  6  
ATOM 7189  C CE1  . PHE A 1 70 ? -5.903  -0.100  2.686  1.00 0.00 ? 272 PHE A CE1  6  
ATOM 7190  C CE2  . PHE A 1 70 ? -6.195  2.229   2.225  1.00 0.00 ? 272 PHE A CE2  6  
ATOM 7191  C CZ   . PHE A 1 70 ? -6.305  0.910   1.832  1.00 0.00 ? 272 PHE A CZ   6  
ATOM 7192  H H    . PHE A 1 70 ? -4.246  -0.422  6.979  1.00 0.00 ? 272 PHE A H    6  
ATOM 7193  H HA   . PHE A 1 70 ? -2.759  1.276   5.096  1.00 0.00 ? 272 PHE A HA   6  
ATOM 7194  H HB2  . PHE A 1 70 ? -5.440  1.540   6.430  1.00 0.00 ? 272 PHE A HB2  6  
ATOM 7195  H HB3  . PHE A 1 70 ? -4.627  2.946   5.753  1.00 0.00 ? 272 PHE A HB3  6  
ATOM 7196  H HD1  . PHE A 1 70 ? -5.078  -0.573  4.597  1.00 0.00 ? 272 PHE A HD1  6  
ATOM 7197  H HD2  . PHE A 1 70 ? -5.599  3.569   3.778  1.00 0.00 ? 272 PHE A HD2  6  
ATOM 7198  H HE1  . PHE A 1 70 ? -5.987  -1.131  2.380  1.00 0.00 ? 272 PHE A HE1  6  
ATOM 7199  H HE2  . PHE A 1 70 ? -6.508  3.019   1.560  1.00 0.00 ? 272 PHE A HE2  6  
ATOM 7200  H HZ   . PHE A 1 70 ? -6.704  0.667   0.858  1.00 0.00 ? 272 PHE A HZ   6  
ATOM 7201  N N    . ALA A 1 71 ? -1.449  2.446   6.848  1.00 0.00 ? 273 ALA A N    6  
ATOM 7202  C CA   . ALA A 1 71 ? -0.695  3.211   7.837  1.00 0.00 ? 273 ALA A CA   6  
ATOM 7203  C C    . ALA A 1 71 ? 0.085   4.347   7.175  1.00 0.00 ? 273 ALA A C    6  
ATOM 7204  O O    . ALA A 1 71 ? 0.515   4.233   6.029  1.00 0.00 ? 273 ALA A O    6  
ATOM 7205  C CB   . ALA A 1 71 ? 0.250   2.311   8.620  1.00 0.00 ? 273 ALA A CB   6  
ATOM 7206  H H    . ALA A 1 71 ? -1.048  2.270   5.971  1.00 0.00 ? 273 ALA A H    6  
ATOM 7207  H HA   . ALA A 1 71 ? -1.404  3.637   8.532  1.00 0.00 ? 273 ALA A HA   6  
ATOM 7208  H HB1  . ALA A 1 71 ? 0.576   2.825   9.515  1.00 0.00 ? 273 ALA A HB1  6  
ATOM 7209  H HB2  . ALA A 1 71 ? -0.263  1.403   8.898  1.00 0.00 ? 273 ALA A HB2  6  
ATOM 7210  H HB3  . ALA A 1 71 ? 1.109   2.071   8.013  1.00 0.00 ? 273 ALA A HB3  6  
ATOM 7211  N N    . PRO A 1 72 ? 0.270   5.462   7.899  1.00 0.00 ? 274 PRO A N    6  
ATOM 7212  C CA   . PRO A 1 72 ? 0.996   6.631   7.393  1.00 0.00 ? 274 PRO A CA   6  
ATOM 7213  C C    . PRO A 1 72 ? 2.328   6.266   6.748  1.00 0.00 ? 274 PRO A C    6  
ATOM 7214  O O    . PRO A 1 72 ? 2.857   5.176   6.966  1.00 0.00 ? 274 PRO A O    6  
ATOM 7215  C CB   . PRO A 1 72 ? 1.232   7.466   8.649  1.00 0.00 ? 274 PRO A CB   6  
ATOM 7216  C CG   . PRO A 1 72 ? 0.115   7.107   9.562  1.00 0.00 ? 274 PRO A CG   6  
ATOM 7217  C CD   . PRO A 1 72 ? -0.220  5.669   9.275  1.00 0.00 ? 274 PRO A CD   6  
ATOM 7218  H HA   . PRO A 1 72 ? 0.399   7.194   6.690  1.00 0.00 ? 274 PRO A HA   6  
ATOM 7219  H HB2  . PRO A 1 72 ? 2.189   7.207   9.075  1.00 0.00 ? 274 PRO A HB2  6  
ATOM 7220  H HB3  . PRO A 1 72 ? 1.214   8.516   8.396  1.00 0.00 ? 274 PRO A HB3  6  
ATOM 7221  H HG2  . PRO A 1 72 ? 0.435   7.217   10.588 1.00 0.00 ? 274 PRO A HG2  6  
ATOM 7222  H HG3  . PRO A 1 72 ? -0.740  7.737   9.365  1.00 0.00 ? 274 PRO A HG3  6  
ATOM 7223  H HD2  . PRO A 1 72 ? 0.293   5.017   9.966  1.00 0.00 ? 274 PRO A HD2  6  
ATOM 7224  H HD3  . PRO A 1 72 ? -1.286  5.511   9.326  1.00 0.00 ? 274 PRO A HD3  6  
ATOM 7225  N N    . VAL A 1 73 ? 2.867   7.191   5.958  1.00 0.00 ? 275 VAL A N    6  
ATOM 7226  C CA   . VAL A 1 73 ? 4.140   6.973   5.286  1.00 0.00 ? 275 VAL A CA   6  
ATOM 7227  C C    . VAL A 1 73 ? 5.292   6.967   6.287  1.00 0.00 ? 275 VAL A C    6  
ATOM 7228  O O    . VAL A 1 73 ? 6.251   6.210   6.140  1.00 0.00 ? 275 VAL A O    6  
ATOM 7229  C CB   . VAL A 1 73 ? 4.401   8.054   4.217  1.00 0.00 ? 275 VAL A CB   6  
ATOM 7230  C CG1  . VAL A 1 73 ? 4.469   9.435   4.851  1.00 0.00 ? 275 VAL A CG1  6  
ATOM 7231  C CG2  . VAL A 1 73 ? 5.679   7.749   3.447  1.00 0.00 ? 275 VAL A CG2  6  
ATOM 7232  H H    . VAL A 1 73 ? 2.396   8.041   5.829  1.00 0.00 ? 275 VAL A H    6  
ATOM 7233  H HA   . VAL A 1 73 ? 4.098   6.013   4.795  1.00 0.00 ? 275 VAL A HA   6  
ATOM 7234  H HB   . VAL A 1 73 ? 3.577   8.047   3.518  1.00 0.00 ? 275 VAL A HB   6  
ATOM 7235  H HG11 . VAL A 1 73 ? 3.761   9.493   5.665  1.00 0.00 ? 275 VAL A HG11 6  
ATOM 7236  H HG12 . VAL A 1 73 ? 5.467   9.608   5.229  1.00 0.00 ? 275 VAL A HG12 6  
ATOM 7237  H HG13 . VAL A 1 73 ? 4.230   10.183  4.112  1.00 0.00 ? 275 VAL A HG13 6  
ATOM 7238  H HG21 . VAL A 1 73 ? 5.923   6.703   3.554  1.00 0.00 ? 275 VAL A HG21 6  
ATOM 7239  H HG22 . VAL A 1 73 ? 5.533   7.979   2.403  1.00 0.00 ? 275 VAL A HG22 6  
ATOM 7240  H HG23 . VAL A 1 73 ? 6.487   8.349   3.839  1.00 0.00 ? 275 VAL A HG23 6  
ATOM 7241  N N    . HIS A 1 74 ? 5.191   7.816   7.307  1.00 0.00 ? 276 HIS A N    6  
ATOM 7242  C CA   . HIS A 1 74 ? 6.227   7.903   8.332  1.00 0.00 ? 276 HIS A CA   6  
ATOM 7243  C C    . HIS A 1 74 ? 6.152   6.712   9.284  1.00 0.00 ? 276 HIS A C    6  
ATOM 7244  O O    . HIS A 1 74 ? 7.150   6.338   9.901  1.00 0.00 ? 276 HIS A O    6  
ATOM 7245  C CB   . HIS A 1 74 ? 6.111   9.213   9.117  1.00 0.00 ? 276 HIS A CB   6  
ATOM 7246  C CG   . HIS A 1 74 ? 4.706   9.594   9.471  1.00 0.00 ? 276 HIS A CG   6  
ATOM 7247  N ND1  . HIS A 1 74 ? 4.214   10.873  9.314  1.00 0.00 ? 276 HIS A ND1  6  
ATOM 7248  C CD2  . HIS A 1 74 ? 3.688   8.860   9.977  1.00 0.00 ? 276 HIS A CD2  6  
ATOM 7249  C CE1  . HIS A 1 74 ? 2.954   10.909  9.710  1.00 0.00 ? 276 HIS A CE1  6  
ATOM 7250  N NE2  . HIS A 1 74 ? 2.611   9.702   10.116 1.00 0.00 ? 276 HIS A NE2  6  
ATOM 7251  H H    . HIS A 1 74 ? 4.402   8.393   7.372  1.00 0.00 ? 276 HIS A H    6  
ATOM 7252  H HA   . HIS A 1 74 ? 7.182   7.881   7.831  1.00 0.00 ? 276 HIS A HA   6  
ATOM 7253  H HB2  . HIS A 1 74 ? 6.669   9.121   10.037 1.00 0.00 ? 276 HIS A HB2  6  
ATOM 7254  H HB3  . HIS A 1 74 ? 6.533   10.014  8.526  1.00 0.00 ? 276 HIS A HB3  6  
ATOM 7255  H HD1  . HIS A 1 74 ? 4.713   11.640  8.965  1.00 0.00 ? 276 HIS A HD1  6  
ATOM 7256  H HD2  . HIS A 1 74 ? 3.713   7.808   10.221 1.00 0.00 ? 276 HIS A HD2  6  
ATOM 7257  H HE1  . HIS A 1 74 ? 2.313   11.780  9.702  1.00 0.00 ? 276 HIS A HE1  6  
ATOM 7258  H HE2  . HIS A 1 74 ? 1.752   9.466   10.524 1.00 0.00 ? 276 HIS A HE2  6  
ATOM 7259  N N    . LYS A 1 75 ? 4.970   6.113   9.394  1.00 0.00 ? 277 LYS A N    6  
ATOM 7260  C CA   . LYS A 1 75 ? 4.779   4.958   10.264 1.00 0.00 ? 277 LYS A CA   6  
ATOM 7261  C C    . LYS A 1 75 ? 5.320   3.694   9.609  1.00 0.00 ? 277 LYS A C    6  
ATOM 7262  O O    . LYS A 1 75 ? 5.597   2.704   10.285 1.00 0.00 ? 277 LYS A O    6  
ATOM 7263  C CB   . LYS A 1 75 ? 3.299   4.773   10.596 1.00 0.00 ? 277 LYS A CB   6  
ATOM 7264  C CG   . LYS A 1 75 ? 2.806   5.674   11.715 1.00 0.00 ? 277 LYS A CG   6  
ATOM 7265  C CD   . LYS A 1 75 ? 2.386   4.866   12.934 1.00 0.00 ? 277 LYS A CD   6  
ATOM 7266  C CE   . LYS A 1 75 ? 3.514   4.746   13.946 1.00 0.00 ? 277 LYS A CE   6  
ATOM 7267  N NZ   . LYS A 1 75 ? 4.124   6.069   14.259 1.00 0.00 ? 277 LYS A NZ   6  
ATOM 7268  H H    . LYS A 1 75 ? 4.211   6.449   8.872  1.00 0.00 ? 277 LYS A H    6  
ATOM 7269  H HA   . LYS A 1 75 ? 5.325   5.138   11.178 1.00 0.00 ? 277 LYS A HA   6  
ATOM 7270  H HB2  . LYS A 1 75 ? 2.716   4.984   9.712  1.00 0.00 ? 277 LYS A HB2  6  
ATOM 7271  H HB3  . LYS A 1 75 ? 3.134   3.747   10.888 1.00 0.00 ? 277 LYS A HB3  6  
ATOM 7272  H HG2  . LYS A 1 75 ? 3.601   6.349   11.999 1.00 0.00 ? 277 LYS A HG2  6  
ATOM 7273  H HG3  . LYS A 1 75 ? 1.958   6.241   11.362 1.00 0.00 ? 277 LYS A HG3  6  
ATOM 7274  H HD2  . LYS A 1 75 ? 1.547   5.352   13.403 1.00 0.00 ? 277 LYS A HD2  6  
ATOM 7275  H HD3  . LYS A 1 75 ? 2.097   3.875   12.611 1.00 0.00 ? 277 LYS A HD3  6  
ATOM 7276  H HE2  . LYS A 1 75 ? 3.120   4.320   14.856 1.00 0.00 ? 277 LYS A HE2  6  
ATOM 7277  H HE3  . LYS A 1 75 ? 4.275   4.094   13.543 1.00 0.00 ? 277 LYS A HE3  6  
ATOM 7278  H HZ1  . LYS A 1 75 ? 3.493   6.838   13.953 1.00 0.00 ? 277 LYS A HZ1  6  
ATOM 7279  H HZ2  . LYS A 1 75 ? 5.036   6.167   13.767 1.00 0.00 ? 277 LYS A HZ2  6  
ATOM 7280  H HZ3  . LYS A 1 75 ? 4.287   6.155   15.282 1.00 0.00 ? 277 LYS A HZ3  6  
ATOM 7281  N N    . VAL A 1 76 ? 5.469   3.733   8.289  1.00 0.00 ? 278 VAL A N    6  
ATOM 7282  C CA   . VAL A 1 76 ? 5.977   2.588   7.551  1.00 0.00 ? 278 VAL A CA   6  
ATOM 7283  C C    . VAL A 1 76 ? 7.484   2.692   7.343  1.00 0.00 ? 278 VAL A C    6  
ATOM 7284  O O    . VAL A 1 76 ? 8.013   3.770   7.075  1.00 0.00 ? 278 VAL A O    6  
ATOM 7285  C CB   . VAL A 1 76 ? 5.287   2.442   6.182  1.00 0.00 ? 278 VAL A CB   6  
ATOM 7286  C CG1  . VAL A 1 76 ? 5.719   1.154   5.504  1.00 0.00 ? 278 VAL A CG1  6  
ATOM 7287  C CG2  . VAL A 1 76 ? 3.774   2.481   6.334  1.00 0.00 ? 278 VAL A CG2  6  
ATOM 7288  H H    . VAL A 1 76 ? 5.229   4.551   7.803  1.00 0.00 ? 278 VAL A H    6  
ATOM 7289  H HA   . VAL A 1 76 ? 5.768   1.704   8.131  1.00 0.00 ? 278 VAL A HA   6  
ATOM 7290  H HB   . VAL A 1 76 ? 5.588   3.270   5.557  1.00 0.00 ? 278 VAL A HB   6  
ATOM 7291  H HG11 . VAL A 1 76 ? 6.613   1.333   4.926  1.00 0.00 ? 278 VAL A HG11 6  
ATOM 7292  H HG12 . VAL A 1 76 ? 5.918   0.403   6.253  1.00 0.00 ? 278 VAL A HG12 6  
ATOM 7293  H HG13 . VAL A 1 76 ? 4.930   0.811   4.852  1.00 0.00 ? 278 VAL A HG13 6  
ATOM 7294  H HG21 . VAL A 1 76 ? 3.352   1.562   5.956  1.00 0.00 ? 278 VAL A HG21 6  
ATOM 7295  H HG22 . VAL A 1 76 ? 3.520   2.592   7.377  1.00 0.00 ? 278 VAL A HG22 6  
ATOM 7296  H HG23 . VAL A 1 76 ? 3.379   3.315   5.775  1.00 0.00 ? 278 VAL A HG23 6  
ATOM 7297  N N    . THR A 1 77 ? 8.167   1.561   7.473  1.00 0.00 ? 279 THR A N    6  
ATOM 7298  C CA   . THR A 1 77 ? 9.613   1.518   7.304  1.00 0.00 ? 279 THR A CA   6  
ATOM 7299  C C    . THR A 1 77 ? 10.024  0.343   6.425  1.00 0.00 ? 279 THR A C    6  
ATOM 7300  O O    . THR A 1 77 ? 9.499   -0.763  6.565  1.00 0.00 ? 279 THR A O    6  
ATOM 7301  C CB   . THR A 1 77 ? 10.303  1.419   8.665  1.00 0.00 ? 279 THR A CB   6  
ATOM 7302  O OG1  . THR A 1 77 ? 9.413   1.774   9.709  1.00 0.00 ? 279 THR A OG1  6  
ATOM 7303  C CG2  . THR A 1 77 ? 11.523  2.305   8.785  1.00 0.00 ? 279 THR A CG2  6  
ATOM 7304  H H    . THR A 1 77 ? 7.687   0.735   7.691  1.00 0.00 ? 279 THR A H    6  
ATOM 7305  H HA   . THR A 1 77 ? 9.918   2.436   6.823  1.00 0.00 ? 279 THR A HA   6  
ATOM 7306  H HB   . THR A 1 77 ? 10.620  0.398   8.824  1.00 0.00 ? 279 THR A HB   6  
ATOM 7307  H HG1  . THR A 1 77 ? 8.943   0.994   10.010 1.00 0.00 ? 279 THR A HG1  6  
ATOM 7308  H HG21 . THR A 1 77 ? 11.618  2.650   9.804  1.00 0.00 ? 279 THR A HG21 6  
ATOM 7309  H HG22 . THR A 1 77 ? 11.416  3.154   8.127  1.00 0.00 ? 279 THR A HG22 6  
ATOM 7310  H HG23 . THR A 1 77 ? 12.404  1.744   8.510  1.00 0.00 ? 279 THR A HG23 6  
ATOM 7311  N N    . LYS A 1 78 ? 10.965  0.586   5.519  1.00 0.00 ? 280 LYS A N    6  
ATOM 7312  C CA   . LYS A 1 78 ? 11.446  -0.453  4.617  1.00 0.00 ? 280 LYS A CA   6  
ATOM 7313  C C    . LYS A 1 78 ? 12.174  -1.548  5.392  1.00 0.00 ? 280 LYS A C    6  
ATOM 7314  O O    . LYS A 1 78 ? 13.016  -1.265  6.243  1.00 0.00 ? 280 LYS A O    6  
ATOM 7315  C CB   . LYS A 1 78 ? 12.373  0.151   3.559  1.00 0.00 ? 280 LYS A CB   6  
ATOM 7316  C CG   . LYS A 1 78 ? 11.809  0.086   2.149  1.00 0.00 ? 280 LYS A CG   6  
ATOM 7317  C CD   . LYS A 1 78 ? 12.715  0.790   1.150  1.00 0.00 ? 280 LYS A CD   6  
ATOM 7318  C CE   . LYS A 1 78 ? 12.055  2.037   0.582  1.00 0.00 ? 280 LYS A CE   6  
ATOM 7319  N NZ   . LYS A 1 78 ? 11.966  3.127   1.592  1.00 0.00 ? 280 LYS A NZ   6  
ATOM 7320  H H    . LYS A 1 78 ? 11.346  1.487   5.455  1.00 0.00 ? 280 LYS A H    6  
ATOM 7321  H HA   . LYS A 1 78 ? 10.589  -0.887  4.126  1.00 0.00 ? 280 LYS A HA   6  
ATOM 7322  H HB2  . LYS A 1 78 ? 12.553  1.187   3.804  1.00 0.00 ? 280 LYS A HB2  6  
ATOM 7323  H HB3  . LYS A 1 78 ? 13.314  -0.380  3.572  1.00 0.00 ? 280 LYS A HB3  6  
ATOM 7324  H HG2  . LYS A 1 78 ? 11.709  -0.950  1.860  1.00 0.00 ? 280 LYS A HG2  6  
ATOM 7325  H HG3  . LYS A 1 78 ? 10.838  0.559   2.139  1.00 0.00 ? 280 LYS A HG3  6  
ATOM 7326  H HD2  . LYS A 1 78 ? 13.631  1.074   1.646  1.00 0.00 ? 280 LYS A HD2  6  
ATOM 7327  H HD3  . LYS A 1 78 ? 12.938  0.110   0.340  1.00 0.00 ? 280 LYS A HD3  6  
ATOM 7328  H HE2  . LYS A 1 78 ? 12.638  2.384   -0.259 1.00 0.00 ? 280 LYS A HE2  6  
ATOM 7329  H HE3  . LYS A 1 78 ? 11.061  1.783   0.248  1.00 0.00 ? 280 LYS A HE3  6  
ATOM 7330  H HZ1  . LYS A 1 78 ? 11.492  2.781   2.450  1.00 0.00 ? 280 LYS A HZ1  6  
ATOM 7331  H HZ2  . LYS A 1 78 ? 11.423  3.926   1.207  1.00 0.00 ? 280 LYS A HZ2  6  
ATOM 7332  H HZ3  . LYS A 1 78 ? 12.918  3.460   1.845  1.00 0.00 ? 280 LYS A HZ3  6  
ATOM 7333  N N    . ILE A 1 79 ? 11.842  -2.799  5.090  1.00 0.00 ? 281 ILE A N    6  
ATOM 7334  C CA   . ILE A 1 79 ? 12.464  -3.937  5.758  1.00 0.00 ? 281 ILE A CA   6  
ATOM 7335  C C    . ILE A 1 79 ? 13.806  -4.281  5.120  1.00 0.00 ? 281 ILE A C    6  
ATOM 7336  O O    . ILE A 1 79 ? 14.704  -4.802  5.782  1.00 0.00 ? 281 ILE A O    6  
ATOM 7337  C CB   . ILE A 1 79 ? 11.549  -5.177  5.720  1.00 0.00 ? 281 ILE A CB   6  
ATOM 7338  C CG1  . ILE A 1 79 ? 12.178  -6.332  6.503  1.00 0.00 ? 281 ILE A CG1  6  
ATOM 7339  C CG2  . ILE A 1 79 ? 11.273  -5.594  4.282  1.00 0.00 ? 281 ILE A CG2  6  
ATOM 7340  C CD1  . ILE A 1 79 ? 11.170  -7.340  7.008  1.00 0.00 ? 281 ILE A CD1  6  
ATOM 7341  H H    . ILE A 1 79 ? 11.164  -2.960  4.402  1.00 0.00 ? 281 ILE A H    6  
ATOM 7342  H HA   . ILE A 1 79 ? 12.627  -3.668  6.792  1.00 0.00 ? 281 ILE A HA   6  
ATOM 7343  H HB   . ILE A 1 79 ? 10.607  -4.916  6.177  1.00 0.00 ? 281 ILE A HB   6  
ATOM 7344  H HG12 . ILE A 1 79 ? 12.876  -6.854  5.865  1.00 0.00 ? 281 ILE A HG12 6  
ATOM 7345  H HG13 . ILE A 1 79 ? 12.707  -5.934  7.356  1.00 0.00 ? 281 ILE A HG13 6  
ATOM 7346  H HG21 . ILE A 1 79 ? 10.869  -6.594  4.267  1.00 0.00 ? 281 ILE A HG21 6  
ATOM 7347  H HG22 . ILE A 1 79 ? 10.561  -4.911  3.841  1.00 0.00 ? 281 ILE A HG22 6  
ATOM 7348  H HG23 . ILE A 1 79 ? 12.193  -5.568  3.718  1.00 0.00 ? 281 ILE A HG23 6  
ATOM 7349  H HD11 . ILE A 1 79 ? 10.281  -7.296  6.396  1.00 0.00 ? 281 ILE A HD11 6  
ATOM 7350  H HD12 . ILE A 1 79 ? 11.594  -8.331  6.957  1.00 0.00 ? 281 ILE A HD12 6  
ATOM 7351  H HD13 . ILE A 1 79 ? 10.913  -7.111  8.032  1.00 0.00 ? 281 ILE A HD13 6  
ATOM 7352  N N    . GLY A 1 80 ? 13.937  -3.988  3.829  1.00 0.00 ? 282 GLY A N    6  
ATOM 7353  C CA   . GLY A 1 80 ? 15.171  -4.272  3.124  1.00 0.00 ? 282 GLY A CA   6  
ATOM 7354  C C    . GLY A 1 80 ? 15.056  -4.025  1.634  1.00 0.00 ? 282 GLY A C    6  
ATOM 7355  O O    . GLY A 1 80 ? 14.700  -2.927  1.206  1.00 0.00 ? 282 GLY A O    6  
ATOM 7356  H H    . GLY A 1 80 ? 13.187  -3.573  3.353  1.00 0.00 ? 282 GLY A H    6  
ATOM 7357  H HA2  . GLY A 1 80 ? 15.954  -3.643  3.523  1.00 0.00 ? 282 GLY A HA2  6  
ATOM 7358  H HA3  . GLY A 1 80 ? 15.436  -5.306  3.288  1.00 0.00 ? 282 GLY A HA3  6  
ATOM 7359  N N    . PHE A 1 81 ? 15.358  -5.047  0.841  1.00 0.00 ? 283 PHE A N    6  
ATOM 7360  C CA   . PHE A 1 81 ? 15.285  -4.935  -0.611 1.00 0.00 ? 283 PHE A CA   6  
ATOM 7361  C C    . PHE A 1 81 ? 13.889  -5.300  -1.114 1.00 0.00 ? 283 PHE A C    6  
ATOM 7362  O O    . PHE A 1 81 ? 13.250  -6.209  -0.585 1.00 0.00 ? 283 PHE A O    6  
ATOM 7363  C CB   . PHE A 1 81 ? 16.329  -5.840  -1.266 1.00 0.00 ? 283 PHE A CB   6  
ATOM 7364  C CG   . PHE A 1 81 ? 17.688  -5.742  -0.636 1.00 0.00 ? 283 PHE A CG   6  
ATOM 7365  C CD1  . PHE A 1 81 ? 18.022  -6.534  0.450  1.00 0.00 ? 283 PHE A CD1  6  
ATOM 7366  C CD2  . PHE A 1 81 ? 18.633  -4.856  -1.129 1.00 0.00 ? 283 PHE A CD2  6  
ATOM 7367  C CE1  . PHE A 1 81 ? 19.272  -6.446  1.033  1.00 0.00 ? 283 PHE A CE1  6  
ATOM 7368  C CE2  . PHE A 1 81 ? 19.884  -4.762  -0.551 1.00 0.00 ? 283 PHE A CE2  6  
ATOM 7369  C CZ   . PHE A 1 81 ? 20.204  -5.559  0.533  1.00 0.00 ? 283 PHE A CZ   6  
ATOM 7370  H H    . PHE A 1 81 ? 15.635  -5.898  1.242  1.00 0.00 ? 283 PHE A H    6  
ATOM 7371  H HA   . PHE A 1 81 ? 15.493  -3.909  -0.873 1.00 0.00 ? 283 PHE A HA   6  
ATOM 7372  H HB2  . PHE A 1 81 ? 16.003  -6.866  -1.193 1.00 0.00 ? 283 PHE A HB2  6  
ATOM 7373  H HB3  . PHE A 1 81 ? 16.424  -5.571  -2.308 1.00 0.00 ? 283 PHE A HB3  6  
ATOM 7374  H HD1  . PHE A 1 81 ? 17.293  -7.228  0.843  1.00 0.00 ? 283 PHE A HD1  6  
ATOM 7375  H HD2  . PHE A 1 81 ? 18.384  -4.233  -1.976 1.00 0.00 ? 283 PHE A HD2  6  
ATOM 7376  H HE1  . PHE A 1 81 ? 19.520  -7.069  1.879  1.00 0.00 ? 283 PHE A HE1  6  
ATOM 7377  H HE2  . PHE A 1 81 ? 20.612  -4.068  -0.946 1.00 0.00 ? 283 PHE A HE2  6  
ATOM 7378  H HZ   . PHE A 1 81 ? 21.182  -5.487  0.986  1.00 0.00 ? 283 PHE A HZ   6  
ATOM 7379  N N    . GLY B 2 29 ? -2.195  10.965  20.774 1.00 0.00 ? 444 GLY B N    6  
ATOM 7380  C CA   . GLY B 2 29 ? -1.208  10.717  19.738 1.00 0.00 ? 444 GLY B CA   6  
ATOM 7381  C C    . GLY B 2 29 ? -0.651  9.307   19.795 1.00 0.00 ? 444 GLY B C    6  
ATOM 7382  O O    . GLY B 2 29 ? -1.126  8.416   19.092 1.00 0.00 ? 444 GLY B O    6  
ATOM 7383  H HA2  . GLY B 2 29 ? -1.669  10.871  18.774 1.00 0.00 ? 444 GLY B HA2  6  
ATOM 7384  H HA3  . GLY B 2 29 ? -0.395  11.418  19.854 1.00 0.00 ? 444 GLY B HA3  6  
ATOM 7385  N N    . GLU B 2 30 ? 0.359   9.107   20.637 1.00 0.00 ? 445 GLU B N    6  
ATOM 7386  C CA   . GLU B 2 30 ? 0.981   7.796   20.782 1.00 0.00 ? 445 GLU B CA   6  
ATOM 7387  C C    . GLU B 2 30 ? 1.591   7.334   19.462 1.00 0.00 ? 445 GLU B C    6  
ATOM 7388  O O    . GLU B 2 30 ? 1.242   7.841   18.396 1.00 0.00 ? 445 GLU B O    6  
ATOM 7389  C CB   . GLU B 2 30 ? -0.049  6.773   21.272 1.00 0.00 ? 445 GLU B CB   6  
ATOM 7390  C CG   . GLU B 2 30 ? 0.250   6.226   22.658 1.00 0.00 ? 445 GLU B CG   6  
ATOM 7391  C CD   . GLU B 2 30 ? -0.618  5.035   23.015 1.00 0.00 ? 445 GLU B CD   6  
ATOM 7392  O OE1  . GLU B 2 30 ? -1.817  5.049   22.666 1.00 0.00 ? 445 GLU B OE1  6  
ATOM 7393  O OE2  . GLU B 2 30 ? -0.099  4.087   23.643 1.00 0.00 ? 445 GLU B OE2  6  
ATOM 7394  H H    . GLU B 2 30 ? 0.692   9.856   21.170 1.00 0.00 ? 445 GLU B H    6  
ATOM 7395  H HA   . GLU B 2 30 ? 1.767   7.883   21.517 1.00 0.00 ? 445 GLU B HA   6  
ATOM 7396  H HB2  . GLU B 2 30 ? -1.020  7.241   21.296 1.00 0.00 ? 445 GLU B HB2  6  
ATOM 7397  H HB3  . GLU B 2 30 ? -0.076  5.944   20.581 1.00 0.00 ? 445 GLU B HB3  6  
ATOM 7398  H HG2  . GLU B 2 30 ? 1.285   5.922   22.697 1.00 0.00 ? 445 GLU B HG2  6  
ATOM 7399  H HG3  . GLU B 2 30 ? 0.079   7.007   23.385 1.00 0.00 ? 445 GLU B HG3  6  
ATOM 7400  N N    . GLU B 2 31 ? 2.502   6.370   19.543 1.00 0.00 ? 446 GLU B N    6  
ATOM 7401  C CA   . GLU B 2 31 ? 3.159   5.839   18.352 1.00 0.00 ? 446 GLU B CA   6  
ATOM 7402  C C    . GLU B 2 31 ? 2.471   4.564   17.868 1.00 0.00 ? 446 GLU B C    6  
ATOM 7403  O O    . GLU B 2 31 ? 3.064   3.765   17.145 1.00 0.00 ? 446 GLU B O    6  
ATOM 7404  C CB   . GLU B 2 31 ? 4.636   5.560   18.645 1.00 0.00 ? 446 GLU B CB   6  
ATOM 7405  C CG   . GLU B 2 31 ? 5.584   6.542   17.976 1.00 0.00 ? 446 GLU B CG   6  
ATOM 7406  C CD   . GLU B 2 31 ? 7.037   6.127   18.105 1.00 0.00 ? 446 GLU B CD   6  
ATOM 7407  O OE1  . GLU B 2 31 ? 7.472   5.836   19.240 1.00 0.00 ? 446 GLU B OE1  6  
ATOM 7408  O OE2  . GLU B 2 31 ? 7.739   6.094   17.074 1.00 0.00 ? 446 GLU B OE2  6  
ATOM 7409  H H    . GLU B 2 31 ? 2.737   6.005   20.421 1.00 0.00 ? 446 GLU B H    6  
ATOM 7410  H HA   . GLU B 2 31 ? 3.091   6.586   17.576 1.00 0.00 ? 446 GLU B HA   6  
ATOM 7411  H HB2  . GLU B 2 31 ? 4.796   5.607   19.710 1.00 0.00 ? 446 GLU B HB2  6  
ATOM 7412  H HB3  . GLU B 2 31 ? 4.880   4.566   18.297 1.00 0.00 ? 446 GLU B HB3  6  
ATOM 7413  H HG2  . GLU B 2 31 ? 5.337   6.606   16.927 1.00 0.00 ? 446 GLU B HG2  6  
ATOM 7414  H HG3  . GLU B 2 31 ? 5.459   7.511   18.435 1.00 0.00 ? 446 GLU B HG3  6  
ATOM 7415  N N    . GLU B 2 32 ? 1.217   4.380   18.272 1.00 0.00 ? 447 GLU B N    6  
ATOM 7416  C CA   . GLU B 2 32 ? 0.454   3.203   17.877 1.00 0.00 ? 447 GLU B CA   6  
ATOM 7417  C C    . GLU B 2 32 ? -1.000  3.571   17.591 1.00 0.00 ? 447 GLU B C    6  
ATOM 7418  O O    . GLU B 2 32 ? -1.471  4.633   17.994 1.00 0.00 ? 447 GLU B O    6  
ATOM 7419  C CB   . GLU B 2 32 ? 0.516   2.135   18.970 1.00 0.00 ? 447 GLU B CB   6  
ATOM 7420  C CG   . GLU B 2 32 ? 1.901   1.956   19.570 1.00 0.00 ? 447 GLU B CG   6  
ATOM 7421  C CD   . GLU B 2 32 ? 2.848   1.221   18.642 1.00 0.00 ? 447 GLU B CD   6  
ATOM 7422  O OE1  . GLU B 2 32 ? 2.622   1.253   17.415 1.00 0.00 ? 447 GLU B OE1  6  
ATOM 7423  O OE2  . GLU B 2 32 ? 3.817   0.612   19.143 1.00 0.00 ? 447 GLU B OE2  6  
ATOM 7424  H H    . GLU B 2 32 ? 0.794   5.051   18.847 1.00 0.00 ? 447 GLU B H    6  
ATOM 7425  H HA   . GLU B 2 32 ? 0.896   2.807   16.974 1.00 0.00 ? 447 GLU B HA   6  
ATOM 7426  H HB2  . GLU B 2 32 ? -0.165  2.407   19.762 1.00 0.00 ? 447 GLU B HB2  6  
ATOM 7427  H HB3  . GLU B 2 32 ? 0.206   1.189   18.551 1.00 0.00 ? 447 GLU B HB3  6  
ATOM 7428  H HG2  . GLU B 2 32 ? 2.315   2.931   19.783 1.00 0.00 ? 447 GLU B HG2  6  
ATOM 7429  H HG3  . GLU B 2 32 ? 1.812   1.396   20.489 1.00 0.00 ? 447 GLU B HG3  6  
ATOM 7430  N N    . GLY B 2 33 ? -1.702  2.685   16.893 1.00 0.00 ? 448 GLY B N    6  
ATOM 7431  C CA   . GLY B 2 33 ? -3.094  2.937   16.567 1.00 0.00 ? 448 GLY B CA   6  
ATOM 7432  C C    . GLY B 2 33 ? -3.256  3.896   15.404 1.00 0.00 ? 448 GLY B C    6  
ATOM 7433  O O    . GLY B 2 33 ? -4.309  4.514   15.244 1.00 0.00 ? 448 GLY B O    6  
ATOM 7434  H H    . GLY B 2 33 ? -1.275  1.854   16.600 1.00 0.00 ? 448 GLY B H    6  
ATOM 7435  H HA2  . GLY B 2 33 ? -3.568  2.000   16.316 1.00 0.00 ? 448 GLY B HA2  6  
ATOM 7436  H HA3  . GLY B 2 33 ? -3.585  3.354   17.435 1.00 0.00 ? 448 GLY B HA3  6  
ATOM 7437  N N    . GLU B 2 34 ? -2.213  4.023   14.591 1.00 0.00 ? 449 GLU B N    6  
ATOM 7438  C CA   . GLU B 2 34 ? -2.246  4.916   13.438 1.00 0.00 ? 449 GLU B CA   6  
ATOM 7439  C C    . GLU B 2 34 ? -2.388  4.127   12.145 1.00 0.00 ? 449 GLU B C    6  
ATOM 7440  O O    . GLU B 2 34 ? -1.991  4.596   11.081 1.00 0.00 ? 449 GLU B O    6  
ATOM 7441  C CB   . GLU B 2 34 ? -0.972  5.759   13.370 1.00 0.00 ? 449 GLU B CB   6  
ATOM 7442  C CG   . GLU B 2 34 ? -0.414  6.144   14.731 1.00 0.00 ? 449 GLU B CG   6  
ATOM 7443  C CD   . GLU B 2 34 ? -1.305  7.124   15.470 1.00 0.00 ? 449 GLU B CD   6  
ATOM 7444  O OE1  . GLU B 2 34 ? -2.503  7.210   15.129 1.00 0.00 ? 449 GLU B OE1  6  
ATOM 7445  O OE2  . GLU B 2 34 ? -0.805  7.804   16.390 1.00 0.00 ? 449 GLU B OE2  6  
ATOM 7446  H H    . GLU B 2 34 ? -1.400  3.505   14.772 1.00 0.00 ? 449 GLU B H    6  
ATOM 7447  H HA   . GLU B 2 34 ? -3.098  5.570   13.545 1.00 0.00 ? 449 GLU B HA   6  
ATOM 7448  H HB2  . GLU B 2 34 ? -0.217  5.198   12.835 1.00 0.00 ? 449 GLU B HB2  6  
ATOM 7449  H HB3  . GLU B 2 34 ? -1.187  6.666   12.823 1.00 0.00 ? 449 GLU B HB3  6  
ATOM 7450  H HG2  . GLU B 2 34 ? -0.311  5.253   15.331 1.00 0.00 ? 449 GLU B HG2  6  
ATOM 7451  H HG3  . GLU B 2 34 ? 0.557   6.598   14.592 1.00 0.00 ? 449 GLU B HG3  6  
ATOM 7452  N N    . GLU B 2 35 ? -2.947  2.927   12.234 1.00 0.00 ? 450 GLU B N    6  
ATOM 7453  C CA   . GLU B 2 35 ? -3.119  2.095   11.054 1.00 0.00 ? 450 GLU B CA   6  
ATOM 7454  C C    . GLU B 2 35 ? -4.469  1.384   11.072 1.00 0.00 ? 450 GLU B C    6  
ATOM 7455  O O    . GLU B 2 35 ? -5.046  1.148   12.133 1.00 0.00 ? 450 GLU B O    6  
ATOM 7456  C CB   . GLU B 2 35 ? -1.977  1.082   10.949 1.00 0.00 ? 450 GLU B CB   6  
ATOM 7457  C CG   . GLU B 2 35 ? -2.050  -0.040  11.975 1.00 0.00 ? 450 GLU B CG   6  
ATOM 7458  C CD   . GLU B 2 35 ? -0.913  0.012   12.979 1.00 0.00 ? 450 GLU B CD   6  
ATOM 7459  O OE1  . GLU B 2 35 ? -0.744  1.063   13.631 1.00 0.00 ? 450 GLU B OE1  6  
ATOM 7460  O OE2  . GLU B 2 35 ? -0.191  -1.000  13.110 1.00 0.00 ? 450 GLU B OE2  6  
ATOM 7461  H H    . GLU B 2 35 ? -3.244  2.596   13.106 1.00 0.00 ? 450 GLU B H    6  
ATOM 7462  H HA   . GLU B 2 35 ? -3.086  2.744   10.194 1.00 0.00 ? 450 GLU B HA   6  
ATOM 7463  H HB2  . GLU B 2 35 ? -1.992  0.643   9.964  1.00 0.00 ? 450 GLU B HB2  6  
ATOM 7464  H HB3  . GLU B 2 35 ? -1.039  1.604   11.084 1.00 0.00 ? 450 GLU B HB3  6  
ATOM 7465  H HG2  . GLU B 2 35 ? -2.983  0.039   12.511 1.00 0.00 ? 450 GLU B HG2  6  
ATOM 7466  H HG3  . GLU B 2 35 ? -2.011  -0.986  11.458 1.00 0.00 ? 450 GLU B HG3  6  
ATOM 7467  N N    . TYR B 2 36 ? -4.965  1.047   9.885  1.00 0.00 ? 451 TYR B N    6  
ATOM 7468  C CA   . TYR B 2 36 ? -6.247  0.366   9.757  1.00 0.00 ? 451 TYR B CA   6  
ATOM 7469  C C    . TYR B 2 36 ? -6.158  -0.776  8.750  1.00 0.00 ? 451 TYR B C    6  
ATOM 7470  O O    . TYR B 2 36 ? -5.046  -1.310  8.557  1.00 0.00 ? 451 TYR B O    6  
ATOM 7471  C CB   . TYR B 2 36 ? -7.330  1.357   9.327  1.00 0.00 ? 451 TYR B CB   6  
ATOM 7472  C CG   . TYR B 2 36 ? -7.875  2.189   10.468 1.00 0.00 ? 451 TYR B CG   6  
ATOM 7473  C CD1  . TYR B 2 36 ? -7.205  3.326   10.905 1.00 0.00 ? 451 TYR B CD1  6  
ATOM 7474  C CD2  . TYR B 2 36 ? -9.057  1.837   11.107 1.00 0.00 ? 451 TYR B CD2  6  
ATOM 7475  C CE1  . TYR B 2 36 ? -7.700  4.087   11.947 1.00 0.00 ? 451 TYR B CE1  6  
ATOM 7476  C CE2  . TYR B 2 36 ? -9.556  2.593   12.149 1.00 0.00 ? 451 TYR B CE2  6  
ATOM 7477  C CZ   . TYR B 2 36 ? -8.875  3.717   12.565 1.00 0.00 ? 451 TYR B CZ   6  
ATOM 7478  O OH   . TYR B 2 36 ? -9.370  4.472   13.602 1.00 0.00 ? 451 TYR B OH   6  
ATOM 7479  O OXT  . TYR B 2 36 ? -7.204  -1.126  8.163  1.00 0.00 ? 451 TYR B OXT  6  
ATOM 7480  H H    . TYR B 2 36 ? -4.458  1.265   9.077  1.00 0.00 ? 451 TYR B H    6  
ATOM 7481  H HA   . TYR B 2 36 ? -6.505  -0.041  10.724 1.00 0.00 ? 451 TYR B HA   6  
ATOM 7482  H HB2  . TYR B 2 36 ? -6.920  2.031   8.592  1.00 0.00 ? 451 TYR B HB2  6  
ATOM 7483  H HB3  . TYR B 2 36 ? -8.153  0.813   8.890  1.00 0.00 ? 451 TYR B HB3  6  
ATOM 7484  H HD1  . TYR B 2 36 ? -6.285  3.613   10.419 1.00 0.00 ? 451 TYR B HD1  6  
ATOM 7485  H HD2  . TYR B 2 36 ? -9.588  0.956   10.778 1.00 0.00 ? 451 TYR B HD2  6  
ATOM 7486  H HE1  . TYR B 2 36 ? -7.165  4.968   12.273 1.00 0.00 ? 451 TYR B HE1  6  
ATOM 7487  H HE2  . TYR B 2 36 ? -10.478 2.303   12.632 1.00 0.00 ? 451 TYR B HE2  6  
ATOM 7488  H HH   . TYR B 2 36 ? -9.238  5.405   13.413 1.00 0.00 ? 451 TYR B HH   6  
ATOM 7489  N N    . ARG A 1 8  ? 13.728  8.892   2.963  1.00 0.00 ? 210 ARG A N    7  
ATOM 7490  C CA   . ARG A 1 8  ? 12.689  8.511   3.913  1.00 0.00 ? 210 ARG A CA   7  
ATOM 7491  C C    . ARG A 1 8  ? 11.417  8.080   3.186  1.00 0.00 ? 210 ARG A C    7  
ATOM 7492  O O    . ARG A 1 8  ? 10.660  7.246   3.682  1.00 0.00 ? 210 ARG A O    7  
ATOM 7493  C CB   . ARG A 1 8  ? 12.382  9.675   4.858  1.00 0.00 ? 210 ARG A CB   7  
ATOM 7494  C CG   . ARG A 1 8  ? 12.216  9.252   6.308  1.00 0.00 ? 210 ARG A CG   7  
ATOM 7495  C CD   . ARG A 1 8  ? 11.993  10.450  7.217  1.00 0.00 ? 210 ARG A CD   7  
ATOM 7496  N NE   . ARG A 1 8  ? 11.163  10.115  8.371  1.00 0.00 ? 210 ARG A NE   7  
ATOM 7497  C CZ   . ARG A 1 8  ? 10.532  11.019  9.118  1.00 0.00 ? 210 ARG A CZ   7  
ATOM 7498  N NH1  . ARG A 1 8  ? 10.634  12.312  8.835  1.00 0.00 ? 210 ARG A NH1  7  
ATOM 7499  N NH2  . ARG A 1 8  ? 9.797   10.629  10.149 1.00 0.00 ? 210 ARG A NH2  7  
ATOM 7500  H HA   . ARG A 1 8  ? 13.058  7.678   4.491  1.00 0.00 ? 210 ARG A HA   7  
ATOM 7501  H HB2  . ARG A 1 8  ? 13.190  10.389  4.804  1.00 0.00 ? 210 ARG A HB2  7  
ATOM 7502  H HB3  . ARG A 1 8  ? 11.467  10.152  4.538  1.00 0.00 ? 210 ARG A HB3  7  
ATOM 7503  H HG2  . ARG A 1 8  ? 11.365  8.592   6.386  1.00 0.00 ? 210 ARG A HG2  7  
ATOM 7504  H HG3  . ARG A 1 8  ? 13.108  8.732   6.626  1.00 0.00 ? 210 ARG A HG3  7  
ATOM 7505  H HD2  . ARG A 1 8  ? 12.952  10.805  7.565  1.00 0.00 ? 210 ARG A HD2  7  
ATOM 7506  H HD3  . ARG A 1 8  ? 11.506  11.229  6.648  1.00 0.00 ? 210 ARG A HD3  7  
ATOM 7507  H HE   . ARG A 1 8  ? 11.072  9.168   8.603  1.00 0.00 ? 210 ARG A HE   7  
ATOM 7508  H HH11 . ARG A 1 8  ? 11.186  12.612  8.058  1.00 0.00 ? 210 ARG A HH11 7  
ATOM 7509  H HH12 . ARG A 1 8  ? 10.157  12.986  9.399  1.00 0.00 ? 210 ARG A HH12 7  
ATOM 7510  H HH21 . ARG A 1 8  ? 9.717   9.655   10.367 1.00 0.00 ? 210 ARG A HH21 7  
ATOM 7511  H HH22 . ARG A 1 8  ? 9.322   11.306  10.710 1.00 0.00 ? 210 ARG A HH22 7  
ATOM 7512  N N    . GLU A 1 9  ? 11.191  8.653   2.008  1.00 0.00 ? 211 GLU A N    7  
ATOM 7513  C CA   . GLU A 1 9  ? 10.010  8.326   1.214  1.00 0.00 ? 211 GLU A CA   7  
ATOM 7514  C C    . GLU A 1 9  ? 9.971   6.838   0.885  1.00 0.00 ? 211 GLU A C    7  
ATOM 7515  O O    . GLU A 1 9  ? 10.983  6.144   0.972  1.00 0.00 ? 211 GLU A O    7  
ATOM 7516  C CB   . GLU A 1 9  ? 9.995   9.148   -0.076 1.00 0.00 ? 211 GLU A CB   7  
ATOM 7517  C CG   . GLU A 1 9  ? 11.182  8.875   -0.985 1.00 0.00 ? 211 GLU A CG   7  
ATOM 7518  C CD   . GLU A 1 9  ? 10.856  9.089   -2.450 1.00 0.00 ? 211 GLU A CD   7  
ATOM 7519  O OE1  . GLU A 1 9  ? 10.004  8.346   -2.983 1.00 0.00 ? 211 GLU A OE1  7  
ATOM 7520  O OE2  . GLU A 1 9  ? 11.451  9.999   -3.065 1.00 0.00 ? 211 GLU A OE2  7  
ATOM 7521  H H    . GLU A 1 9  ? 11.830  9.310   1.665  1.00 0.00 ? 211 GLU A H    7  
ATOM 7522  H HA   . GLU A 1 9  ? 9.139   8.577   1.800  1.00 0.00 ? 211 GLU A HA   7  
ATOM 7523  H HB2  . GLU A 1 9  ? 9.092   8.922   -0.622 1.00 0.00 ? 211 GLU A HB2  7  
ATOM 7524  H HB3  . GLU A 1 9  ? 9.999   10.197  0.180  1.00 0.00 ? 211 GLU A HB3  7  
ATOM 7525  H HG2  . GLU A 1 9  ? 11.990  9.539   -0.712 1.00 0.00 ? 211 GLU A HG2  7  
ATOM 7526  H HG3  . GLU A 1 9  ? 11.497  7.850   -0.847 1.00 0.00 ? 211 GLU A HG3  7  
ATOM 7527  N N    . LEU A 1 10 ? 8.792   6.352   0.504  1.00 0.00 ? 212 LEU A N    7  
ATOM 7528  C CA   . LEU A 1 10 ? 8.619   4.946   0.163  1.00 0.00 ? 212 LEU A CA   7  
ATOM 7529  C C    . LEU A 1 10 ? 8.129   4.788   -1.273 1.00 0.00 ? 212 LEU A C    7  
ATOM 7530  O O    . LEU A 1 10 ? 7.555   5.715   -1.848 1.00 0.00 ? 212 LEU A O    7  
ATOM 7531  C CB   . LEU A 1 10 ? 7.629   4.284   1.124  1.00 0.00 ? 212 LEU A CB   7  
ATOM 7532  C CG   . LEU A 1 10 ? 8.150   4.072   2.544  1.00 0.00 ? 212 LEU A CG   7  
ATOM 7533  C CD1  . LEU A 1 10 ? 7.008   3.711   3.482  1.00 0.00 ? 212 LEU A CD1  7  
ATOM 7534  C CD2  . LEU A 1 10 ? 9.219   2.990   2.564  1.00 0.00 ? 212 LEU A CD2  7  
ATOM 7535  H H    . LEU A 1 10 ? 8.020   6.955   0.455  1.00 0.00 ? 212 LEU A H    7  
ATOM 7536  H HA   . LEU A 1 10 ? 9.578   4.460   0.257  1.00 0.00 ? 212 LEU A HA   7  
ATOM 7537  H HB2  . LEU A 1 10 ? 6.743   4.901   1.174  1.00 0.00 ? 212 LEU A HB2  7  
ATOM 7538  H HB3  . LEU A 1 10 ? 7.354   3.322   0.717  1.00 0.00 ? 212 LEU A HB3  7  
ATOM 7539  H HG   . LEU A 1 10 ? 8.594   4.990   2.900  1.00 0.00 ? 212 LEU A HG   7  
ATOM 7540  H HD11 . LEU A 1 10 ? 6.191   4.401   3.337  1.00 0.00 ? 212 LEU A HD11 7  
ATOM 7541  H HD12 . LEU A 1 10 ? 6.673   2.706   3.270  1.00 0.00 ? 212 LEU A HD12 7  
ATOM 7542  H HD13 . LEU A 1 10 ? 7.350   3.768   4.506  1.00 0.00 ? 212 LEU A HD13 7  
ATOM 7543  H HD21 . LEU A 1 10 ? 9.164   2.444   3.493  1.00 0.00 ? 212 LEU A HD21 7  
ATOM 7544  H HD22 . LEU A 1 10 ? 9.061   2.312   1.737  1.00 0.00 ? 212 LEU A HD22 7  
ATOM 7545  H HD23 . LEU A 1 10 ? 10.194  3.446   2.472  1.00 0.00 ? 212 LEU A HD23 7  
ATOM 7546  N N    . LYS A 1 11 ? 8.358   3.611   -1.846 1.00 0.00 ? 213 LYS A N    7  
ATOM 7547  C CA   . LYS A 1 11 ? 7.939   3.330   -3.214 1.00 0.00 ? 213 LYS A CA   7  
ATOM 7548  C C    . LYS A 1 11 ? 7.048   2.094   -3.264 1.00 0.00 ? 213 LYS A C    7  
ATOM 7549  O O    . LYS A 1 11 ? 7.229   1.154   -2.488 1.00 0.00 ? 213 LYS A O    7  
ATOM 7550  C CB   . LYS A 1 11 ? 9.162   3.129   -4.112 1.00 0.00 ? 213 LYS A CB   7  
ATOM 7551  C CG   . LYS A 1 11 ? 10.181  4.253   -4.015 1.00 0.00 ? 213 LYS A CG   7  
ATOM 7552  C CD   . LYS A 1 11 ? 11.343  3.875   -3.109 1.00 0.00 ? 213 LYS A CD   7  
ATOM 7553  C CE   . LYS A 1 11 ? 12.560  3.448   -3.914 1.00 0.00 ? 213 LYS A CE   7  
ATOM 7554  N NZ   . LYS A 1 11 ? 13.380  4.615   -4.344 1.00 0.00 ? 213 LYS A NZ   7  
ATOM 7555  H H    . LYS A 1 11 ? 8.819   2.914   -1.334 1.00 0.00 ? 213 LYS A H    7  
ATOM 7556  H HA   . LYS A 1 11 ? 7.377   4.179   -3.569 1.00 0.00 ? 213 LYS A HA   7  
ATOM 7557  H HB2  . LYS A 1 11 ? 9.648   2.205   -3.837 1.00 0.00 ? 213 LYS A HB2  7  
ATOM 7558  H HB3  . LYS A 1 11 ? 8.830   3.060   -5.138 1.00 0.00 ? 213 LYS A HB3  7  
ATOM 7559  H HG2  . LYS A 1 11 ? 10.561  4.467   -5.001 1.00 0.00 ? 213 LYS A HG2  7  
ATOM 7560  H HG3  . LYS A 1 11 ? 9.696   5.132   -3.615 1.00 0.00 ? 213 LYS A HG3  7  
ATOM 7561  H HD2  . LYS A 1 11 ? 11.606  4.729   -2.503 1.00 0.00 ? 213 LYS A HD2  7  
ATOM 7562  H HD3  . LYS A 1 11 ? 11.039  3.058   -2.472 1.00 0.00 ? 213 LYS A HD3  7  
ATOM 7563  H HE2  . LYS A 1 11 ? 13.169  2.797   -3.305 1.00 0.00 ? 213 LYS A HE2  7  
ATOM 7564  H HE3  . LYS A 1 11 ? 12.226  2.912   -4.791 1.00 0.00 ? 213 LYS A HE3  7  
ATOM 7565  H HZ1  . LYS A 1 11 ? 13.215  5.421   -3.706 1.00 0.00 ? 213 LYS A HZ1  7  
ATOM 7566  H HZ2  . LYS A 1 11 ? 13.126  4.894   -5.312 1.00 0.00 ? 213 LYS A HZ2  7  
ATOM 7567  H HZ3  . LYS A 1 11 ? 14.390  4.370   -4.318 1.00 0.00 ? 213 LYS A HZ3  7  
ATOM 7568  N N    . ILE A 1 12 ? 6.085   2.100   -4.179 1.00 0.00 ? 214 ILE A N    7  
ATOM 7569  C CA   . ILE A 1 12 ? 5.166   0.978   -4.327 1.00 0.00 ? 214 ILE A CA   7  
ATOM 7570  C C    . ILE A 1 12 ? 5.908   -0.282  -4.761 1.00 0.00 ? 214 ILE A C    7  
ATOM 7571  O O    . ILE A 1 12 ? 6.817   -0.225  -5.590 1.00 0.00 ? 214 ILE A O    7  
ATOM 7572  C CB   . ILE A 1 12 ? 4.057   1.288   -5.349 1.00 0.00 ? 214 ILE A CB   7  
ATOM 7573  C CG1  . ILE A 1 12 ? 3.376   2.616   -5.009 1.00 0.00 ? 214 ILE A CG1  7  
ATOM 7574  C CG2  . ILE A 1 12 ? 3.037   0.158   -5.386 1.00 0.00 ? 214 ILE A CG2  7  
ATOM 7575  C CD1  . ILE A 1 12 ? 2.254   2.982   -5.957 1.00 0.00 ? 214 ILE A CD1  7  
ATOM 7576  H H    . ILE A 1 12 ? 5.989   2.876   -4.768 1.00 0.00 ? 214 ILE A H    7  
ATOM 7577  H HA   . ILE A 1 12 ? 4.703   0.797   -3.367 1.00 0.00 ? 214 ILE A HA   7  
ATOM 7578  H HB   . ILE A 1 12 ? 4.508   1.364   -6.327 1.00 0.00 ? 214 ILE A HB   7  
ATOM 7579  H HG12 . ILE A 1 12 ? 2.960   2.555   -4.014 1.00 0.00 ? 214 ILE A HG12 7  
ATOM 7580  H HG13 . ILE A 1 12 ? 4.110   3.407   -5.041 1.00 0.00 ? 214 ILE A HG13 7  
ATOM 7581  H HG21 . ILE A 1 12 ? 2.491   0.135   -4.455 1.00 0.00 ? 214 ILE A HG21 7  
ATOM 7582  H HG22 . ILE A 1 12 ? 2.350   0.320   -6.203 1.00 0.00 ? 214 ILE A HG22 7  
ATOM 7583  H HG23 . ILE A 1 12 ? 3.548   -0.783  -5.527 1.00 0.00 ? 214 ILE A HG23 7  
ATOM 7584  H HD11 . ILE A 1 12 ? 2.346   4.019   -6.240 1.00 0.00 ? 214 ILE A HD11 7  
ATOM 7585  H HD12 . ILE A 1 12 ? 2.311   2.361   -6.839 1.00 0.00 ? 214 ILE A HD12 7  
ATOM 7586  H HD13 . ILE A 1 12 ? 1.305   2.824   -5.467 1.00 0.00 ? 214 ILE A HD13 7  
ATOM 7587  N N    . GLY A 1 13 ? 5.516   -1.419  -4.195 1.00 0.00 ? 215 GLY A N    7  
ATOM 7588  C CA   . GLY A 1 13 ? 6.156   -2.676  -4.532 1.00 0.00 ? 215 GLY A CA   7  
ATOM 7589  C C    . GLY A 1 13 ? 7.366   -2.971  -3.663 1.00 0.00 ? 215 GLY A C    7  
ATOM 7590  O O    . GLY A 1 13 ? 8.007   -4.010  -3.818 1.00 0.00 ? 215 GLY A O    7  
ATOM 7591  H H    . GLY A 1 13 ? 4.788   -1.402  -3.539 1.00 0.00 ? 215 GLY A H    7  
ATOM 7592  H HA2  . GLY A 1 13 ? 5.439   -3.475  -4.412 1.00 0.00 ? 215 GLY A HA2  7  
ATOM 7593  H HA3  . GLY A 1 13 ? 6.468   -2.642  -5.566 1.00 0.00 ? 215 GLY A HA3  7  
ATOM 7594  N N    . ASP A 1 14 ? 7.681   -2.056  -2.750 1.00 0.00 ? 216 ASP A N    7  
ATOM 7595  C CA   . ASP A 1 14 ? 8.824   -2.227  -1.860 1.00 0.00 ? 216 ASP A CA   7  
ATOM 7596  C C    . ASP A 1 14 ? 8.399   -2.856  -0.538 1.00 0.00 ? 216 ASP A C    7  
ATOM 7597  O O    . ASP A 1 14 ? 7.300   -2.605  -0.044 1.00 0.00 ? 216 ASP A O    7  
ATOM 7598  C CB   . ASP A 1 14 ? 9.502   -0.881  -1.604 1.00 0.00 ? 216 ASP A CB   7  
ATOM 7599  C CG   . ASP A 1 14 ? 10.125  -0.300  -2.857 1.00 0.00 ? 216 ASP A CG   7  
ATOM 7600  O OD1  . ASP A 1 14 ? 9.378   -0.021  -3.818 1.00 0.00 ? 216 ASP A OD1  7  
ATOM 7601  O OD2  . ASP A 1 14 ? 11.362  -0.122  -2.878 1.00 0.00 ? 216 ASP A OD2  7  
ATOM 7602  H H    . ASP A 1 14 ? 7.136   -1.247  -2.672 1.00 0.00 ? 216 ASP A H    7  
ATOM 7603  H HA   . ASP A 1 14 ? 9.525   -2.886  -2.346 1.00 0.00 ? 216 ASP A HA   7  
ATOM 7604  H HB2  . ASP A 1 14 ? 8.769   -0.180  -1.230 1.00 0.00 ? 216 ASP A HB2  7  
ATOM 7605  H HB3  . ASP A 1 14 ? 10.278  -1.011  -0.864 1.00 0.00 ? 216 ASP A HB3  7  
ATOM 7606  N N    . ARG A 1 15 ? 9.282   -3.671  0.034  1.00 0.00 ? 217 ARG A N    7  
ATOM 7607  C CA   . ARG A 1 15 ? 9.000   -4.327  1.304  1.00 0.00 ? 217 ARG A CA   7  
ATOM 7608  C C    . ARG A 1 15 ? 9.150   -3.340  2.453  1.00 0.00 ? 217 ARG A C    7  
ATOM 7609  O O    . ARG A 1 15 ? 10.156  -2.636  2.551  1.00 0.00 ? 217 ARG A O    7  
ATOM 7610  C CB   . ARG A 1 15 ? 9.939   -5.518  1.507  1.00 0.00 ? 217 ARG A CB   7  
ATOM 7611  C CG   . ARG A 1 15 ? 9.346   -6.626  2.363  1.00 0.00 ? 217 ARG A CG   7  
ATOM 7612  C CD   . ARG A 1 15 ? 8.173   -7.298  1.668  1.00 0.00 ? 217 ARG A CD   7  
ATOM 7613  N NE   . ARG A 1 15 ? 8.541   -7.829  0.357  1.00 0.00 ? 217 ARG A NE   7  
ATOM 7614  C CZ   . ARG A 1 15 ? 9.080   -9.032  0.166  1.00 0.00 ? 217 ARG A CZ   7  
ATOM 7615  N NH1  . ARG A 1 15 ? 9.326   -9.832  1.198  1.00 0.00 ? 217 ARG A NH1  7  
ATOM 7616  N NH2  . ARG A 1 15 ? 9.375   -9.437  -1.061 1.00 0.00 ? 217 ARG A NH2  7  
ATOM 7617  H H    . ARG A 1 15 ? 10.143  -3.827  -0.405 1.00 0.00 ? 217 ARG A H    7  
ATOM 7618  H HA   . ARG A 1 15 ? 7.980   -4.680  1.280  1.00 0.00 ? 217 ARG A HA   7  
ATOM 7619  H HB2  . ARG A 1 15 ? 10.188  -5.934  0.542  1.00 0.00 ? 217 ARG A HB2  7  
ATOM 7620  H HB3  . ARG A 1 15 ? 10.845  -5.172  1.983  1.00 0.00 ? 217 ARG A HB3  7  
ATOM 7621  H HG2  . ARG A 1 15 ? 10.108  -7.366  2.556  1.00 0.00 ? 217 ARG A HG2  7  
ATOM 7622  H HG3  . ARG A 1 15 ? 9.008   -6.204  3.296  1.00 0.00 ? 217 ARG A HG3  7  
ATOM 7623  H HD2  . ARG A 1 15 ? 7.818   -8.107  2.289  1.00 0.00 ? 217 ARG A HD2  7  
ATOM 7624  H HD3  . ARG A 1 15 ? 7.383   -6.572  1.543  1.00 0.00 ? 217 ARG A HD3  7  
ATOM 7625  H HE   . ARG A 1 15 ? 8.376   -7.261  -0.423 1.00 0.00 ? 217 ARG A HE   7  
ATOM 7626  H HH11 . ARG A 1 15 ? 9.108   -9.534  2.126  1.00 0.00 ? 217 ARG A HH11 7  
ATOM 7627  H HH12 . ARG A 1 15 ? 9.730   -10.734 1.043  1.00 0.00 ? 217 ARG A HH12 7  
ATOM 7628  H HH21 . ARG A 1 15 ? 9.193   -8.839  -1.843 1.00 0.00 ? 217 ARG A HH21 7  
ATOM 7629  H HH22 . ARG A 1 15 ? 9.779   -10.340 -1.207 1.00 0.00 ? 217 ARG A HH22 7  
ATOM 7630  N N    . VAL A 1 16 ? 8.141   -3.279  3.312  1.00 0.00 ? 218 VAL A N    7  
ATOM 7631  C CA   . VAL A 1 16 ? 8.162   -2.360  4.441  1.00 0.00 ? 218 VAL A CA   7  
ATOM 7632  C C    . VAL A 1 16 ? 7.423   -2.931  5.645  1.00 0.00 ? 218 VAL A C    7  
ATOM 7633  O O    . VAL A 1 16 ? 6.943   -4.063  5.617  1.00 0.00 ? 218 VAL A O    7  
ATOM 7634  C CB   . VAL A 1 16 ? 7.516   -1.013  4.063  1.00 0.00 ? 218 VAL A CB   7  
ATOM 7635  C CG1  . VAL A 1 16 ? 8.143   -0.454  2.793  1.00 0.00 ? 218 VAL A CG1  7  
ATOM 7636  C CG2  . VAL A 1 16 ? 6.008   -1.168  3.896  1.00 0.00 ? 218 VAL A CG2  7  
ATOM 7637  H H    . VAL A 1 16 ? 7.360   -3.855  3.176  1.00 0.00 ? 218 VAL A H    7  
ATOM 7638  H HA   . VAL A 1 16 ? 9.191   -2.179  4.709  1.00 0.00 ? 218 VAL A HA   7  
ATOM 7639  H HB   . VAL A 1 16 ? 7.698   -0.311  4.864  1.00 0.00 ? 218 VAL A HB   7  
ATOM 7640  H HG11 . VAL A 1 16 ? 9.208   -0.629  2.812  1.00 0.00 ? 218 VAL A HG11 7  
ATOM 7641  H HG12 . VAL A 1 16 ? 7.713   -0.948  1.934  1.00 0.00 ? 218 VAL A HG12 7  
ATOM 7642  H HG13 . VAL A 1 16 ? 7.952   0.606   2.734  1.00 0.00 ? 218 VAL A HG13 7  
ATOM 7643  H HG21 . VAL A 1 16 ? 5.552   -1.308  4.867  1.00 0.00 ? 218 VAL A HG21 7  
ATOM 7644  H HG22 . VAL A 1 16 ? 5.603   -0.279  3.435  1.00 0.00 ? 218 VAL A HG22 7  
ATOM 7645  H HG23 . VAL A 1 16 ? 5.799   -2.025  3.276  1.00 0.00 ? 218 VAL A HG23 7  
ATOM 7646  N N    . LEU A 1 17 ? 7.320   -2.122  6.693  1.00 0.00 ? 219 LEU A N    7  
ATOM 7647  C CA   . LEU A 1 17 ? 6.623   -2.520  7.906  1.00 0.00 ? 219 LEU A CA   7  
ATOM 7648  C C    . LEU A 1 17 ? 5.538   -1.511  8.246  1.00 0.00 ? 219 LEU A C    7  
ATOM 7649  O O    . LEU A 1 17 ? 5.818   -0.330  8.439  1.00 0.00 ? 219 LEU A O    7  
ATOM 7650  C CB   . LEU A 1 17 ? 7.592   -2.633  9.083  1.00 0.00 ? 219 LEU A CB   7  
ATOM 7651  C CG   . LEU A 1 17 ? 8.700   -3.676  8.931  1.00 0.00 ? 219 LEU A CG   7  
ATOM 7652  C CD1  . LEU A 1 17 ? 9.438   -3.854  10.249 1.00 0.00 ? 219 LEU A CD1  7  
ATOM 7653  C CD2  . LEU A 1 17 ? 8.127   -5.003  8.455  1.00 0.00 ? 219 LEU A CD2  7  
ATOM 7654  H H    . LEU A 1 17 ? 7.713   -1.225  6.642  1.00 0.00 ? 219 LEU A H    7  
ATOM 7655  H HA   . LEU A 1 17 ? 6.166   -3.481  7.728  1.00 0.00 ? 219 LEU A HA   7  
ATOM 7656  H HB2  . LEU A 1 17 ? 8.054   -1.668  9.235  1.00 0.00 ? 219 LEU A HB2  7  
ATOM 7657  H HB3  . LEU A 1 17 ? 7.018   -2.879  9.965  1.00 0.00 ? 219 LEU A HB3  7  
ATOM 7658  H HG   . LEU A 1 17 ? 9.411   -3.332  8.195  1.00 0.00 ? 219 LEU A HG   7  
ATOM 7659  H HD11 . LEU A 1 17 ? 10.220  -3.113  10.328 1.00 0.00 ? 219 LEU A HD11 7  
ATOM 7660  H HD12 . LEU A 1 17 ? 8.745   -3.734  11.069 1.00 0.00 ? 219 LEU A HD12 7  
ATOM 7661  H HD13 . LEU A 1 17 ? 9.873   -4.842  10.288 1.00 0.00 ? 219 LEU A HD13 7  
ATOM 7662  H HD21 . LEU A 1 17 ? 7.208   -5.209  8.983  1.00 0.00 ? 219 LEU A HD21 7  
ATOM 7663  H HD22 . LEU A 1 17 ? 7.929   -4.949  7.395  1.00 0.00 ? 219 LEU A HD22 7  
ATOM 7664  H HD23 . LEU A 1 17 ? 8.839   -5.793  8.648  1.00 0.00 ? 219 LEU A HD23 7  
ATOM 7665  N N    . VAL A 1 18 ? 4.302   -1.979  8.327  1.00 0.00 ? 220 VAL A N    7  
ATOM 7666  C CA   . VAL A 1 18 ? 3.184   -1.103  8.656  1.00 0.00 ? 220 VAL A CA   7  
ATOM 7667  C C    . VAL A 1 18 ? 2.987   -1.051  10.167 1.00 0.00 ? 220 VAL A C    7  
ATOM 7668  O O    . VAL A 1 18 ? 2.606   -2.043  10.790 1.00 0.00 ? 220 VAL A O    7  
ATOM 7669  C CB   . VAL A 1 18 ? 1.865   -1.544  7.973  1.00 0.00 ? 220 VAL A CB   7  
ATOM 7670  C CG1  . VAL A 1 18 ? 1.262   -0.398  7.172  1.00 0.00 ? 220 VAL A CG1  7  
ATOM 7671  C CG2  . VAL A 1 18 ? 2.082   -2.764  7.086  1.00 0.00 ? 220 VAL A CG2  7  
ATOM 7672  H H    . VAL A 1 18 ? 4.140   -2.932  8.174  1.00 0.00 ? 220 VAL A H    7  
ATOM 7673  H HA   . VAL A 1 18 ? 3.433   -0.111  8.307  1.00 0.00 ? 220 VAL A HA   7  
ATOM 7674  H HB   . VAL A 1 18 ? 1.159   -1.812  8.741  1.00 0.00 ? 220 VAL A HB   7  
ATOM 7675  H HG11 . VAL A 1 18 ? 1.156   -0.696  6.139  1.00 0.00 ? 220 VAL A HG11 7  
ATOM 7676  H HG12 . VAL A 1 18 ? 0.292   -0.149  7.575  1.00 0.00 ? 220 VAL A HG12 7  
ATOM 7677  H HG13 . VAL A 1 18 ? 1.909   0.465   7.232  1.00 0.00 ? 220 VAL A HG13 7  
ATOM 7678  H HG21 . VAL A 1 18 ? 2.330   -3.616  7.702  1.00 0.00 ? 220 VAL A HG21 7  
ATOM 7679  H HG22 . VAL A 1 18 ? 1.178   -2.972  6.531  1.00 0.00 ? 220 VAL A HG22 7  
ATOM 7680  H HG23 . VAL A 1 18 ? 2.891   -2.569  6.398  1.00 0.00 ? 220 VAL A HG23 7  
ATOM 7681  N N    . GLY A 1 19 ? 3.266   0.112   10.749 1.00 0.00 ? 221 GLY A N    7  
ATOM 7682  C CA   . GLY A 1 19 ? 3.131   0.274   12.185 1.00 0.00 ? 221 GLY A CA   7  
ATOM 7683  C C    . GLY A 1 19 ? 4.383   -0.143  12.939 1.00 0.00 ? 221 GLY A C    7  
ATOM 7684  O O    . GLY A 1 19 ? 4.473   0.047   14.152 1.00 0.00 ? 221 GLY A O    7  
ATOM 7685  H H    . GLY A 1 19 ? 3.576   0.861   10.201 1.00 0.00 ? 221 GLY A H    7  
ATOM 7686  H HA2  . GLY A 1 19 ? 2.923   1.312   12.399 1.00 0.00 ? 221 GLY A HA2  7  
ATOM 7687  H HA3  . GLY A 1 19 ? 2.301   -0.326  12.527 1.00 0.00 ? 221 GLY A HA3  7  
ATOM 7688  N N    . GLY A 1 20 ? 5.351   -0.713  12.222 1.00 0.00 ? 222 GLY A N    7  
ATOM 7689  C CA   . GLY A 1 20 ? 6.588   -1.146  12.849 1.00 0.00 ? 222 GLY A CA   7  
ATOM 7690  C C    . GLY A 1 20 ? 6.528   -2.584  13.331 1.00 0.00 ? 222 GLY A C    7  
ATOM 7691  O O    . GLY A 1 20 ? 7.556   -3.253  13.431 1.00 0.00 ? 222 GLY A O    7  
ATOM 7692  H H    . GLY A 1 20 ? 5.226   -0.839  11.259 1.00 0.00 ? 222 GLY A H    7  
ATOM 7693  H HA2  . GLY A 1 20 ? 7.391   -1.056  12.134 1.00 0.00 ? 222 GLY A HA2  7  
ATOM 7694  H HA3  . GLY A 1 20 ? 6.798   -0.505  13.690 1.00 0.00 ? 222 GLY A HA3  7  
ATOM 7695  N N    . THR A 1 21 ? 5.324   -3.057  13.631 1.00 0.00 ? 223 THR A N    7  
ATOM 7696  C CA   . THR A 1 21 ? 5.137   -4.421  14.106 1.00 0.00 ? 223 THR A CA   7  
ATOM 7697  C C    . THR A 1 21 ? 4.665   -5.327  12.974 1.00 0.00 ? 223 THR A C    7  
ATOM 7698  O O    . THR A 1 21 ? 4.908   -6.535  12.991 1.00 0.00 ? 223 THR A O    7  
ATOM 7699  C CB   . THR A 1 21 ? 4.123   -4.444  15.248 1.00 0.00 ? 223 THR A CB   7  
ATOM 7700  O OG1  . THR A 1 21 ? 2.938   -3.759  14.881 1.00 0.00 ? 223 THR A OG1  7  
ATOM 7701  C CG2  . THR A 1 21 ? 4.647   -3.809  16.518 1.00 0.00 ? 223 THR A CG2  7  
ATOM 7702  H H    . THR A 1 21 ? 4.543   -2.476  13.531 1.00 0.00 ? 223 THR A H    7  
ATOM 7703  H HA   . THR A 1 21 ? 6.087   -4.781  14.469 1.00 0.00 ? 223 THR A HA   7  
ATOM 7704  H HB   . THR A 1 21 ? 3.868   -5.469  15.471 1.00 0.00 ? 223 THR A HB   7  
ATOM 7705  H HG1  . THR A 1 21 ? 2.309   -3.797  15.606 1.00 0.00 ? 223 THR A HG1  7  
ATOM 7706  H HG21 . THR A 1 21 ? 4.275   -4.353  17.372 1.00 0.00 ? 223 THR A HG21 7  
ATOM 7707  H HG22 . THR A 1 21 ? 4.312   -2.784  16.571 1.00 0.00 ? 223 THR A HG22 7  
ATOM 7708  H HG23 . THR A 1 21 ? 5.726   -3.836  16.515 1.00 0.00 ? 223 THR A HG23 7  
ATOM 7709  N N    . LYS A 1 22 ? 3.989   -4.740  11.995 1.00 0.00 ? 224 LYS A N    7  
ATOM 7710  C CA   . LYS A 1 22 ? 3.480   -5.495  10.857 1.00 0.00 ? 224 LYS A CA   7  
ATOM 7711  C C    . LYS A 1 22 ? 4.398   -5.335  9.650  1.00 0.00 ? 224 LYS A C    7  
ATOM 7712  O O    . LYS A 1 22 ? 5.006   -4.283  9.459  1.00 0.00 ? 224 LYS A O    7  
ATOM 7713  C CB   . LYS A 1 22 ? 2.065   -5.033  10.502 1.00 0.00 ? 224 LYS A CB   7  
ATOM 7714  C CG   . LYS A 1 22 ? 1.200   -4.706  11.713 1.00 0.00 ? 224 LYS A CG   7  
ATOM 7715  C CD   . LYS A 1 22 ? 0.560   -5.954  12.298 1.00 0.00 ? 224 LYS A CD   7  
ATOM 7716  C CE   . LYS A 1 22 ? 1.547   -6.746  13.138 1.00 0.00 ? 224 LYS A CE   7  
ATOM 7717  N NZ   . LYS A 1 22 ? 0.914   -7.296  14.368 1.00 0.00 ? 224 LYS A NZ   7  
ATOM 7718  H H    . LYS A 1 22 ? 3.824   -3.775  12.038 1.00 0.00 ? 224 LYS A H    7  
ATOM 7719  H HA   . LYS A 1 22 ? 3.451   -6.538  11.137 1.00 0.00 ? 224 LYS A HA   7  
ATOM 7720  H HB2  . LYS A 1 22 ? 2.131   -4.148  9.888  1.00 0.00 ? 224 LYS A HB2  7  
ATOM 7721  H HB3  . LYS A 1 22 ? 1.574   -5.813  9.940  1.00 0.00 ? 224 LYS A HB3  7  
ATOM 7722  H HG2  . LYS A 1 22 ? 1.815   -4.242  12.469 1.00 0.00 ? 224 LYS A HG2  7  
ATOM 7723  H HG3  . LYS A 1 22 ? 0.423   -4.021  11.412 1.00 0.00 ? 224 LYS A HG3  7  
ATOM 7724  H HD2  . LYS A 1 22 ? -0.273  -5.660  12.921 1.00 0.00 ? 224 LYS A HD2  7  
ATOM 7725  H HD3  . LYS A 1 22 ? 0.205   -6.576  11.491 1.00 0.00 ? 224 LYS A HD3  7  
ATOM 7726  H HE2  . LYS A 1 22 ? 1.931   -7.565  12.545 1.00 0.00 ? 224 LYS A HE2  7  
ATOM 7727  H HE3  . LYS A 1 22 ? 2.362   -6.097  13.421 1.00 0.00 ? 224 LYS A HE3  7  
ATOM 7728  H HZ1  . LYS A 1 22 ? 0.617   -8.281  14.208 1.00 0.00 ? 224 LYS A HZ1  7  
ATOM 7729  H HZ2  . LYS A 1 22 ? 0.080   -6.731  14.625 1.00 0.00 ? 224 LYS A HZ2  7  
ATOM 7730  H HZ3  . LYS A 1 22 ? 1.591   -7.275  15.158 1.00 0.00 ? 224 LYS A HZ3  7  
ATOM 7731  N N    . ALA A 1 23 ? 4.500   -6.384  8.841  1.00 0.00 ? 225 ALA A N    7  
ATOM 7732  C CA   . ALA A 1 23 ? 5.347   -6.353  7.653  1.00 0.00 ? 225 ALA A CA   7  
ATOM 7733  C C    . ALA A 1 23 ? 4.531   -6.596  6.391  1.00 0.00 ? 225 ALA A C    7  
ATOM 7734  O O    . ALA A 1 23 ? 3.587   -7.383  6.394  1.00 0.00 ? 225 ALA A O    7  
ATOM 7735  C CB   . ALA A 1 23 ? 6.458   -7.383  7.764  1.00 0.00 ? 225 ALA A CB   7  
ATOM 7736  H H    . ALA A 1 23 ? 3.993   -7.198  9.045  1.00 0.00 ? 225 ALA A H    7  
ATOM 7737  H HA   . ALA A 1 23 ? 5.801   -5.375  7.593  1.00 0.00 ? 225 ALA A HA   7  
ATOM 7738  H HB1  . ALA A 1 23 ? 6.034   -8.375  7.724  1.00 0.00 ? 225 ALA A HB1  7  
ATOM 7739  H HB2  . ALA A 1 23 ? 7.150   -7.254  6.944  1.00 0.00 ? 225 ALA A HB2  7  
ATOM 7740  H HB3  . ALA A 1 23 ? 6.980   -7.252  8.699  1.00 0.00 ? 225 ALA A HB3  7  
ATOM 7741  N N    . GLY A 1 24 ? 4.906   -5.917  5.313  1.00 0.00 ? 226 GLY A N    7  
ATOM 7742  C CA   . GLY A 1 24 ? 4.197   -6.076  4.059  1.00 0.00 ? 226 GLY A CA   7  
ATOM 7743  C C    . GLY A 1 24 ? 4.844   -5.311  2.922  1.00 0.00 ? 226 GLY A C    7  
ATOM 7744  O O    . GLY A 1 24 ? 5.960   -4.811  3.056  1.00 0.00 ? 226 GLY A O    7  
ATOM 7745  H H    . GLY A 1 24 ? 5.668   -5.303  5.368  1.00 0.00 ? 226 GLY A H    7  
ATOM 7746  H HA2  . GLY A 1 24 ? 4.171   -7.125  3.804  1.00 0.00 ? 226 GLY A HA2  7  
ATOM 7747  H HA3  . GLY A 1 24 ? 3.185   -5.722  4.185  1.00 0.00 ? 226 GLY A HA3  7  
ATOM 7748  N N    . VAL A 1 25 ? 4.139   -5.221  1.798  1.00 0.00 ? 227 VAL A N    7  
ATOM 7749  C CA   . VAL A 1 25 ? 4.647   -4.512  0.630  1.00 0.00 ? 227 VAL A CA   7  
ATOM 7750  C C    . VAL A 1 25 ? 3.759   -3.322  0.285  1.00 0.00 ? 227 VAL A C    7  
ATOM 7751  O O    . VAL A 1 25 ? 2.534   -3.433  0.270  1.00 0.00 ? 227 VAL A O    7  
ATOM 7752  C CB   . VAL A 1 25 ? 4.744   -5.447  -0.594 1.00 0.00 ? 227 VAL A CB   7  
ATOM 7753  C CG1  . VAL A 1 25 ? 5.101   -4.663  -1.850 1.00 0.00 ? 227 VAL A CG1  7  
ATOM 7754  C CG2  . VAL A 1 25 ? 5.757   -6.552  -0.343 1.00 0.00 ? 227 VAL A CG2  7  
ATOM 7755  H H    . VAL A 1 25 ? 3.255   -5.641  1.754  1.00 0.00 ? 227 VAL A H    7  
ATOM 7756  H HA   . VAL A 1 25 ? 5.640   -4.154  0.863  1.00 0.00 ? 227 VAL A HA   7  
ATOM 7757  H HB   . VAL A 1 25 ? 3.777   -5.905  -0.748 1.00 0.00 ? 227 VAL A HB   7  
ATOM 7758  H HG11 . VAL A 1 25 ? 5.715   -5.274  -2.494 1.00 0.00 ? 227 VAL A HG11 7  
ATOM 7759  H HG12 . VAL A 1 25 ? 4.195   -4.388  -2.370 1.00 0.00 ? 227 VAL A HG12 7  
ATOM 7760  H HG13 . VAL A 1 25 ? 5.644   -3.771  -1.574 1.00 0.00 ? 227 VAL A HG13 7  
ATOM 7761  H HG21 . VAL A 1 25 ? 5.547   -7.025  0.604  1.00 0.00 ? 227 VAL A HG21 7  
ATOM 7762  H HG22 . VAL A 1 25 ? 5.696   -7.284  -1.134 1.00 0.00 ? 227 VAL A HG22 7  
ATOM 7763  H HG23 . VAL A 1 25 ? 6.750   -6.129  -0.320 1.00 0.00 ? 227 VAL A HG23 7  
ATOM 7764  N N    . VAL A 1 26 ? 4.385   -2.188  -0.004 1.00 0.00 ? 228 VAL A N    7  
ATOM 7765  C CA   . VAL A 1 26 ? 3.650   -0.982  -0.360 1.00 0.00 ? 228 VAL A CA   7  
ATOM 7766  C C    . VAL A 1 26 ? 2.881   -1.184  -1.660 1.00 0.00 ? 228 VAL A C    7  
ATOM 7767  O O    . VAL A 1 26 ? 3.437   -1.644  -2.656 1.00 0.00 ? 228 VAL A O    7  
ATOM 7768  C CB   . VAL A 1 26 ? 4.594   0.224   -0.508 1.00 0.00 ? 228 VAL A CB   7  
ATOM 7769  C CG1  . VAL A 1 26 ? 3.800   1.510   -0.696 1.00 0.00 ? 228 VAL A CG1  7  
ATOM 7770  C CG2  . VAL A 1 26 ? 5.513   0.322   0.702  1.00 0.00 ? 228 VAL A CG2  7  
ATOM 7771  H H    . VAL A 1 26 ? 5.365   -2.163  0.014  1.00 0.00 ? 228 VAL A H    7  
ATOM 7772  H HA   . VAL A 1 26 ? 2.948   -0.772  0.435  1.00 0.00 ? 228 VAL A HA   7  
ATOM 7773  H HB   . VAL A 1 26 ? 5.204   0.073   -1.385 1.00 0.00 ? 228 VAL A HB   7  
ATOM 7774  H HG11 . VAL A 1 26 ? 3.982   2.172   0.137  1.00 0.00 ? 228 VAL A HG11 7  
ATOM 7775  H HG12 . VAL A 1 26 ? 4.110   1.991   -1.611 1.00 0.00 ? 228 VAL A HG12 7  
ATOM 7776  H HG13 . VAL A 1 26 ? 2.747   1.280   -0.750 1.00 0.00 ? 228 VAL A HG13 7  
ATOM 7777  H HG21 . VAL A 1 26 ? 4.928   0.242   1.606  1.00 0.00 ? 228 VAL A HG21 7  
ATOM 7778  H HG22 . VAL A 1 26 ? 6.236   -0.478  0.668  1.00 0.00 ? 228 VAL A HG22 7  
ATOM 7779  H HG23 . VAL A 1 26 ? 6.026   1.272   0.686  1.00 0.00 ? 228 VAL A HG23 7  
ATOM 7780  N N    . ARG A 1 27 ? 1.596   -0.849  -1.642 1.00 0.00 ? 229 ARG A N    7  
ATOM 7781  C CA   . ARG A 1 27 ? 0.751   -1.008  -2.819 1.00 0.00 ? 229 ARG A CA   7  
ATOM 7782  C C    . ARG A 1 27 ? 0.215   0.337   -3.299 1.00 0.00 ? 229 ARG A C    7  
ATOM 7783  O O    . ARG A 1 27 ? 0.153   0.598   -4.500 1.00 0.00 ? 229 ARG A O    7  
ATOM 7784  C CB   . ARG A 1 27 ? -0.410  -1.955  -2.509 1.00 0.00 ? 229 ARG A CB   7  
ATOM 7785  C CG   . ARG A 1 27 ? -0.003  -3.165  -1.683 1.00 0.00 ? 229 ARG A CG   7  
ATOM 7786  C CD   . ARG A 1 27 ? 1.065   -3.985  -2.386 1.00 0.00 ? 229 ARG A CD   7  
ATOM 7787  N NE   . ARG A 1 27 ? 0.516   -5.205  -2.972 1.00 0.00 ? 229 ARG A NE   7  
ATOM 7788  C CZ   . ARG A 1 27 ? 0.158   -5.327  -4.250 1.00 0.00 ? 229 ARG A CZ   7  
ATOM 7789  N NH1  . ARG A 1 27 ? 0.269   -4.299  -5.083 1.00 0.00 ? 229 ARG A NH1  7  
ATOM 7790  N NH2  . ARG A 1 27 ? -0.320  -6.481  -4.695 1.00 0.00 ? 229 ARG A NH2  7  
ATOM 7791  H H    . ARG A 1 27 ? 1.204   -0.495  -0.816 1.00 0.00 ? 229 ARG A H    7  
ATOM 7792  H HA   . ARG A 1 27 ? 1.354   -1.440  -3.603 1.00 0.00 ? 229 ARG A HA   7  
ATOM 7793  H HB2  . ARG A 1 27 ? -1.167  -1.414  -1.964 1.00 0.00 ? 229 ARG A HB2  7  
ATOM 7794  H HB3  . ARG A 1 27 ? -0.830  -2.306  -3.437 1.00 0.00 ? 229 ARG A HB3  7  
ATOM 7795  H HG2  . ARG A 1 27 ? 0.384   -2.825  -0.733 1.00 0.00 ? 229 ARG A HG2  7  
ATOM 7796  H HG3  . ARG A 1 27 ? -0.873  -3.784  -1.519 1.00 0.00 ? 229 ARG A HG3  7  
ATOM 7797  H HD2  . ARG A 1 27 ? 1.509   -3.387  -3.165 1.00 0.00 ? 229 ARG A HD2  7  
ATOM 7798  H HD3  . ARG A 1 27 ? 1.823   -4.255  -1.666 1.00 0.00 ? 229 ARG A HD3  7  
ATOM 7799  H HE   . ARG A 1 27 ? 0.410   -5.979  -2.382 1.00 0.00 ? 229 ARG A HE   7  
ATOM 7800  H HH11 . ARG A 1 27 ? 0.622   -3.424  -4.758 1.00 0.00 ? 229 ARG A HH11 7  
ATOM 7801  H HH12 . ARG A 1 27 ? -0.001  -4.402  -6.041 1.00 0.00 ? 229 ARG A HH12 7  
ATOM 7802  H HH21 . ARG A 1 27 ? -0.410  -7.258  -4.071 1.00 0.00 ? 229 ARG A HH21 7  
ATOM 7803  H HH22 . ARG A 1 27 ? -0.588  -6.574  -5.654 1.00 0.00 ? 229 ARG A HH22 7  
ATOM 7804  N N    . PHE A 1 28 ? -0.174  1.189   -2.355 1.00 0.00 ? 230 PHE A N    7  
ATOM 7805  C CA   . PHE A 1 28 ? -0.705  2.506   -2.690 1.00 0.00 ? 230 PHE A CA   7  
ATOM 7806  C C    . PHE A 1 28 ? -0.318  3.537   -1.636 1.00 0.00 ? 230 PHE A C    7  
ATOM 7807  O O    . PHE A 1 28 ? -0.140  3.205   -0.469 1.00 0.00 ? 230 PHE A O    7  
ATOM 7808  C CB   . PHE A 1 28 ? -2.227  2.444   -2.823 1.00 0.00 ? 230 PHE A CB   7  
ATOM 7809  C CG   . PHE A 1 28 ? -2.828  3.678   -3.432 1.00 0.00 ? 230 PHE A CG   7  
ATOM 7810  C CD1  . PHE A 1 28 ? -2.581  4.004   -4.756 1.00 0.00 ? 230 PHE A CD1  7  
ATOM 7811  C CD2  . PHE A 1 28 ? -3.638  4.514   -2.681 1.00 0.00 ? 230 PHE A CD2  7  
ATOM 7812  C CE1  . PHE A 1 28 ? -3.131  5.138   -5.321 1.00 0.00 ? 230 PHE A CE1  7  
ATOM 7813  C CE2  . PHE A 1 28 ? -4.192  5.651   -3.240 1.00 0.00 ? 230 PHE A CE2  7  
ATOM 7814  C CZ   . PHE A 1 28 ? -3.939  5.962   -4.561 1.00 0.00 ? 230 PHE A CZ   7  
ATOM 7815  H H    . PHE A 1 28 ? -0.101  0.927   -1.414 1.00 0.00 ? 230 PHE A H    7  
ATOM 7816  H HA   . PHE A 1 28 ? -0.284  2.802   -3.635 1.00 0.00 ? 230 PHE A HA   7  
ATOM 7817  H HB2  . PHE A 1 28 ? -2.494  1.604   -3.445 1.00 0.00 ? 230 PHE A HB2  7  
ATOM 7818  H HB3  . PHE A 1 28 ? -2.662  2.312   -1.842 1.00 0.00 ? 230 PHE A HB3  7  
ATOM 7819  H HD1  . PHE A 1 28 ? -1.950  3.358   -5.352 1.00 0.00 ? 230 PHE A HD1  7  
ATOM 7820  H HD2  . PHE A 1 28 ? -3.837  4.271   -1.648 1.00 0.00 ? 230 PHE A HD2  7  
ATOM 7821  H HE1  . PHE A 1 28 ? -2.931  5.380   -6.354 1.00 0.00 ? 230 PHE A HE1  7  
ATOM 7822  H HE2  . PHE A 1 28 ? -4.823  6.293   -2.644 1.00 0.00 ? 230 PHE A HE2  7  
ATOM 7823  H HZ   . PHE A 1 28 ? -4.370  6.850   -5.001 1.00 0.00 ? 230 PHE A HZ   7  
ATOM 7824  N N    . LEU A 1 29 ? -0.191  4.792   -2.053 1.00 0.00 ? 231 LEU A N    7  
ATOM 7825  C CA   . LEU A 1 29 ? 0.169   5.865   -1.133 1.00 0.00 ? 231 LEU A CA   7  
ATOM 7826  C C    . LEU A 1 29 ? -0.717  7.087   -1.348 1.00 0.00 ? 231 LEU A C    7  
ATOM 7827  O O    . LEU A 1 29 ? -0.743  7.664   -2.436 1.00 0.00 ? 231 LEU A O    7  
ATOM 7828  C CB   . LEU A 1 29 ? 1.641   6.245   -1.304 1.00 0.00 ? 231 LEU A CB   7  
ATOM 7829  C CG   . LEU A 1 29 ? 2.634   5.101   -1.074 1.00 0.00 ? 231 LEU A CG   7  
ATOM 7830  C CD1  . LEU A 1 29 ? 3.463   4.850   -2.324 1.00 0.00 ? 231 LEU A CD1  7  
ATOM 7831  C CD2  . LEU A 1 29 ? 3.538   5.407   0.111  1.00 0.00 ? 231 LEU A CD2  7  
ATOM 7832  H H    . LEU A 1 29 ? -0.348  5.002   -2.997 1.00 0.00 ? 231 LEU A H    7  
ATOM 7833  H HA   . LEU A 1 29 ? 0.017   5.502   -0.128 1.00 0.00 ? 231 LEU A HA   7  
ATOM 7834  H HB2  . LEU A 1 29 ? 1.778   6.620   -2.307 1.00 0.00 ? 231 LEU A HB2  7  
ATOM 7835  H HB3  . LEU A 1 29 ? 1.869   7.037   -0.608 1.00 0.00 ? 231 LEU A HB3  7  
ATOM 7836  H HG   . LEU A 1 29 ? 2.085   4.197   -0.852 1.00 0.00 ? 231 LEU A HG   7  
ATOM 7837  H HD11 . LEU A 1 29 ? 2.943   5.241   -3.186 1.00 0.00 ? 231 LEU A HD11 7  
ATOM 7838  H HD12 . LEU A 1 29 ? 4.419   5.340   -2.228 1.00 0.00 ? 231 LEU A HD12 7  
ATOM 7839  H HD13 . LEU A 1 29 ? 3.613   3.787   -2.448 1.00 0.00 ? 231 LEU A HD13 7  
ATOM 7840  H HD21 . LEU A 1 29 ? 4.199   6.223   -0.141 1.00 0.00 ? 231 LEU A HD21 7  
ATOM 7841  H HD22 . LEU A 1 29 ? 2.933   5.683   0.964  1.00 0.00 ? 231 LEU A HD22 7  
ATOM 7842  H HD23 . LEU A 1 29 ? 4.123   4.533   0.354  1.00 0.00 ? 231 LEU A HD23 7  
ATOM 7843  N N    . GLY A 1 30 ? -1.444  7.477   -0.306 1.00 0.00 ? 232 GLY A N    7  
ATOM 7844  C CA   . GLY A 1 30 ? -2.321  8.629   -0.403 1.00 0.00 ? 232 GLY A CA   7  
ATOM 7845  C C    . GLY A 1 30 ? -3.198  8.798   0.822  1.00 0.00 ? 232 GLY A C    7  
ATOM 7846  O O    . GLY A 1 30 ? -3.048  8.073   1.805  1.00 0.00 ? 232 GLY A O    7  
ATOM 7847  H H    . GLY A 1 30 ? -1.383  6.979   0.536  1.00 0.00 ? 232 GLY A H    7  
ATOM 7848  H HA2  . GLY A 1 30 ? -1.718  9.517   -0.526 1.00 0.00 ? 232 GLY A HA2  7  
ATOM 7849  H HA3  . GLY A 1 30 ? -2.953  8.514   -1.271 1.00 0.00 ? 232 GLY A HA3  7  
ATOM 7850  N N    . GLU A 1 31 ? -4.115  9.757   0.764  1.00 0.00 ? 233 GLU A N    7  
ATOM 7851  C CA   . GLU A 1 31 ? -5.017  10.019  1.878  1.00 0.00 ? 233 GLU A CA   7  
ATOM 7852  C C    . GLU A 1 31 ? -6.167  9.015   1.895  1.00 0.00 ? 233 GLU A C    7  
ATOM 7853  O O    . GLU A 1 31 ? -6.430  8.342   0.899  1.00 0.00 ? 233 GLU A O    7  
ATOM 7854  C CB   . GLU A 1 31 ? -5.570  11.442  1.792  1.00 0.00 ? 233 GLU A CB   7  
ATOM 7855  C CG   . GLU A 1 31 ? -4.505  12.491  1.520  1.00 0.00 ? 233 GLU A CG   7  
ATOM 7856  C CD   . GLU A 1 31 ? -4.405  12.855  0.051  1.00 0.00 ? 233 GLU A CD   7  
ATOM 7857  O OE1  . GLU A 1 31 ? -4.784  12.018  -0.794 1.00 0.00 ? 233 GLU A OE1  7  
ATOM 7858  O OE2  . GLU A 1 31 ? -3.947  13.977  -0.253 1.00 0.00 ? 233 GLU A OE2  7  
ATOM 7859  H H    . GLU A 1 31 ? -4.185  10.303  -0.047 1.00 0.00 ? 233 GLU A H    7  
ATOM 7860  H HA   . GLU A 1 31 ? -4.453  9.916   2.792  1.00 0.00 ? 233 GLU A HA   7  
ATOM 7861  H HB2  . GLU A 1 31 ? -6.299  11.486  0.996  1.00 0.00 ? 233 GLU A HB2  7  
ATOM 7862  H HB3  . GLU A 1 31 ? -6.054  11.685  2.725  1.00 0.00 ? 233 GLU A HB3  7  
ATOM 7863  H HG2  . GLU A 1 31 ? -4.743  13.383  2.080  1.00 0.00 ? 233 GLU A HG2  7  
ATOM 7864  H HG3  . GLU A 1 31 ? -3.548  12.108  1.846  1.00 0.00 ? 233 GLU A HG3  7  
ATOM 7865  N N    . THR A 1 32 ? -6.845  8.920   3.033  1.00 0.00 ? 234 THR A N    7  
ATOM 7866  C CA   . THR A 1 32 ? -7.965  7.999   3.180  1.00 0.00 ? 234 THR A CA   7  
ATOM 7867  C C    . THR A 1 32 ? -9.286  8.755   3.268  1.00 0.00 ? 234 THR A C    7  
ATOM 7868  O O    . THR A 1 32 ? -9.306  9.960   3.522  1.00 0.00 ? 234 THR A O    7  
ATOM 7869  C CB   . THR A 1 32 ? -7.778  7.131   4.428  1.00 0.00 ? 234 THR A CB   7  
ATOM 7870  O OG1  . THR A 1 32 ? -7.952  7.901   5.604  1.00 0.00 ? 234 THR A OG1  7  
ATOM 7871  C CG2  . THR A 1 32 ? -6.415  6.477   4.502  1.00 0.00 ? 234 THR A CG2  7  
ATOM 7872  H H    . THR A 1 32 ? -6.586  9.483   3.793  1.00 0.00 ? 234 THR A H    7  
ATOM 7873  H HA   . THR A 1 32 ? -7.986  7.361   2.310  1.00 0.00 ? 234 THR A HA   7  
ATOM 7874  H HB   . THR A 1 32 ? -8.521  6.347   4.422  1.00 0.00 ? 234 THR A HB   7  
ATOM 7875  H HG1  . THR A 1 32 ? -7.403  8.687   5.555  1.00 0.00 ? 234 THR A HG1  7  
ATOM 7876  H HG21 . THR A 1 32 ? -5.976  6.675   5.469  1.00 0.00 ? 234 THR A HG21 7  
ATOM 7877  H HG22 . THR A 1 32 ? -5.780  6.881   3.728  1.00 0.00 ? 234 THR A HG22 7  
ATOM 7878  H HG23 . THR A 1 32 ? -6.519  5.411   4.364  1.00 0.00 ? 234 THR A HG23 7  
ATOM 7879  N N    . ASP A 1 33 ? -10.387 8.042   3.055  1.00 0.00 ? 235 ASP A N    7  
ATOM 7880  C CA   . ASP A 1 33 ? -11.714 8.647   3.109  1.00 0.00 ? 235 ASP A CA   7  
ATOM 7881  C C    . ASP A 1 33 ? -12.274 8.637   4.531  1.00 0.00 ? 235 ASP A C    7  
ATOM 7882  O O    . ASP A 1 33 ? -13.364 9.153   4.777  1.00 0.00 ? 235 ASP A O    7  
ATOM 7883  C CB   . ASP A 1 33 ? -12.668 7.907   2.169  1.00 0.00 ? 235 ASP A CB   7  
ATOM 7884  C CG   . ASP A 1 33 ? -13.616 8.846   1.451  1.00 0.00 ? 235 ASP A CG   7  
ATOM 7885  O OD1  . ASP A 1 33 ? -13.235 9.375   0.386  1.00 0.00 ? 235 ASP A OD1  7  
ATOM 7886  O OD2  . ASP A 1 33 ? -14.741 9.053   1.955  1.00 0.00 ? 235 ASP A OD2  7  
ATOM 7887  H H    . ASP A 1 33 ? -10.305 7.086   2.857  1.00 0.00 ? 235 ASP A H    7  
ATOM 7888  H HA   . ASP A 1 33 ? -11.622 9.670   2.779  1.00 0.00 ? 235 ASP A HA   7  
ATOM 7889  H HB2  . ASP A 1 33 ? -12.091 7.372   1.428  1.00 0.00 ? 235 ASP A HB2  7  
ATOM 7890  H HB3  . ASP A 1 33 ? -13.252 7.201   2.742  1.00 0.00 ? 235 ASP A HB3  7  
ATOM 7891  N N    . PHE A 1 34 ? -11.530 8.051   5.466  1.00 0.00 ? 236 PHE A N    7  
ATOM 7892  C CA   . PHE A 1 34 ? -11.970 7.983   6.857  1.00 0.00 ? 236 PHE A CA   7  
ATOM 7893  C C    . PHE A 1 34 ? -10.955 8.638   7.798  1.00 0.00 ? 236 PHE A C    7  
ATOM 7894  O O    . PHE A 1 34 ? -11.278 8.954   8.943  1.00 0.00 ? 236 PHE A O    7  
ATOM 7895  C CB   . PHE A 1 34 ? -12.208 6.525   7.273  1.00 0.00 ? 236 PHE A CB   7  
ATOM 7896  C CG   . PHE A 1 34 ? -10.956 5.774   7.642  1.00 0.00 ? 236 PHE A CG   7  
ATOM 7897  C CD1  . PHE A 1 34 ? -9.940  5.589   6.718  1.00 0.00 ? 236 PHE A CD1  7  
ATOM 7898  C CD2  . PHE A 1 34 ? -10.800 5.257   8.919  1.00 0.00 ? 236 PHE A CD2  7  
ATOM 7899  C CE1  . PHE A 1 34 ? -8.791  4.901   7.060  1.00 0.00 ? 236 PHE A CE1  7  
ATOM 7900  C CE2  . PHE A 1 34 ? -9.652  4.569   9.266  1.00 0.00 ? 236 PHE A CE2  7  
ATOM 7901  C CZ   . PHE A 1 34 ? -8.647  4.390   8.335  1.00 0.00 ? 236 PHE A CZ   7  
ATOM 7902  H H    . PHE A 1 34 ? -10.671 7.655   5.216  1.00 0.00 ? 236 PHE A H    7  
ATOM 7903  H HA   . PHE A 1 34 ? -12.902 8.522   6.931  1.00 0.00 ? 236 PHE A HA   7  
ATOM 7904  H HB2  . PHE A 1 34 ? -12.867 6.507   8.127  1.00 0.00 ? 236 PHE A HB2  7  
ATOM 7905  H HB3  . PHE A 1 34 ? -12.680 6.001   6.454  1.00 0.00 ? 236 PHE A HB3  7  
ATOM 7906  H HD1  . PHE A 1 34 ? -10.050 5.987   5.723  1.00 0.00 ? 236 PHE A HD1  7  
ATOM 7907  H HD2  . PHE A 1 34 ? -11.584 5.395   9.646  1.00 0.00 ? 236 PHE A HD2  7  
ATOM 7908  H HE1  . PHE A 1 34 ? -8.007  4.762   6.331  1.00 0.00 ? 236 PHE A HE1  7  
ATOM 7909  H HE2  . PHE A 1 34 ? -9.542  4.169   10.263 1.00 0.00 ? 236 PHE A HE2  7  
ATOM 7910  H HZ   . PHE A 1 34 ? -7.750  3.852   8.605  1.00 0.00 ? 236 PHE A HZ   7  
ATOM 7911  N N    . ALA A 1 35 ? -9.732  8.836   7.314  1.00 0.00 ? 237 ALA A N    7  
ATOM 7912  C CA   . ALA A 1 35 ? -8.684  9.448   8.121  1.00 0.00 ? 237 ALA A CA   7  
ATOM 7913  C C    . ALA A 1 35 ? -8.166  10.731  7.477  1.00 0.00 ? 237 ALA A C    7  
ATOM 7914  O O    . ALA A 1 35 ? -8.023  10.808  6.256  1.00 0.00 ? 237 ALA A O    7  
ATOM 7915  C CB   . ALA A 1 35 ? -7.543  8.467   8.338  1.00 0.00 ? 237 ALA A CB   7  
ATOM 7916  H H    . ALA A 1 35 ? -9.526  8.563   6.397  1.00 0.00 ? 237 ALA A H    7  
ATOM 7917  H HA   . ALA A 1 35 ? -9.107  9.689   9.086  1.00 0.00 ? 237 ALA A HA   7  
ATOM 7918  H HB1  . ALA A 1 35 ? -7.944  7.471   8.458  1.00 0.00 ? 237 ALA A HB1  7  
ATOM 7919  H HB2  . ALA A 1 35 ? -6.882  8.490   7.486  1.00 0.00 ? 237 ALA A HB2  7  
ATOM 7920  H HB3  . ALA A 1 35 ? -6.995  8.742   9.228  1.00 0.00 ? 237 ALA A HB3  7  
ATOM 7921  N N    . LYS A 1 36 ? -7.887  11.732  8.304  1.00 0.00 ? 238 LYS A N    7  
ATOM 7922  C CA   . LYS A 1 36 ? -7.382  13.010  7.814  1.00 0.00 ? 238 LYS A CA   7  
ATOM 7923  C C    . LYS A 1 36 ? -5.856  13.017  7.780  1.00 0.00 ? 238 LYS A C    7  
ATOM 7924  O O    . LYS A 1 36 ? -5.202  12.820  8.804  1.00 0.00 ? 238 LYS A O    7  
ATOM 7925  C CB   . LYS A 1 36 ? -7.887  14.154  8.695  1.00 0.00 ? 238 LYS A CB   7  
ATOM 7926  C CG   . LYS A 1 36 ? -9.389  14.123  8.933  1.00 0.00 ? 238 LYS A CG   7  
ATOM 7927  C CD   . LYS A 1 36 ? -9.953  15.522  9.114  1.00 0.00 ? 238 LYS A CD   7  
ATOM 7928  C CE   . LYS A 1 36 ? -9.392  16.192  10.358 1.00 0.00 ? 238 LYS A CE   7  
ATOM 7929  N NZ   . LYS A 1 36 ? -9.603  15.364  11.578 1.00 0.00 ? 238 LYS A NZ   7  
ATOM 7930  H H    . LYS A 1 36 ? -8.021  11.608  9.268  1.00 0.00 ? 238 LYS A H    7  
ATOM 7931  H HA   . LYS A 1 36 ? -7.754  13.149  6.809  1.00 0.00 ? 238 LYS A HA   7  
ATOM 7932  H HB2  . LYS A 1 36 ? -7.393  14.100  9.653  1.00 0.00 ? 238 LYS A HB2  7  
ATOM 7933  H HB3  . LYS A 1 36 ? -7.640  15.093  8.224  1.00 0.00 ? 238 LYS A HB3  7  
ATOM 7934  H HG2  . LYS A 1 36 ? -9.868  13.660  8.084  1.00 0.00 ? 238 LYS A HG2  7  
ATOM 7935  H HG3  . LYS A 1 36 ? -9.590  13.545  9.822  1.00 0.00 ? 238 LYS A HG3  7  
ATOM 7936  H HD2  . LYS A 1 36 ? -9.698  16.118  8.251  1.00 0.00 ? 238 LYS A HD2  7  
ATOM 7937  H HD3  . LYS A 1 36 ? -11.028 15.457  9.204  1.00 0.00 ? 238 LYS A HD3  7  
ATOM 7938  H HE2  . LYS A 1 36 ? -8.333  16.350  10.220 1.00 0.00 ? 238 LYS A HE2  7  
ATOM 7939  H HE3  . LYS A 1 36 ? -9.882  17.146  10.490 1.00 0.00 ? 238 LYS A HE3  7  
ATOM 7940  H HZ1  . LYS A 1 36 ? -9.646  15.973  12.420 1.00 0.00 ? 238 LYS A HZ1  7  
ATOM 7941  H HZ2  . LYS A 1 36 ? -8.819  14.690  11.692 1.00 0.00 ? 238 LYS A HZ2  7  
ATOM 7942  H HZ3  . LYS A 1 36 ? -10.494 14.836  11.502 1.00 0.00 ? 238 LYS A HZ3  7  
ATOM 7943  N N    . GLY A 1 37 ? -5.296  13.243  6.595  1.00 0.00 ? 239 GLY A N    7  
ATOM 7944  C CA   . GLY A 1 37 ? -3.852  13.272  6.452  1.00 0.00 ? 239 GLY A CA   7  
ATOM 7945  C C    . GLY A 1 37 ? -3.355  12.331  5.371  1.00 0.00 ? 239 GLY A C    7  
ATOM 7946  O O    . GLY A 1 37 ? -4.137  11.855  4.547  1.00 0.00 ? 239 GLY A O    7  
ATOM 7947  H H    . GLY A 1 37 ? -5.867  13.393  5.815  1.00 0.00 ? 239 GLY A H    7  
ATOM 7948  H HA2  . GLY A 1 37 ? -3.546  14.278  6.205  1.00 0.00 ? 239 GLY A HA2  7  
ATOM 7949  H HA3  . GLY A 1 37 ? -3.401  12.992  7.393  1.00 0.00 ? 239 GLY A HA3  7  
ATOM 7950  N N    . GLU A 1 38 ? -2.055  12.061  5.376  1.00 0.00 ? 240 GLU A N    7  
ATOM 7951  C CA   . GLU A 1 38 ? -1.454  11.171  4.390  1.00 0.00 ? 240 GLU A CA   7  
ATOM 7952  C C    . GLU A 1 38 ? -1.351  9.749   4.933  1.00 0.00 ? 240 GLU A C    7  
ATOM 7953  O O    . GLU A 1 38 ? -0.933  9.537   6.071  1.00 0.00 ? 240 GLU A O    7  
ATOM 7954  C CB   . GLU A 1 38 ? -0.066  11.678  3.991  1.00 0.00 ? 240 GLU A CB   7  
ATOM 7955  C CG   . GLU A 1 38 ? 0.929   11.696  5.140  1.00 0.00 ? 240 GLU A CG   7  
ATOM 7956  C CD   . GLU A 1 38 ? 2.273   12.270  4.738  1.00 0.00 ? 240 GLU A CD   7  
ATOM 7957  O OE1  . GLU A 1 38 ? 2.295   13.212  3.916  1.00 0.00 ? 240 GLU A OE1  7  
ATOM 7958  O OE2  . GLU A 1 38 ? 3.304   11.779  5.241  1.00 0.00 ? 240 GLU A OE2  7  
ATOM 7959  H H    . GLU A 1 38 ? -1.483  12.472  6.060  1.00 0.00 ? 240 GLU A H    7  
ATOM 7960  H HA   . GLU A 1 38 ? -2.090  11.165  3.518  1.00 0.00 ? 240 GLU A HA   7  
ATOM 7961  H HB2  . GLU A 1 38 ? 0.326   11.041  3.212  1.00 0.00 ? 240 GLU A HB2  7  
ATOM 7962  H HB3  . GLU A 1 38 ? -0.160  12.683  3.608  1.00 0.00 ? 240 GLU A HB3  7  
ATOM 7963  H HG2  . GLU A 1 38 ? 0.524   12.295  5.941  1.00 0.00 ? 240 GLU A HG2  7  
ATOM 7964  H HG3  . GLU A 1 38 ? 1.077   10.683  5.487  1.00 0.00 ? 240 GLU A HG3  7  
ATOM 7965  N N    . TRP A 1 39 ? -1.738  8.779   4.111  1.00 0.00 ? 241 TRP A N    7  
ATOM 7966  C CA   . TRP A 1 39 ? -1.691  7.375   4.510  1.00 0.00 ? 241 TRP A CA   7  
ATOM 7967  C C    . TRP A 1 39 ? -1.084  6.515   3.406  1.00 0.00 ? 241 TRP A C    7  
ATOM 7968  O O    . TRP A 1 39 ? -0.888  6.978   2.283  1.00 0.00 ? 241 TRP A O    7  
ATOM 7969  C CB   . TRP A 1 39 ? -3.096  6.877   4.853  1.00 0.00 ? 241 TRP A CB   7  
ATOM 7970  C CG   . TRP A 1 39 ? -3.683  7.551   6.056  1.00 0.00 ? 241 TRP A CG   7  
ATOM 7971  C CD1  . TRP A 1 39 ? -4.171  8.824   6.124  1.00 0.00 ? 241 TRP A CD1  7  
ATOM 7972  C CD2  . TRP A 1 39 ? -3.838  6.990   7.363  1.00 0.00 ? 241 TRP A CD2  7  
ATOM 7973  N NE1  . TRP A 1 39 ? -4.622  9.088   7.396  1.00 0.00 ? 241 TRP A NE1  7  
ATOM 7974  C CE2  . TRP A 1 39 ? -4.428  7.977   8.174  1.00 0.00 ? 241 TRP A CE2  7  
ATOM 7975  C CE3  . TRP A 1 39 ? -3.536  5.747   7.926  1.00 0.00 ? 241 TRP A CE3  7  
ATOM 7976  C CZ2  . TRP A 1 39 ? -4.721  7.760   9.518  1.00 0.00 ? 241 TRP A CZ2  7  
ATOM 7977  C CZ3  . TRP A 1 39 ? -3.827  5.533   9.260  1.00 0.00 ? 241 TRP A CZ3  7  
ATOM 7978  C CH2  . TRP A 1 39 ? -4.415  6.534   10.043 1.00 0.00 ? 241 TRP A CH2  7  
ATOM 7979  H H    . TRP A 1 39 ? -2.065  9.010   3.217  1.00 0.00 ? 241 TRP A H    7  
ATOM 7980  H HA   . TRP A 1 39 ? -1.071  7.303   5.389  1.00 0.00 ? 241 TRP A HA   7  
ATOM 7981  H HB2  . TRP A 1 39 ? -3.752  7.059   4.014  1.00 0.00 ? 241 TRP A HB2  7  
ATOM 7982  H HB3  . TRP A 1 39 ? -3.056  5.815   5.050  1.00 0.00 ? 241 TRP A HB3  7  
ATOM 7983  H HD1  . TRP A 1 39 ? -4.194  9.513   5.294  1.00 0.00 ? 241 TRP A HD1  7  
ATOM 7984  H HE1  . TRP A 1 39 ? -5.017  9.933   7.695  1.00 0.00 ? 241 TRP A HE1  7  
ATOM 7985  H HE3  . TRP A 1 39 ? -3.083  4.963   7.339  1.00 0.00 ? 241 TRP A HE3  7  
ATOM 7986  H HZ2  . TRP A 1 39 ? -5.174  8.522   10.135 1.00 0.00 ? 241 TRP A HZ2  7  
ATOM 7987  H HZ3  . TRP A 1 39 ? -3.602  4.580   9.712  1.00 0.00 ? 241 TRP A HZ3  7  
ATOM 7988  H HH2  . TRP A 1 39 ? -4.623  6.322   11.082 1.00 0.00 ? 241 TRP A HH2  7  
ATOM 7989  N N    . CYS A 1 40 ? -0.785  5.263   3.734  1.00 0.00 ? 242 CYS A N    7  
ATOM 7990  C CA   . CYS A 1 40 ? -0.197  4.343   2.766  1.00 0.00 ? 242 CYS A CA   7  
ATOM 7991  C C    . CYS A 1 40 ? -0.789  2.944   2.907  1.00 0.00 ? 242 CYS A C    7  
ATOM 7992  O O    . CYS A 1 40 ? -1.286  2.568   3.969  1.00 0.00 ? 242 CYS A O    7  
ATOM 7993  C CB   . CYS A 1 40 ? 1.324   4.289   2.936  1.00 0.00 ? 242 CYS A CB   7  
ATOM 7994  S SG   . CYS A 1 40 ? 2.154   3.106   1.847  1.00 0.00 ? 242 CYS A SG   7  
ATOM 7995  H H    . CYS A 1 40 ? -0.962  4.950   4.645  1.00 0.00 ? 242 CYS A H    7  
ATOM 7996  H HA   . CYS A 1 40 ? -0.424  4.716   1.778  1.00 0.00 ? 242 CYS A HA   7  
ATOM 7997  H HB2  . CYS A 1 40 ? 1.735   5.265   2.726  1.00 0.00 ? 242 CYS A HB2  7  
ATOM 7998  H HB3  . CYS A 1 40 ? 1.557   4.018   3.956  1.00 0.00 ? 242 CYS A HB3  7  
ATOM 7999  H HG   . CYS A 1 40 ? 3.084   3.341   1.808  1.00 0.00 ? 242 CYS A HG   7  
ATOM 8000  N N    . GLY A 1 41 ? -0.730  2.182   1.822  1.00 0.00 ? 243 GLY A N    7  
ATOM 8001  C CA   . GLY A 1 41 ? -1.254  0.830   1.820  1.00 0.00 ? 243 GLY A CA   7  
ATOM 8002  C C    . GLY A 1 41 ? -0.159  -0.206  1.690  1.00 0.00 ? 243 GLY A C    7  
ATOM 8003  O O    . GLY A 1 41 ? 0.649   -0.147  0.764  1.00 0.00 ? 243 GLY A O    7  
ATOM 8004  H H    . GLY A 1 41 ? -0.320  2.540   1.008  1.00 0.00 ? 243 GLY A H    7  
ATOM 8005  H HA2  . GLY A 1 41 ? -1.793  0.661   2.742  1.00 0.00 ? 243 GLY A HA2  7  
ATOM 8006  H HA3  . GLY A 1 41 ? -1.937  0.724   0.989  1.00 0.00 ? 243 GLY A HA3  7  
ATOM 8007  N N    . VAL A 1 42 ? -0.128  -1.157  2.616  1.00 0.00 ? 244 VAL A N    7  
ATOM 8008  C CA   . VAL A 1 42 ? 0.882   -2.206  2.593  1.00 0.00 ? 244 VAL A CA   7  
ATOM 8009  C C    . VAL A 1 42 ? 0.242   -3.587  2.693  1.00 0.00 ? 244 VAL A C    7  
ATOM 8010  O O    . VAL A 1 42 ? -0.608  -3.827  3.551  1.00 0.00 ? 244 VAL A O    7  
ATOM 8011  C CB   . VAL A 1 42 ? 1.894   -2.045  3.749  1.00 0.00 ? 244 VAL A CB   7  
ATOM 8012  C CG1  . VAL A 1 42 ? 3.130   -2.896  3.503  1.00 0.00 ? 244 VAL A CG1  7  
ATOM 8013  C CG2  . VAL A 1 42 ? 2.278   -0.585  3.939  1.00 0.00 ? 244 VAL A CG2  7  
ATOM 8014  H H    . VAL A 1 42 ? -0.798  -1.151  3.332  1.00 0.00 ? 244 VAL A H    7  
ATOM 8015  H HA   . VAL A 1 42 ? 1.419   -2.135  1.656  1.00 0.00 ? 244 VAL A HA   7  
ATOM 8016  H HB   . VAL A 1 42 ? 1.425   -2.391  4.658  1.00 0.00 ? 244 VAL A HB   7  
ATOM 8017  H HG11 . VAL A 1 42 ? 3.697   -2.479  2.684  1.00 0.00 ? 244 VAL A HG11 7  
ATOM 8018  H HG12 . VAL A 1 42 ? 3.741   -2.907  4.393  1.00 0.00 ? 244 VAL A HG12 7  
ATOM 8019  H HG13 . VAL A 1 42 ? 2.831   -3.904  3.259  1.00 0.00 ? 244 VAL A HG13 7  
ATOM 8020  H HG21 . VAL A 1 42 ? 2.678   -0.194  3.015  1.00 0.00 ? 244 VAL A HG21 7  
ATOM 8021  H HG22 . VAL A 1 42 ? 1.406   -0.016  4.224  1.00 0.00 ? 244 VAL A HG22 7  
ATOM 8022  H HG23 . VAL A 1 42 ? 3.027   -0.509  4.715  1.00 0.00 ? 244 VAL A HG23 7  
ATOM 8023  N N    . GLU A 1 43 ? 0.663   -4.493  1.817  1.00 0.00 ? 245 GLU A N    7  
ATOM 8024  C CA   . GLU A 1 43 ? 0.138   -5.852  1.815  1.00 0.00 ? 245 GLU A CA   7  
ATOM 8025  C C    . GLU A 1 43 ? 0.894   -6.703  2.828  1.00 0.00 ? 245 GLU A C    7  
ATOM 8026  O O    . GLU A 1 43 ? 2.074   -6.999  2.646  1.00 0.00 ? 245 GLU A O    7  
ATOM 8027  C CB   . GLU A 1 43 ? 0.255   -6.467  0.419  1.00 0.00 ? 245 GLU A CB   7  
ATOM 8028  C CG   . GLU A 1 43 ? -0.275  -7.889  0.335  1.00 0.00 ? 245 GLU A CG   7  
ATOM 8029  C CD   . GLU A 1 43 ? -0.250  -8.439  -1.078 1.00 0.00 ? 245 GLU A CD   7  
ATOM 8030  O OE1  . GLU A 1 43 ? -0.241  -7.628  -2.030 1.00 0.00 ? 245 GLU A OE1  7  
ATOM 8031  O OE2  . GLU A 1 43 ? -0.241  -9.677  -1.235 1.00 0.00 ? 245 GLU A OE2  7  
ATOM 8032  H H    . GLU A 1 43 ? 1.348   -4.245  1.164  1.00 0.00 ? 245 GLU A H    7  
ATOM 8033  H HA   . GLU A 1 43 ? -0.902  -5.810  2.100  1.00 0.00 ? 245 GLU A HA   7  
ATOM 8034  H HB2  . GLU A 1 43 ? -0.301  -5.857  -0.277 1.00 0.00 ? 245 GLU A HB2  7  
ATOM 8035  H HB3  . GLU A 1 43 ? 1.295   -6.477  0.127  1.00 0.00 ? 245 GLU A HB3  7  
ATOM 8036  H HG2  . GLU A 1 43 ? 0.332   -8.526  0.960  1.00 0.00 ? 245 GLU A HG2  7  
ATOM 8037  H HG3  . GLU A 1 43 ? -1.294  -7.902  0.692  1.00 0.00 ? 245 GLU A HG3  7  
ATOM 8038  N N    . LEU A 1 44 ? 0.212   -7.078  3.902  1.00 0.00 ? 246 LEU A N    7  
ATOM 8039  C CA   . LEU A 1 44 ? 0.827   -7.877  4.952  1.00 0.00 ? 246 LEU A CA   7  
ATOM 8040  C C    . LEU A 1 44 ? 1.158   -9.282  4.465  1.00 0.00 ? 246 LEU A C    7  
ATOM 8041  O O    . LEU A 1 44 ? 0.420   -9.869  3.673  1.00 0.00 ? 246 LEU A O    7  
ATOM 8042  C CB   . LEU A 1 44 ? -0.095  -7.951  6.170  1.00 0.00 ? 246 LEU A CB   7  
ATOM 8043  C CG   . LEU A 1 44 ? -0.454  -6.601  6.791  1.00 0.00 ? 246 LEU A CG   7  
ATOM 8044  C CD1  . LEU A 1 44 ? -1.597  -6.756  7.783  1.00 0.00 ? 246 LEU A CD1  7  
ATOM 8045  C CD2  . LEU A 1 44 ? 0.763   -5.984  7.465  1.00 0.00 ? 246 LEU A CD2  7  
ATOM 8046  H H    . LEU A 1 44 ? -0.723  -6.801  3.997  1.00 0.00 ? 246 LEU A H    7  
ATOM 8047  H HA   . LEU A 1 44 ? 1.744   -7.386  5.241  1.00 0.00 ? 246 LEU A HA   7  
ATOM 8048  H HB2  . LEU A 1 44 ? -1.010  -8.443  5.872  1.00 0.00 ? 246 LEU A HB2  7  
ATOM 8049  H HB3  . LEU A 1 44 ? 0.387   -8.552  6.925  1.00 0.00 ? 246 LEU A HB3  7  
ATOM 8050  H HG   . LEU A 1 44 ? -0.781  -5.928  6.012  1.00 0.00 ? 246 LEU A HG   7  
ATOM 8051  H HD11 . LEU A 1 44 ? -1.695  -7.796  8.058  1.00 0.00 ? 246 LEU A HD11 7  
ATOM 8052  H HD12 . LEU A 1 44 ? -1.392  -6.167  8.665  1.00 0.00 ? 246 LEU A HD12 7  
ATOM 8053  H HD13 . LEU A 1 44 ? -2.516  -6.417  7.330  1.00 0.00 ? 246 LEU A HD13 7  
ATOM 8054  H HD21 . LEU A 1 44 ? 1.436   -6.769  7.778  1.00 0.00 ? 246 LEU A HD21 7  
ATOM 8055  H HD22 . LEU A 1 44 ? 1.269   -5.333  6.768  1.00 0.00 ? 246 LEU A HD22 7  
ATOM 8056  H HD23 . LEU A 1 44 ? 0.449   -5.416  8.327  1.00 0.00 ? 246 LEU A HD23 7  
ATOM 8057  N N    . ASP A 1 45 ? 2.279   -9.811  4.944  1.00 0.00 ? 247 ASP A N    7  
ATOM 8058  C CA   . ASP A 1 45 ? 2.725   -11.145 4.566  1.00 0.00 ? 247 ASP A CA   7  
ATOM 8059  C C    . ASP A 1 45 ? 1.804   -12.219 5.138  1.00 0.00 ? 247 ASP A C    7  
ATOM 8060  O O    . ASP A 1 45 ? 1.726   -13.328 4.611  1.00 0.00 ? 247 ASP A O    7  
ATOM 8061  C CB   . ASP A 1 45 ? 4.159   -11.374 5.049  1.00 0.00 ? 247 ASP A CB   7  
ATOM 8062  C CG   . ASP A 1 45 ? 5.186   -10.743 4.129  1.00 0.00 ? 247 ASP A CG   7  
ATOM 8063  O OD1  . ASP A 1 45 ? 4.847   -9.750  3.452  1.00 0.00 ? 247 ASP A OD1  7  
ATOM 8064  O OD2  . ASP A 1 45 ? 6.331   -11.243 4.085  1.00 0.00 ? 247 ASP A OD2  7  
ATOM 8065  H H    . ASP A 1 45 ? 2.822   -9.287  5.570  1.00 0.00 ? 247 ASP A H    7  
ATOM 8066  H HA   . ASP A 1 45 ? 2.705   -11.208 3.488  1.00 0.00 ? 247 ASP A HA   7  
ATOM 8067  H HB2  . ASP A 1 45 ? 4.273   -10.942 6.032  1.00 0.00 ? 247 ASP A HB2  7  
ATOM 8068  H HB3  . ASP A 1 45 ? 4.352   -12.433 5.102  1.00 0.00 ? 247 ASP A HB3  7  
ATOM 8069  N N    . GLU A 1 46 ? 1.108   -11.885 6.223  1.00 0.00 ? 248 GLU A N    7  
ATOM 8070  C CA   . GLU A 1 46 ? 0.195   -12.824 6.865  1.00 0.00 ? 248 GLU A CA   7  
ATOM 8071  C C    . GLU A 1 46 ? -1.101  -12.126 7.275  1.00 0.00 ? 248 GLU A C    7  
ATOM 8072  O O    . GLU A 1 46 ? -1.186  -10.898 7.248  1.00 0.00 ? 248 GLU A O    7  
ATOM 8073  C CB   . GLU A 1 46 ? 0.863   -13.455 8.089  1.00 0.00 ? 248 GLU A CB   7  
ATOM 8074  C CG   . GLU A 1 46 ? 1.354   -14.874 7.849  1.00 0.00 ? 248 GLU A CG   7  
ATOM 8075  C CD   . GLU A 1 46 ? 2.867   -14.969 7.806  1.00 0.00 ? 248 GLU A CD   7  
ATOM 8076  O OE1  . GLU A 1 46 ? 3.507   -14.731 8.851  1.00 0.00 ? 248 GLU A OE1  7  
ATOM 8077  O OE2  . GLU A 1 46 ? 3.410   -15.283 6.727  1.00 0.00 ? 248 GLU A OE2  7  
ATOM 8078  H H    . GLU A 1 46 ? 1.211   -10.987 6.599  1.00 0.00 ? 248 GLU A H    7  
ATOM 8079  H HA   . GLU A 1 46 ? -0.040  -13.600 6.152  1.00 0.00 ? 248 GLU A HA   7  
ATOM 8080  H HB2  . GLU A 1 46 ? 1.710   -12.848 8.375  1.00 0.00 ? 248 GLU A HB2  7  
ATOM 8081  H HB3  . GLU A 1 46 ? 0.153   -13.475 8.903  1.00 0.00 ? 248 GLU A HB3  7  
ATOM 8082  H HG2  . GLU A 1 46 ? 0.992   -15.505 8.648  1.00 0.00 ? 248 GLU A HG2  7  
ATOM 8083  H HG3  . GLU A 1 46 ? 0.958   -15.224 6.908  1.00 0.00 ? 248 GLU A HG3  7  
ATOM 8084  N N    . PRO A 1 47 ? -2.132  -12.902 7.661  1.00 0.00 ? 249 PRO A N    7  
ATOM 8085  C CA   . PRO A 1 47 ? -3.424  -12.346 8.077  1.00 0.00 ? 249 PRO A CA   7  
ATOM 8086  C C    . PRO A 1 47 ? -3.313  -11.537 9.364  1.00 0.00 ? 249 PRO A C    7  
ATOM 8087  O O    . PRO A 1 47 ? -3.787  -11.957 10.420 1.00 0.00 ? 249 PRO A O    7  
ATOM 8088  C CB   . PRO A 1 47 ? -4.300  -13.584 8.293  1.00 0.00 ? 249 PRO A CB   7  
ATOM 8089  C CG   . PRO A 1 47 ? -3.340  -14.696 8.537  1.00 0.00 ? 249 PRO A CG   7  
ATOM 8090  C CD   . PRO A 1 47 ? -2.119  -14.374 7.722  1.00 0.00 ? 249 PRO A CD   7  
ATOM 8091  H HA   . PRO A 1 47 ? -3.854  -11.727 7.303  1.00 0.00 ? 249 PRO A HA   7  
ATOM 8092  H HB2  . PRO A 1 47 ? -4.946  -13.425 9.144  1.00 0.00 ? 249 PRO A HB2  7  
ATOM 8093  H HB3  . PRO A 1 47 ? -4.896  -13.765 7.411  1.00 0.00 ? 249 PRO A HB3  7  
ATOM 8094  H HG2  . PRO A 1 47 ? -3.089  -14.739 9.587  1.00 0.00 ? 249 PRO A HG2  7  
ATOM 8095  H HG3  . PRO A 1 47 ? -3.771  -15.631 8.214  1.00 0.00 ? 249 PRO A HG3  7  
ATOM 8096  H HD2  . PRO A 1 47 ? -1.231  -14.735 8.217  1.00 0.00 ? 249 PRO A HD2  7  
ATOM 8097  H HD3  . PRO A 1 47 ? -2.202  -14.802 6.734  1.00 0.00 ? 249 PRO A HD3  7  
ATOM 8098  N N    . LEU A 1 48 ? -2.681  -10.372 9.268  1.00 0.00 ? 250 LEU A N    7  
ATOM 8099  C CA   . LEU A 1 48 ? -2.502  -9.499  10.422 1.00 0.00 ? 250 LEU A CA   7  
ATOM 8100  C C    . LEU A 1 48 ? -3.014  -8.089  10.132 1.00 0.00 ? 250 LEU A C    7  
ATOM 8101  O O    . LEU A 1 48 ? -2.583  -7.123  10.762 1.00 0.00 ? 250 LEU A O    7  
ATOM 8102  C CB   . LEU A 1 48 ? -1.025  -9.445  10.821 1.00 0.00 ? 250 LEU A CB   7  
ATOM 8103  C CG   . LEU A 1 48 ? -0.035  -9.409  9.650  1.00 0.00 ? 250 LEU A CG   7  
ATOM 8104  C CD1  . LEU A 1 48 ? 0.886   -8.204  9.760  1.00 0.00 ? 250 LEU A CD1  7  
ATOM 8105  C CD2  . LEU A 1 48 ? 0.775   -10.695 9.596  1.00 0.00 ? 250 LEU A CD2  7  
ATOM 8106  H H    . LEU A 1 48 ? -2.326  -10.094 8.399  1.00 0.00 ? 250 LEU A H    7  
ATOM 8107  H HA   . LEU A 1 48 ? -3.070  -9.912  11.241 1.00 0.00 ? 250 LEU A HA   7  
ATOM 8108  H HB2  . LEU A 1 48 ? -0.872  -8.563  11.425 1.00 0.00 ? 250 LEU A HB2  7  
ATOM 8109  H HB3  . LEU A 1 48 ? -0.806  -10.315 11.423 1.00 0.00 ? 250 LEU A HB3  7  
ATOM 8110  H HG   . LEU A 1 48 ? -0.586  -9.321  8.726  1.00 0.00 ? 250 LEU A HG   7  
ATOM 8111  H HD11 . LEU A 1 48 ? 1.298   -8.156  10.757 1.00 0.00 ? 250 LEU A HD11 7  
ATOM 8112  H HD12 . LEU A 1 48 ? 1.687   -8.296  9.043  1.00 0.00 ? 250 LEU A HD12 7  
ATOM 8113  H HD13 . LEU A 1 48 ? 0.325   -7.303  9.560  1.00 0.00 ? 250 LEU A HD13 7  
ATOM 8114  H HD21 . LEU A 1 48 ? 0.927   -10.981 8.566  1.00 0.00 ? 250 LEU A HD21 7  
ATOM 8115  H HD22 . LEU A 1 48 ? 1.732   -10.538 10.070 1.00 0.00 ? 250 LEU A HD22 7  
ATOM 8116  H HD23 . LEU A 1 48 ? 0.241   -11.480 10.113 1.00 0.00 ? 250 LEU A HD23 7  
ATOM 8117  N N    . GLY A 1 49 ? -3.935  -7.979  9.180  1.00 0.00 ? 251 GLY A N    7  
ATOM 8118  C CA   . GLY A 1 49 ? -4.485  -6.683  8.831  1.00 0.00 ? 251 GLY A CA   7  
ATOM 8119  C C    . GLY A 1 49 ? -5.904  -6.501  9.336  1.00 0.00 ? 251 GLY A C    7  
ATOM 8120  O O    . GLY A 1 49 ? -6.383  -7.289  10.151 1.00 0.00 ? 251 GLY A O    7  
ATOM 8121  H H    . GLY A 1 49 ? -4.243  -8.782  8.711  1.00 0.00 ? 251 GLY A H    7  
ATOM 8122  H HA2  . GLY A 1 49 ? -3.862  -5.911  9.259  1.00 0.00 ? 251 GLY A HA2  7  
ATOM 8123  H HA3  . GLY A 1 49 ? -4.480  -6.578  7.756  1.00 0.00 ? 251 GLY A HA3  7  
ATOM 8124  N N    . LYS A 1 50 ? -6.575  -5.458  8.855  1.00 0.00 ? 252 LYS A N    7  
ATOM 8125  C CA   . LYS A 1 50 ? -7.946  -5.177  9.270  1.00 0.00 ? 252 LYS A CA   7  
ATOM 8126  C C    . LYS A 1 50 ? -8.903  -5.226  8.082  1.00 0.00 ? 252 LYS A C    7  
ATOM 8127  O O    . LYS A 1 50 ? -10.052 -5.648  8.218  1.00 0.00 ? 252 LYS A O    7  
ATOM 8128  C CB   . LYS A 1 50 ? -8.025  -3.805  9.945  1.00 0.00 ? 252 LYS A CB   7  
ATOM 8129  C CG   . LYS A 1 50 ? -6.868  -3.519  10.887 1.00 0.00 ? 252 LYS A CG   7  
ATOM 8130  C CD   . LYS A 1 50 ? -6.996  -4.303  12.182 1.00 0.00 ? 252 LYS A CD   7  
ATOM 8131  C CE   . LYS A 1 50 ? -5.657  -4.436  12.888 1.00 0.00 ? 252 LYS A CE   7  
ATOM 8132  N NZ   . LYS A 1 50 ? -5.807  -4.441  14.369 1.00 0.00 ? 252 LYS A NZ   7  
ATOM 8133  H H    . LYS A 1 50 ? -6.138  -4.865  8.211  1.00 0.00 ? 252 LYS A H    7  
ATOM 8134  H HA   . LYS A 1 50 ? -8.238  -5.934  9.983  1.00 0.00 ? 252 LYS A HA   7  
ATOM 8135  H HB2  . LYS A 1 50 ? -8.036  -3.042  9.181  1.00 0.00 ? 252 LYS A HB2  7  
ATOM 8136  H HB3  . LYS A 1 50 ? -8.944  -3.750  10.509 1.00 0.00 ? 252 LYS A HB3  7  
ATOM 8137  H HG2  . LYS A 1 50 ? -5.944  -3.795  10.401 1.00 0.00 ? 252 LYS A HG2  7  
ATOM 8138  H HG3  . LYS A 1 50 ? -6.855  -2.464  11.115 1.00 0.00 ? 252 LYS A HG3  7  
ATOM 8139  H HD2  . LYS A 1 50 ? -7.687  -3.793  12.835 1.00 0.00 ? 252 LYS A HD2  7  
ATOM 8140  H HD3  . LYS A 1 50 ? -7.373  -5.290  11.958 1.00 0.00 ? 252 LYS A HD3  7  
ATOM 8141  H HE2  . LYS A 1 50 ? -5.190  -5.360  12.580 1.00 0.00 ? 252 LYS A HE2  7  
ATOM 8142  H HE3  . LYS A 1 50 ? -5.030  -3.603  12.602 1.00 0.00 ? 252 LYS A HE3  7  
ATOM 8143  H HZ1  . LYS A 1 50 ? -6.248  -3.555  14.687 1.00 0.00 ? 252 LYS A HZ1  7  
ATOM 8144  H HZ2  . LYS A 1 50 ? -4.876  -4.535  14.823 1.00 0.00 ? 252 LYS A HZ2  7  
ATOM 8145  H HZ3  . LYS A 1 50 ? -6.407  -5.238  14.665 1.00 0.00 ? 252 LYS A HZ3  7  
ATOM 8146  N N    . ASN A 1 51 ? -8.428  -4.788  6.920  1.00 0.00 ? 253 ASN A N    7  
ATOM 8147  C CA   . ASN A 1 51 ? -9.250  -4.781  5.715  1.00 0.00 ? 253 ASN A CA   7  
ATOM 8148  C C    . ASN A 1 51 ? -8.614  -5.617  4.610  1.00 0.00 ? 253 ASN A C    7  
ATOM 8149  O O    . ASN A 1 51 ? -7.446  -5.998  4.696  1.00 0.00 ? 253 ASN A O    7  
ATOM 8150  C CB   . ASN A 1 51 ? -9.461  -3.346  5.227  1.00 0.00 ? 253 ASN A CB   7  
ATOM 8151  C CG   . ASN A 1 51 ? -8.162  -2.672  4.832  1.00 0.00 ? 253 ASN A CG   7  
ATOM 8152  O OD1  . ASN A 1 51 ? -7.876  -2.492  3.648  1.00 0.00 ? 253 ASN A OD1  7  
ATOM 8153  N ND2  . ASN A 1 51 ? -7.364  -2.297  5.826  1.00 0.00 ? 253 ASN A ND2  7  
ATOM 8154  H H    . ASN A 1 51 ? -7.506  -4.461  6.871  1.00 0.00 ? 253 ASN A H    7  
ATOM 8155  H HA   . ASN A 1 51 ? -10.209 -5.209  5.966  1.00 0.00 ? 253 ASN A HA   7  
ATOM 8156  H HB2  . ASN A 1 51 ? -10.114 -3.358  4.367  1.00 0.00 ? 253 ASN A HB2  7  
ATOM 8157  H HB3  . ASN A 1 51 ? -9.920  -2.768  6.015  1.00 0.00 ? 253 ASN A HB3  7  
ATOM 8158  H HD21 . ASN A 1 51 ? -7.656  -2.473  6.746  1.00 0.00 ? 253 ASN A HD21 7  
ATOM 8159  H HD22 . ASN A 1 51 ? -6.516  -1.858  5.598  1.00 0.00 ? 253 ASN A HD22 7  
ATOM 8160  N N    . ASP A 1 52 ? -9.394  -5.900  3.570  1.00 0.00 ? 254 ASP A N    7  
ATOM 8161  C CA   . ASP A 1 52 ? -8.912  -6.693  2.444  1.00 0.00 ? 254 ASP A CA   7  
ATOM 8162  C C    . ASP A 1 52 ? -8.457  -5.795  1.297  1.00 0.00 ? 254 ASP A C    7  
ATOM 8163  O O    . ASP A 1 52 ? -8.462  -6.206  0.135  1.00 0.00 ? 254 ASP A O    7  
ATOM 8164  C CB   . ASP A 1 52 ? -10.009 -7.641  1.957  1.00 0.00 ? 254 ASP A CB   7  
ATOM 8165  C CG   . ASP A 1 52 ? -11.238 -6.903  1.465  1.00 0.00 ? 254 ASP A CG   7  
ATOM 8166  O OD1  . ASP A 1 52 ? -11.293 -6.578  0.261  1.00 0.00 ? 254 ASP A OD1  7  
ATOM 8167  O OD2  . ASP A 1 52 ? -12.145 -6.648  2.285  1.00 0.00 ? 254 ASP A OD2  7  
ATOM 8168  H H    . ASP A 1 52 ? -10.315 -5.569  3.563  1.00 0.00 ? 254 ASP A H    7  
ATOM 8169  H HA   . ASP A 1 52 ? -8.071  -7.275  2.785  1.00 0.00 ? 254 ASP A HA   7  
ATOM 8170  H HB2  . ASP A 1 52 ? -9.624  -8.241  1.146  1.00 0.00 ? 254 ASP A HB2  7  
ATOM 8171  H HB3  . ASP A 1 52 ? -10.303 -8.289  2.770  1.00 0.00 ? 254 ASP A HB3  7  
ATOM 8172  N N    . GLY A 1 53 ? -8.057  -4.570  1.626  1.00 0.00 ? 255 GLY A N    7  
ATOM 8173  C CA   . GLY A 1 53 ? -7.601  -3.641  0.609  1.00 0.00 ? 255 GLY A CA   7  
ATOM 8174  C C    . GLY A 1 53 ? -8.607  -2.541  0.321  1.00 0.00 ? 255 GLY A C    7  
ATOM 8175  O O    . GLY A 1 53 ? -8.525  -1.873  -0.709 1.00 0.00 ? 255 GLY A O    7  
ATOM 8176  H H    . GLY A 1 53 ? -8.067  -4.296  2.566  1.00 0.00 ? 255 GLY A H    7  
ATOM 8177  H HA2  . GLY A 1 53 ? -6.677  -3.188  0.939  1.00 0.00 ? 255 GLY A HA2  7  
ATOM 8178  H HA3  . GLY A 1 53 ? -7.413  -4.187  -0.303 1.00 0.00 ? 255 GLY A HA3  7  
ATOM 8179  N N    . ALA A 1 54 ? -9.558  -2.352  1.230  1.00 0.00 ? 256 ALA A N    7  
ATOM 8180  C CA   . ALA A 1 54 ? -10.579 -1.324  1.063  1.00 0.00 ? 256 ALA A CA   7  
ATOM 8181  C C    . ALA A 1 54 ? -10.842 -0.594  2.376  1.00 0.00 ? 256 ALA A C    7  
ATOM 8182  O O    . ALA A 1 54 ? -10.588 -1.128  3.456  1.00 0.00 ? 256 ALA A O    7  
ATOM 8183  C CB   . ALA A 1 54 ? -11.865 -1.937  0.530  1.00 0.00 ? 256 ALA A CB   7  
ATOM 8184  H H    . ALA A 1 54 ? -9.573  -2.914  2.033  1.00 0.00 ? 256 ALA A H    7  
ATOM 8185  H HA   . ALA A 1 54 ? -10.218 -0.612  0.335  1.00 0.00 ? 256 ALA A HA   7  
ATOM 8186  H HB1  . ALA A 1 54 ? -11.768 -2.108  -0.533 1.00 0.00 ? 256 ALA A HB1  7  
ATOM 8187  H HB2  . ALA A 1 54 ? -12.051 -2.877  1.030  1.00 0.00 ? 256 ALA A HB2  7  
ATOM 8188  H HB3  . ALA A 1 54 ? -12.688 -1.264  0.712  1.00 0.00 ? 256 ALA A HB3  7  
ATOM 8189  N N    . VAL A 1 55 ? -11.351 0.629   2.277  1.00 0.00 ? 257 VAL A N    7  
ATOM 8190  C CA   . VAL A 1 55 ? -11.645 1.433   3.456  1.00 0.00 ? 257 VAL A CA   7  
ATOM 8191  C C    . VAL A 1 55 ? -12.906 2.267   3.252  1.00 0.00 ? 257 VAL A C    7  
ATOM 8192  O O    . VAL A 1 55 ? -12.992 3.066   2.319  1.00 0.00 ? 257 VAL A O    7  
ATOM 8193  C CB   . VAL A 1 55 ? -10.471 2.368   3.804  1.00 0.00 ? 257 VAL A CB   7  
ATOM 8194  C CG1  . VAL A 1 55 ? -10.757 3.142   5.084  1.00 0.00 ? 257 VAL A CG1  7  
ATOM 8195  C CG2  . VAL A 1 55 ? -9.177  1.577   3.930  1.00 0.00 ? 257 VAL A CG2  7  
ATOM 8196  H H    . VAL A 1 55 ? -11.530 1.001   1.387  1.00 0.00 ? 257 VAL A H    7  
ATOM 8197  H HA   . VAL A 1 55 ? -11.801 0.760   4.287  1.00 0.00 ? 257 VAL A HA   7  
ATOM 8198  H HB   . VAL A 1 55 ? -10.354 3.080   3.000  1.00 0.00 ? 257 VAL A HB   7  
ATOM 8199  H HG11 . VAL A 1 55 ? -11.004 4.164   4.839  1.00 0.00 ? 257 VAL A HG11 7  
ATOM 8200  H HG12 . VAL A 1 55 ? -11.589 2.685   5.602  1.00 0.00 ? 257 VAL A HG12 7  
ATOM 8201  H HG13 . VAL A 1 55 ? -9.884  3.123   5.718  1.00 0.00 ? 257 VAL A HG13 7  
ATOM 8202  H HG21 . VAL A 1 55 ? -9.399  0.579   4.283  1.00 0.00 ? 257 VAL A HG21 7  
ATOM 8203  H HG22 . VAL A 1 55 ? -8.695  1.519   2.965  1.00 0.00 ? 257 VAL A HG22 7  
ATOM 8204  H HG23 . VAL A 1 55 ? -8.521  2.069   4.631  1.00 0.00 ? 257 VAL A HG23 7  
ATOM 8205  N N    . ALA A 1 56 ? -13.884 2.078   4.135  1.00 0.00 ? 258 ALA A N    7  
ATOM 8206  C CA   . ALA A 1 56 ? -15.141 2.812   4.057  1.00 0.00 ? 258 ALA A CA   7  
ATOM 8207  C C    . ALA A 1 56 ? -15.818 2.606   2.705  1.00 0.00 ? 258 ALA A C    7  
ATOM 8208  O O    . ALA A 1 56 ? -16.533 3.481   2.218  1.00 0.00 ? 258 ALA A O    7  
ATOM 8209  C CB   . ALA A 1 56 ? -14.901 4.294   4.305  1.00 0.00 ? 258 ALA A CB   7  
ATOM 8210  H H    . ALA A 1 56 ? -13.755 1.428   4.858  1.00 0.00 ? 258 ALA A H    7  
ATOM 8211  H HA   . ALA A 1 56 ? -15.792 2.442   4.833  1.00 0.00 ? 258 ALA A HA   7  
ATOM 8212  H HB1  . ALA A 1 56 ? -14.826 4.811   3.360  1.00 0.00 ? 258 ALA A HB1  7  
ATOM 8213  H HB2  . ALA A 1 56 ? -15.724 4.701   4.874  1.00 0.00 ? 258 ALA A HB2  7  
ATOM 8214  H HB3  . ALA A 1 56 ? -13.983 4.421   4.860  1.00 0.00 ? 258 ALA A HB3  7  
ATOM 8215  N N    . GLY A 1 57 ? -15.587 1.443   2.104  1.00 0.00 ? 259 GLY A N    7  
ATOM 8216  C CA   . GLY A 1 57 ? -16.180 1.145   0.814  1.00 0.00 ? 259 GLY A CA   7  
ATOM 8217  C C    . GLY A 1 57 ? -15.329 1.624   -0.348 1.00 0.00 ? 259 GLY A C    7  
ATOM 8218  O O    . GLY A 1 57 ? -15.785 1.644   -1.490 1.00 0.00 ? 259 GLY A O    7  
ATOM 8219  H H    . GLY A 1 57 ? -15.007 0.784   2.538  1.00 0.00 ? 259 GLY A H    7  
ATOM 8220  H HA2  . GLY A 1 57 ? -16.314 0.077   0.731  1.00 0.00 ? 259 GLY A HA2  7  
ATOM 8221  H HA3  . GLY A 1 57 ? -17.148 1.623   0.757  1.00 0.00 ? 259 GLY A HA3  7  
ATOM 8222  N N    . THR A 1 58 ? -14.089 2.010   -0.057 1.00 0.00 ? 260 THR A N    7  
ATOM 8223  C CA   . THR A 1 58 ? -13.177 2.488   -1.089 1.00 0.00 ? 260 THR A CA   7  
ATOM 8224  C C    . THR A 1 58 ? -11.965 1.571   -1.208 1.00 0.00 ? 260 THR A C    7  
ATOM 8225  O O    . THR A 1 58 ? -11.157 1.469   -0.284 1.00 0.00 ? 260 THR A O    7  
ATOM 8226  C CB   . THR A 1 58 ? -12.722 3.915   -0.775 1.00 0.00 ? 260 THR A CB   7  
ATOM 8227  O OG1  . THR A 1 58 ? -13.838 4.768   -0.598 1.00 0.00 ? 260 THR A OG1  7  
ATOM 8228  C CG2  . THR A 1 58 ? -11.850 4.516   -1.855 1.00 0.00 ? 260 THR A CG2  7  
ATOM 8229  H H    . THR A 1 58 ? -13.780 1.971   0.871  1.00 0.00 ? 260 THR A H    7  
ATOM 8230  H HA   . THR A 1 58 ? -13.707 2.487   -2.029 1.00 0.00 ? 260 THR A HA   7  
ATOM 8231  H HB   . THR A 1 58 ? -12.152 3.906   0.143  1.00 0.00 ? 260 THR A HB   7  
ATOM 8232  H HG1  . THR A 1 58 ? -14.366 4.457   0.141  1.00 0.00 ? 260 THR A HG1  7  
ATOM 8233  H HG21 . THR A 1 58 ? -12.375 4.488   -2.799 1.00 0.00 ? 260 THR A HG21 7  
ATOM 8234  H HG22 . THR A 1 58 ? -10.934 3.950   -1.936 1.00 0.00 ? 260 THR A HG22 7  
ATOM 8235  H HG23 . THR A 1 58 ? -11.619 5.541   -1.603 1.00 0.00 ? 260 THR A HG23 7  
ATOM 8236  N N    . ARG A 1 59 ? -11.842 0.903   -2.350 1.00 0.00 ? 261 ARG A N    7  
ATOM 8237  C CA   . ARG A 1 59 ? -10.728 -0.005  -2.589 1.00 0.00 ? 261 ARG A CA   7  
ATOM 8238  C C    . ARG A 1 59 ? -9.538  0.741   -3.183 1.00 0.00 ? 261 ARG A C    7  
ATOM 8239  O O    . ARG A 1 59 ? -9.594  1.218   -4.317 1.00 0.00 ? 261 ARG A O    7  
ATOM 8240  C CB   . ARG A 1 59 ? -11.157 -1.137  -3.524 1.00 0.00 ? 261 ARG A CB   7  
ATOM 8241  C CG   . ARG A 1 59 ? -10.048 -2.133  -3.826 1.00 0.00 ? 261 ARG A CG   7  
ATOM 8242  C CD   . ARG A 1 59 ? -10.326 -2.904  -5.107 1.00 0.00 ? 261 ARG A CD   7  
ATOM 8243  N NE   . ARG A 1 59 ? -10.143 -2.076  -6.296 1.00 0.00 ? 261 ARG A NE   7  
ATOM 8244  C CZ   . ARG A 1 59 ? -10.653 -2.369  -7.490 1.00 0.00 ? 261 ARG A CZ   7  
ATOM 8245  N NH1  . ARG A 1 59 ? -11.376 -3.469  -7.659 1.00 0.00 ? 261 ARG A NH1  7  
ATOM 8246  N NH2  . ARG A 1 59 ? -10.439 -1.560  -8.519 1.00 0.00 ? 261 ARG A NH2  7  
ATOM 8247  H H    . ARG A 1 59 ? -12.517 1.026   -3.051 1.00 0.00 ? 261 ARG A H    7  
ATOM 8248  H HA   . ARG A 1 59 ? -10.435 -0.426  -1.638 1.00 0.00 ? 261 ARG A HA   7  
ATOM 8249  H HB2  . ARG A 1 59 ? -11.977 -1.673  -3.069 1.00 0.00 ? 261 ARG A HB2  7  
ATOM 8250  H HB3  . ARG A 1 59 ? -11.493 -0.710  -4.457 1.00 0.00 ? 261 ARG A HB3  7  
ATOM 8251  H HG2  . ARG A 1 59 ? -9.117  -1.597  -3.936 1.00 0.00 ? 261 ARG A HG2  7  
ATOM 8252  H HG3  . ARG A 1 59 ? -9.971  -2.831  -3.005 1.00 0.00 ? 261 ARG A HG3  7  
ATOM 8253  H HD2  . ARG A 1 59 ? -9.650  -3.745  -5.159 1.00 0.00 ? 261 ARG A HD2  7  
ATOM 8254  H HD3  . ARG A 1 59 ? -11.345 -3.263  -5.082 1.00 0.00 ? 261 ARG A HD3  7  
ATOM 8255  H HE   . ARG A 1 59 ? -9.613  -1.257  -6.201 1.00 0.00 ? 261 ARG A HE   7  
ATOM 8256  H HH11 . ARG A 1 59 ? -11.541 -4.084  -6.886 1.00 0.00 ? 261 ARG A HH11 7  
ATOM 8257  H HH12 . ARG A 1 59 ? -11.756 -3.684  -8.559 1.00 0.00 ? 261 ARG A HH12 7  
ATOM 8258  H HH21 . ARG A 1 59 ? -9.895  -0.730  -8.398 1.00 0.00 ? 261 ARG A HH21 7  
ATOM 8259  H HH22 . ARG A 1 59 ? -10.822 -1.781  -9.417 1.00 0.00 ? 261 ARG A HH22 7  
ATOM 8260  N N    . TYR A 1 60 ? -8.462  0.840   -2.410 1.00 0.00 ? 262 TYR A N    7  
ATOM 8261  C CA   . TYR A 1 60 ? -7.258  1.527   -2.859 1.00 0.00 ? 262 TYR A CA   7  
ATOM 8262  C C    . TYR A 1 60 ? -6.341  0.577   -3.620 1.00 0.00 ? 262 TYR A C    7  
ATOM 8263  O O    . TYR A 1 60 ? -5.670  0.975   -4.572 1.00 0.00 ? 262 TYR A O    7  
ATOM 8264  C CB   . TYR A 1 60 ? -6.517  2.131   -1.665 1.00 0.00 ? 262 TYR A CB   7  
ATOM 8265  C CG   . TYR A 1 60 ? -7.274  3.253   -0.989 1.00 0.00 ? 262 TYR A CG   7  
ATOM 8266  C CD1  . TYR A 1 60 ? -8.321  2.984   -0.116 1.00 0.00 ? 262 TYR A CD1  7  
ATOM 8267  C CD2  . TYR A 1 60 ? -6.944  4.581   -1.226 1.00 0.00 ? 262 TYR A CD2  7  
ATOM 8268  C CE1  . TYR A 1 60 ? -9.016  4.006   0.502  1.00 0.00 ? 262 TYR A CE1  7  
ATOM 8269  C CE2  . TYR A 1 60 ? -7.634  5.608   -0.613 1.00 0.00 ? 262 TYR A CE2  7  
ATOM 8270  C CZ   . TYR A 1 60 ? -8.669  5.316   0.250  1.00 0.00 ? 262 TYR A CZ   7  
ATOM 8271  O OH   . TYR A 1 60 ? -9.359  6.337   0.863  1.00 0.00 ? 262 TYR A OH   7  
ATOM 8272  H H    . TYR A 1 60 ? -8.478  0.440   -1.515 1.00 0.00 ? 262 TYR A H    7  
ATOM 8273  H HA   . TYR A 1 60 ? -7.562  2.324   -3.523 1.00 0.00 ? 262 TYR A HA   7  
ATOM 8274  H HB2  . TYR A 1 60 ? -6.343  1.360   -0.930 1.00 0.00 ? 262 TYR A HB2  7  
ATOM 8275  H HB3  . TYR A 1 60 ? -5.568  2.525   -2.000 1.00 0.00 ? 262 TYR A HB3  7  
ATOM 8276  H HD1  . TYR A 1 60 ? -8.590  1.956   0.081  1.00 0.00 ? 262 TYR A HD1  7  
ATOM 8277  H HD2  . TYR A 1 60 ? -6.134  4.808   -1.904 1.00 0.00 ? 262 TYR A HD2  7  
ATOM 8278  H HE1  . TYR A 1 60 ? -9.826  3.775   1.178  1.00 0.00 ? 262 TYR A HE1  7  
ATOM 8279  H HE2  . TYR A 1 60 ? -7.363  6.635   -0.809 1.00 0.00 ? 262 TYR A HE2  7  
ATOM 8280  H HH   . TYR A 1 60 ? -10.297 6.134   0.862  1.00 0.00 ? 262 TYR A HH   7  
ATOM 8281  N N    . PHE A 1 61 ? -6.320  -0.682  -3.194 1.00 0.00 ? 263 PHE A N    7  
ATOM 8282  C CA   . PHE A 1 61 ? -5.488  -1.694  -3.837 1.00 0.00 ? 263 PHE A CA   7  
ATOM 8283  C C    . PHE A 1 61 ? -6.066  -3.087  -3.620 1.00 0.00 ? 263 PHE A C    7  
ATOM 8284  O O    . PHE A 1 61 ? -6.994  -3.269  -2.830 1.00 0.00 ? 263 PHE A O    7  
ATOM 8285  C CB   . PHE A 1 61 ? -4.058  -1.629  -3.296 1.00 0.00 ? 263 PHE A CB   7  
ATOM 8286  C CG   . PHE A 1 61 ? -3.986  -1.537  -1.800 1.00 0.00 ? 263 PHE A CG   7  
ATOM 8287  C CD1  . PHE A 1 61 ? -4.147  -0.319  -1.160 1.00 0.00 ? 263 PHE A CD1  7  
ATOM 8288  C CD2  . PHE A 1 61 ? -3.754  -2.667  -1.031 1.00 0.00 ? 263 PHE A CD2  7  
ATOM 8289  C CE1  . PHE A 1 61 ? -4.080  -0.229  0.216  1.00 0.00 ? 263 PHE A CE1  7  
ATOM 8290  C CE2  . PHE A 1 61 ? -3.686  -2.583  0.346  1.00 0.00 ? 263 PHE A CE2  7  
ATOM 8291  C CZ   . PHE A 1 61 ? -3.848  -1.363  0.971  1.00 0.00 ? 263 PHE A CZ   7  
ATOM 8292  H H    . PHE A 1 61 ? -6.879  -0.938  -2.432 1.00 0.00 ? 263 PHE A H    7  
ATOM 8293  H HA   . PHE A 1 61 ? -5.472  -1.485  -4.896 1.00 0.00 ? 263 PHE A HA   7  
ATOM 8294  H HB2  . PHE A 1 61 ? -3.527  -2.520  -3.599 1.00 0.00 ? 263 PHE A HB2  7  
ATOM 8295  H HB3  . PHE A 1 61 ? -3.562  -0.763  -3.707 1.00 0.00 ? 263 PHE A HB3  7  
ATOM 8296  H HD1  . PHE A 1 61 ? -4.328  0.568   -1.750 1.00 0.00 ? 263 PHE A HD1  7  
ATOM 8297  H HD2  . PHE A 1 61 ? -3.625  -3.622  -1.519 1.00 0.00 ? 263 PHE A HD2  7  
ATOM 8298  H HE1  . PHE A 1 61 ? -4.207  0.728   0.702  1.00 0.00 ? 263 PHE A HE1  7  
ATOM 8299  H HE2  . PHE A 1 61 ? -3.505  -3.471  0.934  1.00 0.00 ? 263 PHE A HE2  7  
ATOM 8300  H HZ   . PHE A 1 61 ? -3.795  -1.295  2.048  1.00 0.00 ? 263 PHE A HZ   7  
ATOM 8301  N N    . GLN A 1 62 ? -5.513  -4.070  -4.323 1.00 0.00 ? 264 GLN A N    7  
ATOM 8302  C CA   . GLN A 1 62 ? -5.977  -5.448  -4.205 1.00 0.00 ? 264 GLN A CA   7  
ATOM 8303  C C    . GLN A 1 62 ? -4.993  -6.284  -3.393 1.00 0.00 ? 264 GLN A C    7  
ATOM 8304  O O    . GLN A 1 62 ? -3.793  -6.285  -3.665 1.00 0.00 ? 264 GLN A O    7  
ATOM 8305  C CB   . GLN A 1 62 ? -6.166  -6.065  -5.592 1.00 0.00 ? 264 GLN A CB   7  
ATOM 8306  C CG   . GLN A 1 62 ? -6.960  -7.361  -5.577 1.00 0.00 ? 264 GLN A CG   7  
ATOM 8307  C CD   . GLN A 1 62 ? -8.405  -7.155  -5.164 1.00 0.00 ? 264 GLN A CD   7  
ATOM 8308  O OE1  . GLN A 1 62 ? -9.246  -6.768  -5.976 1.00 0.00 ? 264 GLN A OE1  7  
ATOM 8309  N NE2  . GLN A 1 62 ? -8.701  -7.413  -3.895 1.00 0.00 ? 264 GLN A NE2  7  
ATOM 8310  H H    . GLN A 1 62 ? -4.777  -3.865  -4.936 1.00 0.00 ? 264 GLN A H    7  
ATOM 8311  H HA   . GLN A 1 62 ? -6.927  -5.434  -3.693 1.00 0.00 ? 264 GLN A HA   7  
ATOM 8312  H HB2  . GLN A 1 62 ? -6.685  -5.356  -6.220 1.00 0.00 ? 264 GLN A HB2  7  
ATOM 8313  H HB3  . GLN A 1 62 ? -5.195  -6.269  -6.019 1.00 0.00 ? 264 GLN A HB3  7  
ATOM 8314  H HG2  . GLN A 1 62 ? -6.943  -7.791  -6.567 1.00 0.00 ? 264 GLN A HG2  7  
ATOM 8315  H HG3  . GLN A 1 62 ? -6.497  -8.044  -4.881 1.00 0.00 ? 264 GLN A HG3  7  
ATOM 8316  H HE21 . GLN A 1 62 ? -7.980  -7.717  -3.305 1.00 0.00 ? 264 GLN A HE21 7  
ATOM 8317  H HE22 . GLN A 1 62 ? -9.628  -7.288  -3.602 1.00 0.00 ? 264 GLN A HE22 7  
ATOM 8318  N N    . CYS A 1 63 ? -5.510  -6.992  -2.394 1.00 0.00 ? 265 CYS A N    7  
ATOM 8319  C CA   . CYS A 1 63 ? -4.675  -7.833  -1.543 1.00 0.00 ? 265 CYS A CA   7  
ATOM 8320  C C    . CYS A 1 63 ? -5.483  -8.974  -0.936 1.00 0.00 ? 265 CYS A C    7  
ATOM 8321  O O    . CYS A 1 63 ? -6.714  -8.951  -0.943 1.00 0.00 ? 265 CYS A O    7  
ATOM 8322  C CB   . CYS A 1 63 ? -4.039  -6.995  -0.433 1.00 0.00 ? 265 CYS A CB   7  
ATOM 8323  S SG   . CYS A 1 63 ? -5.215  -5.973  0.485  1.00 0.00 ? 265 CYS A SG   7  
ATOM 8324  H H    . CYS A 1 63 ? -6.475  -6.951  -2.227 1.00 0.00 ? 265 CYS A H    7  
ATOM 8325  H HA   . CYS A 1 63 ? -3.892  -8.251  -2.159 1.00 0.00 ? 265 CYS A HA   7  
ATOM 8326  H HB2  . CYS A 1 63 ? -3.556  -7.655  0.274  1.00 0.00 ? 265 CYS A HB2  7  
ATOM 8327  H HB3  . CYS A 1 63 ? -3.299  -6.338  -0.866 1.00 0.00 ? 265 CYS A HB3  7  
ATOM 8328  H HG   . CYS A 1 63 ? -5.159  -6.219  1.412  1.00 0.00 ? 265 CYS A HG   7  
ATOM 8329  N N    . GLN A 1 64 ? -4.780  -9.971  -0.409 1.00 0.00 ? 266 GLN A N    7  
ATOM 8330  C CA   . GLN A 1 64 ? -5.427  -11.124 0.208  1.00 0.00 ? 266 GLN A CA   7  
ATOM 8331  C C    . GLN A 1 64 ? -6.287  -10.696 1.395  1.00 0.00 ? 266 GLN A C    7  
ATOM 8332  O O    . GLN A 1 64 ? -6.162  -9.574  1.888  1.00 0.00 ? 266 GLN A O    7  
ATOM 8333  C CB   . GLN A 1 64 ? -4.370  -12.134 0.665  1.00 0.00 ? 266 GLN A CB   7  
ATOM 8334  C CG   . GLN A 1 64 ? -4.015  -13.166 -0.394 1.00 0.00 ? 266 GLN A CG   7  
ATOM 8335  C CD   . GLN A 1 64 ? -5.228  -13.904 -0.922 1.00 0.00 ? 266 GLN A CD   7  
ATOM 8336  O OE1  . GLN A 1 64 ? -5.655  -14.909 -0.351 1.00 0.00 ? 266 GLN A OE1  7  
ATOM 8337  N NE2  . GLN A 1 64 ? -5.791  -13.410 -2.019 1.00 0.00 ? 266 GLN A NE2  7  
ATOM 8338  H H    . GLN A 1 64 ? -3.801  -9.929  -0.434 1.00 0.00 ? 266 GLN A H    7  
ATOM 8339  H HA   . GLN A 1 64 ? -6.060  -11.588 -0.535 1.00 0.00 ? 266 GLN A HA   7  
ATOM 8340  H HB2  . GLN A 1 64 ? -3.471  -11.600 0.932  1.00 0.00 ? 266 GLN A HB2  7  
ATOM 8341  H HB3  . GLN A 1 64 ? -4.739  -12.656 1.536  1.00 0.00 ? 266 GLN A HB3  7  
ATOM 8342  H HG2  . GLN A 1 64 ? -3.531  -12.663 -1.220 1.00 0.00 ? 266 GLN A HG2  7  
ATOM 8343  H HG3  . GLN A 1 64 ? -3.332  -13.884 0.038  1.00 0.00 ? 266 GLN A HG3  7  
ATOM 8344  H HE21 . GLN A 1 64 ? -5.396  -12.607 -2.420 1.00 0.00 ? 266 GLN A HE21 7  
ATOM 8345  H HE22 . GLN A 1 64 ? -6.577  -13.867 -2.382 1.00 0.00 ? 266 GLN A HE22 7  
ATOM 8346  N N    . PRO A 1 65 ? -7.176  -11.584 1.875  1.00 0.00 ? 267 PRO A N    7  
ATOM 8347  C CA   . PRO A 1 65 ? -8.051  -11.282 3.011  1.00 0.00 ? 267 PRO A CA   7  
ATOM 8348  C C    . PRO A 1 65 ? -7.263  -11.051 4.297  1.00 0.00 ? 267 PRO A C    7  
ATOM 8349  O O    . PRO A 1 65 ? -6.376  -11.833 4.641  1.00 0.00 ? 267 PRO A O    7  
ATOM 8350  C CB   . PRO A 1 65 ? -8.929  -12.533 3.137  1.00 0.00 ? 267 PRO A CB   7  
ATOM 8351  C CG   . PRO A 1 65 ? -8.159  -13.614 2.460  1.00 0.00 ? 267 PRO A CG   7  
ATOM 8352  C CD   . PRO A 1 65 ? -7.397  -12.944 1.353  1.00 0.00 ? 267 PRO A CD   7  
ATOM 8353  H HA   . PRO A 1 65 ? -8.672  -10.421 2.813  1.00 0.00 ? 267 PRO A HA   7  
ATOM 8354  H HB2  . PRO A 1 65 ? -9.090  -12.758 4.182  1.00 0.00 ? 267 PRO A HB2  7  
ATOM 8355  H HB3  . PRO A 1 65 ? -9.877  -12.360 2.651  1.00 0.00 ? 267 PRO A HB3  7  
ATOM 8356  H HG2  . PRO A 1 65 ? -7.479  -14.074 3.160  1.00 0.00 ? 267 PRO A HG2  7  
ATOM 8357  H HG3  . PRO A 1 65 ? -8.839  -14.349 2.054  1.00 0.00 ? 267 PRO A HG3  7  
ATOM 8358  H HD2  . PRO A 1 65 ? -6.459  -13.450 1.182  1.00 0.00 ? 267 PRO A HD2  7  
ATOM 8359  H HD3  . PRO A 1 65 ? -7.985  -12.920 0.448  1.00 0.00 ? 267 PRO A HD3  7  
ATOM 8360  N N    . LYS A 1 66 ? -7.589  -9.972  4.998  1.00 0.00 ? 268 LYS A N    7  
ATOM 8361  C CA   . LYS A 1 66 ? -6.910  -9.634  6.244  1.00 0.00 ? 268 LYS A CA   7  
ATOM 8362  C C    . LYS A 1 66 ? -5.433  -9.325  6.003  1.00 0.00 ? 268 LYS A C    7  
ATOM 8363  O O    . LYS A 1 66 ? -4.631  -9.323  6.936  1.00 0.00 ? 268 LYS A O    7  
ATOM 8364  C CB   . LYS A 1 66 ? -7.043  -10.779 7.250  1.00 0.00 ? 268 LYS A CB   7  
ATOM 8365  C CG   . LYS A 1 66 ? -8.463  -11.299 7.396  1.00 0.00 ? 268 LYS A CG   7  
ATOM 8366  C CD   . LYS A 1 66 ? -9.310  -10.374 8.255  1.00 0.00 ? 268 LYS A CD   7  
ATOM 8367  C CE   . LYS A 1 66 ? -10.704 -10.937 8.472  1.00 0.00 ? 268 LYS A CE   7  
ATOM 8368  N NZ   . LYS A 1 66 ? -11.501 -10.946 7.214  1.00 0.00 ? 268 LYS A NZ   7  
ATOM 8369  H H    . LYS A 1 66 ? -8.303  -9.387  4.671  1.00 0.00 ? 268 LYS A H    7  
ATOM 8370  H HA   . LYS A 1 66 ? -7.386  -8.755  6.652  1.00 0.00 ? 268 LYS A HA   7  
ATOM 8371  H HB2  . LYS A 1 66 ? -6.413  -11.597 6.933  1.00 0.00 ? 268 LYS A HB2  7  
ATOM 8372  H HB3  . LYS A 1 66 ? -6.709  -10.434 8.217  1.00 0.00 ? 268 LYS A HB3  7  
ATOM 8373  H HG2  . LYS A 1 66 ? -8.911  -11.375 6.417  1.00 0.00 ? 268 LYS A HG2  7  
ATOM 8374  H HG3  . LYS A 1 66 ? -8.433  -12.276 7.857  1.00 0.00 ? 268 LYS A HG3  7  
ATOM 8375  H HD2  . LYS A 1 66 ? -8.830  -10.250 9.214  1.00 0.00 ? 268 LYS A HD2  7  
ATOM 8376  H HD3  . LYS A 1 66 ? -9.389  -9.415  7.762  1.00 0.00 ? 268 LYS A HD3  7  
ATOM 8377  H HE2  . LYS A 1 66 ? -10.618 -11.948 8.841  1.00 0.00 ? 268 LYS A HE2  7  
ATOM 8378  H HE3  . LYS A 1 66 ? -11.213 -10.330 9.205  1.00 0.00 ? 268 LYS A HE3  7  
ATOM 8379  H HZ1  . LYS A 1 66 ? -12.104 -11.794 7.180  1.00 0.00 ? 268 LYS A HZ1  7  
ATOM 8380  H HZ2  . LYS A 1 66 ? -10.867 -10.953 6.390  1.00 0.00 ? 268 LYS A HZ2  7  
ATOM 8381  H HZ3  . LYS A 1 66 ? -12.106 -10.103 7.167  1.00 0.00 ? 268 LYS A HZ3  7  
ATOM 8382  N N    . TYR A 1 67 ? -5.080  -9.059  4.747  1.00 0.00 ? 269 TYR A N    7  
ATOM 8383  C CA   . TYR A 1 67 ? -3.700  -8.745  4.392  1.00 0.00 ? 269 TYR A CA   7  
ATOM 8384  C C    . TYR A 1 67 ? -3.542  -7.266  4.041  1.00 0.00 ? 269 TYR A C    7  
ATOM 8385  O O    . TYR A 1 67 ? -2.455  -6.821  3.672  1.00 0.00 ? 269 TYR A O    7  
ATOM 8386  C CB   . TYR A 1 67 ? -3.246  -9.604  3.206  1.00 0.00 ? 269 TYR A CB   7  
ATOM 8387  C CG   . TYR A 1 67 ? -2.741  -10.975 3.598  1.00 0.00 ? 269 TYR A CG   7  
ATOM 8388  C CD1  . TYR A 1 67 ? -3.370  -11.715 4.593  1.00 0.00 ? 269 TYR A CD1  7  
ATOM 8389  C CD2  . TYR A 1 67 ? -1.636  -11.532 2.967  1.00 0.00 ? 269 TYR A CD2  7  
ATOM 8390  C CE1  . TYR A 1 67 ? -2.910  -12.970 4.947  1.00 0.00 ? 269 TYR A CE1  7  
ATOM 8391  C CE2  . TYR A 1 67 ? -1.170  -12.785 3.318  1.00 0.00 ? 269 TYR A CE2  7  
ATOM 8392  C CZ   . TYR A 1 67 ? -1.810  -13.500 4.306  1.00 0.00 ? 269 TYR A CZ   7  
ATOM 8393  O OH   . TYR A 1 67 ? -1.352  -14.749 4.657  1.00 0.00 ? 269 TYR A OH   7  
ATOM 8394  H H    . TYR A 1 67 ? -5.761  -9.072  4.044  1.00 0.00 ? 269 TYR A H    7  
ATOM 8395  H HA   . TYR A 1 67 ? -3.078  -8.970  5.244  1.00 0.00 ? 269 TYR A HA   7  
ATOM 8396  H HB2  . TYR A 1 67 ? -4.077  -9.740  2.533  1.00 0.00 ? 269 TYR A HB2  7  
ATOM 8397  H HB3  . TYR A 1 67 ? -2.450  -9.092  2.687  1.00 0.00 ? 269 TYR A HB3  7  
ATOM 8398  H HD1  . TYR A 1 67 ? -4.230  -11.296 5.092  1.00 0.00 ? 269 TYR A HD1  7  
ATOM 8399  H HD2  . TYR A 1 67 ? -1.133  -10.969 2.193  1.00 0.00 ? 269 TYR A HD2  7  
ATOM 8400  H HE1  . TYR A 1 67 ? -3.413  -13.529 5.722  1.00 0.00 ? 269 TYR A HE1  7  
ATOM 8401  H HE2  . TYR A 1 67 ? -0.308  -13.200 2.815  1.00 0.00 ? 269 TYR A HE2  7  
ATOM 8402  H HH   . TYR A 1 67 ? -2.040  -15.399 4.496  1.00 0.00 ? 269 TYR A HH   7  
ATOM 8403  N N    . GLY A 1 68 ? -4.630  -6.505  4.153  1.00 0.00 ? 270 GLY A N    7  
ATOM 8404  C CA   . GLY A 1 68 ? -4.577  -5.090  3.839  1.00 0.00 ? 270 GLY A CA   7  
ATOM 8405  C C    . GLY A 1 68 ? -4.455  -4.220  5.073  1.00 0.00 ? 270 GLY A C    7  
ATOM 8406  O O    . GLY A 1 68 ? -5.350  -4.201  5.920  1.00 0.00 ? 270 GLY A O    7  
ATOM 8407  H H    . GLY A 1 68 ? -5.473  -6.906  4.449  1.00 0.00 ? 270 GLY A H    7  
ATOM 8408  H HA2  . GLY A 1 68 ? -3.725  -4.906  3.200  1.00 0.00 ? 270 GLY A HA2  7  
ATOM 8409  H HA3  . GLY A 1 68 ? -5.477  -4.817  3.307  1.00 0.00 ? 270 GLY A HA3  7  
ATOM 8410  N N    . LEU A 1 69 ? -3.347  -3.495  5.174  1.00 0.00 ? 271 LEU A N    7  
ATOM 8411  C CA   . LEU A 1 69 ? -3.108  -2.612  6.309  1.00 0.00 ? 271 LEU A CA   7  
ATOM 8412  C C    . LEU A 1 69 ? -2.826  -1.191  5.832  1.00 0.00 ? 271 LEU A C    7  
ATOM 8413  O O    . LEU A 1 69 ? -2.020  -0.979  4.927  1.00 0.00 ? 271 LEU A O    7  
ATOM 8414  C CB   . LEU A 1 69 ? -1.938  -3.130  7.148  1.00 0.00 ? 271 LEU A CB   7  
ATOM 8415  C CG   . LEU A 1 69 ? -2.015  -2.806  8.641  1.00 0.00 ? 271 LEU A CG   7  
ATOM 8416  C CD1  . LEU A 1 69 ? -3.249  -3.442  9.265  1.00 0.00 ? 271 LEU A CD1  7  
ATOM 8417  C CD2  . LEU A 1 69 ? -0.755  -3.274  9.353  1.00 0.00 ? 271 LEU A CD2  7  
ATOM 8418  H H    . LEU A 1 69 ? -2.674  -3.552  4.464  1.00 0.00 ? 271 LEU A H    7  
ATOM 8419  H HA   . LEU A 1 69 ? -4.001  -2.605  6.917  1.00 0.00 ? 271 LEU A HA   7  
ATOM 8420  H HB2  . LEU A 1 69 ? -1.890  -4.204  7.036  1.00 0.00 ? 271 LEU A HB2  7  
ATOM 8421  H HB3  . LEU A 1 69 ? -1.027  -2.705  6.757  1.00 0.00 ? 271 LEU A HB3  7  
ATOM 8422  H HG   . LEU A 1 69 ? -2.093  -1.736  8.766  1.00 0.00 ? 271 LEU A HG   7  
ATOM 8423  H HD11 . LEU A 1 69 ? -3.772  -2.706  9.858  1.00 0.00 ? 271 LEU A HD11 7  
ATOM 8424  H HD12 . LEU A 1 69 ? -3.904  -3.804  8.486  1.00 0.00 ? 271 LEU A HD12 7  
ATOM 8425  H HD13 . LEU A 1 69 ? -2.951  -4.265  9.897  1.00 0.00 ? 271 LEU A HD13 7  
ATOM 8426  H HD21 . LEU A 1 69 ? -0.960  -4.192  9.883  1.00 0.00 ? 271 LEU A HD21 7  
ATOM 8427  H HD22 . LEU A 1 69 ? 0.027   -3.446  8.627  1.00 0.00 ? 271 LEU A HD22 7  
ATOM 8428  H HD23 . LEU A 1 69 ? -0.435  -2.518  10.054 1.00 0.00 ? 271 LEU A HD23 7  
ATOM 8429  N N    . PHE A 1 70 ? -3.508  -0.222  6.434  1.00 0.00 ? 272 PHE A N    7  
ATOM 8430  C CA   . PHE A 1 70 ? -3.342  1.177   6.057  1.00 0.00 ? 272 PHE A CA   7  
ATOM 8431  C C    . PHE A 1 70 ? -2.651  1.975   7.161  1.00 0.00 ? 272 PHE A C    7  
ATOM 8432  O O    . PHE A 1 70 ? -3.221  2.186   8.229  1.00 0.00 ? 272 PHE A O    7  
ATOM 8433  C CB   . PHE A 1 70 ? -4.706  1.802   5.754  1.00 0.00 ? 272 PHE A CB   7  
ATOM 8434  C CG   . PHE A 1 70 ? -5.274  1.400   4.422  1.00 0.00 ? 272 PHE A CG   7  
ATOM 8435  C CD1  . PHE A 1 70 ? -5.420  0.062   4.090  1.00 0.00 ? 272 PHE A CD1  7  
ATOM 8436  C CD2  . PHE A 1 70 ? -5.669  2.361   3.506  1.00 0.00 ? 272 PHE A CD2  7  
ATOM 8437  C CE1  . PHE A 1 70 ? -5.946  -0.308  2.868  1.00 0.00 ? 272 PHE A CE1  7  
ATOM 8438  C CE2  . PHE A 1 70 ? -6.197  1.996   2.283  1.00 0.00 ? 272 PHE A CE2  7  
ATOM 8439  C CZ   . PHE A 1 70 ? -6.337  0.660   1.964  1.00 0.00 ? 272 PHE A CZ   7  
ATOM 8440  H H    . PHE A 1 70 ? -4.146  -0.454  7.140  1.00 0.00 ? 272 PHE A H    7  
ATOM 8441  H HA   . PHE A 1 70 ? -2.734  1.213   5.166  1.00 0.00 ? 272 PHE A HA   7  
ATOM 8442  H HB2  . PHE A 1 70 ? -5.407  1.498   6.517  1.00 0.00 ? 272 PHE A HB2  7  
ATOM 8443  H HB3  . PHE A 1 70 ? -4.612  2.877   5.766  1.00 0.00 ? 272 PHE A HB3  7  
ATOM 8444  H HD1  . PHE A 1 70 ? -5.116  -0.695  4.798  1.00 0.00 ? 272 PHE A HD1  7  
ATOM 8445  H HD2  . PHE A 1 70 ? -5.561  3.407   3.755  1.00 0.00 ? 272 PHE A HD2  7  
ATOM 8446  H HE1  . PHE A 1 70 ? -6.055  -1.354  2.621  1.00 0.00 ? 272 PHE A HE1  7  
ATOM 8447  H HE2  . PHE A 1 70 ? -6.501  2.755   1.577  1.00 0.00 ? 272 PHE A HE2  7  
ATOM 8448  H HZ   . PHE A 1 70 ? -6.748  0.371   1.008  1.00 0.00 ? 272 PHE A HZ   7  
ATOM 8449  N N    . ALA A 1 71 ? -1.431  2.432   6.890  1.00 0.00 ? 273 ALA A N    7  
ATOM 8450  C CA   . ALA A 1 71 ? -0.679  3.223   7.860  1.00 0.00 ? 273 ALA A CA   7  
ATOM 8451  C C    . ALA A 1 71 ? 0.101   4.339   7.172  1.00 0.00 ? 273 ALA A C    7  
ATOM 8452  O O    . ALA A 1 71 ? 0.529   4.197   6.027  1.00 0.00 ? 273 ALA A O    7  
ATOM 8453  C CB   . ALA A 1 71 ? 0.262   2.344   8.672  1.00 0.00 ? 273 ALA A CB   7  
ATOM 8454  H H    . ALA A 1 71 ? -1.032  2.243   6.015  1.00 0.00 ? 273 ALA A H    7  
ATOM 8455  H HA   . ALA A 1 71 ? -1.392  3.667   8.542  1.00 0.00 ? 273 ALA A HA   7  
ATOM 8456  H HB1  . ALA A 1 71 ? 1.199   2.236   8.145  1.00 0.00 ? 273 ALA A HB1  7  
ATOM 8457  H HB2  . ALA A 1 71 ? 0.443   2.803   9.634  1.00 0.00 ? 273 ALA A HB2  7  
ATOM 8458  H HB3  . ALA A 1 71 ? -0.185  1.372   8.817  1.00 0.00 ? 273 ALA A HB3  7  
ATOM 8459  N N    . PRO A 1 72 ? 0.294   5.472   7.868  1.00 0.00 ? 274 PRO A N    7  
ATOM 8460  C CA   . PRO A 1 72 ? 1.022   6.624   7.331  1.00 0.00 ? 274 PRO A CA   7  
ATOM 8461  C C    . PRO A 1 72 ? 2.352   6.237   6.696  1.00 0.00 ? 274 PRO A C    7  
ATOM 8462  O O    . PRO A 1 72 ? 2.879   5.151   6.943  1.00 0.00 ? 274 PRO A O    7  
ATOM 8463  C CB   . PRO A 1 72 ? 1.266   7.490   8.564  1.00 0.00 ? 274 PRO A CB   7  
ATOM 8464  C CG   . PRO A 1 72 ? 0.155   7.153   9.496  1.00 0.00 ? 274 PRO A CG   7  
ATOM 8465  C CD   . PRO A 1 72 ? -0.190  5.712   9.239  1.00 0.00 ? 274 PRO A CD   7  
ATOM 8466  H HA   . PRO A 1 72 ? 0.428   7.172   6.617  1.00 0.00 ? 274 PRO A HA   7  
ATOM 8467  H HB2  . PRO A 1 72 ? 2.226   7.244   8.991  1.00 0.00 ? 274 PRO A HB2  7  
ATOM 8468  H HB3  . PRO A 1 72 ? 1.245   8.533   8.287  1.00 0.00 ? 274 PRO A HB3  7  
ATOM 8469  H HG2  . PRO A 1 72 ? 0.487   7.279   10.516 1.00 0.00 ? 274 PRO A HG2  7  
ATOM 8470  H HG3  . PRO A 1 72 ? -0.697  7.785   9.297  1.00 0.00 ? 274 PRO A HG3  7  
ATOM 8471  H HD2  . PRO A 1 72 ? 0.317   5.070   9.944  1.00 0.00 ? 274 PRO A HD2  7  
ATOM 8472  H HD3  . PRO A 1 72 ? -1.259  5.564   9.297  1.00 0.00 ? 274 PRO A HD3  7  
ATOM 8473  N N    . VAL A 1 73 ? 2.895   7.138   5.883  1.00 0.00 ? 275 VAL A N    7  
ATOM 8474  C CA   . VAL A 1 73 ? 4.167   6.897   5.218  1.00 0.00 ? 275 VAL A CA   7  
ATOM 8475  C C    . VAL A 1 73 ? 5.320   6.937   6.219  1.00 0.00 ? 275 VAL A C    7  
ATOM 8476  O O    . VAL A 1 73 ? 6.275   6.168   6.111  1.00 0.00 ? 275 VAL A O    7  
ATOM 8477  C CB   . VAL A 1 73 ? 4.425   7.932   4.104  1.00 0.00 ? 275 VAL A CB   7  
ATOM 8478  C CG1  . VAL A 1 73 ? 4.483   9.339   4.679  1.00 0.00 ? 275 VAL A CG1  7  
ATOM 8479  C CG2  . VAL A 1 73 ? 5.705   7.601   3.350  1.00 0.00 ? 275 VAL A CG2  7  
ATOM 8480  H H    . VAL A 1 73 ? 2.430   7.987   5.731  1.00 0.00 ? 275 VAL A H    7  
ATOM 8481  H HA   . VAL A 1 73 ? 4.129   5.916   4.768  1.00 0.00 ? 275 VAL A HA   7  
ATOM 8482  H HB   . VAL A 1 73 ? 3.601   7.888   3.405  1.00 0.00 ? 275 VAL A HB   7  
ATOM 8483  H HG11 . VAL A 1 73 ? 5.500   9.571   4.957  1.00 0.00 ? 275 VAL A HG11 7  
ATOM 8484  H HG12 . VAL A 1 73 ? 4.143   10.046  3.936  1.00 0.00 ? 275 VAL A HG12 7  
ATOM 8485  H HG13 . VAL A 1 73 ? 3.849   9.398   5.551  1.00 0.00 ? 275 VAL A HG13 7  
ATOM 8486  H HG21 . VAL A 1 73 ? 6.532   7.565   4.043  1.00 0.00 ? 275 VAL A HG21 7  
ATOM 8487  H HG22 . VAL A 1 73 ? 5.600   6.642   2.864  1.00 0.00 ? 275 VAL A HG22 7  
ATOM 8488  H HG23 . VAL A 1 73 ? 5.892   8.363   2.607  1.00 0.00 ? 275 VAL A HG23 7  
ATOM 8489  N N    . HIS A 1 74 ? 5.219   7.834   7.196  1.00 0.00 ? 276 HIS A N    7  
ATOM 8490  C CA   . HIS A 1 74 ? 6.253   7.965   8.218  1.00 0.00 ? 276 HIS A CA   7  
ATOM 8491  C C    . HIS A 1 74 ? 6.204   6.792   9.192  1.00 0.00 ? 276 HIS A C    7  
ATOM 8492  O O    . HIS A 1 74 ? 7.215   6.433   9.796  1.00 0.00 ? 276 HIS A O    7  
ATOM 8493  C CB   . HIS A 1 74 ? 6.106   9.287   8.978  1.00 0.00 ? 276 HIS A CB   7  
ATOM 8494  C CG   . HIS A 1 74 ? 4.693   9.636   9.332  1.00 0.00 ? 276 HIS A CG   7  
ATOM 8495  N ND1  . HIS A 1 74 ? 4.146   10.881  9.105  1.00 0.00 ? 276 HIS A ND1  7  
ATOM 8496  C CD2  . HIS A 1 74 ? 3.713   8.897   9.904  1.00 0.00 ? 276 HIS A CD2  7  
ATOM 8497  C CE1  . HIS A 1 74 ? 2.892   10.894  9.523  1.00 0.00 ? 276 HIS A CE1  7  
ATOM 8498  N NE2  . HIS A 1 74 ? 2.606   9.702   10.011 1.00 0.00 ? 276 HIS A NE2  7  
ATOM 8499  H H    . HIS A 1 74 ? 4.431   8.416   7.232  1.00 0.00 ? 276 HIS A H    7  
ATOM 8500  H HA   . HIS A 1 74 ? 7.210   7.956   7.717  1.00 0.00 ? 276 HIS A HA   7  
ATOM 8501  H HB2  . HIS A 1 74 ? 6.670   9.230   9.896  1.00 0.00 ? 276 HIS A HB2  7  
ATOM 8502  H HB3  . HIS A 1 74 ? 6.502   10.088  8.370  1.00 0.00 ? 276 HIS A HB3  7  
ATOM 8503  H HD1  . HIS A 1 74 ? 4.608   11.644  8.698  1.00 0.00 ? 276 HIS A HD1  7  
ATOM 8504  H HD2  . HIS A 1 74 ? 3.786   7.863   10.212 1.00 0.00 ? 276 HIS A HD2  7  
ATOM 8505  H HE1  . HIS A 1 74 ? 2.217   11.734  9.471  1.00 0.00 ? 276 HIS A HE1  7  
ATOM 8506  H HE2  . HIS A 1 74 ? 1.777   9.469   10.480 1.00 0.00 ? 276 HIS A HE2  7  
ATOM 8507  N N    . LYS A 1 75 ? 5.026   6.188   9.333  1.00 0.00 ? 277 LYS A N    7  
ATOM 8508  C CA   . LYS A 1 75 ? 4.856   5.047   10.224 1.00 0.00 ? 277 LYS A CA   7  
ATOM 8509  C C    . LYS A 1 75 ? 5.400   3.777   9.583  1.00 0.00 ? 277 LYS A C    7  
ATOM 8510  O O    . LYS A 1 75 ? 5.690   2.798   10.272 1.00 0.00 ? 277 LYS A O    7  
ATOM 8511  C CB   . LYS A 1 75 ? 3.379   4.851   10.571 1.00 0.00 ? 277 LYS A CB   7  
ATOM 8512  C CG   . LYS A 1 75 ? 2.882   5.764   11.679 1.00 0.00 ? 277 LYS A CG   7  
ATOM 8513  C CD   . LYS A 1 75 ? 2.464   4.971   12.906 1.00 0.00 ? 277 LYS A CD   7  
ATOM 8514  C CE   . LYS A 1 75 ? 3.612   4.812   13.890 1.00 0.00 ? 277 LYS A CE   7  
ATOM 8515  N NZ   . LYS A 1 75 ? 4.762   4.079   13.293 1.00 0.00 ? 277 LYS A NZ   7  
ATOM 8516  H H    . LYS A 1 75 ? 4.257   6.512   8.818  1.00 0.00 ? 277 LYS A H    7  
ATOM 8517  H HA   . LYS A 1 75 ? 5.408   5.247   11.130 1.00 0.00 ? 277 LYS A HA   7  
ATOM 8518  H HB2  . LYS A 1 75 ? 2.787   5.041   9.688  1.00 0.00 ? 277 LYS A HB2  7  
ATOM 8519  H HB3  . LYS A 1 75 ? 3.228   3.828   10.880 1.00 0.00 ? 277 LYS A HB3  7  
ATOM 8520  H HG2  . LYS A 1 75 ? 3.675   6.445   11.956 1.00 0.00 ? 277 LYS A HG2  7  
ATOM 8521  H HG3  . LYS A 1 75 ? 2.033   6.325   11.317 1.00 0.00 ? 277 LYS A HG3  7  
ATOM 8522  H HD2  . LYS A 1 75 ? 1.652   5.485   13.395 1.00 0.00 ? 277 LYS A HD2  7  
ATOM 8523  H HD3  . LYS A 1 75 ? 2.133   3.990   12.589 1.00 0.00 ? 277 LYS A HD3  7  
ATOM 8524  H HE2  . LYS A 1 75 ? 3.942   5.793   14.197 1.00 0.00 ? 277 LYS A HE2  7  
ATOM 8525  H HE3  . LYS A 1 75 ? 3.257   4.266   14.752 1.00 0.00 ? 277 LYS A HE3  7  
ATOM 8526  H HZ1  . LYS A 1 75 ? 5.127   3.376   13.968 1.00 0.00 ? 277 LYS A HZ1  7  
ATOM 8527  H HZ2  . LYS A 1 75 ? 5.526   4.745   13.056 1.00 0.00 ? 277 LYS A HZ2  7  
ATOM 8528  H HZ3  . LYS A 1 75 ? 4.465   3.589   12.426 1.00 0.00 ? 277 LYS A HZ3  7  
ATOM 8529  N N    . VAL A 1 76 ? 5.534   3.797   8.261  1.00 0.00 ? 278 VAL A N    7  
ATOM 8530  C CA   . VAL A 1 76 ? 6.043   2.644   7.532  1.00 0.00 ? 278 VAL A CA   7  
ATOM 8531  C C    . VAL A 1 76 ? 7.533   2.783   7.246  1.00 0.00 ? 278 VAL A C    7  
ATOM 8532  O O    . VAL A 1 76 ? 8.017   3.870   6.931  1.00 0.00 ? 278 VAL A O    7  
ATOM 8533  C CB   . VAL A 1 76 ? 5.294   2.436   6.202  1.00 0.00 ? 278 VAL A CB   7  
ATOM 8534  C CG1  . VAL A 1 76 ? 5.711   1.127   5.556  1.00 0.00 ? 278 VAL A CG1  7  
ATOM 8535  C CG2  . VAL A 1 76 ? 3.791   2.468   6.418  1.00 0.00 ? 278 VAL A CG2  7  
ATOM 8536  H H    . VAL A 1 76 ? 5.284   4.604   7.766  1.00 0.00 ? 278 VAL A H    7  
ATOM 8537  H HA   . VAL A 1 76 ? 5.890   1.772   8.148  1.00 0.00 ? 278 VAL A HA   7  
ATOM 8538  H HB   . VAL A 1 76 ? 5.559   3.242   5.534  1.00 0.00 ? 278 VAL A HB   7  
ATOM 8539  H HG11 . VAL A 1 76 ? 4.866   0.452   5.533  1.00 0.00 ? 278 VAL A HG11 7  
ATOM 8540  H HG12 . VAL A 1 76 ? 6.047   1.315   4.548  1.00 0.00 ? 278 VAL A HG12 7  
ATOM 8541  H HG13 . VAL A 1 76 ? 6.509   0.680   6.126  1.00 0.00 ? 278 VAL A HG13 7  
ATOM 8542  H HG21 . VAL A 1 76 ? 3.326   3.019   5.614  1.00 0.00 ? 278 VAL A HG21 7  
ATOM 8543  H HG22 . VAL A 1 76 ? 3.409   1.458   6.428  1.00 0.00 ? 278 VAL A HG22 7  
ATOM 8544  H HG23 . VAL A 1 76 ? 3.571   2.947   7.359  1.00 0.00 ? 278 VAL A HG23 7  
ATOM 8545  N N    . THR A 1 77 ? 8.252   1.672   7.354  1.00 0.00 ? 279 THR A N    7  
ATOM 8546  C CA   . THR A 1 77 ? 9.688   1.662   7.105  1.00 0.00 ? 279 THR A CA   7  
ATOM 8547  C C    . THR A 1 77 ? 10.084  0.444   6.276  1.00 0.00 ? 279 THR A C    7  
ATOM 8548  O O    . THR A 1 77 ? 9.504   -0.631  6.418  1.00 0.00 ? 279 THR A O    7  
ATOM 8549  C CB   . THR A 1 77 ? 10.454  1.665   8.428  1.00 0.00 ? 279 THR A CB   7  
ATOM 8550  O OG1  . THR A 1 77 ? 9.615   2.070   9.496  1.00 0.00 ? 279 THR A OG1  7  
ATOM 8551  C CG2  . THR A 1 77 ? 11.657  2.583   8.419  1.00 0.00 ? 279 THR A CG2  7  
ATOM 8552  H H    . THR A 1 77 ? 7.806   0.837   7.606  1.00 0.00 ? 279 THR A H    7  
ATOM 8553  H HA   . THR A 1 77 ? 9.935   2.555   6.552  1.00 0.00 ? 279 THR A HA   7  
ATOM 8554  H HB   . THR A 1 77 ? 10.803  0.664   8.633  1.00 0.00 ? 279 THR A HB   7  
ATOM 8555  H HG1  . THR A 1 77 ? 9.120   2.850   9.236  1.00 0.00 ? 279 THR A HG1  7  
ATOM 8556  H HG21 . THR A 1 77 ? 11.332  3.599   8.251  1.00 0.00 ? 279 THR A HG21 7  
ATOM 8557  H HG22 . THR A 1 77 ? 12.330  2.284   7.629  1.00 0.00 ? 279 THR A HG22 7  
ATOM 8558  H HG23 . THR A 1 77 ? 12.165  2.518   9.370  1.00 0.00 ? 279 THR A HG23 7  
ATOM 8559  N N    . LYS A 1 78 ? 11.077  0.621   5.410  1.00 0.00 ? 280 LYS A N    7  
ATOM 8560  C CA   . LYS A 1 78 ? 11.548  -0.466  4.559  1.00 0.00 ? 280 LYS A CA   7  
ATOM 8561  C C    . LYS A 1 78 ? 12.242  -1.542  5.389  1.00 0.00 ? 280 LYS A C    7  
ATOM 8562  O O    . LYS A 1 78 ? 13.074  -1.241  6.245  1.00 0.00 ? 280 LYS A O    7  
ATOM 8563  C CB   . LYS A 1 78 ? 12.501  0.071   3.488  1.00 0.00 ? 280 LYS A CB   7  
ATOM 8564  C CG   . LYS A 1 78 ? 12.079  -0.286  2.071  1.00 0.00 ? 280 LYS A CG   7  
ATOM 8565  C CD   . LYS A 1 78 ? 13.159  0.068   1.061  1.00 0.00 ? 280 LYS A CD   7  
ATOM 8566  C CE   . LYS A 1 78 ? 12.957  -0.668  -0.253 1.00 0.00 ? 280 LYS A CE   7  
ATOM 8567  N NZ   . LYS A 1 78 ? 12.697  -2.119  -0.041 1.00 0.00 ? 280 LYS A NZ   7  
ATOM 8568  H H    . LYS A 1 78 ? 11.502  1.501   5.341  1.00 0.00 ? 280 LYS A H    7  
ATOM 8569  H HA   . LYS A 1 78 ? 10.688  -0.904  4.077  1.00 0.00 ? 280 LYS A HA   7  
ATOM 8570  H HB2  . LYS A 1 78 ? 12.544  1.146   3.567  1.00 0.00 ? 280 LYS A HB2  7  
ATOM 8571  H HB3  . LYS A 1 78 ? 13.486  -0.334  3.660  1.00 0.00 ? 280 LYS A HB3  7  
ATOM 8572  H HG2  . LYS A 1 78 ? 11.888  -1.348  2.020  1.00 0.00 ? 280 LYS A HG2  7  
ATOM 8573  H HG3  . LYS A 1 78 ? 11.178  0.256   1.827  1.00 0.00 ? 280 LYS A HG3  7  
ATOM 8574  H HD2  . LYS A 1 78 ? 13.128  1.131   0.874  1.00 0.00 ? 280 LYS A HD2  7  
ATOM 8575  H HD3  . LYS A 1 78 ? 14.123  -0.199  1.470  1.00 0.00 ? 280 LYS A HD3  7  
ATOM 8576  H HE2  . LYS A 1 78 ? 12.115  -0.234  -0.769 1.00 0.00 ? 280 LYS A HE2  7  
ATOM 8577  H HE3  . LYS A 1 78 ? 13.846  -0.554  -0.854 1.00 0.00 ? 280 LYS A HE3  7  
ATOM 8578  H HZ1  . LYS A 1 78 ? 11.705  -2.269  0.235  1.00 0.00 ? 280 LYS A HZ1  7  
ATOM 8579  H HZ2  . LYS A 1 78 ? 13.313  -2.488  0.711  1.00 0.00 ? 280 LYS A HZ2  7  
ATOM 8580  H HZ3  . LYS A 1 78 ? 12.885  -2.648  -0.916 1.00 0.00 ? 280 LYS A HZ3  7  
ATOM 8581  N N    . ILE A 1 79 ? 11.893  -2.797  5.129  1.00 0.00 ? 281 ILE A N    7  
ATOM 8582  C CA   . ILE A 1 79 ? 12.483  -3.919  5.849  1.00 0.00 ? 281 ILE A CA   7  
ATOM 8583  C C    . ILE A 1 79 ? 13.760  -4.400  5.168  1.00 0.00 ? 281 ILE A C    7  
ATOM 8584  O O    . ILE A 1 79 ? 14.670  -4.911  5.820  1.00 0.00 ? 281 ILE A O    7  
ATOM 8585  C CB   . ILE A 1 79 ? 11.491  -5.095  5.962  1.00 0.00 ? 281 ILE A CB   7  
ATOM 8586  C CG1  . ILE A 1 79 ? 12.089  -6.221  6.809  1.00 0.00 ? 281 ILE A CG1  7  
ATOM 8587  C CG2  . ILE A 1 79 ? 11.111  -5.608  4.580  1.00 0.00 ? 281 ILE A CG2  7  
ATOM 8588  C CD1  . ILE A 1 79 ? 11.050  -7.155  7.393  1.00 0.00 ? 281 ILE A CD1  7  
ATOM 8589  H H    . ILE A 1 79 ? 11.225  -2.974  4.434  1.00 0.00 ? 281 ILE A H    7  
ATOM 8590  H HA   . ILE A 1 79 ? 12.724  -3.583  6.847  1.00 0.00 ? 281 ILE A HA   7  
ATOM 8591  H HB   . ILE A 1 79 ? 10.594  -4.733  6.441  1.00 0.00 ? 281 ILE A HB   7  
ATOM 8592  H HG12 . ILE A 1 79 ? 12.755  -6.810  6.196  1.00 0.00 ? 281 ILE A HG12 7  
ATOM 8593  H HG13 . ILE A 1 79 ? 12.646  -5.789  7.627  1.00 0.00 ? 281 ILE A HG13 7  
ATOM 8594  H HG21 . ILE A 1 79 ? 12.002  -5.718  3.980  1.00 0.00 ? 281 ILE A HG21 7  
ATOM 8595  H HG22 . ILE A 1 79 ? 10.621  -6.566  4.673  1.00 0.00 ? 281 ILE A HG22 7  
ATOM 8596  H HG23 . ILE A 1 79 ? 10.443  -4.906  4.107  1.00 0.00 ? 281 ILE A HG23 7  
ATOM 8597  H HD11 . ILE A 1 79 ? 11.424  -8.167  7.371  1.00 0.00 ? 281 ILE A HD11 7  
ATOM 8598  H HD12 . ILE A 1 79 ? 10.843  -6.869  8.414  1.00 0.00 ? 281 ILE A HD12 7  
ATOM 8599  H HD13 . ILE A 1 79 ? 10.144  -7.093  6.810  1.00 0.00 ? 281 ILE A HD13 7  
ATOM 8600  N N    . GLY A 1 80 ? 13.821  -4.234  3.850  1.00 0.00 ? 282 GLY A N    7  
ATOM 8601  C CA   . GLY A 1 80 ? 14.990  -4.655  3.104  1.00 0.00 ? 282 GLY A CA   7  
ATOM 8602  C C    . GLY A 1 80 ? 14.796  -6.000  2.430  1.00 0.00 ? 282 GLY A C    7  
ATOM 8603  O O    . GLY A 1 80 ? 13.747  -6.261  1.842  1.00 0.00 ? 282 GLY A O    7  
ATOM 8604  H H    . GLY A 1 80 ? 13.067  -3.820  3.383  1.00 0.00 ? 282 GLY A H    7  
ATOM 8605  H HA2  . GLY A 1 80 ? 15.207  -3.915  2.345  1.00 0.00 ? 282 GLY A HA2  7  
ATOM 8606  H HA3  . GLY A 1 80 ? 15.832  -4.720  3.777  1.00 0.00 ? 282 GLY A HA3  7  
ATOM 8607  N N    . PHE A 1 81 ? 15.809  -6.855  2.519  1.00 0.00 ? 283 PHE A N    7  
ATOM 8608  C CA   . PHE A 1 81 ? 15.743  -8.181  1.915  1.00 0.00 ? 283 PHE A CA   7  
ATOM 8609  C C    . PHE A 1 81 ? 14.920  -9.134  2.779  1.00 0.00 ? 283 PHE A C    7  
ATOM 8610  O O    . PHE A 1 81 ? 14.928  -9.033  4.006  1.00 0.00 ? 283 PHE A O    7  
ATOM 8611  C CB   . PHE A 1 81 ? 17.151  -8.743  1.714  1.00 0.00 ? 283 PHE A CB   7  
ATOM 8612  C CG   . PHE A 1 81 ? 18.012  -8.660  2.943  1.00 0.00 ? 283 PHE A CG   7  
ATOM 8613  C CD1  . PHE A 1 81 ? 17.759  -9.469  4.038  1.00 0.00 ? 283 PHE A CD1  7  
ATOM 8614  C CD2  . PHE A 1 81 ? 19.073  -7.770  3.002  1.00 0.00 ? 283 PHE A CD2  7  
ATOM 8615  C CE1  . PHE A 1 81 ? 18.551  -9.394  5.169  1.00 0.00 ? 283 PHE A CE1  7  
ATOM 8616  C CE2  . PHE A 1 81 ? 19.867  -7.690  4.130  1.00 0.00 ? 283 PHE A CE2  7  
ATOM 8617  C CZ   . PHE A 1 81 ? 19.605  -8.503  5.215  1.00 0.00 ? 283 PHE A CZ   7  
ATOM 8618  H H    . PHE A 1 81 ? 16.618  -6.590  3.002  1.00 0.00 ? 283 PHE A H    7  
ATOM 8619  H HA   . PHE A 1 81 ? 15.264  -8.082  0.952  1.00 0.00 ? 283 PHE A HA   7  
ATOM 8620  H HB2  . PHE A 1 81 ? 17.079  -9.783  1.430  1.00 0.00 ? 283 PHE A HB2  7  
ATOM 8621  H HB3  . PHE A 1 81 ? 17.643  -8.193  0.925  1.00 0.00 ? 283 PHE A HB3  7  
ATOM 8622  H HD1  . PHE A 1 81 ? 16.935  -10.166 4.003  1.00 0.00 ? 283 PHE A HD1  7  
ATOM 8623  H HD2  . PHE A 1 81 ? 19.279  -7.135  2.153  1.00 0.00 ? 283 PHE A HD2  7  
ATOM 8624  H HE1  . PHE A 1 81 ? 18.342  -10.031 6.017  1.00 0.00 ? 283 PHE A HE1  7  
ATOM 8625  H HE2  . PHE A 1 81 ? 20.690  -6.993  4.162  1.00 0.00 ? 283 PHE A HE2  7  
ATOM 8626  H HZ   . PHE A 1 81 ? 20.225  -8.444  6.099  1.00 0.00 ? 283 PHE A HZ   7  
ATOM 8627  N N    . GLY B 2 29 ? -1.544  8.945   20.066 1.00 0.00 ? 444 GLY B N    7  
ATOM 8628  C CA   . GLY B 2 29 ? -0.832  8.116   19.112 1.00 0.00 ? 444 GLY B CA   7  
ATOM 8629  C C    . GLY B 2 29 ? 0.670   8.308   19.181 1.00 0.00 ? 444 GLY B C    7  
ATOM 8630  O O    . GLY B 2 29 ? 1.161   9.435   19.109 1.00 0.00 ? 444 GLY B O    7  
ATOM 8631  H HA2  . GLY B 2 29 ? -1.061  7.079   19.311 1.00 0.00 ? 444 GLY B HA2  7  
ATOM 8632  H HA3  . GLY B 2 29 ? -1.170  8.363   18.116 1.00 0.00 ? 444 GLY B HA3  7  
ATOM 8633  N N    . GLU B 2 30 ? 1.400   7.208   19.323 1.00 0.00 ? 445 GLU B N    7  
ATOM 8634  C CA   . GLU B 2 30 ? 2.856   7.261   19.405 1.00 0.00 ? 445 GLU B CA   7  
ATOM 8635  C C    . GLU B 2 30 ? 3.492   6.414   18.306 1.00 0.00 ? 445 GLU B C    7  
ATOM 8636  O O    . GLU B 2 30 ? 3.952   6.941   17.292 1.00 0.00 ? 445 GLU B O    7  
ATOM 8637  C CB   . GLU B 2 30 ? 3.329   6.780   20.778 1.00 0.00 ? 445 GLU B CB   7  
ATOM 8638  C CG   . GLU B 2 30 ? 2.984   7.735   21.910 1.00 0.00 ? 445 GLU B CG   7  
ATOM 8639  C CD   . GLU B 2 30 ? 4.194   8.123   22.737 1.00 0.00 ? 445 GLU B CD   7  
ATOM 8640  O OE1  . GLU B 2 30 ? 4.526   7.382   23.687 1.00 0.00 ? 445 GLU B OE1  7  
ATOM 8641  O OE2  . GLU B 2 30 ? 4.810   9.166   22.435 1.00 0.00 ? 445 GLU B OE2  7  
ATOM 8642  H H    . GLU B 2 30 ? 0.949   6.339   19.377 1.00 0.00 ? 445 GLU B H    7  
ATOM 8643  H HA   . GLU B 2 30 ? 3.157   8.288   19.270 1.00 0.00 ? 445 GLU B HA   7  
ATOM 8644  H HB2  . GLU B 2 30 ? 2.869   5.826   20.991 1.00 0.00 ? 445 GLU B HB2  7  
ATOM 8645  H HB3  . GLU B 2 30 ? 4.400   6.656   20.753 1.00 0.00 ? 445 GLU B HB3  7  
ATOM 8646  H HG2  . GLU B 2 30 ? 2.554   8.631   21.489 1.00 0.00 ? 445 GLU B HG2  7  
ATOM 8647  H HG3  . GLU B 2 30 ? 2.260   7.261   22.558 1.00 0.00 ? 445 GLU B HG3  7  
ATOM 8648  N N    . GLU B 2 31 ? 3.518   5.101   18.515 1.00 0.00 ? 446 GLU B N    7  
ATOM 8649  C CA   . GLU B 2 31 ? 4.100   4.183   17.541 1.00 0.00 ? 446 GLU B CA   7  
ATOM 8650  C C    . GLU B 2 31 ? 3.058   3.198   17.009 1.00 0.00 ? 446 GLU B C    7  
ATOM 8651  O O    . GLU B 2 31 ? 3.323   2.454   16.064 1.00 0.00 ? 446 GLU B O    7  
ATOM 8652  C CB   . GLU B 2 31 ? 5.267   3.418   18.169 1.00 0.00 ? 446 GLU B CB   7  
ATOM 8653  C CG   . GLU B 2 31 ? 6.631   3.977   17.793 1.00 0.00 ? 446 GLU B CG   7  
ATOM 8654  C CD   . GLU B 2 31 ? 7.333   3.140   16.740 1.00 0.00 ? 446 GLU B CD   7  
ATOM 8655  O OE1  . GLU B 2 31 ? 7.101   3.386   15.538 1.00 0.00 ? 446 GLU B OE1  7  
ATOM 8656  O OE2  . GLU B 2 31 ? 8.113   2.242   17.118 1.00 0.00 ? 446 GLU B OE2  7  
ATOM 8657  H H    . GLU B 2 31 ? 3.137   4.741   19.342 1.00 0.00 ? 446 GLU B H    7  
ATOM 8658  H HA   . GLU B 2 31 ? 4.472   4.770   16.715 1.00 0.00 ? 446 GLU B HA   7  
ATOM 8659  H HB2  . GLU B 2 31 ? 5.171   3.457   19.244 1.00 0.00 ? 446 GLU B HB2  7  
ATOM 8660  H HB3  . GLU B 2 31 ? 5.225   2.388   17.848 1.00 0.00 ? 446 GLU B HB3  7  
ATOM 8661  H HG2  . GLU B 2 31 ? 6.503   4.978   17.410 1.00 0.00 ? 446 GLU B HG2  7  
ATOM 8662  H HG3  . GLU B 2 31 ? 7.249   4.006   18.679 1.00 0.00 ? 446 GLU B HG3  7  
ATOM 8663  N N    . GLU B 2 32 ? 1.875   3.191   17.620 1.00 0.00 ? 447 GLU B N    7  
ATOM 8664  C CA   . GLU B 2 32 ? 0.805   2.293   17.199 1.00 0.00 ? 447 GLU B CA   7  
ATOM 8665  C C    . GLU B 2 32 ? -0.549  2.992   17.260 1.00 0.00 ? 447 GLU B C    7  
ATOM 8666  O O    . GLU B 2 32 ? -0.696  4.026   17.911 1.00 0.00 ? 447 GLU B O    7  
ATOM 8667  C CB   . GLU B 2 32 ? 0.787   1.043   18.081 1.00 0.00 ? 447 GLU B CB   7  
ATOM 8668  C CG   . GLU B 2 32 ? 2.165   0.444   18.315 1.00 0.00 ? 447 GLU B CG   7  
ATOM 8669  C CD   . GLU B 2 32 ? 2.819   0.966   19.579 1.00 0.00 ? 447 GLU B CD   7  
ATOM 8670  O OE1  . GLU B 2 32 ? 2.145   0.984   20.632 1.00 0.00 ? 447 GLU B OE1  7  
ATOM 8671  O OE2  . GLU B 2 32 ? 4.004   1.358   19.517 1.00 0.00 ? 447 GLU B OE2  7  
ATOM 8672  H H    . GLU B 2 32 ? 1.715   3.802   18.368 1.00 0.00 ? 447 GLU B H    7  
ATOM 8673  H HA   . GLU B 2 32 ? 1.001   2.001   16.179 1.00 0.00 ? 447 GLU B HA   7  
ATOM 8674  H HB2  . GLU B 2 32 ? 0.360   1.298   19.039 1.00 0.00 ? 447 GLU B HB2  7  
ATOM 8675  H HB3  . GLU B 2 32 ? 0.169   0.292   17.608 1.00 0.00 ? 447 GLU B HB3  7  
ATOM 8676  H HG2  . GLU B 2 32 ? 2.068   -0.629  18.394 1.00 0.00 ? 447 GLU B HG2  7  
ATOM 8677  H HG3  . GLU B 2 32 ? 2.796   0.687   17.474 1.00 0.00 ? 447 GLU B HG3  7  
ATOM 8678  N N    . GLY B 2 33 ? -1.534  2.424   16.575 1.00 0.00 ? 448 GLY B N    7  
ATOM 8679  C CA   . GLY B 2 33 ? -2.862  3.008   16.562 1.00 0.00 ? 448 GLY B CA   7  
ATOM 8680  C C    . GLY B 2 33 ? -3.099  3.906   15.361 1.00 0.00 ? 448 GLY B C    7  
ATOM 8681  O O    . GLY B 2 33 ? -4.225  4.335   15.113 1.00 0.00 ? 448 GLY B O    7  
ATOM 8682  H H    . GLY B 2 33 ? -1.361  1.600   16.073 1.00 0.00 ? 448 GLY B H    7  
ATOM 8683  H HA2  . GLY B 2 33 ? -3.594  2.213   16.551 1.00 0.00 ? 448 GLY B HA2  7  
ATOM 8684  H HA3  . GLY B 2 33 ? -2.995  3.590   17.463 1.00 0.00 ? 448 GLY B HA3  7  
ATOM 8685  N N    . GLU B 2 34 ? -2.036  4.193   14.614 1.00 0.00 ? 449 GLU B N    7  
ATOM 8686  C CA   . GLU B 2 34 ? -2.138  5.048   13.436 1.00 0.00 ? 449 GLU B CA   7  
ATOM 8687  C C    . GLU B 2 34 ? -2.285  4.217   12.169 1.00 0.00 ? 449 GLU B C    7  
ATOM 8688  O O    . GLU B 2 34 ? -1.862  4.637   11.096 1.00 0.00 ? 449 GLU B O    7  
ATOM 8689  C CB   . GLU B 2 34 ? -0.901  5.937   13.307 1.00 0.00 ? 449 GLU B CB   7  
ATOM 8690  C CG   . GLU B 2 34 ? -0.319  6.384   14.639 1.00 0.00 ? 449 GLU B CG   7  
ATOM 8691  C CD   . GLU B 2 34 ? -1.242  7.321   15.392 1.00 0.00 ? 449 GLU B CD   7  
ATOM 8692  O OE1  . GLU B 2 34 ? -1.471  8.448   14.905 1.00 0.00 ? 449 GLU B OE1  7  
ATOM 8693  O OE2  . GLU B 2 34 ? -1.734  6.929   16.471 1.00 0.00 ? 449 GLU B OE2  7  
ATOM 8694  H H    . GLU B 2 34 ? -1.163  3.825   14.862 1.00 0.00 ? 449 GLU B H    7  
ATOM 8695  H HA   . GLU B 2 34 ? -3.010  5.672   13.550 1.00 0.00 ? 449 GLU B HA   7  
ATOM 8696  H HB2  . GLU B 2 34 ? -0.138  5.392   12.767 1.00 0.00 ? 449 GLU B HB2  7  
ATOM 8697  H HB3  . GLU B 2 34 ? -1.165  6.819   12.742 1.00 0.00 ? 449 GLU B HB3  7  
ATOM 8698  H HG2  . GLU B 2 34 ? -0.140  5.512   15.250 1.00 0.00 ? 449 GLU B HG2  7  
ATOM 8699  H HG3  . GLU B 2 34 ? 0.617   6.892   14.456 1.00 0.00 ? 449 GLU B HG3  7  
ATOM 8700  N N    . GLU B 2 35 ? -2.878  3.037   12.291 1.00 0.00 ? 450 GLU B N    7  
ATOM 8701  C CA   . GLU B 2 35 ? -3.056  2.170   11.136 1.00 0.00 ? 450 GLU B CA   7  
ATOM 8702  C C    . GLU B 2 35 ? -4.402  1.451   11.178 1.00 0.00 ? 450 GLU B C    7  
ATOM 8703  O O    . GLU B 2 35 ? -4.965  1.224   12.248 1.00 0.00 ? 450 GLU B O    7  
ATOM 8704  C CB   . GLU B 2 35 ? -1.909  1.162   11.049 1.00 0.00 ? 450 GLU B CB   7  
ATOM 8705  C CG   . GLU B 2 35 ? -1.990  0.044   12.077 1.00 0.00 ? 450 GLU B CG   7  
ATOM 8706  C CD   . GLU B 2 35 ? -0.782  0.007   12.996 1.00 0.00 ? 450 GLU B CD   7  
ATOM 8707  O OE1  . GLU B 2 35 ? -0.353  1.088   13.453 1.00 0.00 ? 450 GLU B OE1  7  
ATOM 8708  O OE2  . GLU B 2 35 ? -0.268  -1.102  13.258 1.00 0.00 ? 450 GLU B OE2  7  
ATOM 8709  H H    . GLU B 2 35 ? -3.196  2.742   13.171 1.00 0.00 ? 450 GLU B H    7  
ATOM 8710  H HA   . GLU B 2 35 ? -3.032  2.796   10.259 1.00 0.00 ? 450 GLU B HA   7  
ATOM 8711  H HB2  . GLU B 2 35 ? -1.912  0.718   10.064 1.00 0.00 ? 450 GLU B HB2  7  
ATOM 8712  H HB3  . GLU B 2 35 ? -0.975  1.687   11.191 1.00 0.00 ? 450 GLU B HB3  7  
ATOM 8713  H HG2  . GLU B 2 35 ? -2.875  0.187   12.679 1.00 0.00 ? 450 GLU B HG2  7  
ATOM 8714  H HG3  . GLU B 2 35 ? -2.056  -0.901  11.558 1.00 0.00 ? 450 GLU B HG3  7  
ATOM 8715  N N    . TYR B 2 36 ? -4.910  1.100   10.000 1.00 0.00 ? 451 TYR B N    7  
ATOM 8716  C CA   . TYR B 2 36 ? -6.188  0.409   9.889  1.00 0.00 ? 451 TYR B CA   7  
ATOM 8717  C C    . TYR B 2 36 ? -6.096  -0.749  8.901  1.00 0.00 ? 451 TYR B C    7  
ATOM 8718  O O    . TYR B 2 36 ? -4.971  -1.240  8.667  1.00 0.00 ? 451 TYR B O    7  
ATOM 8719  C CB   . TYR B 2 36 ? -7.278  1.386   9.446  1.00 0.00 ? 451 TYR B CB   7  
ATOM 8720  C CG   . TYR B 2 36 ? -7.824  2.235   10.572 1.00 0.00 ? 451 TYR B CG   7  
ATOM 8721  C CD1  . TYR B 2 36 ? -7.161  3.382   10.988 1.00 0.00 ? 451 TYR B CD1  7  
ATOM 8722  C CD2  . TYR B 2 36 ? -9.005  1.889   11.218 1.00 0.00 ? 451 TYR B CD2  7  
ATOM 8723  C CE1  . TYR B 2 36 ? -7.657  4.159   12.018 1.00 0.00 ? 451 TYR B CE1  7  
ATOM 8724  C CE2  . TYR B 2 36 ? -9.507  2.660   12.248 1.00 0.00 ? 451 TYR B CE2  7  
ATOM 8725  C CZ   . TYR B 2 36 ? -8.829  3.794   12.644 1.00 0.00 ? 451 TYR B CZ   7  
ATOM 8726  O OH   . TYR B 2 36 ? -9.326  4.565   13.670 1.00 0.00 ? 451 TYR B OH   7  
ATOM 8727  O OXT  . TYR B 2 36 ? -7.151  -1.157  8.369  1.00 0.00 ? 451 TYR B OXT  7  
ATOM 8728  H H    . TYR B 2 36 ? -4.410  1.312   9.184  1.00 0.00 ? 451 TYR B H    7  
ATOM 8729  H HA   . TYR B 2 36 ? -6.441  0.018   10.862 1.00 0.00 ? 451 TYR B HA   7  
ATOM 8730  H HB2  . TYR B 2 36 ? -6.873  2.051   8.697  1.00 0.00 ? 451 TYR B HB2  7  
ATOM 8731  H HB3  . TYR B 2 36 ? -8.099  0.830   9.017  1.00 0.00 ? 451 TYR B HB3  7  
ATOM 8732  H HD1  . TYR B 2 36 ? -6.243  3.665   10.496 1.00 0.00 ? 451 TYR B HD1  7  
ATOM 8733  H HD2  . TYR B 2 36 ? -9.533  0.999   10.907 1.00 0.00 ? 451 TYR B HD2  7  
ATOM 8734  H HE1  . TYR B 2 36 ? -7.125  5.047   12.326 1.00 0.00 ? 451 TYR B HE1  7  
ATOM 8735  H HE2  . TYR B 2 36 ? -10.425 2.374   12.739 1.00 0.00 ? 451 TYR B HE2  7  
ATOM 8736  H HH   . TYR B 2 36 ? -8.771  4.462   14.446 1.00 0.00 ? 451 TYR B HH   7  
ATOM 8737  N N    . ARG A 1 8  ? 13.389  7.179   3.670  1.00 0.00 ? 210 ARG A N    8  
ATOM 8738  C CA   . ARG A 1 8  ? 12.302  8.093   3.998  1.00 0.00 ? 210 ARG A CA   8  
ATOM 8739  C C    . ARG A 1 8  ? 11.088  7.834   3.110  1.00 0.00 ? 210 ARG A C    8  
ATOM 8740  O O    . ARG A 1 8  ? 10.052  7.364   3.580  1.00 0.00 ? 210 ARG A O    8  
ATOM 8741  C CB   . ARG A 1 8  ? 12.764  9.543   3.842  1.00 0.00 ? 210 ARG A CB   8  
ATOM 8742  C CG   . ARG A 1 8  ? 12.253  10.466  4.938  1.00 0.00 ? 210 ARG A CG   8  
ATOM 8743  C CD   . ARG A 1 8  ? 13.253  10.593  6.077  1.00 0.00 ? 210 ARG A CD   8  
ATOM 8744  N NE   . ARG A 1 8  ? 13.630  11.983  6.323  1.00 0.00 ? 210 ARG A NE   8  
ATOM 8745  C CZ   . ARG A 1 8  ? 14.580  12.627  5.646  1.00 0.00 ? 210 ARG A CZ   8  
ATOM 8746  N NH1  . ARG A 1 8  ? 15.246  12.015  4.675  1.00 0.00 ? 210 ARG A NH1  8  
ATOM 8747  N NH2  . ARG A 1 8  ? 14.861  13.889  5.940  1.00 0.00 ? 210 ARG A NH2  8  
ATOM 8748  H HA   . ARG A 1 8  ? 12.023  7.922   5.027  1.00 0.00 ? 210 ARG A HA   8  
ATOM 8749  H HB2  . ARG A 1 8  ? 13.844  9.568   3.857  1.00 0.00 ? 210 ARG A HB2  8  
ATOM 8750  H HB3  . ARG A 1 8  ? 12.417  9.921   2.892  1.00 0.00 ? 210 ARG A HB3  8  
ATOM 8751  H HG2  . ARG A 1 8  ? 12.077  11.444  4.517  1.00 0.00 ? 210 ARG A HG2  8  
ATOM 8752  H HG3  . ARG A 1 8  ? 11.327  10.066  5.326  1.00 0.00 ? 210 ARG A HG3  8  
ATOM 8753  H HD2  . ARG A 1 8  ? 12.809  10.188  6.974  1.00 0.00 ? 210 ARG A HD2  8  
ATOM 8754  H HD3  . ARG A 1 8  ? 14.139  10.028  5.828  1.00 0.00 ? 210 ARG A HD3  8  
ATOM 8755  H HE   . ARG A 1 8  ? 13.151  12.462  7.031  1.00 0.00 ? 210 ARG A HE   8  
ATOM 8756  H HH11 . ARG A 1 8  ? 15.040  11.064  4.446  1.00 0.00 ? 210 ARG A HH11 8  
ATOM 8757  H HH12 . ARG A 1 8  ? 15.958  12.506  4.172  1.00 0.00 ? 210 ARG A HH12 8  
ATOM 8758  H HH21 . ARG A 1 8  ? 14.361  14.357  6.668  1.00 0.00 ? 210 ARG A HH21 8  
ATOM 8759  H HH22 . ARG A 1 8  ? 15.575  14.374  5.433  1.00 0.00 ? 210 ARG A HH22 8  
ATOM 8760  N N    . GLU A 1 9  ? 11.223  8.144   1.825  1.00 0.00 ? 211 GLU A N    8  
ATOM 8761  C CA   . GLU A 1 9  ? 10.137  7.944   0.872  1.00 0.00 ? 211 GLU A CA   8  
ATOM 8762  C C    . GLU A 1 9  ? 9.947   6.462   0.569  1.00 0.00 ? 211 GLU A C    8  
ATOM 8763  O O    . GLU A 1 9  ? 10.908  5.690   0.568  1.00 0.00 ? 211 GLU A O    8  
ATOM 8764  C CB   . GLU A 1 9  ? 10.417  8.710   -0.422 1.00 0.00 ? 211 GLU A CB   8  
ATOM 8765  C CG   . GLU A 1 9  ? 9.183   8.915   -1.286 1.00 0.00 ? 211 GLU A CG   8  
ATOM 8766  C CD   . GLU A 1 9  ? 9.188   10.251  -2.003 1.00 0.00 ? 211 GLU A CD   8  
ATOM 8767  O OE1  . GLU A 1 9  ? 10.274  10.684  -2.445 1.00 0.00 ? 211 GLU A OE1  8  
ATOM 8768  O OE2  . GLU A 1 9  ? 8.107   10.867  -2.120 1.00 0.00 ? 211 GLU A OE2  8  
ATOM 8769  H H    . GLU A 1 9  ? 12.074  8.516   1.510  1.00 0.00 ? 211 GLU A H    8  
ATOM 8770  H HA   . GLU A 1 9  ? 9.232   8.327   1.317  1.00 0.00 ? 211 GLU A HA   8  
ATOM 8771  H HB2  . GLU A 1 9  ? 10.821  9.680   -0.173 1.00 0.00 ? 211 GLU A HB2  8  
ATOM 8772  H HB3  . GLU A 1 9  ? 11.147  8.164   -0.999 1.00 0.00 ? 211 GLU A HB3  8  
ATOM 8773  H HG2  . GLU A 1 9  ? 9.143   8.129   -2.025 1.00 0.00 ? 211 GLU A HG2  8  
ATOM 8774  H HG3  . GLU A 1 9  ? 8.307   8.862   -0.657 1.00 0.00 ? 211 GLU A HG3  8  
ATOM 8775  N N    . LEU A 1 10 ? 8.704   6.069   0.312  1.00 0.00 ? 212 LEU A N    8  
ATOM 8776  C CA   . LEU A 1 10 ? 8.389   4.678   0.008  1.00 0.00 ? 212 LEU A CA   8  
ATOM 8777  C C    . LEU A 1 10 ? 7.842   4.539   -1.410 1.00 0.00 ? 212 LEU A C    8  
ATOM 8778  O O    . LEU A 1 10 ? 7.127   5.414   -1.898 1.00 0.00 ? 212 LEU A O    8  
ATOM 8779  C CB   . LEU A 1 10 ? 7.374   4.132   1.013  1.00 0.00 ? 212 LEU A CB   8  
ATOM 8780  C CG   . LEU A 1 10 ? 7.907   3.944   2.435  1.00 0.00 ? 212 LEU A CG   8  
ATOM 8781  C CD1  . LEU A 1 10 ? 6.778   3.564   3.381  1.00 0.00 ? 212 LEU A CD1  8  
ATOM 8782  C CD2  . LEU A 1 10 ? 9.002   2.888   2.457  1.00 0.00 ? 212 LEU A CD2  8  
ATOM 8783  H H    . LEU A 1 10 ? 7.981   6.730   0.329  1.00 0.00 ? 212 LEU A H    8  
ATOM 8784  H HA   . LEU A 1 10 ? 9.303   4.106   0.085  1.00 0.00 ? 212 LEU A HA   8  
ATOM 8785  H HB2  . LEU A 1 10 ? 6.535   4.814   1.052  1.00 0.00 ? 212 LEU A HB2  8  
ATOM 8786  H HB3  . LEU A 1 10 ? 7.023   3.176   0.655  1.00 0.00 ? 212 LEU A HB3  8  
ATOM 8787  H HG   . LEU A 1 10 ? 8.331   4.876   2.779  1.00 0.00 ? 212 LEU A HG   8  
ATOM 8788  H HD11 . LEU A 1 10 ? 6.101   2.889   2.880  1.00 0.00 ? 212 LEU A HD11 8  
ATOM 8789  H HD12 . LEU A 1 10 ? 7.190   3.080   4.255  1.00 0.00 ? 212 LEU A HD12 8  
ATOM 8790  H HD13 . LEU A 1 10 ? 6.245   4.454   3.679  1.00 0.00 ? 212 LEU A HD13 8  
ATOM 8791  H HD21 . LEU A 1 10 ? 9.115   2.508   3.460  1.00 0.00 ? 212 LEU A HD21 8  
ATOM 8792  H HD22 . LEU A 1 10 ? 8.736   2.079   1.793  1.00 0.00 ? 212 LEU A HD22 8  
ATOM 8793  H HD23 . LEU A 1 10 ? 9.933   3.329   2.131  1.00 0.00 ? 212 LEU A HD23 8  
ATOM 8794  N N    . LYS A 1 11 ? 8.183   3.433   -2.063 1.00 0.00 ? 213 LYS A N    8  
ATOM 8795  C CA   . LYS A 1 11 ? 7.725   3.177   -3.423 1.00 0.00 ? 213 LYS A CA   8  
ATOM 8796  C C    . LYS A 1 11 ? 6.829   1.944   -3.470 1.00 0.00 ? 213 LYS A C    8  
ATOM 8797  O O    . LYS A 1 11 ? 7.052   0.974   -2.744 1.00 0.00 ? 213 LYS A O    8  
ATOM 8798  C CB   . LYS A 1 11 ? 8.921   2.988   -4.359 1.00 0.00 ? 213 LYS A CB   8  
ATOM 8799  C CG   . LYS A 1 11 ? 9.933   4.121   -4.289 1.00 0.00 ? 213 LYS A CG   8  
ATOM 8800  C CD   . LYS A 1 11 ? 11.162  3.725   -3.486 1.00 0.00 ? 213 LYS A CD   8  
ATOM 8801  C CE   . LYS A 1 11 ? 11.137  4.326   -2.089 1.00 0.00 ? 213 LYS A CE   8  
ATOM 8802  N NZ   . LYS A 1 11 ? 12.328  5.179   -1.829 1.00 0.00 ? 213 LYS A NZ   8  
ATOM 8803  H H    . LYS A 1 11 ? 8.754   2.773   -1.619 1.00 0.00 ? 213 LYS A H    8  
ATOM 8804  H HA   . LYS A 1 11 ? 7.155   4.034   -3.749 1.00 0.00 ? 213 LYS A HA   8  
ATOM 8805  H HB2  . LYS A 1 11 ? 9.423   2.067   -4.101 1.00 0.00 ? 213 LYS A HB2  8  
ATOM 8806  H HB3  . LYS A 1 11 ? 8.560   2.918   -5.375 1.00 0.00 ? 213 LYS A HB3  8  
ATOM 8807  H HG2  . LYS A 1 11 ? 10.240  4.379   -5.292 1.00 0.00 ? 213 LYS A HG2  8  
ATOM 8808  H HG3  . LYS A 1 11 ? 9.468   4.977   -3.822 1.00 0.00 ? 213 LYS A HG3  8  
ATOM 8809  H HD2  . LYS A 1 11 ? 11.195  2.649   -3.403 1.00 0.00 ? 213 LYS A HD2  8  
ATOM 8810  H HD3  . LYS A 1 11 ? 12.046  4.074   -4.001 1.00 0.00 ? 213 LYS A HD3  8  
ATOM 8811  H HE2  . LYS A 1 11 ? 10.246  4.926   -1.983 1.00 0.00 ? 213 LYS A HE2  8  
ATOM 8812  H HE3  . LYS A 1 11 ? 11.116  3.522   -1.366 1.00 0.00 ? 213 LYS A HE3  8  
ATOM 8813  H HZ1  . LYS A 1 11 ? 12.267  6.057   -2.384 1.00 0.00 ? 213 LYS A HZ1  8  
ATOM 8814  H HZ2  . LYS A 1 11 ? 13.196  4.672   -2.097 1.00 0.00 ? 213 LYS A HZ2  8  
ATOM 8815  H HZ3  . LYS A 1 11 ? 12.380  5.423   -0.820 1.00 0.00 ? 213 LYS A HZ3  8  
ATOM 8816  N N    . ILE A 1 12 ? 5.815   1.987   -4.327 1.00 0.00 ? 214 ILE A N    8  
ATOM 8817  C CA   . ILE A 1 12 ? 4.886   0.873   -4.468 1.00 0.00 ? 214 ILE A CA   8  
ATOM 8818  C C    . ILE A 1 12 ? 5.610   -0.392  -4.919 1.00 0.00 ? 214 ILE A C    8  
ATOM 8819  O O    . ILE A 1 12 ? 6.461   -0.347  -5.808 1.00 0.00 ? 214 ILE A O    8  
ATOM 8820  C CB   . ILE A 1 12 ? 3.761   1.198   -5.468 1.00 0.00 ? 214 ILE A CB   8  
ATOM 8821  C CG1  . ILE A 1 12 ? 3.085   2.520   -5.095 1.00 0.00 ? 214 ILE A CG1  8  
ATOM 8822  C CG2  . ILE A 1 12 ? 2.740   0.067   -5.507 1.00 0.00 ? 214 ILE A CG2  8  
ATOM 8823  C CD1  . ILE A 1 12 ? 1.922   2.882   -5.992 1.00 0.00 ? 214 ILE A CD1  8  
ATOM 8824  H H    . ILE A 1 12 ? 5.689   2.786   -4.879 1.00 0.00 ? 214 ILE A H    8  
ATOM 8825  H HA   . ILE A 1 12 ? 4.438   0.690   -3.500 1.00 0.00 ? 214 ILE A HA   8  
ATOM 8826  H HB   . ILE A 1 12 ? 4.197   1.290   -6.451 1.00 0.00 ? 214 ILE A HB   8  
ATOM 8827  H HG12 . ILE A 1 12 ? 2.713   2.454   -4.083 1.00 0.00 ? 214 ILE A HG12 8  
ATOM 8828  H HG13 . ILE A 1 12 ? 3.811   3.317   -5.155 1.00 0.00 ? 214 ILE A HG13 8  
ATOM 8829  H HG21 . ILE A 1 12 ? 2.019   0.261   -6.288 1.00 0.00 ? 214 ILE A HG21 8  
ATOM 8830  H HG22 . ILE A 1 12 ? 3.246   -0.866  -5.708 1.00 0.00 ? 214 ILE A HG22 8  
ATOM 8831  H HG23 . ILE A 1 12 ? 2.234   0.006   -4.555 1.00 0.00 ? 214 ILE A HG23 8  
ATOM 8832  H HD11 . ILE A 1 12 ? 1.003   2.523   -5.552 1.00 0.00 ? 214 ILE A HD11 8  
ATOM 8833  H HD12 . ILE A 1 12 ? 1.873   3.956   -6.102 1.00 0.00 ? 214 ILE A HD12 8  
ATOM 8834  H HD13 . ILE A 1 12 ? 2.059   2.426   -6.961 1.00 0.00 ? 214 ILE A HD13 8  
ATOM 8835  N N    . GLY A 1 13 ? 5.270   -1.516  -4.297 1.00 0.00 ? 215 GLY A N    8  
ATOM 8836  C CA   . GLY A 1 13 ? 5.899   -2.776  -4.645 1.00 0.00 ? 215 GLY A CA   8  
ATOM 8837  C C    . GLY A 1 13 ? 7.124   -3.072  -3.798 1.00 0.00 ? 215 GLY A C    8  
ATOM 8838  O O    . GLY A 1 13 ? 7.751   -4.120  -3.952 1.00 0.00 ? 215 GLY A O    8  
ATOM 8839  H H    . GLY A 1 13 ? 4.588   -1.488  -3.596 1.00 0.00 ? 215 GLY A H    8  
ATOM 8840  H HA2  . GLY A 1 13 ? 5.182   -3.572  -4.509 1.00 0.00 ? 215 GLY A HA2  8  
ATOM 8841  H HA3  . GLY A 1 13 ? 6.192   -2.745  -5.683 1.00 0.00 ? 215 GLY A HA3  8  
ATOM 8842  N N    . ASP A 1 14 ? 7.468   -2.148  -2.903 1.00 0.00 ? 216 ASP A N    8  
ATOM 8843  C CA   . ASP A 1 14 ? 8.627   -2.321  -2.036 1.00 0.00 ? 216 ASP A CA   8  
ATOM 8844  C C    . ASP A 1 14 ? 8.225   -2.928  -0.696 1.00 0.00 ? 216 ASP A C    8  
ATOM 8845  O O    . ASP A 1 14 ? 7.134   -2.668  -0.187 1.00 0.00 ? 216 ASP A O    8  
ATOM 8846  C CB   . ASP A 1 14 ? 9.327   -0.981  -1.812 1.00 0.00 ? 216 ASP A CB   8  
ATOM 8847  C CG   . ASP A 1 14 ? 10.083  -0.511  -3.040 1.00 0.00 ? 216 ASP A CG   8  
ATOM 8848  O OD1  . ASP A 1 14 ? 9.677   -0.878  -4.162 1.00 0.00 ? 216 ASP A OD1  8  
ATOM 8849  O OD2  . ASP A 1 14 ? 11.080  0.223   -2.879 1.00 0.00 ? 216 ASP A OD2  8  
ATOM 8850  H H    . ASP A 1 14 ? 6.933   -1.332  -2.825 1.00 0.00 ? 216 ASP A H    8  
ATOM 8851  H HA   . ASP A 1 14 ? 9.309   -2.995  -2.529 1.00 0.00 ? 216 ASP A HA   8  
ATOM 8852  H HB2  . ASP A 1 14 ? 8.590   -0.234  -1.559 1.00 0.00 ? 216 ASP A HB2  8  
ATOM 8853  H HB3  . ASP A 1 14 ? 10.028  -1.079  -0.996 1.00 0.00 ? 216 ASP A HB3  8  
ATOM 8854  N N    . ARG A 1 15 ? 9.118   -3.731  -0.127 1.00 0.00 ? 217 ARG A N    8  
ATOM 8855  C CA   . ARG A 1 15 ? 8.860   -4.370  1.158  1.00 0.00 ? 217 ARG A CA   8  
ATOM 8856  C C    . ARG A 1 15 ? 9.038   -3.373  2.295  1.00 0.00 ? 217 ARG A C    8  
ATOM 8857  O O    . ARG A 1 15 ? 10.012  -2.622  2.330  1.00 0.00 ? 217 ARG A O    8  
ATOM 8858  C CB   . ARG A 1 15 ? 9.798   -5.562  1.357  1.00 0.00 ? 217 ARG A CB   8  
ATOM 8859  C CG   . ARG A 1 15 ? 9.166   -6.715  2.121  1.00 0.00 ? 217 ARG A CG   8  
ATOM 8860  C CD   . ARG A 1 15 ? 8.254   -7.540  1.227  1.00 0.00 ? 217 ARG A CD   8  
ATOM 8861  N NE   . ARG A 1 15 ? 8.938   -8.711  0.680  1.00 0.00 ? 217 ARG A NE   8  
ATOM 8862  C CZ   . ARG A 1 15 ? 8.314   -9.704  0.047  1.00 0.00 ? 217 ARG A CZ   8  
ATOM 8863  N NH1  . ARG A 1 15 ? 6.998   -9.672  -0.118 1.00 0.00 ? 217 ARG A NH1  8  
ATOM 8864  N NH2  . ARG A 1 15 ? 9.010   -10.730 -0.422 1.00 0.00 ? 217 ARG A NH2  8  
ATOM 8865  H H    . ARG A 1 15 ? 9.970   -3.895  -0.579 1.00 0.00 ? 217 ARG A H    8  
ATOM 8866  H HA   . ARG A 1 15 ? 7.839   -4.719  1.159  1.00 0.00 ? 217 ARG A HA   8  
ATOM 8867  H HB2  . ARG A 1 15 ? 10.109  -5.927  0.390  1.00 0.00 ? 217 ARG A HB2  8  
ATOM 8868  H HB3  . ARG A 1 15 ? 10.670  -5.233  1.905  1.00 0.00 ? 217 ARG A HB3  8  
ATOM 8869  H HG2  . ARG A 1 15 ? 9.949   -7.351  2.504  1.00 0.00 ? 217 ARG A HG2  8  
ATOM 8870  H HG3  . ARG A 1 15 ? 8.587   -6.316  2.941  1.00 0.00 ? 217 ARG A HG3  8  
ATOM 8871  H HD2  . ARG A 1 15 ? 7.405   -7.870  1.806  1.00 0.00 ? 217 ARG A HD2  8  
ATOM 8872  H HD3  . ARG A 1 15 ? 7.914   -6.920  0.411  1.00 0.00 ? 217 ARG A HD3  8  
ATOM 8873  H HE   . ARG A 1 15 ? 9.910   -8.759  0.788  1.00 0.00 ? 217 ARG A HE   8  
ATOM 8874  H HH11 . ARG A 1 15 ? 6.467   -8.900  0.234  1.00 0.00 ? 217 ARG A HH11 8  
ATOM 8875  H HH12 . ARG A 1 15 ? 6.536   -10.421 -0.594 1.00 0.00 ? 217 ARG A HH12 8  
ATOM 8876  H HH21 . ARG A 1 15 ? 10.002  -10.759 -0.300 1.00 0.00 ? 217 ARG A HH21 8  
ATOM 8877  H HH22 . ARG A 1 15 ? 8.542   -11.475 -0.896 1.00 0.00 ? 217 ARG A HH22 8  
ATOM 8878  N N    . VAL A 1 16 ? 8.086   -3.363  3.220  1.00 0.00 ? 218 VAL A N    8  
ATOM 8879  C CA   . VAL A 1 16 ? 8.134   -2.448  4.351  1.00 0.00 ? 218 VAL A CA   8  
ATOM 8880  C C    . VAL A 1 16 ? 7.383   -3.006  5.552  1.00 0.00 ? 218 VAL A C    8  
ATOM 8881  O O    . VAL A 1 16 ? 6.876   -4.128  5.519  1.00 0.00 ? 218 VAL A O    8  
ATOM 8882  C CB   . VAL A 1 16 ? 7.528   -1.080  3.983  1.00 0.00 ? 218 VAL A CB   8  
ATOM 8883  C CG1  . VAL A 1 16 ? 8.144   -0.546  2.700  1.00 0.00 ? 218 VAL A CG1  8  
ATOM 8884  C CG2  . VAL A 1 16 ? 6.011   -1.183  3.853  1.00 0.00 ? 218 VAL A CG2  8  
ATOM 8885  H H    . VAL A 1 16 ? 7.330   -3.981  3.134  1.00 0.00 ? 218 VAL A H    8  
ATOM 8886  H HA   . VAL A 1 16 ? 9.171   -2.300  4.619  1.00 0.00 ? 218 VAL A HA   8  
ATOM 8887  H HB   . VAL A 1 16 ? 7.751   -0.385  4.780  1.00 0.00 ? 218 VAL A HB   8  
ATOM 8888  H HG11 . VAL A 1 16 ? 9.219   -0.547  2.789  1.00 0.00 ? 218 VAL A HG11 8  
ATOM 8889  H HG12 . VAL A 1 16 ? 7.852   -1.173  1.871  1.00 0.00 ? 218 VAL A HG12 8  
ATOM 8890  H HG13 . VAL A 1 16 ? 7.798   0.463   2.527  1.00 0.00 ? 218 VAL A HG13 8  
ATOM 8891  H HG21 . VAL A 1 16 ? 5.631   -0.305  3.354  1.00 0.00 ? 218 VAL A HG21 8  
ATOM 8892  H HG22 . VAL A 1 16 ? 5.757   -2.063  3.281  1.00 0.00 ? 218 VAL A HG22 8  
ATOM 8893  H HG23 . VAL A 1 16 ? 5.571   -1.257  4.839  1.00 0.00 ? 218 VAL A HG23 8  
ATOM 8894  N N    . LEU A 1 17 ? 7.299   -2.202  6.605  1.00 0.00 ? 219 LEU A N    8  
ATOM 8895  C CA   . LEU A 1 17 ? 6.591   -2.593  7.815  1.00 0.00 ? 219 LEU A CA   8  
ATOM 8896  C C    . LEU A 1 17 ? 5.518   -1.569  8.149  1.00 0.00 ? 219 LEU A C    8  
ATOM 8897  O O    . LEU A 1 17 ? 5.816   -0.395  8.353  1.00 0.00 ? 219 LEU A O    8  
ATOM 8898  C CB   . LEU A 1 17 ? 7.555   -2.719  8.995  1.00 0.00 ? 219 LEU A CB   8  
ATOM 8899  C CG   . LEU A 1 17 ? 8.648   -3.779  8.846  1.00 0.00 ? 219 LEU A CG   8  
ATOM 8900  C CD1  . LEU A 1 17 ? 9.377   -3.970  10.166 1.00 0.00 ? 219 LEU A CD1  8  
ATOM 8901  C CD2  . LEU A 1 17 ? 8.057   -5.093  8.363  1.00 0.00 ? 219 LEU A CD2  8  
ATOM 8902  H H    . LEU A 1 17 ? 7.711   -1.314  6.560  1.00 0.00 ? 219 LEU A H    8  
ATOM 8903  H HA   . LEU A 1 17 ? 6.123   -3.547  7.634  1.00 0.00 ? 219 LEU A HA   8  
ATOM 8904  H HB2  . LEU A 1 17 ? 8.030   -1.761  9.146  1.00 0.00 ? 219 LEU A HB2  8  
ATOM 8905  H HB3  . LEU A 1 17 ? 6.974   -2.956  9.875  1.00 0.00 ? 219 LEU A HB3  8  
ATOM 8906  H HG   . LEU A 1 17 ? 9.367   -3.441  8.114  1.00 0.00 ? 219 LEU A HG   8  
ATOM 8907  H HD11 . LEU A 1 17 ? 9.289   -3.071  10.761 1.00 0.00 ? 219 LEU A HD11 8  
ATOM 8908  H HD12 . LEU A 1 17 ? 8.937   -4.799  10.702 1.00 0.00 ? 219 LEU A HD12 8  
ATOM 8909  H HD13 . LEU A 1 17 ? 10.419  -4.177  9.977  1.00 0.00 ? 219 LEU A HD13 8  
ATOM 8910  H HD21 . LEU A 1 17 ? 8.769   -5.890  8.526  1.00 0.00 ? 219 LEU A HD21 8  
ATOM 8911  H HD22 . LEU A 1 17 ? 7.150   -5.304  8.909  1.00 0.00 ? 219 LEU A HD22 8  
ATOM 8912  H HD23 . LEU A 1 17 ? 7.833   -5.023  7.308  1.00 0.00 ? 219 LEU A HD23 8  
ATOM 8913  N N    . VAL A 1 18 ? 4.275   -2.017  8.218  1.00 0.00 ? 220 VAL A N    8  
ATOM 8914  C CA   . VAL A 1 18 ? 3.169   -1.124  8.542  1.00 0.00 ? 220 VAL A CA   8  
ATOM 8915  C C    . VAL A 1 18 ? 2.977   -1.054  10.053 1.00 0.00 ? 220 VAL A C    8  
ATOM 8916  O O    . VAL A 1 18 ? 2.578   -2.032  10.687 1.00 0.00 ? 220 VAL A O    8  
ATOM 8917  C CB   . VAL A 1 18 ? 1.841   -1.551  7.867  1.00 0.00 ? 220 VAL A CB   8  
ATOM 8918  C CG1  . VAL A 1 18 ? 1.298   -0.427  6.999  1.00 0.00 ? 220 VAL A CG1  8  
ATOM 8919  C CG2  . VAL A 1 18 ? 2.021   -2.822  7.047  1.00 0.00 ? 220 VAL A CG2  8  
ATOM 8920  H H    . VAL A 1 18 ? 4.099   -2.967  8.058  1.00 0.00 ? 220 VAL A H    8  
ATOM 8921  H HA   . VAL A 1 18 ? 3.430   -0.138  8.183  1.00 0.00 ? 220 VAL A HA   8  
ATOM 8922  H HB   . VAL A 1 18 ? 1.117   -1.751  8.640  1.00 0.00 ? 220 VAL A HB   8  
ATOM 8923  H HG11 . VAL A 1 18 ? 0.907   -0.837  6.079  1.00 0.00 ? 220 VAL A HG11 8  
ATOM 8924  H HG12 . VAL A 1 18 ? 0.507   0.087   7.528  1.00 0.00 ? 220 VAL A HG12 8  
ATOM 8925  H HG13 . VAL A 1 18 ? 2.092   0.270   6.773  1.00 0.00 ? 220 VAL A HG13 8  
ATOM 8926  H HG21 . VAL A 1 18 ? 2.234   -3.650  7.708  1.00 0.00 ? 220 VAL A HG21 8  
ATOM 8927  H HG22 . VAL A 1 18 ? 1.115   -3.026  6.495  1.00 0.00 ? 220 VAL A HG22 8  
ATOM 8928  H HG23 . VAL A 1 18 ? 2.842   -2.692  6.357  1.00 0.00 ? 220 VAL A HG23 8  
ATOM 8929  N N    . GLY A 1 19 ? 3.279   0.108   10.625 1.00 0.00 ? 221 GLY A N    8  
ATOM 8930  C CA   . GLY A 1 19 ? 3.149   0.287   12.058 1.00 0.00 ? 221 GLY A CA   8  
ATOM 8931  C C    . GLY A 1 19 ? 4.395   -0.143  12.814 1.00 0.00 ? 221 GLY A C    8  
ATOM 8932  O O    . GLY A 1 19 ? 4.490   0.057   14.025 1.00 0.00 ? 221 GLY A O    8  
ATOM 8933  H H    . GLY A 1 19 ? 3.601   0.846   10.067 1.00 0.00 ? 221 GLY A H    8  
ATOM 8934  H HA2  . GLY A 1 19 ? 2.960   1.331   12.262 1.00 0.00 ? 221 GLY A HA2  8  
ATOM 8935  H HA3  . GLY A 1 19 ? 2.310   -0.295  12.407 1.00 0.00 ? 221 GLY A HA3  8  
ATOM 8936  N N    . GLY A 1 20 ? 5.354   -0.735  12.102 1.00 0.00 ? 222 GLY A N    8  
ATOM 8937  C CA   . GLY A 1 20 ? 6.582   -1.184  12.733 1.00 0.00 ? 222 GLY A CA   8  
ATOM 8938  C C    . GLY A 1 20 ? 6.501   -2.616  13.222 1.00 0.00 ? 222 GLY A C    8  
ATOM 8939  O O    . GLY A 1 20 ? 7.519   -3.298  13.341 1.00 0.00 ? 222 GLY A O    8  
ATOM 8940  H H    . GLY A 1 20 ? 5.226   -0.869  11.140 1.00 0.00 ? 222 GLY A H    8  
ATOM 8941  H HA2  . GLY A 1 20 ? 7.388   -1.107  12.020 1.00 0.00 ? 222 GLY A HA2  8  
ATOM 8942  H HA3  . GLY A 1 20 ? 6.800   -0.541  13.573 1.00 0.00 ? 222 GLY A HA3  8  
ATOM 8943  N N    . THR A 1 21 ? 5.288   -3.073  13.511 1.00 0.00 ? 223 THR A N    8  
ATOM 8944  C CA   . THR A 1 21 ? 5.076   -4.431  13.992 1.00 0.00 ? 223 THR A CA   8  
ATOM 8945  C C    . THR A 1 21 ? 4.596   -5.339  12.867 1.00 0.00 ? 223 THR A C    8  
ATOM 8946  O O    . THR A 1 21 ? 4.824   -6.548  12.890 1.00 0.00 ? 223 THR A O    8  
ATOM 8947  C CB   . THR A 1 21 ? 4.057   -4.428  15.131 1.00 0.00 ? 223 THR A CB   8  
ATOM 8948  O OG1  . THR A 1 21 ? 2.896   -3.707  14.762 1.00 0.00 ? 223 THR A OG1  8  
ATOM 8949  C CG2  . THR A 1 21 ? 4.594   -3.817  16.405 1.00 0.00 ? 223 THR A CG2  8  
ATOM 8950  H H    . THR A 1 21 ? 4.515   -2.483  13.398 1.00 0.00 ? 223 THR A H    8  
ATOM 8951  H HA   . THR A 1 21 ? 6.019   -4.804  14.364 1.00 0.00 ? 223 THR A HA   8  
ATOM 8952  H HB   . THR A 1 21 ? 3.768   -5.448  15.344 1.00 0.00 ? 223 THR A HB   8  
ATOM 8953  H HG1  . THR A 1 21 ? 2.138   -4.294  14.763 1.00 0.00 ? 223 THR A HG1  8  
ATOM 8954  H HG21 . THR A 1 21 ? 5.605   -4.160  16.570 1.00 0.00 ? 223 THR A HG21 8  
ATOM 8955  H HG22 . THR A 1 21 ? 3.972   -4.113  17.236 1.00 0.00 ? 223 THR A HG22 8  
ATOM 8956  H HG23 . THR A 1 21 ? 4.589   -2.740  16.317 1.00 0.00 ? 223 THR A HG23 8  
ATOM 8957  N N    . LYS A 1 22 ? 3.926   -4.747  11.884 1.00 0.00 ? 224 LYS A N    8  
ATOM 8958  C CA   . LYS A 1 22 ? 3.408   -5.502  10.751 1.00 0.00 ? 224 LYS A CA   8  
ATOM 8959  C C    . LYS A 1 22 ? 4.334   -5.362  9.547  1.00 0.00 ? 224 LYS A C    8  
ATOM 8960  O O    . LYS A 1 22 ? 4.958   -4.320  9.353  1.00 0.00 ? 224 LYS A O    8  
ATOM 8961  C CB   . LYS A 1 22 ? 1.999   -5.019  10.386 1.00 0.00 ? 224 LYS A CB   8  
ATOM 8962  C CG   . LYS A 1 22 ? 1.170   -4.566  11.582 1.00 0.00 ? 224 LYS A CG   8  
ATOM 8963  C CD   . LYS A 1 22 ? 0.461   -5.735  12.247 1.00 0.00 ? 224 LYS A CD   8  
ATOM 8964  C CE   . LYS A 1 22 ? 1.449   -6.721  12.847 1.00 0.00 ? 224 LYS A CE   8  
ATOM 8965  N NZ   . LYS A 1 22 ? 0.850   -7.495  13.970 1.00 0.00 ? 224 LYS A NZ   8  
ATOM 8966  H H    . LYS A 1 22 ? 3.774   -3.780  11.923 1.00 0.00 ? 224 LYS A H    8  
ATOM 8967  H HA   . LYS A 1 22 ? 3.361   -6.542  11.037 1.00 0.00 ? 224 LYS A HA   8  
ATOM 8968  H HB2  . LYS A 1 22 ? 2.085   -4.188  9.704  1.00 0.00 ? 224 LYS A HB2  8  
ATOM 8969  H HB3  . LYS A 1 22 ? 1.474   -5.823  9.894  1.00 0.00 ? 224 LYS A HB3  8  
ATOM 8970  H HG2  . LYS A 1 22 ? 1.819   -4.096  12.304 1.00 0.00 ? 224 LYS A HG2  8  
ATOM 8971  H HG3  . LYS A 1 22 ? 0.432   -3.855  11.245 1.00 0.00 ? 224 LYS A HG3  8  
ATOM 8972  H HD2  . LYS A 1 22 ? -0.176  -5.357  13.033 1.00 0.00 ? 224 LYS A HD2  8  
ATOM 8973  H HD3  . LYS A 1 22 ? -0.141  -6.243  11.510 1.00 0.00 ? 224 LYS A HD3  8  
ATOM 8974  H HE2  . LYS A 1 22 ? 1.765   -7.410  12.076 1.00 0.00 ? 224 LYS A HE2  8  
ATOM 8975  H HE3  . LYS A 1 22 ? 2.305   -6.175  13.212 1.00 0.00 ? 224 LYS A HE3  8  
ATOM 8976  H HZ1  . LYS A 1 22 ? 1.567   -8.113  14.400 1.00 0.00 ? 224 LYS A HZ1  8  
ATOM 8977  H HZ2  . LYS A 1 22 ? 0.065   -8.082  13.620 1.00 0.00 ? 224 LYS A HZ2  8  
ATOM 8978  H HZ3  . LYS A 1 22 ? 0.487   -6.846  14.697 1.00 0.00 ? 224 LYS A HZ3  8  
ATOM 8979  N N    . ALA A 1 23 ? 4.422   -6.415  8.742  1.00 0.00 ? 225 ALA A N    8  
ATOM 8980  C CA   . ALA A 1 23 ? 5.274   -6.401  7.558  1.00 0.00 ? 225 ALA A CA   8  
ATOM 8981  C C    . ALA A 1 23 ? 4.459   -6.640  6.296  1.00 0.00 ? 225 ALA A C    8  
ATOM 8982  O O    . ALA A 1 23 ? 3.538   -7.455  6.288  1.00 0.00 ? 225 ALA A O    8  
ATOM 8983  C CB   . ALA A 1 23 ? 6.370   -7.446  7.675  1.00 0.00 ? 225 ALA A CB   8  
ATOM 8984  H H    . ALA A 1 23 ? 3.903   -7.220  8.948  1.00 0.00 ? 225 ALA A H    8  
ATOM 8985  H HA   . ALA A 1 23 ? 5.740   -5.429  7.493  1.00 0.00 ? 225 ALA A HA   8  
ATOM 8986  H HB1  . ALA A 1 23 ? 7.062   -7.333  6.854  1.00 0.00 ? 225 ALA A HB1  8  
ATOM 8987  H HB2  . ALA A 1 23 ? 6.895   -7.313  8.609  1.00 0.00 ? 225 ALA A HB2  8  
ATOM 8988  H HB3  . ALA A 1 23 ? 5.932   -8.431  7.644  1.00 0.00 ? 225 ALA A HB3  8  
ATOM 8989  N N    . GLY A 1 24 ? 4.805   -5.929  5.229  1.00 0.00 ? 226 GLY A N    8  
ATOM 8990  C CA   . GLY A 1 24 ? 4.090   -6.086  3.980  1.00 0.00 ? 226 GLY A CA   8  
ATOM 8991  C C    . GLY A 1 24 ? 4.747   -5.350  2.829  1.00 0.00 ? 226 GLY A C    8  
ATOM 8992  O O    . GLY A 1 24 ? 5.894   -4.915  2.931  1.00 0.00 ? 226 GLY A O    8  
ATOM 8993  H H    . GLY A 1 24 ? 5.548   -5.294  5.292  1.00 0.00 ? 226 GLY A H    8  
ATOM 8994  H HA2  . GLY A 1 24 ? 4.038   -7.136  3.737  1.00 0.00 ? 226 GLY A HA2  8  
ATOM 8995  H HA3  . GLY A 1 24 ? 3.086   -5.708  4.105  1.00 0.00 ? 226 GLY A HA3  8  
ATOM 8996  N N    . VAL A 1 25 ? 4.013   -5.215  1.729  1.00 0.00 ? 227 VAL A N    8  
ATOM 8997  C CA   . VAL A 1 25 ? 4.519   -4.531  0.546  1.00 0.00 ? 227 VAL A CA   8  
ATOM 8998  C C    . VAL A 1 25 ? 3.643   -3.335  0.190  1.00 0.00 ? 227 VAL A C    8  
ATOM 8999  O O    . VAL A 1 25 ? 2.419   -3.440  0.150  1.00 0.00 ? 227 VAL A O    8  
ATOM 9000  C CB   . VAL A 1 25 ? 4.585   -5.488  -0.665 1.00 0.00 ? 227 VAL A CB   8  
ATOM 9001  C CG1  . VAL A 1 25 ? 4.944   -4.733  -1.936 1.00 0.00 ? 227 VAL A CG1  8  
ATOM 9002  C CG2  . VAL A 1 25 ? 5.580   -6.608  -0.403 1.00 0.00 ? 227 VAL A CG2  8  
ATOM 9003  H H    . VAL A 1 25 ? 3.107   -5.586  1.712  1.00 0.00 ? 227 VAL A H    8  
ATOM 9004  H HA   . VAL A 1 25 ? 5.521   -4.185  0.761  1.00 0.00 ? 227 VAL A HA   8  
ATOM 9005  H HB   . VAL A 1 25 ? 3.609   -5.929  -0.800 1.00 0.00 ? 227 VAL A HB   8  
ATOM 9006  H HG11 . VAL A 1 25 ? 4.074   -4.197  -2.293 1.00 0.00 ? 227 VAL A HG11 8  
ATOM 9007  H HG12 . VAL A 1 25 ? 5.737   -4.031  -1.728 1.00 0.00 ? 227 VAL A HG12 8  
ATOM 9008  H HG13 . VAL A 1 25 ? 5.270   -5.433  -2.691 1.00 0.00 ? 227 VAL A HG13 8  
ATOM 9009  H HG21 . VAL A 1 25 ? 5.757   -6.693  0.659  1.00 0.00 ? 227 VAL A HG21 8  
ATOM 9010  H HG22 . VAL A 1 25 ? 5.181   -7.539  -0.778 1.00 0.00 ? 227 VAL A HG22 8  
ATOM 9011  H HG23 . VAL A 1 25 ? 6.511   -6.388  -0.905 1.00 0.00 ? 227 VAL A HG23 8  
ATOM 9012  N N    . VAL A 1 26 ? 4.278   -2.200  -0.081 1.00 0.00 ? 228 VAL A N    8  
ATOM 9013  C CA   . VAL A 1 26 ? 3.550   -0.991  -0.443 1.00 0.00 ? 228 VAL A CA   8  
ATOM 9014  C C    . VAL A 1 26 ? 2.745   -1.212  -1.717 1.00 0.00 ? 228 VAL A C    8  
ATOM 9015  O O    . VAL A 1 26 ? 3.254   -1.762  -2.694 1.00 0.00 ? 228 VAL A O    8  
ATOM 9016  C CB   . VAL A 1 26 ? 4.505   0.201   -0.643 1.00 0.00 ? 228 VAL A CB   8  
ATOM 9017  C CG1  . VAL A 1 26 ? 3.721   1.486   -0.860 1.00 0.00 ? 228 VAL A CG1  8  
ATOM 9018  C CG2  . VAL A 1 26 ? 5.444   0.332   0.548  1.00 0.00 ? 228 VAL A CG2  8  
ATOM 9019  H H    . VAL A 1 26 ? 5.257   -2.178  -0.043 1.00 0.00 ? 228 VAL A H    8  
ATOM 9020  H HA   . VAL A 1 26 ? 2.872   -0.754  0.364  1.00 0.00 ? 228 VAL A HA   8  
ATOM 9021  H HB   . VAL A 1 26 ? 5.100   0.015   -1.525 1.00 0.00 ? 228 VAL A HB   8  
ATOM 9022  H HG11 . VAL A 1 26 ? 2.695   1.247   -1.099 1.00 0.00 ? 228 VAL A HG11 8  
ATOM 9023  H HG12 . VAL A 1 26 ? 3.752   2.084   0.038  1.00 0.00 ? 228 VAL A HG12 8  
ATOM 9024  H HG13 . VAL A 1 26 ? 4.161   2.041   -1.677 1.00 0.00 ? 228 VAL A HG13 8  
ATOM 9025  H HG21 . VAL A 1 26 ? 5.135   1.166   1.161  1.00 0.00 ? 228 VAL A HG21 8  
ATOM 9026  H HG22 . VAL A 1 26 ? 5.414   -0.575  1.134  1.00 0.00 ? 228 VAL A HG22 8  
ATOM 9027  H HG23 . VAL A 1 26 ? 6.451   0.500   0.196  1.00 0.00 ? 228 VAL A HG23 8  
ATOM 9028  N N    . ARG A 1 27 ? 1.485   -0.800  -1.698 1.00 0.00 ? 229 ARG A N    8  
ATOM 9029  C CA   . ARG A 1 27 ? 0.612   -0.973  -2.852 1.00 0.00 ? 229 ARG A CA   8  
ATOM 9030  C C    . ARG A 1 27 ? 0.076   0.365   -3.353 1.00 0.00 ? 229 ARG A C    8  
ATOM 9031  O O    . ARG A 1 27 ? 0.068   0.629   -4.555 1.00 0.00 ? 229 ARG A O    8  
ATOM 9032  C CB   . ARG A 1 27 ? -0.543  -1.906  -2.490 1.00 0.00 ? 229 ARG A CB   8  
ATOM 9033  C CG   . ARG A 1 27 ? -0.089  -3.241  -1.924 1.00 0.00 ? 229 ARG A CG   8  
ATOM 9034  C CD   . ARG A 1 27 ? 0.942   -3.909  -2.821 1.00 0.00 ? 229 ARG A CD   8  
ATOM 9035  N NE   . ARG A 1 27 ? 0.708   -5.344  -2.948 1.00 0.00 ? 229 ARG A NE   8  
ATOM 9036  C CZ   . ARG A 1 27 ? 1.201   -6.093  -3.933 1.00 0.00 ? 229 ARG A CZ   8  
ATOM 9037  N NH1  . ARG A 1 27 ? 1.956   -5.547  -4.877 1.00 0.00 ? 229 ARG A NH1  8  
ATOM 9038  N NH2  . ARG A 1 27 ? 0.936   -7.393  -3.973 1.00 0.00 ? 229 ARG A NH2  8  
ATOM 9039  H H    . ARG A 1 27 ? 1.129   -0.381  -0.887 1.00 0.00 ? 229 ARG A H    8  
ATOM 9040  H HA   . ARG A 1 27 ? 1.194   -1.428  -3.640 1.00 0.00 ? 229 ARG A HA   8  
ATOM 9041  H HB2  . ARG A 1 27 ? -1.168  -1.420  -1.757 1.00 0.00 ? 229 ARG A HB2  8  
ATOM 9042  H HB3  . ARG A 1 27 ? -1.127  -2.098  -3.377 1.00 0.00 ? 229 ARG A HB3  8  
ATOM 9043  H HG2  . ARG A 1 27 ? 0.348   -3.077  -0.951 1.00 0.00 ? 229 ARG A HG2  8  
ATOM 9044  H HG3  . ARG A 1 27 ? -0.947  -3.891  -1.829 1.00 0.00 ? 229 ARG A HG3  8  
ATOM 9045  H HD2  . ARG A 1 27 ? 0.893   -3.458  -3.801 1.00 0.00 ? 229 ARG A HD2  8  
ATOM 9046  H HD3  . ARG A 1 27 ? 1.923   -3.748  -2.400 1.00 0.00 ? 229 ARG A HD3  8  
ATOM 9047  H HE   . ARG A 1 27 ? 0.154   -5.773  -2.264 1.00 0.00 ? 229 ARG A HE   8  
ATOM 9048  H HH11 . ARG A 1 27 ? 2.161   -4.569  -4.853 1.00 0.00 ? 229 ARG A HH11 8  
ATOM 9049  H HH12 . ARG A 1 27 ? 2.324   -6.116  -5.614 1.00 0.00 ? 229 ARG A HH12 8  
ATOM 9050  H HH21 . ARG A 1 27 ? 0.368   -7.809  -3.263 1.00 0.00 ? 229 ARG A HH21 8  
ATOM 9051  H HH22 . ARG A 1 27 ? 1.306   -7.955  -4.712 1.00 0.00 ? 229 ARG A HH22 8  
ATOM 9052  N N    . PHE A 1 28 ? -0.370  1.207   -2.428 1.00 0.00 ? 230 PHE A N    8  
ATOM 9053  C CA   . PHE A 1 28 ? -0.907  2.518   -2.782 1.00 0.00 ? 230 PHE A CA   8  
ATOM 9054  C C    . PHE A 1 28 ? -0.601  3.541   -1.695 1.00 0.00 ? 230 PHE A C    8  
ATOM 9055  O O    . PHE A 1 28 ? -0.724  3.250   -0.510 1.00 0.00 ? 230 PHE A O    8  
ATOM 9056  C CB   . PHE A 1 28 ? -2.417  2.430   -3.007 1.00 0.00 ? 230 PHE A CB   8  
ATOM 9057  C CG   . PHE A 1 28 ? -3.006  3.668   -3.621 1.00 0.00 ? 230 PHE A CG   8  
ATOM 9058  C CD1  . PHE A 1 28 ? -2.885  3.909   -4.980 1.00 0.00 ? 230 PHE A CD1  8  
ATOM 9059  C CD2  . PHE A 1 28 ? -3.682  4.590   -2.838 1.00 0.00 ? 230 PHE A CD2  8  
ATOM 9060  C CE1  . PHE A 1 28 ? -3.425  5.047   -5.547 1.00 0.00 ? 230 PHE A CE1  8  
ATOM 9061  C CE2  . PHE A 1 28 ? -4.225  5.731   -3.400 1.00 0.00 ? 230 PHE A CE2  8  
ATOM 9062  C CZ   . PHE A 1 28 ? -4.097  5.959   -4.757 1.00 0.00 ? 230 PHE A CZ   8  
ATOM 9063  H H    . PHE A 1 28 ? -0.339  0.943   -1.485 1.00 0.00 ? 230 PHE A H    8  
ATOM 9064  H HA   . PHE A 1 28 ? -0.433  2.831   -3.698 1.00 0.00 ? 230 PHE A HA   8  
ATOM 9065  H HB2  . PHE A 1 28 ? -2.628  1.601   -3.666 1.00 0.00 ? 230 PHE A HB2  8  
ATOM 9066  H HB3  . PHE A 1 28 ? -2.906  2.263   -2.059 1.00 0.00 ? 230 PHE A HB3  8  
ATOM 9067  H HD1  . PHE A 1 28 ? -2.360  3.196   -5.599 1.00 0.00 ? 230 PHE A HD1  8  
ATOM 9068  H HD2  . PHE A 1 28 ? -3.783  4.412   -1.778 1.00 0.00 ? 230 PHE A HD2  8  
ATOM 9069  H HE1  . PHE A 1 28 ? -3.324  5.222   -6.609 1.00 0.00 ? 230 PHE A HE1  8  
ATOM 9070  H HE2  . PHE A 1 28 ? -4.748  6.442   -2.780 1.00 0.00 ? 230 PHE A HE2  8  
ATOM 9071  H HZ   . PHE A 1 28 ? -4.519  6.849   -5.198 1.00 0.00 ? 230 PHE A HZ   8  
ATOM 9072  N N    . LEU A 1 29 ? -0.206  4.742   -2.102 1.00 0.00 ? 231 LEU A N    8  
ATOM 9073  C CA   . LEU A 1 29 ? 0.112   5.800   -1.146 1.00 0.00 ? 231 LEU A CA   8  
ATOM 9074  C C    . LEU A 1 29 ? -0.761  7.028   -1.379 1.00 0.00 ? 231 LEU A C    8  
ATOM 9075  O O    . LEU A 1 29 ? -0.816  7.564   -2.486 1.00 0.00 ? 231 LEU A O    8  
ATOM 9076  C CB   . LEU A 1 29 ? 1.591   6.181   -1.244 1.00 0.00 ? 231 LEU A CB   8  
ATOM 9077  C CG   . LEU A 1 29 ? 2.572   5.009   -1.135 1.00 0.00 ? 231 LEU A CG   8  
ATOM 9078  C CD1  . LEU A 1 29 ? 3.277   4.775   -2.463 1.00 0.00 ? 231 LEU A CD1  8  
ATOM 9079  C CD2  . LEU A 1 29 ? 3.587   5.261   -0.030 1.00 0.00 ? 231 LEU A CD2  8  
ATOM 9080  H H    . LEU A 1 29 ? -0.129  4.922   -3.062 1.00 0.00 ? 231 LEU A H    8  
ATOM 9081  H HA   . LEU A 1 29 ? -0.085  5.418   -0.156 1.00 0.00 ? 231 LEU A HA   8  
ATOM 9082  H HB2  . LEU A 1 29 ? 1.751   6.674   -2.192 1.00 0.00 ? 231 LEU A HB2  8  
ATOM 9083  H HB3  . LEU A 1 29 ? 1.811   6.882   -0.453 1.00 0.00 ? 231 LEU A HB3  8  
ATOM 9084  H HG   . LEU A 1 29 ? 2.023   4.111   -0.889 1.00 0.00 ? 231 LEU A HG   8  
ATOM 9085  H HD11 . LEU A 1 29 ? 2.547   4.527   -3.220 1.00 0.00 ? 231 LEU A HD11 8  
ATOM 9086  H HD12 . LEU A 1 29 ? 3.807   5.669   -2.752 1.00 0.00 ? 231 LEU A HD12 8  
ATOM 9087  H HD13 . LEU A 1 29 ? 3.978   3.959   -2.360 1.00 0.00 ? 231 LEU A HD13 8  
ATOM 9088  H HD21 . LEU A 1 29 ? 3.101   5.753   0.800  1.00 0.00 ? 231 LEU A HD21 8  
ATOM 9089  H HD22 . LEU A 1 29 ? 4.001   4.320   0.301  1.00 0.00 ? 231 LEU A HD22 8  
ATOM 9090  H HD23 . LEU A 1 29 ? 4.380   5.889   -0.405 1.00 0.00 ? 231 LEU A HD23 8  
ATOM 9091  N N    . GLY A 1 30 ? -1.444  7.467   -0.327 1.00 0.00 ? 232 GLY A N    8  
ATOM 9092  C CA   . GLY A 1 30 ? -2.307  8.629   -0.432 1.00 0.00 ? 232 GLY A CA   8  
ATOM 9093  C C    . GLY A 1 30 ? -3.187  8.808   0.788  1.00 0.00 ? 232 GLY A C    8  
ATOM 9094  O O    . GLY A 1 30 ? -3.047  8.083   1.773  1.00 0.00 ? 232 GLY A O    8  
ATOM 9095  H H    . GLY A 1 30 ? -1.360  6.998   0.530  1.00 0.00 ? 232 GLY A H    8  
ATOM 9096  H HA2  . GLY A 1 30 ? -1.694  9.509   -0.554 1.00 0.00 ? 232 GLY A HA2  8  
ATOM 9097  H HA3  . GLY A 1 30 ? -2.936  8.517   -1.303 1.00 0.00 ? 232 GLY A HA3  8  
ATOM 9098  N N    . GLU A 1 31 ? -4.094  9.776   0.725  1.00 0.00 ? 233 GLU A N    8  
ATOM 9099  C CA   . GLU A 1 31 ? -5.000  10.047  1.836  1.00 0.00 ? 233 GLU A CA   8  
ATOM 9100  C C    . GLU A 1 31 ? -6.159  9.057   1.847  1.00 0.00 ? 233 GLU A C    8  
ATOM 9101  O O    . GLU A 1 31 ? -6.443  8.408   0.839  1.00 0.00 ? 233 GLU A O    8  
ATOM 9102  C CB   . GLU A 1 31 ? -5.535  11.477  1.748  1.00 0.00 ? 233 GLU A CB   8  
ATOM 9103  C CG   . GLU A 1 31 ? -4.450  12.519  1.530  1.00 0.00 ? 233 GLU A CG   8  
ATOM 9104  C CD   . GLU A 1 31 ? -4.946  13.933  1.761  1.00 0.00 ? 233 GLU A CD   8  
ATOM 9105  O OE1  . GLU A 1 31 ? -6.152  14.181  1.549  1.00 0.00 ? 233 GLU A OE1  8  
ATOM 9106  O OE2  . GLU A 1 31 ? -4.129  14.793  2.153  1.00 0.00 ? 233 GLU A OE2  8  
ATOM 9107  H H    . GLU A 1 31 ? -4.156  10.321  -0.087 1.00 0.00 ? 233 GLU A H    8  
ATOM 9108  H HA   . GLU A 1 31 ? -4.441  9.938   2.753  1.00 0.00 ? 233 GLU A HA   8  
ATOM 9109  H HB2  . GLU A 1 31 ? -6.232  11.538  0.927  1.00 0.00 ? 233 GLU A HB2  8  
ATOM 9110  H HB3  . GLU A 1 31 ? -6.051  11.713  2.666  1.00 0.00 ? 233 GLU A HB3  8  
ATOM 9111  H HG2  . GLU A 1 31 ? -3.638  12.324  2.215  1.00 0.00 ? 233 GLU A HG2  8  
ATOM 9112  H HG3  . GLU A 1 31 ? -4.091  12.440  0.514  1.00 0.00 ? 233 GLU A HG3  8  
ATOM 9113  N N    . THR A 1 32 ? -6.826  8.946   2.992  1.00 0.00 ? 234 THR A N    8  
ATOM 9114  C CA   . THR A 1 32 ? -7.955  8.034   3.133  1.00 0.00 ? 234 THR A CA   8  
ATOM 9115  C C    . THR A 1 32 ? -9.271  8.803   3.198  1.00 0.00 ? 234 THR A C    8  
ATOM 9116  O O    . THR A 1 32 ? -9.287  10.004  3.463  1.00 0.00 ? 234 THR A O    8  
ATOM 9117  C CB   . THR A 1 32 ? -7.790  7.176   4.389  1.00 0.00 ? 234 THR A CB   8  
ATOM 9118  O OG1  . THR A 1 32 ? -7.930  7.966   5.557  1.00 0.00 ? 234 THR A OG1  8  
ATOM 9119  C CG2  . THR A 1 32 ? -6.450  6.478   4.464  1.00 0.00 ? 234 THR A CG2  8  
ATOM 9120  H H    . THR A 1 32 ? -6.551  9.491   3.759  1.00 0.00 ? 234 THR A H    8  
ATOM 9121  H HA   . THR A 1 32 ? -7.970  7.389   2.267  1.00 0.00 ? 234 THR A HA   8  
ATOM 9122  H HB   . THR A 1 32 ? -8.559  6.418   4.398  1.00 0.00 ? 234 THR A HB   8  
ATOM 9123  H HG1  . THR A 1 32 ? -7.320  8.707   5.517  1.00 0.00 ? 234 THR A HG1  8  
ATOM 9124  H HG21 . THR A 1 32 ? -5.663  7.216   4.526  1.00 0.00 ? 234 THR A HG21 8  
ATOM 9125  H HG22 . THR A 1 32 ? -6.309  5.873   3.582  1.00 0.00 ? 234 THR A HG22 8  
ATOM 9126  H HG23 . THR A 1 32 ? -6.422  5.848   5.342  1.00 0.00 ? 234 THR A HG23 8  
ATOM 9127  N N    . ASP A 1 33 ? -10.372 8.100   2.953  1.00 0.00 ? 235 ASP A N    8  
ATOM 9128  C CA   . ASP A 1 33 ? -11.694 8.717   2.982  1.00 0.00 ? 235 ASP A CA   8  
ATOM 9129  C C    . ASP A 1 33 ? -12.272 8.728   4.398  1.00 0.00 ? 235 ASP A C    8  
ATOM 9130  O O    . ASP A 1 33 ? -13.350 9.278   4.628  1.00 0.00 ? 235 ASP A O    8  
ATOM 9131  C CB   . ASP A 1 33 ? -12.642 7.974   2.040  1.00 0.00 ? 235 ASP A CB   8  
ATOM 9132  C CG   . ASP A 1 33 ? -12.118 7.918   0.618  1.00 0.00 ? 235 ASP A CG   8  
ATOM 9133  O OD1  . ASP A 1 33 ? -11.554 8.931   0.154  1.00 0.00 ? 235 ASP A OD1  8  
ATOM 9134  O OD2  . ASP A 1 33 ? -12.272 6.862   -0.030 1.00 0.00 ? 235 ASP A OD2  8  
ATOM 9135  H H    . ASP A 1 33 ? -10.293 7.147   2.746  1.00 0.00 ? 235 ASP A H    8  
ATOM 9136  H HA   . ASP A 1 33 ? -11.591 9.735   2.642  1.00 0.00 ? 235 ASP A HA   8  
ATOM 9137  H HB2  . ASP A 1 33 ? -12.774 6.963   2.394  1.00 0.00 ? 235 ASP A HB2  8  
ATOM 9138  H HB3  . ASP A 1 33 ? -13.599 8.476   2.032  1.00 0.00 ? 235 ASP A HB3  8  
ATOM 9139  N N    . PHE A 1 34 ? -11.557 8.122   5.343  1.00 0.00 ? 236 PHE A N    8  
ATOM 9140  C CA   . PHE A 1 34 ? -12.016 8.074   6.729  1.00 0.00 ? 236 PHE A CA   8  
ATOM 9141  C C    . PHE A 1 34 ? -10.993 8.697   7.679  1.00 0.00 ? 236 PHE A C    8  
ATOM 9142  O O    . PHE A 1 34 ? -11.317 9.025   8.821  1.00 0.00 ? 236 PHE A O    8  
ATOM 9143  C CB   . PHE A 1 34 ? -12.305 6.624   7.145  1.00 0.00 ? 236 PHE A CB   8  
ATOM 9144  C CG   . PHE A 1 34 ? -11.081 5.837   7.534  1.00 0.00 ? 236 PHE A CG   8  
ATOM 9145  C CD1  . PHE A 1 34 ? -10.058 5.619   6.626  1.00 0.00 ? 236 PHE A CD1  8  
ATOM 9146  C CD2  . PHE A 1 34 ? -10.958 5.319   8.814  1.00 0.00 ? 236 PHE A CD2  8  
ATOM 9147  C CE1  . PHE A 1 34 ? -8.935  4.899   6.985  1.00 0.00 ? 236 PHE A CE1  8  
ATOM 9148  C CE2  . PHE A 1 34 ? -9.837  4.600   9.180  1.00 0.00 ? 236 PHE A CE2  8  
ATOM 9149  C CZ   . PHE A 1 34 ? -8.824  4.389   8.264  1.00 0.00 ? 236 PHE A CZ   8  
ATOM 9150  H H    . PHE A 1 34 ? -10.707 7.701   5.104  1.00 0.00 ? 236 PHE A H    8  
ATOM 9151  H HA   . PHE A 1 34 ? -12.932 8.641   6.791  1.00 0.00 ? 236 PHE A HA   8  
ATOM 9152  H HB2  . PHE A 1 34 ? -12.977 6.629   7.990  1.00 0.00 ? 236 PHE A HB2  8  
ATOM 9153  H HB3  . PHE A 1 34 ? -12.781 6.112   6.320  1.00 0.00 ? 236 PHE A HB3  8  
ATOM 9154  H HD1  . PHE A 1 34 ? -10.142 6.015   5.627  1.00 0.00 ? 236 PHE A HD1  8  
ATOM 9155  H HD2  . PHE A 1 34 ? -11.749 5.484   9.530  1.00 0.00 ? 236 PHE A HD2  8  
ATOM 9156  H HE1  . PHE A 1 34 ? -8.144  4.735   6.268  1.00 0.00 ? 236 PHE A HE1  8  
ATOM 9157  H HE2  . PHE A 1 34 ? -9.753  4.201   10.179 1.00 0.00 ? 236 PHE A HE2  8  
ATOM 9158  H HZ   . PHE A 1 34 ? -7.947  3.826   8.549  1.00 0.00 ? 236 PHE A HZ   8  
ATOM 9159  N N    . ALA A 1 35 ? -9.757  8.857   7.209  1.00 0.00 ? 237 ALA A N    8  
ATOM 9160  C CA   . ALA A 1 35 ? -8.700  9.438   8.027  1.00 0.00 ? 237 ALA A CA   8  
ATOM 9161  C C    . ALA A 1 35 ? -8.137  10.702  7.387  1.00 0.00 ? 237 ALA A C    8  
ATOM 9162  O O    . ALA A 1 35 ? -7.991  10.780  6.166  1.00 0.00 ? 237 ALA A O    8  
ATOM 9163  C CB   . ALA A 1 35 ? -7.592  8.421   8.254  1.00 0.00 ? 237 ALA A CB   8  
ATOM 9164  H H    . ALA A 1 35 ? -9.551  8.576   6.294  1.00 0.00 ? 237 ALA A H    8  
ATOM 9165  H HA   . ALA A 1 35 ? -9.125  9.691   8.987  1.00 0.00 ? 237 ALA A HA   8  
ATOM 9166  H HB1  . ALA A 1 35 ? -8.012  7.426   8.260  1.00 0.00 ? 237 ALA A HB1  8  
ATOM 9167  H HB2  . ALA A 1 35 ? -6.865  8.499   7.460  1.00 0.00 ? 237 ALA A HB2  8  
ATOM 9168  H HB3  . ALA A 1 35 ? -7.113  8.616   9.202  1.00 0.00 ? 237 ALA A HB3  8  
ATOM 9169  N N    . LYS A 1 36 ? -7.820  11.689  8.218  1.00 0.00 ? 238 LYS A N    8  
ATOM 9170  C CA   . LYS A 1 36 ? -7.270  12.949  7.734  1.00 0.00 ? 238 LYS A CA   8  
ATOM 9171  C C    . LYS A 1 36 ? -5.746  12.890  7.679  1.00 0.00 ? 238 LYS A C    8  
ATOM 9172  O O    . LYS A 1 36 ? -5.103  12.364  8.586  1.00 0.00 ? 238 LYS A O    8  
ATOM 9173  C CB   . LYS A 1 36 ? -7.716  14.103  8.634  1.00 0.00 ? 238 LYS A CB   8  
ATOM 9174  C CG   . LYS A 1 36 ? -7.439  13.866  10.109 1.00 0.00 ? 238 LYS A CG   8  
ATOM 9175  C CD   . LYS A 1 36 ? -8.697  13.444  10.854 1.00 0.00 ? 238 LYS A CD   8  
ATOM 9176  C CE   . LYS A 1 36 ? -8.649  13.865  12.313 1.00 0.00 ? 238 LYS A CE   8  
ATOM 9177  N NZ   . LYS A 1 36 ? -8.874  15.327  12.478 1.00 0.00 ? 238 LYS A NZ   8  
ATOM 9178  H H    . LYS A 1 36 ? -7.958  11.566  9.180  1.00 0.00 ? 238 LYS A H    8  
ATOM 9179  H HA   . LYS A 1 36 ? -7.649  13.115  6.737  1.00 0.00 ? 238 LYS A HA   8  
ATOM 9180  H HB2  . LYS A 1 36 ? -7.196  15.001  8.333  1.00 0.00 ? 238 LYS A HB2  8  
ATOM 9181  H HB3  . LYS A 1 36 ? -8.777  14.254  8.508  1.00 0.00 ? 238 LYS A HB3  8  
ATOM 9182  H HG2  . LYS A 1 36 ? -6.699  13.086  10.207 1.00 0.00 ? 238 LYS A HG2  8  
ATOM 9183  H HG3  . LYS A 1 36 ? -7.063  14.779  10.548 1.00 0.00 ? 238 LYS A HG3  8  
ATOM 9184  H HD2  . LYS A 1 36 ? -9.554  13.907  10.384 1.00 0.00 ? 238 LYS A HD2  8  
ATOM 9185  H HD3  . LYS A 1 36 ? -8.792  12.370  10.800 1.00 0.00 ? 238 LYS A HD3  8  
ATOM 9186  H HE2  . LYS A 1 36 ? -9.416  13.329  12.855 1.00 0.00 ? 238 LYS A HE2  8  
ATOM 9187  H HE3  . LYS A 1 36 ? -7.680  13.610  12.716 1.00 0.00 ? 238 LYS A HE3  8  
ATOM 9188  H HZ1  . LYS A 1 36 ? -8.313  15.688  13.277 1.00 0.00 ? 238 LYS A HZ1  8  
ATOM 9189  H HZ2  . LYS A 1 36 ? -9.882  15.517  12.662 1.00 0.00 ? 238 LYS A HZ2  8  
ATOM 9190  H HZ3  . LYS A 1 36 ? -8.591  15.834  11.616 1.00 0.00 ? 238 LYS A HZ3  8  
ATOM 9191  N N    . GLY A 1 37 ? -5.176  13.433  6.607  1.00 0.00 ? 239 GLY A N    8  
ATOM 9192  C CA   . GLY A 1 37 ? -3.733  13.430  6.454  1.00 0.00 ? 239 GLY A CA   8  
ATOM 9193  C C    . GLY A 1 37 ? -3.266  12.486  5.362  1.00 0.00 ? 239 GLY A C    8  
ATOM 9194  O O    . GLY A 1 37 ? -4.056  12.069  4.514  1.00 0.00 ? 239 GLY A O    8  
ATOM 9195  H H    . GLY A 1 37 ? -5.741  13.838  5.915  1.00 0.00 ? 239 GLY A H    8  
ATOM 9196  H HA2  . GLY A 1 37 ? -3.407  14.431  6.212  1.00 0.00 ? 239 GLY A HA2  8  
ATOM 9197  H HA3  . GLY A 1 37 ? -3.282  13.132  7.389  1.00 0.00 ? 239 GLY A HA3  8  
ATOM 9198  N N    . GLU A 1 38 ? -1.981  12.148  5.384  1.00 0.00 ? 240 GLU A N    8  
ATOM 9199  C CA   . GLU A 1 38 ? -1.411  11.248  4.387  1.00 0.00 ? 240 GLU A CA   8  
ATOM 9200  C C    . GLU A 1 38 ? -1.314  9.826   4.932  1.00 0.00 ? 240 GLU A C    8  
ATOM 9201  O O    . GLU A 1 38 ? -0.887  9.613   6.067  1.00 0.00 ? 240 GLU A O    8  
ATOM 9202  C CB   . GLU A 1 38 ? -0.026  11.738  3.958  1.00 0.00 ? 240 GLU A CB   8  
ATOM 9203  C CG   . GLU A 1 38 ? 0.988   11.769  5.091  1.00 0.00 ? 240 GLU A CG   8  
ATOM 9204  C CD   . GLU A 1 38 ? 2.326   12.336  4.661  1.00 0.00 ? 240 GLU A CD   8  
ATOM 9205  O OE1  . GLU A 1 38 ? 2.728   12.095  3.503  1.00 0.00 ? 240 GLU A OE1  8  
ATOM 9206  O OE2  . GLU A 1 38 ? 2.973   13.020  5.481  1.00 0.00 ? 240 GLU A OE2  8  
ATOM 9207  H H    . GLU A 1 38 ? -1.401  12.514  6.085  1.00 0.00 ? 240 GLU A H    8  
ATOM 9208  H HA   . GLU A 1 38 ? -2.063  11.247  3.529  1.00 0.00 ? 240 GLU A HA   8  
ATOM 9209  H HB2  . GLU A 1 38 ? 0.351   11.085  3.187  1.00 0.00 ? 240 GLU A HB2  8  
ATOM 9210  H HB3  . GLU A 1 38 ? -0.118  12.737  3.560  1.00 0.00 ? 240 GLU A HB3  8  
ATOM 9211  H HG2  . GLU A 1 38 ? 0.596   12.381  5.891  1.00 0.00 ? 240 GLU A HG2  8  
ATOM 9212  H HG3  . GLU A 1 38 ? 1.137   10.762  5.451  1.00 0.00 ? 240 GLU A HG3  8  
ATOM 9213  N N    . TRP A 1 39 ? -1.718  8.857   4.116  1.00 0.00 ? 241 TRP A N    8  
ATOM 9214  C CA   . TRP A 1 39 ? -1.679  7.455   4.515  1.00 0.00 ? 241 TRP A CA   8  
ATOM 9215  C C    . TRP A 1 39 ? -1.051  6.595   3.425  1.00 0.00 ? 241 TRP A C    8  
ATOM 9216  O O    . TRP A 1 39 ? -0.844  7.054   2.301  1.00 0.00 ? 241 TRP A O    8  
ATOM 9217  C CB   . TRP A 1 39 ? -3.091  6.956   4.828  1.00 0.00 ? 241 TRP A CB   8  
ATOM 9218  C CG   . TRP A 1 39 ? -3.683  7.586   6.051  1.00 0.00 ? 241 TRP A CG   8  
ATOM 9219  C CD1  . TRP A 1 39 ? -4.111  8.875   6.183  1.00 0.00 ? 241 TRP A CD1  8  
ATOM 9220  C CD2  . TRP A 1 39 ? -3.914  6.953   7.315  1.00 0.00 ? 241 TRP A CD2  8  
ATOM 9221  N NE1  . TRP A 1 39 ? -4.591  9.084   7.454  1.00 0.00 ? 241 TRP A NE1  8  
ATOM 9222  C CE2  . TRP A 1 39 ? -4.482  7.919   8.167  1.00 0.00 ? 241 TRP A CE2  8  
ATOM 9223  C CE3  . TRP A 1 39 ? -3.695  5.665   7.809  1.00 0.00 ? 241 TRP A CE3  8  
ATOM 9224  C CZ2  . TRP A 1 39 ? -4.832  7.636   9.485  1.00 0.00 ? 241 TRP A CZ2  8  
ATOM 9225  C CZ3  . TRP A 1 39 ? -4.044  5.384   9.115  1.00 0.00 ? 241 TRP A CZ3  8  
ATOM 9226  C CH2  . TRP A 1 39 ? -4.608  6.365   9.941  1.00 0.00 ? 241 TRP A CH2  8  
ATOM 9227  H H    . TRP A 1 39 ? -2.051  9.091   3.225  1.00 0.00 ? 241 TRP A H    8  
ATOM 9228  H HA   . TRP A 1 39 ? -1.075  7.383   5.408  1.00 0.00 ? 241 TRP A HA   8  
ATOM 9229  H HB2  . TRP A 1 39 ? -3.738  7.177   3.992  1.00 0.00 ? 241 TRP A HB2  8  
ATOM 9230  H HB3  . TRP A 1 39 ? -3.062  5.888   4.981  1.00 0.00 ? 241 TRP A HB3  8  
ATOM 9231  H HD1  . TRP A 1 39 ? -4.068  9.614   5.397  1.00 0.00 ? 241 TRP A HD1  8  
ATOM 9232  H HE1  . TRP A 1 39 ? -4.955  9.929   7.792  1.00 0.00 ? 241 TRP A HE1  8  
ATOM 9233  H HE3  . TRP A 1 39 ? -3.263  4.895   7.186  1.00 0.00 ? 241 TRP A HE3  8  
ATOM 9234  H HZ2  . TRP A 1 39 ? -5.268  8.380   10.134 1.00 0.00 ? 241 TRP A HZ2  8  
ATOM 9235  H HZ3  . TRP A 1 39 ? -3.883  4.393   9.514  1.00 0.00 ? 241 TRP A HZ3  8  
ATOM 9236  H HH2  . TRP A 1 39 ? -4.862  6.101   10.957 1.00 0.00 ? 241 TRP A HH2  8  
ATOM 9237  N N    . CYS A 1 40 ? -0.752  5.345   3.760  1.00 0.00 ? 242 CYS A N    8  
ATOM 9238  C CA   . CYS A 1 40 ? -0.149  4.422   2.806  1.00 0.00 ? 242 CYS A CA   8  
ATOM 9239  C C    . CYS A 1 40 ? -0.760  3.029   2.930  1.00 0.00 ? 242 CYS A C    8  
ATOM 9240  O O    . CYS A 1 40 ? -1.291  2.660   3.977  1.00 0.00 ? 242 CYS A O    8  
ATOM 9241  C CB   . CYS A 1 40 ? 1.368   4.355   3.015  1.00 0.00 ? 242 CYS A CB   8  
ATOM 9242  S SG   . CYS A 1 40 ? 2.215   3.173   1.939  1.00 0.00 ? 242 CYS A SG   8  
ATOM 9243  H H    . CYS A 1 40 ? -0.941  5.034   4.671  1.00 0.00 ? 242 CYS A H    8  
ATOM 9244  H HA   . CYS A 1 40 ? -0.347  4.799   1.814  1.00 0.00 ? 242 CYS A HA   8  
ATOM 9245  H HB2  . CYS A 1 40 ? 1.792   5.328   2.823  1.00 0.00 ? 242 CYS A HB2  8  
ATOM 9246  H HB3  . CYS A 1 40 ? 1.571   4.074   4.037  1.00 0.00 ? 242 CYS A HB3  8  
ATOM 9247  H HG   . CYS A 1 40 ? 3.158   3.344   1.994  1.00 0.00 ? 242 CYS A HG   8  
ATOM 9248  N N    . GLY A 1 41 ? -0.676  2.264   1.848  1.00 0.00 ? 243 GLY A N    8  
ATOM 9249  C CA   . GLY A 1 41 ? -1.220  0.920   1.834  1.00 0.00 ? 243 GLY A CA   8  
ATOM 9250  C C    . GLY A 1 41 ? -0.141  -0.132  1.683  1.00 0.00 ? 243 GLY A C    8  
ATOM 9251  O O    . GLY A 1 41 ? 0.662   -0.077  0.753  1.00 0.00 ? 243 GLY A O    8  
ATOM 9252  H H    . GLY A 1 41 ? -0.242  2.619   1.045  1.00 0.00 ? 243 GLY A H    8  
ATOM 9253  H HA2  . GLY A 1 41 ? -1.754  0.746   2.755  1.00 0.00 ? 243 GLY A HA2  8  
ATOM 9254  H HA3  . GLY A 1 41 ? -1.910  0.832   1.005  1.00 0.00 ? 243 GLY A HA3  8  
ATOM 9255  N N    . VAL A 1 42 ? -0.121  -1.091  2.599  1.00 0.00 ? 244 VAL A N    8  
ATOM 9256  C CA   . VAL A 1 42 ? 0.871   -2.157  2.562  1.00 0.00 ? 244 VAL A CA   8  
ATOM 9257  C C    . VAL A 1 42 ? 0.209   -3.526  2.670  1.00 0.00 ? 244 VAL A C    8  
ATOM 9258  O O    . VAL A 1 42 ? -0.627  -3.755  3.545  1.00 0.00 ? 244 VAL A O    8  
ATOM 9259  C CB   . VAL A 1 42 ? 1.900   -2.009  3.706  1.00 0.00 ? 244 VAL A CB   8  
ATOM 9260  C CG1  . VAL A 1 42 ? 3.122   -2.875  3.447  1.00 0.00 ? 244 VAL A CG1  8  
ATOM 9261  C CG2  . VAL A 1 42 ? 2.305   -0.553  3.889  1.00 0.00 ? 244 VAL A CG2  8  
ATOM 9262  H H    . VAL A 1 42 ? -0.787  -1.081  3.319  1.00 0.00 ? 244 VAL A H    8  
ATOM 9263  H HA   . VAL A 1 42 ? 1.397   -2.095  1.618  1.00 0.00 ? 244 VAL A HA   8  
ATOM 9264  H HB   . VAL A 1 42 ? 1.437   -2.347  4.621  1.00 0.00 ? 244 VAL A HB   8  
ATOM 9265  H HG11 . VAL A 1 42 ? 2.809   -3.894  3.272  1.00 0.00 ? 244 VAL A HG11 8  
ATOM 9266  H HG12 . VAL A 1 42 ? 3.649   -2.506  2.581  1.00 0.00 ? 244 VAL A HG12 8  
ATOM 9267  H HG13 . VAL A 1 42 ? 3.775   -2.842  4.309  1.00 0.00 ? 244 VAL A HG13 8  
ATOM 9268  H HG21 . VAL A 1 42 ? 2.625   -0.146  2.942  1.00 0.00 ? 244 VAL A HG21 8  
ATOM 9269  H HG22 . VAL A 1 42 ? 1.462   0.012   4.258  1.00 0.00 ? 244 VAL A HG22 8  
ATOM 9270  H HG23 . VAL A 1 42 ? 3.117   -0.492  4.599  1.00 0.00 ? 244 VAL A HG23 8  
ATOM 9271  N N    . GLU A 1 43 ? 0.593   -4.436  1.781  1.00 0.00 ? 245 GLU A N    8  
ATOM 9272  C CA   . GLU A 1 43 ? 0.042   -5.785  1.784  1.00 0.00 ? 245 GLU A CA   8  
ATOM 9273  C C    . GLU A 1 43 ? 0.802   -6.655  2.777  1.00 0.00 ? 245 GLU A C    8  
ATOM 9274  O O    . GLU A 1 43 ? 1.973   -6.972  2.570  1.00 0.00 ? 245 GLU A O    8  
ATOM 9275  C CB   . GLU A 1 43 ? 0.116   -6.398  0.384  1.00 0.00 ? 245 GLU A CB   8  
ATOM 9276  C CG   . GLU A 1 43 ? -0.650  -7.703  0.248  1.00 0.00 ? 245 GLU A CG   8  
ATOM 9277  C CD   . GLU A 1 43 ? -1.109  -7.964  -1.173 1.00 0.00 ? 245 GLU A CD   8  
ATOM 9278  O OE1  . GLU A 1 43 ? -1.227  -6.990  -1.946 1.00 0.00 ? 245 GLU A OE1  8  
ATOM 9279  O OE2  . GLU A 1 43 ? -1.352  -9.142  -1.511 1.00 0.00 ? 245 GLU A OE2  8  
ATOM 9280  H H    . GLU A 1 43 ? 1.267   -4.197  1.113  1.00 0.00 ? 245 GLU A H    8  
ATOM 9281  H HA   . GLU A 1 43 ? -0.992  -5.725  2.092  1.00 0.00 ? 245 GLU A HA   8  
ATOM 9282  H HB2  . GLU A 1 43 ? -0.290  -5.692  -0.327 1.00 0.00 ? 245 GLU A HB2  8  
ATOM 9283  H HB3  . GLU A 1 43 ? 1.151   -6.584  0.139  1.00 0.00 ? 245 GLU A HB3  8  
ATOM 9284  H HG2  . GLU A 1 43 ? -0.009  -8.516  0.557  1.00 0.00 ? 245 GLU A HG2  8  
ATOM 9285  H HG3  . GLU A 1 43 ? -1.516  -7.665  0.891  1.00 0.00 ? 245 GLU A HG3  8  
ATOM 9286  N N    . LEU A 1 44 ? 0.135   -7.023  3.864  1.00 0.00 ? 246 LEU A N    8  
ATOM 9287  C CA   . LEU A 1 44 ? 0.755   -7.836  4.900  1.00 0.00 ? 246 LEU A CA   8  
ATOM 9288  C C    . LEU A 1 44 ? 1.056   -9.245  4.398  1.00 0.00 ? 246 LEU A C    8  
ATOM 9289  O O    . LEU A 1 44 ? 0.282   -9.824  3.635  1.00 0.00 ? 246 LEU A O    8  
ATOM 9290  C CB   . LEU A 1 44 ? -0.148  -7.902  6.133  1.00 0.00 ? 246 LEU A CB   8  
ATOM 9291  C CG   . LEU A 1 44 ? -0.467  -6.550  6.770  1.00 0.00 ? 246 LEU A CG   8  
ATOM 9292  C CD1  . LEU A 1 44 ? -1.475  -6.715  7.896  1.00 0.00 ? 246 LEU A CD1  8  
ATOM 9293  C CD2  . LEU A 1 44 ? 0.805   -5.889  7.284  1.00 0.00 ? 246 LEU A CD2  8  
ATOM 9294  H H    . LEU A 1 44 ? -0.791  -6.729  3.979  1.00 0.00 ? 246 LEU A H    8  
ATOM 9295  H HA   . LEU A 1 44 ? 1.686   -7.363  5.174  1.00 0.00 ? 246 LEU A HA   8  
ATOM 9296  H HB2  . LEU A 1 44 ? -1.077  -8.372  5.847  1.00 0.00 ? 246 LEU A HB2  8  
ATOM 9297  H HB3  . LEU A 1 44 ? 0.336   -8.520  6.874  1.00 0.00 ? 246 LEU A HB3  8  
ATOM 9298  H HG   . LEU A 1 44 ? -0.903  -5.901  6.025  1.00 0.00 ? 246 LEU A HG   8  
ATOM 9299  H HD11 . LEU A 1 44 ? -2.289  -7.340  7.561  1.00 0.00 ? 246 LEU A HD11 8  
ATOM 9300  H HD12 . LEU A 1 44 ? -0.994  -7.177  8.746  1.00 0.00 ? 246 LEU A HD12 8  
ATOM 9301  H HD13 . LEU A 1 44 ? -1.858  -5.746  8.181  1.00 0.00 ? 246 LEU A HD13 8  
ATOM 9302  H HD21 . LEU A 1 44 ? 1.224   -5.265  6.509  1.00 0.00 ? 246 LEU A HD21 8  
ATOM 9303  H HD22 . LEU A 1 44 ? 0.572   -5.284  8.148  1.00 0.00 ? 246 LEU A HD22 8  
ATOM 9304  H HD23 . LEU A 1 44 ? 1.518   -6.651  7.561  1.00 0.00 ? 246 LEU A HD23 8  
ATOM 9305  N N    . ASP A 1 45 ? 2.189   -9.784  4.833  1.00 0.00 ? 247 ASP A N    8  
ATOM 9306  C CA   . ASP A 1 45 ? 2.609   -11.122 4.436  1.00 0.00 ? 247 ASP A CA   8  
ATOM 9307  C C    . ASP A 1 45 ? 1.702   -12.190 5.040  1.00 0.00 ? 247 ASP A C    8  
ATOM 9308  O O    . ASP A 1 45 ? 1.572   -13.285 4.493  1.00 0.00 ? 247 ASP A O    8  
ATOM 9309  C CB   . ASP A 1 45 ? 4.059   -11.364 4.865  1.00 0.00 ? 247 ASP A CB   8  
ATOM 9310  C CG   . ASP A 1 45 ? 5.057   -10.741 3.909  1.00 0.00 ? 247 ASP A CG   8  
ATOM 9311  O OD1  . ASP A 1 45 ? 4.756   -10.670 2.699  1.00 0.00 ? 247 ASP A OD1  8  
ATOM 9312  O OD2  . ASP A 1 45 ? 6.140   -10.320 4.371  1.00 0.00 ? 247 ASP A OD2  8  
ATOM 9313  H H    . ASP A 1 45 ? 2.760   -9.266  5.438  1.00 0.00 ? 247 ASP A H    8  
ATOM 9314  H HA   . ASP A 1 45 ? 2.550   -11.181 3.360  1.00 0.00 ? 247 ASP A HA   8  
ATOM 9315  H HB2  . ASP A 1 45 ? 4.213   -10.935 5.844  1.00 0.00 ? 247 ASP A HB2  8  
ATOM 9316  H HB3  . ASP A 1 45 ? 4.245   -12.425 4.908  1.00 0.00 ? 247 ASP A HB3  8  
ATOM 9317  N N    . GLU A 1 46 ? 1.076   -11.867 6.166  1.00 0.00 ? 248 GLU A N    8  
ATOM 9318  C CA   . GLU A 1 46 ? 0.183   -12.804 6.839  1.00 0.00 ? 248 GLU A CA   8  
ATOM 9319  C C    . GLU A 1 46 ? -1.104  -12.109 7.281  1.00 0.00 ? 248 GLU A C    8  
ATOM 9320  O O    . GLU A 1 46 ? -1.202  -10.883 7.232  1.00 0.00 ? 248 GLU A O    8  
ATOM 9321  C CB   . GLU A 1 46 ? 0.886   -13.432 8.045  1.00 0.00 ? 248 GLU A CB   8  
ATOM 9322  C CG   . GLU A 1 46 ? 1.317   -14.872 7.815  1.00 0.00 ? 248 GLU A CG   8  
ATOM 9323  C CD   . GLU A 1 46 ? 2.774   -14.987 7.414  1.00 0.00 ? 248 GLU A CD   8  
ATOM 9324  O OE1  . GLU A 1 46 ? 3.632   -14.422 8.125  1.00 0.00 ? 248 GLU A OE1  8  
ATOM 9325  O OE2  . GLU A 1 46 ? 3.057   -15.642 6.388  1.00 0.00 ? 248 GLU A OE2  8  
ATOM 9326  H H    . GLU A 1 46 ? 1.219   -10.979 6.557  1.00 0.00 ? 248 GLU A H    8  
ATOM 9327  H HA   . GLU A 1 46 ? -0.069  -13.583 6.135  1.00 0.00 ? 248 GLU A HA   8  
ATOM 9328  H HB2  . GLU A 1 46 ? 1.766   -12.849 8.277  1.00 0.00 ? 248 GLU A HB2  8  
ATOM 9329  H HB3  . GLU A 1 46 ? 0.216   -13.409 8.892  1.00 0.00 ? 248 GLU A HB3  8  
ATOM 9330  H HG2  . GLU A 1 46 ? 1.165   -15.429 8.727  1.00 0.00 ? 248 GLU A HG2  8  
ATOM 9331  H HG3  . GLU A 1 46 ? 0.706   -15.295 7.031  1.00 0.00 ? 248 GLU A HG3  8  
ATOM 9332  N N    . PRO A 1 47 ? -2.112  -12.887 7.718  1.00 0.00 ? 249 PRO A N    8  
ATOM 9333  C CA   . PRO A 1 47 ? -3.396  -12.335 8.167  1.00 0.00 ? 249 PRO A CA   8  
ATOM 9334  C C    . PRO A 1 47 ? -3.257  -11.516 9.447  1.00 0.00 ? 249 PRO A C    8  
ATOM 9335  O O    . PRO A 1 47 ? -3.750  -11.906 10.505 1.00 0.00 ? 249 PRO A O    8  
ATOM 9336  C CB   . PRO A 1 47 ? -4.257  -13.577 8.414  1.00 0.00 ? 249 PRO A CB   8  
ATOM 9337  C CG   . PRO A 1 47 ? -3.282  -14.677 8.656  1.00 0.00 ? 249 PRO A CG   8  
ATOM 9338  C CD   . PRO A 1 47 ? -2.082  -14.359 7.807  1.00 0.00 ? 249 PRO A CD   8  
ATOM 9339  H HA   . PRO A 1 47 ? -3.850  -11.725 7.400  1.00 0.00 ? 249 PRO A HA   8  
ATOM 9340  H HB2  . PRO A 1 47 ? -4.890  -13.413 9.274  1.00 0.00 ? 249 PRO A HB2  8  
ATOM 9341  H HB3  . PRO A 1 47 ? -4.866  -13.775 7.544  1.00 0.00 ? 249 PRO A HB3  8  
ATOM 9342  H HG2  . PRO A 1 47 ? -3.006  -14.701 9.699  1.00 0.00 ? 249 PRO A HG2  8  
ATOM 9343  H HG3  . PRO A 1 47 ? -3.712  -15.622 8.358  1.00 0.00 ? 249 PRO A HG3  8  
ATOM 9344  H HD2  . PRO A 1 47 ? -1.180  -14.700 8.290  1.00 0.00 ? 249 PRO A HD2  8  
ATOM 9345  H HD3  . PRO A 1 47 ? -2.184  -14.806 6.829  1.00 0.00 ? 249 PRO A HD3  8  
ATOM 9346  N N    . LEU A 1 48 ? -2.581  -10.377 9.340  1.00 0.00 ? 250 LEU A N    8  
ATOM 9347  C CA   . LEU A 1 48 ? -2.374  -9.496  10.482 1.00 0.00 ? 250 LEU A CA   8  
ATOM 9348  C C    . LEU A 1 48 ? -2.842  -8.077  10.169 1.00 0.00 ? 250 LEU A C    8  
ATOM 9349  O O    . LEU A 1 48 ? -2.349  -7.111  10.748 1.00 0.00 ? 250 LEU A O    8  
ATOM 9350  C CB   . LEU A 1 48 ? -0.897  -9.480  10.879 1.00 0.00 ? 250 LEU A CB   8  
ATOM 9351  C CG   . LEU A 1 48 ? 0.090   -9.492  9.707  1.00 0.00 ? 250 LEU A CG   8  
ATOM 9352  C CD1  . LEU A 1 48 ? 1.157   -8.425  9.893  1.00 0.00 ? 250 LEU A CD1  8  
ATOM 9353  C CD2  . LEU A 1 48 ? 0.730   -10.863 9.563  1.00 0.00 ? 250 LEU A CD2  8  
ATOM 9354  H H    . LEU A 1 48 ? -2.214  -10.122 8.467  1.00 0.00 ? 250 LEU A H    8  
ATOM 9355  H HA   . LEU A 1 48 ? -2.955  -9.880  11.306 1.00 0.00 ? 250 LEU A HA   8  
ATOM 9356  H HB2  . LEU A 1 48 ? -0.717  -8.592  11.468 1.00 0.00 ? 250 LEU A HB2  8  
ATOM 9357  H HB3  . LEU A 1 48 ? -0.702  -10.346 11.495 1.00 0.00 ? 250 LEU A HB3  8  
ATOM 9358  H HG   . LEU A 1 48 ? -0.442  -9.273  8.794  1.00 0.00 ? 250 LEU A HG   8  
ATOM 9359  H HD11 . LEU A 1 48 ? 1.542   -8.129  8.928  1.00 0.00 ? 250 LEU A HD11 8  
ATOM 9360  H HD12 . LEU A 1 48 ? 0.726   -7.569  10.387 1.00 0.00 ? 250 LEU A HD12 8  
ATOM 9361  H HD13 . LEU A 1 48 ? 1.961   -8.821  10.495 1.00 0.00 ? 250 LEU A HD13 8  
ATOM 9362  H HD21 . LEU A 1 48 ? 1.554   -10.952 10.255 1.00 0.00 ? 250 LEU A HD21 8  
ATOM 9363  H HD22 . LEU A 1 48 ? -0.003  -11.627 9.777  1.00 0.00 ? 250 LEU A HD22 8  
ATOM 9364  H HD23 . LEU A 1 48 ? 1.092   -10.987 8.554  1.00 0.00 ? 250 LEU A HD23 8  
ATOM 9365  N N    . GLY A 1 49 ? -3.794  -7.962  9.249  1.00 0.00 ? 251 GLY A N    8  
ATOM 9366  C CA   . GLY A 1 49 ? -4.307  -6.658  8.876  1.00 0.00 ? 251 GLY A CA   8  
ATOM 9367  C C    . GLY A 1 49 ? -5.691  -6.396  9.435  1.00 0.00 ? 251 GLY A C    8  
ATOM 9368  O O    . GLY A 1 49 ? -6.103  -7.024  10.411 1.00 0.00 ? 251 GLY A O    8  
ATOM 9369  H H    . GLY A 1 49 ? -4.149  -8.767  8.818  1.00 0.00 ? 251 GLY A H    8  
ATOM 9370  H HA2  . GLY A 1 49 ? -3.632  -5.900  9.246  1.00 0.00 ? 251 GLY A HA2  8  
ATOM 9371  H HA3  . GLY A 1 49 ? -4.346  -6.593  7.800  1.00 0.00 ? 251 GLY A HA3  8  
ATOM 9372  N N    . LYS A 1 50 ? -6.411  -5.464  8.819  1.00 0.00 ? 252 LYS A N    8  
ATOM 9373  C CA   . LYS A 1 50 ? -7.756  -5.120  9.264  1.00 0.00 ? 252 LYS A CA   8  
ATOM 9374  C C    . LYS A 1 50 ? -8.760  -5.222  8.119  1.00 0.00 ? 252 LYS A C    8  
ATOM 9375  O O    . LYS A 1 50 ? -9.878  -5.702  8.304  1.00 0.00 ? 252 LYS A O    8  
ATOM 9376  C CB   . LYS A 1 50 ? -7.776  -3.706  9.848  1.00 0.00 ? 252 LYS A CB   8  
ATOM 9377  C CG   . LYS A 1 50 ? -6.650  -3.437  10.835 1.00 0.00 ? 252 LYS A CG   8  
ATOM 9378  C CD   . LYS A 1 50 ? -7.100  -3.665  12.269 1.00 0.00 ? 252 LYS A CD   8  
ATOM 9379  C CE   . LYS A 1 50 ? -5.931  -4.042  13.166 1.00 0.00 ? 252 LYS A CE   8  
ATOM 9380  N NZ   . LYS A 1 50 ? -6.244  -3.828  14.606 1.00 0.00 ? 252 LYS A NZ   8  
ATOM 9381  H H    . LYS A 1 50 ? -6.027  -4.996  8.048  1.00 0.00 ? 252 LYS A H    8  
ATOM 9382  H HA   . LYS A 1 50 ? -8.037  -5.819  10.036 1.00 0.00 ? 252 LYS A HA   8  
ATOM 9383  H HB2  . LYS A 1 50 ? -7.694  -2.994  9.040  1.00 0.00 ? 252 LYS A HB2  8  
ATOM 9384  H HB3  . LYS A 1 50 ? -8.716  -3.552  10.358 1.00 0.00 ? 252 LYS A HB3  8  
ATOM 9385  H HG2  . LYS A 1 50 ? -5.827  -4.100  10.618 1.00 0.00 ? 252 LYS A HG2  8  
ATOM 9386  H HG3  . LYS A 1 50 ? -6.329  -2.411  10.727 1.00 0.00 ? 252 LYS A HG3  8  
ATOM 9387  H HD2  . LYS A 1 50 ? -7.551  -2.759  12.644 1.00 0.00 ? 252 LYS A HD2  8  
ATOM 9388  H HD3  . LYS A 1 50 ? -7.827  -4.464  12.285 1.00 0.00 ? 252 LYS A HD3  8  
ATOM 9389  H HE2  . LYS A 1 50 ? -5.695  -5.083  13.009 1.00 0.00 ? 252 LYS A HE2  8  
ATOM 9390  H HE3  . LYS A 1 50 ? -5.080  -3.434  12.896 1.00 0.00 ? 252 LYS A HE3  8  
ATOM 9391  H HZ1  . LYS A 1 50 ? -6.986  -3.105  14.706 1.00 0.00 ? 252 LYS A HZ1  8  
ATOM 9392  H HZ2  . LYS A 1 50 ? -5.394  -3.508  15.112 1.00 0.00 ? 252 LYS A HZ2  8  
ATOM 9393  H HZ3  . LYS A 1 50 ? -6.578  -4.713  15.035 1.00 0.00 ? 252 LYS A HZ3  8  
ATOM 9394  N N    . ASN A 1 51 ? -8.357  -4.764  6.937  1.00 0.00 ? 253 ASN A N    8  
ATOM 9395  C CA   . ASN A 1 51 ? -9.229  -4.804  5.767  1.00 0.00 ? 253 ASN A CA   8  
ATOM 9396  C C    . ASN A 1 51 ? -8.623  -5.660  4.658  1.00 0.00 ? 253 ASN A C    8  
ATOM 9397  O O    . ASN A 1 51 ? -7.487  -6.123  4.765  1.00 0.00 ? 253 ASN A O    8  
ATOM 9398  C CB   . ASN A 1 51 ? -9.489  -3.386  5.252  1.00 0.00 ? 253 ASN A CB   8  
ATOM 9399  C CG   . ASN A 1 51 ? -8.238  -2.728  4.702  1.00 0.00 ? 253 ASN A CG   8  
ATOM 9400  O OD1  . ASN A 1 51 ? -8.069  -2.606  3.489  1.00 0.00 ? 253 ASN A OD1  8  
ATOM 9401  N ND2  . ASN A 1 51 ? -7.354  -2.298  5.596  1.00 0.00 ? 253 ASN A ND2  8  
ATOM 9402  H H    . ASN A 1 51 ? -7.456  -4.390  6.849  1.00 0.00 ? 253 ASN A H    8  
ATOM 9403  H HA   . ASN A 1 51 ? -10.167 -5.243  6.069  1.00 0.00 ? 253 ASN A HA   8  
ATOM 9404  H HB2  . ASN A 1 51 ? -10.226 -3.428  4.463  1.00 0.00 ? 253 ASN A HB2  8  
ATOM 9405  H HB3  . ASN A 1 51 ? -9.869  -2.780  6.060  1.00 0.00 ? 253 ASN A HB3  8  
ATOM 9406  H HD21 . ASN A 1 51 ? -7.558  -2.429  6.547  1.00 0.00 ? 253 ASN A HD21 8  
ATOM 9407  H HD22 . ASN A 1 51 ? -6.535  -1.869  5.267  1.00 0.00 ? 253 ASN A HD22 8  
ATOM 9408  N N    . ASP A 1 52 ? -9.392  -5.863  3.593  1.00 0.00 ? 254 ASP A N    8  
ATOM 9409  C CA   . ASP A 1 52 ? -8.939  -6.662  2.460  1.00 0.00 ? 254 ASP A CA   8  
ATOM 9410  C C    . ASP A 1 52 ? -8.472  -5.772  1.310  1.00 0.00 ? 254 ASP A C    8  
ATOM 9411  O O    . ASP A 1 52 ? -8.497  -6.179  0.149  1.00 0.00 ? 254 ASP A O    8  
ATOM 9412  C CB   . ASP A 1 52 ? -10.060 -7.585  1.979  1.00 0.00 ? 254 ASP A CB   8  
ATOM 9413  C CG   . ASP A 1 52 ? -11.304 -6.819  1.571  1.00 0.00 ? 254 ASP A CG   8  
ATOM 9414  O OD1  . ASP A 1 52 ? -11.397 -6.425  0.390  1.00 0.00 ? 254 ASP A OD1  8  
ATOM 9415  O OD2  . ASP A 1 52 ? -12.183 -6.612  2.433  1.00 0.00 ? 254 ASP A OD2  8  
ATOM 9416  H H    . ASP A 1 52 ? -10.289 -5.467  3.570  1.00 0.00 ? 254 ASP A H    8  
ATOM 9417  H HA   . ASP A 1 52 ? -8.108  -7.266  2.791  1.00 0.00 ? 254 ASP A HA   8  
ATOM 9418  H HB2  . ASP A 1 52 ? -9.714  -8.150  1.128  1.00 0.00 ? 254 ASP A HB2  8  
ATOM 9419  H HB3  . ASP A 1 52 ? -10.323 -8.265  2.775  1.00 0.00 ? 254 ASP A HB3  8  
ATOM 9420  N N    . GLY A 1 53 ? -8.042  -4.556  1.640  1.00 0.00 ? 255 GLY A N    8  
ATOM 9421  C CA   . GLY A 1 53 ? -7.574  -3.634  0.621  1.00 0.00 ? 255 GLY A CA   8  
ATOM 9422  C C    . GLY A 1 53 ? -8.578  -2.538  0.313  1.00 0.00 ? 255 GLY A C    8  
ATOM 9423  O O    . GLY A 1 53 ? -8.487  -1.881  -0.725 1.00 0.00 ? 255 GLY A O    8  
ATOM 9424  H H    . GLY A 1 53 ? -8.039  -4.286  2.582  1.00 0.00 ? 255 GLY A H    8  
ATOM 9425  H HA2  . GLY A 1 53 ? -6.655  -3.179  0.961  1.00 0.00 ? 255 GLY A HA2  8  
ATOM 9426  H HA3  . GLY A 1 53 ? -7.374  -4.188  -0.284 1.00 0.00 ? 255 GLY A HA3  8  
ATOM 9427  N N    . ALA A 1 54 ? -9.535  -2.339  1.214  1.00 0.00 ? 256 ALA A N    8  
ATOM 9428  C CA   . ALA A 1 54 ? -10.554 -1.314  1.028  1.00 0.00 ? 256 ALA A CA   8  
ATOM 9429  C C    . ALA A 1 54 ? -10.826 -0.567  2.327  1.00 0.00 ? 256 ALA A C    8  
ATOM 9430  O O    . ALA A 1 54 ? -10.554 -1.073  3.417  1.00 0.00 ? 256 ALA A O    8  
ATOM 9431  C CB   . ALA A 1 54 ? -11.837 -1.936  0.495  1.00 0.00 ? 256 ALA A CB   8  
ATOM 9432  H H    . ALA A 1 54 ? -9.556  -2.892  2.023  1.00 0.00 ? 256 ALA A H    8  
ATOM 9433  H HA   . ALA A 1 54 ? -10.189 -0.612  0.291  1.00 0.00 ? 256 ALA A HA   8  
ATOM 9434  H HB1  . ALA A 1 54 ? -12.279 -1.277  -0.238 1.00 0.00 ? 256 ALA A HB1  8  
ATOM 9435  H HB2  . ALA A 1 54 ? -11.612 -2.887  0.034  1.00 0.00 ? 256 ALA A HB2  8  
ATOM 9436  H HB3  . ALA A 1 54 ? -12.530 -2.086  1.309  1.00 0.00 ? 256 ALA A HB3  8  
ATOM 9437  N N    . VAL A 1 55 ? -11.364 0.642   2.206  1.00 0.00 ? 257 VAL A N    8  
ATOM 9438  C CA   . VAL A 1 55 ? -11.673 1.463   3.371  1.00 0.00 ? 257 VAL A CA   8  
ATOM 9439  C C    . VAL A 1 55 ? -12.967 2.244   3.165  1.00 0.00 ? 257 VAL A C    8  
ATOM 9440  O O    . VAL A 1 55 ? -13.076 3.053   2.244  1.00 0.00 ? 257 VAL A O    8  
ATOM 9441  C CB   . VAL A 1 55 ? -10.529 2.451   3.677  1.00 0.00 ? 257 VAL A CB   8  
ATOM 9442  C CG1  . VAL A 1 55 ? -10.824 3.242   4.944  1.00 0.00 ? 257 VAL A CG1  8  
ATOM 9443  C CG2  . VAL A 1 55 ? -9.204  1.713   3.795  1.00 0.00 ? 257 VAL A CG2  8  
ATOM 9444  H H    . VAL A 1 55 ? -11.559 0.991   1.311  1.00 0.00 ? 257 VAL A H    8  
ATOM 9445  H HA   . VAL A 1 55 ? -11.790 0.806   4.219  1.00 0.00 ? 257 VAL A HA   8  
ATOM 9446  H HB   . VAL A 1 55 ? -10.457 3.148   2.855  1.00 0.00 ? 257 VAL A HB   8  
ATOM 9447  H HG11 . VAL A 1 55 ? -11.749 2.894   5.380  1.00 0.00 ? 257 VAL A HG11 8  
ATOM 9448  H HG12 . VAL A 1 55 ? -10.019 3.105   5.650  1.00 0.00 ? 257 VAL A HG12 8  
ATOM 9449  H HG13 . VAL A 1 55 ? -10.913 4.291   4.700  1.00 0.00 ? 257 VAL A HG13 8  
ATOM 9450  H HG21 . VAL A 1 55 ? -8.433  2.403   4.103  1.00 0.00 ? 257 VAL A HG21 8  
ATOM 9451  H HG22 . VAL A 1 55 ? -9.295  0.924   4.528  1.00 0.00 ? 257 VAL A HG22 8  
ATOM 9452  H HG23 . VAL A 1 55 ? -8.943  1.287   2.838  1.00 0.00 ? 257 VAL A HG23 8  
ATOM 9453  N N    . ALA A 1 56 ? -13.945 1.994   4.030  1.00 0.00 ? 258 ALA A N    8  
ATOM 9454  C CA   . ALA A 1 56 ? -15.234 2.673   3.946  1.00 0.00 ? 258 ALA A CA   8  
ATOM 9455  C C    . ALA A 1 56 ? -15.897 2.435   2.594  1.00 0.00 ? 258 ALA A C    8  
ATOM 9456  O O    . ALA A 1 56 ? -16.696 3.250   2.133  1.00 0.00 ? 258 ALA A O    8  
ATOM 9457  C CB   . ALA A 1 56 ? -15.060 4.164   4.197  1.00 0.00 ? 258 ALA A CB   8  
ATOM 9458  H H    . ALA A 1 56 ? -13.797 1.338   4.743  1.00 0.00 ? 258 ALA A H    8  
ATOM 9459  H HA   . ALA A 1 56 ? -15.871 2.274   4.723  1.00 0.00 ? 258 ALA A HA   8  
ATOM 9460  H HB1  . ALA A 1 56 ? -15.886 4.701   3.756  1.00 0.00 ? 258 ALA A HB1  8  
ATOM 9461  H HB2  . ALA A 1 56 ? -15.036 4.349   5.261  1.00 0.00 ? 258 ALA A HB2  8  
ATOM 9462  H HB3  . ALA A 1 56 ? -14.133 4.497   3.752  1.00 0.00 ? 258 ALA A HB3  8  
ATOM 9463  N N    . GLY A 1 57 ? -15.560 1.316   1.961  1.00 0.00 ? 259 GLY A N    8  
ATOM 9464  C CA   . GLY A 1 57 ? -16.132 0.995   0.666  1.00 0.00 ? 259 GLY A CA   8  
ATOM 9465  C C    . GLY A 1 57 ? -15.275 1.475   -0.489 1.00 0.00 ? 259 GLY A C    8  
ATOM 9466  O O    . GLY A 1 57 ? -15.714 1.468   -1.640 1.00 0.00 ? 259 GLY A O    8  
ATOM 9467  H H    . GLY A 1 57 ? -14.916 0.704   2.375  1.00 0.00 ? 259 GLY A H    8  
ATOM 9468  H HA2  . GLY A 1 57 ? -16.248 -0.075  0.593  1.00 0.00 ? 259 GLY A HA2  8  
ATOM 9469  H HA3  . GLY A 1 57 ? -17.107 1.457   0.593  1.00 0.00 ? 259 GLY A HA3  8  
ATOM 9470  N N    . THR A 1 58 ? -14.047 1.892   -0.188 1.00 0.00 ? 260 THR A N    8  
ATOM 9471  C CA   . THR A 1 58 ? -13.130 2.374   -1.215 1.00 0.00 ? 260 THR A CA   8  
ATOM 9472  C C    . THR A 1 58 ? -11.895 1.483   -1.299 1.00 0.00 ? 260 THR A C    8  
ATOM 9473  O O    . THR A 1 58 ? -11.101 1.416   -0.362 1.00 0.00 ? 260 THR A O    8  
ATOM 9474  C CB   . THR A 1 58 ? -12.715 3.816   -0.920 1.00 0.00 ? 260 THR A CB   8  
ATOM 9475  O OG1  . THR A 1 58 ? -13.852 4.654   -0.817 1.00 0.00 ? 260 THR A OG1  8  
ATOM 9476  C CG2  . THR A 1 58 ? -11.804 4.404   -1.977 1.00 0.00 ? 260 THR A CG2  8  
ATOM 9477  H H    . THR A 1 58 ? -13.750 1.873   0.745  1.00 0.00 ? 260 THR A H    8  
ATOM 9478  H HA   . THR A 1 58 ? -13.646 2.343   -2.161 1.00 0.00 ? 260 THR A HA   8  
ATOM 9479  H HB   . THR A 1 58 ? -12.187 3.842   0.023  1.00 0.00 ? 260 THR A HB   8  
ATOM 9480  H HG1  . THR A 1 58 ? -13.647 5.402   -0.252 1.00 0.00 ? 260 THR A HG1  8  
ATOM 9481  H HG21 . THR A 1 58 ? -11.812 3.771   -2.851 1.00 0.00 ? 260 THR A HG21 8  
ATOM 9482  H HG22 . THR A 1 58 ? -10.799 4.471   -1.590 1.00 0.00 ? 260 THR A HG22 8  
ATOM 9483  H HG23 . THR A 1 58 ? -12.153 5.391   -2.243 1.00 0.00 ? 260 THR A HG23 8  
ATOM 9484  N N    . ARG A 1 59 ? -11.737 0.801   -2.430 1.00 0.00 ? 261 ARG A N    8  
ATOM 9485  C CA   . ARG A 1 59 ? -10.596 -0.083  -2.635 1.00 0.00 ? 261 ARG A CA   8  
ATOM 9486  C C    . ARG A 1 59 ? -9.419  0.681   -3.231 1.00 0.00 ? 261 ARG A C    8  
ATOM 9487  O O    . ARG A 1 59 ? -9.461  1.101   -4.386 1.00 0.00 ? 261 ARG A O    8  
ATOM 9488  C CB   . ARG A 1 59 ? -10.983 -1.247  -3.549 1.00 0.00 ? 261 ARG A CB   8  
ATOM 9489  C CG   . ARG A 1 59 ? -9.847  -2.223  -3.804 1.00 0.00 ? 261 ARG A CG   8  
ATOM 9490  C CD   . ARG A 1 59 ? -10.244 -3.286  -4.817 1.00 0.00 ? 261 ARG A CD   8  
ATOM 9491  N NE   . ARG A 1 59 ? -10.271 -2.762  -6.180 1.00 0.00 ? 261 ARG A NE   8  
ATOM 9492  C CZ   . ARG A 1 59 ? -9.183  -2.570  -6.923 1.00 0.00 ? 261 ARG A CZ   8  
ATOM 9493  N NH1  . ARG A 1 59 ? -7.982  -2.860  -6.440 1.00 0.00 ? 261 ARG A NH1  8  
ATOM 9494  N NH2  . ARG A 1 59 ? -9.297  -2.088  -8.153 1.00 0.00 ? 261 ARG A NH2  8  
ATOM 9495  H H    . ARG A 1 59 ? -12.402 0.897   -3.143 1.00 0.00 ? 261 ARG A H    8  
ATOM 9496  H HA   . ARG A 1 59 ? -10.304 -0.475  -1.672 1.00 0.00 ? 261 ARG A HA   8  
ATOM 9497  H HB2  . ARG A 1 59 ? -11.801 -1.788  -3.097 1.00 0.00 ? 261 ARG A HB2  8  
ATOM 9498  H HB3  . ARG A 1 59 ? -11.307 -0.850  -4.499 1.00 0.00 ? 261 ARG A HB3  8  
ATOM 9499  H HG2  . ARG A 1 59 ? -8.995  -1.680  -4.184 1.00 0.00 ? 261 ARG A HG2  8  
ATOM 9500  H HG3  . ARG A 1 59 ? -9.584  -2.705  -2.874 1.00 0.00 ? 261 ARG A HG3  8  
ATOM 9501  H HD2  . ARG A 1 59 ? -9.530  -4.096  -4.768 1.00 0.00 ? 261 ARG A HD2  8  
ATOM 9502  H HD3  . ARG A 1 59 ? -11.225 -3.658  -4.564 1.00 0.00 ? 261 ARG A HD3  8  
ATOM 9503  H HE   . ARG A 1 59 ? -11.147 -2.540  -6.562 1.00 0.00 ? 261 ARG A HE   8  
ATOM 9504  H HH11 . ARG A 1 59 ? -7.889  -3.223  -5.513 1.00 0.00 ? 261 ARG A HH11 8  
ATOM 9505  H HH12 . ARG A 1 59 ? -7.168  -2.715  -7.003 1.00 0.00 ? 261 ARG A HH12 8  
ATOM 9506  H HH21 . ARG A 1 59 ? -10.201 -1.870  -8.523 1.00 0.00 ? 261 ARG A HH21 8  
ATOM 9507  H HH22 . ARG A 1 59 ? -8.481  -1.946  -8.711 1.00 0.00 ? 261 ARG A HH22 8  
ATOM 9508  N N    . TYR A 1 60 ? -8.369  0.856   -2.434 1.00 0.00 ? 262 TYR A N    8  
ATOM 9509  C CA   . TYR A 1 60 ? -7.179  1.569   -2.885 1.00 0.00 ? 262 TYR A CA   8  
ATOM 9510  C C    . TYR A 1 60 ? -6.241  0.634   -3.641 1.00 0.00 ? 262 TYR A C    8  
ATOM 9511  O O    . TYR A 1 60 ? -5.553  1.049   -4.574 1.00 0.00 ? 262 TYR A O    8  
ATOM 9512  C CB   . TYR A 1 60 ? -6.450  2.193   -1.693 1.00 0.00 ? 262 TYR A CB   8  
ATOM 9513  C CG   . TYR A 1 60 ? -7.218  3.317   -1.035 1.00 0.00 ? 262 TYR A CG   8  
ATOM 9514  C CD1  . TYR A 1 60 ? -8.300  3.055   -0.205 1.00 0.00 ? 262 TYR A CD1  8  
ATOM 9515  C CD2  . TYR A 1 60 ? -6.858  4.643   -1.244 1.00 0.00 ? 262 TYR A CD2  8  
ATOM 9516  C CE1  . TYR A 1 60 ? -9.003  4.080   0.398  1.00 0.00 ? 262 TYR A CE1  8  
ATOM 9517  C CE2  . TYR A 1 60 ? -7.556  5.674   -0.644 1.00 0.00 ? 262 TYR A CE2  8  
ATOM 9518  C CZ   . TYR A 1 60 ? -8.628  5.388   0.175  1.00 0.00 ? 262 TYR A CZ   8  
ATOM 9519  O OH   . TYR A 1 60 ? -9.326  6.412   0.772  1.00 0.00 ? 262 TYR A OH   8  
ATOM 9520  H H    . TYR A 1 60 ? -8.394  0.496   -1.523 1.00 0.00 ? 262 TYR A H    8  
ATOM 9521  H HA   . TYR A 1 60 ? -7.499  2.356   -3.552 1.00 0.00 ? 262 TYR A HA   8  
ATOM 9522  H HB2  . TYR A 1 60 ? -6.275  1.430   -0.948 1.00 0.00 ? 262 TYR A HB2  8  
ATOM 9523  H HB3  . TYR A 1 60 ? -5.502  2.588   -2.027 1.00 0.00 ? 262 TYR A HB3  8  
ATOM 9524  H HD1  . TYR A 1 60 ? -8.593  2.030   -0.031 1.00 0.00 ? 262 TYR A HD1  8  
ATOM 9525  H HD2  . TYR A 1 60 ? -6.019  4.864   -1.886 1.00 0.00 ? 262 TYR A HD2  8  
ATOM 9526  H HE1  . TYR A 1 60 ? -9.843  3.856   1.039  1.00 0.00 ? 262 TYR A HE1  8  
ATOM 9527  H HE2  . TYR A 1 60 ? -7.261  6.699   -0.820 1.00 0.00 ? 262 TYR A HE2  8  
ATOM 9528  H HH   . TYR A 1 60 ? -9.444  7.128   0.144  1.00 0.00 ? 262 TYR A HH   8  
ATOM 9529  N N    . PHE A 1 61 ? -6.222  -0.630  -3.233 1.00 0.00 ? 263 PHE A N    8  
ATOM 9530  C CA   . PHE A 1 61 ? -5.373  -1.628  -3.872 1.00 0.00 ? 263 PHE A CA   8  
ATOM 9531  C C    . PHE A 1 61 ? -5.949  -3.027  -3.683 1.00 0.00 ? 263 PHE A C    8  
ATOM 9532  O O    . PHE A 1 61 ? -6.922  -3.215  -2.953 1.00 0.00 ? 263 PHE A O    8  
ATOM 9533  C CB   . PHE A 1 61 ? -3.954  -1.565  -3.303 1.00 0.00 ? 263 PHE A CB   8  
ATOM 9534  C CG   . PHE A 1 61 ? -3.909  -1.456  -1.806 1.00 0.00 ? 263 PHE A CG   8  
ATOM 9535  C CD1  . PHE A 1 61 ? -4.074  -0.229  -1.184 1.00 0.00 ? 263 PHE A CD1  8  
ATOM 9536  C CD2  . PHE A 1 61 ? -3.704  -2.579  -1.020 1.00 0.00 ? 263 PHE A CD2  8  
ATOM 9537  C CE1  . PHE A 1 61 ? -4.033  -0.124  0.193  1.00 0.00 ? 263 PHE A CE1  8  
ATOM 9538  C CE2  . PHE A 1 61 ? -3.662  -2.479  0.358  1.00 0.00 ? 263 PHE A CE2  8  
ATOM 9539  C CZ   . PHE A 1 61 ? -3.827  -1.250  0.965  1.00 0.00 ? 263 PHE A CZ   8  
ATOM 9540  H H    . PHE A 1 61 ? -6.795  -0.899  -2.485 1.00 0.00 ? 263 PHE A H    8  
ATOM 9541  H HA   . PHE A 1 61 ? -5.337  -1.405  -4.928 1.00 0.00 ? 263 PHE A HA   8  
ATOM 9542  H HB2  . PHE A 1 61 ? -3.419  -2.459  -3.586 1.00 0.00 ? 263 PHE A HB2  8  
ATOM 9543  H HB3  . PHE A 1 61 ? -3.445  -0.704  -3.713 1.00 0.00 ? 263 PHE A HB3  8  
ATOM 9544  H HD1  . PHE A 1 61 ? -4.236  0.653   -1.785 1.00 0.00 ? 263 PHE A HD1  8  
ATOM 9545  H HD2  . PHE A 1 61 ? -3.574  -3.540  -1.494 1.00 0.00 ? 263 PHE A HD2  8  
ATOM 9546  H HE1  . PHE A 1 61 ? -4.161  0.840   0.664  1.00 0.00 ? 263 PHE A HE1  8  
ATOM 9547  H HE2  . PHE A 1 61 ? -3.500  -3.361  0.958  1.00 0.00 ? 263 PHE A HE2  8  
ATOM 9548  H HZ   . PHE A 1 61 ? -3.795  -1.170  2.042  1.00 0.00 ? 263 PHE A HZ   8  
ATOM 9549  N N    . GLN A 1 62 ? -5.346  -4.007  -4.347 1.00 0.00 ? 264 GLN A N    8  
ATOM 9550  C CA   . GLN A 1 62 ? -5.804  -5.389  -4.251 1.00 0.00 ? 264 GLN A CA   8  
ATOM 9551  C C    . GLN A 1 62 ? -4.868  -6.211  -3.372 1.00 0.00 ? 264 GLN A C    8  
ATOM 9552  O O    . GLN A 1 62 ? -3.655  -6.223  -3.581 1.00 0.00 ? 264 GLN A O    8  
ATOM 9553  C CB   . GLN A 1 62 ? -5.900  -6.016  -5.643 1.00 0.00 ? 264 GLN A CB   8  
ATOM 9554  C CG   . GLN A 1 62 ? -6.456  -7.429  -5.635 1.00 0.00 ? 264 GLN A CG   8  
ATOM 9555  C CD   . GLN A 1 62 ? -7.972  -7.459  -5.585 1.00 0.00 ? 264 GLN A CD   8  
ATOM 9556  O OE1  . GLN A 1 62 ? -8.644  -7.012  -6.514 1.00 0.00 ? 264 GLN A OE1  8  
ATOM 9557  N NE2  . GLN A 1 62 ? -8.518  -7.988  -4.497 1.00 0.00 ? 264 GLN A NE2  8  
ATOM 9558  H H    . GLN A 1 62 ? -4.575  -3.797  -4.915 1.00 0.00 ? 264 GLN A H    8  
ATOM 9559  H HA   . GLN A 1 62 ? -6.786  -5.381  -3.800 1.00 0.00 ? 264 GLN A HA   8  
ATOM 9560  H HB2  . GLN A 1 62 ? -6.542  -5.403  -6.258 1.00 0.00 ? 264 GLN A HB2  8  
ATOM 9561  H HB3  . GLN A 1 62 ? -4.913  -6.043  -6.081 1.00 0.00 ? 264 GLN A HB3  8  
ATOM 9562  H HG2  . GLN A 1 62 ? -6.131  -7.935  -6.531 1.00 0.00 ? 264 GLN A HG2  8  
ATOM 9563  H HG3  . GLN A 1 62 ? -6.072  -7.950  -4.770 1.00 0.00 ? 264 GLN A HG3  8  
ATOM 9564  H HE21 . GLN A 1 62 ? -7.921  -8.325  -3.796 1.00 0.00 ? 264 GLN A HE21 8  
ATOM 9565  H HE22 . GLN A 1 62 ? -9.496  -8.020  -4.439 1.00 0.00 ? 264 GLN A HE22 8  
ATOM 9566  N N    . CYS A 1 63 ? -5.439  -6.899  -2.390 1.00 0.00 ? 265 CYS A N    8  
ATOM 9567  C CA   . CYS A 1 63 ? -4.657  -7.725  -1.480 1.00 0.00 ? 265 CYS A CA   8  
ATOM 9568  C C    . CYS A 1 63 ? -5.502  -8.851  -0.896 1.00 0.00 ? 265 CYS A C    8  
ATOM 9569  O O    . CYS A 1 63 ? -6.732  -8.796  -0.920 1.00 0.00 ? 265 CYS A O    8  
ATOM 9570  C CB   . CYS A 1 63 ? -4.077  -6.869  -0.351 1.00 0.00 ? 265 CYS A CB   8  
ATOM 9571  S SG   . CYS A 1 63 ? -5.313  -5.901  0.548  1.00 0.00 ? 265 CYS A SG   8  
ATOM 9572  H H    . CYS A 1 63 ? -6.413  -6.850  -2.275 1.00 0.00 ? 265 CYS A H    8  
ATOM 9573  H HA   . CYS A 1 63 ? -3.843  -8.158  -2.044 1.00 0.00 ? 265 CYS A HA   8  
ATOM 9574  H HB2  . CYS A 1 63 ? -3.585  -7.512  0.361  1.00 0.00 ? 265 CYS A HB2  8  
ATOM 9575  H HB3  . CYS A 1 63 ? -3.357  -6.179  -0.766 1.00 0.00 ? 265 CYS A HB3  8  
ATOM 9576  H HG   . CYS A 1 63 ? -4.848  -5.301  1.136  1.00 0.00 ? 265 CYS A HG   8  
ATOM 9577  N N    . GLN A 1 64 ? -4.834  -9.871  -0.368 1.00 0.00 ? 266 GLN A N    8  
ATOM 9578  C CA   . GLN A 1 64 ? -5.518  -11.013 0.226  1.00 0.00 ? 266 GLN A CA   8  
ATOM 9579  C C    . GLN A 1 64 ? -6.385  -10.574 1.404  1.00 0.00 ? 266 GLN A C    8  
ATOM 9580  O O    . GLN A 1 64 ? -6.246  -9.457  1.905  1.00 0.00 ? 266 GLN A O    8  
ATOM 9581  C CB   . GLN A 1 64 ? -4.500  -12.057 0.686  1.00 0.00 ? 266 GLN A CB   8  
ATOM 9582  C CG   . GLN A 1 64 ? -4.261  -13.162 -0.330 1.00 0.00 ? 266 GLN A CG   8  
ATOM 9583  C CD   . GLN A 1 64 ? -3.246  -14.183 0.145  1.00 0.00 ? 266 GLN A CD   8  
ATOM 9584  O OE1  . GLN A 1 64 ? -2.214  -14.393 -0.491 1.00 0.00 ? 266 GLN A OE1  8  
ATOM 9585  N NE2  . GLN A 1 64 ? -3.536  -14.827 1.271  1.00 0.00 ? 266 GLN A NE2  8  
ATOM 9586  H H    . GLN A 1 64 ? -3.854  -9.855  -0.379 1.00 0.00 ? 266 GLN A H    8  
ATOM 9587  H HA   . GLN A 1 64 ? -6.154  -11.450 -0.530 1.00 0.00 ? 266 GLN A HA   8  
ATOM 9588  H HB2  . GLN A 1 64 ? -3.558  -11.565 0.880  1.00 0.00 ? 266 GLN A HB2  8  
ATOM 9589  H HB3  . GLN A 1 64 ? -4.852  -12.510 1.601  1.00 0.00 ? 266 GLN A HB3  8  
ATOM 9590  H HG2  . GLN A 1 64 ? -5.196  -13.668 -0.519 1.00 0.00 ? 266 GLN A HG2  8  
ATOM 9591  H HG3  . GLN A 1 64 ? -3.901  -12.718 -1.247 1.00 0.00 ? 266 GLN A HG3  8  
ATOM 9592  H HE21 . GLN A 1 64 ? -4.376  -14.608 1.725  1.00 0.00 ? 266 GLN A HE21 8  
ATOM 9593  H HE22 . GLN A 1 64 ? -2.897  -15.492 1.602  1.00 0.00 ? 266 GLN A HE22 8  
ATOM 9594  N N    . PRO A 1 65 ? -7.294  -11.450 1.866  1.00 0.00 ? 267 PRO A N    8  
ATOM 9595  C CA   . PRO A 1 65 ? -8.179  -11.143 2.994  1.00 0.00 ? 267 PRO A CA   8  
ATOM 9596  C C    . PRO A 1 65 ? -7.404  -10.934 4.290  1.00 0.00 ? 267 PRO A C    8  
ATOM 9597  O O    . PRO A 1 65 ? -6.521  -11.721 4.630  1.00 0.00 ? 267 PRO A O    8  
ATOM 9598  C CB   . PRO A 1 65 ? -9.077  -12.380 3.098  1.00 0.00 ? 267 PRO A CB   8  
ATOM 9599  C CG   . PRO A 1 65 ? -8.316  -13.467 2.424  1.00 0.00 ? 267 PRO A CG   8  
ATOM 9600  C CD   . PRO A 1 65 ? -7.529  -12.802 1.331  1.00 0.00 ? 267 PRO A CD   8  
ATOM 9601  H HA   . PRO A 1 65 ? -8.784  -10.269 2.794  1.00 0.00 ? 267 PRO A HA   8  
ATOM 9602  H HB2  . PRO A 1 65 ? -9.256  -12.609 4.139  1.00 0.00 ? 267 PRO A HB2  8  
ATOM 9603  H HB3  . PRO A 1 65 ? -10.016 -12.189 2.601  1.00 0.00 ? 267 PRO A HB3  8  
ATOM 9604  H HG2  . PRO A 1 65 ? -7.650  -13.943 3.129  1.00 0.00 ? 267 PRO A HG2  8  
ATOM 9605  H HG3  . PRO A 1 65 ? -9.001  -14.190 2.005  1.00 0.00 ? 267 PRO A HG3  8  
ATOM 9606  H HD2  . PRO A 1 65 ? -6.596  -13.321 1.167  1.00 0.00 ? 267 PRO A HD2  8  
ATOM 9607  H HD3  . PRO A 1 65 ? -8.106  -12.761 0.420  1.00 0.00 ? 267 PRO A HD3  8  
ATOM 9608  N N    . LYS A 1 66 ? -7.741  -9.869  5.011  1.00 0.00 ? 268 LYS A N    8  
ATOM 9609  C CA   . LYS A 1 66 ? -7.078  -9.555  6.272  1.00 0.00 ? 268 LYS A CA   8  
ATOM 9610  C C    . LYS A 1 66 ? -5.588  -9.290  6.065  1.00 0.00 ? 268 LYS A C    8  
ATOM 9611  O O    . LYS A 1 66 ? -4.802  -9.358  7.010  1.00 0.00 ? 268 LYS A O    8  
ATOM 9612  C CB   . LYS A 1 66 ? -7.268  -10.697 7.273  1.00 0.00 ? 268 LYS A CB   8  
ATOM 9613  C CG   . LYS A 1 66 ? -8.589  -10.635 8.023  1.00 0.00 ? 268 LYS A CG   8  
ATOM 9614  C CD   . LYS A 1 66 ? -8.611  -9.486  9.018  1.00 0.00 ? 268 LYS A CD   8  
ATOM 9615  C CE   . LYS A 1 66 ? -9.585  -9.749  10.156 1.00 0.00 ? 268 LYS A CE   8  
ATOM 9616  N NZ   . LYS A 1 66 ? -8.901  -9.772  11.478 1.00 0.00 ? 268 LYS A NZ   8  
ATOM 9617  H H    . LYS A 1 66 ? -8.455  -9.280  4.687  1.00 0.00 ? 268 LYS A H    8  
ATOM 9618  H HA   . LYS A 1 66 ? -7.536  -8.662  6.671  1.00 0.00 ? 268 LYS A HA   8  
ATOM 9619  H HB2  . LYS A 1 66 ? -7.224  -11.637 6.742  1.00 0.00 ? 268 LYS A HB2  8  
ATOM 9620  H HB3  . LYS A 1 66 ? -6.467  -10.665 7.995  1.00 0.00 ? 268 LYS A HB3  8  
ATOM 9621  H HG2  . LYS A 1 66 ? -9.390  -10.499 7.312  1.00 0.00 ? 268 LYS A HG2  8  
ATOM 9622  H HG3  . LYS A 1 66 ? -8.732  -11.564 8.556  1.00 0.00 ? 268 LYS A HG3  8  
ATOM 9623  H HD2  . LYS A 1 66 ? -7.621  -9.359  9.428  1.00 0.00 ? 268 LYS A HD2  8  
ATOM 9624  H HD3  . LYS A 1 66 ? -8.907  -8.584  8.503  1.00 0.00 ? 268 LYS A HD3  8  
ATOM 9625  H HE2  . LYS A 1 66 ? -10.331 -8.969  10.161 1.00 0.00 ? 268 LYS A HE2  8  
ATOM 9626  H HE3  . LYS A 1 66 ? -10.065 -10.703 9.991  1.00 0.00 ? 268 LYS A HE3  8  
ATOM 9627  H HZ1  . LYS A 1 66 ? -8.983  -8.844  11.939 1.00 0.00 ? 268 LYS A HZ1  8  
ATOM 9628  H HZ2  . LYS A 1 66 ? -7.893  -9.999  11.355 1.00 0.00 ? 268 LYS A HZ2  8  
ATOM 9629  H HZ3  . LYS A 1 66 ? -9.333  -10.491 12.092 1.00 0.00 ? 268 LYS A HZ3  8  
ATOM 9630  N N    . TYR A 1 67 ? -5.203  -8.982  4.829  1.00 0.00 ? 269 TYR A N    8  
ATOM 9631  C CA   . TYR A 1 67 ? -3.806  -8.705  4.510  1.00 0.00 ? 269 TYR A CA   8  
ATOM 9632  C C    . TYR A 1 67 ? -3.586  -7.214  4.264  1.00 0.00 ? 269 TYR A C    8  
ATOM 9633  O O    . TYR A 1 67 ? -2.458  -6.727  4.325  1.00 0.00 ? 269 TYR A O    8  
ATOM 9634  C CB   . TYR A 1 67 ? -3.371  -9.496  3.273  1.00 0.00 ? 269 TYR A CB   8  
ATOM 9635  C CG   . TYR A 1 67 ? -2.927  -10.916 3.562  1.00 0.00 ? 269 TYR A CG   8  
ATOM 9636  C CD1  . TYR A 1 67 ? -3.492  -11.650 4.597  1.00 0.00 ? 269 TYR A CD1  8  
ATOM 9637  C CD2  . TYR A 1 67 ? -1.946  -11.523 2.788  1.00 0.00 ? 269 TYR A CD2  8  
ATOM 9638  C CE1  . TYR A 1 67 ? -3.089  -12.949 4.855  1.00 0.00 ? 269 TYR A CE1  8  
ATOM 9639  C CE2  . TYR A 1 67 ? -1.539  -12.819 3.038  1.00 0.00 ? 269 TYR A CE2  8  
ATOM 9640  C CZ   . TYR A 1 67 ? -2.113  -13.528 4.071  1.00 0.00 ? 269 TYR A CZ   8  
ATOM 9641  O OH   . TYR A 1 67 ? -1.713  -14.819 4.322  1.00 0.00 ? 269 TYR A OH   8  
ATOM 9642  H H    . TYR A 1 67 ? -5.873  -8.940  4.115  1.00 0.00 ? 269 TYR A H    8  
ATOM 9643  H HA   . TYR A 1 67 ? -3.205  -9.012  5.353  1.00 0.00 ? 269 TYR A HA   8  
ATOM 9644  H HB2  . TYR A 1 67 ? -4.196  -9.546  2.580  1.00 0.00 ? 269 TYR A HB2  8  
ATOM 9645  H HB3  . TYR A 1 67 ? -2.546  -8.982  2.802  1.00 0.00 ? 269 TYR A HB3  8  
ATOM 9646  H HD1  . TYR A 1 67 ? -4.254  -11.195 5.210  1.00 0.00 ? 269 TYR A HD1  8  
ATOM 9647  H HD2  . TYR A 1 67 ? -1.497  -10.966 1.979  1.00 0.00 ? 269 TYR A HD2  8  
ATOM 9648  H HE1  . TYR A 1 67 ? -3.541  -13.502 5.665  1.00 0.00 ? 269 TYR A HE1  8  
ATOM 9649  H HE2  . TYR A 1 67 ? -0.774  -13.272 2.426  1.00 0.00 ? 269 TYR A HE2  8  
ATOM 9650  H HH   . TYR A 1 67 ? -1.173  -14.840 5.114  1.00 0.00 ? 269 TYR A HH   8  
ATOM 9651  N N    . GLY A 1 68 ? -4.667  -6.491  3.981  1.00 0.00 ? 270 GLY A N    8  
ATOM 9652  C CA   . GLY A 1 68 ? -4.559  -5.067  3.723  1.00 0.00 ? 270 GLY A CA   8  
ATOM 9653  C C    . GLY A 1 68 ? -4.405  -4.248  4.990  1.00 0.00 ? 270 GLY A C    8  
ATOM 9654  O O    . GLY A 1 68 ? -5.170  -4.411  5.941  1.00 0.00 ? 270 GLY A O    8  
ATOM 9655  H H    . GLY A 1 68 ? -5.543  -6.930  3.942  1.00 0.00 ? 270 GLY A H    8  
ATOM 9656  H HA2  . GLY A 1 68 ? -3.702  -4.893  3.090  1.00 0.00 ? 270 GLY A HA2  8  
ATOM 9657  H HA3  . GLY A 1 68 ? -5.448  -4.740  3.203  1.00 0.00 ? 270 GLY A HA3  8  
ATOM 9658  N N    . LEU A 1 69 ? -3.414  -3.362  4.997  1.00 0.00 ? 271 LEU A N    8  
ATOM 9659  C CA   . LEU A 1 69 ? -3.158  -2.506  6.150  1.00 0.00 ? 271 LEU A CA   8  
ATOM 9660  C C    . LEU A 1 69 ? -2.852  -1.080  5.700  1.00 0.00 ? 271 LEU A C    8  
ATOM 9661  O O    . LEU A 1 69 ? -1.987  -0.859  4.851  1.00 0.00 ? 271 LEU A O    8  
ATOM 9662  C CB   . LEU A 1 69 ? -1.993  -3.058  6.976  1.00 0.00 ? 271 LEU A CB   8  
ATOM 9663  C CG   . LEU A 1 69 ? -2.039  -2.720  8.467  1.00 0.00 ? 271 LEU A CG   8  
ATOM 9664  C CD1  . LEU A 1 69 ? -3.295  -3.293  9.110  1.00 0.00 ? 271 LEU A CD1  8  
ATOM 9665  C CD2  . LEU A 1 69 ? -0.794  -3.242  9.167  1.00 0.00 ? 271 LEU A CD2  8  
ATOM 9666  H H    . LEU A 1 69 ? -2.843  -3.280  4.205  1.00 0.00 ? 271 LEU A H    8  
ATOM 9667  H HA   . LEU A 1 69 ? -4.049  -2.495  6.760  1.00 0.00 ? 271 LEU A HA   8  
ATOM 9668  H HB2  . LEU A 1 69 ? -1.985  -4.133  6.870  1.00 0.00 ? 271 LEU A HB2  8  
ATOM 9669  H HB3  . LEU A 1 69 ? -1.075  -2.666  6.568  1.00 0.00 ? 271 LEU A HB3  8  
ATOM 9670  H HG   . LEU A 1 69 ? -2.065  -1.647  8.586  1.00 0.00 ? 271 LEU A HG   8  
ATOM 9671  H HD11 . LEU A 1 69 ? -3.948  -3.683  8.343  1.00 0.00 ? 271 LEU A HD11 8  
ATOM 9672  H HD12 . LEU A 1 69 ? -3.022  -4.088  9.788  1.00 0.00 ? 271 LEU A HD12 8  
ATOM 9673  H HD13 . LEU A 1 69 ? -3.806  -2.515  9.656  1.00 0.00 ? 271 LEU A HD13 8  
ATOM 9674  H HD21 . LEU A 1 69 ? -1.018  -4.185  9.645  1.00 0.00 ? 271 LEU A HD21 8  
ATOM 9675  H HD22 . LEU A 1 69 ? -0.006  -3.384  8.442  1.00 0.00 ? 271 LEU A HD22 8  
ATOM 9676  H HD23 . LEU A 1 69 ? -0.473  -2.528  9.912  1.00 0.00 ? 271 LEU A HD23 8  
ATOM 9677  N N    . PHE A 1 70 ? -3.573  -0.118  6.265  1.00 0.00 ? 272 PHE A N    8  
ATOM 9678  C CA   . PHE A 1 70 ? -3.386  1.287   5.914  1.00 0.00 ? 272 PHE A CA   8  
ATOM 9679  C C    . PHE A 1 70 ? -2.693  2.052   7.037  1.00 0.00 ? 272 PHE A C    8  
ATOM 9680  O O    . PHE A 1 70 ? -3.267  2.252   8.103  1.00 0.00 ? 272 PHE A O    8  
ATOM 9681  C CB   . PHE A 1 70 ? -4.738  1.936   5.614  1.00 0.00 ? 272 PHE A CB   8  
ATOM 9682  C CG   . PHE A 1 70 ? -5.301  1.573   4.270  1.00 0.00 ? 272 PHE A CG   8  
ATOM 9683  C CD1  . PHE A 1 70 ? -5.489  0.247   3.917  1.00 0.00 ? 272 PHE A CD1  8  
ATOM 9684  C CD2  . PHE A 1 70 ? -5.646  2.560   3.360  1.00 0.00 ? 272 PHE A CD2  8  
ATOM 9685  C CE1  . PHE A 1 70 ? -6.012  -0.087  2.682  1.00 0.00 ? 272 PHE A CE1  8  
ATOM 9686  C CE2  . PHE A 1 70 ? -6.169  2.232   2.126  1.00 0.00 ? 272 PHE A CE2  8  
ATOM 9687  C CZ   . PHE A 1 70 ? -6.352  0.906   1.786  1.00 0.00 ? 272 PHE A CZ   8  
ATOM 9688  H H    . PHE A 1 70 ? -4.254  -0.356  6.929  1.00 0.00 ? 272 PHE A H    8  
ATOM 9689  H HA   . PHE A 1 70 ? -2.770  1.329   5.028  1.00 0.00 ? 272 PHE A HA   8  
ATOM 9690  H HB2  . PHE A 1 70 ? -5.450  1.625   6.364  1.00 0.00 ? 272 PHE A HB2  8  
ATOM 9691  H HB3  . PHE A 1 70 ? -4.630  3.009   5.652  1.00 0.00 ? 272 PHE A HB3  8  
ATOM 9692  H HD1  . PHE A 1 70 ? -5.223  -0.530  4.618  1.00 0.00 ? 272 PHE A HD1  8  
ATOM 9693  H HD2  . PHE A 1 70 ? -5.502  3.598   3.626  1.00 0.00 ? 272 PHE A HD2  8  
ATOM 9694  H HE1  . PHE A 1 70 ? -6.154  -1.127  2.419  1.00 0.00 ? 272 PHE A HE1  8  
ATOM 9695  H HE2  . PHE A 1 70 ? -6.433  3.011   1.426  1.00 0.00 ? 272 PHE A HE2  8  
ATOM 9696  H HZ   . PHE A 1 70 ? -6.761  0.647   0.820  1.00 0.00 ? 272 PHE A HZ   8  
ATOM 9697  N N    . ALA A 1 71 ? -1.463  2.492   6.787  1.00 0.00 ? 273 ALA A N    8  
ATOM 9698  C CA   . ALA A 1 71 ? -0.708  3.250   7.780  1.00 0.00 ? 273 ALA A CA   8  
ATOM 9699  C C    . ALA A 1 71 ? 0.080   4.382   7.125  1.00 0.00 ? 273 ALA A C    8  
ATOM 9700  O O    . ALA A 1 71 ? 0.482   4.285   5.966  1.00 0.00 ? 273 ALA A O    8  
ATOM 9701  C CB   . ALA A 1 71 ? 0.228   2.338   8.560  1.00 0.00 ? 273 ALA A CB   8  
ATOM 9702  H H    . ALA A 1 71 ? -1.057  2.313   5.912  1.00 0.00 ? 273 ALA A H    8  
ATOM 9703  H HA   . ALA A 1 71 ? -1.417  3.676   8.477  1.00 0.00 ? 273 ALA A HA   8  
ATOM 9704  H HB1  . ALA A 1 71 ? 1.101   2.122   7.964  1.00 0.00 ? 273 ALA A HB1  8  
ATOM 9705  H HB2  . ALA A 1 71 ? 0.530   2.832   9.474  1.00 0.00 ? 273 ALA A HB2  8  
ATOM 9706  H HB3  . ALA A 1 71 ? -0.282  1.418   8.803  1.00 0.00 ? 273 ALA A HB3  8  
ATOM 9707  N N    . PRO A 1 72 ? 0.306   5.479   7.868  1.00 0.00 ? 274 PRO A N    8  
ATOM 9708  C CA   . PRO A 1 72 ? 1.046   6.642   7.366  1.00 0.00 ? 274 PRO A CA   8  
ATOM 9709  C C    . PRO A 1 72 ? 2.392   6.262   6.761  1.00 0.00 ? 274 PRO A C    8  
ATOM 9710  O O    . PRO A 1 72 ? 2.908   5.172   7.000  1.00 0.00 ? 274 PRO A O    8  
ATOM 9711  C CB   . PRO A 1 72 ? 1.261   7.496   8.614  1.00 0.00 ? 274 PRO A CB   8  
ATOM 9712  C CG   . PRO A 1 72 ? 0.164   7.110   9.543  1.00 0.00 ? 274 PRO A CG   8  
ATOM 9713  C CD   . PRO A 1 72 ? -0.145  5.668   9.257  1.00 0.00 ? 274 PRO A CD   8  
ATOM 9714  H HA   . PRO A 1 72 ? 0.469   7.196   6.642  1.00 0.00 ? 274 PRO A HA   8  
ATOM 9715  H HB2  . PRO A 1 72 ? 2.229   7.276   9.037  1.00 0.00 ? 274 PRO A HB2  8  
ATOM 9716  H HB3  . PRO A 1 72 ? 1.205   8.542   8.352  1.00 0.00 ? 274 PRO A HB3  8  
ATOM 9717  H HG2  . PRO A 1 72 ? 0.496   7.226   10.563 1.00 0.00 ? 274 PRO A HG2  8  
ATOM 9718  H HG3  . PRO A 1 72 ? -0.706  7.724   9.359  1.00 0.00 ? 274 PRO A HG3  8  
ATOM 9719  H HD2  . PRO A 1 72 ? 0.402   5.024   9.930  1.00 0.00 ? 274 PRO A HD2  8  
ATOM 9720  H HD3  . PRO A 1 72 ? -1.206  5.487   9.340  1.00 0.00 ? 274 PRO A HD3  8  
ATOM 9721  N N    . VAL A 1 73 ? 2.958   7.176   5.978  1.00 0.00 ? 275 VAL A N    8  
ATOM 9722  C CA   . VAL A 1 73 ? 4.247   6.943   5.342  1.00 0.00 ? 275 VAL A CA   8  
ATOM 9723  C C    . VAL A 1 73 ? 5.382   7.003   6.363  1.00 0.00 ? 275 VAL A C    8  
ATOM 9724  O O    . VAL A 1 73 ? 6.427   6.380   6.178  1.00 0.00 ? 275 VAL A O    8  
ATOM 9725  C CB   . VAL A 1 73 ? 4.513   7.970   4.223  1.00 0.00 ? 275 VAL A CB   8  
ATOM 9726  C CG1  . VAL A 1 73 ? 4.516   9.387   4.778  1.00 0.00 ? 275 VAL A CG1  8  
ATOM 9727  C CG2  . VAL A 1 73 ? 5.825   7.664   3.514  1.00 0.00 ? 275 VAL A CG2  8  
ATOM 9728  H H    . VAL A 1 73 ? 2.498   8.029   5.830  1.00 0.00 ? 275 VAL A H    8  
ATOM 9729  H HA   . VAL A 1 73 ? 4.227   5.958   4.900  1.00 0.00 ? 275 VAL A HA   8  
ATOM 9730  H HB   . VAL A 1 73 ? 3.714   7.896   3.500  1.00 0.00 ? 275 VAL A HB   8  
ATOM 9731  H HG11 . VAL A 1 73 ? 4.864   9.373   5.800  1.00 0.00 ? 275 VAL A HG11 8  
ATOM 9732  H HG12 . VAL A 1 73 ? 5.172   10.005  4.183  1.00 0.00 ? 275 VAL A HG12 8  
ATOM 9733  H HG13 . VAL A 1 73 ? 3.514   9.788   4.745  1.00 0.00 ? 275 VAL A HG13 8  
ATOM 9734  H HG21 . VAL A 1 73 ? 5.722   6.752   2.945  1.00 0.00 ? 275 VAL A HG21 8  
ATOM 9735  H HG22 . VAL A 1 73 ? 6.073   8.478   2.849  1.00 0.00 ? 275 VAL A HG22 8  
ATOM 9736  H HG23 . VAL A 1 73 ? 6.610   7.543   4.246  1.00 0.00 ? 275 VAL A HG23 8  
ATOM 9737  N N    . HIS A 1 74 ? 5.170   7.756   7.442  1.00 0.00 ? 276 HIS A N    8  
ATOM 9738  C CA   . HIS A 1 74 ? 6.179   7.889   8.485  1.00 0.00 ? 276 HIS A CA   8  
ATOM 9739  C C    . HIS A 1 74 ? 6.173   6.675   9.410  1.00 0.00 ? 276 HIS A C    8  
ATOM 9740  O O    . HIS A 1 74 ? 7.193   6.336   10.012 1.00 0.00 ? 276 HIS A O    8  
ATOM 9741  C CB   . HIS A 1 74 ? 5.950   9.168   9.298  1.00 0.00 ? 276 HIS A CB   8  
ATOM 9742  C CG   . HIS A 1 74 ? 4.542   9.339   9.778  1.00 0.00 ? 276 HIS A CG   8  
ATOM 9743  N ND1  . HIS A 1 74 ? 3.820   10.499  9.588  1.00 0.00 ? 276 HIS A ND1  8  
ATOM 9744  C CD2  . HIS A 1 74 ? 3.722   8.494   10.448 1.00 0.00 ? 276 HIS A CD2  8  
ATOM 9745  C CE1  . HIS A 1 74 ? 2.619   10.360  10.123 1.00 0.00 ? 276 HIS A CE1  8  
ATOM 9746  N NE2  . HIS A 1 74 ? 2.534   9.153   10.649 1.00 0.00 ? 276 HIS A NE2  8  
ATOM 9747  H H    . HIS A 1 74 ? 4.317   8.229   7.536  1.00 0.00 ? 276 HIS A H    8  
ATOM 9748  H HA   . HIS A 1 74 ? 7.144   7.951   8.004  1.00 0.00 ? 276 HIS A HA   8  
ATOM 9749  H HB2  . HIS A 1 74 ? 6.595   9.155   10.163 1.00 0.00 ? 276 HIS A HB2  8  
ATOM 9750  H HB3  . HIS A 1 74 ? 6.198   10.022  8.685  1.00 0.00 ? 276 HIS A HB3  8  
ATOM 9751  H HD1  . HIS A 1 74 ? 4.141   11.304  9.131  1.00 0.00 ? 276 HIS A HD1  8  
ATOM 9752  H HD2  . HIS A 1 74 ? 3.954   7.485   10.759 1.00 0.00 ? 276 HIS A HD2  8  
ATOM 9753  H HE1  . HIS A 1 74 ? 1.839   11.107  10.126 1.00 0.00 ? 276 HIS A HE1  8  
ATOM 9754  H HE2  . HIS A 1 74 ? 1.722   8.759   11.028 1.00 0.00 ? 276 HIS A HE2  8  
ATOM 9755  N N    . LYS A 1 75 ? 5.022   6.018   9.512  1.00 0.00 ? 277 LYS A N    8  
ATOM 9756  C CA   . LYS A 1 75 ? 4.889   4.837   10.357 1.00 0.00 ? 277 LYS A CA   8  
ATOM 9757  C C    . LYS A 1 75 ? 5.437   3.601   9.653  1.00 0.00 ? 277 LYS A C    8  
ATOM 9758  O O    . LYS A 1 75 ? 5.750   2.598   10.296 1.00 0.00 ? 277 LYS A O    8  
ATOM 9759  C CB   . LYS A 1 75 ? 3.424   4.609   10.735 1.00 0.00 ? 277 LYS A CB   8  
ATOM 9760  C CG   . LYS A 1 75 ? 2.948   5.473   11.892 1.00 0.00 ? 277 LYS A CG   8  
ATOM 9761  C CD   . LYS A 1 75 ? 2.496   4.628   13.075 1.00 0.00 ? 277 LYS A CD   8  
ATOM 9762  C CE   . LYS A 1 75 ? 3.274   4.965   14.339 1.00 0.00 ? 277 LYS A CE   8  
ATOM 9763  N NZ   . LYS A 1 75 ? 3.163   6.408   14.695 1.00 0.00 ? 277 LYS A NZ   8  
ATOM 9764  H H    . LYS A 1 75 ? 4.245   6.332   9.005  1.00 0.00 ? 277 LYS A H    8  
ATOM 9765  H HA   . LYS A 1 75 ? 5.461   5.008   11.257 1.00 0.00 ? 277 LYS A HA   8  
ATOM 9766  H HB2  . LYS A 1 75 ? 2.807   4.826   9.875  1.00 0.00 ? 277 LYS A HB2  8  
ATOM 9767  H HB3  . LYS A 1 75 ? 3.293   3.572   11.006 1.00 0.00 ? 277 LYS A HB3  8  
ATOM 9768  H HG2  . LYS A 1 75 ? 3.759   6.113   12.207 1.00 0.00 ? 277 LYS A HG2  8  
ATOM 9769  H HG3  . LYS A 1 75 ? 2.119   6.079   11.557 1.00 0.00 ? 277 LYS A HG3  8  
ATOM 9770  H HD2  . LYS A 1 75 ? 1.449   4.809   13.254 1.00 0.00 ? 277 LYS A HD2  8  
ATOM 9771  H HD3  . LYS A 1 75 ? 2.646   3.585   12.840 1.00 0.00 ? 277 LYS A HD3  8  
ATOM 9772  H HE2  . LYS A 1 75 ? 2.885   4.373   15.153 1.00 0.00 ? 277 LYS A HE2  8  
ATOM 9773  H HE3  . LYS A 1 75 ? 4.314   4.721   14.181 1.00 0.00 ? 277 LYS A HE3  8  
ATOM 9774  H HZ1  . LYS A 1 75 ? 4.098   6.786   14.949 1.00 0.00 ? 277 LYS A HZ1  8  
ATOM 9775  H HZ2  . LYS A 1 75 ? 2.521   6.527   15.505 1.00 0.00 ? 277 LYS A HZ2  8  
ATOM 9776  H HZ3  . LYS A 1 75 ? 2.791   6.950   13.889 1.00 0.00 ? 277 LYS A HZ3  8  
ATOM 9777  N N    . VAL A 1 76 ? 5.550   3.678   8.332  1.00 0.00 ? 278 VAL A N    8  
ATOM 9778  C CA   . VAL A 1 76 ? 6.059   2.561   7.550  1.00 0.00 ? 278 VAL A CA   8  
ATOM 9779  C C    . VAL A 1 76 ? 7.555   2.696   7.298  1.00 0.00 ? 278 VAL A C    8  
ATOM 9780  O O    . VAL A 1 76 ? 8.070   3.798   7.116  1.00 0.00 ? 278 VAL A O    8  
ATOM 9781  C CB   . VAL A 1 76 ? 5.330   2.434   6.200  1.00 0.00 ? 278 VAL A CB   8  
ATOM 9782  C CG1  . VAL A 1 76 ? 5.724   1.144   5.505  1.00 0.00 ? 278 VAL A CG1  8  
ATOM 9783  C CG2  . VAL A 1 76 ? 3.825   2.499   6.393  1.00 0.00 ? 278 VAL A CG2  8  
ATOM 9784  H H    . VAL A 1 76 ? 5.282   4.502   7.873  1.00 0.00 ? 278 VAL A H    8  
ATOM 9785  H HA   . VAL A 1 76 ? 5.883   1.660   8.115  1.00 0.00 ? 278 VAL A HA   8  
ATOM 9786  H HB   . VAL A 1 76 ? 5.629   3.261   5.572  1.00 0.00 ? 278 VAL A HB   8  
ATOM 9787  H HG11 . VAL A 1 76 ? 5.845   0.362   6.240  1.00 0.00 ? 278 VAL A HG11 8  
ATOM 9788  H HG12 . VAL A 1 76 ? 4.948   0.862   4.807  1.00 0.00 ? 278 VAL A HG12 8  
ATOM 9789  H HG13 . VAL A 1 76 ? 6.652   1.286   4.973  1.00 0.00 ? 278 VAL A HG13 8  
ATOM 9790  H HG21 . VAL A 1 76 ? 3.376   1.584   6.032  1.00 0.00 ? 278 VAL A HG21 8  
ATOM 9791  H HG22 . VAL A 1 76 ? 3.601   2.620   7.441  1.00 0.00 ? 278 VAL A HG22 8  
ATOM 9792  H HG23 . VAL A 1 76 ? 3.429   3.337   5.839  1.00 0.00 ? 278 VAL A HG23 8  
ATOM 9793  N N    . THR A 1 77 ? 8.245   1.562   7.294  1.00 0.00 ? 279 THR A N    8  
ATOM 9794  C CA   . THR A 1 77 ? 9.684   1.542   7.067  1.00 0.00 ? 279 THR A CA   8  
ATOM 9795  C C    . THR A 1 77 ? 10.085  0.321   6.244  1.00 0.00 ? 279 THR A C    8  
ATOM 9796  O O    . THR A 1 77 ? 9.509   -0.755  6.395  1.00 0.00 ? 279 THR A O    8  
ATOM 9797  C CB   . THR A 1 77 ? 10.431  1.540   8.401  1.00 0.00 ? 279 THR A CB   8  
ATOM 9798  O OG1  . THR A 1 77 ? 9.578   1.953   9.455  1.00 0.00 ? 279 THR A OG1  8  
ATOM 9799  C CG2  . THR A 1 77 ? 11.642  2.447   8.411  1.00 0.00 ? 279 THR A CG2  8  
ATOM 9800  H H    . THR A 1 77 ? 7.775   0.716   7.448  1.00 0.00 ? 279 THR A H    8  
ATOM 9801  H HA   . THR A 1 77 ? 9.946   2.434   6.518  1.00 0.00 ? 279 THR A HA   8  
ATOM 9802  H HB   . THR A 1 77 ? 10.769  0.536   8.613  1.00 0.00 ? 279 THR A HB   8  
ATOM 9803  H HG1  . THR A 1 77 ? 9.026   1.216   9.728  1.00 0.00 ? 279 THR A HG1  8  
ATOM 9804  H HG21 . THR A 1 77 ? 12.538  1.853   8.317  1.00 0.00 ? 279 THR A HG21 8  
ATOM 9805  H HG22 . THR A 1 77 ? 11.671  2.999   9.339  1.00 0.00 ? 279 THR A HG22 8  
ATOM 9806  H HG23 . THR A 1 77 ? 11.578  3.139   7.583  1.00 0.00 ? 279 THR A HG23 8  
ATOM 9807  N N    . LYS A 1 78 ? 11.077  0.496   5.377  1.00 0.00 ? 280 LYS A N    8  
ATOM 9808  C CA   . LYS A 1 78 ? 11.552  -0.594  4.535  1.00 0.00 ? 280 LYS A CA   8  
ATOM 9809  C C    . LYS A 1 78 ? 12.206  -1.685  5.375  1.00 0.00 ? 280 LYS A C    8  
ATOM 9810  O O    . LYS A 1 78 ? 13.000  -1.400  6.272  1.00 0.00 ? 280 LYS A O    8  
ATOM 9811  C CB   . LYS A 1 78 ? 12.540  -0.067  3.491  1.00 0.00 ? 280 LYS A CB   8  
ATOM 9812  C CG   . LYS A 1 78 ? 12.145  -0.397  2.061  1.00 0.00 ? 280 LYS A CG   8  
ATOM 9813  C CD   . LYS A 1 78 ? 13.275  -0.097  1.088  1.00 0.00 ? 280 LYS A CD   8  
ATOM 9814  C CE   . LYS A 1 78 ? 13.016  1.180   0.305  1.00 0.00 ? 280 LYS A CE   8  
ATOM 9815  N NZ   . LYS A 1 78 ? 14.150  2.138   0.414  1.00 0.00 ? 280 LYS A NZ   8  
ATOM 9816  H H    . LYS A 1 78 ? 11.498  1.377   5.303  1.00 0.00 ? 280 LYS A H    8  
ATOM 9817  H HA   . LYS A 1 78 ? 10.697  -1.015  4.025  1.00 0.00 ? 280 LYS A HA   8  
ATOM 9818  H HB2  . LYS A 1 78 ? 12.605  1.007   3.585  1.00 0.00 ? 280 LYS A HB2  8  
ATOM 9819  H HB3  . LYS A 1 78 ? 13.513  -0.495  3.682  1.00 0.00 ? 280 LYS A HB3  8  
ATOM 9820  H HG2  . LYS A 1 78 ? 11.899  -1.446  1.999  1.00 0.00 ? 280 LYS A HG2  8  
ATOM 9821  H HG3  . LYS A 1 78 ? 11.283  0.195   1.790  1.00 0.00 ? 280 LYS A HG3  8  
ATOM 9822  H HD2  . LYS A 1 78 ? 14.196  0.013   1.642  1.00 0.00 ? 280 LYS A HD2  8  
ATOM 9823  H HD3  . LYS A 1 78 ? 13.367  -0.921  0.395  1.00 0.00 ? 280 LYS A HD3  8  
ATOM 9824  H HE2  . LYS A 1 78 ? 12.871  0.928   -0.736 1.00 0.00 ? 280 LYS A HE2  8  
ATOM 9825  H HE3  . LYS A 1 78 ? 12.121  1.649   0.688  1.00 0.00 ? 280 LYS A HE3  8  
ATOM 9826  H HZ1  . LYS A 1 78 ? 15.055  1.627   0.368  1.00 0.00 ? 280 LYS A HZ1  8  
ATOM 9827  H HZ2  . LYS A 1 78 ? 14.100  2.651   1.318  1.00 0.00 ? 280 LYS A HZ2  8  
ATOM 9828  H HZ3  . LYS A 1 78 ? 14.114  2.826   -0.365 1.00 0.00 ? 280 LYS A HZ3  8  
ATOM 9829  N N    . ILE A 1 79 ? 11.866  -2.936  5.078  1.00 0.00 ? 281 ILE A N    8  
ATOM 9830  C CA   . ILE A 1 79 ? 12.420  -4.070  5.806  1.00 0.00 ? 281 ILE A CA   8  
ATOM 9831  C C    . ILE A 1 79 ? 13.704  -4.568  5.150  1.00 0.00 ? 281 ILE A C    8  
ATOM 9832  O O    . ILE A 1 79 ? 14.596  -5.089  5.822  1.00 0.00 ? 281 ILE A O    8  
ATOM 9833  C CB   . ILE A 1 79 ? 11.408  -5.231  5.888  1.00 0.00 ? 281 ILE A CB   8  
ATOM 9834  C CG1  . ILE A 1 79 ? 11.961  -6.363  6.756  1.00 0.00 ? 281 ILE A CG1  8  
ATOM 9835  C CG2  . ILE A 1 79 ? 11.066  -5.741  4.494  1.00 0.00 ? 281 ILE A CG2  8  
ATOM 9836  C CD1  . ILE A 1 79 ? 10.910  -7.365  7.183  1.00 0.00 ? 281 ILE A CD1  8  
ATOM 9837  H H    . ILE A 1 79 ? 11.228  -3.098  4.352  1.00 0.00 ? 281 ILE A H    8  
ATOM 9838  H HA   . ILE A 1 79 ? 12.644  -3.744  6.811  1.00 0.00 ? 281 ILE A HA   8  
ATOM 9839  H HB   . ILE A 1 79 ? 10.501  -4.855  6.337  1.00 0.00 ? 281 ILE A HB   8  
ATOM 9840  H HG12 . ILE A 1 79 ? 12.721  -6.895  6.202  1.00 0.00 ? 281 ILE A HG12 8  
ATOM 9841  H HG13 . ILE A 1 79 ? 12.402  -5.941  7.647  1.00 0.00 ? 281 ILE A HG13 8  
ATOM 9842  H HG21 . ILE A 1 79 ? 10.004  -5.927  4.430  1.00 0.00 ? 281 ILE A HG21 8  
ATOM 9843  H HG22 . ILE A 1 79 ? 11.347  -5.000  3.761  1.00 0.00 ? 281 ILE A HG22 8  
ATOM 9844  H HG23 . ILE A 1 79 ? 11.604  -6.658  4.305  1.00 0.00 ? 281 ILE A HG23 8  
ATOM 9845  H HD11 . ILE A 1 79 ? 10.887  -7.423  8.261  1.00 0.00 ? 281 ILE A HD11 8  
ATOM 9846  H HD12 . ILE A 1 79 ? 9.944   -7.050  6.818  1.00 0.00 ? 281 ILE A HD12 8  
ATOM 9847  H HD13 . ILE A 1 79 ? 11.152  -8.335  6.775  1.00 0.00 ? 281 ILE A HD13 8  
ATOM 9848  N N    . GLY A 1 80 ? 13.793  -4.405  3.834  1.00 0.00 ? 282 GLY A N    8  
ATOM 9849  C CA   . GLY A 1 80 ? 14.971  -4.843  3.110  1.00 0.00 ? 282 GLY A CA   8  
ATOM 9850  C C    . GLY A 1 80 ? 15.008  -6.346  2.919  1.00 0.00 ? 282 GLY A C    8  
ATOM 9851  O O    . GLY A 1 80 ? 13.988  -6.968  2.628  1.00 0.00 ? 282 GLY A O    8  
ATOM 9852  H H    . GLY A 1 80 ? 13.051  -3.983  3.351  1.00 0.00 ? 282 GLY A H    8  
ATOM 9853  H HA2  . GLY A 1 80 ? 14.980  -4.367  2.140  1.00 0.00 ? 282 GLY A HA2  8  
ATOM 9854  H HA3  . GLY A 1 80 ? 15.850  -4.537  3.657  1.00 0.00 ? 282 GLY A HA3  8  
ATOM 9855  N N    . PHE A 1 81 ? 16.191  -6.932  3.085  1.00 0.00 ? 283 PHE A N    8  
ATOM 9856  C CA   . PHE A 1 81 ? 16.359  -8.371  2.929  1.00 0.00 ? 283 PHE A CA   8  
ATOM 9857  C C    . PHE A 1 81 ? 16.613  -9.037  4.280  1.00 0.00 ? 283 PHE A C    8  
ATOM 9858  O O    . PHE A 1 81 ? 17.335  -8.498  5.119  1.00 0.00 ? 283 PHE A O    8  
ATOM 9859  C CB   . PHE A 1 81 ? 17.517  -8.668  1.975  1.00 0.00 ? 283 PHE A CB   8  
ATOM 9860  C CG   . PHE A 1 81 ? 17.337  -9.937  1.189  1.00 0.00 ? 283 PHE A CG   8  
ATOM 9861  C CD1  . PHE A 1 81 ? 16.398  -10.009 0.173  1.00 0.00 ? 283 PHE A CD1  8  
ATOM 9862  C CD2  . PHE A 1 81 ? 18.106  -11.054 1.467  1.00 0.00 ? 283 PHE A CD2  8  
ATOM 9863  C CE1  . PHE A 1 81 ? 16.229  -11.173 -0.552 1.00 0.00 ? 283 PHE A CE1  8  
ATOM 9864  C CE2  . PHE A 1 81 ? 17.943  -12.222 0.746  1.00 0.00 ? 283 PHE A CE2  8  
ATOM 9865  C CZ   . PHE A 1 81 ? 17.003  -12.281 -0.265 1.00 0.00 ? 283 PHE A CZ   8  
ATOM 9866  H H    . PHE A 1 81 ? 16.968  -6.381  3.317  1.00 0.00 ? 283 PHE A H    8  
ATOM 9867  H HA   . PHE A 1 81 ? 15.447  -8.767  2.510  1.00 0.00 ? 283 PHE A HA   8  
ATOM 9868  H HB2  . PHE A 1 81 ? 17.614  -7.855  1.273  1.00 0.00 ? 283 PHE A HB2  8  
ATOM 9869  H HB3  . PHE A 1 81 ? 18.430  -8.757  2.545  1.00 0.00 ? 283 PHE A HB3  8  
ATOM 9870  H HD1  . PHE A 1 81 ? 15.793  -9.144  -0.052 1.00 0.00 ? 283 PHE A HD1  8  
ATOM 9871  H HD2  . PHE A 1 81 ? 18.842  -11.009 2.256  1.00 0.00 ? 283 PHE A HD2  8  
ATOM 9872  H HE1  . PHE A 1 81 ? 15.494  -11.218 -1.341 1.00 0.00 ? 283 PHE A HE1  8  
ATOM 9873  H HE2  . PHE A 1 81 ? 18.548  -13.087 0.972  1.00 0.00 ? 283 PHE A HE2  8  
ATOM 9874  H HZ   . PHE A 1 81 ? 16.873  -13.193 -0.829 1.00 0.00 ? 283 PHE A HZ   8  
ATOM 9875  N N    . GLY B 2 29 ? 7.161   9.193   23.077 1.00 0.00 ? 444 GLY B N    8  
ATOM 9876  C CA   . GLY B 2 29 ? 6.847   7.842   22.655 1.00 0.00 ? 444 GLY B CA   8  
ATOM 9877  C C    . GLY B 2 29 ? 5.864   7.796   21.498 1.00 0.00 ? 444 GLY B C    8  
ATOM 9878  O O    . GLY B 2 29 ? 5.439   6.718   21.084 1.00 0.00 ? 444 GLY B O    8  
ATOM 9879  H HA2  . GLY B 2 29 ? 7.759   7.350   22.355 1.00 0.00 ? 444 GLY B HA2  8  
ATOM 9880  H HA3  . GLY B 2 29 ? 6.424   7.306   23.494 1.00 0.00 ? 444 GLY B HA3  8  
ATOM 9881  N N    . GLU B 2 30 ? 5.501   8.964   20.976 1.00 0.00 ? 445 GLU B N    8  
ATOM 9882  C CA   . GLU B 2 30 ? 4.562   9.045   19.863 1.00 0.00 ? 445 GLU B CA   8  
ATOM 9883  C C    . GLU B 2 30 ? 3.228   8.397   20.226 1.00 0.00 ? 445 GLU B C    8  
ATOM 9884  O O    . GLU B 2 30 ? 2.963   8.110   21.393 1.00 0.00 ? 445 GLU B O    8  
ATOM 9885  C CB   . GLU B 2 30 ? 5.154   8.371   18.621 1.00 0.00 ? 445 GLU B CB   8  
ATOM 9886  C CG   . GLU B 2 30 ? 5.136   9.256   17.384 1.00 0.00 ? 445 GLU B CG   8  
ATOM 9887  C CD   . GLU B 2 30 ? 6.020   8.722   16.274 1.00 0.00 ? 445 GLU B CD   8  
ATOM 9888  O OE1  . GLU B 2 30 ? 5.524   7.929   15.447 1.00 0.00 ? 445 GLU B OE1  8  
ATOM 9889  O OE2  . GLU B 2 30 ? 7.211   9.098   16.232 1.00 0.00 ? 445 GLU B OE2  8  
ATOM 9890  H H    . GLU B 2 30 ? 5.871   9.791   21.347 1.00 0.00 ? 445 GLU B H    8  
ATOM 9891  H HA   . GLU B 2 30 ? 4.393   10.089  19.647 1.00 0.00 ? 445 GLU B HA   8  
ATOM 9892  H HB2  . GLU B 2 30 ? 6.179   8.100   18.828 1.00 0.00 ? 445 GLU B HB2  8  
ATOM 9893  H HB3  . GLU B 2 30 ? 4.590   7.475   18.405 1.00 0.00 ? 445 GLU B HB3  8  
ATOM 9894  H HG2  . GLU B 2 30 ? 4.123   9.317   17.017 1.00 0.00 ? 445 GLU B HG2  8  
ATOM 9895  H HG3  . GLU B 2 30 ? 5.480   10.241  17.657 1.00 0.00 ? 445 GLU B HG3  8  
ATOM 9896  N N    . GLU B 2 31 ? 2.391   8.170   19.219 1.00 0.00 ? 446 GLU B N    8  
ATOM 9897  C CA   . GLU B 2 31 ? 1.085   7.558   19.433 1.00 0.00 ? 446 GLU B CA   8  
ATOM 9898  C C    . GLU B 2 31 ? 0.996   6.203   18.737 1.00 0.00 ? 446 GLU B C    8  
ATOM 9899  O O    . GLU B 2 31 ? 1.870   5.837   17.952 1.00 0.00 ? 446 GLU B O    8  
ATOM 9900  C CB   . GLU B 2 31 ? -0.024  8.481   18.923 1.00 0.00 ? 446 GLU B CB   8  
ATOM 9901  C CG   . GLU B 2 31 ? -1.374  8.224   19.570 1.00 0.00 ? 446 GLU B CG   8  
ATOM 9902  C CD   . GLU B 2 31 ? -2.091  9.503   19.957 1.00 0.00 ? 446 GLU B CD   8  
ATOM 9903  O OE1  . GLU B 2 31 ? -1.403  10.499  20.263 1.00 0.00 ? 446 GLU B OE1  8  
ATOM 9904  O OE2  . GLU B 2 31 ? -3.340  9.509   19.951 1.00 0.00 ? 446 GLU B OE2  8  
ATOM 9905  H H    . GLU B 2 31 ? 2.657   8.422   18.309 1.00 0.00 ? 446 GLU B H    8  
ATOM 9906  H HA   . GLU B 2 31 ? 0.958   7.413   20.495 1.00 0.00 ? 446 GLU B HA   8  
ATOM 9907  H HB2  . GLU B 2 31 ? 0.257   9.506   19.121 1.00 0.00 ? 446 GLU B HB2  8  
ATOM 9908  H HB3  . GLU B 2 31 ? -0.128  8.345   17.856 1.00 0.00 ? 446 GLU B HB3  8  
ATOM 9909  H HG2  . GLU B 2 31 ? -1.995  7.679   18.874 1.00 0.00 ? 446 GLU B HG2  8  
ATOM 9910  H HG3  . GLU B 2 31 ? -1.225  7.629   20.460 1.00 0.00 ? 446 GLU B HG3  8  
ATOM 9911  N N    . GLU B 2 32 ? -0.068  5.463   19.033 1.00 0.00 ? 447 GLU B N    8  
ATOM 9912  C CA   . GLU B 2 32 ? -0.278  4.147   18.441 1.00 0.00 ? 447 GLU B CA   8  
ATOM 9913  C C    . GLU B 2 32 ? -1.680  4.037   17.850 1.00 0.00 ? 447 GLU B C    8  
ATOM 9914  O O    . GLU B 2 32 ? -2.562  4.836   18.166 1.00 0.00 ? 447 GLU B O    8  
ATOM 9915  C CB   . GLU B 2 32 ? -0.063  3.051   19.485 1.00 0.00 ? 447 GLU B CB   8  
ATOM 9916  C CG   . GLU B 2 32 ? 1.139   3.292   20.384 1.00 0.00 ? 447 GLU B CG   8  
ATOM 9917  C CD   . GLU B 2 32 ? 1.835   2.005   20.784 1.00 0.00 ? 447 GLU B CD   8  
ATOM 9918  O OE1  . GLU B 2 32 ? 2.636   1.489   19.978 1.00 0.00 ? 447 GLU B OE1  8  
ATOM 9919  O OE2  . GLU B 2 32 ? 1.578   1.516   21.904 1.00 0.00 ? 447 GLU B OE2  8  
ATOM 9920  H H    . GLU B 2 32 ? -0.731  5.811   19.667 1.00 0.00 ? 447 GLU B H    8  
ATOM 9921  H HA   . GLU B 2 32 ? 0.444   4.023   17.647 1.00 0.00 ? 447 GLU B HA   8  
ATOM 9922  H HB2  . GLU B 2 32 ? -0.943  2.985   20.108 1.00 0.00 ? 447 GLU B HB2  8  
ATOM 9923  H HB3  . GLU B 2 32 ? 0.079   2.109   18.977 1.00 0.00 ? 447 GLU B HB3  8  
ATOM 9924  H HG2  . GLU B 2 32 ? 1.847   3.916   19.859 1.00 0.00 ? 447 GLU B HG2  8  
ATOM 9925  H HG3  . GLU B 2 32 ? 0.808   3.798   21.278 1.00 0.00 ? 447 GLU B HG3  8  
ATOM 9926  N N    . GLY B 2 33 ? -1.880  3.042   16.990 1.00 0.00 ? 448 GLY B N    8  
ATOM 9927  C CA   . GLY B 2 33 ? -3.181  2.852   16.372 1.00 0.00 ? 448 GLY B CA   8  
ATOM 9928  C C    . GLY B 2 33 ? -3.381  3.741   15.162 1.00 0.00 ? 448 GLY B C    8  
ATOM 9929  O O    . GLY B 2 33 ? -4.512  4.080   14.812 1.00 0.00 ? 448 GLY B O    8  
ATOM 9930  H H    . GLY B 2 33 ? -1.145  2.432   16.778 1.00 0.00 ? 448 GLY B H    8  
ATOM 9931  H HA2  . GLY B 2 33 ? -3.273  1.819   16.067 1.00 0.00 ? 448 GLY B HA2  8  
ATOM 9932  H HA3  . GLY B 2 33 ? -3.949  3.073   17.099 1.00 0.00 ? 448 GLY B HA3  8  
ATOM 9933  N N    . GLU B 2 34 ? -2.279  4.127   14.522 1.00 0.00 ? 449 GLU B N    8  
ATOM 9934  C CA   . GLU B 2 34 ? -2.337  4.989   13.345 1.00 0.00 ? 449 GLU B CA   8  
ATOM 9935  C C    . GLU B 2 34 ? -2.484  4.177   12.064 1.00 0.00 ? 449 GLU B C    8  
ATOM 9936  O O    . GLU B 2 34 ? -2.195  4.674   10.980 1.00 0.00 ? 449 GLU B O    8  
ATOM 9937  C CB   . GLU B 2 34 ? -1.075  5.846   13.246 1.00 0.00 ? 449 GLU B CB   8  
ATOM 9938  C CG   . GLU B 2 34 ? -0.505  6.267   14.595 1.00 0.00 ? 449 GLU B CG   8  
ATOM 9939  C CD   . GLU B 2 34 ? -0.153  7.741   14.645 1.00 0.00 ? 449 GLU B CD   8  
ATOM 9940  O OE1  . GLU B 2 34 ? -1.007  8.568   14.261 1.00 0.00 ? 449 GLU B OE1  8  
ATOM 9941  O OE2  . GLU B 2 34 ? 0.976   8.067   15.068 1.00 0.00 ? 449 GLU B OE2  8  
ATOM 9942  H H    . GLU B 2 34 ? -1.408  3.826   14.852 1.00 0.00 ? 449 GLU B H    8  
ATOM 9943  H HA   . GLU B 2 34 ? -3.194  5.637   13.448 1.00 0.00 ? 449 GLU B HA   8  
ATOM 9944  H HB2  . GLU B 2 34 ? -0.317  5.285   12.714 1.00 0.00 ? 449 GLU B HB2  8  
ATOM 9945  H HB3  . GLU B 2 34 ? -1.306  6.739   12.684 1.00 0.00 ? 449 GLU B HB3  8  
ATOM 9946  H HG2  . GLU B 2 34 ? -1.237  6.060   15.360 1.00 0.00 ? 449 GLU B HG2  8  
ATOM 9947  H HG3  . GLU B 2 34 ? 0.388   5.691   14.788 1.00 0.00 ? 449 GLU B HG3  8  
ATOM 9948  N N    . GLU B 2 35 ? -2.926  2.929   12.182 1.00 0.00 ? 450 GLU B N    8  
ATOM 9949  C CA   . GLU B 2 35 ? -3.091  2.084   11.008 1.00 0.00 ? 450 GLU B CA   8  
ATOM 9950  C C    . GLU B 2 35 ? -4.445  1.381   11.014 1.00 0.00 ? 450 GLU B C    8  
ATOM 9951  O O    . GLU B 2 35 ? -5.015  1.113   12.072 1.00 0.00 ? 450 GLU B O    8  
ATOM 9952  C CB   . GLU B 2 35 ? -1.954  1.060   10.926 1.00 0.00 ? 450 GLU B CB   8  
ATOM 9953  C CG   . GLU B 2 35 ? -2.077  -0.082  11.922 1.00 0.00 ? 450 GLU B CG   8  
ATOM 9954  C CD   . GLU B 2 35 ? -1.983  0.386   13.360 1.00 0.00 ? 450 GLU B CD   8  
ATOM 9955  O OE1  . GLU B 2 35 ? -1.032  1.127   13.683 1.00 0.00 ? 450 GLU B OE1  8  
ATOM 9956  O OE2  . GLU B 2 35 ? -2.861  0.007   14.166 1.00 0.00 ? 450 GLU B OE2  8  
ATOM 9957  H H    . GLU B 2 35 ? -3.144  2.573   13.067 1.00 0.00 ? 450 GLU B H    8  
ATOM 9958  H HA   . GLU B 2 35 ? -3.042  2.722   10.141 1.00 0.00 ? 450 GLU B HA   8  
ATOM 9959  H HB2  . GLU B 2 35 ? -1.935  0.642   9.931  1.00 0.00 ? 450 GLU B HB2  8  
ATOM 9960  H HB3  . GLU B 2 35 ? -1.018  1.568   11.110 1.00 0.00 ? 450 GLU B HB3  8  
ATOM 9961  H HG2  . GLU B 2 35 ? -3.032  -0.567  11.779 1.00 0.00 ? 450 GLU B HG2  8  
ATOM 9962  H HG3  . GLU B 2 35 ? -1.285  -0.790  11.735 1.00 0.00 ? 450 GLU B HG3  8  
ATOM 9963  N N    . TYR B 2 36 ? -4.953  1.088   9.821  1.00 0.00 ? 451 TYR B N    8  
ATOM 9964  C CA   . TYR B 2 36 ? -6.239  0.421   9.676  1.00 0.00 ? 451 TYR B CA   8  
ATOM 9965  C C    . TYR B 2 36 ? -6.165  -0.684  8.628  1.00 0.00 ? 451 TYR B C    8  
ATOM 9966  O O    . TYR B 2 36 ? -5.048  -1.178  8.366  1.00 0.00 ? 451 TYR B O    8  
ATOM 9967  C CB   . TYR B 2 36 ? -7.318  1.433   9.288  1.00 0.00 ? 451 TYR B CB   8  
ATOM 9968  C CG   . TYR B 2 36 ? -7.852  2.228   10.460 1.00 0.00 ? 451 TYR B CG   8  
ATOM 9969  C CD1  . TYR B 2 36 ? -7.189  3.361   10.914 1.00 0.00 ? 451 TYR B CD1  8  
ATOM 9970  C CD2  . TYR B 2 36 ? -9.016  1.843   11.112 1.00 0.00 ? 451 TYR B CD2  8  
ATOM 9971  C CE1  . TYR B 2 36 ? -7.672  4.089   11.984 1.00 0.00 ? 451 TYR B CE1  8  
ATOM 9972  C CE2  . TYR B 2 36 ? -9.505  2.567   12.183 1.00 0.00 ? 451 TYR B CE2  8  
ATOM 9973  C CZ   . TYR B 2 36 ? -8.830  3.689   12.615 1.00 0.00 ? 451 TYR B CZ   8  
ATOM 9974  O OH   . TYR B 2 36 ? -9.314  4.411   13.680 1.00 0.00 ? 451 TYR B OH   8  
ATOM 9975  O OXT  . TYR B 2 36 ? -7.227  -1.046  8.077  1.00 0.00 ? 451 TYR B OXT  8  
ATOM 9976  H H    . TYR B 2 36 ? -4.447  1.329   9.017  1.00 0.00 ? 451 TYR B H    8  
ATOM 9977  H HA   . TYR B 2 36 ? -6.496  -0.019  10.629 1.00 0.00 ? 451 TYR B HA   8  
ATOM 9978  H HB2  . TYR B 2 36 ? -6.906  2.130   8.575  1.00 0.00 ? 451 TYR B HB2  8  
ATOM 9979  H HB3  . TYR B 2 36 ? -8.148  0.910   8.835  1.00 0.00 ? 451 TYR B HB3  8  
ATOM 9980  H HD1  . TYR B 2 36 ? -6.281  3.673   10.417 1.00 0.00 ? 451 TYR B HD1  8  
ATOM 9981  H HD2  . TYR B 2 36 ? -9.542  0.964   10.772 1.00 0.00 ? 451 TYR B HD2  8  
ATOM 9982  H HE1  . TYR B 2 36 ? -7.142  4.968   12.322 1.00 0.00 ? 451 TYR B HE1  8  
ATOM 9983  H HE2  . TYR B 2 36 ? -10.414 2.252   12.677 1.00 0.00 ? 451 TYR B HE2  8  
ATOM 9984  H HH   . TYR B 2 36 ? -8.617  4.538   14.327 1.00 0.00 ? 451 TYR B HH   8  
ATOM 9985  N N    . ARG A 1 8  ? 8.706   9.996   -2.425 1.00 0.00 ? 210 ARG A N    9  
ATOM 9986  C CA   . ARG A 1 8  ? 9.558   10.813  -1.568 1.00 0.00 ? 210 ARG A CA   9  
ATOM 9987  C C    . ARG A 1 8  ? 10.111  9.994   -0.405 1.00 0.00 ? 210 ARG A C    9  
ATOM 9988  O O    . ARG A 1 8  ? 11.273  10.147  -0.026 1.00 0.00 ? 210 ARG A O    9  
ATOM 9989  C CB   . ARG A 1 8  ? 8.775   12.014  -1.033 1.00 0.00 ? 210 ARG A CB   9  
ATOM 9990  C CG   . ARG A 1 8  ? 9.659   13.084  -0.407 1.00 0.00 ? 210 ARG A CG   9  
ATOM 9991  C CD   . ARG A 1 8  ? 9.398   14.456  -1.012 1.00 0.00 ? 210 ARG A CD   9  
ATOM 9992  N NE   . ARG A 1 8  ? 8.686   15.335  -0.087 1.00 0.00 ? 210 ARG A NE   9  
ATOM 9993  C CZ   . ARG A 1 8  ? 9.270   15.986  0.915  1.00 0.00 ? 210 ARG A CZ   9  
ATOM 9994  N NH1  . ARG A 1 8  ? 10.574  15.855  1.130  1.00 0.00 ? 210 ARG A NH1  9  
ATOM 9995  N NH2  . ARG A 1 8  ? 8.550   16.768  1.708  1.00 0.00 ? 210 ARG A NH2  9  
ATOM 9996  H HA   . ARG A 1 8  ? 10.383  11.171  -2.165 1.00 0.00 ? 210 ARG A HA   9  
ATOM 9997  H HB2  . ARG A 1 8  ? 8.224   12.461  -1.846 1.00 0.00 ? 210 ARG A HB2  9  
ATOM 9998  H HB3  . ARG A 1 8  ? 8.079   11.671  -0.283 1.00 0.00 ? 210 ARG A HB3  9  
ATOM 9999  H HG2  . ARG A 1 8  ? 9.458   13.127  0.653  1.00 0.00 ? 210 ARG A HG2  9  
ATOM 10000 H HG3  . ARG A 1 8  ? 10.695  12.821  -0.568 1.00 0.00 ? 210 ARG A HG3  9  
ATOM 10001 H HD2  . ARG A 1 8  ? 10.344  14.908  -1.266 1.00 0.00 ? 210 ARG A HD2  9  
ATOM 10002 H HD3  . ARG A 1 8  ? 8.807   14.335  -1.907 1.00 0.00 ? 210 ARG A HD3  9  
ATOM 10003 H HE   . ARG A 1 8  ? 7.722   15.448  -0.222 1.00 0.00 ? 210 ARG A HE   9  
ATOM 10004 H HH11 . ARG A 1 8  ? 11.122  15.266  0.538  1.00 0.00 ? 210 ARG A HH11 9  
ATOM 10005 H HH12 . ARG A 1 8  ? 11.007  16.347  1.885  1.00 0.00 ? 210 ARG A HH12 9  
ATOM 10006 H HH21 . ARG A 1 8  ? 7.568   16.870  1.551  1.00 0.00 ? 210 ARG A HH21 9  
ATOM 10007 H HH22 . ARG A 1 8  ? 8.990   17.255  2.462  1.00 0.00 ? 210 ARG A HH22 9  
ATOM 10008 N N    . GLU A 1 9  ? 9.275   9.130   0.158  1.00 0.00 ? 211 GLU A N    9  
ATOM 10009 C CA   . GLU A 1 9  ? 9.684   8.294   1.281  1.00 0.00 ? 211 GLU A CA   9  
ATOM 10010 C C    . GLU A 1 9  ? 9.640   6.815   0.907  1.00 0.00 ? 211 GLU A C    9  
ATOM 10011 O O    . GLU A 1 9  ? 10.656  6.121   0.960  1.00 0.00 ? 211 GLU A O    9  
ATOM 10012 C CB   . GLU A 1 9  ? 8.786   8.554   2.491  1.00 0.00 ? 211 GLU A CB   9  
ATOM 10013 C CG   . GLU A 1 9  ? 9.372   9.546   3.482  1.00 0.00 ? 211 GLU A CG   9  
ATOM 10014 C CD   . GLU A 1 9  ? 8.460   9.799   4.665  1.00 0.00 ? 211 GLU A CD   9  
ATOM 10015 O OE1  . GLU A 1 9  ? 8.271   8.870   5.479  1.00 0.00 ? 211 GLU A OE1  9  
ATOM 10016 O OE2  . GLU A 1 9  ? 7.931   10.924  4.777  1.00 0.00 ? 211 GLU A OE2  9  
ATOM 10017 H H    . GLU A 1 9  ? 8.361   9.055   -0.185 1.00 0.00 ? 211 GLU A H    9  
ATOM 10018 H HA   . GLU A 1 9  ? 10.700  8.556   1.537  1.00 0.00 ? 211 GLU A HA   9  
ATOM 10019 H HB2  . GLU A 1 9  ? 7.838   8.940   2.146  1.00 0.00 ? 211 GLU A HB2  9  
ATOM 10020 H HB3  . GLU A 1 9  ? 8.615   7.620   3.008  1.00 0.00 ? 211 GLU A HB3  9  
ATOM 10021 H HG2  . GLU A 1 9  ? 10.311  9.158   3.848  1.00 0.00 ? 211 GLU A HG2  9  
ATOM 10022 H HG3  . GLU A 1 9  ? 9.547   10.483  2.973  1.00 0.00 ? 211 GLU A HG3  9  
ATOM 10023 N N    . LEU A 1 10 ? 8.456   6.335   0.536  1.00 0.00 ? 212 LEU A N    9  
ATOM 10024 C CA   . LEU A 1 10 ? 8.284   4.937   0.161  1.00 0.00 ? 212 LEU A CA   9  
ATOM 10025 C C    . LEU A 1 10 ? 7.752   4.810   -1.263 1.00 0.00 ? 212 LEU A C    9  
ATOM 10026 O O    . LEU A 1 10 ? 7.152   5.743   -1.799 1.00 0.00 ? 212 LEU A O    9  
ATOM 10027 C CB   . LEU A 1 10 ? 7.330   4.242   1.133  1.00 0.00 ? 212 LEU A CB   9  
ATOM 10028 C CG   . LEU A 1 10 ? 7.879   4.038   2.545  1.00 0.00 ? 212 LEU A CG   9  
ATOM 10029 C CD1  . LEU A 1 10 ? 6.762   3.669   3.506  1.00 0.00 ? 212 LEU A CD1  9  
ATOM 10030 C CD2  . LEU A 1 10 ? 8.960   2.966   2.546  1.00 0.00 ? 212 LEU A CD2  9  
ATOM 10031 H H    . LEU A 1 10 ? 7.682   6.935   0.517  1.00 0.00 ? 212 LEU A H    9  
ATOM 10032 H HA   . LEU A 1 10 ? 9.249   4.457   0.216  1.00 0.00 ? 212 LEU A HA   9  
ATOM 10033 H HB2  . LEU A 1 10 ? 6.426   4.830   1.201  1.00 0.00 ? 212 LEU A HB2  9  
ATOM 10034 H HB3  . LEU A 1 10 ? 7.076   3.273   0.727  1.00 0.00 ? 212 LEU A HB3  9  
ATOM 10035 H HG   . LEU A 1 10 ? 8.323   4.961   2.889  1.00 0.00 ? 212 LEU A HG   9  
ATOM 10036 H HD11 . LEU A 1 10 ? 7.148   3.629   4.514  1.00 0.00 ? 212 LEU A HD11 9  
ATOM 10037 H HD12 . LEU A 1 10 ? 5.980   4.412   3.451  1.00 0.00 ? 212 LEU A HD12 9  
ATOM 10038 H HD13 . LEU A 1 10 ? 6.359   2.703   3.237  1.00 0.00 ? 212 LEU A HD13 9  
ATOM 10039 H HD21 . LEU A 1 10 ? 8.926   2.421   3.478  1.00 0.00 ? 212 LEU A HD21 9  
ATOM 10040 H HD22 . LEU A 1 10 ? 8.792   2.285   1.724  1.00 0.00 ? 212 LEU A HD22 9  
ATOM 10041 H HD23 . LEU A 1 10 ? 9.928   3.431   2.436  1.00 0.00 ? 212 LEU A HD23 9  
ATOM 10042 N N    . LYS A 1 11 ? 7.975   3.650   -1.867 1.00 0.00 ? 213 LYS A N    9  
ATOM 10043 C CA   . LYS A 1 11 ? 7.517   3.393   -3.228 1.00 0.00 ? 213 LYS A CA   9  
ATOM 10044 C C    . LYS A 1 11 ? 6.705   2.104   -3.291 1.00 0.00 ? 213 LYS A C    9  
ATOM 10045 O O    . LYS A 1 11 ? 6.921   1.184   -2.500 1.00 0.00 ? 213 LYS A O    9  
ATOM 10046 C CB   . LYS A 1 11 ? 8.711   3.304   -4.182 1.00 0.00 ? 213 LYS A CB   9  
ATOM 10047 C CG   . LYS A 1 11 ? 9.739   4.405   -3.974 1.00 0.00 ? 213 LYS A CG   9  
ATOM 10048 C CD   . LYS A 1 11 ? 10.929  3.915   -3.162 1.00 0.00 ? 213 LYS A CD   9  
ATOM 10049 C CE   . LYS A 1 11 ? 11.183  4.798   -1.952 1.00 0.00 ? 213 LYS A CE   9  
ATOM 10050 N NZ   . LYS A 1 11 ? 11.767  6.113   -2.335 1.00 0.00 ? 213 LYS A NZ   9  
ATOM 10051 H H    . LYS A 1 11 ? 8.458   2.944   -1.386 1.00 0.00 ? 213 LYS A H    9  
ATOM 10052 H HA   . LYS A 1 11 ? 6.888   4.217   -3.528 1.00 0.00 ? 213 LYS A HA   9  
ATOM 10053 H HB2  . LYS A 1 11 ? 9.200   2.352   -4.040 1.00 0.00 ? 213 LYS A HB2  9  
ATOM 10054 H HB3  . LYS A 1 11 ? 8.350   3.365   -5.198 1.00 0.00 ? 213 LYS A HB3  9  
ATOM 10055 H HG2  . LYS A 1 11 ? 10.089  4.743   -4.938 1.00 0.00 ? 213 LYS A HG2  9  
ATOM 10056 H HG3  . LYS A 1 11 ? 9.270   5.227   -3.453 1.00 0.00 ? 213 LYS A HG3  9  
ATOM 10057 H HD2  . LYS A 1 11 ? 10.734  2.907   -2.825 1.00 0.00 ? 213 LYS A HD2  9  
ATOM 10058 H HD3  . LYS A 1 11 ? 11.807  3.921   -3.791 1.00 0.00 ? 213 LYS A HD3  9  
ATOM 10059 H HE2  . LYS A 1 11 ? 10.245  4.967   -1.443 1.00 0.00 ? 213 LYS A HE2  9  
ATOM 10060 H HE3  . LYS A 1 11 ? 11.865  4.290   -1.287 1.00 0.00 ? 213 LYS A HE3  9  
ATOM 10061 H HZ1  . LYS A 1 11 ? 11.376  6.867   -1.737 1.00 0.00 ? 213 LYS A HZ1  9  
ATOM 10062 H HZ2  . LYS A 1 11 ? 11.548  6.326   -3.330 1.00 0.00 ? 213 LYS A HZ2  9  
ATOM 10063 H HZ3  . LYS A 1 11 ? 12.801  6.092   -2.218 1.00 0.00 ? 213 LYS A HZ3  9  
ATOM 10064 N N    . ILE A 1 12 ? 5.769   2.044   -4.231 1.00 0.00 ? 214 ILE A N    9  
ATOM 10065 C CA   . ILE A 1 12 ? 4.923   0.867   -4.392 1.00 0.00 ? 214 ILE A CA   9  
ATOM 10066 C C    . ILE A 1 12 ? 5.741   -0.341  -4.839 1.00 0.00 ? 214 ILE A C    9  
ATOM 10067 O O    . ILE A 1 12 ? 6.686   -0.211  -5.619 1.00 0.00 ? 214 ILE A O    9  
ATOM 10068 C CB   . ILE A 1 12 ? 3.796   1.119   -5.410 1.00 0.00 ? 214 ILE A CB   9  
ATOM 10069 C CG1  . ILE A 1 12 ? 3.040   2.401   -5.056 1.00 0.00 ? 214 ILE A CG1  9  
ATOM 10070 C CG2  . ILE A 1 12 ? 2.845   -0.069  -5.457 1.00 0.00 ? 214 ILE A CG2  9  
ATOM 10071 C CD1  . ILE A 1 12 ? 1.888   2.703   -5.989 1.00 0.00 ? 214 ILE A CD1  9  
ATOM 10072 H H    . ILE A 1 12 ? 5.643   2.808   -4.831 1.00 0.00 ? 214 ILE A H    9  
ATOM 10073 H HA   . ILE A 1 12 ? 4.473   0.648   -3.435 1.00 0.00 ? 214 ILE A HA   9  
ATOM 10074 H HB   . ILE A 1 12 ? 4.241   1.231   -6.387 1.00 0.00 ? 214 ILE A HB   9  
ATOM 10075 H HG12 . ILE A 1 12 ? 2.641   2.312   -4.058 1.00 0.00 ? 214 ILE A HG12 9  
ATOM 10076 H HG13 . ILE A 1 12 ? 3.724   3.236   -5.092 1.00 0.00 ? 214 ILE A HG13 9  
ATOM 10077 H HG21 . ILE A 1 12 ? 2.175   0.038   -6.297 1.00 0.00 ? 214 ILE A HG21 9  
ATOM 10078 H HG22 . ILE A 1 12 ? 3.413   -0.980  -5.563 1.00 0.00 ? 214 ILE A HG22 9  
ATOM 10079 H HG23 . ILE A 1 12 ? 2.272   -0.105  -4.541 1.00 0.00 ? 214 ILE A HG23 9  
ATOM 10080 H HD11 . ILE A 1 12 ? 0.956   2.623   -5.449 1.00 0.00 ? 214 ILE A HD11 9  
ATOM 10081 H HD12 . ILE A 1 12 ? 1.993   3.705   -6.378 1.00 0.00 ? 214 ILE A HD12 9  
ATOM 10082 H HD13 . ILE A 1 12 ? 1.892   1.997   -6.806 1.00 0.00 ? 214 ILE A HD13 9  
ATOM 10083 N N    . GLY A 1 13 ? 5.371   -1.516  -4.339 1.00 0.00 ? 215 GLY A N    9  
ATOM 10084 C CA   . GLY A 1 13 ? 6.080   -2.732  -4.696 1.00 0.00 ? 215 GLY A CA   9  
ATOM 10085 C C    . GLY A 1 13 ? 7.279   -2.996  -3.803 1.00 0.00 ? 215 GLY A C    9  
ATOM 10086 O O    . GLY A 1 13 ? 7.938   -4.028  -3.933 1.00 0.00 ? 215 GLY A O    9  
ATOM 10087 H H    . GLY A 1 13 ? 4.612   -1.557  -3.722 1.00 0.00 ? 215 GLY A H    9  
ATOM 10088 H HA2  . GLY A 1 13 ? 5.398   -3.565  -4.619 1.00 0.00 ? 215 GLY A HA2  9  
ATOM 10089 H HA3  . GLY A 1 13 ? 6.417   -2.649  -5.718 1.00 0.00 ? 215 GLY A HA3  9  
ATOM 10090 N N    . ASP A 1 14 ? 7.568   -2.065  -2.897 1.00 0.00 ? 216 ASP A N    9  
ATOM 10091 C CA   . ASP A 1 14 ? 8.698   -2.209  -1.989 1.00 0.00 ? 216 ASP A CA   9  
ATOM 10092 C C    . ASP A 1 14 ? 8.266   -2.823  -0.662 1.00 0.00 ? 216 ASP A C    9  
ATOM 10093 O O    . ASP A 1 14 ? 7.173   -2.554  -0.167 1.00 0.00 ? 216 ASP A O    9  
ATOM 10094 C CB   . ASP A 1 14 ? 9.360   -0.853  -1.743 1.00 0.00 ? 216 ASP A CB   9  
ATOM 10095 C CG   . ASP A 1 14 ? 10.283  -0.445  -2.874 1.00 0.00 ? 216 ASP A CG   9  
ATOM 10096 O OD1  . ASP A 1 14 ? 9.803   0.200   -3.830 1.00 0.00 ? 216 ASP A OD1  9  
ATOM 10097 O OD2  . ASP A 1 14 ? 11.487  -0.774  -2.807 1.00 0.00 ? 216 ASP A OD2  9  
ATOM 10098 H H    . ASP A 1 14 ? 7.011   -1.261  -2.840 1.00 0.00 ? 216 ASP A H    9  
ATOM 10099 H HA   . ASP A 1 14 ? 9.415   -2.866  -2.457 1.00 0.00 ? 216 ASP A HA   9  
ATOM 10100 H HB2  . ASP A 1 14 ? 8.593   -0.098  -1.640 1.00 0.00 ? 216 ASP A HB2  9  
ATOM 10101 H HB3  . ASP A 1 14 ? 9.936   -0.898  -0.831 1.00 0.00 ? 216 ASP A HB3  9  
ATOM 10102 N N    . ARG A 1 15 ? 9.138   -3.648  -0.089 1.00 0.00 ? 217 ARG A N    9  
ATOM 10103 C CA   . ARG A 1 15 ? 8.852   -4.297  1.185  1.00 0.00 ? 217 ARG A CA   9  
ATOM 10104 C C    . ARG A 1 15 ? 9.027   -3.313  2.335  1.00 0.00 ? 217 ARG A C    9  
ATOM 10105 O O    . ARG A 1 15 ? 9.996   -2.557  2.373  1.00 0.00 ? 217 ARG A O    9  
ATOM 10106 C CB   . ARG A 1 15 ? 9.768   -5.507  1.384  1.00 0.00 ? 217 ARG A CB   9  
ATOM 10107 C CG   . ARG A 1 15 ? 9.214   -6.539  2.350  1.00 0.00 ? 217 ARG A CG   9  
ATOM 10108 C CD   . ARG A 1 15 ? 8.294   -7.524  1.645  1.00 0.00 ? 217 ARG A CD   9  
ATOM 10109 N NE   . ARG A 1 15 ? 9.036   -8.609  1.009  1.00 0.00 ? 217 ARG A NE   9  
ATOM 10110 C CZ   . ARG A 1 15 ? 8.461   -9.633  0.382  1.00 0.00 ? 217 ARG A CZ   9  
ATOM 10111 N NH1  . ARG A 1 15 ? 7.138   -9.716  0.308  1.00 0.00 ? 217 ARG A NH1  9  
ATOM 10112 N NH2  . ARG A 1 15 ? 9.211   -10.577 -0.171 1.00 0.00 ? 217 ARG A NH2  9  
ATOM 10113 H H    . ARG A 1 15 ? 9.995   -3.820  -0.530 1.00 0.00 ? 217 ARG A H    9  
ATOM 10114 H HA   . ARG A 1 15 ? 7.826   -4.632  1.165  1.00 0.00 ? 217 ARG A HA   9  
ATOM 10115 H HB2  . ARG A 1 15 ? 9.925   -5.986  0.429  1.00 0.00 ? 217 ARG A HB2  9  
ATOM 10116 H HB3  . ARG A 1 15 ? 10.720  -5.162  1.764  1.00 0.00 ? 217 ARG A HB3  9  
ATOM 10117 H HG2  . ARG A 1 15 ? 10.035  -7.082  2.791  1.00 0.00 ? 217 ARG A HG2  9  
ATOM 10118 H HG3  . ARG A 1 15 ? 8.657   -6.031  3.125  1.00 0.00 ? 217 ARG A HG3  9  
ATOM 10119 H HD2  . ARG A 1 15 ? 7.613   -7.943  2.371  1.00 0.00 ? 217 ARG A HD2  9  
ATOM 10120 H HD3  . ARG A 1 15 ? 7.732   -6.993  0.892  1.00 0.00 ? 217 ARG A HD3  9  
ATOM 10121 H HE   . ARG A 1 15 ? 10.015  -8.572  1.049  1.00 0.00 ? 217 ARG A HE   9  
ATOM 10122 H HH11 . ARG A 1 15 ? 6.568   -9.008  0.723  1.00 0.00 ? 217 ARG A HH11 9  
ATOM 10123 H HH12 . ARG A 1 15 ? 6.713   -10.488 -0.165 1.00 0.00 ? 217 ARG A HH12 9  
ATOM 10124 H HH21 . ARG A 1 15 ? 10.208  -10.518 -0.118 1.00 0.00 ? 217 ARG A HH21 9  
ATOM 10125 H HH22 . ARG A 1 15 ? 8.779   -11.346 -0.641 1.00 0.00 ? 217 ARG A HH22 9  
ATOM 10126 N N    . VAL A 1 16 ? 8.079   -3.321  3.264  1.00 0.00 ? 218 VAL A N    9  
ATOM 10127 C CA   . VAL A 1 16 ? 8.130   -2.419  4.406  1.00 0.00 ? 218 VAL A CA   9  
ATOM 10128 C C    . VAL A 1 16 ? 7.380   -2.988  5.605  1.00 0.00 ? 218 VAL A C    9  
ATOM 10129 O O    . VAL A 1 16 ? 6.873   -4.108  5.562  1.00 0.00 ? 218 VAL A O    9  
ATOM 10130 C CB   . VAL A 1 16 ? 7.524   -1.045  4.055  1.00 0.00 ? 218 VAL A CB   9  
ATOM 10131 C CG1  . VAL A 1 16 ? 8.153   -0.491  2.786  1.00 0.00 ? 218 VAL A CG1  9  
ATOM 10132 C CG2  . VAL A 1 16 ? 6.010   -1.148  3.906  1.00 0.00 ? 218 VAL A CG2  9  
ATOM 10133 H H    . VAL A 1 16 ? 7.326   -3.942  3.175  1.00 0.00 ? 218 VAL A H    9  
ATOM 10134 H HA   . VAL A 1 16 ? 9.165   -2.273  4.674  1.00 0.00 ? 218 VAL A HA   9  
ATOM 10135 H HB   . VAL A 1 16 ? 7.739   -0.362  4.864  1.00 0.00 ? 218 VAL A HB   9  
ATOM 10136 H HG11 . VAL A 1 16 ? 9.229   -0.483  2.890  1.00 0.00 ? 218 VAL A HG11 9  
ATOM 10137 H HG12 . VAL A 1 16 ? 7.878   -1.112  1.946  1.00 0.00 ? 218 VAL A HG12 9  
ATOM 10138 H HG13 . VAL A 1 16 ? 7.801   0.517   2.618  1.00 0.00 ? 218 VAL A HG13 9  
ATOM 10139 H HG21 . VAL A 1 16 ? 5.763   -2.003  3.296  1.00 0.00 ? 218 VAL A HG21 9  
ATOM 10140 H HG22 . VAL A 1 16 ? 5.562   -1.261  4.884  1.00 0.00 ? 218 VAL A HG22 9  
ATOM 10141 H HG23 . VAL A 1 16 ? 5.630   -0.249  3.441  1.00 0.00 ? 218 VAL A HG23 9  
ATOM 10142 N N    . LEU A 1 17 ? 7.302   -2.192  6.665  1.00 0.00 ? 219 LEU A N    9  
ATOM 10143 C CA   . LEU A 1 17 ? 6.598   -2.593  7.874  1.00 0.00 ? 219 LEU A CA   9  
ATOM 10144 C C    . LEU A 1 17 ? 5.528   -1.571  8.225  1.00 0.00 ? 219 LEU A C    9  
ATOM 10145 O O    . LEU A 1 17 ? 5.828   -0.399  8.436  1.00 0.00 ? 219 LEU A O    9  
ATOM 10146 C CB   . LEU A 1 17 ? 7.565   -2.736  9.048  1.00 0.00 ? 219 LEU A CB   9  
ATOM 10147 C CG   . LEU A 1 17 ? 8.663   -3.786  8.879  1.00 0.00 ? 219 LEU A CG   9  
ATOM 10148 C CD1  . LEU A 1 17 ? 9.406   -3.987  10.192 1.00 0.00 ? 219 LEU A CD1  9  
ATOM 10149 C CD2  . LEU A 1 17 ? 8.076   -5.101  8.390  1.00 0.00 ? 219 LEU A CD2  9  
ATOM 10150 H H    . LEU A 1 17 ? 7.716   -1.305  6.627  1.00 0.00 ? 219 LEU A H    9  
ATOM 10151 H HA   . LEU A 1 17 ? 6.125   -3.545  7.686  1.00 0.00 ? 219 LEU A HA   9  
ATOM 10152 H HB2  . LEU A 1 17 ? 8.036   -1.777  9.215  1.00 0.00 ? 219 LEU A HB2  9  
ATOM 10153 H HB3  . LEU A 1 17 ? 6.988   -2.989  9.926  1.00 0.00 ? 219 LEU A HB3  9  
ATOM 10154 H HG   . LEU A 1 17 ? 9.374   -3.439  8.143  1.00 0.00 ? 219 LEU A HG   9  
ATOM 10155 H HD11 . LEU A 1 17 ? 9.269   -3.118  10.819 1.00 0.00 ? 219 LEU A HD11 9  
ATOM 10156 H HD12 . LEU A 1 17 ? 9.016   -4.860  10.696 1.00 0.00 ? 219 LEU A HD12 9  
ATOM 10157 H HD13 . LEU A 1 17 ? 10.457  -4.125  9.994  1.00 0.00 ? 219 LEU A HD13 9  
ATOM 10158 H HD21 . LEU A 1 17 ? 7.157   -5.306  8.921  1.00 0.00 ? 219 LEU A HD21 9  
ATOM 10159 H HD22 . LEU A 1 17 ? 7.871   -5.033  7.332  1.00 0.00 ? 219 LEU A HD22 9  
ATOM 10160 H HD23 . LEU A 1 17 ? 8.780   -5.899  8.570  1.00 0.00 ? 219 LEU A HD23 9  
ATOM 10161 N N    . VAL A 1 18 ? 4.284   -2.019  8.296  1.00 0.00 ? 220 VAL A N    9  
ATOM 10162 C CA   . VAL A 1 18 ? 3.180   -1.129  8.635  1.00 0.00 ? 220 VAL A CA   9  
ATOM 10163 C C    . VAL A 1 18 ? 2.997   -1.075  10.148 1.00 0.00 ? 220 VAL A C    9  
ATOM 10164 O O    . VAL A 1 18 ? 2.605   -2.062  10.774 1.00 0.00 ? 220 VAL A O    9  
ATOM 10165 C CB   . VAL A 1 18 ? 1.850   -1.549  7.962  1.00 0.00 ? 220 VAL A CB   9  
ATOM 10166 C CG1  . VAL A 1 18 ? 1.268   -0.392  7.160  1.00 0.00 ? 220 VAL A CG1  9  
ATOM 10167 C CG2  . VAL A 1 18 ? 2.038   -2.773  7.076  1.00 0.00 ? 220 VAL A CG2  9  
ATOM 10168 H H    . VAL A 1 18 ? 4.106   -2.967  8.128  1.00 0.00 ? 220 VAL A H    9  
ATOM 10169 H HA   . VAL A 1 18 ? 3.442   -0.139  8.286  1.00 0.00 ? 220 VAL A HA   9  
ATOM 10170 H HB   . VAL A 1 18 ? 1.142   -1.800  8.736  1.00 0.00 ? 220 VAL A HB   9  
ATOM 10171 H HG11 . VAL A 1 18 ? 2.038   0.341   6.975  1.00 0.00 ? 220 VAL A HG11 9  
ATOM 10172 H HG12 . VAL A 1 18 ? 0.889   -0.761  6.218  1.00 0.00 ? 220 VAL A HG12 9  
ATOM 10173 H HG13 . VAL A 1 18 ? 0.463   0.064   7.718  1.00 0.00 ? 220 VAL A HG13 9  
ATOM 10174 H HG21 . VAL A 1 18 ? 2.842   -2.591  6.378  1.00 0.00 ? 220 VAL A HG21 9  
ATOM 10175 H HG22 . VAL A 1 18 ? 2.281   -3.627  7.691  1.00 0.00 ? 220 VAL A HG22 9  
ATOM 10176 H HG23 . VAL A 1 18 ? 1.126   -2.970  6.533  1.00 0.00 ? 220 VAL A HG23 9  
ATOM 10177 N N    . GLY A 1 19 ? 3.298   0.082   10.729 1.00 0.00 ? 221 GLY A N    9  
ATOM 10178 C CA   . GLY A 1 19 ? 3.176   0.247   12.165 1.00 0.00 ? 221 GLY A CA   9  
ATOM 10179 C C    . GLY A 1 19 ? 4.430   -0.183  12.909 1.00 0.00 ? 221 GLY A C    9  
ATOM 10180 O O    . GLY A 1 19 ? 4.533   0.004   14.120 1.00 0.00 ? 221 GLY A O    9  
ATOM 10181 H H    . GLY A 1 19 ? 3.615   0.828   10.178 1.00 0.00 ? 221 GLY A H    9  
ATOM 10182 H HA2  . GLY A 1 19 ? 2.983   1.288   12.381 1.00 0.00 ? 221 GLY A HA2  9  
ATOM 10183 H HA3  . GLY A 1 19 ? 2.343   -0.343  12.515 1.00 0.00 ? 221 GLY A HA3  9  
ATOM 10184 N N    . GLY A 1 20 ? 5.386   -0.763  12.182 1.00 0.00 ? 222 GLY A N    9  
ATOM 10185 C CA   . GLY A 1 20 ? 6.624   -1.211  12.798 1.00 0.00 ? 222 GLY A CA   9  
ATOM 10186 C C    . GLY A 1 20 ? 6.553   -2.647  13.281 1.00 0.00 ? 222 GLY A C    9  
ATOM 10187 O O    . GLY A 1 20 ? 7.575   -3.323  13.386 1.00 0.00 ? 222 GLY A O    9  
ATOM 10188 H H    . GLY A 1 20 ? 5.252   -0.888  11.220 1.00 0.00 ? 222 GLY A H    9  
ATOM 10189 H HA2  . GLY A 1 20 ? 7.421   -1.128  12.077 1.00 0.00 ? 222 GLY A HA2  9  
ATOM 10190 H HA3  . GLY A 1 20 ? 6.848   -0.573  13.639 1.00 0.00 ? 222 GLY A HA3  9  
ATOM 10191 N N    . THR A 1 21 ? 5.345   -3.112  13.575 1.00 0.00 ? 223 THR A N    9  
ATOM 10192 C CA   . THR A 1 21 ? 5.145   -4.475  14.049 1.00 0.00 ? 223 THR A CA   9  
ATOM 10193 C C    . THR A 1 21 ? 4.654   -5.376  12.923 1.00 0.00 ? 223 THR A C    9  
ATOM 10194 O O    . THR A 1 21 ? 4.888   -6.585  12.935 1.00 0.00 ? 223 THR A O    9  
ATOM 10195 C CB   . THR A 1 21 ? 4.142   -4.485  15.202 1.00 0.00 ? 223 THR A CB   9  
ATOM 10196 O OG1  . THR A 1 21 ? 2.977   -3.754  14.858 1.00 0.00 ? 223 THR A OG1  9  
ATOM 10197 C CG2  . THR A 1 21 ? 4.699   -3.891  16.476 1.00 0.00 ? 223 THR A CG2  9  
ATOM 10198 H H    . THR A 1 21 ? 4.569   -2.527  13.472 1.00 0.00 ? 223 THR A H    9  
ATOM 10199 H HA   . THR A 1 21 ? 6.095   -4.846  14.405 1.00 0.00 ? 223 THR A HA   9  
ATOM 10200 H HB   . THR A 1 21 ? 3.854   -5.506  15.407 1.00 0.00 ? 223 THR A HB   9  
ATOM 10201 H HG1  . THR A 1 21 ? 2.207   -4.318  14.955 1.00 0.00 ? 223 THR A HG1  9  
ATOM 10202 H HG21 . THR A 1 21 ? 4.379   -2.864  16.564 1.00 0.00 ? 223 THR A HG21 9  
ATOM 10203 H HG22 . THR A 1 21 ? 5.778   -3.930  16.449 1.00 0.00 ? 223 THR A HG22 9  
ATOM 10204 H HG23 . THR A 1 21 ? 4.339   -4.455  17.324 1.00 0.00 ? 223 THR A HG23 9  
ATOM 10205 N N    . LYS A 1 22 ? 3.968   -4.781  11.953 1.00 0.00 ? 224 LYS A N    9  
ATOM 10206 C CA   . LYS A 1 22 ? 3.442   -5.532  10.820 1.00 0.00 ? 224 LYS A CA   9  
ATOM 10207 C C    . LYS A 1 22 ? 4.351   -5.377  9.605  1.00 0.00 ? 224 LYS A C    9  
ATOM 10208 O O    . LYS A 1 22 ? 4.975   -4.334  9.418  1.00 0.00 ? 224 LYS A O    9  
ATOM 10209 C CB   . LYS A 1 22 ? 2.025   -5.056  10.477 1.00 0.00 ? 224 LYS A CB   9  
ATOM 10210 C CG   . LYS A 1 22 ? 1.203   -4.633  11.688 1.00 0.00 ? 224 LYS A CG   9  
ATOM 10211 C CD   . LYS A 1 22 ? 0.526   -5.822  12.351 1.00 0.00 ? 224 LYS A CD   9  
ATOM 10212 C CE   . LYS A 1 22 ? 1.543   -6.823  12.876 1.00 0.00 ? 224 LYS A CE   9  
ATOM 10213 N NZ   . LYS A 1 22 ? 0.977   -7.666  13.966 1.00 0.00 ? 224 LYS A NZ   9  
ATOM 10214 H H    . LYS A 1 22 ? 3.812   -3.816  11.999 1.00 0.00 ? 224 LYS A H    9  
ATOM 10215 H HA   . LYS A 1 22 ? 3.405   -6.574  11.099 1.00 0.00 ? 224 LYS A HA   9  
ATOM 10216 H HB2  . LYS A 1 22 ? 2.096   -4.213  9.807  1.00 0.00 ? 224 LYS A HB2  9  
ATOM 10217 H HB3  . LYS A 1 22 ? 1.501   -5.858  9.976  1.00 0.00 ? 224 LYS A HB3  9  
ATOM 10218 H HG2  . LYS A 1 22 ? 1.852   -4.156  12.406 1.00 0.00 ? 224 LYS A HG2  9  
ATOM 10219 H HG3  . LYS A 1 22 ? 0.446   -3.934  11.367 1.00 0.00 ? 224 LYS A HG3  9  
ATOM 10220 H HD2  . LYS A 1 22 ? -0.075  -5.468  13.175 1.00 0.00 ? 224 LYS A HD2  9  
ATOM 10221 H HD3  . LYS A 1 22 ? -0.106  -6.312  11.628 1.00 0.00 ? 224 LYS A HD3  9  
ATOM 10222 H HE2  . LYS A 1 22 ? 1.854   -7.462  12.064 1.00 0.00 ? 224 LYS A HE2  9  
ATOM 10223 H HE3  . LYS A 1 22 ? 2.395   -6.282  13.257 1.00 0.00 ? 224 LYS A HE3  9  
ATOM 10224 H HZ1  . LYS A 1 22 ? 1.365   -8.630  13.910 1.00 0.00 ? 224 LYS A HZ1  9  
ATOM 10225 H HZ2  . LYS A 1 22 ? -0.058  -7.715  13.880 1.00 0.00 ? 224 LYS A HZ2  9  
ATOM 10226 H HZ3  . LYS A 1 22 ? 1.218   -7.262  14.893 1.00 0.00 ? 224 LYS A HZ3  9  
ATOM 10227 N N    . ALA A 1 23 ? 4.425   -6.418  8.781  1.00 0.00 ? 225 ALA A N    9  
ATOM 10228 C CA   . ALA A 1 23 ? 5.261   -6.388  7.586  1.00 0.00 ? 225 ALA A CA   9  
ATOM 10229 C C    . ALA A 1 23 ? 4.429   -6.601  6.331  1.00 0.00 ? 225 ALA A C    9  
ATOM 10230 O O    . ALA A 1 23 ? 3.438   -7.329  6.348  1.00 0.00 ? 225 ALA A O    9  
ATOM 10231 C CB   . ALA A 1 23 ? 6.355   -7.440  7.670  1.00 0.00 ? 225 ALA A CB   9  
ATOM 10232 H H    . ALA A 1 23 ? 3.905   -7.225  8.982  1.00 0.00 ? 225 ALA A H    9  
ATOM 10233 H HA   . ALA A 1 23 ? 5.731   -5.418  7.533  1.00 0.00 ? 225 ALA A HA   9  
ATOM 10234 H HB1  . ALA A 1 23 ? 6.806   -7.411  8.651  1.00 0.00 ? 225 ALA A HB1  9  
ATOM 10235 H HB2  . ALA A 1 23 ? 5.927   -8.417  7.497  1.00 0.00 ? 225 ALA A HB2  9  
ATOM 10236 H HB3  . ALA A 1 23 ? 7.105   -7.237  6.921  1.00 0.00 ? 225 ALA A HB3  9  
ATOM 10237 N N    . GLY A 1 24 ? 4.840   -5.962  5.240  1.00 0.00 ? 226 GLY A N    9  
ATOM 10238 C CA   . GLY A 1 24 ? 4.121   -6.100  3.991  1.00 0.00 ? 226 GLY A CA   9  
ATOM 10239 C C    . GLY A 1 24 ? 4.776   -5.343  2.853  1.00 0.00 ? 226 GLY A C    9  
ATOM 10240 O O    . GLY A 1 24 ? 5.917   -4.897  2.968  1.00 0.00 ? 226 GLY A O    9  
ATOM 10241 H H    . GLY A 1 24 ? 5.639   -5.397  5.286  1.00 0.00 ? 226 GLY A H    9  
ATOM 10242 H HA2  . GLY A 1 24 ? 4.070   -7.147  3.731  1.00 0.00 ? 226 GLY A HA2  9  
ATOM 10243 H HA3  . GLY A 1 24 ? 3.117   -5.725  4.126  1.00 0.00 ? 226 GLY A HA3  9  
ATOM 10244 N N    . VAL A 1 25 ? 4.049   -5.202  1.749  1.00 0.00 ? 227 VAL A N    9  
ATOM 10245 C CA   . VAL A 1 25 ? 4.558   -4.497  0.580  1.00 0.00 ? 227 VAL A CA   9  
ATOM 10246 C C    . VAL A 1 25 ? 3.679   -3.299  0.238  1.00 0.00 ? 227 VAL A C    9  
ATOM 10247 O O    . VAL A 1 25 ? 2.454   -3.406  0.210  1.00 0.00 ? 227 VAL A O    9  
ATOM 10248 C CB   . VAL A 1 25 ? 4.640   -5.434  -0.645 1.00 0.00 ? 227 VAL A CB   9  
ATOM 10249 C CG1  . VAL A 1 25 ? 4.970   -4.654  -1.908 1.00 0.00 ? 227 VAL A CG1  9  
ATOM 10250 C CG2  . VAL A 1 25 ? 5.665   -6.532  -0.406 1.00 0.00 ? 227 VAL A CG2  9  
ATOM 10251 H H    . VAL A 1 25 ? 3.147   -5.583  1.721  1.00 0.00 ? 227 VAL A H    9  
ATOM 10252 H HA   . VAL A 1 25 ? 5.556   -4.147  0.808  1.00 0.00 ? 227 VAL A HA   9  
ATOM 10253 H HB   . VAL A 1 25 ? 3.674   -5.900  -0.778 1.00 0.00 ? 227 VAL A HB   9  
ATOM 10254 H HG11 . VAL A 1 25 ? 4.053   -4.385  -2.414 1.00 0.00 ? 227 VAL A HG11 9  
ATOM 10255 H HG12 . VAL A 1 25 ? 5.513   -3.759  -1.647 1.00 0.00 ? 227 VAL A HG12 9  
ATOM 10256 H HG13 . VAL A 1 25 ? 5.576   -5.266  -2.561 1.00 0.00 ? 227 VAL A HG13 9  
ATOM 10257 H HG21 . VAL A 1 25 ? 5.676   -6.794  0.643  1.00 0.00 ? 227 VAL A HG21 9  
ATOM 10258 H HG22 . VAL A 1 25 ? 5.406   -7.402  -0.991 1.00 0.00 ? 227 VAL A HG22 9  
ATOM 10259 H HG23 . VAL A 1 25 ? 6.643   -6.179  -0.699 1.00 0.00 ? 227 VAL A HG23 9  
ATOM 10260 N N    . VAL A 1 26 ? 4.310   -2.163  -0.034 1.00 0.00 ? 228 VAL A N    9  
ATOM 10261 C CA   . VAL A 1 26 ? 3.581   -0.954  -0.386 1.00 0.00 ? 228 VAL A CA   9  
ATOM 10262 C C    . VAL A 1 26 ? 2.798   -1.159  -1.677 1.00 0.00 ? 228 VAL A C    9  
ATOM 10263 O O    . VAL A 1 26 ? 3.354   -1.577  -2.691 1.00 0.00 ? 228 VAL A O    9  
ATOM 10264 C CB   . VAL A 1 26 ? 4.531   0.244   -0.552 1.00 0.00 ? 228 VAL A CB   9  
ATOM 10265 C CG1  . VAL A 1 26 ? 3.745   1.533   -0.743 1.00 0.00 ? 228 VAL A CG1  9  
ATOM 10266 C CG2  . VAL A 1 26 ? 5.462   0.347   0.647  1.00 0.00 ? 228 VAL A CG2  9  
ATOM 10267 H H    . VAL A 1 26 ? 5.290   -2.142  -0.007 1.00 0.00 ? 228 VAL A H    9  
ATOM 10268 H HA   . VAL A 1 26 ? 2.890   -0.735  0.414  1.00 0.00 ? 228 VAL A HA   9  
ATOM 10269 H HB   . VAL A 1 26 ? 5.132   0.082   -1.434 1.00 0.00 ? 228 VAL A HB   9  
ATOM 10270 H HG11 . VAL A 1 26 ? 3.802   2.127   0.156  1.00 0.00 ? 228 VAL A HG11 9  
ATOM 10271 H HG12 . VAL A 1 26 ? 4.163   2.090   -1.569 1.00 0.00 ? 228 VAL A HG12 9  
ATOM 10272 H HG13 . VAL A 1 26 ? 2.713   1.298   -0.954 1.00 0.00 ? 228 VAL A HG13 9  
ATOM 10273 H HG21 . VAL A 1 26 ? 5.649   1.387   0.870  1.00 0.00 ? 228 VAL A HG21 9  
ATOM 10274 H HG22 . VAL A 1 26 ? 5.004   -0.128  1.501  1.00 0.00 ? 228 VAL A HG22 9  
ATOM 10275 H HG23 . VAL A 1 26 ? 6.396   -0.146  0.420  1.00 0.00 ? 228 VAL A HG23 9  
ATOM 10276 N N    . ARG A 1 27 ? 1.499   -0.879  -1.631 1.00 0.00 ? 229 ARG A N    9  
ATOM 10277 C CA   . ARG A 1 27 ? 0.643   -1.052  -2.800 1.00 0.00 ? 229 ARG A CA   9  
ATOM 10278 C C    . ARG A 1 27 ? 0.113   0.286   -3.308 1.00 0.00 ? 229 ARG A C    9  
ATOM 10279 O O    . ARG A 1 27 ? 0.122   0.548   -4.511 1.00 0.00 ? 229 ARG A O    9  
ATOM 10280 C CB   . ARG A 1 27 ? -0.521  -1.985  -2.459 1.00 0.00 ? 229 ARG A CB   9  
ATOM 10281 C CG   . ARG A 1 27 ? -0.113  -3.188  -1.625 1.00 0.00 ? 229 ARG A CG   9  
ATOM 10282 C CD   . ARG A 1 27 ? 0.952   -4.016  -2.324 1.00 0.00 ? 229 ARG A CD   9  
ATOM 10283 N NE   . ARG A 1 27 ? 0.372   -5.113  -3.095 1.00 0.00 ? 229 ARG A NE   9  
ATOM 10284 C CZ   . ARG A 1 27 ? -0.024  -5.008  -4.362 1.00 0.00 ? 229 ARG A CZ   9  
ATOM 10285 N NH1  . ARG A 1 27 ? 0.091   -3.855  -5.011 1.00 0.00 ? 229 ARG A NH1  9  
ATOM 10286 N NH2  . ARG A 1 27 ? -0.537  -6.060  -4.983 1.00 0.00 ? 229 ARG A NH2  9  
ATOM 10287 H H    . ARG A 1 27 ? 1.106   -0.558  -0.793 1.00 0.00 ? 229 ARG A H    9  
ATOM 10288 H HA   . ARG A 1 27 ? 1.237   -1.506  -3.577 1.00 0.00 ? 229 ARG A HA   9  
ATOM 10289 H HB2  . ARG A 1 27 ? -1.264  -1.430  -1.910 1.00 0.00 ? 229 ARG A HB2  9  
ATOM 10290 H HB3  . ARG A 1 27 ? -0.959  -2.344  -3.376 1.00 0.00 ? 229 ARG A HB3  9  
ATOM 10291 H HG2  . ARG A 1 27 ? 0.278   -2.842  -0.680 1.00 0.00 ? 229 ARG A HG2  9  
ATOM 10292 H HG3  . ARG A 1 27 ? -0.982  -3.806  -1.452 1.00 0.00 ? 229 ARG A HG3  9  
ATOM 10293 H HD2  . ARG A 1 27 ? 1.512   -3.376  -2.989 1.00 0.00 ? 229 ARG A HD2  9  
ATOM 10294 H HD3  . ARG A 1 27 ? 1.617   -4.426  -1.578 1.00 0.00 ? 229 ARG A HD3  9  
ATOM 10295 H HE   . ARG A 1 27 ? 0.270   -5.974  -2.642 1.00 0.00 ? 229 ARG A HE   9  
ATOM 10296 H HH11 . ARG A 1 27 ? 0.475   -3.057  -4.550 1.00 0.00 ? 229 ARG A HH11 9  
ATOM 10297 H HH12 . ARG A 1 27 ? -0.207  -3.786  -5.962 1.00 0.00 ? 229 ARG A HH12 9  
ATOM 10298 H HH21 . ARG A 1 27 ? -0.628  -6.931  -4.501 1.00 0.00 ? 229 ARG A HH21 9  
ATOM 10299 H HH22 . ARG A 1 27 ? -0.835  -5.983  -5.935 1.00 0.00 ? 229 ARG A HH22 9  
ATOM 10300 N N    . PHE A 1 28 ? -0.349  1.128   -2.391 1.00 0.00 ? 230 PHE A N    9  
ATOM 10301 C CA   . PHE A 1 28 ? -0.882  2.436   -2.757 1.00 0.00 ? 230 PHE A CA   9  
ATOM 10302 C C    . PHE A 1 28 ? -0.608  3.459   -1.662 1.00 0.00 ? 230 PHE A C    9  
ATOM 10303 O O    . PHE A 1 28 ? -0.827  3.191   -0.486 1.00 0.00 ? 230 PHE A O    9  
ATOM 10304 C CB   . PHE A 1 28 ? -2.387  2.340   -3.018 1.00 0.00 ? 230 PHE A CB   9  
ATOM 10305 C CG   . PHE A 1 28 ? -2.934  3.492   -3.812 1.00 0.00 ? 230 PHE A CG   9  
ATOM 10306 C CD1  . PHE A 1 28 ? -2.848  3.498   -5.195 1.00 0.00 ? 230 PHE A CD1  9  
ATOM 10307 C CD2  . PHE A 1 28 ? -3.534  4.567   -3.176 1.00 0.00 ? 230 PHE A CD2  9  
ATOM 10308 C CE1  . PHE A 1 28 ? -3.351  4.558   -5.929 1.00 0.00 ? 230 PHE A CE1  9  
ATOM 10309 C CE2  . PHE A 1 28 ? -4.039  5.627   -3.904 1.00 0.00 ? 230 PHE A CE2  9  
ATOM 10310 C CZ   . PHE A 1 28 ? -3.948  5.622   -5.282 1.00 0.00 ? 230 PHE A CZ   9  
ATOM 10311 H H    . PHE A 1 28 ? -0.331  0.865   -1.448 1.00 0.00 ? 230 PHE A H    9  
ATOM 10312 H HA   . PHE A 1 28 ? -0.390  2.754   -3.662 1.00 0.00 ? 230 PHE A HA   9  
ATOM 10313 H HB2  . PHE A 1 28 ? -2.594  1.433   -3.564 1.00 0.00 ? 230 PHE A HB2  9  
ATOM 10314 H HB3  . PHE A 1 28 ? -2.907  2.311   -2.071 1.00 0.00 ? 230 PHE A HB3  9  
ATOM 10315 H HD1  . PHE A 1 28 ? -2.383  2.666   -5.701 1.00 0.00 ? 230 PHE A HD1  9  
ATOM 10316 H HD2  . PHE A 1 28 ? -3.606  4.571   -2.098 1.00 0.00 ? 230 PHE A HD2  9  
ATOM 10317 H HE1  . PHE A 1 28 ? -3.278  4.550   -7.006 1.00 0.00 ? 230 PHE A HE1  9  
ATOM 10318 H HE2  . PHE A 1 28 ? -4.505  6.459   -3.397 1.00 0.00 ? 230 PHE A HE2  9  
ATOM 10319 H HZ   . PHE A 1 28 ? -4.340  6.450   -5.853 1.00 0.00 ? 230 PHE A HZ   9  
ATOM 10320 N N    . LEU A 1 29 ? -0.134  4.637   -2.056 1.00 0.00 ? 231 LEU A N    9  
ATOM 10321 C CA   . LEU A 1 29 ? 0.164   5.695   -1.096 1.00 0.00 ? 231 LEU A CA   9  
ATOM 10322 C C    . LEU A 1 29 ? -0.703  6.922   -1.349 1.00 0.00 ? 231 LEU A C    9  
ATOM 10323 O O    . LEU A 1 29 ? -0.762  7.436   -2.466 1.00 0.00 ? 231 LEU A O    9  
ATOM 10324 C CB   . LEU A 1 29 ? 1.645   6.078   -1.165 1.00 0.00 ? 231 LEU A CB   9  
ATOM 10325 C CG   . LEU A 1 29 ? 2.623   4.900   -1.114 1.00 0.00 ? 231 LEU A CG   9  
ATOM 10326 C CD1  . LEU A 1 29 ? 3.333   4.733   -2.448 1.00 0.00 ? 231 LEU A CD1  9  
ATOM 10327 C CD2  . LEU A 1 29 ? 3.634   5.093   0.008  1.00 0.00 ? 231 LEU A CD2  9  
ATOM 10328 H H    . LEU A 1 29 ? 0.015   4.799   -3.010 1.00 0.00 ? 231 LEU A H    9  
ATOM 10329 H HA   . LEU A 1 29 ? -0.051  5.315   -0.109 1.00 0.00 ? 231 LEU A HA   9  
ATOM 10330 H HB2  . LEU A 1 29 ? 1.811   6.620   -2.084 1.00 0.00 ? 231 LEU A HB2  9  
ATOM 10331 H HB3  . LEU A 1 29 ? 1.863   6.735   -0.336 1.00 0.00 ? 231 LEU A HB3  9  
ATOM 10332 H HG   . LEU A 1 29 ? 2.071   3.993   -0.914 1.00 0.00 ? 231 LEU A HG   9  
ATOM 10333 H HD11 . LEU A 1 29 ? 3.410   5.692   -2.937 1.00 0.00 ? 231 LEU A HD11 9  
ATOM 10334 H HD12 . LEU A 1 29 ? 4.323   4.332   -2.282 1.00 0.00 ? 231 LEU A HD12 9  
ATOM 10335 H HD13 . LEU A 1 29 ? 2.771   4.054   -3.072 1.00 0.00 ? 231 LEU A HD13 9  
ATOM 10336 H HD21 . LEU A 1 29 ? 4.355   5.841   -0.283 1.00 0.00 ? 231 LEU A HD21 9  
ATOM 10337 H HD22 . LEU A 1 29 ? 3.122   5.415   0.903  1.00 0.00 ? 231 LEU A HD22 9  
ATOM 10338 H HD23 . LEU A 1 29 ? 4.142   4.159   0.199  1.00 0.00 ? 231 LEU A HD23 9  
ATOM 10339 N N    . GLY A 1 30 ? -1.379  7.386   -0.302 1.00 0.00 ? 232 GLY A N    9  
ATOM 10340 C CA   . GLY A 1 30 ? -2.238  8.549   -0.428 1.00 0.00 ? 232 GLY A CA   9  
ATOM 10341 C C    . GLY A 1 30 ? -3.126  8.745   0.785  1.00 0.00 ? 232 GLY A C    9  
ATOM 10342 O O    . GLY A 1 30 ? -2.998  8.031   1.779  1.00 0.00 ? 232 GLY A O    9  
ATOM 10343 H H    . GLY A 1 30 ? -1.293  6.935   0.563  1.00 0.00 ? 232 GLY A H    9  
ATOM 10344 H HA2  . GLY A 1 30 ? -1.620  9.427   -0.554 1.00 0.00 ? 232 GLY A HA2  9  
ATOM 10345 H HA3  . GLY A 1 30 ? -2.860  8.430   -1.303 1.00 0.00 ? 232 GLY A HA3  9  
ATOM 10346 N N    . GLU A 1 31 ? -4.030  9.715   0.703  1.00 0.00 ? 233 GLU A N    9  
ATOM 10347 C CA   . GLU A 1 31 ? -4.942  10.002  1.804  1.00 0.00 ? 233 GLU A CA   9  
ATOM 10348 C C    . GLU A 1 31 ? -6.104  9.012   1.818  1.00 0.00 ? 233 GLU A C    9  
ATOM 10349 O O    . GLU A 1 31 ? -6.375  8.345   0.820  1.00 0.00 ? 233 GLU A O    9  
ATOM 10350 C CB   . GLU A 1 31 ? -5.476  11.431  1.694  1.00 0.00 ? 233 GLU A CB   9  
ATOM 10351 C CG   . GLU A 1 31 ? -4.390  12.468  1.451  1.00 0.00 ? 233 GLU A CG   9  
ATOM 10352 C CD   . GLU A 1 31 ? -4.653  13.315  0.221  1.00 0.00 ? 233 GLU A CD   9  
ATOM 10353 O OE1  . GLU A 1 31 ? -5.839  13.562  -0.086 1.00 0.00 ? 233 GLU A OE1  9  
ATOM 10354 O OE2  . GLU A 1 31 ? -3.675  13.730  -0.435 1.00 0.00 ? 233 GLU A OE2  9  
ATOM 10355 H H    . GLU A 1 31 ? -4.085  10.252  -0.116 1.00 0.00 ? 233 GLU A H    9  
ATOM 10356 H HA   . GLU A 1 31 ? -4.390  9.903   2.726  1.00 0.00 ? 233 GLU A HA   9  
ATOM 10357 H HB2  . GLU A 1 31 ? -6.179  11.478  0.876  1.00 0.00 ? 233 GLU A HB2  9  
ATOM 10358 H HB3  . GLU A 1 31 ? -5.986  11.685  2.612  1.00 0.00 ? 233 GLU A HB3  9  
ATOM 10359 H HG2  . GLU A 1 31 ? -4.331  13.118  2.310  1.00 0.00 ? 233 GLU A HG2  9  
ATOM 10360 H HG3  . GLU A 1 31 ? -3.446  11.958  1.324  1.00 0.00 ? 233 GLU A HG3  9  
ATOM 10361 N N    . THR A 1 32 ? -6.785  8.923   2.955  1.00 0.00 ? 234 THR A N    9  
ATOM 10362 C CA   . THR A 1 32 ? -7.915  8.013   3.098  1.00 0.00 ? 234 THR A CA   9  
ATOM 10363 C C    . THR A 1 32 ? -9.230  8.783   3.160  1.00 0.00 ? 234 THR A C    9  
ATOM 10364 O O    . THR A 1 32 ? -9.242  9.991   3.394  1.00 0.00 ? 234 THR A O    9  
ATOM 10365 C CB   . THR A 1 32 ? -7.756  7.158   4.356  1.00 0.00 ? 234 THR A CB   9  
ATOM 10366 O OG1  . THR A 1 32 ? -7.932  7.944   5.521  1.00 0.00 ? 234 THR A OG1  9  
ATOM 10367 C CG2  . THR A 1 32 ? -6.403  6.487   4.454  1.00 0.00 ? 234 THR A CG2  9  
ATOM 10368 H H    . THR A 1 32 ? -6.521  9.480   3.717  1.00 0.00 ? 234 THR A H    9  
ATOM 10369 H HA   . THR A 1 32 ? -7.932  7.366   2.234  1.00 0.00 ? 234 THR A HA   9  
ATOM 10370 H HB   . THR A 1 32 ? -8.509  6.384   4.352  1.00 0.00 ? 234 THR A HB   9  
ATOM 10371 H HG1  . THR A 1 32 ? -7.390  8.734   5.460  1.00 0.00 ? 234 THR A HG1  9  
ATOM 10372 H HG21 . THR A 1 32 ? -5.627  7.238   4.445  1.00 0.00 ? 234 THR A HG21 9  
ATOM 10373 H HG22 . THR A 1 32 ? -6.270  5.820   3.615  1.00 0.00 ? 234 THR A HG22 9  
ATOM 10374 H HG23 . THR A 1 32 ? -6.348  5.923   5.375  1.00 0.00 ? 234 THR A HG23 9  
ATOM 10375 N N    . ASP A 1 33 ? -10.334 8.075   2.949  1.00 0.00 ? 235 ASP A N    9  
ATOM 10376 C CA   . ASP A 1 33 ? -11.656 8.691   2.981  1.00 0.00 ? 235 ASP A CA   9  
ATOM 10377 C C    . ASP A 1 33 ? -12.222 8.720   4.401  1.00 0.00 ? 235 ASP A C    9  
ATOM 10378 O O    . ASP A 1 33 ? -13.291 9.284   4.637  1.00 0.00 ? 235 ASP A O    9  
ATOM 10379 C CB   . ASP A 1 33 ? -12.613 7.938   2.056  1.00 0.00 ? 235 ASP A CB   9  
ATOM 10380 C CG   . ASP A 1 33 ? -12.539 8.430   0.623  1.00 0.00 ? 235 ASP A CG   9  
ATOM 10381 O OD1  . ASP A 1 33 ? -13.164 9.467   0.320  1.00 0.00 ? 235 ASP A OD1  9  
ATOM 10382 O OD2  . ASP A 1 33 ? -11.857 7.777   -0.194 1.00 0.00 ? 235 ASP A OD2  9  
ATOM 10383 H H    . ASP A 1 33 ? -10.258 7.115   2.769  1.00 0.00 ? 235 ASP A H    9  
ATOM 10384 H HA   . ASP A 1 33 ? -11.555 9.706   2.627  1.00 0.00 ? 235 ASP A HA   9  
ATOM 10385 H HB2  . ASP A 1 33 ? -12.364 6.887   2.069  1.00 0.00 ? 235 ASP A HB2  9  
ATOM 10386 H HB3  . ASP A 1 33 ? -13.625 8.068   2.411  1.00 0.00 ? 235 ASP A HB3  9  
ATOM 10387 N N    . PHE A 1 34 ? -11.506 8.115   5.344  1.00 0.00 ? 236 PHE A N    9  
ATOM 10388 C CA   . PHE A 1 34 ? -11.950 8.081   6.735  1.00 0.00 ? 236 PHE A CA   9  
ATOM 10389 C C    . PHE A 1 34 ? -10.921 8.725   7.667  1.00 0.00 ? 236 PHE A C    9  
ATOM 10390 O O    . PHE A 1 34 ? -11.236 9.069   8.806  1.00 0.00 ? 236 PHE A O    9  
ATOM 10391 C CB   . PHE A 1 34 ? -12.227 6.635   7.172  1.00 0.00 ? 236 PHE A CB   9  
ATOM 10392 C CG   . PHE A 1 34 ? -10.995 5.862   7.562  1.00 0.00 ? 236 PHE A CG   9  
ATOM 10393 C CD1  . PHE A 1 34 ? -9.979  5.635   6.646  1.00 0.00 ? 236 PHE A CD1  9  
ATOM 10394 C CD2  . PHE A 1 34 ? -10.854 5.367   8.849  1.00 0.00 ? 236 PHE A CD2  9  
ATOM 10395 C CE1  . PHE A 1 34 ? -8.848  4.926   7.007  1.00 0.00 ? 236 PHE A CE1  9  
ATOM 10396 C CE2  . PHE A 1 34 ? -9.726  4.658   9.214  1.00 0.00 ? 236 PHE A CE2  9  
ATOM 10397 C CZ   . PHE A 1 34 ? -8.721  4.438   8.292  1.00 0.00 ? 236 PHE A CZ   9  
ATOM 10398 H H    . PHE A 1 34 ? -10.662 7.682   5.102  1.00 0.00 ? 236 PHE A H    9  
ATOM 10399 H HA   . PHE A 1 34 ? -12.870 8.643   6.797  1.00 0.00 ? 236 PHE A HA   9  
ATOM 10400 H HB2  . PHE A 1 34 ? -12.890 6.648   8.025  1.00 0.00 ? 236 PHE A HB2  9  
ATOM 10401 H HB3  . PHE A 1 34 ? -12.706 6.110   6.360  1.00 0.00 ? 236 PHE A HB3  9  
ATOM 10402 H HD1  . PHE A 1 34 ? -10.077 6.015   5.642  1.00 0.00 ? 236 PHE A HD1  9  
ATOM 10403 H HD2  . PHE A 1 34 ? -11.639 5.538   9.571  1.00 0.00 ? 236 PHE A HD2  9  
ATOM 10404 H HE1  . PHE A 1 34 ? -8.065  4.756   6.283  1.00 0.00 ? 236 PHE A HE1  9  
ATOM 10405 H HE2  . PHE A 1 34 ? -9.628  4.277   10.220 1.00 0.00 ? 236 PHE A HE2  9  
ATOM 10406 H HZ   . PHE A 1 34 ? -7.838  3.885   8.575  1.00 0.00 ? 236 PHE A HZ   9  
ATOM 10407 N N    . ALA A 1 35 ? -9.693  8.883   7.180  1.00 0.00 ? 237 ALA A N    9  
ATOM 10408 C CA   . ALA A 1 35 ? -8.630  9.482   7.978  1.00 0.00 ? 237 ALA A CA   9  
ATOM 10409 C C    . ALA A 1 35 ? -8.079  10.737  7.309  1.00 0.00 ? 237 ALA A C    9  
ATOM 10410 O O    . ALA A 1 35 ? -7.898  10.775  6.093  1.00 0.00 ? 237 ALA A O    9  
ATOM 10411 C CB   . ALA A 1 35 ? -7.516  8.475   8.212  1.00 0.00 ? 237 ALA A CB   9  
ATOM 10412 H H    . ALA A 1 35 ? -9.493  8.590   6.268  1.00 0.00 ? 237 ALA A H    9  
ATOM 10413 H HA   . ALA A 1 35 ? -9.047  9.751   8.937  1.00 0.00 ? 237 ALA A HA   9  
ATOM 10414 H HB1  . ALA A 1 35 ? -7.937  7.484   8.295  1.00 0.00 ? 237 ALA A HB1  9  
ATOM 10415 H HB2  . ALA A 1 35 ? -6.824  8.503   7.382  1.00 0.00 ? 237 ALA A HB2  9  
ATOM 10416 H HB3  . ALA A 1 35 ? -6.993  8.721   9.124  1.00 0.00 ? 237 ALA A HB3  9  
ATOM 10417 N N    . LYS A 1 36 ? -7.813  11.761  8.113  1.00 0.00 ? 238 LYS A N    9  
ATOM 10418 C CA   . LYS A 1 36 ? -7.280  13.017  7.600  1.00 0.00 ? 238 LYS A CA   9  
ATOM 10419 C C    . LYS A 1 36 ? -5.755  12.989  7.566  1.00 0.00 ? 238 LYS A C    9  
ATOM 10420 O O    . LYS A 1 36 ? -5.111  12.585  8.536  1.00 0.00 ? 238 LYS A O    9  
ATOM 10421 C CB   . LYS A 1 36 ? -7.760  14.189  8.459  1.00 0.00 ? 238 LYS A CB   9  
ATOM 10422 C CG   . LYS A 1 36 ? -9.258  14.177  8.722  1.00 0.00 ? 238 LYS A CG   9  
ATOM 10423 C CD   . LYS A 1 36 ? -9.682  15.363  9.573  1.00 0.00 ? 238 LYS A CD   9  
ATOM 10424 C CE   . LYS A 1 36 ? -9.824  14.977  11.036 1.00 0.00 ? 238 LYS A CE   9  
ATOM 10425 N NZ   . LYS A 1 36 ? -10.687 15.934  11.782 1.00 0.00 ? 238 LYS A NZ   9  
ATOM 10426 H H    . LYS A 1 36 ? -7.978  11.670  9.076  1.00 0.00 ? 238 LYS A H    9  
ATOM 10427 H HA   . LYS A 1 36 ? -7.648  13.147  6.593  1.00 0.00 ? 238 LYS A HA   9  
ATOM 10428 H HB2  . LYS A 1 36 ? -7.249  14.155  9.410  1.00 0.00 ? 238 LYS A HB2  9  
ATOM 10429 H HB3  . LYS A 1 36 ? -7.511  15.113  7.959  1.00 0.00 ? 238 LYS A HB3  9  
ATOM 10430 H HG2  . LYS A 1 36 ? -9.779  14.219  7.779  1.00 0.00 ? 238 LYS A HG2  9  
ATOM 10431 H HG3  . LYS A 1 36 ? -9.515  13.264  9.239  1.00 0.00 ? 238 LYS A HG3  9  
ATOM 10432 H HD2  . LYS A 1 36 ? -8.937  16.140  9.489  1.00 0.00 ? 238 LYS A HD2  9  
ATOM 10433 H HD3  . LYS A 1 36 ? -10.631 15.732  9.212  1.00 0.00 ? 238 LYS A HD3  9  
ATOM 10434 H HE2  . LYS A 1 36 ? -10.263 13.991  11.094 1.00 0.00 ? 238 LYS A HE2  9  
ATOM 10435 H HE3  . LYS A 1 36 ? -8.844  14.959  11.488 1.00 0.00 ? 238 LYS A HE3  9  
ATOM 10436 H HZ1  . LYS A 1 36 ? -11.672 15.601  11.785 1.00 0.00 ? 238 LYS A HZ1  9  
ATOM 10437 H HZ2  . LYS A 1 36 ? -10.649 16.872  11.335 1.00 0.00 ? 238 LYS A HZ2  9  
ATOM 10438 H HZ3  . LYS A 1 36 ? -10.359 16.019  12.766 1.00 0.00 ? 238 LYS A HZ3  9  
ATOM 10439 N N    . GLY A 1 37 ? -5.183  13.419  6.447  1.00 0.00 ? 239 GLY A N    9  
ATOM 10440 C CA   . GLY A 1 37 ? -3.738  13.434  6.309  1.00 0.00 ? 239 GLY A CA   9  
ATOM 10441 C C    . GLY A 1 37 ? -3.245  12.469  5.248  1.00 0.00 ? 239 GLY A C    9  
ATOM 10442 O O    . GLY A 1 37 ? -4.027  11.974  4.439  1.00 0.00 ? 239 GLY A O    9  
ATOM 10443 H H    . GLY A 1 37 ? -5.747  13.729  5.708  1.00 0.00 ? 239 GLY A H    9  
ATOM 10444 H HA2  . GLY A 1 37 ? -3.423  14.432  6.046  1.00 0.00 ? 239 GLY A HA2  9  
ATOM 10445 H HA3  . GLY A 1 37 ? -3.295  13.167  7.258  1.00 0.00 ? 239 GLY A HA3  9  
ATOM 10446 N N    . GLU A 1 38 ? -1.942  12.205  5.254  1.00 0.00 ? 240 GLU A N    9  
ATOM 10447 C CA   . GLU A 1 38 ? -1.343  11.294  4.285  1.00 0.00 ? 240 GLU A CA   9  
ATOM 10448 C C    . GLU A 1 38 ? -1.225  9.887   4.860  1.00 0.00 ? 240 GLU A C    9  
ATOM 10449 O O    . GLU A 1 38 ? -0.734  9.699   5.974  1.00 0.00 ? 240 GLU A O    9  
ATOM 10450 C CB   . GLU A 1 38 ? 0.036   11.802  3.862  1.00 0.00 ? 240 GLU A CB   9  
ATOM 10451 C CG   . GLU A 1 38 ? 1.007   11.963  5.021  1.00 0.00 ? 240 GLU A CG   9  
ATOM 10452 C CD   . GLU A 1 38 ? 2.408   12.319  4.563  1.00 0.00 ? 240 GLU A CD   9  
ATOM 10453 O OE1  . GLU A 1 38 ? 2.548   12.867  3.449  1.00 0.00 ? 240 GLU A OE1  9  
ATOM 10454 O OE2  . GLU A 1 38 ? 3.365   12.049  5.319  1.00 0.00 ? 240 GLU A OE2  9  
ATOM 10455 H H    . GLU A 1 38 ? -1.370  12.631  5.925  1.00 0.00 ? 240 GLU A H    9  
ATOM 10456 H HA   . GLU A 1 38 ? -1.987  11.263  3.418  1.00 0.00 ? 240 GLU A HA   9  
ATOM 10457 H HB2  . GLU A 1 38 ? 0.465   11.104  3.156  1.00 0.00 ? 240 GLU A HB2  9  
ATOM 10458 H HB3  . GLU A 1 38 ? -0.077  12.762  3.380  1.00 0.00 ? 240 GLU A HB3  9  
ATOM 10459 H HG2  . GLU A 1 38 ? 0.646   12.747  5.669  1.00 0.00 ? 240 GLU A HG2  9  
ATOM 10460 H HG3  . GLU A 1 38 ? 1.049   11.034  5.570  1.00 0.00 ? 240 GLU A HG3  9  
ATOM 10461 N N    . TRP A 1 39 ? -1.678  8.899   4.094  1.00 0.00 ? 241 TRP A N    9  
ATOM 10462 C CA   . TRP A 1 39 ? -1.624  7.509   4.528  1.00 0.00 ? 241 TRP A CA   9  
ATOM 10463 C C    . TRP A 1 39 ? -0.985  6.630   3.457  1.00 0.00 ? 241 TRP A C    9  
ATOM 10464 O O    . TRP A 1 39 ? -0.776  7.067   2.325  1.00 0.00 ? 241 TRP A O    9  
ATOM 10465 C CB   . TRP A 1 39 ? -3.030  7.000   4.853  1.00 0.00 ? 241 TRP A CB   9  
ATOM 10466 C CG   . TRP A 1 39 ? -3.628  7.643   6.065  1.00 0.00 ? 241 TRP A CG   9  
ATOM 10467 C CD1  . TRP A 1 39 ? -4.105  8.919   6.164  1.00 0.00 ? 241 TRP A CD1  9  
ATOM 10468 C CD2  . TRP A 1 39 ? -3.808  7.045   7.352  1.00 0.00 ? 241 TRP A CD2  9  
ATOM 10469 N NE1  . TRP A 1 39 ? -4.572  9.150   7.434  1.00 0.00 ? 241 TRP A NE1  9  
ATOM 10470 C CE2  . TRP A 1 39 ? -4.402  8.014   8.183  1.00 0.00 ? 241 TRP A CE2  9  
ATOM 10471 C CE3  . TRP A 1 39 ? -3.528  5.783   7.884  1.00 0.00 ? 241 TRP A CE3  9  
ATOM 10472 C CZ2  . TRP A 1 39 ? -4.718  7.760   9.516  1.00 0.00 ? 241 TRP A CZ2  9  
ATOM 10473 C CZ3  . TRP A 1 39 ? -3.842  5.533   9.206  1.00 0.00 ? 241 TRP A CZ3  9  
ATOM 10474 C CH2  . TRP A 1 39 ? -4.432  6.516   10.010 1.00 0.00 ? 241 TRP A CH2  9  
ATOM 10475 H H    . TRP A 1 39 ? -2.057  9.112   3.217  1.00 0.00 ? 241 TRP A H    9  
ATOM 10476 H HA   . TRP A 1 39 ? -1.020  7.461   5.420  1.00 0.00 ? 241 TRP A HA   9  
ATOM 10477 H HB2  . TRP A 1 39 ? -3.680  7.198   4.014  1.00 0.00 ? 241 TRP A HB2  9  
ATOM 10478 H HB3  . TRP A 1 39 ? -2.989  5.933   5.025  1.00 0.00 ? 241 TRP A HB3  9  
ATOM 10479 H HD1  . TRP A 1 39 ? -4.108  9.632   5.353  1.00 0.00 ? 241 TRP A HD1  9  
ATOM 10480 H HE1  . TRP A 1 39 ? -4.964  9.989   7.753  1.00 0.00 ? 241 TRP A HE1  9  
ATOM 10481 H HE3  . TRP A 1 39 ? -3.074  5.012   7.281  1.00 0.00 ? 241 TRP A HE3  9  
ATOM 10482 H HZ2  . TRP A 1 39 ? -5.174  8.508   10.148 1.00 0.00 ? 241 TRP A HZ2  9  
ATOM 10483 H HZ3  . TRP A 1 39 ? -3.633  4.564   9.633  1.00 0.00 ? 241 TRP A HZ3  9  
ATOM 10484 H HH2  . TRP A 1 39 ? -4.660  6.276   11.037 1.00 0.00 ? 241 TRP A HH2  9  
ATOM 10485 N N    . CYS A 1 40 ? -0.676  5.389   3.821  1.00 0.00 ? 242 CYS A N    9  
ATOM 10486 C CA   . CYS A 1 40 ? -0.062  4.453   2.887  1.00 0.00 ? 242 CYS A CA   9  
ATOM 10487 C C    . CYS A 1 40 ? -0.699  3.070   2.999  1.00 0.00 ? 242 CYS A C    9  
ATOM 10488 O O    . CYS A 1 40 ? -1.260  2.713   4.035  1.00 0.00 ? 242 CYS A O    9  
ATOM 10489 C CB   . CYS A 1 40 ? 1.446   4.361   3.140  1.00 0.00 ? 242 CYS A CB   9  
ATOM 10490 S SG   . CYS A 1 40 ? 2.300   3.134   2.121  1.00 0.00 ? 242 CYS A SG   9  
ATOM 10491 H H    . CYS A 1 40 ? -0.867  5.097   4.736  1.00 0.00 ? 242 CYS A H    9  
ATOM 10492 H HA   . CYS A 1 40 ? -0.225  4.828   1.888  1.00 0.00 ? 242 CYS A HA   9  
ATOM 10493 H HB2  . CYS A 1 40 ? 1.895   5.322   2.935  1.00 0.00 ? 242 CYS A HB2  9  
ATOM 10494 H HB3  . CYS A 1 40 ? 1.615   4.105   4.176  1.00 0.00 ? 242 CYS A HB3  9  
ATOM 10495 H HG   . CYS A 1 40 ? 2.224   3.406   1.203  1.00 0.00 ? 242 CYS A HG   9  
ATOM 10496 N N    . GLY A 1 41 ? -0.603  2.301   1.921  1.00 0.00 ? 243 GLY A N    9  
ATOM 10497 C CA   . GLY A 1 41 ? -1.167  0.965   1.899  1.00 0.00 ? 243 GLY A CA   9  
ATOM 10498 C C    . GLY A 1 41 ? -0.104  -0.101  1.739  1.00 0.00 ? 243 GLY A C    9  
ATOM 10499 O O    . GLY A 1 41 ? 0.697   -0.052  0.805  1.00 0.00 ? 243 GLY A O    9  
ATOM 10500 H H    . GLY A 1 41 ? -0.141  2.645   1.128  1.00 0.00 ? 243 GLY A H    9  
ATOM 10501 H HA2  . GLY A 1 41 ? -1.701  0.794   2.823  1.00 0.00 ? 243 GLY A HA2  9  
ATOM 10502 H HA3  . GLY A 1 41 ? -1.859  0.893   1.073  1.00 0.00 ? 243 GLY A HA3  9  
ATOM 10503 N N    . VAL A 1 42 ? -0.092  -1.063  2.653  1.00 0.00 ? 244 VAL A N    9  
ATOM 10504 C CA   . VAL A 1 42 ? 0.888   -2.140  2.608  1.00 0.00 ? 244 VAL A CA   9  
ATOM 10505 C C    . VAL A 1 42 ? 0.208   -3.502  2.695  1.00 0.00 ? 244 VAL A C    9  
ATOM 10506 O O    . VAL A 1 42 ? -0.644  -3.728  3.554  1.00 0.00 ? 244 VAL A O    9  
ATOM 10507 C CB   . VAL A 1 42 ? 1.911   -2.023  3.758  1.00 0.00 ? 244 VAL A CB   9  
ATOM 10508 C CG1  . VAL A 1 42 ? 3.127   -2.892  3.489  1.00 0.00 ? 244 VAL A CG1  9  
ATOM 10509 C CG2  . VAL A 1 42 ? 2.324   -0.573  3.974  1.00 0.00 ? 244 VAL A CG2  9  
ATOM 10510 H H    . VAL A 1 42 ? -0.752  -1.046  3.377  1.00 0.00 ? 244 VAL A H    9  
ATOM 10511 H HA   . VAL A 1 42 ? 1.420   -2.073  1.668  1.00 0.00 ? 244 VAL A HA   9  
ATOM 10512 H HB   . VAL A 1 42 ? 1.441   -2.376  4.665  1.00 0.00 ? 244 VAL A HB   9  
ATOM 10513 H HG11 . VAL A 1 42 ? 3.781   -2.872  4.349  1.00 0.00 ? 244 VAL A HG11 9  
ATOM 10514 H HG12 . VAL A 1 42 ? 2.809   -3.907  3.300  1.00 0.00 ? 244 VAL A HG12 9  
ATOM 10515 H HG13 . VAL A 1 42 ? 3.657   -2.514  2.627  1.00 0.00 ? 244 VAL A HG13 9  
ATOM 10516 H HG21 . VAL A 1 42 ? 2.918   -0.239  3.136  1.00 0.00 ? 244 VAL A HG21 9  
ATOM 10517 H HG22 . VAL A 1 42 ? 1.443   0.044   4.061  1.00 0.00 ? 244 VAL A HG22 9  
ATOM 10518 H HG23 . VAL A 1 42 ? 2.907   -0.496  4.880  1.00 0.00 ? 244 VAL A HG23 9  
ATOM 10519 N N    . GLU A 1 43 ? 0.600   -4.411  1.809  1.00 0.00 ? 245 GLU A N    9  
ATOM 10520 C CA   . GLU A 1 43 ? 0.039   -5.755  1.795  1.00 0.00 ? 245 GLU A CA   9  
ATOM 10521 C C    . GLU A 1 43 ? 0.775   -6.632  2.798  1.00 0.00 ? 245 GLU A C    9  
ATOM 10522 O O    . GLU A 1 43 ? 1.953   -6.938  2.622  1.00 0.00 ? 245 GLU A O    9  
ATOM 10523 C CB   . GLU A 1 43 ? 0.135   -6.361  0.395  1.00 0.00 ? 245 GLU A CB   9  
ATOM 10524 C CG   . GLU A 1 43 ? -0.468  -7.753  0.291  1.00 0.00 ? 245 GLU A CG   9  
ATOM 10525 C CD   . GLU A 1 43 ? -0.834  -8.125  -1.132 1.00 0.00 ? 245 GLU A CD   9  
ATOM 10526 O OE1  . GLU A 1 43 ? -0.185  -7.609  -2.067 1.00 0.00 ? 245 GLU A OE1  9  
ATOM 10527 O OE2  . GLU A 1 43 ? -1.770  -8.932  -1.313 1.00 0.00 ? 245 GLU A OE2  9  
ATOM 10528 H H    . GLU A 1 43 ? 1.292   -4.176  1.155  1.00 0.00 ? 245 GLU A H    9  
ATOM 10529 H HA   . GLU A 1 43 ? -1.000  -5.687  2.083  1.00 0.00 ? 245 GLU A HA   9  
ATOM 10530 H HB2  . GLU A 1 43 ? -0.380  -5.717  -0.300 1.00 0.00 ? 245 GLU A HB2  9  
ATOM 10531 H HB3  . GLU A 1 43 ? 1.176   -6.421  0.112  1.00 0.00 ? 245 GLU A HB3  9  
ATOM 10532 H HG2  . GLU A 1 43 ? 0.249   -8.471  0.661  1.00 0.00 ? 245 GLU A HG2  9  
ATOM 10533 H HG3  . GLU A 1 43 ? -1.359  -7.791  0.899  1.00 0.00 ? 245 GLU A HG3  9  
ATOM 10534 N N    . LEU A 1 44 ? 0.079   -7.019  3.861  1.00 0.00 ? 246 LEU A N    9  
ATOM 10535 C CA   . LEU A 1 44 ? 0.680   -7.841  4.900  1.00 0.00 ? 246 LEU A CA   9  
ATOM 10536 C C    . LEU A 1 44 ? 1.006   -9.240  4.389  1.00 0.00 ? 246 LEU A C    9  
ATOM 10537 O O    . LEU A 1 44 ? 0.258   -9.816  3.598  1.00 0.00 ? 246 LEU A O    9  
ATOM 10538 C CB   . LEU A 1 44 ? -0.254  -7.931  6.109  1.00 0.00 ? 246 LEU A CB   9  
ATOM 10539 C CG   . LEU A 1 44 ? -0.717  -6.584  6.669  1.00 0.00 ? 246 LEU A CG   9  
ATOM 10540 C CD1  . LEU A 1 44 ? -1.684  -6.790  7.822  1.00 0.00 ? 246 LEU A CD1  9  
ATOM 10541 C CD2  . LEU A 1 44 ? 0.478   -5.756  7.116  1.00 0.00 ? 246 LEU A CD2  9  
ATOM 10542 H H    . LEU A 1 44 ? -0.852  -6.732  3.953  1.00 0.00 ? 246 LEU A H    9  
ATOM 10543 H HA   . LEU A 1 44 ? 1.597   -7.362  5.205  1.00 0.00 ? 246 LEU A HA   9  
ATOM 10544 H HB2  . LEU A 1 44 ? -1.128  -8.498  5.821  1.00 0.00 ? 246 LEU A HB2  9  
ATOM 10545 H HB3  . LEU A 1 44 ? 0.258   -8.465  6.895  1.00 0.00 ? 246 LEU A HB3  9  
ATOM 10546 H HG   . LEU A 1 44 ? -1.232  -6.038  5.894  1.00 0.00 ? 246 LEU A HG   9  
ATOM 10547 H HD11 . LEU A 1 44 ? -1.129  -6.983  8.728  1.00 0.00 ? 246 LEU A HD11 9  
ATOM 10548 H HD12 . LEU A 1 44 ? -2.286  -5.903  7.950  1.00 0.00 ? 246 LEU A HD12 9  
ATOM 10549 H HD13 . LEU A 1 44 ? -2.326  -7.633  7.606  1.00 0.00 ? 246 LEU A HD13 9  
ATOM 10550 H HD21 . LEU A 1 44 ? 1.229   -5.757  6.339  1.00 0.00 ? 246 LEU A HD21 9  
ATOM 10551 H HD22 . LEU A 1 44 ? 0.161   -4.741  7.307  1.00 0.00 ? 246 LEU A HD22 9  
ATOM 10552 H HD23 . LEU A 1 44 ? 0.893   -6.179  8.018  1.00 0.00 ? 246 LEU A HD23 9  
ATOM 10553 N N    . ASP A 1 45 ? 2.133   -9.772  4.848  1.00 0.00 ? 247 ASP A N    9  
ATOM 10554 C CA   . ASP A 1 45 ? 2.578   -11.102 4.445  1.00 0.00 ? 247 ASP A CA   9  
ATOM 10555 C C    . ASP A 1 45 ? 1.661   -12.182 5.014  1.00 0.00 ? 247 ASP A C    9  
ATOM 10556 O O    . ASP A 1 45 ? 1.538   -13.265 4.444  1.00 0.00 ? 247 ASP A O    9  
ATOM 10557 C CB   . ASP A 1 45 ? 4.015   -11.335 4.915  1.00 0.00 ? 247 ASP A CB   9  
ATOM 10558 C CG   . ASP A 1 45 ? 4.929   -10.172 4.582  1.00 0.00 ? 247 ASP A CG   9  
ATOM 10559 O OD1  . ASP A 1 45 ? 4.761   -9.092  5.187  1.00 0.00 ? 247 ASP A OD1  9  
ATOM 10560 O OD2  . ASP A 1 45 ? 5.814   -10.341 3.717  1.00 0.00 ? 247 ASP A OD2  9  
ATOM 10561 H H    . ASP A 1 45 ? 2.682   -9.256  5.473  1.00 0.00 ? 247 ASP A H    9  
ATOM 10562 H HA   . ASP A 1 45 ? 2.548   -11.150 3.367  1.00 0.00 ? 247 ASP A HA   9  
ATOM 10563 H HB2  . ASP A 1 45 ? 4.019   -11.475 5.986  1.00 0.00 ? 247 ASP A HB2  9  
ATOM 10564 H HB3  . ASP A 1 45 ? 4.405   -12.222 4.439  1.00 0.00 ? 247 ASP A HB3  9  
ATOM 10565 N N    . GLU A 1 46 ? 1.020   -11.878 6.138  1.00 0.00 ? 248 GLU A N    9  
ATOM 10566 C CA   . GLU A 1 46 ? 0.114   -12.822 6.782  1.00 0.00 ? 248 GLU A CA   9  
ATOM 10567 C C    . GLU A 1 46 ? -1.175  -12.124 7.213  1.00 0.00 ? 248 GLU A C    9  
ATOM 10568 O O    . GLU A 1 46 ? -1.258  -10.897 7.193  1.00 0.00 ? 248 GLU A O    9  
ATOM 10569 C CB   . GLU A 1 46 ? 0.797   -13.465 7.994  1.00 0.00 ? 248 GLU A CB   9  
ATOM 10570 C CG   . GLU A 1 46 ? 1.261   -14.890 7.744  1.00 0.00 ? 248 GLU A CG   9  
ATOM 10571 C CD   . GLU A 1 46 ? 2.732   -15.089 8.057  1.00 0.00 ? 248 GLU A CD   9  
ATOM 10572 O OE1  . GLU A 1 46 ? 3.540   -14.209 7.697  1.00 0.00 ? 248 GLU A OE1  9  
ATOM 10573 O OE2  . GLU A 1 46 ? 3.074   -16.126 8.664  1.00 0.00 ? 248 GLU A OE2  9  
ATOM 10574 H H    . GLU A 1 46 ? 1.159   -10.997 6.544  1.00 0.00 ? 248 GLU A H    9  
ATOM 10575 H HA   . GLU A 1 46 ? -0.128  -13.592 6.065  1.00 0.00 ? 248 GLU A HA   9  
ATOM 10576 H HB2  . GLU A 1 46 ? 1.656   -12.869 8.264  1.00 0.00 ? 248 GLU A HB2  9  
ATOM 10577 H HB3  . GLU A 1 46 ? 0.102   -13.475 8.821  1.00 0.00 ? 248 GLU A HB3  9  
ATOM 10578 H HG2  . GLU A 1 46 ? 0.683   -15.558 8.365  1.00 0.00 ? 248 GLU A HG2  9  
ATOM 10579 H HG3  . GLU A 1 46 ? 1.093   -15.133 6.704  1.00 0.00 ? 248 GLU A HG3  9  
ATOM 10580 N N    . PRO A 1 47 ? -2.200  -12.900 7.612  1.00 0.00 ? 249 PRO A N    9  
ATOM 10581 C CA   . PRO A 1 47 ? -3.485  -12.342 8.049  1.00 0.00 ? 249 PRO A CA   9  
ATOM 10582 C C    . PRO A 1 47 ? -3.358  -11.553 9.350  1.00 0.00 ? 249 PRO A C    9  
ATOM 10583 O O    . PRO A 1 47 ? -3.853  -11.974 10.395 1.00 0.00 ? 249 PRO A O    9  
ATOM 10584 C CB   . PRO A 1 47 ? -4.366  -13.578 8.253  1.00 0.00 ? 249 PRO A CB   9  
ATOM 10585 C CG   . PRO A 1 47 ? -3.409  -14.695 8.487  1.00 0.00 ? 249 PRO A CG   9  
ATOM 10586 C CD   . PRO A 1 47 ? -2.190  -14.372 7.669  1.00 0.00 ? 249 PRO A CD   9  
ATOM 10587 H HA   . PRO A 1 47 ? -3.918  -11.708 7.289  1.00 0.00 ? 249 PRO A HA   9  
ATOM 10588 H HB2  . PRO A 1 47 ? -5.013  -13.425 9.104  1.00 0.00 ? 249 PRO A HB2  9  
ATOM 10589 H HB3  . PRO A 1 47 ? -4.961  -13.748 7.368  1.00 0.00 ? 249 PRO A HB3  9  
ATOM 10590 H HG2  . PRO A 1 47 ? -3.155  -14.747 9.535  1.00 0.00 ? 249 PRO A HG2  9  
ATOM 10591 H HG3  . PRO A 1 47 ? -3.845  -15.626 8.157  1.00 0.00 ? 249 PRO A HG3  9  
ATOM 10592 H HD2  . PRO A 1 47 ? -1.300  -14.735 8.162  1.00 0.00 ? 249 PRO A HD2  9  
ATOM 10593 H HD3  . PRO A 1 47 ? -2.275  -14.798 6.680  1.00 0.00 ? 249 PRO A HD3  9  
ATOM 10594 N N    . LEU A 1 48 ? -2.686  -10.410 9.275  1.00 0.00 ? 250 LEU A N    9  
ATOM 10595 C CA   . LEU A 1 48 ? -2.486  -9.559  10.442 1.00 0.00 ? 250 LEU A CA   9  
ATOM 10596 C C    . LEU A 1 48 ? -2.956  -8.133  10.169 1.00 0.00 ? 250 LEU A C    9  
ATOM 10597 O O    . LEU A 1 48 ? -2.444  -7.179  10.756 1.00 0.00 ? 250 LEU A O    9  
ATOM 10598 C CB   . LEU A 1 48 ? -1.012  -9.555  10.849 1.00 0.00 ? 250 LEU A CB   9  
ATOM 10599 C CG   . LEU A 1 48 ? -0.017  -9.531  9.683  1.00 0.00 ? 250 LEU A CG   9  
ATOM 10600 C CD1  . LEU A 1 48 ? 1.014   -8.431  9.877  1.00 0.00 ? 250 LEU A CD1  9  
ATOM 10601 C CD2  . LEU A 1 48 ? 0.668   -10.881 9.540  1.00 0.00 ? 250 LEU A CD2  9  
ATOM 10602 H H    . LEU A 1 48 ? -2.314  -10.130 8.412  1.00 0.00 ? 250 LEU A H    9  
ATOM 10603 H HA   . LEU A 1 48 ? -3.072  -9.967  11.252 1.00 0.00 ? 250 LEU A HA   9  
ATOM 10604 H HB2  . LEU A 1 48 ? -0.835  -8.685  11.467 1.00 0.00 ? 250 LEU A HB2  9  
ATOM 10605 H HB3  . LEU A 1 48 ? -0.820  -10.439 11.440 1.00 0.00 ? 250 LEU A HB3  9  
ATOM 10606 H HG   . LEU A 1 48 ? -0.552  -9.328  8.766  1.00 0.00 ? 250 LEU A HG   9  
ATOM 10607 H HD11 . LEU A 1 48 ? 1.476   -8.198  8.928  1.00 0.00 ? 250 LEU A HD11 9  
ATOM 10608 H HD12 . LEU A 1 48 ? 0.528   -7.549  10.265 1.00 0.00 ? 250 LEU A HD12 9  
ATOM 10609 H HD13 . LEU A 1 48 ? 1.769   -8.762  10.574 1.00 0.00 ? 250 LEU A HD13 9  
ATOM 10610 H HD21 . LEU A 1 48 ? -0.032  -11.668 9.779  1.00 0.00 ? 250 LEU A HD21 9  
ATOM 10611 H HD22 . LEU A 1 48 ? 1.015   -11.004 8.525  1.00 0.00 ? 250 LEU A HD22 9  
ATOM 10612 H HD23 . LEU A 1 48 ? 1.510   -10.931 10.215 1.00 0.00 ? 250 LEU A HD23 9  
ATOM 10613 N N    . GLY A 1 49 ? -3.931  -7.994  9.277  1.00 0.00 ? 251 GLY A N    9  
ATOM 10614 C CA   . GLY A 1 49 ? -4.450  -6.679  8.947  1.00 0.00 ? 251 GLY A CA   9  
ATOM 10615 C C    . GLY A 1 49 ? -5.870  -6.477  9.437  1.00 0.00 ? 251 GLY A C    9  
ATOM 10616 O O    . GLY A 1 49 ? -6.374  -7.263  10.241 1.00 0.00 ? 251 GLY A O    9  
ATOM 10617 H H    . GLY A 1 49 ? -4.303  -8.788  8.841  1.00 0.00 ? 251 GLY A H    9  
ATOM 10618 H HA2  . GLY A 1 49 ? -3.816  -5.929  9.397  1.00 0.00 ? 251 GLY A HA2  9  
ATOM 10619 H HA3  . GLY A 1 49 ? -4.429  -6.554  7.874  1.00 0.00 ? 251 GLY A HA3  9  
ATOM 10620 N N    . LYS A 1 50 ? -6.518  -5.419  8.957  1.00 0.00 ? 252 LYS A N    9  
ATOM 10621 C CA   . LYS A 1 50 ? -7.888  -5.118  9.360  1.00 0.00 ? 252 LYS A CA   9  
ATOM 10622 C C    . LYS A 1 50 ? -8.835  -5.146  8.162  1.00 0.00 ? 252 LYS A C    9  
ATOM 10623 O O    . LYS A 1 50 ? -9.997  -5.532  8.288  1.00 0.00 ? 252 LYS A O    9  
ATOM 10624 C CB   . LYS A 1 50 ? -7.953  -3.748  10.038 1.00 0.00 ? 252 LYS A CB   9  
ATOM 10625 C CG   . LYS A 1 50 ? -6.790  -3.474  10.977 1.00 0.00 ? 252 LYS A CG   9  
ATOM 10626 C CD   . LYS A 1 50 ? -6.817  -4.399  12.184 1.00 0.00 ? 252 LYS A CD   9  
ATOM 10627 C CE   . LYS A 1 50 ? -5.414  -4.711  12.679 1.00 0.00 ? 252 LYS A CE   9  
ATOM 10628 N NZ   . LYS A 1 50 ? -5.315  -6.090  13.233 1.00 0.00 ? 252 LYS A NZ   9  
ATOM 10629 H H    . LYS A 1 50 ? -6.063  -4.827  8.324  1.00 0.00 ? 252 LYS A H    9  
ATOM 10630 H HA   . LYS A 1 50 ? -8.199  -5.873  10.065 1.00 0.00 ? 252 LYS A HA   9  
ATOM 10631 H HB2  . LYS A 1 50 ? -7.960  -2.982  9.278  1.00 0.00 ? 252 LYS A HB2  9  
ATOM 10632 H HB3  . LYS A 1 50 ? -8.868  -3.685  10.608 1.00 0.00 ? 252 LYS A HB3  9  
ATOM 10633 H HG2  . LYS A 1 50 ? -5.863  -3.626  10.442 1.00 0.00 ? 252 LYS A HG2  9  
ATOM 10634 H HG3  . LYS A 1 50 ? -6.847  -2.451  11.318 1.00 0.00 ? 252 LYS A HG3  9  
ATOM 10635 H HD2  . LYS A 1 50 ? -7.369  -3.921  12.979 1.00 0.00 ? 252 LYS A HD2  9  
ATOM 10636 H HD3  . LYS A 1 50 ? -7.305  -5.322  11.907 1.00 0.00 ? 252 LYS A HD3  9  
ATOM 10637 H HE2  . LYS A 1 50 ? -4.724  -4.614  11.853 1.00 0.00 ? 252 LYS A HE2  9  
ATOM 10638 H HE3  . LYS A 1 50 ? -5.152  -4.002  13.450 1.00 0.00 ? 252 LYS A HE3  9  
ATOM 10639 H HZ1  . LYS A 1 50 ? -4.533  -6.144  13.917 1.00 0.00 ? 252 LYS A HZ1  9  
ATOM 10640 H HZ2  . LYS A 1 50 ? -5.138  -6.771  12.467 1.00 0.00 ? 252 LYS A HZ2  9  
ATOM 10641 H HZ3  . LYS A 1 50 ? -6.199  -6.346  13.714 1.00 0.00 ? 252 LYS A HZ3  9  
ATOM 10642 N N    . ASN A 1 51 ? -8.334  -4.731  7.002  1.00 0.00 ? 253 ASN A N    9  
ATOM 10643 C CA   . ASN A 1 51 ? -9.144  -4.709  5.787  1.00 0.00 ? 253 ASN A CA   9  
ATOM 10644 C C    . ASN A 1 51 ? -8.539  -5.599  4.706  1.00 0.00 ? 253 ASN A C    9  
ATOM 10645 O O    . ASN A 1 51 ? -7.423  -6.099  4.849  1.00 0.00 ? 253 ASN A O    9  
ATOM 10646 C CB   . ASN A 1 51 ? -9.280  -3.275  5.267  1.00 0.00 ? 253 ASN A CB   9  
ATOM 10647 C CG   . ASN A 1 51 ? -7.954  -2.692  4.818  1.00 0.00 ? 253 ASN A CG   9  
ATOM 10648 O OD1  . ASN A 1 51 ? -7.691  -2.567  3.622  1.00 0.00 ? 253 ASN A OD1  9  
ATOM 10649 N ND2  . ASN A 1 51 ? -7.111  -2.333  5.779  1.00 0.00 ? 253 ASN A ND2  9  
ATOM 10650 H H    . ASN A 1 51 ? -7.402  -4.432  6.960  1.00 0.00 ? 253 ASN A H    9  
ATOM 10651 H HA   . ASN A 1 51 ? -10.125 -5.083  6.036  1.00 0.00 ? 253 ASN A HA   9  
ATOM 10652 H HB2  . ASN A 1 51 ? -9.957  -3.267  4.426  1.00 0.00 ? 253 ASN A HB2  9  
ATOM 10653 H HB3  . ASN A 1 51 ? -9.679  -2.651  6.052  1.00 0.00 ? 253 ASN A HB3  9  
ATOM 10654 H HD21 . ASN A 1 51 ? -7.388  -2.462  6.711  1.00 0.00 ? 253 ASN A HD21 9  
ATOM 10655 H HD22 . ASN A 1 51 ? -6.244  -1.953  5.515  1.00 0.00 ? 253 ASN A HD22 9  
ATOM 10656 N N    . ASP A 1 52 ? -9.288  -5.793  3.624  1.00 0.00 ? 254 ASP A N    9  
ATOM 10657 C CA   . ASP A 1 52 ? -8.832  -6.623  2.515  1.00 0.00 ? 254 ASP A CA   9  
ATOM 10658 C C    . ASP A 1 52 ? -8.370  -5.765  1.339  1.00 0.00 ? 254 ASP A C    9  
ATOM 10659 O O    . ASP A 1 52 ? -8.396  -6.204  0.190  1.00 0.00 ? 254 ASP A O    9  
ATOM 10660 C CB   . ASP A 1 52 ? -9.949  -7.569  2.068  1.00 0.00 ? 254 ASP A CB   9  
ATOM 10661 C CG   . ASP A 1 52 ? -11.142 -6.829  1.497  1.00 0.00 ? 254 ASP A CG   9  
ATOM 10662 O OD1  . ASP A 1 52 ? -11.565 -5.825  2.104  1.00 0.00 ? 254 ASP A OD1  9  
ATOM 10663 O OD2  . ASP A 1 52 ? -11.654 -7.254  0.439  1.00 0.00 ? 254 ASP A OD2  9  
ATOM 10664 H H    . ASP A 1 52 ? -10.169 -5.367  3.571  1.00 0.00 ? 254 ASP A H    9  
ATOM 10665 H HA   . ASP A 1 52 ? -7.995  -7.209  2.865  1.00 0.00 ? 254 ASP A HA   9  
ATOM 10666 H HB2  . ASP A 1 52 ? -9.565  -8.236  1.310  1.00 0.00 ? 254 ASP A HB2  9  
ATOM 10667 H HB3  . ASP A 1 52 ? -10.280 -8.149  2.917  1.00 0.00 ? 254 ASP A HB3  9  
ATOM 10668 N N    . GLY A 1 53 ? -7.944  -4.538  1.634  1.00 0.00 ? 255 GLY A N    9  
ATOM 10669 C CA   . GLY A 1 53 ? -7.479  -3.644  0.589  1.00 0.00 ? 255 GLY A CA   9  
ATOM 10670 C C    . GLY A 1 53 ? -8.455  -2.518  0.295  1.00 0.00 ? 255 GLY A C    9  
ATOM 10671 O O    . GLY A 1 53 ? -8.327  -1.826  -0.717 1.00 0.00 ? 255 GLY A O    9  
ATOM 10672 H H    . GLY A 1 53 ? -7.939  -4.241  2.569  1.00 0.00 ? 255 GLY A H    9  
ATOM 10673 H HA2  . GLY A 1 53 ? -6.536  -3.214  0.893  1.00 0.00 ? 255 GLY A HA2  9  
ATOM 10674 H HA3  . GLY A 1 53 ? -7.326  -4.214  -0.315 1.00 0.00 ? 255 GLY A HA3  9  
ATOM 10675 N N    . ALA A 1 54 ? -9.431  -2.328  1.177  1.00 0.00 ? 256 ALA A N    9  
ATOM 10676 C CA   . ALA A 1 54 ? -10.424 -1.276  1.000  1.00 0.00 ? 256 ALA A CA   9  
ATOM 10677 C C    . ALA A 1 54 ? -10.717 -0.566  2.317  1.00 0.00 ? 256 ALA A C    9  
ATOM 10678 O O    . ALA A 1 54 ? -10.472 -1.109  3.394  1.00 0.00 ? 256 ALA A O    9  
ATOM 10679 C CB   . ALA A 1 54 ? -11.703 -1.851  0.411  1.00 0.00 ? 256 ALA A CB   9  
ATOM 10680 H H    . ALA A 1 54 ? -9.483  -2.906  1.967  1.00 0.00 ? 256 ALA A H    9  
ATOM 10681 H HA   . ALA A 1 54 ? -10.026 -0.558  0.299  1.00 0.00 ? 256 ALA A HA   9  
ATOM 10682 H HB1  . ALA A 1 54 ? -12.223 -1.083  -0.143 1.00 0.00 ? 256 ALA A HB1  9  
ATOM 10683 H HB2  . ALA A 1 54 ? -11.460 -2.670  -0.252 1.00 0.00 ? 256 ALA A HB2  9  
ATOM 10684 H HB3  . ALA A 1 54 ? -12.337 -2.213  1.207  1.00 0.00 ? 256 ALA A HB3  9  
ATOM 10685 N N    . VAL A 1 55 ? -11.239 0.652   2.222  1.00 0.00 ? 257 VAL A N    9  
ATOM 10686 C CA   . VAL A 1 55 ? -11.563 1.441   3.405  1.00 0.00 ? 257 VAL A CA   9  
ATOM 10687 C C    . VAL A 1 55 ? -12.892 2.171   3.233  1.00 0.00 ? 257 VAL A C    9  
ATOM 10688 O O    . VAL A 1 55 ? -13.048 2.991   2.328  1.00 0.00 ? 257 VAL A O    9  
ATOM 10689 C CB   . VAL A 1 55 ? -10.458 2.471   3.713  1.00 0.00 ? 257 VAL A CB   9  
ATOM 10690 C CG1  . VAL A 1 55 ? -10.765 3.225   5.000  1.00 0.00 ? 257 VAL A CG1  9  
ATOM 10691 C CG2  . VAL A 1 55 ? -9.101  1.787   3.795  1.00 0.00 ? 257 VAL A CG2  9  
ATOM 10692 H H    . VAL A 1 55 ? -11.410 1.032   1.334  1.00 0.00 ? 257 VAL A H    9  
ATOM 10693 H HA   . VAL A 1 55 ? -11.641 0.764   4.245  1.00 0.00 ? 257 VAL A HA   9  
ATOM 10694 H HB   . VAL A 1 55 ? -10.427 3.185   2.903  1.00 0.00 ? 257 VAL A HB   9  
ATOM 10695 H HG11 . VAL A 1 55 ? -11.662 2.824   5.448  1.00 0.00 ? 257 VAL A HG11 9  
ATOM 10696 H HG12 . VAL A 1 55 ? -9.939  3.116   5.688  1.00 0.00 ? 257 VAL A HG12 9  
ATOM 10697 H HG13 . VAL A 1 55 ? -10.911 4.272   4.777  1.00 0.00 ? 257 VAL A HG13 9  
ATOM 10698 H HG21 . VAL A 1 55 ? -8.984  1.118   2.956  1.00 0.00 ? 257 VAL A HG21 9  
ATOM 10699 H HG22 . VAL A 1 55 ? -8.320  2.532   3.773  1.00 0.00 ? 257 VAL A HG22 9  
ATOM 10700 H HG23 . VAL A 1 55 ? -9.037  1.225   4.716  1.00 0.00 ? 257 VAL A HG23 9  
ATOM 10701 N N    . ALA A 1 56 ? -13.845 1.867   4.109  1.00 0.00 ? 258 ALA A N    9  
ATOM 10702 C CA   . ALA A 1 56 ? -15.159 2.496   4.058  1.00 0.00 ? 258 ALA A CA   9  
ATOM 10703 C C    . ALA A 1 56 ? -15.832 2.263   2.709  1.00 0.00 ? 258 ALA A C    9  
ATOM 10704 O O    . ALA A 1 56 ? -16.666 3.060   2.275  1.00 0.00 ? 258 ALA A O    9  
ATOM 10705 C CB   . ALA A 1 56 ? -15.044 3.985   4.342  1.00 0.00 ? 258 ALA A CB   9  
ATOM 10706 H H    . ALA A 1 56 ? -13.658 1.207   4.808  1.00 0.00 ? 258 ALA A H    9  
ATOM 10707 H HA   . ALA A 1 56 ? -15.770 2.051   4.832  1.00 0.00 ? 258 ALA A HA   9  
ATOM 10708 H HB1  . ALA A 1 56 ? -14.208 4.161   5.002  1.00 0.00 ? 258 ALA A HB1  9  
ATOM 10709 H HB2  . ALA A 1 56 ? -14.888 4.517   3.415  1.00 0.00 ? 258 ALA A HB2  9  
ATOM 10710 H HB3  . ALA A 1 56 ? -15.952 4.334   4.810  1.00 0.00 ? 258 ALA A HB3  9  
ATOM 10711 N N    . GLY A 1 57 ? -15.467 1.169   2.047  1.00 0.00 ? 259 GLY A N    9  
ATOM 10712 C CA   . GLY A 1 57 ? -16.050 0.858   0.755  1.00 0.00 ? 259 GLY A CA   9  
ATOM 10713 C C    . GLY A 1 57 ? -15.188 1.324   -0.406 1.00 0.00 ? 259 GLY A C    9  
ATOM 10714 O O    . GLY A 1 57 ? -15.477 1.011   -1.561 1.00 0.00 ? 259 GLY A O    9  
ATOM 10715 H H    . GLY A 1 57 ? -14.799 0.569   2.439  1.00 0.00 ? 259 GLY A H    9  
ATOM 10716 H HA2  . GLY A 1 57 ? -16.182 -0.210  0.682  1.00 0.00 ? 259 GLY A HA2  9  
ATOM 10717 H HA3  . GLY A 1 57 ? -17.015 1.335   0.683  1.00 0.00 ? 259 GLY A HA3  9  
ATOM 10718 N N    . THR A 1 58 ? -14.129 2.069   -0.104 1.00 0.00 ? 260 THR A N    9  
ATOM 10719 C CA   . THR A 1 58 ? -13.231 2.573   -1.137 1.00 0.00 ? 260 THR A CA   9  
ATOM 10720 C C    . THR A 1 58 ? -11.967 1.723   -1.218 1.00 0.00 ? 260 THR A C    9  
ATOM 10721 O O    . THR A 1 58 ? -11.179 1.672   -0.274 1.00 0.00 ? 260 THR A O    9  
ATOM 10722 C CB   . THR A 1 58 ? -12.861 4.030   -0.854 1.00 0.00 ? 260 THR A CB   9  
ATOM 10723 O OG1  . THR A 1 58 ? -14.026 4.815   -0.670 1.00 0.00 ? 260 THR A OG1  9  
ATOM 10724 C CG2  . THR A 1 58 ? -12.049 4.666   -1.962 1.00 0.00 ? 260 THR A CG2  9  
ATOM 10725 H H    . THR A 1 58 ? -13.946 2.287   0.833  1.00 0.00 ? 260 THR A H    9  
ATOM 10726 H HA   . THR A 1 58 ? -13.750 2.518   -2.081 1.00 0.00 ? 260 THR A HA   9  
ATOM 10727 H HB   . THR A 1 58 ? -12.275 4.073   0.052  1.00 0.00 ? 260 THR A HB   9  
ATOM 10728 H HG1  . THR A 1 58 ? -14.134 5.015   0.263  1.00 0.00 ? 260 THR A HG1  9  
ATOM 10729 H HG21 . THR A 1 58 ? -12.347 4.248   -2.912 1.00 0.00 ? 260 THR A HG21 9  
ATOM 10730 H HG22 . THR A 1 58 ? -10.999 4.471   -1.796 1.00 0.00 ? 260 THR A HG22 9  
ATOM 10731 H HG23 . THR A 1 58 ? -12.222 5.733   -1.967 1.00 0.00 ? 260 THR A HG23 9  
ATOM 10732 N N    . ARG A 1 59 ? -11.779 1.056   -2.353 1.00 0.00 ? 261 ARG A N    9  
ATOM 10733 C CA   . ARG A 1 59 ? -10.611 0.210   -2.558 1.00 0.00 ? 261 ARG A CA   9  
ATOM 10734 C C    . ARG A 1 59 ? -9.440  1.024   -3.096 1.00 0.00 ? 261 ARG A C    9  
ATOM 10735 O O    . ARG A 1 59 ? -9.575  1.741   -4.087 1.00 0.00 ? 261 ARG A O    9  
ATOM 10736 C CB   . ARG A 1 59 ? -10.943 -0.929  -3.522 1.00 0.00 ? 261 ARG A CB   9  
ATOM 10737 C CG   . ARG A 1 59 ? -9.890  -2.027  -3.553 1.00 0.00 ? 261 ARG A CG   9  
ATOM 10738 C CD   . ARG A 1 59 ? -9.978  -2.847  -4.829 1.00 0.00 ? 261 ARG A CD   9  
ATOM 10739 N NE   . ARG A 1 59 ? -10.946 -3.939  -4.715 1.00 0.00 ? 261 ARG A NE   9  
ATOM 10740 C CZ   . ARG A 1 59 ? -12.244 -3.813  -4.987 1.00 0.00 ? 261 ARG A CZ   9  
ATOM 10741 N NH1  . ARG A 1 59 ? -12.739 -2.651  -5.392 1.00 0.00 ? 261 ARG A NH1  9  
ATOM 10742 N NH2  . ARG A 1 59 ? -13.049 -4.859  -4.856 1.00 0.00 ? 261 ARG A NH2  9  
ATOM 10743 H H    . ARG A 1 59 ? -12.443 1.138   -3.071 1.00 0.00 ? 261 ARG A H    9  
ATOM 10744 H HA   . ARG A 1 59 ? -10.334 -0.208  -1.602 1.00 0.00 ? 261 ARG A HA   9  
ATOM 10745 H HB2  . ARG A 1 59 ? -11.885 -1.371  -3.229 1.00 0.00 ? 261 ARG A HB2  9  
ATOM 10746 H HB3  . ARG A 1 59 ? -11.040 -0.525  -4.518 1.00 0.00 ? 261 ARG A HB3  9  
ATOM 10747 H HG2  . ARG A 1 59 ? -8.912  -1.576  -3.494 1.00 0.00 ? 261 ARG A HG2  9  
ATOM 10748 H HG3  . ARG A 1 59 ? -10.040 -2.679  -2.705 1.00 0.00 ? 261 ARG A HG3  9  
ATOM 10749 H HD2  . ARG A 1 59 ? -10.272 -2.201  -5.641 1.00 0.00 ? 261 ARG A HD2  9  
ATOM 10750 H HD3  . ARG A 1 59 ? -9.004  -3.265  -5.039 1.00 0.00 ? 261 ARG A HD3  9  
ATOM 10751 H HE   . ARG A 1 59 ? -10.610 -4.809  -4.419 1.00 0.00 ? 261 ARG A HE   9  
ATOM 10752 H HH11 . ARG A 1 59 ? -12.140 -1.858  -5.495 1.00 0.00 ? 261 ARG A HH11 9  
ATOM 10753 H HH12 . ARG A 1 59 ? -13.716 -2.568  -5.595 1.00 0.00 ? 261 ARG A HH12 9  
ATOM 10754 H HH21 . ARG A 1 59 ? -12.683 -5.738  -4.552 1.00 0.00 ? 261 ARG A HH21 9  
ATOM 10755 H HH22 . ARG A 1 59 ? -14.024 -4.768  -5.060 1.00 0.00 ? 261 ARG A HH22 9  
ATOM 10756 N N    . TYR A 1 60 ? -8.293  0.911   -2.436 1.00 0.00 ? 262 TYR A N    9  
ATOM 10757 C CA   . TYR A 1 60 ? -7.100  1.643   -2.850 1.00 0.00 ? 262 TYR A CA   9  
ATOM 10758 C C    . TYR A 1 60 ? -6.137  0.731   -3.604 1.00 0.00 ? 262 TYR A C    9  
ATOM 10759 O O    . TYR A 1 60 ? -5.424  1.174   -4.504 1.00 0.00 ? 262 TYR A O    9  
ATOM 10760 C CB   . TYR A 1 60 ? -6.403  2.252   -1.632 1.00 0.00 ? 262 TYR A CB   9  
ATOM 10761 C CG   . TYR A 1 60 ? -7.187  3.374   -0.987 1.00 0.00 ? 262 TYR A CG   9  
ATOM 10762 C CD1  . TYR A 1 60 ? -8.275  3.104   -0.166 1.00 0.00 ? 262 TYR A CD1  9  
ATOM 10763 C CD2  . TYR A 1 60 ? -6.842  4.702   -1.204 1.00 0.00 ? 262 TYR A CD2  9  
ATOM 10764 C CE1  . TYR A 1 60 ? -8.996  4.126   0.421  1.00 0.00 ? 262 TYR A CE1  9  
ATOM 10765 C CE2  . TYR A 1 60 ? -7.558  5.730   -0.620 1.00 0.00 ? 262 TYR A CE2  9  
ATOM 10766 C CZ   . TYR A 1 60 ? -8.633  5.436   0.192  1.00 0.00 ? 262 TYR A CZ   9  
ATOM 10767 O OH   . TYR A 1 60 ? -9.350  6.457   0.774  1.00 0.00 ? 262 TYR A OH   9  
ATOM 10768 H H    . TYR A 1 60 ? -8.248  0.327   -1.651 1.00 0.00 ? 262 TYR A H    9  
ATOM 10769 H HA   . TYR A 1 60 ? -7.413  2.437   -3.509 1.00 0.00 ? 262 TYR A HA   9  
ATOM 10770 H HB2  . TYR A 1 60 ? -6.253  1.483   -0.888 1.00 0.00 ? 262 TYR A HB2  9  
ATOM 10771 H HB3  . TYR A 1 60 ? -5.444  2.647   -1.934 1.00 0.00 ? 262 TYR A HB3  9  
ATOM 10772 H HD1  . TYR A 1 60 ? -8.556  2.077   0.013  1.00 0.00 ? 262 TYR A HD1  9  
ATOM 10773 H HD2  . TYR A 1 60 ? -6.000  4.928   -1.841 1.00 0.00 ? 262 TYR A HD2  9  
ATOM 10774 H HE1  . TYR A 1 60 ? -9.837  3.896   1.058  1.00 0.00 ? 262 TYR A HE1  9  
ATOM 10775 H HE2  . TYR A 1 60 ? -7.274  6.756   -0.799 1.00 0.00 ? 262 TYR A HE2  9  
ATOM 10776 H HH   . TYR A 1 60 ? -10.284 6.240   0.761  1.00 0.00 ? 262 TYR A HH   9  
ATOM 10777 N N    . PHE A 1 61 ? -6.126  -0.544  -3.233 1.00 0.00 ? 263 PHE A N    9  
ATOM 10778 C CA   . PHE A 1 61 ? -5.255  -1.520  -3.879 1.00 0.00 ? 263 PHE A CA   9  
ATOM 10779 C C    . PHE A 1 61 ? -5.819  -2.929  -3.732 1.00 0.00 ? 263 PHE A C    9  
ATOM 10780 O O    . PHE A 1 61 ? -6.793  -3.147  -3.011 1.00 0.00 ? 263 PHE A O    9  
ATOM 10781 C CB   . PHE A 1 61 ? -3.844  -1.453  -3.289 1.00 0.00 ? 263 PHE A CB   9  
ATOM 10782 C CG   . PHE A 1 61 ? -3.819  -1.365  -1.790 1.00 0.00 ? 263 PHE A CG   9  
ATOM 10783 C CD1  . PHE A 1 61 ? -4.000  -0.150  -1.152 1.00 0.00 ? 263 PHE A CD1  9  
ATOM 10784 C CD2  . PHE A 1 61 ? -3.611  -2.498  -1.018 1.00 0.00 ? 263 PHE A CD2  9  
ATOM 10785 C CE1  . PHE A 1 61 ? -3.976  -0.064  0.226  1.00 0.00 ? 263 PHE A CE1  9  
ATOM 10786 C CE2  . PHE A 1 61 ? -3.584  -2.418  0.360  1.00 0.00 ? 263 PHE A CE2  9  
ATOM 10787 C CZ   . PHE A 1 61 ? -3.767  -1.199  0.984  1.00 0.00 ? 263 PHE A CZ   9  
ATOM 10788 H H    . PHE A 1 61 ? -6.720  -0.837  -2.512 1.00 0.00 ? 263 PHE A H    9  
ATOM 10789 H HA   . PHE A 1 61 ? -5.207  -1.275  -4.929 1.00 0.00 ? 263 PHE A HA   9  
ATOM 10790 H HB2  . PHE A 1 61 ? -3.298  -2.337  -3.578 1.00 0.00 ? 263 PHE A HB2  9  
ATOM 10791 H HB3  . PHE A 1 61 ? -3.340  -0.580  -3.681 1.00 0.00 ? 263 PHE A HB3  9  
ATOM 10792 H HD1  . PHE A 1 61 ? -4.164  0.740   -1.743 1.00 0.00 ? 263 PHE A HD1  9  
ATOM 10793 H HD2  . PHE A 1 61 ? -3.468  -3.452  -1.506 1.00 0.00 ? 263 PHE A HD2  9  
ATOM 10794 H HE1  . PHE A 1 61 ? -4.118  0.891   0.711  1.00 0.00 ? 263 PHE A HE1  9  
ATOM 10795 H HE2  . PHE A 1 61 ? -3.422  -3.308  0.950  1.00 0.00 ? 263 PHE A HE2  9  
ATOM 10796 H HZ   . PHE A 1 61 ? -3.746  -1.135  2.061  1.00 0.00 ? 263 PHE A HZ   9  
ATOM 10797 N N    . GLN A 1 62 ? -5.203  -3.884  -4.421 1.00 0.00 ? 264 GLN A N    9  
ATOM 10798 C CA   . GLN A 1 62 ? -5.649  -5.272  -4.368 1.00 0.00 ? 264 GLN A CA   9  
ATOM 10799 C C    . GLN A 1 62 ? -4.711  -6.114  -3.510 1.00 0.00 ? 264 GLN A C    9  
ATOM 10800 O O    . GLN A 1 62 ? -3.496  -6.105  -3.706 1.00 0.00 ? 264 GLN A O    9  
ATOM 10801 C CB   . GLN A 1 62 ? -5.733  -5.857  -5.779 1.00 0.00 ? 264 GLN A CB   9  
ATOM 10802 C CG   . GLN A 1 62 ? -6.621  -7.086  -5.875 1.00 0.00 ? 264 GLN A CG   9  
ATOM 10803 C CD   . GLN A 1 62 ? -8.064  -6.793  -5.512 1.00 0.00 ? 264 GLN A CD   9  
ATOM 10804 O OE1  . GLN A 1 62 ? -8.735  -6.004  -6.177 1.00 0.00 ? 264 GLN A OE1  9  
ATOM 10805 N NE2  . GLN A 1 62 ? -8.548  -7.429  -4.451 1.00 0.00 ? 264 GLN A NE2  9  
ATOM 10806 H H    . GLN A 1 62 ? -4.434  -3.651  -4.981 1.00 0.00 ? 264 GLN A H    9  
ATOM 10807 H HA   . GLN A 1 62 ? -6.633  -5.285  -3.923 1.00 0.00 ? 264 GLN A HA   9  
ATOM 10808 H HB2  . GLN A 1 62 ? -6.125  -5.104  -6.445 1.00 0.00 ? 264 GLN A HB2  9  
ATOM 10809 H HB3  . GLN A 1 62 ? -4.739  -6.130  -6.102 1.00 0.00 ? 264 GLN A HB3  9  
ATOM 10810 H HG2  . GLN A 1 62 ? -6.590  -7.459  -6.888 1.00 0.00 ? 264 GLN A HG2  9  
ATOM 10811 H HG3  . GLN A 1 62 ? -6.242  -7.842  -5.202 1.00 0.00 ? 264 GLN A HG3  9  
ATOM 10812 H HE21 . GLN A 1 62 ? -7.956  -8.042  -3.969 1.00 0.00 ? 264 GLN A HE21 9  
ATOM 10813 H HE22 . GLN A 1 62 ? -9.478  -7.257  -4.194 1.00 0.00 ? 264 GLN A HE22 9  
ATOM 10814 N N    . CYS A 1 63 ? -5.287  -6.845  -2.561 1.00 0.00 ? 265 CYS A N    9  
ATOM 10815 C CA   . CYS A 1 63 ? -4.507  -7.697  -1.672 1.00 0.00 ? 265 CYS A CA   9  
ATOM 10816 C C    . CYS A 1 63 ? -5.356  -8.848  -1.144 1.00 0.00 ? 265 CYS A C    9  
ATOM 10817 O O    . CYS A 1 63 ? -6.586  -8.788  -1.169 1.00 0.00 ? 265 CYS A O    9  
ATOM 10818 C CB   . CYS A 1 63 ? -3.950  -6.880  -0.505 1.00 0.00 ? 265 CYS A CB   9  
ATOM 10819 S SG   . CYS A 1 63 ? -5.164  -5.795  0.282  1.00 0.00 ? 265 CYS A SG   9  
ATOM 10820 H H    . CYS A 1 63 ? -6.262  -6.810  -2.458 1.00 0.00 ? 265 CYS A H    9  
ATOM 10821 H HA   . CYS A 1 63 ? -3.684  -8.104  -2.241 1.00 0.00 ? 265 CYS A HA   9  
ATOM 10822 H HB2  . CYS A 1 63 ? -3.576  -7.555  0.251  1.00 0.00 ? 265 CYS A HB2  9  
ATOM 10823 H HB3  . CYS A 1 63 ? -3.139  -6.263  -0.863 1.00 0.00 ? 265 CYS A HB3  9  
ATOM 10824 H HG   . CYS A 1 63 ? -4.686  -5.094  0.732  1.00 0.00 ? 265 CYS A HG   9  
ATOM 10825 N N    . GLN A 1 64 ? -4.694  -9.894  -0.665 1.00 0.00 ? 266 GLN A N    9  
ATOM 10826 C CA   . GLN A 1 64 ? -5.390  -11.059 -0.129 1.00 0.00 ? 266 GLN A CA   9  
ATOM 10827 C C    . GLN A 1 64 ? -6.258  -10.669 1.063  1.00 0.00 ? 266 GLN A C    9  
ATOM 10828 O O    . GLN A 1 64 ? -6.109  -9.583  1.622  1.00 0.00 ? 266 GLN A O    9  
ATOM 10829 C CB   . GLN A 1 64 ? -4.385  -12.134 0.288  1.00 0.00 ? 266 GLN A CB   9  
ATOM 10830 C CG   . GLN A 1 64 ? -3.884  -12.981 -0.870 1.00 0.00 ? 266 GLN A CG   9  
ATOM 10831 C CD   . GLN A 1 64 ? -3.041  -14.156 -0.410 1.00 0.00 ? 266 GLN A CD   9  
ATOM 10832 O OE1  . GLN A 1 64 ? -1.914  -14.343 -0.867 1.00 0.00 ? 266 GLN A OE1  9  
ATOM 10833 N NE2  . GLN A 1 64 ? -3.587  -14.955 0.500  1.00 0.00 ? 266 GLN A NE2  9  
ATOM 10834 H H    . GLN A 1 64 ? -3.714  -9.886  -0.671 1.00 0.00 ? 266 GLN A H    9  
ATOM 10835 H HA   . GLN A 1 64 ? -6.025  -11.454 -0.909 1.00 0.00 ? 266 GLN A HA   9  
ATOM 10836 H HB2  . GLN A 1 64 ? -3.535  -11.656 0.751  1.00 0.00 ? 266 GLN A HB2  9  
ATOM 10837 H HB3  . GLN A 1 64 ? -4.855  -12.788 1.007  1.00 0.00 ? 266 GLN A HB3  9  
ATOM 10838 H HG2  . GLN A 1 64 ? -4.734  -13.361 -1.416 1.00 0.00 ? 266 GLN A HG2  9  
ATOM 10839 H HG3  . GLN A 1 64 ? -3.286  -12.361 -1.520 1.00 0.00 ? 266 GLN A HG3  9  
ATOM 10840 H HE21 . GLN A 1 64 ? -4.490  -14.745 0.818  1.00 0.00 ? 266 GLN A HE21 9  
ATOM 10841 H HE22 . GLN A 1 64 ? -3.065  -15.722 0.815  1.00 0.00 ? 266 GLN A HE22 9  
ATOM 10842 N N    . PRO A 1 65 ? -7.185  -11.554 1.470  1.00 0.00 ? 267 PRO A N    9  
ATOM 10843 C CA   . PRO A 1 65 ? -8.078  -11.293 2.604  1.00 0.00 ? 267 PRO A CA   9  
ATOM 10844 C C    . PRO A 1 65 ? -7.308  -11.063 3.900  1.00 0.00 ? 267 PRO A C    9  
ATOM 10845 O O    . PRO A 1 65 ? -6.438  -11.855 4.264  1.00 0.00 ? 267 PRO A O    9  
ATOM 10846 C CB   . PRO A 1 65 ? -8.923  -12.569 2.703  1.00 0.00 ? 267 PRO A CB   9  
ATOM 10847 C CG   . PRO A 1 65 ? -8.804  -13.220 1.368  1.00 0.00 ? 267 PRO A CG   9  
ATOM 10848 C CD   . PRO A 1 65 ? -7.436  -12.870 0.862  1.00 0.00 ? 267 PRO A CD   9  
ATOM 10849 H HA   . PRO A 1 65 ? -8.719  -10.445 2.414  1.00 0.00 ? 267 PRO A HA   9  
ATOM 10850 H HB2  . PRO A 1 65 ? -8.532  -13.200 3.488  1.00 0.00 ? 267 PRO A HB2  9  
ATOM 10851 H HB3  . PRO A 1 65 ? -9.947  -12.308 2.923  1.00 0.00 ? 267 PRO A HB3  9  
ATOM 10852 H HG2  . PRO A 1 65 ? -8.903  -14.291 1.472  1.00 0.00 ? 267 PRO A HG2  9  
ATOM 10853 H HG3  . PRO A 1 65 ? -9.560  -12.834 0.702  1.00 0.00 ? 267 PRO A HG3  9  
ATOM 10854 H HD2  . PRO A 1 65 ? -6.710  -13.596 1.198  1.00 0.00 ? 267 PRO A HD2  9  
ATOM 10855 H HD3  . PRO A 1 65 ? -7.435  -12.803 -0.216 1.00 0.00 ? 267 PRO A HD3  9  
ATOM 10856 N N    . LYS A 1 66 ? -7.635  -9.977  4.591  1.00 0.00 ? 268 LYS A N    9  
ATOM 10857 C CA   . LYS A 1 66 ? -6.973  -9.640  5.848  1.00 0.00 ? 268 LYS A CA   9  
ATOM 10858 C C    . LYS A 1 66 ? -5.477  -9.404  5.644  1.00 0.00 ? 268 LYS A C    9  
ATOM 10859 O O    . LYS A 1 66 ? -4.697  -9.474  6.592  1.00 0.00 ? 268 LYS A O    9  
ATOM 10860 C CB   . LYS A 1 66 ? -7.188  -10.755 6.874  1.00 0.00 ? 268 LYS A CB   9  
ATOM 10861 C CG   . LYS A 1 66 ? -8.486  -10.624 7.654  1.00 0.00 ? 268 LYS A CG   9  
ATOM 10862 C CD   . LYS A 1 66 ? -8.263  -9.955  8.999  1.00 0.00 ? 268 LYS A CD   9  
ATOM 10863 C CE   . LYS A 1 66 ? -9.511  -9.228  9.474  1.00 0.00 ? 268 LYS A CE   9  
ATOM 10864 N NZ   . LYS A 1 66 ? -9.659  -9.286  10.954 1.00 0.00 ? 268 LYS A NZ   9  
ATOM 10865 H H    . LYS A 1 66 ? -8.336  -9.385  4.248  1.00 0.00 ? 268 LYS A H    9  
ATOM 10866 H HA   . LYS A 1 66 ? -7.420  -8.732  6.223  1.00 0.00 ? 268 LYS A HA   9  
ATOM 10867 H HB2  . LYS A 1 66 ? -7.196  -11.706 6.361  1.00 0.00 ? 268 LYS A HB2  9  
ATOM 10868 H HB3  . LYS A 1 66 ? -6.369  -10.744 7.578  1.00 0.00 ? 268 LYS A HB3  9  
ATOM 10869 H HG2  . LYS A 1 66 ? -9.181  -10.030 7.079  1.00 0.00 ? 268 LYS A HG2  9  
ATOM 10870 H HG3  . LYS A 1 66 ? -8.899  -11.609 7.814  1.00 0.00 ? 268 LYS A HG3  9  
ATOM 10871 H HD2  . LYS A 1 66 ? -8.001  -10.710 9.726  1.00 0.00 ? 268 LYS A HD2  9  
ATOM 10872 H HD3  . LYS A 1 66 ? -7.456  -9.243  8.908  1.00 0.00 ? 268 LYS A HD3  9  
ATOM 10873 H HE2  . LYS A 1 66 ? -9.448  -8.193  9.169  1.00 0.00 ? 268 LYS A HE2  9  
ATOM 10874 H HE3  . LYS A 1 66 ? -10.375 -9.686  9.015  1.00 0.00 ? 268 LYS A HE3  9  
ATOM 10875 H HZ1  . LYS A 1 66 ? -8.882  -8.769  11.412 1.00 0.00 ? 268 LYS A HZ1  9  
ATOM 10876 H HZ2  . LYS A 1 66 ? -9.640  -10.275 11.277 1.00 0.00 ? 268 LYS A HZ2  9  
ATOM 10877 H HZ3  . LYS A 1 66 ? -10.561 -8.856  11.242 1.00 0.00 ? 268 LYS A HZ3  9  
ATOM 10878 N N    . TYR A 1 67 ? -5.084  -9.119  4.405  1.00 0.00 ? 269 TYR A N    9  
ATOM 10879 C CA   . TYR A 1 67 ? -3.681  -8.868  4.089  1.00 0.00 ? 269 TYR A CA   9  
ATOM 10880 C C    . TYR A 1 67 ? -3.460  -7.407  3.707  1.00 0.00 ? 269 TYR A C    9  
ATOM 10881 O O    . TYR A 1 67 ? -2.477  -7.073  3.046  1.00 0.00 ? 269 TYR A O    9  
ATOM 10882 C CB   . TYR A 1 67 ? -3.218  -9.774  2.946  1.00 0.00 ? 269 TYR A CB   9  
ATOM 10883 C CG   . TYR A 1 67 ? -2.730  -11.133 3.400  1.00 0.00 ? 269 TYR A CG   9  
ATOM 10884 C CD1  . TYR A 1 67 ? -3.414  -11.852 4.372  1.00 0.00 ? 269 TYR A CD1  9  
ATOM 10885 C CD2  . TYR A 1 67 ? -1.585  -11.696 2.853  1.00 0.00 ? 269 TYR A CD2  9  
ATOM 10886 C CE1  . TYR A 1 67 ? -2.971  -13.094 4.785  1.00 0.00 ? 269 TYR A CE1  9  
ATOM 10887 C CE2  . TYR A 1 67 ? -1.134  -12.937 3.262  1.00 0.00 ? 269 TYR A CE2  9  
ATOM 10888 C CZ   . TYR A 1 67 ? -1.830  -13.631 4.228  1.00 0.00 ? 269 TYR A CZ   9  
ATOM 10889 O OH   . TYR A 1 67 ? -1.386  -14.868 4.636  1.00 0.00 ? 269 TYR A OH   9  
ATOM 10890 H H    . TYR A 1 67 ? -5.750  -9.073  3.689  1.00 0.00 ? 269 TYR A H    9  
ATOM 10891 H HA   . TYR A 1 67 ? -3.098  -9.090  4.970  1.00 0.00 ? 269 TYR A HA   9  
ATOM 10892 H HB2  . TYR A 1 67 ? -4.038  -9.929  2.264  1.00 0.00 ? 269 TYR A HB2  9  
ATOM 10893 H HB3  . TYR A 1 67 ? -2.408  -9.290  2.421  1.00 0.00 ? 269 TYR A HB3  9  
ATOM 10894 H HD1  . TYR A 1 67 ? -4.308  -11.428 4.808  1.00 0.00 ? 269 TYR A HD1  9  
ATOM 10895 H HD2  . TYR A 1 67 ? -1.040  -11.150 2.097  1.00 0.00 ? 269 TYR A HD2  9  
ATOM 10896 H HE1  . TYR A 1 67 ? -3.517  -13.637 5.542  1.00 0.00 ? 269 TYR A HE1  9  
ATOM 10897 H HE2  . TYR A 1 67 ? -0.241  -13.358 2.824  1.00 0.00 ? 269 TYR A HE2  9  
ATOM 10898 H HH   . TYR A 1 67 ? -2.004  -15.542 4.347  1.00 0.00 ? 269 TYR A HH   9  
ATOM 10899 N N    . GLY A 1 68 ? -4.378  -6.540  4.123  1.00 0.00 ? 270 GLY A N    9  
ATOM 10900 C CA   . GLY A 1 68 ? -4.259  -5.128  3.810  1.00 0.00 ? 270 GLY A CA   9  
ATOM 10901 C C    . GLY A 1 68 ? -4.253  -4.255  5.048  1.00 0.00 ? 270 GLY A C    9  
ATOM 10902 O O    . GLY A 1 68 ? -5.155  -4.340  5.882  1.00 0.00 ? 270 GLY A O    9  
ATOM 10903 H H    . GLY A 1 68 ? -5.143  -6.859  4.645  1.00 0.00 ? 270 GLY A H    9  
ATOM 10904 H HA2  . GLY A 1 68 ? -3.338  -4.968  3.266  1.00 0.00 ? 270 GLY A HA2  9  
ATOM 10905 H HA3  . GLY A 1 68 ? -5.090  -4.838  3.183  1.00 0.00 ? 270 GLY A HA3  9  
ATOM 10906 N N    . LEU A 1 69 ? -3.232  -3.411  5.169  1.00 0.00 ? 271 LEU A N    9  
ATOM 10907 C CA   . LEU A 1 69 ? -3.111  -2.517  6.314  1.00 0.00 ? 271 LEU A CA   9  
ATOM 10908 C C    . LEU A 1 69 ? -2.810  -1.093  5.856  1.00 0.00 ? 271 LEU A C    9  
ATOM 10909 O O    . LEU A 1 69 ? -1.915  -0.868  5.041  1.00 0.00 ? 271 LEU A O    9  
ATOM 10910 C CB   . LEU A 1 69 ? -2.011  -3.010  7.257  1.00 0.00 ? 271 LEU A CB   9  
ATOM 10911 C CG   . LEU A 1 69 ? -2.195  -2.620  8.726  1.00 0.00 ? 271 LEU A CG   9  
ATOM 10912 C CD1  . LEU A 1 69 ? -3.440  -3.282  9.303  1.00 0.00 ? 271 LEU A CD1  9  
ATOM 10913 C CD2  . LEU A 1 69 ? -0.962  -2.998  9.535  1.00 0.00 ? 271 LEU A CD2  9  
ATOM 10914 H H    . LEU A 1 69 ? -2.545  -3.390  4.472  1.00 0.00 ? 271 LEU A H    9  
ATOM 10915 H HA   . LEU A 1 69 ? -4.053  -2.520  6.839  1.00 0.00 ? 271 LEU A HA   9  
ATOM 10916 H HB2  . LEU A 1 69 ? -1.968  -4.086  7.193  1.00 0.00 ? 271 LEU A HB2  9  
ATOM 10917 H HB3  . LEU A 1 69 ? -1.069  -2.608  6.918  1.00 0.00 ? 271 LEU A HB3  9  
ATOM 10918 H HG   . LEU A 1 69 ? -2.326  -1.550  8.794  1.00 0.00 ? 271 LEU A HG   9  
ATOM 10919 H HD11 . LEU A 1 69 ? -4.075  -3.619  8.498  1.00 0.00 ? 271 LEU A HD11 9  
ATOM 10920 H HD12 . LEU A 1 69 ? -3.149  -4.126  9.909  1.00 0.00 ? 271 LEU A HD12 9  
ATOM 10921 H HD13 . LEU A 1 69 ? -3.975  -2.569  9.911  1.00 0.00 ? 271 LEU A HD13 9  
ATOM 10922 H HD21 . LEU A 1 69 ? -1.200  -3.820  10.194 1.00 0.00 ? 271 LEU A HD21 9  
ATOM 10923 H HD22 . LEU A 1 69 ? -0.166  -3.292  8.866  1.00 0.00 ? 271 LEU A HD22 9  
ATOM 10924 H HD23 . LEU A 1 69 ? -0.644  -2.149  10.121 1.00 0.00 ? 271 LEU A HD23 9  
ATOM 10925 N N    . PHE A 1 70 ? -3.569  -0.136  6.380  1.00 0.00 ? 272 PHE A N    9  
ATOM 10926 C CA   . PHE A 1 70 ? -3.391  1.267   6.020  1.00 0.00 ? 272 PHE A CA   9  
ATOM 10927 C C    . PHE A 1 70 ? -2.706  2.040   7.143  1.00 0.00 ? 272 PHE A C    9  
ATOM 10928 O O    . PHE A 1 70 ? -3.285  2.236   8.210  1.00 0.00 ? 272 PHE A O    9  
ATOM 10929 C CB   . PHE A 1 70 ? -4.747  1.905   5.712  1.00 0.00 ? 272 PHE A CB   9  
ATOM 10930 C CG   . PHE A 1 70 ? -5.291  1.548   4.359  1.00 0.00 ? 272 PHE A CG   9  
ATOM 10931 C CD1  . PHE A 1 70 ? -5.429  0.222   3.980  1.00 0.00 ? 272 PHE A CD1  9  
ATOM 10932 C CD2  . PHE A 1 70 ? -5.668  2.539   3.467  1.00 0.00 ? 272 PHE A CD2  9  
ATOM 10933 C CE1  . PHE A 1 70 ? -5.933  -0.109  2.737  1.00 0.00 ? 272 PHE A CE1  9  
ATOM 10934 C CE2  . PHE A 1 70 ? -6.172  2.214   2.222  1.00 0.00 ? 272 PHE A CE2  9  
ATOM 10935 C CZ   . PHE A 1 70 ? -6.306  0.889   1.856  1.00 0.00 ? 272 PHE A CZ   9  
ATOM 10936 H H    . PHE A 1 70 ? -4.270  -0.379  7.021  1.00 0.00 ? 272 PHE A H    9  
ATOM 10937 H HA   . PHE A 1 70 ? -2.773  1.310   5.138  1.00 0.00 ? 272 PHE A HA   9  
ATOM 10938 H HB2  . PHE A 1 70 ? -5.464  1.580   6.451  1.00 0.00 ? 272 PHE A HB2  9  
ATOM 10939 H HB3  . PHE A 1 70 ? -4.650  2.979   5.761  1.00 0.00 ? 272 PHE A HB3  9  
ATOM 10940 H HD1  . PHE A 1 70 ? -5.138  -0.558  4.667  1.00 0.00 ? 272 PHE A HD1  9  
ATOM 10941 H HD2  . PHE A 1 70 ? -5.564  3.575   3.751  1.00 0.00 ? 272 PHE A HD2  9  
ATOM 10942 H HE1  . PHE A 1 70 ? -6.036  -1.145  2.454  1.00 0.00 ? 272 PHE A HE1  9  
ATOM 10943 H HE2  . PHE A 1 70 ? -6.463  2.995   1.535  1.00 0.00 ? 272 PHE A HE2  9  
ATOM 10944 H HZ   . PHE A 1 70 ? -6.700  0.633   0.883  1.00 0.00 ? 272 PHE A HZ   9  
ATOM 10945 N N    . ALA A 1 71 ? -1.478  2.489   6.896  1.00 0.00 ? 273 ALA A N    9  
ATOM 10946 C CA   . ALA A 1 71 ? -0.732  3.252   7.891  1.00 0.00 ? 273 ALA A CA   9  
ATOM 10947 C C    . ALA A 1 71 ? 0.062   4.384   7.237  1.00 0.00 ? 273 ALA A C    9  
ATOM 10948 O O    . ALA A 1 71 ? 0.508   4.265   6.096  1.00 0.00 ? 273 ALA A O    9  
ATOM 10949 C CB   . ALA A 1 71 ? 0.199   2.346   8.683  1.00 0.00 ? 273 ALA A CB   9  
ATOM 10950 H H    . ALA A 1 71 ? -1.070  2.311   6.023  1.00 0.00 ? 273 ALA A H    9  
ATOM 10951 H HA   . ALA A 1 71 ? -1.446  3.681   8.579  1.00 0.00 ? 273 ALA A HA   9  
ATOM 10952 H HB1  . ALA A 1 71 ? 0.622   2.899   9.510  1.00 0.00 ? 273 ALA A HB1  9  
ATOM 10953 H HB2  . ALA A 1 71 ? -0.356  1.502   9.063  1.00 0.00 ? 273 ALA A HB2  9  
ATOM 10954 H HB3  . ALA A 1 71 ? 0.996   1.996   8.042  1.00 0.00 ? 273 ALA A HB3  9  
ATOM 10955 N N    . PRO A 1 72 ? 0.249   5.498   7.964  1.00 0.00 ? 274 PRO A N    9  
ATOM 10956 C CA   . PRO A 1 72 ? 0.990   6.661   7.466  1.00 0.00 ? 274 PRO A CA   9  
ATOM 10957 C C    . PRO A 1 72 ? 2.324   6.281   6.832  1.00 0.00 ? 274 PRO A C    9  
ATOM 10958 O O    . PRO A 1 72 ? 2.839   5.186   7.051  1.00 0.00 ? 274 PRO A O    9  
ATOM 10959 C CB   . PRO A 1 72 ? 1.231   7.487   8.725  1.00 0.00 ? 274 PRO A CB   9  
ATOM 10960 C CG   . PRO A 1 72 ? 0.107   7.137   9.635  1.00 0.00 ? 274 PRO A CG   9  
ATOM 10961 C CD   . PRO A 1 72 ? -0.254  5.709   9.333  1.00 0.00 ? 274 PRO A CD   9  
ATOM 10962 H HA   . PRO A 1 72 ? 0.406   7.233   6.761  1.00 0.00 ? 274 PRO A HA   9  
ATOM 10963 H HB2  . PRO A 1 72 ? 2.182   7.216   9.155  1.00 0.00 ? 274 PRO A HB2  9  
ATOM 10964 H HB3  . PRO A 1 72 ? 1.226   8.538   8.477  1.00 0.00 ? 274 PRO A HB3  9  
ATOM 10965 H HG2  . PRO A 1 72 ? 0.430   7.231   10.661 1.00 0.00 ? 274 PRO A HG2  9  
ATOM 10966 H HG3  . PRO A 1 72 ? -0.735  7.786   9.445  1.00 0.00 ? 274 PRO A HG3  9  
ATOM 10967 H HD2  . PRO A 1 72 ? 0.234   5.042   10.029 1.00 0.00 ? 274 PRO A HD2  9  
ATOM 10968 H HD3  . PRO A 1 72 ? -1.324  5.577   9.371  1.00 0.00 ? 274 PRO A HD3  9  
ATOM 10969 N N    . VAL A 1 73 ? 2.881   7.201   6.050  1.00 0.00 ? 275 VAL A N    9  
ATOM 10970 C CA   . VAL A 1 73 ? 4.158   6.971   5.391  1.00 0.00 ? 275 VAL A CA   9  
ATOM 10971 C C    . VAL A 1 73 ? 5.301   6.968   6.404  1.00 0.00 ? 275 VAL A C    9  
ATOM 10972 O O    . VAL A 1 73 ? 6.274   6.231   6.252  1.00 0.00 ? 275 VAL A O    9  
ATOM 10973 C CB   . VAL A 1 73 ? 4.436   8.040   4.314  1.00 0.00 ? 275 VAL A CB   9  
ATOM 10974 C CG1  . VAL A 1 73 ? 4.499   9.426   4.937  1.00 0.00 ? 275 VAL A CG1  9  
ATOM 10975 C CG2  . VAL A 1 73 ? 5.723   7.724   3.564  1.00 0.00 ? 275 VAL A CG2  9  
ATOM 10976 H H    . VAL A 1 73 ? 2.423   8.058   5.920  1.00 0.00 ? 275 VAL A H    9  
ATOM 10977 H HA   . VAL A 1 73 ? 4.115   6.005   4.908  1.00 0.00 ? 275 VAL A HA   9  
ATOM 10978 H HB   . VAL A 1 73 ? 3.620   8.026   3.606  1.00 0.00 ? 275 VAL A HB   9  
ATOM 10979 H HG11 . VAL A 1 73 ? 5.520   9.653   5.208  1.00 0.00 ? 275 VAL A HG11 9  
ATOM 10980 H HG12 . VAL A 1 73 ? 4.144   10.157  4.225  1.00 0.00 ? 275 VAL A HG12 9  
ATOM 10981 H HG13 . VAL A 1 73 ? 3.878   9.453   5.821  1.00 0.00 ? 275 VAL A HG13 9  
ATOM 10982 H HG21 . VAL A 1 73 ? 5.659   6.732   3.143  1.00 0.00 ? 275 VAL A HG21 9  
ATOM 10983 H HG22 . VAL A 1 73 ? 5.862   8.444   2.771  1.00 0.00 ? 275 VAL A HG22 9  
ATOM 10984 H HG23 . VAL A 1 73 ? 6.558   7.773   4.248  1.00 0.00 ? 275 VAL A HG23 9  
ATOM 10985 N N    . HIS A 1 74 ? 5.174   7.795   7.438  1.00 0.00 ? 276 HIS A N    9  
ATOM 10986 C CA   . HIS A 1 74 ? 6.199   7.880   8.474  1.00 0.00 ? 276 HIS A CA   9  
ATOM 10987 C C    . HIS A 1 74 ? 6.134   6.676   9.408  1.00 0.00 ? 276 HIS A C    9  
ATOM 10988 O O    . HIS A 1 74 ? 7.138   6.292   10.008 1.00 0.00 ? 276 HIS A O    9  
ATOM 10989 C CB   . HIS A 1 74 ? 6.056   9.178   9.276  1.00 0.00 ? 276 HIS A CB   9  
ATOM 10990 C CG   . HIS A 1 74 ? 4.647   9.509   9.661  1.00 0.00 ? 276 HIS A CG   9  
ATOM 10991 N ND1  . HIS A 1 74 ? 4.097   10.763  9.489  1.00 0.00 ? 276 HIS A ND1  9  
ATOM 10992 C CD2  . HIS A 1 74 ? 3.674   8.747   10.215 1.00 0.00 ? 276 HIS A CD2  9  
ATOM 10993 C CE1  . HIS A 1 74 ? 2.848   10.757  9.923  1.00 0.00 ? 276 HIS A CE1  9  
ATOM 10994 N NE2  . HIS A 1 74 ? 2.569   9.548   10.367 1.00 0.00 ? 276 HIS A NE2  9  
ATOM 10995 H H    . HIS A 1 74 ? 4.374   8.358   7.506  1.00 0.00 ? 276 HIS A H    9  
ATOM 10996 H HA   . HIS A 1 74 ? 7.159   7.882   7.981  1.00 0.00 ? 276 HIS A HA   9  
ATOM 10997 H HB2  . HIS A 1 74 ? 6.634   9.094   10.185 1.00 0.00 ? 276 HIS A HB2  9  
ATOM 10998 H HB3  . HIS A 1 74 ? 6.442   9.999   8.689  1.00 0.00 ? 276 HIS A HB3  9  
ATOM 10999 H HD1  . HIS A 1 74 ? 4.555   11.540  9.109  1.00 0.00 ? 276 HIS A HD1  9  
ATOM 11000 H HD2  . HIS A 1 74 ? 3.750   7.702   10.480 1.00 0.00 ? 276 HIS A HD2  9  
ATOM 11001 H HE1  . HIS A 1 74 ? 2.173   11.599  9.915  1.00 0.00 ? 276 HIS A HE1  9  
ATOM 11002 H HE2  . HIS A 1 74 ? 1.739   9.290   10.820 1.00 0.00 ? 276 HIS A HE2  9  
ATOM 11003 N N    . LYS A 1 75 ? 4.951   6.075   9.521  1.00 0.00 ? 277 LYS A N    9  
ATOM 11004 C CA   . LYS A 1 75 ? 4.771   4.907   10.375 1.00 0.00 ? 277 LYS A CA   9  
ATOM 11005 C C    . LYS A 1 75 ? 5.311   3.653   9.699  1.00 0.00 ? 277 LYS A C    9  
ATOM 11006 O O    . LYS A 1 75 ? 5.595   2.654   10.361 1.00 0.00 ? 277 LYS A O    9  
ATOM 11007 C CB   . LYS A 1 75 ? 3.293   4.712   10.718 1.00 0.00 ? 277 LYS A CB   9  
ATOM 11008 C CG   . LYS A 1 75 ? 2.810   5.587   11.864 1.00 0.00 ? 277 LYS A CG   9  
ATOM 11009 C CD   . LYS A 1 75 ? 2.331   4.750   13.041 1.00 0.00 ? 277 LYS A CD   9  
ATOM 11010 C CE   . LYS A 1 75 ? 3.449   4.494   14.041 1.00 0.00 ? 277 LYS A CE   9  
ATOM 11011 N NZ   . LYS A 1 75 ? 4.640   3.867   13.406 1.00 0.00 ? 277 LYS A NZ   9  
ATOM 11012 H H    . LYS A 1 75 ? 4.187   6.420   9.013  1.00 0.00 ? 277 LYS A H    9  
ATOM 11013 H HA   . LYS A 1 75 ? 5.324   5.076   11.287 1.00 0.00 ? 277 LYS A HA   9  
ATOM 11014 H HB2  . LYS A 1 75 ? 2.701   4.942   9.846  1.00 0.00 ? 277 LYS A HB2  9  
ATOM 11015 H HB3  . LYS A 1 75 ? 3.132   3.679   10.989 1.00 0.00 ? 277 LYS A HB3  9  
ATOM 11016 H HG2  . LYS A 1 75 ? 3.622   6.219   12.190 1.00 0.00 ? 277 LYS A HG2  9  
ATOM 11017 H HG3  . LYS A 1 75 ? 1.991   6.199   11.514 1.00 0.00 ? 277 LYS A HG3  9  
ATOM 11018 H HD2  . LYS A 1 75 ? 1.533   5.273   13.539 1.00 0.00 ? 277 LYS A HD2  9  
ATOM 11019 H HD3  . LYS A 1 75 ? 1.969   3.803   12.670 1.00 0.00 ? 277 LYS A HD3  9  
ATOM 11020 H HE2  . LYS A 1 75 ? 3.741   5.435   14.483 1.00 0.00 ? 277 LYS A HE2  9  
ATOM 11021 H HE3  . LYS A 1 75 ? 3.077   3.836   14.814 1.00 0.00 ? 277 LYS A HE3  9  
ATOM 11022 H HZ1  . LYS A 1 75 ? 5.056   3.160   14.045 1.00 0.00 ? 277 LYS A HZ1  9  
ATOM 11023 H HZ2  . LYS A 1 75 ? 5.356   4.591   13.195 1.00 0.00 ? 277 LYS A HZ2  9  
ATOM 11024 H HZ3  . LYS A 1 75 ? 4.367   3.397   12.519 1.00 0.00 ? 277 LYS A HZ3  9  
ATOM 11025 N N    . VAL A 1 76 ? 5.452   3.711   8.379  1.00 0.00 ? 278 VAL A N    9  
ATOM 11026 C CA   . VAL A 1 76 ? 5.961   2.576   7.624  1.00 0.00 ? 278 VAL A CA   9  
ATOM 11027 C C    . VAL A 1 76 ? 7.460   2.703   7.384  1.00 0.00 ? 278 VAL A C    9  
ATOM 11028 O O    . VAL A 1 76 ? 7.970   3.793   7.124  1.00 0.00 ? 278 VAL A O    9  
ATOM 11029 C CB   . VAL A 1 76 ? 5.247   2.427   6.268  1.00 0.00 ? 278 VAL A CB   9  
ATOM 11030 C CG1  . VAL A 1 76 ? 5.661   1.135   5.590  1.00 0.00 ? 278 VAL A CG1  9  
ATOM 11031 C CG2  . VAL A 1 76 ? 3.738   2.473   6.446  1.00 0.00 ? 278 VAL A CG2  9  
ATOM 11032 H H    . VAL A 1 76 ? 5.209   4.532   7.906  1.00 0.00 ? 278 VAL A H    9  
ATOM 11033 H HA   . VAL A 1 76 ? 5.777   1.686   8.204  1.00 0.00 ? 278 VAL A HA   9  
ATOM 11034 H HB   . VAL A 1 76 ? 5.539   3.251   5.636  1.00 0.00 ? 278 VAL A HB   9  
ATOM 11035 H HG11 . VAL A 1 76 ? 4.861   0.795   4.948  1.00 0.00 ? 278 VAL A HG11 9  
ATOM 11036 H HG12 . VAL A 1 76 ? 6.549   1.306   5.000  1.00 0.00 ? 278 VAL A HG12 9  
ATOM 11037 H HG13 . VAL A 1 76 ? 5.864   0.384   6.339  1.00 0.00 ? 278 VAL A HG13 9  
ATOM 11038 H HG21 . VAL A 1 76 ? 3.339   3.321   5.912  1.00 0.00 ? 278 VAL A HG21 9  
ATOM 11039 H HG22 . VAL A 1 76 ? 3.302   1.564   6.054  1.00 0.00 ? 278 VAL A HG22 9  
ATOM 11040 H HG23 . VAL A 1 76 ? 3.500   2.561   7.495  1.00 0.00 ? 278 VAL A HG23 9  
ATOM 11041 N N    . THR A 1 77 ? 8.162   1.579   7.477  1.00 0.00 ? 279 THR A N    9  
ATOM 11042 C CA   . THR A 1 77 ? 9.604   1.560   7.274  1.00 0.00 ? 279 THR A CA   9  
ATOM 11043 C C    . THR A 1 77 ? 10.012  0.388   6.388  1.00 0.00 ? 279 THR A C    9  
ATOM 11044 O O    . THR A 1 77 ? 9.387   -0.671  6.415  1.00 0.00 ? 279 THR A O    9  
ATOM 11045 C CB   . THR A 1 77 ? 10.327  1.473   8.620  1.00 0.00 ? 279 THR A CB   9  
ATOM 11046 O OG1  . THR A 1 77 ? 9.455   1.822   9.681  1.00 0.00 ? 279 THR A OG1  9  
ATOM 11047 C CG2  . THR A 1 77 ? 11.537  2.376   8.706  1.00 0.00 ? 279 THR A CG2  9  
ATOM 11048 H H    . THR A 1 77 ? 7.697   0.743   7.689  1.00 0.00 ? 279 THR A H    9  
ATOM 11049 H HA   . THR A 1 77 ? 9.883   2.481   6.784  1.00 0.00 ? 279 THR A HA   9  
ATOM 11050 H HB   . THR A 1 77 ? 10.658  0.458   8.774  1.00 0.00 ? 279 THR A HB   9  
ATOM 11051 H HG1  . THR A 1 77 ? 9.525   1.169   10.381 1.00 0.00 ? 279 THR A HG1  9  
ATOM 11052 H HG21 . THR A 1 77 ? 12.240  1.968   9.417  1.00 0.00 ? 279 THR A HG21 9  
ATOM 11053 H HG22 . THR A 1 77 ? 11.230  3.360   9.029  1.00 0.00 ? 279 THR A HG22 9  
ATOM 11054 H HG23 . THR A 1 77 ? 12.005  2.444   7.736  1.00 0.00 ? 279 THR A HG23 9  
ATOM 11055 N N    . LYS A 1 78 ? 11.066  0.587   5.603  1.00 0.00 ? 280 LYS A N    9  
ATOM 11056 C CA   . LYS A 1 78 ? 11.558  -0.455  4.710  1.00 0.00 ? 280 LYS A CA   9  
ATOM 11057 C C    . LYS A 1 78 ? 12.216  -1.581  5.502  1.00 0.00 ? 280 LYS A C    9  
ATOM 11058 O O    . LYS A 1 78 ? 13.022  -1.334  6.398  1.00 0.00 ? 280 LYS A O    9  
ATOM 11059 C CB   . LYS A 1 78 ? 12.553  0.134   3.706  1.00 0.00 ? 280 LYS A CB   9  
ATOM 11060 C CG   . LYS A 1 78 ? 12.179  -0.126  2.257  1.00 0.00 ? 280 LYS A CG   9  
ATOM 11061 C CD   . LYS A 1 78 ? 13.406  -0.143  1.359  1.00 0.00 ? 280 LYS A CD   9  
ATOM 11062 C CE   . LYS A 1 78 ? 14.067  -1.511  1.343  1.00 0.00 ? 280 LYS A CE   9  
ATOM 11063 N NZ   . LYS A 1 78 ? 14.515  -1.895  -0.026 1.00 0.00 ? 280 LYS A NZ   9  
ATOM 11064 H H    . LYS A 1 78 ? 11.525  1.453   5.626  1.00 0.00 ? 280 LYS A H    9  
ATOM 11065 H HA   . LYS A 1 78 ? 10.712  -0.856  4.171  1.00 0.00 ? 280 LYS A HA   9  
ATOM 11066 H HB2  . LYS A 1 78 ? 12.607  1.202   3.855  1.00 0.00 ? 280 LYS A HB2  9  
ATOM 11067 H HB3  . LYS A 1 78 ? 13.529  -0.295  3.885  1.00 0.00 ? 280 LYS A HB3  9  
ATOM 11068 H HG2  . LYS A 1 78 ? 11.684  -1.082  2.188  1.00 0.00 ? 280 LYS A HG2  9  
ATOM 11069 H HG3  . LYS A 1 78 ? 11.510  0.653   1.922  1.00 0.00 ? 280 LYS A HG3  9  
ATOM 11070 H HD2  . LYS A 1 78 ? 13.107  0.115   0.353  1.00 0.00 ? 280 LYS A HD2  9  
ATOM 11071 H HD3  . LYS A 1 78 ? 14.115  0.586   1.723  1.00 0.00 ? 280 LYS A HD3  9  
ATOM 11072 H HE2  . LYS A 1 78 ? 14.924  -1.492  2.000  1.00 0.00 ? 280 LYS A HE2  9  
ATOM 11073 H HE3  . LYS A 1 78 ? 13.358  -2.243  1.699  1.00 0.00 ? 280 LYS A HE3  9  
ATOM 11074 H HZ1  . LYS A 1 78 ? 14.381  -2.916  -0.171 1.00 0.00 ? 280 LYS A HZ1  9  
ATOM 11075 H HZ2  . LYS A 1 78 ? 15.523  -1.665  -0.149 1.00 0.00 ? 280 LYS A HZ2  9  
ATOM 11076 H HZ3  . LYS A 1 78 ? 13.963  -1.380  -0.740 1.00 0.00 ? 280 LYS A HZ3  9  
ATOM 11077 N N    . ILE A 1 79 ? 11.864  -2.818  5.165  1.00 0.00 ? 281 ILE A N    9  
ATOM 11078 C CA   . ILE A 1 79 ? 12.420  -3.981  5.844  1.00 0.00 ? 281 ILE A CA   9  
ATOM 11079 C C    . ILE A 1 79 ? 13.624  -4.538  5.088  1.00 0.00 ? 281 ILE A C    9  
ATOM 11080 O O    . ILE A 1 79 ? 14.494  -5.182  5.675  1.00 0.00 ? 281 ILE A O    9  
ATOM 11081 C CB   . ILE A 1 79 ? 11.364  -5.093  6.010  1.00 0.00 ? 281 ILE A CB   9  
ATOM 11082 C CG1  . ILE A 1 79 ? 11.942  -6.271  6.799  1.00 0.00 ? 281 ILE A CG1  9  
ATOM 11083 C CG2  . ILE A 1 79 ? 10.855  -5.555  4.652  1.00 0.00 ? 281 ILE A CG2  9  
ATOM 11084 C CD1  . ILE A 1 79 ? 10.887  -7.195  7.366  1.00 0.00 ? 281 ILE A CD1  9  
ATOM 11085 H H    . ILE A 1 79 ? 11.217  -2.950  4.440  1.00 0.00 ? 281 ILE A H    9  
ATOM 11086 H HA   . ILE A 1 79 ? 12.741  -3.670  6.827  1.00 0.00 ? 281 ILE A HA   9  
ATOM 11087 H HB   . ILE A 1 79 ? 10.527  -4.683  6.556  1.00 0.00 ? 281 ILE A HB   9  
ATOM 11088 H HG12 . ILE A 1 79 ? 12.577  -6.853  6.150  1.00 0.00 ? 281 ILE A HG12 9  
ATOM 11089 H HG13 . ILE A 1 79 ? 12.528  -5.890  7.623  1.00 0.00 ? 281 ILE A HG13 9  
ATOM 11090 H HG21 . ILE A 1 79 ? 10.741  -6.629  4.655  1.00 0.00 ? 281 ILE A HG21 9  
ATOM 11091 H HG22 . ILE A 1 79 ? 9.901   -5.091  4.449  1.00 0.00 ? 281 ILE A HG22 9  
ATOM 11092 H HG23 . ILE A 1 79 ? 11.563  -5.272  3.887  1.00 0.00 ? 281 ILE A HG23 9  
ATOM 11093 H HD11 . ILE A 1 79 ? 11.243  -8.214  7.328  1.00 0.00 ? 281 ILE A HD11 9  
ATOM 11094 H HD12 . ILE A 1 79 ? 10.685  -6.923  8.393  1.00 0.00 ? 281 ILE A HD12 9  
ATOM 11095 H HD13 . ILE A 1 79 ? 9.981   -7.106  6.785  1.00 0.00 ? 281 ILE A HD13 9  
ATOM 11096 N N    . GLY A 1 80 ? 13.669  -4.285  3.783  1.00 0.00 ? 282 GLY A N    9  
ATOM 11097 C CA   . GLY A 1 80 ? 14.771  -4.768  2.973  1.00 0.00 ? 282 GLY A CA   9  
ATOM 11098 C C    . GLY A 1 80 ? 15.932  -3.794  2.939  1.00 0.00 ? 282 GLY A C    9  
ATOM 11099 O O    . GLY A 1 80 ? 15.891  -2.746  3.583  1.00 0.00 ? 282 GLY A O    9  
ATOM 11100 H H    . GLY A 1 80 ? 12.949  -3.766  3.368  1.00 0.00 ? 282 GLY A H    9  
ATOM 11101 H HA2  . GLY A 1 80 ? 15.114  -5.709  3.376  1.00 0.00 ? 282 GLY A HA2  9  
ATOM 11102 H HA3  . GLY A 1 80 ? 14.419  -4.927  1.964  1.00 0.00 ? 282 GLY A HA3  9  
ATOM 11103 N N    . PHE A 1 81 ? 16.970  -4.141  2.185  1.00 0.00 ? 283 PHE A N    9  
ATOM 11104 C CA   . PHE A 1 81 ? 18.149  -3.290  2.070  1.00 0.00 ? 283 PHE A CA   9  
ATOM 11105 C C    . PHE A 1 81 ? 17.996  -2.307  0.910  1.00 0.00 ? 283 PHE A C    9  
ATOM 11106 O O    . PHE A 1 81 ? 17.441  -2.648  -0.134 1.00 0.00 ? 283 PHE A O    9  
ATOM 11107 C CB   . PHE A 1 81 ? 19.402  -4.145  1.870  1.00 0.00 ? 283 PHE A CB   9  
ATOM 11108 C CG   . PHE A 1 81 ? 20.590  -3.659  2.648  1.00 0.00 ? 283 PHE A CG   9  
ATOM 11109 C CD1  . PHE A 1 81 ? 20.677  -3.875  4.015  1.00 0.00 ? 283 PHE A CD1  9  
ATOM 11110 C CD2  . PHE A 1 81 ? 21.622  -2.986  2.014  1.00 0.00 ? 283 PHE A CD2  9  
ATOM 11111 C CE1  . PHE A 1 81 ? 21.769  -3.428  4.734  1.00 0.00 ? 283 PHE A CE1  9  
ATOM 11112 C CE2  . PHE A 1 81 ? 22.717  -2.538  2.727  1.00 0.00 ? 283 PHE A CE2  9  
ATOM 11113 C CZ   . PHE A 1 81 ? 22.790  -2.759  4.088  1.00 0.00 ? 283 PHE A CZ   9  
ATOM 11114 H H    . PHE A 1 81 ? 16.943  -4.990  1.696  1.00 0.00 ? 283 PHE A H    9  
ATOM 11115 H HA   . PHE A 1 81 ? 18.246  -2.734  2.990  1.00 0.00 ? 283 PHE A HA   9  
ATOM 11116 H HB2  . PHE A 1 81 ? 19.191  -5.157  2.182  1.00 0.00 ? 283 PHE A HB2  9  
ATOM 11117 H HB3  . PHE A 1 81 ? 19.666  -4.145  0.822  1.00 0.00 ? 283 PHE A HB3  9  
ATOM 11118 H HD1  . PHE A 1 81 ? 19.879  -4.399  4.519  1.00 0.00 ? 283 PHE A HD1  9  
ATOM 11119 H HD2  . PHE A 1 81 ? 21.566  -2.812  0.948  1.00 0.00 ? 283 PHE A HD2  9  
ATOM 11120 H HE1  . PHE A 1 81 ? 21.823  -3.603  5.797  1.00 0.00 ? 283 PHE A HE1  9  
ATOM 11121 H HE2  . PHE A 1 81 ? 23.515  -2.014  2.221  1.00 0.00 ? 283 PHE A HE2  9  
ATOM 11122 H HZ   . PHE A 1 81 ? 23.645  -2.409  4.648  1.00 0.00 ? 283 PHE A HZ   9  
ATOM 11123 N N    . GLY B 2 29 ? 0.454   10.065  24.450 1.00 0.00 ? 444 GLY B N    9  
ATOM 11124 C CA   . GLY B 2 29 ? 0.662   9.659   23.072 1.00 0.00 ? 444 GLY B CA   9  
ATOM 11125 C C    . GLY B 2 29 ? 0.709   8.153   22.912 1.00 0.00 ? 444 GLY B C    9  
ATOM 11126 O O    . GLY B 2 29 ? 0.965   7.428   23.873 1.00 0.00 ? 444 GLY B O    9  
ATOM 11127 H HA2  . GLY B 2 29 ? -0.143  10.049  22.468 1.00 0.00 ? 444 GLY B HA2  9  
ATOM 11128 H HA3  . GLY B 2 29 ? 1.595   10.077  22.722 1.00 0.00 ? 444 GLY B HA3  9  
ATOM 11129 N N    . GLU B 2 30 ? 0.463   7.679   21.695 1.00 0.00 ? 445 GLU B N    9  
ATOM 11130 C CA   . GLU B 2 30 ? 0.478   6.249   21.413 1.00 0.00 ? 445 GLU B CA   9  
ATOM 11131 C C    . GLU B 2 30 ? 1.089   5.970   20.043 1.00 0.00 ? 445 GLU B C    9  
ATOM 11132 O O    . GLU B 2 30 ? 0.560   6.399   19.017 1.00 0.00 ? 445 GLU B O    9  
ATOM 11133 C CB   . GLU B 2 30 ? -0.941  5.679   21.479 1.00 0.00 ? 445 GLU B CB   9  
ATOM 11134 C CG   . GLU B 2 30 ? -1.021  4.326   22.167 1.00 0.00 ? 445 GLU B CG   9  
ATOM 11135 C CD   . GLU B 2 30 ? -1.631  4.412   23.552 1.00 0.00 ? 445 GLU B CD   9  
ATOM 11136 O OE1  . GLU B 2 30 ? -2.875  4.483   23.650 1.00 0.00 ? 445 GLU B OE1  9  
ATOM 11137 O OE2  . GLU B 2 30 ? -0.867  4.407   24.540 1.00 0.00 ? 445 GLU B OE2  9  
ATOM 11138 H H    . GLU B 2 30 ? 0.266   8.308   20.970 1.00 0.00 ? 445 GLU B H    9  
ATOM 11139 H HA   . GLU B 2 30 ? 1.084   5.770   22.168 1.00 0.00 ? 445 GLU B HA   9  
ATOM 11140 H HB2  . GLU B 2 30 ? -1.568  6.372   22.019 1.00 0.00 ? 445 GLU B HB2  9  
ATOM 11141 H HB3  . GLU B 2 30 ? -1.320  5.571   20.475 1.00 0.00 ? 445 GLU B HB3  9  
ATOM 11142 H HG2  . GLU B 2 30 ? -1.627  3.666   21.564 1.00 0.00 ? 445 GLU B HG2  9  
ATOM 11143 H HG3  . GLU B 2 30 ? -0.024  3.920   22.253 1.00 0.00 ? 445 GLU B HG3  9  
ATOM 11144 N N    . GLU B 2 31 ? 2.206   5.251   20.035 1.00 0.00 ? 446 GLU B N    9  
ATOM 11145 C CA   . GLU B 2 31 ? 2.891   4.915   18.792 1.00 0.00 ? 446 GLU B CA   9  
ATOM 11146 C C    . GLU B 2 31 ? 1.983   4.099   17.874 1.00 0.00 ? 446 GLU B C    9  
ATOM 11147 O O    . GLU B 2 31 ? 1.942   4.325   16.665 1.00 0.00 ? 446 GLU B O    9  
ATOM 11148 C CB   . GLU B 2 31 ? 4.175   4.136   19.087 1.00 0.00 ? 446 GLU B CB   9  
ATOM 11149 C CG   . GLU B 2 31 ? 5.386   4.646   18.322 1.00 0.00 ? 446 GLU B CG   9  
ATOM 11150 C CD   . GLU B 2 31 ? 6.633   3.829   18.593 1.00 0.00 ? 446 GLU B CD   9  
ATOM 11151 O OE1  . GLU B 2 31 ? 7.320   4.110   19.598 1.00 0.00 ? 446 GLU B OE1  9  
ATOM 11152 O OE2  . GLU B 2 31 ? 6.923   2.908   17.802 1.00 0.00 ? 446 GLU B OE2  9  
ATOM 11153 H H    . GLU B 2 31 ? 2.580   4.938   20.885 1.00 0.00 ? 446 GLU B H    9  
ATOM 11154 H HA   . GLU B 2 31 ? 3.147   5.839   18.296 1.00 0.00 ? 446 GLU B HA   9  
ATOM 11155 H HB2  . GLU B 2 31 ? 4.390   4.204   20.143 1.00 0.00 ? 446 GLU B HB2  9  
ATOM 11156 H HB3  . GLU B 2 31 ? 4.022   3.098   18.827 1.00 0.00 ? 446 GLU B HB3  9  
ATOM 11157 H HG2  . GLU B 2 31 ? 5.170   4.605   17.264 1.00 0.00 ? 446 GLU B HG2  9  
ATOM 11158 H HG3  . GLU B 2 31 ? 5.572   5.671   18.611 1.00 0.00 ? 446 GLU B HG3  9  
ATOM 11159 N N    . GLU B 2 32 ? 1.260   3.150   18.458 1.00 0.00 ? 447 GLU B N    9  
ATOM 11160 C CA   . GLU B 2 32 ? 0.353   2.301   17.694 1.00 0.00 ? 447 GLU B CA   9  
ATOM 11161 C C    . GLU B 2 32 ? -1.044  2.911   17.636 1.00 0.00 ? 447 GLU B C    9  
ATOM 11162 O O    . GLU B 2 32 ? -1.379  3.793   18.426 1.00 0.00 ? 447 GLU B O    9  
ATOM 11163 C CB   . GLU B 2 32 ? 0.287   0.903   18.311 1.00 0.00 ? 447 GLU B CB   9  
ATOM 11164 C CG   . GLU B 2 32 ? 1.652   0.302   18.605 1.00 0.00 ? 447 GLU B CG   9  
ATOM 11165 C CD   . GLU B 2 32 ? 1.606   -0.733  19.713 1.00 0.00 ? 447 GLU B CD   9  
ATOM 11166 O OE1  . GLU B 2 32 ? 1.565   -0.334  20.895 1.00 0.00 ? 447 GLU B OE1  9  
ATOM 11167 O OE2  . GLU B 2 32 ? 1.612   -1.941  19.396 1.00 0.00 ? 447 GLU B OE2  9  
ATOM 11168 H H    . GLU B 2 32 ? 1.337   3.019   19.426 1.00 0.00 ? 447 GLU B H    9  
ATOM 11169 H HA   . GLU B 2 32 ? 0.740   2.223   16.690 1.00 0.00 ? 447 GLU B HA   9  
ATOM 11170 H HB2  . GLU B 2 32 ? -0.265  0.957   19.237 1.00 0.00 ? 447 GLU B HB2  9  
ATOM 11171 H HB3  . GLU B 2 32 ? -0.232  0.246   17.629 1.00 0.00 ? 447 GLU B HB3  9  
ATOM 11172 H HG2  . GLU B 2 32 ? 2.024   -0.169  17.708 1.00 0.00 ? 447 GLU B HG2  9  
ATOM 11173 H HG3  . GLU B 2 32 ? 2.324   1.094   18.900 1.00 0.00 ? 447 GLU B HG3  9  
ATOM 11174 N N    . GLY B 2 33 ? -1.853  2.437   16.693 1.00 0.00 ? 448 GLY B N    9  
ATOM 11175 C CA   . GLY B 2 33 ? -3.203  2.950   16.550 1.00 0.00 ? 448 GLY B CA   9  
ATOM 11176 C C    . GLY B 2 33 ? -3.355  3.870   15.351 1.00 0.00 ? 448 GLY B C    9  
ATOM 11177 O O    . GLY B 2 33 ? -4.453  4.350   15.068 1.00 0.00 ? 448 GLY B O    9  
ATOM 11178 H H    . GLY B 2 33 ? -1.533  1.733   16.092 1.00 0.00 ? 448 GLY B H    9  
ATOM 11179 H HA2  . GLY B 2 33 ? -3.881  2.117   16.438 1.00 0.00 ? 448 GLY B HA2  9  
ATOM 11180 H HA3  . GLY B 2 33 ? -3.465  3.496   17.444 1.00 0.00 ? 448 GLY B HA3  9  
ATOM 11181 N N    . GLU B 2 34 ? -2.254  4.118   14.645 1.00 0.00 ? 449 GLU B N    9  
ATOM 11182 C CA   . GLU B 2 34 ? -2.278  4.988   13.476 1.00 0.00 ? 449 GLU B CA   9  
ATOM 11183 C C    . GLU B 2 34 ? -2.414  4.178   12.194 1.00 0.00 ? 449 GLU B C    9  
ATOM 11184 O O    . GLU B 2 34 ? -1.989  4.621   11.130 1.00 0.00 ? 449 GLU B O    9  
ATOM 11185 C CB   . GLU B 2 34 ? -1.000  5.826   13.400 1.00 0.00 ? 449 GLU B CB   9  
ATOM 11186 C CG   . GLU B 2 34 ? -0.447  6.232   14.757 1.00 0.00 ? 449 GLU B CG   9  
ATOM 11187 C CD   . GLU B 2 34 ? 0.446   7.455   14.681 1.00 0.00 ? 449 GLU B CD   9  
ATOM 11188 O OE1  . GLU B 2 34 ? 0.143   8.361   13.878 1.00 0.00 ? 449 GLU B OE1  9  
ATOM 11189 O OE2  . GLU B 2 34 ? 1.449   7.504   15.423 1.00 0.00 ? 449 GLU B OE2  9  
ATOM 11190 H H    . GLU B 2 34 ? -1.408  3.709   14.920 1.00 0.00 ? 449 GLU B H    9  
ATOM 11191 H HA   . GLU B 2 34 ? -3.127  5.649   13.565 1.00 0.00 ? 449 GLU B HA   9  
ATOM 11192 H HB2  . GLU B 2 34 ? -0.243  5.254   12.879 1.00 0.00 ? 449 GLU B HB2  9  
ATOM 11193 H HB3  . GLU B 2 34 ? -1.207  6.725   12.838 1.00 0.00 ? 449 GLU B HB3  9  
ATOM 11194 H HG2  . GLU B 2 34 ? -1.273  6.450   15.419 1.00 0.00 ? 449 GLU B HG2  9  
ATOM 11195 H HG3  . GLU B 2 34 ? 0.126   5.409   15.158 1.00 0.00 ? 449 GLU B HG3  9  
ATOM 11196 N N    . GLU B 2 35 ? -2.997  2.991   12.293 1.00 0.00 ? 450 GLU B N    9  
ATOM 11197 C CA   . GLU B 2 35 ? -3.166  2.144   11.122 1.00 0.00 ? 450 GLU B CA   9  
ATOM 11198 C C    . GLU B 2 35 ? -4.523  1.445   11.132 1.00 0.00 ? 450 GLU B C    9  
ATOM 11199 O O    . GLU B 2 35 ? -5.114  1.223   12.190 1.00 0.00 ? 450 GLU B O    9  
ATOM 11200 C CB   . GLU B 2 35 ? -2.031  1.119   11.042 1.00 0.00 ? 450 GLU B CB   9  
ATOM 11201 C CG   . GLU B 2 35 ? -2.183  -0.050  12.005 1.00 0.00 ? 450 GLU B CG   9  
ATOM 11202 C CD   . GLU B 2 35 ? -0.874  -0.438  12.663 1.00 0.00 ? 450 GLU B CD   9  
ATOM 11203 O OE1  . GLU B 2 35 ? 0.054   -0.855  11.938 1.00 0.00 ? 450 GLU B OE1  9  
ATOM 11204 O OE2  . GLU B 2 35 ? -0.776  -0.324  13.903 1.00 0.00 ? 450 GLU B OE2  9  
ATOM 11205 H H    . GLU B 2 35 ? -3.317  2.680   13.164 1.00 0.00 ? 450 GLU B H    9  
ATOM 11206 H HA   . GLU B 2 35 ? -3.116  2.781   10.253 1.00 0.00 ? 450 GLU B HA   9  
ATOM 11207 H HB2  . GLU B 2 35 ? -1.987  0.727   10.038 1.00 0.00 ? 450 GLU B HB2  9  
ATOM 11208 H HB3  . GLU B 2 35 ? -1.098  1.618   11.263 1.00 0.00 ? 450 GLU B HB3  9  
ATOM 11209 H HG2  . GLU B 2 35 ? -2.889  0.223   12.775 1.00 0.00 ? 450 GLU B HG2  9  
ATOM 11210 H HG3  . GLU B 2 35 ? -2.561  -0.901  11.458 1.00 0.00 ? 450 GLU B HG3  9  
ATOM 11211 N N    . TYR B 2 36 ? -5.010  1.106   9.944  1.00 0.00 ? 451 TYR B N    9  
ATOM 11212 C CA   . TYR B 2 36 ? -6.298  0.437   9.804  1.00 0.00 ? 451 TYR B CA   9  
ATOM 11213 C C    . TYR B 2 36 ? -6.213  -0.704  8.798  1.00 0.00 ? 451 TYR B C    9  
ATOM 11214 O O    . TYR B 2 36 ? -5.089  -1.186  8.542  1.00 0.00 ? 451 TYR B O    9  
ATOM 11215 C CB   . TYR B 2 36 ? -7.367  1.439   9.366  1.00 0.00 ? 451 TYR B CB   9  
ATOM 11216 C CG   . TYR B 2 36 ? -7.912  2.276   10.501 1.00 0.00 ? 451 TYR B CG   9  
ATOM 11217 C CD1  . TYR B 2 36 ? -7.229  3.400   10.948 1.00 0.00 ? 451 TYR B CD1  9  
ATOM 11218 C CD2  . TYR B 2 36 ? -9.109  1.945   11.124 1.00 0.00 ? 451 TYR B CD2  9  
ATOM 11219 C CE1  . TYR B 2 36 ? -7.722  4.170   11.985 1.00 0.00 ? 451 TYR B CE1  9  
ATOM 11220 C CE2  . TYR B 2 36 ? -9.608  2.710   12.161 1.00 0.00 ? 451 TYR B CE2  9  
ATOM 11221 C CZ   . TYR B 2 36 ? -8.911  3.820   12.588 1.00 0.00 ? 451 TYR B CZ   9  
ATOM 11222 O OH   . TYR B 2 36 ? -9.405  4.583   13.620 1.00 0.00 ? 451 TYR B OH   9  
ATOM 11223 O OXT  . TYR B 2 36 ? -7.272  -1.110  8.274  1.00 0.00 ? 451 TYR B OXT  9  
ATOM 11224 H H    . TYR B 2 36 ? -4.492  1.313   9.138  1.00 0.00 ? 451 TYR B H    9  
ATOM 11225 H HA   . TYR B 2 36 ? -6.569  0.033   10.769 1.00 0.00 ? 451 TYR B HA   9  
ATOM 11226 H HB2  . TYR B 2 36 ? -6.944  2.107   8.633  1.00 0.00 ? 451 TYR B HB2  9  
ATOM 11227 H HB3  . TYR B 2 36 ? -8.193  0.901   8.922  1.00 0.00 ? 451 TYR B HB3  9  
ATOM 11228 H HD1  . TYR B 2 36 ? -6.297  3.671   10.473 1.00 0.00 ? 451 TYR B HD1  9  
ATOM 11229 H HD2  . TYR B 2 36 ? -9.652  1.074   10.788 1.00 0.00 ? 451 TYR B HD2  9  
ATOM 11230 H HE1  . TYR B 2 36 ? -7.175  5.039   12.318 1.00 0.00 ? 451 TYR B HE1  9  
ATOM 11231 H HE2  . TYR B 2 36 ? -10.541 2.436   12.634 1.00 0.00 ? 451 TYR B HE2  9  
ATOM 11232 H HH   . TYR B 2 36 ? -9.087  4.234   14.457 1.00 0.00 ? 451 TYR B HH   9  
ATOM 11233 N N    . ARG A 1 8  ? 11.808  10.576  4.509  1.00 0.00 ? 210 ARG A N    10 
ATOM 11234 C CA   . ARG A 1 8  ? 10.822  9.576   4.118  1.00 0.00 ? 210 ARG A CA   10 
ATOM 11235 C C    . ARG A 1 8  ? 10.718  9.476   2.600  1.00 0.00 ? 210 ARG A C    10 
ATOM 11236 O O    . ARG A 1 8  ? 10.793  10.483  1.895  1.00 0.00 ? 210 ARG A O    10 
ATOM 11237 C CB   . ARG A 1 8  ? 9.454   9.918   4.712  1.00 0.00 ? 210 ARG A CB   10 
ATOM 11238 C CG   . ARG A 1 8  ? 8.634   8.696   5.097  1.00 0.00 ? 210 ARG A CG   10 
ATOM 11239 C CD   . ARG A 1 8  ? 9.323   7.880   6.179  1.00 0.00 ? 210 ARG A CD   10 
ATOM 11240 N NE   . ARG A 1 8  ? 9.929   6.663   5.646  1.00 0.00 ? 210 ARG A NE   10 
ATOM 11241 C CZ   . ARG A 1 8  ? 10.723  5.860   6.350  1.00 0.00 ? 210 ARG A CZ   10 
ATOM 11242 N NH1  . ARG A 1 8  ? 11.012  6.143   7.615  1.00 0.00 ? 210 ARG A NH1  10 
ATOM 11243 N NH2  . ARG A 1 8  ? 11.229  4.771   5.790  1.00 0.00 ? 210 ARG A NH2  10 
ATOM 11244 H HA   . ARG A 1 8  ? 11.144  8.622   4.509  1.00 0.00 ? 210 ARG A HA   10 
ATOM 11245 H HB2  . ARG A 1 8  ? 9.599   10.520  5.597  1.00 0.00 ? 210 ARG A HB2  10 
ATOM 11246 H HB3  . ARG A 1 8  ? 8.892   10.488  3.986  1.00 0.00 ? 210 ARG A HB3  10 
ATOM 11247 H HG2  . ARG A 1 8  ? 7.672   9.021   5.463  1.00 0.00 ? 210 ARG A HG2  10 
ATOM 11248 H HG3  . ARG A 1 8  ? 8.498   8.077   4.223  1.00 0.00 ? 210 ARG A HG3  10 
ATOM 11249 H HD2  . ARG A 1 8  ? 10.093  8.485   6.635  1.00 0.00 ? 210 ARG A HD2  10 
ATOM 11250 H HD3  . ARG A 1 8  ? 8.591   7.610   6.927  1.00 0.00 ? 210 ARG A HD3  10 
ATOM 11251 H HE   . ARG A 1 8  ? 9.733   6.431   4.715  1.00 0.00 ? 210 ARG A HE   10 
ATOM 11252 H HH11 . ARG A 1 8  ? 10.633  6.964   8.044  1.00 0.00 ? 210 ARG A HH11 10 
ATOM 11253 H HH12 . ARG A 1 8  ? 11.610  5.536   8.139  1.00 0.00 ? 210 ARG A HH12 10 
ATOM 11254 H HH21 . ARG A 1 8  ? 11.015  4.552   4.838  1.00 0.00 ? 210 ARG A HH21 10 
ATOM 11255 H HH22 . ARG A 1 8  ? 11.827  4.168   6.320  1.00 0.00 ? 210 ARG A HH22 10 
ATOM 11256 N N    . GLU A 1 9  ? 10.546  8.255   2.102  1.00 0.00 ? 211 GLU A N    10 
ATOM 11257 C CA   . GLU A 1 9  ? 10.431  8.021   0.667  1.00 0.00 ? 211 GLU A CA   10 
ATOM 11258 C C    . GLU A 1 9  ? 10.182  6.546   0.377  1.00 0.00 ? 211 GLU A C    10 
ATOM 11259 O O    . GLU A 1 9  ? 11.118  5.750   0.310  1.00 0.00 ? 211 GLU A O    10 
ATOM 11260 C CB   . GLU A 1 9  ? 11.701  8.487   -0.050 1.00 0.00 ? 211 GLU A CB   10 
ATOM 11261 C CG   . GLU A 1 9  ? 12.984  8.057   0.645  1.00 0.00 ? 211 GLU A CG   10 
ATOM 11262 C CD   . GLU A 1 9  ? 13.873  9.231   1.006  1.00 0.00 ? 211 GLU A CD   10 
ATOM 11263 O OE1  . GLU A 1 9  ? 14.618  9.706   0.124  1.00 0.00 ? 211 GLU A OE1  10 
ATOM 11264 O OE2  . GLU A 1 9  ? 13.824  9.676   2.172  1.00 0.00 ? 211 GLU A OE2  10 
ATOM 11265 H H    . GLU A 1 9  ? 10.494  7.492   2.717  1.00 0.00 ? 211 GLU A H    10 
ATOM 11266 H HA   . GLU A 1 9  ? 9.592   8.595   0.304  1.00 0.00 ? 211 GLU A HA   10 
ATOM 11267 H HB2  . GLU A 1 9  ? 11.704  8.078   -1.050 1.00 0.00 ? 211 GLU A HB2  10 
ATOM 11268 H HB3  . GLU A 1 9  ? 11.691  9.564   -0.110 1.00 0.00 ? 211 GLU A HB3  10 
ATOM 11269 H HG2  . GLU A 1 9  ? 12.728  7.528   1.551  1.00 0.00 ? 211 GLU A HG2  10 
ATOM 11270 H HG3  . GLU A 1 9  ? 13.531  7.399   -0.014 1.00 0.00 ? 211 GLU A HG3  10 
ATOM 11271 N N    . LEU A 1 10 ? 8.914   6.186   0.205  1.00 0.00 ? 212 LEU A N    10 
ATOM 11272 C CA   . LEU A 1 10 ? 8.542   4.804   -0.078 1.00 0.00 ? 212 LEU A CA   10 
ATOM 11273 C C    . LEU A 1 10 ? 7.987   4.667   -1.491 1.00 0.00 ? 212 LEU A C    10 
ATOM 11274 O O    . LEU A 1 10 ? 7.336   5.576   -2.006 1.00 0.00 ? 212 LEU A O    10 
ATOM 11275 C CB   . LEU A 1 10 ? 7.506   4.315   0.938  1.00 0.00 ? 212 LEU A CB   10 
ATOM 11276 C CG   . LEU A 1 10 ? 8.039   4.096   2.353  1.00 0.00 ? 212 LEU A CG   10 
ATOM 11277 C CD1  . LEU A 1 10 ? 6.910   3.706   3.294  1.00 0.00 ? 212 LEU A CD1  10 
ATOM 11278 C CD2  . LEU A 1 10 ? 9.128   3.034   2.355  1.00 0.00 ? 212 LEU A CD2  10 
ATOM 11279 H H    . LEU A 1 10 ? 8.212   6.868   0.271  1.00 0.00 ? 212 LEU A H    10 
ATOM 11280 H HA   . LEU A 1 10 ? 9.431   4.199   0.010  1.00 0.00 ? 212 LEU A HA   10 
ATOM 11281 H HB2  . LEU A 1 10 ? 6.708   5.042   0.983  1.00 0.00 ? 212 LEU A HB2  10 
ATOM 11282 H HB3  . LEU A 1 10 ? 7.101   3.379   0.582  1.00 0.00 ? 212 LEU A HB3  10 
ATOM 11283 H HG   . LEU A 1 10 ? 8.471   5.019   2.716  1.00 0.00 ? 212 LEU A HG   10 
ATOM 11284 H HD11 . LEU A 1 10 ? 6.626   2.680   3.110  1.00 0.00 ? 212 LEU A HD11 10 
ATOM 11285 H HD12 . LEU A 1 10 ? 7.240   3.810   4.316  1.00 0.00 ? 212 LEU A HD12 10 
ATOM 11286 H HD13 . LEU A 1 10 ? 6.060   4.350   3.122  1.00 0.00 ? 212 LEU A HD13 10 
ATOM 11287 H HD21 . LEU A 1 10 ? 9.082   2.473   3.276  1.00 0.00 ? 212 LEU A HD21 10 
ATOM 11288 H HD22 . LEU A 1 10 ? 8.979   2.365   1.519  1.00 0.00 ? 212 LEU A HD22 10 
ATOM 11289 H HD23 . LEU A 1 10 ? 10.095  3.508   2.269  1.00 0.00 ? 212 LEU A HD23 10 
ATOM 11290 N N    . LYS A 1 11 ? 8.249   3.521   -2.112 1.00 0.00 ? 213 LYS A N    10 
ATOM 11291 C CA   . LYS A 1 11 ? 7.775   3.260   -3.467 1.00 0.00 ? 213 LYS A CA   10 
ATOM 11292 C C    . LYS A 1 11 ? 6.881   2.024   -3.497 1.00 0.00 ? 213 LYS A C    10 
ATOM 11293 O O    . LYS A 1 11 ? 7.103   1.067   -2.756 1.00 0.00 ? 213 LYS A O    10 
ATOM 11294 C CB   . LYS A 1 11 ? 8.958   3.070   -4.418 1.00 0.00 ? 213 LYS A CB   10 
ATOM 11295 C CG   . LYS A 1 11 ? 10.065  4.096   -4.224 1.00 0.00 ? 213 LYS A CG   10 
ATOM 11296 C CD   . LYS A 1 11 ? 11.221  3.524   -3.417 1.00 0.00 ? 213 LYS A CD   10 
ATOM 11297 C CE   . LYS A 1 11 ? 11.612  4.443   -2.272 1.00 0.00 ? 213 LYS A CE   10 
ATOM 11298 N NZ   . LYS A 1 11 ? 12.708  5.377   -2.655 1.00 0.00 ? 213 LYS A NZ   10 
ATOM 11299 H H    . LYS A 1 11 ? 8.772   2.835   -1.649 1.00 0.00 ? 213 LYS A H    10 
ATOM 11300 H HA   . LYS A 1 11 ? 7.199   4.114   -3.788 1.00 0.00 ? 213 LYS A HA   10 
ATOM 11301 H HB2  . LYS A 1 11 ? 9.376   2.086   -4.262 1.00 0.00 ? 213 LYS A HB2  10 
ATOM 11302 H HB3  . LYS A 1 11 ? 8.603   3.143   -5.434 1.00 0.00 ? 213 LYS A HB3  10 
ATOM 11303 H HG2  . LYS A 1 11 ? 10.432  4.401   -5.192 1.00 0.00 ? 213 LYS A HG2  10 
ATOM 11304 H HG3  . LYS A 1 11 ? 9.661   4.950   -3.702 1.00 0.00 ? 213 LYS A HG3  10 
ATOM 11305 H HD2  . LYS A 1 11 ? 10.930  2.567   -3.013 1.00 0.00 ? 213 LYS A HD2  10 
ATOM 11306 H HD3  . LYS A 1 11 ? 12.074  3.395   -4.070 1.00 0.00 ? 213 LYS A HD3  10 
ATOM 11307 H HE2  . LYS A 1 11 ? 10.747  5.021   -1.980 1.00 0.00 ? 213 LYS A HE2  10 
ATOM 11308 H HE3  . LYS A 1 11 ? 11.940  3.841   -1.439 1.00 0.00 ? 213 LYS A HE3  10 
ATOM 11309 H HZ1  . LYS A 1 11 ? 12.311  6.296   -2.939 1.00 0.00 ? 213 LYS A HZ1  10 
ATOM 11310 H HZ2  . LYS A 1 11 ? 13.250  4.983   -3.452 1.00 0.00 ? 213 LYS A HZ2  10 
ATOM 11311 H HZ3  . LYS A 1 11 ? 13.352  5.522   -1.853 1.00 0.00 ? 213 LYS A HZ3  10 
ATOM 11312 N N    . ILE A 1 12 ? 5.869   2.052   -4.357 1.00 0.00 ? 214 ILE A N    10 
ATOM 11313 C CA   . ILE A 1 12 ? 4.943   0.932   -4.480 1.00 0.00 ? 214 ILE A CA   10 
ATOM 11314 C C    . ILE A 1 12 ? 5.671   -0.336  -4.912 1.00 0.00 ? 214 ILE A C    10 
ATOM 11315 O O    . ILE A 1 12 ? 6.567   -0.292  -5.755 1.00 0.00 ? 214 ILE A O    10 
ATOM 11316 C CB   . ILE A 1 12 ? 3.819   1.238   -5.489 1.00 0.00 ? 214 ILE A CB   10 
ATOM 11317 C CG1  . ILE A 1 12 ? 3.146   2.570   -5.144 1.00 0.00 ? 214 ILE A CG1  10 
ATOM 11318 C CG2  . ILE A 1 12 ? 2.797   0.109   -5.504 1.00 0.00 ? 214 ILE A CG2  10 
ATOM 11319 C CD1  . ILE A 1 12 ? 1.972   2.905   -6.038 1.00 0.00 ? 214 ILE A CD1  10 
ATOM 11320 H H    . ILE A 1 12 ? 5.741   2.842   -4.922 1.00 0.00 ? 214 ILE A H    10 
ATOM 11321 H HA   . ILE A 1 12 ? 4.493   0.765   -3.512 1.00 0.00 ? 214 ILE A HA   10 
ATOM 11322 H HB   . ILE A 1 12 ? 4.257   1.309   -6.473 1.00 0.00 ? 214 ILE A HB   10 
ATOM 11323 H HG12 . ILE A 1 12 ? 2.787   2.532   -4.128 1.00 0.00 ? 214 ILE A HG12 10 
ATOM 11324 H HG13 . ILE A 1 12 ? 3.870   3.366   -5.236 1.00 0.00 ? 214 ILE A HG13 10 
ATOM 11325 H HG21 . ILE A 1 12 ? 3.311   -0.840  -5.519 1.00 0.00 ? 214 ILE A HG21 10 
ATOM 11326 H HG22 . ILE A 1 12 ? 2.178   0.170   -4.621 1.00 0.00 ? 214 ILE A HG22 10 
ATOM 11327 H HG23 . ILE A 1 12 ? 2.177   0.197   -6.385 1.00 0.00 ? 214 ILE A HG23 10 
ATOM 11328 H HD11 . ILE A 1 12 ? 1.947   3.970   -6.215 1.00 0.00 ? 214 ILE A HD11 10 
ATOM 11329 H HD12 . ILE A 1 12 ? 2.076   2.387   -6.979 1.00 0.00 ? 214 ILE A HD12 10 
ATOM 11330 H HD13 . ILE A 1 12 ? 1.055   2.597   -5.557 1.00 0.00 ? 214 ILE A HD13 10 
ATOM 11331 N N    . GLY A 1 13 ? 5.281   -1.463  -4.326 1.00 0.00 ? 215 GLY A N    10 
ATOM 11332 C CA   . GLY A 1 13 ? 5.908   -2.728  -4.661 1.00 0.00 ? 215 GLY A CA   10 
ATOM 11333 C C    . GLY A 1 13 ? 7.134   -3.017  -3.812 1.00 0.00 ? 215 GLY A C    10 
ATOM 11334 O O    . GLY A 1 13 ? 7.760   -4.067  -3.957 1.00 0.00 ? 215 GLY A O    10 
ATOM 11335 H H    . GLY A 1 13 ? 4.563   -1.435  -3.660 1.00 0.00 ? 215 GLY A H    10 
ATOM 11336 H HA2  . GLY A 1 13 ? 5.189   -3.521  -4.516 1.00 0.00 ? 215 GLY A HA2  10 
ATOM 11337 H HA3  . GLY A 1 13 ? 6.200   -2.708  -5.699 1.00 0.00 ? 215 GLY A HA3  10 
ATOM 11338 N N    . ASP A 1 14 ? 7.479   -2.087  -2.926 1.00 0.00 ? 216 ASP A N    10 
ATOM 11339 C CA   . ASP A 1 14 ? 8.639   -2.254  -2.058 1.00 0.00 ? 216 ASP A CA   10 
ATOM 11340 C C    . ASP A 1 14 ? 8.233   -2.851  -0.715 1.00 0.00 ? 216 ASP A C    10 
ATOM 11341 O O    . ASP A 1 14 ? 7.147   -2.575  -0.203 1.00 0.00 ? 216 ASP A O    10 
ATOM 11342 C CB   . ASP A 1 14 ? 9.339   -0.911  -1.839 1.00 0.00 ? 216 ASP A CB   10 
ATOM 11343 C CG   . ASP A 1 14 ? 10.142  -0.473  -3.048 1.00 0.00 ? 216 ASP A CG   10 
ATOM 11344 O OD1  . ASP A 1 14 ? 9.754   -0.831  -4.180 1.00 0.00 ? 216 ASP A OD1  10 
ATOM 11345 O OD2  . ASP A 1 14 ? 11.159  0.227   -2.863 1.00 0.00 ? 216 ASP A OD2  10 
ATOM 11346 H H    . ASP A 1 14 ? 6.945   -1.270  -2.853 1.00 0.00 ? 216 ASP A H    10 
ATOM 11347 H HA   . ASP A 1 14 ? 9.323   -2.929  -2.545 1.00 0.00 ? 216 ASP A HA   10 
ATOM 11348 H HB2  . ASP A 1 14 ? 8.596   -0.155  -1.631 1.00 0.00 ? 216 ASP A HB2  10 
ATOM 11349 H HB3  . ASP A 1 14 ? 10.007  -0.994  -0.996 1.00 0.00 ? 216 ASP A HB3  10 
ATOM 11350 N N    . ARG A 1 15 ? 9.113   -3.668  -0.147 1.00 0.00 ? 217 ARG A N    10 
ATOM 11351 C CA   . ARG A 1 15 ? 8.847   -4.300  1.139  1.00 0.00 ? 217 ARG A CA   10 
ATOM 11352 C C    . ARG A 1 15 ? 9.038   -3.302  2.275  1.00 0.00 ? 217 ARG A C    10 
ATOM 11353 O O    . ARG A 1 15 ? 10.009  -2.544  2.291  1.00 0.00 ? 217 ARG A O    10 
ATOM 11354 C CB   . ARG A 1 15 ? 9.766   -5.506  1.341  1.00 0.00 ? 217 ARG A CB   10 
ATOM 11355 C CG   . ARG A 1 15 ? 9.223   -6.525  2.331  1.00 0.00 ? 217 ARG A CG   10 
ATOM 11356 C CD   . ARG A 1 15 ? 7.995   -7.234  1.783  1.00 0.00 ? 217 ARG A CD   10 
ATOM 11357 N NE   . ARG A 1 15 ? 8.295   -7.992  0.571  1.00 0.00 ? 217 ARG A NE   10 
ATOM 11358 C CZ   . ARG A 1 15 ? 8.879   -9.188  0.570  1.00 0.00 ? 217 ARG A CZ   10 
ATOM 11359 N NH1  . ARG A 1 15 ? 9.227   -9.766  1.713  1.00 0.00 ? 217 ARG A NH1  10 
ATOM 11360 N NH2  . ARG A 1 15 ? 9.116   -9.810  -0.578 1.00 0.00 ? 217 ARG A NH2  10 
ATOM 11361 H H    . ARG A 1 15 ? 9.963   -3.847  -0.601 1.00 0.00 ? 217 ARG A H    10 
ATOM 11362 H HA   . ARG A 1 15 ? 7.821   -4.634  1.139  1.00 0.00 ? 217 ARG A HA   10 
ATOM 11363 H HB2  . ARG A 1 15 ? 9.908   -6.000  0.392  1.00 0.00 ? 217 ARG A HB2  10 
ATOM 11364 H HB3  . ARG A 1 15 ? 10.723  -5.159  1.704  1.00 0.00 ? 217 ARG A HB3  10 
ATOM 11365 H HG2  . ARG A 1 15 ? 9.988   -7.259  2.535  1.00 0.00 ? 217 ARG A HG2  10 
ATOM 11366 H HG3  . ARG A 1 15 ? 8.957   -6.017  3.246  1.00 0.00 ? 217 ARG A HG3  10 
ATOM 11367 H HD2  . ARG A 1 15 ? 7.621   -7.912  2.536  1.00 0.00 ? 217 ARG A HD2  10 
ATOM 11368 H HD3  . ARG A 1 15 ? 7.240   -6.496  1.558  1.00 0.00 ? 217 ARG A HD3  10 
ATOM 11369 H HE   . ARG A 1 15 ? 8.048   -7.590  -0.288 1.00 0.00 ? 217 ARG A HE   10 
ATOM 11370 H HH11 . ARG A 1 15 ? 9.051   -9.305  2.582  1.00 0.00 ? 217 ARG A HH11 10 
ATOM 11371 H HH12 . ARG A 1 15 ? 9.665   -10.666 1.706  1.00 0.00 ? 217 ARG A HH12 10 
ATOM 11372 H HH21 . ARG A 1 15 ? 8.856   -9.378  -1.442 1.00 0.00 ? 217 ARG A HH21 10 
ATOM 11373 H HH22 . ARG A 1 15 ? 9.556   -10.707 -0.580 1.00 0.00 ? 217 ARG A HH22 10 
ATOM 11374 N N    . VAL A 1 16 ? 8.103   -3.301  3.216  1.00 0.00 ? 218 VAL A N    10 
ATOM 11375 C CA   . VAL A 1 16 ? 8.167   -2.386  4.347  1.00 0.00 ? 218 VAL A CA   10 
ATOM 11376 C C    . VAL A 1 16 ? 7.435   -2.947  5.559  1.00 0.00 ? 218 VAL A C    10 
ATOM 11377 O O    . VAL A 1 16 ? 6.932   -4.070  5.534  1.00 0.00 ? 218 VAL A O    10 
ATOM 11378 C CB   . VAL A 1 16 ? 7.553   -1.016  3.990  1.00 0.00 ? 218 VAL A CB   10 
ATOM 11379 C CG1  . VAL A 1 16 ? 8.163   -0.474  2.709  1.00 0.00 ? 218 VAL A CG1  10 
ATOM 11380 C CG2  . VAL A 1 16 ? 6.037   -1.124  3.868  1.00 0.00 ? 218 VAL A CG2  10 
ATOM 11381 H H    . VAL A 1 16 ? 7.351   -3.923  3.144  1.00 0.00 ? 218 VAL A H    10 
ATOM 11382 H HA   . VAL A 1 16 ? 9.206   -2.237  4.600  1.00 0.00 ? 218 VAL A HA   10 
ATOM 11383 H HB   . VAL A 1 16 ? 7.779   -0.327  4.792  1.00 0.00 ? 218 VAL A HB   10 
ATOM 11384 H HG11 . VAL A 1 16 ? 7.814   0.535   2.544  1.00 0.00 ? 218 VAL A HG11 10 
ATOM 11385 H HG12 . VAL A 1 16 ? 9.240   -0.473  2.794  1.00 0.00 ? 218 VAL A HG12 10 
ATOM 11386 H HG13 . VAL A 1 16 ? 7.868   -1.096  1.877  1.00 0.00 ? 218 VAL A HG13 10 
ATOM 11387 H HG21 . VAL A 1 16 ? 5.598   -1.149  4.856  1.00 0.00 ? 218 VAL A HG21 10 
ATOM 11388 H HG22 . VAL A 1 16 ? 5.658   -0.267  3.329  1.00 0.00 ? 218 VAL A HG22 10 
ATOM 11389 H HG23 . VAL A 1 16 ? 5.780   -2.027  3.337  1.00 0.00 ? 218 VAL A HG23 10 
ATOM 11390 N N    . LEU A 1 17 ? 7.364   -2.142  6.612  1.00 0.00 ? 219 LEU A N    10 
ATOM 11391 C CA   . LEU A 1 17 ? 6.676   -2.535  7.831  1.00 0.00 ? 219 LEU A CA   10 
ATOM 11392 C C    . LEU A 1 17 ? 5.586   -1.532  8.167  1.00 0.00 ? 219 LEU A C    10 
ATOM 11393 O O    . LEU A 1 17 ? 5.859   -0.349  8.354  1.00 0.00 ? 219 LEU A O    10 
ATOM 11394 C CB   . LEU A 1 17 ? 7.651   -2.633  9.004  1.00 0.00 ? 219 LEU A CB   10 
ATOM 11395 C CG   . LEU A 1 17 ? 8.737   -3.701  8.873  1.00 0.00 ? 219 LEU A CG   10 
ATOM 11396 C CD1  . LEU A 1 17 ? 9.450   -3.890  10.204 1.00 0.00 ? 219 LEU A CD1  10 
ATOM 11397 C CD2  . LEU A 1 17 ? 8.143   -5.016  8.391  1.00 0.00 ? 219 LEU A CD2  10 
ATOM 11398 H H    . LEU A 1 17 ? 7.773   -1.253  6.561  1.00 0.00 ? 219 LEU A H    10 
ATOM 11399 H HA   . LEU A 1 17 ? 6.225   -3.500  7.663  1.00 0.00 ? 219 LEU A HA   10 
ATOM 11400 H HB2  . LEU A 1 17 ? 8.131   -1.674  9.125  1.00 0.00 ? 219 LEU A HB2  10 
ATOM 11401 H HB3  . LEU A 1 17 ? 7.078   -2.843  9.896  1.00 0.00 ? 219 LEU A HB3  10 
ATOM 11402 H HG   . LEU A 1 17 ? 9.467   -3.375  8.148  1.00 0.00 ? 219 LEU A HG   10 
ATOM 11403 H HD11 . LEU A 1 17 ? 8.782   -4.374  10.903 1.00 0.00 ? 219 LEU A HD11 10 
ATOM 11404 H HD12 . LEU A 1 17 ? 10.325  -4.504  10.060 1.00 0.00 ? 219 LEU A HD12 10 
ATOM 11405 H HD13 . LEU A 1 17 ? 9.744   -2.927  10.595 1.00 0.00 ? 219 LEU A HD13 10 
ATOM 11406 H HD21 . LEU A 1 17 ? 7.231   -5.220  8.935  1.00 0.00 ? 219 LEU A HD21 10 
ATOM 11407 H HD22 . LEU A 1 17 ? 7.925   -4.948  7.336  1.00 0.00 ? 219 LEU A HD22 10 
ATOM 11408 H HD23 . LEU A 1 17 ? 8.849   -5.815  8.563  1.00 0.00 ? 219 LEU A HD23 10 
ATOM 11409 N N    . VAL A 1 18 ? 4.354   -2.009  8.255  1.00 0.00 ? 220 VAL A N    10 
ATOM 11410 C CA   . VAL A 1 18 ? 3.231   -1.141  8.582  1.00 0.00 ? 220 VAL A CA   10 
ATOM 11411 C C    . VAL A 1 18 ? 3.038   -1.085  10.094 1.00 0.00 ? 220 VAL A C    10 
ATOM 11412 O O    . VAL A 1 18 ? 2.668   -2.078  10.722 1.00 0.00 ? 220 VAL A O    10 
ATOM 11413 C CB   . VAL A 1 18 ? 1.914   -1.593  7.904  1.00 0.00 ? 220 VAL A CB   10 
ATOM 11414 C CG1  . VAL A 1 18 ? 1.314   -0.454  7.091  1.00 0.00 ? 220 VAL A CG1  10 
ATOM 11415 C CG2  . VAL A 1 18 ? 2.134   -2.819  7.026  1.00 0.00 ? 220 VAL A CG2  10 
ATOM 11416 H H    . VAL A 1 18 ? 4.199   -2.964  8.107  1.00 0.00 ? 220 VAL A H    10 
ATOM 11417 H HA   . VAL A 1 18 ? 3.472   -0.148  8.229  1.00 0.00 ? 220 VAL A HA   10 
ATOM 11418 H HB   . VAL A 1 18 ? 1.207   -1.854  8.675  1.00 0.00 ? 220 VAL A HB   10 
ATOM 11419 H HG11 . VAL A 1 18 ? 2.074   0.288   6.895  1.00 0.00 ? 220 VAL A HG11 10 
ATOM 11420 H HG12 . VAL A 1 18 ? 0.936   -0.839  6.155  1.00 0.00 ? 220 VAL A HG12 10 
ATOM 11421 H HG13 . VAL A 1 18 ? 0.506   -0.003  7.646  1.00 0.00 ? 220 VAL A HG13 10 
ATOM 11422 H HG21 . VAL A 1 18 ? 1.227   -3.043  6.485  1.00 0.00 ? 220 VAL A HG21 10 
ATOM 11423 H HG22 . VAL A 1 18 ? 2.933   -2.622  6.328  1.00 0.00 ? 220 VAL A HG22 10 
ATOM 11424 H HG23 . VAL A 1 18 ? 2.400   -3.663  7.648  1.00 0.00 ? 220 VAL A HG23 10 
ATOM 11425 N N    . GLY A 1 19 ? 3.312   0.080   10.674 1.00 0.00 ? 221 GLY A N    10 
ATOM 11426 C CA   . GLY A 1 19 ? 3.183   0.245   12.109 1.00 0.00 ? 221 GLY A CA   10 
ATOM 11427 C C    . GLY A 1 19 ? 4.452   -0.133  12.855 1.00 0.00 ? 221 GLY A C    10 
ATOM 11428 O O    . GLY A 1 19 ? 4.549   0.064   14.066 1.00 0.00 ? 221 GLY A O    10 
ATOM 11429 H H    . GLY A 1 19 ? 3.616   0.831   10.122 1.00 0.00 ? 221 GLY A H    10 
ATOM 11430 H HA2  . GLY A 1 19 ? 2.948   1.278   12.322 1.00 0.00 ? 221 GLY A HA2  10 
ATOM 11431 H HA3  . GLY A 1 19 ? 2.372   -0.376  12.460 1.00 0.00 ? 221 GLY A HA3  10 
ATOM 11432 N N    . GLY A 1 20 ? 5.429   -0.679  12.130 1.00 0.00 ? 222 GLY A N    10 
ATOM 11433 C CA   . GLY A 1 20 ? 6.684   -1.074  12.745 1.00 0.00 ? 222 GLY A CA   10 
ATOM 11434 C C    . GLY A 1 20 ? 6.673   -2.510  13.234 1.00 0.00 ? 222 GLY A C    10 
ATOM 11435 O O    . GLY A 1 20 ? 7.722   -3.142  13.342 1.00 0.00 ? 222 GLY A O    10 
ATOM 11436 H H    . GLY A 1 20 ? 5.299   -0.812  11.168 1.00 0.00 ? 222 GLY A H    10 
ATOM 11437 H HA2  . GLY A 1 20 ? 7.477   -0.964  12.021 1.00 0.00 ? 222 GLY A HA2  10 
ATOM 11438 H HA3  . GLY A 1 20 ? 6.884   -0.423  13.582 1.00 0.00 ? 222 GLY A HA3  10 
ATOM 11439 N N    . THR A 1 21 ? 5.485   -3.025  13.529 1.00 0.00 ? 223 THR A N    10 
ATOM 11440 C CA   . THR A 1 21 ? 5.346   -4.391  14.011 1.00 0.00 ? 223 THR A CA   10 
ATOM 11441 C C    . THR A 1 21 ? 4.837   -5.309  12.904 1.00 0.00 ? 223 THR A C    10 
ATOM 11442 O O    . THR A 1 21 ? 5.080   -6.516  12.924 1.00 0.00 ? 223 THR A O    10 
ATOM 11443 C CB   . THR A 1 21 ? 4.399   -4.431  15.208 1.00 0.00 ? 223 THR A CB   10 
ATOM 11444 O OG1  . THR A 1 21 ? 3.239   -3.658  14.960 1.00 0.00 ? 223 THR A OG1  10 
ATOM 11445 C CG2  . THR A 1 21 ? 5.033   -3.905  16.477 1.00 0.00 ? 223 THR A CG2  10 
ATOM 11446 H H    . THR A 1 21 ? 4.684   -2.473  13.425 1.00 0.00 ? 223 THR A H    10 
ATOM 11447 H HA   . THR A 1 21 ? 6.321   -4.734  14.323 1.00 0.00 ? 223 THR A HA   10 
ATOM 11448 H HB   . THR A 1 21 ? 4.097   -5.453  15.386 1.00 0.00 ? 223 THR A HB   10 
ATOM 11449 H HG1  . THR A 1 21 ? 2.931   -3.821  14.065 1.00 0.00 ? 223 THR A HG1  10 
ATOM 11450 H HG21 . THR A 1 21 ? 6.093   -4.115  16.463 1.00 0.00 ? 223 THR A HG21 10 
ATOM 11451 H HG22 . THR A 1 21 ? 4.582   -4.387  17.331 1.00 0.00 ? 223 THR A HG22 10 
ATOM 11452 H HG23 . THR A 1 21 ? 4.879   -2.838  16.541 1.00 0.00 ? 223 THR A HG23 10 
ATOM 11453 N N    . LYS A 1 22 ? 4.132   -4.730  11.937 1.00 0.00 ? 224 LYS A N    10 
ATOM 11454 C CA   . LYS A 1 22 ? 3.595   -5.497  10.820 1.00 0.00 ? 224 LYS A CA   10 
ATOM 11455 C C    . LYS A 1 22 ? 4.487   -5.344  9.593  1.00 0.00 ? 224 LYS A C    10 
ATOM 11456 O O    . LYS A 1 22 ? 5.095   -4.295  9.388  1.00 0.00 ? 224 LYS A O    10 
ATOM 11457 C CB   . LYS A 1 22 ? 2.170   -5.042  10.489 1.00 0.00 ? 224 LYS A CB   10 
ATOM 11458 C CG   . LYS A 1 22 ? 1.334   -4.685  11.710 1.00 0.00 ? 224 LYS A CG   10 
ATOM 11459 C CD   . LYS A 1 22 ? 0.689   -5.915  12.327 1.00 0.00 ? 224 LYS A CD   10 
ATOM 11460 C CE   . LYS A 1 22 ? 1.686   -6.719  13.146 1.00 0.00 ? 224 LYS A CE   10 
ATOM 11461 N NZ   . LYS A 1 22 ? 1.081   -7.237  14.403 1.00 0.00 ? 224 LYS A NZ   10 
ATOM 11462 H H    . LYS A 1 22 ? 3.973   -3.763  11.972 1.00 0.00 ? 224 LYS A H    10 
ATOM 11463 H HA   . LYS A 1 22 ? 3.575   -6.538  11.110 1.00 0.00 ? 224 LYS A HA   10 
ATOM 11464 H HB2  . LYS A 1 22 ? 2.223   -4.172  9.853  1.00 0.00 ? 224 LYS A HB2  10 
ATOM 11465 H HB3  . LYS A 1 22 ? 1.668   -5.835  9.956  1.00 0.00 ? 224 LYS A HB3  10 
ATOM 11466 H HG2  . LYS A 1 22 ? 1.969   -4.219  12.447 1.00 0.00 ? 224 LYS A HG2  10 
ATOM 11467 H HG3  . LYS A 1 22 ? 0.559   -3.994  11.414 1.00 0.00 ? 224 LYS A HG3  10 
ATOM 11468 H HD2  . LYS A 1 22 ? -0.119  -5.602  12.970 1.00 0.00 ? 224 LYS A HD2  10 
ATOM 11469 H HD3  . LYS A 1 22 ? 0.299   -6.538  11.537 1.00 0.00 ? 224 LYS A HD3  10 
ATOM 11470 H HE2  . LYS A 1 22 ? 2.030   -7.553  12.552 1.00 0.00 ? 224 LYS A HE2  10 
ATOM 11471 H HE3  . LYS A 1 22 ? 2.524   -6.084  13.393 1.00 0.00 ? 224 LYS A HE3  10 
ATOM 11472 H HZ1  . LYS A 1 22 ? 1.301   -6.598  15.195 1.00 0.00 ? 224 LYS A HZ1  10 
ATOM 11473 H HZ2  . LYS A 1 22 ? 1.458   -8.182  14.619 1.00 0.00 ? 224 LYS A HZ2  10 
ATOM 11474 H HZ3  . LYS A 1 22 ? 0.049   -7.303  14.304 1.00 0.00 ? 224 LYS A HZ3  10 
ATOM 11475 N N    . ALA A 1 23 ? 4.564   -6.392  8.779  1.00 0.00 ? 225 ALA A N    10 
ATOM 11476 C CA   . ALA A 1 23 ? 5.386   -6.359  7.573  1.00 0.00 ? 225 ALA A CA   10 
ATOM 11477 C C    . ALA A 1 23 ? 4.541   -6.588  6.330  1.00 0.00 ? 225 ALA A C    10 
ATOM 11478 O O    . ALA A 1 23 ? 3.589   -7.369  6.349  1.00 0.00 ? 225 ALA A O    10 
ATOM 11479 C CB   . ALA A 1 23 ? 6.492   -7.398  7.651  1.00 0.00 ? 225 ALA A CB   10 
ATOM 11480 H H    . ALA A 1 23 ? 4.058   -7.204  8.992  1.00 0.00 ? 225 ALA A H    10 
ATOM 11481 H HA   . ALA A 1 23 ? 5.844   -5.385  7.508  1.00 0.00 ? 225 ALA A HA   10 
ATOM 11482 H HB1  . ALA A 1 23 ? 7.329   -7.076  7.049  1.00 0.00 ? 225 ALA A HB1  10 
ATOM 11483 H HB2  . ALA A 1 23 ? 6.808   -7.510  8.677  1.00 0.00 ? 225 ALA A HB2  10 
ATOM 11484 H HB3  . ALA A 1 23 ? 6.124   -8.344  7.281  1.00 0.00 ? 225 ALA A HB3  10 
ATOM 11485 N N    . GLY A 1 24 ? 4.895   -5.907  5.246  1.00 0.00 ? 226 GLY A N    10 
ATOM 11486 C CA   . GLY A 1 24 ? 4.156   -6.054  4.009  1.00 0.00 ? 226 GLY A CA   10 
ATOM 11487 C C    . GLY A 1 24 ? 4.807   -5.331  2.846  1.00 0.00 ? 226 GLY A C    10 
ATOM 11488 O O    . GLY A 1 24 ? 5.966   -4.925  2.926  1.00 0.00 ? 226 GLY A O    10 
ATOM 11489 H H    . GLY A 1 24 ? 5.665   -5.300  5.289  1.00 0.00 ? 226 GLY A H    10 
ATOM 11490 H HA2  . GLY A 1 24 ? 4.085   -7.104  3.769  1.00 0.00 ? 226 GLY A HA2  10 
ATOM 11491 H HA3  . GLY A 1 24 ? 3.162   -5.660  4.151  1.00 0.00 ? 226 GLY A HA3  10 
ATOM 11492 N N    . VAL A 1 25 ? 4.054   -5.174  1.763  1.00 0.00 ? 227 VAL A N    10 
ATOM 11493 C CA   . VAL A 1 25 ? 4.553   -4.499  0.571  1.00 0.00 ? 227 VAL A CA   10 
ATOM 11494 C C    . VAL A 1 25 ? 3.669   -3.311  0.207  1.00 0.00 ? 227 VAL A C    10 
ATOM 11495 O O    . VAL A 1 25 ? 2.446   -3.430  0.150  1.00 0.00 ? 227 VAL A O    10 
ATOM 11496 C CB   . VAL A 1 25 ? 4.621   -5.471  -0.627 1.00 0.00 ? 227 VAL A CB   10 
ATOM 11497 C CG1  . VAL A 1 25 ? 4.916   -4.726  -1.922 1.00 0.00 ? 227 VAL A CG1  10 
ATOM 11498 C CG2  . VAL A 1 25 ? 5.664   -6.551  -0.378 1.00 0.00 ? 227 VAL A CG2  10 
ATOM 11499 H H    . VAL A 1 25 ? 3.139   -5.524  1.763  1.00 0.00 ? 227 VAL A H    10 
ATOM 11500 H HA   . VAL A 1 25 ? 5.552   -4.145  0.779  1.00 0.00 ? 227 VAL A HA   10 
ATOM 11501 H HB   . VAL A 1 25 ? 3.658   -5.950  -0.729 1.00 0.00 ? 227 VAL A HB   10 
ATOM 11502 H HG11 . VAL A 1 25 ? 5.446   -3.811  -1.698 1.00 0.00 ? 227 VAL A HG11 10 
ATOM 11503 H HG12 . VAL A 1 25 ? 5.523   -5.346  -2.565 1.00 0.00 ? 227 VAL A HG12 10 
ATOM 11504 H HG13 . VAL A 1 25 ? 3.987   -4.490  -2.421 1.00 0.00 ? 227 VAL A HG13 10 
ATOM 11505 H HG21 . VAL A 1 25 ? 6.651   -6.124  -0.464 1.00 0.00 ? 227 VAL A HG21 10 
ATOM 11506 H HG22 . VAL A 1 25 ? 5.531   -6.955  0.615  1.00 0.00 ? 227 VAL A HG22 10 
ATOM 11507 H HG23 . VAL A 1 25 ? 5.547   -7.338  -1.106 1.00 0.00 ? 227 VAL A HG23 10 
ATOM 11508 N N    . VAL A 1 26 ? 4.294   -2.166  -0.050 1.00 0.00 ? 228 VAL A N    10 
ATOM 11509 C CA   . VAL A 1 26 ? 3.557   -0.965  -0.418 1.00 0.00 ? 228 VAL A CA   10 
ATOM 11510 C C    . VAL A 1 26 ? 2.755   -1.201  -1.691 1.00 0.00 ? 228 VAL A C    10 
ATOM 11511 O O    . VAL A 1 26 ? 3.271   -1.740  -2.670 1.00 0.00 ? 228 VAL A O    10 
ATOM 11512 C CB   . VAL A 1 26 ? 4.502   0.232   -0.622 1.00 0.00 ? 228 VAL A CB   10 
ATOM 11513 C CG1  . VAL A 1 26 ? 3.708   1.514   -0.825 1.00 0.00 ? 228 VAL A CG1  10 
ATOM 11514 C CG2  . VAL A 1 26 ? 5.450   0.362   0.561  1.00 0.00 ? 228 VAL A CG2  10 
ATOM 11515 H H    . VAL A 1 26 ? 5.272   -2.133  0.001  1.00 0.00 ? 228 VAL A H    10 
ATOM 11516 H HA   . VAL A 1 26 ? 2.877   -0.730  0.387  1.00 0.00 ? 228 VAL A HA   10 
ATOM 11517 H HB   . VAL A 1 26 ? 5.090   0.055   -1.512 1.00 0.00 ? 228 VAL A HB   10 
ATOM 11518 H HG11 . VAL A 1 26 ? 2.682   1.269   -1.063 1.00 0.00 ? 228 VAL A HG11 10 
ATOM 11519 H HG12 . VAL A 1 26 ? 3.738   2.103   0.078  1.00 0.00 ? 228 VAL A HG12 10 
ATOM 11520 H HG13 . VAL A 1 26 ? 4.139   2.079   -1.639 1.00 0.00 ? 228 VAL A HG13 10 
ATOM 11521 H HG21 . VAL A 1 26 ? 6.194   -0.419  0.512  1.00 0.00 ? 228 VAL A HG21 10 
ATOM 11522 H HG22 . VAL A 1 26 ? 5.935   1.326   0.530  1.00 0.00 ? 228 VAL A HG22 10 
ATOM 11523 H HG23 . VAL A 1 26 ? 4.891   0.269   1.480  1.00 0.00 ? 228 VAL A HG23 10 
ATOM 11524 N N    . ARG A 1 27 ? 1.486   -0.810  -1.668 1.00 0.00 ? 229 ARG A N    10 
ATOM 11525 C CA   . ARG A 1 27 ? 0.612   -1.000  -2.819 1.00 0.00 ? 229 ARG A CA   10 
ATOM 11526 C C    . ARG A 1 27 ? 0.054   0.328   -3.325 1.00 0.00 ? 229 ARG A C    10 
ATOM 11527 O O    . ARG A 1 27 ? -0.042  0.550   -4.531 1.00 0.00 ? 229 ARG A O    10 
ATOM 11528 C CB   . ARG A 1 27 ? -0.528  -1.948  -2.450 1.00 0.00 ? 229 ARG A CB   10 
ATOM 11529 C CG   . ARG A 1 27 ? -0.050  -3.308  -1.968 1.00 0.00 ? 229 ARG A CG   10 
ATOM 11530 C CD   . ARG A 1 27 ? 0.873   -3.965  -2.983 1.00 0.00 ? 229 ARG A CD   10 
ATOM 11531 N NE   . ARG A 1 27 ? 0.555   -5.378  -3.171 1.00 0.00 ? 229 ARG A NE   10 
ATOM 11532 C CZ   . ARG A 1 27 ? 0.816   -6.058  -4.287 1.00 0.00 ? 229 ARG A CZ   10 
ATOM 11533 N NH1  . ARG A 1 27 ? 1.417   -5.466  -5.313 1.00 0.00 ? 229 ARG A NH1  10 
ATOM 11534 N NH2  . ARG A 1 27 ? 0.479   -7.337  -4.375 1.00 0.00 ? 229 ARG A NH2  10 
ATOM 11535 H H    . ARG A 1 27 ? 1.124   -0.399  -0.857 1.00 0.00 ? 229 ARG A H    10 
ATOM 11536 H HA   . ARG A 1 27 ? 1.198   -1.452  -3.607 1.00 0.00 ? 229 ARG A HA   10 
ATOM 11537 H HB2  . ARG A 1 27 ? -1.116  -1.498  -1.665 1.00 0.00 ? 229 ARG A HB2  10 
ATOM 11538 H HB3  . ARG A 1 27 ? -1.153  -2.098  -3.314 1.00 0.00 ? 229 ARG A HB3  10 
ATOM 11539 H HG2  . ARG A 1 27 ? 0.487   -3.182  -1.039 1.00 0.00 ? 229 ARG A HG2  10 
ATOM 11540 H HG3  . ARG A 1 27 ? -0.907  -3.945  -1.807 1.00 0.00 ? 229 ARG A HG3  10 
ATOM 11541 H HD2  . ARG A 1 27 ? 0.769   -3.453  -3.928 1.00 0.00 ? 229 ARG A HD2  10 
ATOM 11542 H HD3  . ARG A 1 27 ? 1.892   -3.877  -2.635 1.00 0.00 ? 229 ARG A HD3  10 
ATOM 11543 H HE   . ARG A 1 27 ? 0.120   -5.844  -2.429 1.00 0.00 ? 229 ARG A HE   10 
ATOM 11544 H HH11 . ARG A 1 27 ? 1.676   -4.503  -5.253 1.00 0.00 ? 229 ARG A HH11 10 
ATOM 11545 H HH12 . ARG A 1 27 ? 1.607   -5.983  -6.146 1.00 0.00 ? 229 ARG A HH12 10 
ATOM 11546 H HH21 . ARG A 1 27 ? 0.030   -7.791  -3.605 1.00 0.00 ? 229 ARG A HH21 10 
ATOM 11547 H HH22 . ARG A 1 27 ? 0.674   -7.849  -5.212 1.00 0.00 ? 229 ARG A HH22 10 
ATOM 11548 N N    . PHE A 1 28 ? -0.310  1.207   -2.399 1.00 0.00 ? 230 PHE A N    10 
ATOM 11549 C CA   . PHE A 1 28 ? -0.858  2.511   -2.760 1.00 0.00 ? 230 PHE A CA   10 
ATOM 11550 C C    . PHE A 1 28 ? -0.571  3.539   -1.672 1.00 0.00 ? 230 PHE A C    10 
ATOM 11551 O O    . PHE A 1 28 ? -0.698  3.247   -0.489 1.00 0.00 ? 230 PHE A O    10 
ATOM 11552 C CB   . PHE A 1 28 ? -2.365  2.406   -2.998 1.00 0.00 ? 230 PHE A CB   10 
ATOM 11553 C CG   . PHE A 1 28 ? -2.960  3.630   -3.634 1.00 0.00 ? 230 PHE A CG   10 
ATOM 11554 C CD1  . PHE A 1 28 ? -2.789  3.877   -4.987 1.00 0.00 ? 230 PHE A CD1  10 
ATOM 11555 C CD2  . PHE A 1 28 ? -3.687  4.535   -2.879 1.00 0.00 ? 230 PHE A CD2  10 
ATOM 11556 C CE1  . PHE A 1 28 ? -3.334  5.003   -5.574 1.00 0.00 ? 230 PHE A CE1  10 
ATOM 11557 C CE2  . PHE A 1 28 ? -4.236  5.663   -3.460 1.00 0.00 ? 230 PHE A CE2  10 
ATOM 11558 C CZ   . PHE A 1 28 ? -4.059  5.896   -4.809 1.00 0.00 ? 230 PHE A CZ   10 
ATOM 11559 H H    . PHE A 1 28 ? -0.211  0.974   -1.452 1.00 0.00 ? 230 PHE A H    10 
ATOM 11560 H HA   . PHE A 1 28 ? -0.380  2.828   -3.673 1.00 0.00 ? 230 PHE A HA   10 
ATOM 11561 H HB2  . PHE A 1 28 ? -2.563  1.566   -3.647 1.00 0.00 ? 230 PHE A HB2  10 
ATOM 11562 H HB3  . PHE A 1 28 ? -2.862  2.248   -2.052 1.00 0.00 ? 230 PHE A HB3  10 
ATOM 11563 H HD1  . PHE A 1 28 ? -2.223  3.178   -5.585 1.00 0.00 ? 230 PHE A HD1  10 
ATOM 11564 H HD2  . PHE A 1 28 ? -3.825  4.353   -1.822 1.00 0.00 ? 230 PHE A HD2  10 
ATOM 11565 H HE1  . PHE A 1 28 ? -3.195  5.183   -6.630 1.00 0.00 ? 230 PHE A HE1  10 
ATOM 11566 H HE2  . PHE A 1 28 ? -4.801  6.359   -2.861 1.00 0.00 ? 230 PHE A HE2  10 
ATOM 11567 H HZ   . PHE A 1 28 ? -4.485  6.777   -5.268 1.00 0.00 ? 230 PHE A HZ   10 
ATOM 11568 N N    . LEU A 1 29 ? -0.187  4.743   -2.078 1.00 0.00 ? 231 LEU A N    10 
ATOM 11569 C CA   . LEU A 1 29 ? 0.113   5.806   -1.124 1.00 0.00 ? 231 LEU A CA   10 
ATOM 11570 C C    . LEU A 1 29 ? -0.775  7.022   -1.363 1.00 0.00 ? 231 LEU A C    10 
ATOM 11571 O O    . LEU A 1 29 ? -0.785  7.592   -2.453 1.00 0.00 ? 231 LEU A O    10 
ATOM 11572 C CB   . LEU A 1 29 ? 1.588   6.205   -1.215 1.00 0.00 ? 231 LEU A CB   10 
ATOM 11573 C CG   . LEU A 1 29 ? 2.581   5.043   -1.129 1.00 0.00 ? 231 LEU A CG   10 
ATOM 11574 C CD1  . LEU A 1 29 ? 3.324   4.871   -2.445 1.00 0.00 ? 231 LEU A CD1  10 
ATOM 11575 C CD2  . LEU A 1 29 ? 3.564   5.261   0.013  1.00 0.00 ? 231 LEU A CD2  10 
ATOM 11576 H H    . LEU A 1 29 ? -0.106  4.923   -3.038 1.00 0.00 ? 231 LEU A H    10 
ATOM 11577 H HA   . LEU A 1 29 ? -0.083  5.423   -0.133 1.00 0.00 ? 231 LEU A HA   10 
ATOM 11578 H HB2  . LEU A 1 29 ? 1.742   6.718   -2.154 1.00 0.00 ? 231 LEU A HB2  10 
ATOM 11579 H HB3  . LEU A 1 29 ? 1.802   6.894   -0.411 1.00 0.00 ? 231 LEU A HB3  10 
ATOM 11580 H HG   . LEU A 1 29 ? 2.038   4.130   -0.931 1.00 0.00 ? 231 LEU A HG   10 
ATOM 11581 H HD11 . LEU A 1 29 ? 4.247   5.429   -2.413 1.00 0.00 ? 231 LEU A HD11 10 
ATOM 11582 H HD12 . LEU A 1 29 ? 3.542   3.825   -2.602 1.00 0.00 ? 231 LEU A HD12 10 
ATOM 11583 H HD13 . LEU A 1 29 ? 2.710   5.236   -3.255 1.00 0.00 ? 231 LEU A HD13 10 
ATOM 11584 H HD21 . LEU A 1 29 ? 3.979   4.313   0.317  1.00 0.00 ? 231 LEU A HD21 10 
ATOM 11585 H HD22 . LEU A 1 29 ? 4.360   5.913   -0.317 1.00 0.00 ? 231 LEU A HD22 10 
ATOM 11586 H HD23 . LEU A 1 29 ? 3.051   5.715   0.849  1.00 0.00 ? 231 LEU A HD23 10 
ATOM 11587 N N    . GLY A 1 30 ? -1.520  7.411   -0.332 1.00 0.00 ? 232 GLY A N    10 
ATOM 11588 C CA   . GLY A 1 30 ? -2.404  8.556   -0.445 1.00 0.00 ? 232 GLY A CA   10 
ATOM 11589 C C    . GLY A 1 30 ? -3.265  8.746   0.789  1.00 0.00 ? 232 GLY A C    10 
ATOM 11590 O O    . GLY A 1 30 ? -3.129  8.011   1.766  1.00 0.00 ? 232 GLY A O    10 
ATOM 11591 H H    . GLY A 1 30 ? -1.469  6.916   0.512  1.00 0.00 ? 232 GLY A H    10 
ATOM 11592 H HA2  . GLY A 1 30 ? -1.807  9.444   -0.595 1.00 0.00 ? 232 GLY A HA2  10 
ATOM 11593 H HA3  . GLY A 1 30 ? -3.047  8.419   -1.301 1.00 0.00 ? 232 GLY A HA3  10 
ATOM 11594 N N    . GLU A 1 31 ? -4.151  9.735   0.745  1.00 0.00 ? 233 GLU A N    10 
ATOM 11595 C CA   . GLU A 1 31 ? -5.036  10.018  1.869  1.00 0.00 ? 233 GLU A CA   10 
ATOM 11596 C C    . GLU A 1 31 ? -6.218  9.055   1.889  1.00 0.00 ? 233 GLU A C    10 
ATOM 11597 O O    . GLU A 1 31 ? -6.508  8.391   0.894  1.00 0.00 ? 233 GLU A O    10 
ATOM 11598 C CB   . GLU A 1 31 ? -5.541  11.461  1.796  1.00 0.00 ? 233 GLU A CB   10 
ATOM 11599 C CG   . GLU A 1 31 ? -4.429  12.488  1.656  1.00 0.00 ? 233 GLU A CG   10 
ATOM 11600 C CD   . GLU A 1 31 ? -4.314  13.036  0.247  1.00 0.00 ? 233 GLU A CD   10 
ATOM 11601 O OE1  . GLU A 1 31 ? -5.365  13.308  -0.371 1.00 0.00 ? 233 GLU A OE1  10 
ATOM 11602 O OE2  . GLU A 1 31 ? -3.174  13.194  -0.238 1.00 0.00 ? 233 GLU A OE2  10 
ATOM 11603 H H    . GLU A 1 31 ? -4.210  10.287  -0.063 1.00 0.00 ? 233 GLU A H    10 
ATOM 11604 H HA   . GLU A 1 31 ? -4.467  9.891   2.778  1.00 0.00 ? 233 GLU A HA   10 
ATOM 11605 H HB2  . GLU A 1 31 ? -6.199  11.556  0.945  1.00 0.00 ? 233 GLU A HB2  10 
ATOM 11606 H HB3  . GLU A 1 31 ? -6.095  11.682  2.696  1.00 0.00 ? 233 GLU A HB3  10 
ATOM 11607 H HG2  . GLU A 1 31 ? -4.627  13.308  2.331  1.00 0.00 ? 233 GLU A HG2  10 
ATOM 11608 H HG3  . GLU A 1 31 ? -3.492  12.022  1.923  1.00 0.00 ? 233 GLU A HG3  10 
ATOM 11609 N N    . THR A 1 32 ? -6.896  8.983   3.030  1.00 0.00 ? 234 THR A N    10 
ATOM 11610 C CA   . THR A 1 32 ? -8.047  8.100   3.182  1.00 0.00 ? 234 THR A CA   10 
ATOM 11611 C C    . THR A 1 32 ? -9.338  8.905   3.297  1.00 0.00 ? 234 THR A C    10 
ATOM 11612 O O    . THR A 1 32 ? -9.308  10.120  3.487  1.00 0.00 ? 234 THR A O    10 
ATOM 11613 C CB   . THR A 1 32 ? -7.875  7.211   4.415  1.00 0.00 ? 234 THR A CB   10 
ATOM 11614 O OG1  . THR A 1 32 ? -8.001  7.972   5.604  1.00 0.00 ? 234 THR A OG1  10 
ATOM 11615 C CG2  . THR A 1 32 ? -6.538  6.504   4.462  1.00 0.00 ? 234 THR A CG2  10 
ATOM 11616 H H    . THR A 1 32 ? -6.616  9.536   3.789  1.00 0.00 ? 234 THR A H    10 
ATOM 11617 H HA   . THR A 1 32 ? -8.103  7.475   2.304  1.00 0.00 ? 234 THR A HA   10 
ATOM 11618 H HB   . THR A 1 32 ? -8.649  6.457   4.412  1.00 0.00 ? 234 THR A HB   10 
ATOM 11619 H HG1  . THR A 1 32 ? -7.419  8.734   5.558  1.00 0.00 ? 234 THR A HG1  10 
ATOM 11620 H HG21 . THR A 1 32 ? -6.696  5.447   4.614  1.00 0.00 ? 234 THR A HG21 10 
ATOM 11621 H HG22 . THR A 1 32 ? -5.950  6.900   5.274  1.00 0.00 ? 234 THR A HG22 10 
ATOM 11622 H HG23 . THR A 1 32 ? -6.017  6.659   3.528  1.00 0.00 ? 234 THR A HG23 10 
ATOM 11623 N N    . ASP A 1 33 ? -10.469 8.218   3.178  1.00 0.00 ? 235 ASP A N    10 
ATOM 11624 C CA   . ASP A 1 33 ? -11.772 8.867   3.268  1.00 0.00 ? 235 ASP A CA   10 
ATOM 11625 C C    . ASP A 1 33 ? -12.308 8.848   4.699  1.00 0.00 ? 235 ASP A C    10 
ATOM 11626 O O    . ASP A 1 33 ? -13.364 9.417   4.980  1.00 0.00 ? 235 ASP A O    10 
ATOM 11627 C CB   . ASP A 1 33 ? -12.769 8.183   2.332  1.00 0.00 ? 235 ASP A CB   10 
ATOM 11628 C CG   . ASP A 1 33 ? -14.022 9.011   2.116  1.00 0.00 ? 235 ASP A CG   10 
ATOM 11629 O OD1  . ASP A 1 33 ? -13.910 10.254  2.071  1.00 0.00 ? 235 ASP A OD1  10 
ATOM 11630 O OD2  . ASP A 1 33 ? -15.112 8.416   1.990  1.00 0.00 ? 235 ASP A OD2  10 
ATOM 11631 H H    . ASP A 1 33 ? -10.427 7.251   3.026  1.00 0.00 ? 235 ASP A H    10 
ATOM 11632 H HA   . ASP A 1 33 ? -11.650 9.895   2.957  1.00 0.00 ? 235 ASP A HA   10 
ATOM 11633 H HB2  . ASP A 1 33 ? -12.300 8.018   1.374  1.00 0.00 ? 235 ASP A HB2  10 
ATOM 11634 H HB3  . ASP A 1 33 ? -13.058 7.231   2.756  1.00 0.00 ? 235 ASP A HB3  10 
ATOM 11635 N N    . PHE A 1 34 ? -11.581 8.192   5.601  1.00 0.00 ? 236 PHE A N    10 
ATOM 11636 C CA   . PHE A 1 34 ? -11.998 8.107   6.997  1.00 0.00 ? 236 PHE A CA   10 
ATOM 11637 C C    . PHE A 1 34 ? -10.944 8.703   7.933  1.00 0.00 ? 236 PHE A C    10 
ATOM 11638 O O    . PHE A 1 34 ? -11.234 9.003   9.090  1.00 0.00 ? 236 PHE A O    10 
ATOM 11639 C CB   . PHE A 1 34 ? -12.280 6.648   7.381  1.00 0.00 ? 236 PHE A CB   10 
ATOM 11640 C CG   . PHE A 1 34 ? -11.047 5.843   7.703  1.00 0.00 ? 236 PHE A CG   10 
ATOM 11641 C CD1  . PHE A 1 34 ? -10.058 5.648   6.752  1.00 0.00 ? 236 PHE A CD1  10 
ATOM 11642 C CD2  . PHE A 1 34 ? -10.882 5.287   8.959  1.00 0.00 ? 236 PHE A CD2  10 
ATOM 11643 C CE1  . PHE A 1 34 ? -8.927  4.910   7.049  1.00 0.00 ? 236 PHE A CE1  10 
ATOM 11644 C CE2  . PHE A 1 34 ? -9.754  4.548   9.263  1.00 0.00 ? 236 PHE A CE2  10 
ATOM 11645 C CZ   . PHE A 1 34 ? -8.775  4.360   8.308  1.00 0.00 ? 236 PHE A CZ   10 
ATOM 11646 H H    . PHE A 1 34 ? -10.752 7.758   5.321  1.00 0.00 ? 236 PHE A H    10 
ATOM 11647 H HA   . PHE A 1 34 ? -12.910 8.674   7.101  1.00 0.00 ? 236 PHE A HA   10 
ATOM 11648 H HB2  . PHE A 1 34 ? -12.920 6.631   8.249  1.00 0.00 ? 236 PHE A HB2  10 
ATOM 11649 H HB3  . PHE A 1 34 ? -12.787 6.162   6.559  1.00 0.00 ? 236 PHE A HB3  10 
ATOM 11650 H HD1  . PHE A 1 34 ? -10.173 6.078   5.770  1.00 0.00 ? 236 PHE A HD1  10 
ATOM 11651 H HD2  . PHE A 1 34 ? -11.646 5.432   9.710  1.00 0.00 ? 236 PHE A HD2  10 
ATOM 11652 H HE1  . PHE A 1 34 ? -8.164  4.765   6.301  1.00 0.00 ? 236 PHE A HE1  10 
ATOM 11653 H HE2  . PHE A 1 34 ? -9.638  4.119   10.247 1.00 0.00 ? 236 PHE A HE2  10 
ATOM 11654 H HZ   . PHE A 1 34 ? -7.893  3.784   8.542  1.00 0.00 ? 236 PHE A HZ   10 
ATOM 11655 N N    . ALA A 1 35 ? -9.723  8.871   7.429  1.00 0.00 ? 237 ALA A N    10 
ATOM 11656 C CA   . ALA A 1 35 ? -8.641  9.429   8.229  1.00 0.00 ? 237 ALA A CA   10 
ATOM 11657 C C    . ALA A 1 35 ? -8.088  10.703  7.600  1.00 0.00 ? 237 ALA A C    10 
ATOM 11658 O O    . ALA A 1 35 ? -7.971  10.804  6.378  1.00 0.00 ? 237 ALA A O    10 
ATOM 11659 C CB   . ALA A 1 35 ? -7.534  8.402   8.405  1.00 0.00 ? 237 ALA A CB   10 
ATOM 11660 H H    . ALA A 1 35 ? -9.545  8.614   6.502  1.00 0.00 ? 237 ALA A H    10 
ATOM 11661 H HA   . ALA A 1 35 ? -9.039  9.665   9.205  1.00 0.00 ? 237 ALA A HA   10 
ATOM 11662 H HB1  . ALA A 1 35 ? -6.892  8.413   7.537  1.00 0.00 ? 237 ALA A HB1  10 
ATOM 11663 H HB2  . ALA A 1 35 ? -6.955  8.645   9.284  1.00 0.00 ? 237 ALA A HB2  10 
ATOM 11664 H HB3  . ALA A 1 35 ? -7.968  7.421   8.521  1.00 0.00 ? 237 ALA A HB3  10 
ATOM 11665 N N    . LYS A 1 36 ? -7.748  11.674  8.442  1.00 0.00 ? 238 LYS A N    10 
ATOM 11666 C CA   . LYS A 1 36 ? -7.204  12.941  7.968  1.00 0.00 ? 238 LYS A CA   10 
ATOM 11667 C C    . LYS A 1 36 ? -5.685  12.872  7.855  1.00 0.00 ? 238 LYS A C    10 
ATOM 11668 O O    . LYS A 1 36 ? -5.008  12.366  8.749  1.00 0.00 ? 238 LYS A O    10 
ATOM 11669 C CB   . LYS A 1 36 ? -7.604  14.077  8.912  1.00 0.00 ? 238 LYS A CB   10 
ATOM 11670 C CG   . LYS A 1 36 ? -9.106  14.265  9.035  1.00 0.00 ? 238 LYS A CG   10 
ATOM 11671 C CD   . LYS A 1 36 ? -9.450  15.575  9.725  1.00 0.00 ? 238 LYS A CD   10 
ATOM 11672 C CE   . LYS A 1 36 ? -9.640  16.699  8.719  1.00 0.00 ? 238 LYS A CE   10 
ATOM 11673 N NZ   . LYS A 1 36 ? -8.460  16.850  7.823  1.00 0.00 ? 238 LYS A NZ   10 
ATOM 11674 H H    . LYS A 1 36 ? -7.863  11.534  9.405  1.00 0.00 ? 238 LYS A H    10 
ATOM 11675 H HA   . LYS A 1 36 ? -7.618  13.135  6.990  1.00 0.00 ? 238 LYS A HA   10 
ATOM 11676 H HB2  . LYS A 1 36 ? -7.207  13.868  9.894  1.00 0.00 ? 238 LYS A HB2  10 
ATOM 11677 H HB3  . LYS A 1 36 ? -7.176  15.000  8.548  1.00 0.00 ? 238 LYS A HB3  10 
ATOM 11678 H HG2  . LYS A 1 36 ? -9.542  14.265  8.047  1.00 0.00 ? 238 LYS A HG2  10 
ATOM 11679 H HG3  . LYS A 1 36 ? -9.515  13.447  9.612  1.00 0.00 ? 238 LYS A HG3  10 
ATOM 11680 H HD2  . LYS A 1 36 ? -10.363 15.448  10.285 1.00 0.00 ? 238 LYS A HD2  10 
ATOM 11681 H HD3  . LYS A 1 36 ? -8.645  15.838  10.396 1.00 0.00 ? 238 LYS A HD3  10 
ATOM 11682 H HE2  . LYS A 1 36 ? -10.511 16.483  8.119  1.00 0.00 ? 238 LYS A HE2  10 
ATOM 11683 H HE3  . LYS A 1 36 ? -9.795  17.623  9.257  1.00 0.00 ? 238 LYS A HE3  10 
ATOM 11684 H HZ1  . LYS A 1 36 ? -8.600  17.657  7.181  1.00 0.00 ? 238 LYS A HZ1  10 
ATOM 11685 H HZ2  . LYS A 1 36 ? -8.330  15.987  7.256  1.00 0.00 ? 238 LYS A HZ2  10 
ATOM 11686 H HZ3  . LYS A 1 36 ? -7.602  17.014  8.387  1.00 0.00 ? 238 LYS A HZ3  10 
ATOM 11687 N N    . GLY A 1 37 ? -5.153  13.386  6.751  1.00 0.00 ? 239 GLY A N    10 
ATOM 11688 C CA   . GLY A 1 37 ? -3.717  13.372  6.541  1.00 0.00 ? 239 GLY A CA   10 
ATOM 11689 C C    . GLY A 1 37 ? -3.296  12.408  5.449  1.00 0.00 ? 239 GLY A C    10 
ATOM 11690 O O    . GLY A 1 37 ? -4.133  11.896  4.707  1.00 0.00 ? 239 GLY A O    10 
ATOM 11691 H H    . GLY A 1 37 ? -5.742  13.778  6.071  1.00 0.00 ? 239 GLY A H    10 
ATOM 11692 H HA2  . GLY A 1 37 ? -3.394  14.368  6.271  1.00 0.00 ? 239 GLY A HA2  10 
ATOM 11693 H HA3  . GLY A 1 37 ? -3.233  13.087  7.464  1.00 0.00 ? 239 GLY A HA3  10 
ATOM 11694 N N    . GLU A 1 38 ? -1.993  12.161  5.351  1.00 0.00 ? 240 GLU A N    10 
ATOM 11695 C CA   . GLU A 1 38 ? -1.461  11.253  4.341  1.00 0.00 ? 240 GLU A CA   10 
ATOM 11696 C C    . GLU A 1 38 ? -1.322  9.838   4.899  1.00 0.00 ? 240 GLU A C    10 
ATOM 11697 O O    . GLU A 1 38 ? -0.815  9.643   6.004  1.00 0.00 ? 240 GLU A O    10 
ATOM 11698 C CB   . GLU A 1 38 ? -0.105  11.751  3.841  1.00 0.00 ? 240 GLU A CB   10 
ATOM 11699 C CG   . GLU A 1 38 ? 0.977   11.752  4.909  1.00 0.00 ? 240 GLU A CG   10 
ATOM 11700 C CD   . GLU A 1 38 ? 2.134   12.672  4.566  1.00 0.00 ? 240 GLU A CD   10 
ATOM 11701 O OE1  . GLU A 1 38 ? 2.073   13.864  4.933  1.00 0.00 ? 240 GLU A OE1  10 
ATOM 11702 O OE2  . GLU A 1 38 ? 3.098   12.199  3.930  1.00 0.00 ? 240 GLU A OE2  10 
ATOM 11703 H H    . GLU A 1 38 ? -1.375  12.599  5.972  1.00 0.00 ? 240 GLU A H    10 
ATOM 11704 H HA   . GLU A 1 38 ? -2.155  11.233  3.515  1.00 0.00 ? 240 GLU A HA   10 
ATOM 11705 H HB2  . GLU A 1 38 ? 0.222   11.119  3.029  1.00 0.00 ? 240 GLU A HB2  10 
ATOM 11706 H HB3  . GLU A 1 38 ? -0.219  12.761  3.475  1.00 0.00 ? 240 GLU A HB3  10 
ATOM 11707 H HG2  . GLU A 1 38 ? 0.544   12.078  5.843  1.00 0.00 ? 240 GLU A HG2  10 
ATOM 11708 H HG3  . GLU A 1 38 ? 1.356   10.747  5.020  1.00 0.00 ? 240 GLU A HG3  10 
ATOM 11709 N N    . TRP A 1 39 ? -1.775  8.857   4.126  1.00 0.00 ? 241 TRP A N    10 
ATOM 11710 C CA   . TRP A 1 39 ? -1.703  7.460   4.543  1.00 0.00 ? 241 TRP A CA   10 
ATOM 11711 C C    . TRP A 1 39 ? -1.077  6.599   3.450  1.00 0.00 ? 241 TRP A C    10 
ATOM 11712 O O    . TRP A 1 39 ? -0.904  7.047   2.317  1.00 0.00 ? 241 TRP A O    10 
ATOM 11713 C CB   . TRP A 1 39 ? -3.098  6.937   4.887  1.00 0.00 ? 241 TRP A CB   10 
ATOM 11714 C CG   . TRP A 1 39 ? -3.682  7.575   6.110  1.00 0.00 ? 241 TRP A CG   10 
ATOM 11715 C CD1  . TRP A 1 39 ? -4.198  8.834   6.210  1.00 0.00 ? 241 TRP A CD1  10 
ATOM 11716 C CD2  . TRP A 1 39 ? -3.807  6.984   7.408  1.00 0.00 ? 241 TRP A CD2  10 
ATOM 11717 N NE1  . TRP A 1 39 ? -4.636  9.063   7.492  1.00 0.00 ? 241 TRP A NE1  10 
ATOM 11718 C CE2  . TRP A 1 39 ? -4.407  7.942   8.247  1.00 0.00 ? 241 TRP A CE2  10 
ATOM 11719 C CE3  . TRP A 1 39 ? -3.469  5.738   7.943  1.00 0.00 ? 241 TRP A CE3  10 
ATOM 11720 C CZ2  . TRP A 1 39 ? -4.675  7.692   9.591  1.00 0.00 ? 241 TRP A CZ2  10 
ATOM 11721 C CZ3  . TRP A 1 39 ? -3.737  5.491   9.277  1.00 0.00 ? 241 TRP A CZ3  10 
ATOM 11722 C CH2  . TRP A 1 39 ? -4.335  6.463   10.088 1.00 0.00 ? 241 TRP A CH2  10 
ATOM 11723 H H    . TRP A 1 39 ? -2.169  9.076   3.257  1.00 0.00 ? 241 TRP A H    10 
ATOM 11724 H HA   . TRP A 1 39 ? -1.082  7.409   5.424  1.00 0.00 ? 241 TRP A HA   10 
ATOM 11725 H HB2  . TRP A 1 39 ? -3.763  7.131   4.060  1.00 0.00 ? 241 TRP A HB2  10 
ATOM 11726 H HB3  . TRP A 1 39 ? -3.043  5.872   5.057  1.00 0.00 ? 241 TRP A HB3  10 
ATOM 11727 H HD1  . TRP A 1 39 ? -4.248  9.538   5.394  1.00 0.00 ? 241 TRP A HD1  10 
ATOM 11728 H HE1  . TRP A 1 39 ? -5.046  9.894   7.814  1.00 0.00 ? 241 TRP A HE1  10 
ATOM 11729 H HE3  . TRP A 1 39 ? -3.008  4.975   7.334  1.00 0.00 ? 241 TRP A HE3  10 
ATOM 11730 H HZ2  . TRP A 1 39 ? -5.136  8.431   10.228 1.00 0.00 ? 241 TRP A HZ2  10 
ATOM 11731 H HZ3  . TRP A 1 39 ? -3.484  4.534   9.705  1.00 0.00 ? 241 TRP A HZ3  10 
ATOM 11732 H HH2  . TRP A 1 39 ? -4.524  6.227   11.125 1.00 0.00 ? 241 TRP A HH2  10 
ATOM 11733 N N    . CYS A 1 40 ? -0.736  5.363   3.799  1.00 0.00 ? 242 CYS A N    10 
ATOM 11734 C CA   . CYS A 1 40 ? -0.129  4.442   2.844  1.00 0.00 ? 242 CYS A CA   10 
ATOM 11735 C C    . CYS A 1 40 ? -0.739  3.048   2.965  1.00 0.00 ? 242 CYS A C    10 
ATOM 11736 O O    . CYS A 1 40 ? -1.276  2.678   4.010  1.00 0.00 ? 242 CYS A O    10 
ATOM 11737 C CB   . CYS A 1 40 ? 1.386   4.378   3.059  1.00 0.00 ? 242 CYS A CB   10 
ATOM 11738 S SG   . CYS A 1 40 ? 2.238   3.174   2.010  1.00 0.00 ? 242 CYS A SG   10 
ATOM 11739 H H    . CYS A 1 40 ? -0.898  5.062   4.717  1.00 0.00 ? 242 CYS A H    10 
ATOM 11740 H HA   . CYS A 1 40 ? -0.326  4.821   1.853  1.00 0.00 ? 242 CYS A HA   10 
ATOM 11741 H HB2  . CYS A 1 40 ? 1.813   5.347   2.852  1.00 0.00 ? 242 CYS A HB2  10 
ATOM 11742 H HB3  . CYS A 1 40 ? 1.586   4.117   4.088  1.00 0.00 ? 242 CYS A HB3  10 
ATOM 11743 H HG   . CYS A 1 40 ? 3.181   3.342   2.073  1.00 0.00 ? 242 CYS A HG   10 
ATOM 11744 N N    . GLY A 1 41 ? -0.650  2.284   1.884  1.00 0.00 ? 243 GLY A N    10 
ATOM 11745 C CA   . GLY A 1 41 ? -1.191  0.941   1.865  1.00 0.00 ? 243 GLY A CA   10 
ATOM 11746 C C    . GLY A 1 41 ? -0.111  -0.111  1.713  1.00 0.00 ? 243 GLY A C    10 
ATOM 11747 O O    . GLY A 1 41 ? 0.691   -0.055  0.781  1.00 0.00 ? 243 GLY A O    10 
ATOM 11748 H H    . GLY A 1 41 ? -0.210  2.641   1.083  1.00 0.00 ? 243 GLY A H    10 
ATOM 11749 H HA2  . GLY A 1 41 ? -1.727  0.763   2.786  1.00 0.00 ? 243 GLY A HA2  10 
ATOM 11750 H HA3  . GLY A 1 41 ? -1.879  0.854   1.035  1.00 0.00 ? 243 GLY A HA3  10 
ATOM 11751 N N    . VAL A 1 42 ? -0.085  -1.068  2.631  1.00 0.00 ? 244 VAL A N    10 
ATOM 11752 C CA   . VAL A 1 42 ? 0.911   -2.133  2.593  1.00 0.00 ? 244 VAL A CA   10 
ATOM 11753 C C    . VAL A 1 42 ? 0.249   -3.504  2.701  1.00 0.00 ? 244 VAL A C    10 
ATOM 11754 O O    . VAL A 1 42 ? -0.590  -3.732  3.572  1.00 0.00 ? 244 VAL A O    10 
ATOM 11755 C CB   . VAL A 1 42 ? 1.940   -1.986  3.735  1.00 0.00 ? 244 VAL A CB   10 
ATOM 11756 C CG1  . VAL A 1 42 ? 3.166   -2.842  3.468  1.00 0.00 ? 244 VAL A CG1  10 
ATOM 11757 C CG2  . VAL A 1 42 ? 2.336   -0.528  3.929  1.00 0.00 ? 244 VAL A CG2  10 
ATOM 11758 H H    . VAL A 1 42 ? -0.748  -1.059  3.353  1.00 0.00 ? 244 VAL A H    10 
ATOM 11759 H HA   . VAL A 1 42 ? 1.433   -2.068  1.648  1.00 0.00 ? 244 VAL A HA   10 
ATOM 11760 H HB   . VAL A 1 42 ? 1.481   -2.333  4.649  1.00 0.00 ? 244 VAL A HB   10 
ATOM 11761 H HG11 . VAL A 1 42 ? 3.833   -2.791  4.319  1.00 0.00 ? 244 VAL A HG11 10 
ATOM 11762 H HG12 . VAL A 1 42 ? 2.864   -3.866  3.310  1.00 0.00 ? 244 VAL A HG12 10 
ATOM 11763 H HG13 . VAL A 1 42 ? 3.677   -2.478  2.590  1.00 0.00 ? 244 VAL A HG13 10 
ATOM 11764 H HG21 . VAL A 1 42 ? 2.885   -0.186  3.063  1.00 0.00 ? 244 VAL A HG21 10 
ATOM 11765 H HG22 . VAL A 1 42 ? 1.449   0.073   4.054  1.00 0.00 ? 244 VAL A HG22 10 
ATOM 11766 H HG23 . VAL A 1 42 ? 2.958   -0.439  4.807  1.00 0.00 ? 244 VAL A HG23 10 
ATOM 11767 N N    . GLU A 1 43 ? 0.642   -4.415  1.820  1.00 0.00 ? 245 GLU A N    10 
ATOM 11768 C CA   . GLU A 1 43 ? 0.097   -5.766  1.824  1.00 0.00 ? 245 GLU A CA   10 
ATOM 11769 C C    . GLU A 1 43 ? 0.855   -6.629  2.824  1.00 0.00 ? 245 GLU A C    10 
ATOM 11770 O O    . GLU A 1 43 ? 2.029   -6.942  2.623  1.00 0.00 ? 245 GLU A O    10 
ATOM 11771 C CB   . GLU A 1 43 ? 0.179   -6.383  0.427  1.00 0.00 ? 245 GLU A CB   10 
ATOM 11772 C CG   . GLU A 1 43 ? -0.381  -7.794  0.351  1.00 0.00 ? 245 GLU A CG   10 
ATOM 11773 C CD   . GLU A 1 43 ? -0.751  -8.199  -1.063 1.00 0.00 ? 245 GLU A CD   10 
ATOM 11774 O OE1  . GLU A 1 43 ? -0.954  -7.299  -1.905 1.00 0.00 ? 245 GLU A OE1  10 
ATOM 11775 O OE2  . GLU A 1 43 ? -0.838  -9.416  -1.328 1.00 0.00 ? 245 GLU A OE2  10 
ATOM 11776 H H    . GLU A 1 43 ? 1.321   -4.177  1.153  1.00 0.00 ? 245 GLU A H    10 
ATOM 11777 H HA   . GLU A 1 43 ? -0.937  -5.708  2.126  1.00 0.00 ? 245 GLU A HA   10 
ATOM 11778 H HB2  . GLU A 1 43 ? -0.370  -5.761  -0.262 1.00 0.00 ? 245 GLU A HB2  10 
ATOM 11779 H HB3  . GLU A 1 43 ? 1.216   -6.415  0.121  1.00 0.00 ? 245 GLU A HB3  10 
ATOM 11780 H HG2  . GLU A 1 43 ? 0.359   -8.484  0.724  1.00 0.00 ? 245 GLU A HG2  10 
ATOM 11781 H HG3  . GLU A 1 43 ? -1.267  -7.848  0.968  1.00 0.00 ? 245 GLU A HG3  10 
ATOM 11782 N N    . LEU A 1 44 ? 0.185   -6.997  3.909  1.00 0.00 ? 246 LEU A N    10 
ATOM 11783 C CA   . LEU A 1 44 ? 0.807   -7.804  4.950  1.00 0.00 ? 246 LEU A CA   10 
ATOM 11784 C C    . LEU A 1 44 ? 1.117   -9.211  4.454  1.00 0.00 ? 246 LEU A C    10 
ATOM 11785 O O    . LEU A 1 44 ? 0.378   -9.778  3.649  1.00 0.00 ? 246 LEU A O    10 
ATOM 11786 C CB   . LEU A 1 44 ? -0.100  -7.871  6.178  1.00 0.00 ? 246 LEU A CB   10 
ATOM 11787 C CG   . LEU A 1 44 ? -0.406  -6.520  6.828  1.00 0.00 ? 246 LEU A CG   10 
ATOM 11788 C CD1  . LEU A 1 44 ? -1.536  -6.658  7.836  1.00 0.00 ? 246 LEU A CD1  10 
ATOM 11789 C CD2  . LEU A 1 44 ? 0.840   -5.953  7.492  1.00 0.00 ? 246 LEU A CD2  10 
ATOM 11790 H H    . LEU A 1 44 ? -0.744  -6.706  4.020  1.00 0.00 ? 246 LEU A H    10 
ATOM 11791 H HA   . LEU A 1 44 ? 1.734   -7.322  5.225  1.00 0.00 ? 246 LEU A HA   10 
ATOM 11792 H HB2  . LEU A 1 44 ? -1.033  -8.327  5.886  1.00 0.00 ? 246 LEU A HB2  10 
ATOM 11793 H HB3  . LEU A 1 44 ? 0.374   -8.500  6.916  1.00 0.00 ? 246 LEU A HB3  10 
ATOM 11794 H HG   . LEU A 1 44 ? -0.725  -5.825  6.065  1.00 0.00 ? 246 LEU A HG   10 
ATOM 11795 H HD11 . LEU A 1 44 ? -1.310  -6.073  8.715  1.00 0.00 ? 246 LEU A HD11 10 
ATOM 11796 H HD12 . LEU A 1 44 ? -2.456  -6.306  7.396  1.00 0.00 ? 246 LEU A HD12 10 
ATOM 11797 H HD13 . LEU A 1 44 ? -1.645  -7.697  8.113  1.00 0.00 ? 246 LEU A HD13 10 
ATOM 11798 H HD21 . LEU A 1 44 ? 0.555   -5.381  8.362  1.00 0.00 ? 246 LEU A HD21 10 
ATOM 11799 H HD22 . LEU A 1 44 ? 1.488   -6.764  7.791  1.00 0.00 ? 246 LEU A HD22 10 
ATOM 11800 H HD23 . LEU A 1 44 ? 1.360   -5.313  6.794  1.00 0.00 ? 246 LEU A HD23 10 
ATOM 11801 N N    . ASP A 1 45 ? 2.221   -9.767  4.944  1.00 0.00 ? 247 ASP A N    10 
ATOM 11802 C CA   . ASP A 1 45 ? 2.646   -11.108 4.561  1.00 0.00 ? 247 ASP A CA   10 
ATOM 11803 C C    . ASP A 1 45 ? 1.707   -12.168 5.130  1.00 0.00 ? 247 ASP A C    10 
ATOM 11804 O O    . ASP A 1 45 ? 1.568   -13.253 4.567  1.00 0.00 ? 247 ASP A O    10 
ATOM 11805 C CB   . ASP A 1 45 ? 4.076   -11.362 5.041  1.00 0.00 ? 247 ASP A CB   10 
ATOM 11806 C CG   . ASP A 1 45 ? 5.113   -10.742 4.126  1.00 0.00 ? 247 ASP A CG   10 
ATOM 11807 O OD1  . ASP A 1 45 ? 5.415   -9.542  4.298  1.00 0.00 ? 247 ASP A OD1  10 
ATOM 11808 O OD2  . ASP A 1 45 ? 5.626   -11.456 3.239  1.00 0.00 ? 247 ASP A OD2  10 
ATOM 11809 H H    . ASP A 1 45 ? 2.767   -9.259  5.581  1.00 0.00 ? 247 ASP A H    10 
ATOM 11810 H HA   . ASP A 1 45 ? 2.624   -11.166 3.482  1.00 0.00 ? 247 ASP A HA   10 
ATOM 11811 H HB2  . ASP A 1 45 ? 4.197   -10.941 6.029  1.00 0.00 ? 247 ASP A HB2  10 
ATOM 11812 H HB3  . ASP A 1 45 ? 4.252   -12.426 5.086  1.00 0.00 ? 247 ASP A HB3  10 
ATOM 11813 N N    . GLU A 1 46 ? 1.064   -11.846 6.248  1.00 0.00 ? 248 GLU A N    10 
ATOM 11814 C CA   . GLU A 1 46 ? 0.139   -12.774 6.893  1.00 0.00 ? 248 GLU A CA   10 
ATOM 11815 C C    . GLU A 1 46 ? -1.151  -12.063 7.296  1.00 0.00 ? 248 GLU A C    10 
ATOM 11816 O O    . GLU A 1 46 ? -1.229  -10.835 7.253  1.00 0.00 ? 248 GLU A O    10 
ATOM 11817 C CB   . GLU A 1 46 ? 0.800   -13.408 8.119  1.00 0.00 ? 248 GLU A CB   10 
ATOM 11818 C CG   . GLU A 1 46 ? 1.237   -14.848 7.899  1.00 0.00 ? 248 GLU A CG   10 
ATOM 11819 C CD   . GLU A 1 46 ? 2.603   -15.138 8.486  1.00 0.00 ? 248 GLU A CD   10 
ATOM 11820 O OE1  . GLU A 1 46 ? 2.746   -15.060 9.726  1.00 0.00 ? 248 GLU A OE1  10 
ATOM 11821 O OE2  . GLU A 1 46 ? 3.531   -15.446 7.709  1.00 0.00 ? 248 GLU A OE2  10 
ATOM 11822 H H    . GLU A 1 46 ? 1.215   -10.967 6.652  1.00 0.00 ? 248 GLU A H    10 
ATOM 11823 H HA   . GLU A 1 46 ? -0.099  -13.552 6.181  1.00 0.00 ? 248 GLU A HA   10 
ATOM 11824 H HB2  . GLU A 1 46 ? 1.671   -12.827 8.386  1.00 0.00 ? 248 GLU A HB2  10 
ATOM 11825 H HB3  . GLU A 1 46 ? 0.099   -13.390 8.942  1.00 0.00 ? 248 GLU A HB3  10 
ATOM 11826 H HG2  . GLU A 1 46 ? 0.515   -15.503 8.361  1.00 0.00 ? 248 GLU A HG2  10 
ATOM 11827 H HG3  . GLU A 1 46 ? 1.269   -15.041 6.836  1.00 0.00 ? 248 GLU A HG3  10 
ATOM 11828 N N    . PRO A 1 47 ? -2.185  -12.827 7.694  1.00 0.00 ? 249 PRO A N    10 
ATOM 11829 C CA   . PRO A 1 47 ? -3.472  -12.257 8.107  1.00 0.00 ? 249 PRO A CA   10 
ATOM 11830 C C    . PRO A 1 47 ? -3.357  -11.450 9.397  1.00 0.00 ? 249 PRO A C    10 
ATOM 11831 O O    . PRO A 1 47 ? -3.851  -11.860 10.447 1.00 0.00 ? 249 PRO A O    10 
ATOM 11832 C CB   . PRO A 1 47 ? -4.362  -13.486 8.318  1.00 0.00 ? 249 PRO A CB   10 
ATOM 11833 C CG   . PRO A 1 47 ? -3.411  -14.602 8.586  1.00 0.00 ? 249 PRO A CG   10 
ATOM 11834 C CD   . PRO A 1 47 ? -2.182  -14.300 7.777  1.00 0.00 ? 249 PRO A CD   10 
ATOM 11835 H HA   . PRO A 1 47 ? -3.893  -11.632 7.332  1.00 0.00 ? 249 PRO A HA   10 
ATOM 11836 H HB2  . PRO A 1 47 ? -5.019  -13.316 9.158  1.00 0.00 ? 249 PRO A HB2  10 
ATOM 1