data_2E4Y
# 
_entry.id   2E4Y 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2E4Y         pdb_00002e4y 10.2210/pdb2e4y/pdb 
RCSB  RCSB026230   ?            ?                   
WWPDB D_1000026230 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2E4U 'the same protein complexed with L-glutamate'                                unspecified 
PDB 2E4V 'the same protein complexed with DCG-IV'                                     unspecified 
PDB 2E4W 'the same protein complexed with 1S,3S-ACPD'                                 unspecified 
PDB 2E4X 'the same protein complexed with 1S,3R-ACPD'                                 unspecified 
PDB 2E4Z 'the ligand-binding region of the group III metabotropic glutamate receptor' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2E4Y 
_pdbx_database_status.recvd_initial_deposition_date   2006-12-17 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Muto, T.'     1 
'Tsuchiya, D.' 2 
'Morikawa, K.' 3 
'Jingami, H.'  4 
# 
_citation.id                        primary 
_citation.title                     'Structures of the extracellular regions of the group II/III metabotropic glutamate receptors' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            104 
_citation.page_first                3759 
_citation.page_last                 3764 
_citation.year                      2007 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17360426 
_citation.pdbx_database_id_DOI      10.1073/pnas.0611577104 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Muto, T.'     1 ? 
primary 'Tsuchiya, D.' 2 ? 
primary 'Morikawa, K.' 3 ? 
primary 'Jingami, H.'  4 ? 
# 
_cell.entry_id           2E4Y 
_cell.length_a           84.393 
_cell.length_b           91.799 
_cell.length_c           112.972 
_cell.angle_alpha        90.00 
_cell.angle_beta         92.28 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2E4Y 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Metabotropic glutamate receptor 3'                63117.297 2 ? 'N414Q, N439Q' 'Extracellular region' ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose           221.208   1 ? ?              ?                      ? 
3 non-polymer syn '(2R,4R)-4-aminopyrrolidine-2,4-dicarboxylic acid' 174.155   2 ? ?              ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'mGluR3, group II metabotropic glutamate receptor subtype 3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DHNFMRREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTY
ALEQSLEFVRASLTKVDEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRY
DYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELL
QKPNARVVVLFMRSDDSRELIAAANRVNASFTWVASDGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSLNPYN
NHRNPWFRDFWEQKFQCSLQNKRNHRQVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPQTTKLCDAMKI
LDGKKLYKEYLLKIQFTAPFNPNKGADSIVKFDTFGDGMGRYNVFNLQQTGGKYSYLKVGHWAETLSLDVDSIHWSRNSV
PTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFTCMDCGPGQWPTADLSGCYNLPEDYIKWEDALVPR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DHNFMRREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTY
ALEQSLEFVRASLTKVDEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRY
DYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELL
QKPNARVVVLFMRSDDSRELIAAANRVNASFTWVASDGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSLNPYN
NHRNPWFRDFWEQKFQCSLQNKRNHRQVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPQTTKLCDAMKI
LDGKKLYKEYLLKIQFTAPFNPNKGADSIVKFDTFGDGMGRYNVFNLQQTGGKYSYLKVGHWAETLSLDVDSIHWSRNSV
PTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFTCMDCGPGQWPTADLSGCYNLPEDYIKWEDALVPR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   HIS n 
1 3   ASN n 
1 4   PHE n 
1 5   MET n 
1 6   ARG n 
1 7   ARG n 
1 8   GLU n 
1 9   ILE n 
1 10  LYS n 
1 11  ILE n 
1 12  GLU n 
1 13  GLY n 
1 14  ASP n 
1 15  LEU n 
1 16  VAL n 
1 17  LEU n 
1 18  GLY n 
1 19  GLY n 
1 20  LEU n 
1 21  PHE n 
1 22  PRO n 
1 23  ILE n 
1 24  ASN n 
1 25  GLU n 
1 26  LYS n 
1 27  GLY n 
1 28  THR n 
1 29  GLY n 
1 30  THR n 
1 31  GLU n 
1 32  GLU n 
1 33  CYS n 
1 34  GLY n 
1 35  ARG n 
1 36  ILE n 
1 37  ASN n 
1 38  GLU n 
1 39  ASP n 
1 40  ARG n 
1 41  GLY n 
1 42  ILE n 
1 43  GLN n 
1 44  ARG n 
1 45  LEU n 
1 46  GLU n 
1 47  ALA n 
1 48  MET n 
1 49  LEU n 
1 50  PHE n 
1 51  ALA n 
1 52  ILE n 
1 53  ASP n 
1 54  GLU n 
1 55  ILE n 
1 56  ASN n 
1 57  LYS n 
1 58  ASP n 
1 59  ASN n 
1 60  TYR n 
1 61  LEU n 
1 62  LEU n 
1 63  PRO n 
1 64  GLY n 
1 65  VAL n 
1 66  LYS n 
1 67  LEU n 
1 68  GLY n 
1 69  VAL n 
1 70  HIS n 
1 71  ILE n 
1 72  LEU n 
1 73  ASP n 
1 74  THR n 
1 75  CYS n 
1 76  SER n 
1 77  ARG n 
1 78  ASP n 
1 79  THR n 
1 80  TYR n 
1 81  ALA n 
1 82  LEU n 
1 83  GLU n 
1 84  GLN n 
1 85  SER n 
1 86  LEU n 
1 87  GLU n 
1 88  PHE n 
1 89  VAL n 
1 90  ARG n 
1 91  ALA n 
1 92  SER n 
1 93  LEU n 
1 94  THR n 
1 95  LYS n 
1 96  VAL n 
1 97  ASP n 
1 98  GLU n 
1 99  ALA n 
1 100 GLU n 
1 101 TYR n 
1 102 MET n 
1 103 CYS n 
1 104 PRO n 
1 105 ASP n 
1 106 GLY n 
1 107 SER n 
1 108 TYR n 
1 109 ALA n 
1 110 ILE n 
1 111 GLN n 
1 112 GLU n 
1 113 ASN n 
1 114 ILE n 
1 115 PRO n 
1 116 LEU n 
1 117 LEU n 
1 118 ILE n 
1 119 ALA n 
1 120 GLY n 
1 121 VAL n 
1 122 ILE n 
1 123 GLY n 
1 124 GLY n 
1 125 SER n 
1 126 TYR n 
1 127 SER n 
1 128 SER n 
1 129 VAL n 
1 130 SER n 
1 131 ILE n 
1 132 GLN n 
1 133 VAL n 
1 134 ALA n 
1 135 ASN n 
1 136 LEU n 
1 137 LEU n 
1 138 ARG n 
1 139 LEU n 
1 140 PHE n 
1 141 GLN n 
1 142 ILE n 
1 143 PRO n 
1 144 GLN n 
1 145 ILE n 
1 146 SER n 
1 147 TYR n 
1 148 ALA n 
1 149 SER n 
1 150 THR n 
1 151 SER n 
1 152 ALA n 
1 153 LYS n 
1 154 LEU n 
1 155 SER n 
1 156 ASP n 
1 157 LYS n 
1 158 SER n 
1 159 ARG n 
1 160 TYR n 
1 161 ASP n 
1 162 TYR n 
1 163 PHE n 
1 164 ALA n 
1 165 ARG n 
1 166 THR n 
1 167 VAL n 
1 168 PRO n 
1 169 PRO n 
1 170 ASP n 
1 171 PHE n 
1 172 TYR n 
1 173 GLN n 
1 174 ALA n 
1 175 LYS n 
1 176 ALA n 
1 177 MET n 
1 178 ALA n 
1 179 GLU n 
1 180 ILE n 
1 181 LEU n 
1 182 ARG n 
1 183 PHE n 
1 184 PHE n 
1 185 ASN n 
1 186 TRP n 
1 187 THR n 
1 188 TYR n 
1 189 VAL n 
1 190 SER n 
1 191 THR n 
1 192 VAL n 
1 193 ALA n 
1 194 SER n 
1 195 GLU n 
1 196 GLY n 
1 197 ASP n 
1 198 TYR n 
1 199 GLY n 
1 200 GLU n 
1 201 THR n 
1 202 GLY n 
1 203 ILE n 
1 204 GLU n 
1 205 ALA n 
1 206 PHE n 
1 207 GLU n 
1 208 GLN n 
1 209 GLU n 
1 210 ALA n 
1 211 ARG n 
1 212 LEU n 
1 213 ARG n 
1 214 ASN n 
1 215 ILE n 
1 216 CYS n 
1 217 ILE n 
1 218 ALA n 
1 219 THR n 
1 220 ALA n 
1 221 GLU n 
1 222 LYS n 
1 223 VAL n 
1 224 GLY n 
1 225 ARG n 
1 226 SER n 
1 227 ASN n 
1 228 ILE n 
1 229 ARG n 
1 230 LYS n 
1 231 SER n 
1 232 TYR n 
1 233 ASP n 
1 234 SER n 
1 235 VAL n 
1 236 ILE n 
1 237 ARG n 
1 238 GLU n 
1 239 LEU n 
1 240 LEU n 
1 241 GLN n 
1 242 LYS n 
1 243 PRO n 
1 244 ASN n 
1 245 ALA n 
1 246 ARG n 
1 247 VAL n 
1 248 VAL n 
1 249 VAL n 
1 250 LEU n 
1 251 PHE n 
1 252 MET n 
1 253 ARG n 
1 254 SER n 
1 255 ASP n 
1 256 ASP n 
1 257 SER n 
1 258 ARG n 
1 259 GLU n 
1 260 LEU n 
1 261 ILE n 
1 262 ALA n 
1 263 ALA n 
1 264 ALA n 
1 265 ASN n 
1 266 ARG n 
1 267 VAL n 
1 268 ASN n 
1 269 ALA n 
1 270 SER n 
1 271 PHE n 
1 272 THR n 
1 273 TRP n 
1 274 VAL n 
1 275 ALA n 
1 276 SER n 
1 277 ASP n 
1 278 GLY n 
1 279 TRP n 
1 280 GLY n 
1 281 ALA n 
1 282 GLN n 
1 283 GLU n 
1 284 SER n 
1 285 ILE n 
1 286 VAL n 
1 287 LYS n 
1 288 GLY n 
1 289 SER n 
1 290 GLU n 
1 291 HIS n 
1 292 VAL n 
1 293 ALA n 
1 294 TYR n 
1 295 GLY n 
1 296 ALA n 
1 297 ILE n 
1 298 THR n 
1 299 LEU n 
1 300 GLU n 
1 301 LEU n 
1 302 ALA n 
1 303 SER n 
1 304 HIS n 
1 305 PRO n 
1 306 VAL n 
1 307 ARG n 
1 308 GLN n 
1 309 PHE n 
1 310 ASP n 
1 311 ARG n 
1 312 TYR n 
1 313 PHE n 
1 314 GLN n 
1 315 SER n 
1 316 LEU n 
1 317 ASN n 
1 318 PRO n 
1 319 TYR n 
1 320 ASN n 
1 321 ASN n 
1 322 HIS n 
1 323 ARG n 
1 324 ASN n 
1 325 PRO n 
1 326 TRP n 
1 327 PHE n 
1 328 ARG n 
1 329 ASP n 
1 330 PHE n 
1 331 TRP n 
1 332 GLU n 
1 333 GLN n 
1 334 LYS n 
1 335 PHE n 
1 336 GLN n 
1 337 CYS n 
1 338 SER n 
1 339 LEU n 
1 340 GLN n 
1 341 ASN n 
1 342 LYS n 
1 343 ARG n 
1 344 ASN n 
1 345 HIS n 
1 346 ARG n 
1 347 GLN n 
1 348 VAL n 
1 349 CYS n 
1 350 ASP n 
1 351 LYS n 
1 352 HIS n 
1 353 LEU n 
1 354 ALA n 
1 355 ILE n 
1 356 ASP n 
1 357 SER n 
1 358 SER n 
1 359 ASN n 
1 360 TYR n 
1 361 GLU n 
1 362 GLN n 
1 363 GLU n 
1 364 SER n 
1 365 LYS n 
1 366 ILE n 
1 367 MET n 
1 368 PHE n 
1 369 VAL n 
1 370 VAL n 
1 371 ASN n 
1 372 ALA n 
1 373 VAL n 
1 374 TYR n 
1 375 ALA n 
1 376 MET n 
1 377 ALA n 
1 378 HIS n 
1 379 ALA n 
1 380 LEU n 
1 381 HIS n 
1 382 LYS n 
1 383 MET n 
1 384 GLN n 
1 385 ARG n 
1 386 THR n 
1 387 LEU n 
1 388 CYS n 
1 389 PRO n 
1 390 GLN n 
1 391 THR n 
1 392 THR n 
1 393 LYS n 
1 394 LEU n 
1 395 CYS n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 LYS n 
1 400 ILE n 
1 401 LEU n 
1 402 ASP n 
1 403 GLY n 
1 404 LYS n 
1 405 LYS n 
1 406 LEU n 
1 407 TYR n 
1 408 LYS n 
1 409 GLU n 
1 410 TYR n 
1 411 LEU n 
1 412 LEU n 
1 413 LYS n 
1 414 ILE n 
1 415 GLN n 
1 416 PHE n 
1 417 THR n 
1 418 ALA n 
1 419 PRO n 
1 420 PHE n 
1 421 ASN n 
1 422 PRO n 
1 423 ASN n 
1 424 LYS n 
1 425 GLY n 
1 426 ALA n 
1 427 ASP n 
1 428 SER n 
1 429 ILE n 
1 430 VAL n 
1 431 LYS n 
1 432 PHE n 
1 433 ASP n 
1 434 THR n 
1 435 PHE n 
1 436 GLY n 
1 437 ASP n 
1 438 GLY n 
1 439 MET n 
1 440 GLY n 
1 441 ARG n 
1 442 TYR n 
1 443 ASN n 
1 444 VAL n 
1 445 PHE n 
1 446 ASN n 
1 447 LEU n 
1 448 GLN n 
1 449 GLN n 
1 450 THR n 
1 451 GLY n 
1 452 GLY n 
1 453 LYS n 
1 454 TYR n 
1 455 SER n 
1 456 TYR n 
1 457 LEU n 
1 458 LYS n 
1 459 VAL n 
1 460 GLY n 
1 461 HIS n 
1 462 TRP n 
1 463 ALA n 
1 464 GLU n 
1 465 THR n 
1 466 LEU n 
1 467 SER n 
1 468 LEU n 
1 469 ASP n 
1 470 VAL n 
1 471 ASP n 
1 472 SER n 
1 473 ILE n 
1 474 HIS n 
1 475 TRP n 
1 476 SER n 
1 477 ARG n 
1 478 ASN n 
1 479 SER n 
1 480 VAL n 
1 481 PRO n 
1 482 THR n 
1 483 SER n 
1 484 GLN n 
1 485 CYS n 
1 486 SER n 
1 487 ASP n 
1 488 PRO n 
1 489 CYS n 
1 490 ALA n 
1 491 PRO n 
1 492 ASN n 
1 493 GLU n 
1 494 MET n 
1 495 LYS n 
1 496 ASN n 
1 497 MET n 
1 498 GLN n 
1 499 PRO n 
1 500 GLY n 
1 501 ASP n 
1 502 VAL n 
1 503 CYS n 
1 504 CYS n 
1 505 TRP n 
1 506 ILE n 
1 507 CYS n 
1 508 ILE n 
1 509 PRO n 
1 510 CYS n 
1 511 GLU n 
1 512 PRO n 
1 513 TYR n 
1 514 GLU n 
1 515 TYR n 
1 516 LEU n 
1 517 VAL n 
1 518 ASP n 
1 519 GLU n 
1 520 PHE n 
1 521 THR n 
1 522 CYS n 
1 523 MET n 
1 524 ASP n 
1 525 CYS n 
1 526 GLY n 
1 527 PRO n 
1 528 GLY n 
1 529 GLN n 
1 530 TRP n 
1 531 PRO n 
1 532 THR n 
1 533 ALA n 
1 534 ASP n 
1 535 LEU n 
1 536 SER n 
1 537 GLY n 
1 538 CYS n 
1 539 TYR n 
1 540 ASN n 
1 541 LEU n 
1 542 PRO n 
1 543 GLU n 
1 544 ASP n 
1 545 TYR n 
1 546 ILE n 
1 547 LYS n 
1 548 TRP n 
1 549 GLU n 
1 550 ASP n 
1 551 ALA n 
1 552 LEU n 
1 553 VAL n 
1 554 PRO n 
1 555 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Norway rat' 
_entity_src_gen.gene_src_genus                     Rattus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus norvegicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10116 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'cabbage looper' 
_entity_src_gen.pdbx_host_org_scientific_name      'Trichoplusia ni' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7111 
_entity_src_gen.host_org_genus                     Trichoplusia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'HIGH FIVE' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACULOVIRUS 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MGR3_RAT 
_struct_ref.pdbx_db_accession          P31422 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DHNFMRREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTY
ALEQSLEFVRASLTKVDEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRY
DYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELL
QKPNARVVVLFMRSDDSRELIAAANRVNASFTWVASDGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSLNPYN
NHRNPWFRDFWEQKFQCSLQNKRNHRQVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCDAMKI
LDGKKLYKEYLLKINFTAPFNPNKGADSIVKFDTFGDGMGRYNVFNLQQTGGKYSYLKVGHWAETLSLDVDSIHWSRNSV
PTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFTCMDCGPGQWPTADLSGCYNLPEDYIKWEDA
;
_struct_ref.pdbx_align_begin           25 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2E4Y A 1 ? 551 ? P31422 25 ? 575 ? 25 575 
2 1 2E4Y B 1 ? 551 ? P31422 25 ? 575 ? 25 575 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2E4Y GLN A 390 ? UNP P31422 ASN 414 'engineered mutation' 414 1  
1 2E4Y GLN A 415 ? UNP P31422 ASN 439 'engineered mutation' 439 2  
1 2E4Y LEU A 552 ? UNP P31422 ?   ?   'cloning artifact'    576 3  
1 2E4Y VAL A 553 ? UNP P31422 ?   ?   'cloning artifact'    577 4  
1 2E4Y PRO A 554 ? UNP P31422 ?   ?   'cloning artifact'    578 5  
1 2E4Y ARG A 555 ? UNP P31422 ?   ?   'cloning artifact'    579 6  
2 2E4Y GLN B 390 ? UNP P31422 ASN 414 'engineered mutation' 414 7  
2 2E4Y GLN B 415 ? UNP P31422 ASN 439 'engineered mutation' 439 8  
2 2E4Y LEU B 552 ? UNP P31422 ?   ?   'cloning artifact'    576 9  
2 2E4Y VAL B 553 ? UNP P31422 ?   ?   'cloning artifact'    577 10 
2 2E4Y PRO B 554 ? UNP P31422 ?   ?   'cloning artifact'    578 11 
2 2E4Y ARG B 555 ? UNP P31422 ?   ?   'cloning artifact'    579 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
52A non-polymer                  . '(2R,4R)-4-aminopyrrolidine-2,4-dicarboxylic acid' 2R,4R-APDC 'C6 H10 N2 O4'   174.155 
ALA 'L-peptide linking'          y ALANINE                                            ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                           ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                    ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                           ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                          ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                            ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                          ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking'          y ISOLEUCINE                                         ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                             ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                         ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose           
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                                      ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                            ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                             ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                          ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                         ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                             ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2E4Y 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.46 
_exptl_crystal.density_percent_sol   64.48 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5 
_exptl_crystal_grow.pdbx_details    '0.2M NH4H2PO4, 2.5-5.0% PEG 6000, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2004-12-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    SI 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     2E4Y 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            3.4 
_reflns.d_resolution_low             100 
_reflns.number_all                   23883 
_reflns.number_obs                   23883 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.089 
_reflns.pdbx_Rsym_value              0.076 
_reflns.pdbx_netI_over_sigmaI        5.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.4 
_reflns_shell.d_res_low              3.58 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.5 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.4 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2E4Y 
_refine.ls_d_res_high                            3.4 
_refine.ls_d_res_low                             12 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.ls_number_reflns_all                     23280 
_refine.ls_number_reflns_obs                     23280 
_refine.ls_number_reflns_R_free                  1607 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_all                          0.2282 
_refine.ls_R_factor_obs                          0.2282 
_refine.ls_R_factor_R_work                       0.2244 
_refine.ls_R_factor_R_free                       0.2836 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 2E4U' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7785 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         38 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               7823 
_refine_hist.d_res_high                       3.4 
_refine_hist.d_res_low                        12 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.008729 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.44132  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       3.40 
_refine_ls_shell.d_res_low                        3.52 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.3612 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3864 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2E4Y 
_struct.title                     
'Crystal structure of the extracellular region of the group II metabotropic glutamate receptor complexed with 2R,4R-APDC' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2E4Y 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'G-protein-coupled receptor, neuron, central nerve system, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The asymmetric unit contains one biological homodimer.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 41  ? ASP A 58  ? GLY A 65  ASP A 82  1 ? 18 
HELX_P HELX_P2  2  ARG A 77  ? ALA A 91  ? ARG A 101 ALA A 115 1 ? 15 
HELX_P HELX_P3  3  TYR A 126 ? ARG A 138 ? TYR A 150 ARG A 162 1 ? 13 
HELX_P HELX_P4  4  LEU A 139 ? GLN A 141 ? LEU A 163 GLN A 165 5 ? 3  
HELX_P HELX_P5  5  SER A 151 ? ASP A 156 ? SER A 175 ASP A 180 5 ? 6  
HELX_P HELX_P6  6  ASP A 170 ? ARG A 182 ? ASP A 194 ARG A 206 1 ? 13 
HELX_P HELX_P7  7  PHE A 183 ? ASN A 185 ? PHE A 207 ASN A 209 5 ? 3  
HELX_P HELX_P8  8  GLY A 196 ? ARG A 213 ? GLY A 220 ARG A 237 1 ? 18 
HELX_P HELX_P9  9  ILE A 228 ? GLN A 241 ? ILE A 252 GLN A 265 1 ? 14 
HELX_P HELX_P10 10 ARG A 253 ? VAL A 267 ? ARG A 277 VAL A 291 1 ? 15 
HELX_P HELX_P11 11 VAL A 306 ? SER A 315 ? VAL A 330 SER A 339 1 ? 10 
HELX_P HELX_P12 12 TRP A 326 ? GLN A 336 ? TRP A 350 GLN A 360 1 ? 11 
HELX_P HELX_P13 13 LYS A 365 ? CYS A 388 ? LYS A 389 CYS A 412 1 ? 24 
HELX_P HELX_P14 14 ASP A 402 ? LYS A 408 ? ASP A 426 LYS A 432 1 ? 7  
HELX_P HELX_P15 15 TRP A 475 ? SER A 479 ? TRP A 499 SER A 503 5 ? 5  
HELX_P HELX_P16 16 GLY B 41  ? ASP B 58  ? GLY B 65  ASP B 82  1 ? 18 
HELX_P HELX_P17 17 ARG B 77  ? ALA B 91  ? ARG B 101 ALA B 115 1 ? 15 
HELX_P HELX_P18 18 TYR B 126 ? ARG B 138 ? TYR B 150 ARG B 162 1 ? 13 
HELX_P HELX_P19 19 LEU B 139 ? GLN B 141 ? LEU B 163 GLN B 165 5 ? 3  
HELX_P HELX_P20 20 SER B 151 ? ASP B 156 ? SER B 175 ASP B 180 5 ? 6  
HELX_P HELX_P21 21 ASP B 170 ? ARG B 182 ? ASP B 194 ARG B 206 1 ? 13 
HELX_P HELX_P22 22 PHE B 183 ? ASN B 185 ? PHE B 207 ASN B 209 5 ? 3  
HELX_P HELX_P23 23 GLY B 196 ? LEU B 212 ? GLY B 220 LEU B 236 1 ? 17 
HELX_P HELX_P24 24 ILE B 228 ? GLN B 241 ? ILE B 252 GLN B 265 1 ? 14 
HELX_P HELX_P25 25 ARG B 253 ? VAL B 267 ? ARG B 277 VAL B 291 1 ? 15 
HELX_P HELX_P26 26 VAL B 306 ? SER B 315 ? VAL B 330 SER B 339 1 ? 10 
HELX_P HELX_P27 27 TRP B 326 ? PHE B 335 ? TRP B 350 PHE B 359 1 ? 10 
HELX_P HELX_P28 28 LYS B 365 ? CYS B 388 ? LYS B 389 CYS B 412 1 ? 24 
HELX_P HELX_P29 29 ASP B 402 ? LYS B 408 ? ASP B 426 LYS B 432 1 ? 7  
HELX_P HELX_P30 30 TRP B 475 ? SER B 479 ? TRP B 499 SER B 503 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?   ? A CYS 33  SG  ? ? ? 1_555 A CYS 75  SG ? ? A CYS 57  A CYS 99  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf2  disulf ?   ? A CYS 216 SG  ? ? ? 1_555 A CYS 503 SG ? ? A CYS 240 A CYS 527 1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf3  disulf ?   ? A CYS 337 SG  ? ? ? 1_555 A CYS 349 SG ? ? A CYS 361 A CYS 373 1_555 ? ? ? ? ? ? ? 2.010 ? ?               
disulf4  disulf ?   ? A CYS 388 SG  ? ? ? 1_555 A CYS 395 SG ? ? A CYS 412 A CYS 419 1_555 ? ? ? ? ? ? ? 2.005 ? ?               
disulf5  disulf ?   ? A CYS 485 SG  ? ? ? 1_555 A CYS 504 SG ? ? A CYS 509 A CYS 528 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf6  disulf ?   ? A CYS 489 SG  ? ? ? 1_555 A CYS 507 SG ? ? A CYS 513 A CYS 531 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf7  disulf ?   ? A CYS 510 SG  ? ? ? 1_555 A CYS 522 SG ? ? A CYS 534 A CYS 546 1_555 ? ? ? ? ? ? ? 2.018 ? ?               
disulf8  disulf ?   ? A CYS 525 SG  ? ? ? 1_555 A CYS 538 SG ? ? A CYS 549 A CYS 562 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf9  disulf ?   ? B CYS 33  SG  ? ? ? 1_555 B CYS 75  SG ? ? B CYS 57  B CYS 99  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf10 disulf ?   ? B CYS 337 SG  ? ? ? 1_555 B CYS 349 SG ? ? B CYS 361 B CYS 373 1_555 ? ? ? ? ? ? ? 2.019 ? ?               
disulf11 disulf ?   ? B CYS 388 SG  ? ? ? 1_555 B CYS 395 SG ? ? B CYS 412 B CYS 419 1_555 ? ? ? ? ? ? ? 2.007 ? ?               
covale1  covale one ? A ASN 185 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 209 A NAG 801 1_555 ? ? ? ? ? ? ? 1.455 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 7 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 6 ? 
H ? 2 ? 
I ? 7 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
H 1 2 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
I 5 6 ? anti-parallel 
I 6 7 ? anti-parallel 
J 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 8   ? ILE A 11  ? GLU A 32  ILE A 35  
A 2 LEU A 67  ? ASP A 73  ? LEU A 91  ASP A 97  
A 3 LEU A 15  ? PHE A 21  ? LEU A 39  PHE A 45  
A 4 ILE A 118 ? GLY A 123 ? ILE A 142 GLY A 147 
A 5 GLN A 144 ? SER A 146 ? GLN A 168 SER A 170 
A 6 PHE A 163 ? ARG A 165 ? PHE A 187 ARG A 189 
B 1 ASN A 24  ? LYS A 26  ? ASN A 48  LYS A 50  
B 2 CYS A 33  ? ILE A 36  ? CYS A 57  ILE A 60  
C 1 CYS A 216 ? GLU A 221 ? CYS A 240 GLU A 245 
C 2 TYR A 188 ? ALA A 193 ? TYR A 212 ALA A 217 
C 3 VAL A 247 ? PHE A 251 ? VAL A 271 PHE A 275 
C 4 THR A 272 ? ALA A 275 ? THR A 296 ALA A 299 
C 5 ILE A 297 ? LEU A 301 ? ILE A 321 LEU A 325 
C 6 TYR A 442 ? GLN A 449 ? TYR A 466 GLN A 473 
C 7 TYR A 454 ? TRP A 462 ? TYR A 478 TRP A 486 
D 1 ILE A 414 ? PHE A 416 ? ILE A 438 PHE A 440 
D 2 ILE A 429 ? LYS A 431 ? ILE A 453 LYS A 455 
E 1 LYS A 495 ? MET A 497 ? LYS A 519 MET A 521 
E 2 ILE A 506 ? ILE A 508 ? ILE A 530 ILE A 532 
F 1 GLU A 514 ? TYR A 515 ? GLU A 538 TYR A 539 
F 2 MET A 523 ? ASP A 524 ? MET A 547 ASP A 548 
G 1 GLU B 8   ? ILE B 11  ? GLU B 32  ILE B 35  
G 2 LEU B 67  ? ASP B 73  ? LEU B 91  ASP B 97  
G 3 LEU B 15  ? PHE B 21  ? LEU B 39  PHE B 45  
G 4 ILE B 118 ? GLY B 123 ? ILE B 142 GLY B 147 
G 5 GLN B 144 ? SER B 146 ? GLN B 168 SER B 170 
G 6 PHE B 163 ? ARG B 165 ? PHE B 187 ARG B 189 
H 1 ASN B 24  ? LYS B 26  ? ASN B 48  LYS B 50  
H 2 CYS B 33  ? ILE B 36  ? CYS B 57  ILE B 60  
I 1 CYS B 216 ? GLU B 221 ? CYS B 240 GLU B 245 
I 2 TYR B 188 ? ALA B 193 ? TYR B 212 ALA B 217 
I 3 VAL B 247 ? PHE B 251 ? VAL B 271 PHE B 275 
I 4 THR B 272 ? ALA B 275 ? THR B 296 ALA B 299 
I 5 ILE B 297 ? LEU B 301 ? ILE B 321 LEU B 325 
I 6 TYR B 442 ? GLN B 449 ? TYR B 466 GLN B 473 
I 7 TYR B 454 ? TRP B 462 ? TYR B 478 TRP B 486 
J 1 ILE B 414 ? PHE B 416 ? ILE B 438 PHE B 440 
J 2 ILE B 429 ? LYS B 431 ? ILE B 453 LYS B 455 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 11  ? N ILE A 35  O VAL A 69  ? O VAL A 93  
A 2 3 O GLY A 68  ? O GLY A 92  N LEU A 15  ? N LEU A 39  
A 3 4 N VAL A 16  ? N VAL A 40  O ALA A 119 ? O ALA A 143 
A 4 5 N VAL A 121 ? N VAL A 145 O ILE A 145 ? O ILE A 169 
A 5 6 N SER A 146 ? N SER A 170 O ALA A 164 ? O ALA A 188 
B 1 2 N GLU A 25  ? N GLU A 49  O ARG A 35  ? O ARG A 59  
C 1 2 O GLU A 221 ? O GLU A 245 N THR A 191 ? N THR A 215 
C 2 3 N SER A 190 ? N SER A 214 O VAL A 249 ? O VAL A 273 
C 3 4 N LEU A 250 ? N LEU A 274 O VAL A 274 ? O VAL A 298 
C 4 5 N TRP A 273 ? N TRP A 297 O ILE A 297 ? O ILE A 321 
C 5 6 N GLU A 300 ? N GLU A 324 O ASN A 443 ? O ASN A 467 
C 6 7 N TYR A 442 ? N TYR A 466 O TRP A 462 ? O TRP A 486 
D 1 2 N GLN A 415 ? N GLN A 439 O VAL A 430 ? O VAL A 454 
E 1 2 N MET A 497 ? N MET A 521 O ILE A 506 ? O ILE A 530 
F 1 2 N TYR A 515 ? N TYR A 539 O MET A 523 ? O MET A 547 
G 1 2 N ILE B 11  ? N ILE B 35  O VAL B 69  ? O VAL B 93  
G 2 3 O LEU B 72  ? O LEU B 96  N GLY B 19  ? N GLY B 43  
G 3 4 N VAL B 16  ? N VAL B 40  O ALA B 119 ? O ALA B 143 
G 4 5 N GLY B 123 ? N GLY B 147 O ILE B 145 ? O ILE B 169 
G 5 6 N SER B 146 ? N SER B 170 O ALA B 164 ? O ALA B 188 
H 1 2 N GLU B 25  ? N GLU B 49  O ARG B 35  ? O ARG B 59  
I 1 2 O GLU B 221 ? O GLU B 245 N THR B 191 ? N THR B 215 
I 2 3 N SER B 190 ? N SER B 214 O VAL B 249 ? O VAL B 273 
I 3 4 N LEU B 250 ? N LEU B 274 O VAL B 274 ? O VAL B 298 
I 4 5 N TRP B 273 ? N TRP B 297 O ILE B 297 ? O ILE B 321 
I 5 6 N GLU B 300 ? N GLU B 324 O ASN B 443 ? O ASN B 467 
I 6 7 N TYR B 442 ? N TYR B 466 O TRP B 462 ? O TRP B 486 
J 1 2 N GLN B 415 ? N GLN B 439 O VAL B 430 ? O VAL B 454 
# 
_database_PDB_matrix.entry_id          2E4Y 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2E4Y 
_atom_sites.fract_transf_matrix[1][1]   0.011849 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000472 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010893 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008859 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 6   ? 44.525  14.540  45.549  1.00 123.13 ? 30   ARG A N   1 
ATOM   2    C CA  . ARG A 1 6   ? 43.739  13.626  44.661  1.00 123.13 ? 30   ARG A CA  1 
ATOM   3    C C   . ARG A 1 6   ? 44.152  12.162  44.823  1.00 123.13 ? 30   ARG A C   1 
ATOM   4    O O   . ARG A 1 6   ? 45.102  11.692  44.193  1.00 123.13 ? 30   ARG A O   1 
ATOM   5    C CB  . ARG A 1 6   ? 43.905  14.035  43.195  1.00 166.70 ? 30   ARG A CB  1 
ATOM   6    C CG  . ARG A 1 6   ? 43.157  13.134  42.222  1.00 166.70 ? 30   ARG A CG  1 
ATOM   7    C CD  . ARG A 1 6   ? 41.648  13.243  42.407  1.00 166.70 ? 30   ARG A CD  1 
ATOM   8    N NE  . ARG A 1 6   ? 40.919  12.262  41.602  1.00 166.70 ? 30   ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 6   ? 40.970  12.183  40.275  1.00 166.70 ? 30   ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 6   ? 41.720  13.029  39.582  1.00 166.70 ? 30   ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 6   ? 40.270  11.255  39.637  1.00 166.70 ? 30   ARG A NH2 1 
ATOM   12   N N   . ARG A 1 7   ? 43.415  11.448  45.666  1.00 93.02  ? 31   ARG A N   1 
ATOM   13   C CA  . ARG A 1 7   ? 43.680  10.043  45.941  1.00 93.02  ? 31   ARG A CA  1 
ATOM   14   C C   . ARG A 1 7   ? 42.592  9.104   45.421  1.00 93.02  ? 31   ARG A C   1 
ATOM   15   O O   . ARG A 1 7   ? 41.401  9.313   45.629  1.00 93.02  ? 31   ARG A O   1 
ATOM   16   C CB  . ARG A 1 7   ? 43.852  9.847   47.448  1.00 78.45  ? 31   ARG A CB  1 
ATOM   17   C CG  . ARG A 1 7   ? 45.073  10.529  47.993  1.00 78.45  ? 31   ARG A CG  1 
ATOM   18   C CD  . ARG A 1 7   ? 45.257  10.269  49.458  1.00 78.45  ? 31   ARG A CD  1 
ATOM   19   N NE  . ARG A 1 7   ? 44.382  11.105  50.256  1.00 78.45  ? 31   ARG A NE  1 
ATOM   20   C CZ  . ARG A 1 7   ? 44.468  11.212  51.580  1.00 78.45  ? 31   ARG A CZ  1 
ATOM   21   N NH1 . ARG A 1 7   ? 45.396  10.515  52.238  1.00 78.45  ? 31   ARG A NH1 1 
ATOM   22   N NH2 . ARG A 1 7   ? 43.647  12.035  52.244  1.00 78.45  ? 31   ARG A NH2 1 
ATOM   23   N N   . GLU A 1 8   ? 43.017  8.062   44.736  1.00 66.68  ? 32   GLU A N   1 
ATOM   24   C CA  . GLU A 1 8   ? 42.094  7.083   44.210  1.00 66.68  ? 32   GLU A CA  1 
ATOM   25   C C   . GLU A 1 8   ? 42.618  5.694   44.582  1.00 66.68  ? 32   GLU A C   1 
ATOM   26   O O   . GLU A 1 8   ? 43.571  5.583   45.345  1.00 66.68  ? 32   GLU A O   1 
ATOM   27   C CB  . GLU A 1 8   ? 42.008  7.240   42.703  1.00 111.33 ? 32   GLU A CB  1 
ATOM   28   C CG  . GLU A 1 8   ? 43.348  7.367   42.048  1.00 111.33 ? 32   GLU A CG  1 
ATOM   29   C CD  . GLU A 1 8   ? 43.238  7.560   40.555  1.00 111.33 ? 32   GLU A CD  1 
ATOM   30   O OE1 . GLU A 1 8   ? 42.544  8.510   40.119  1.00 111.33 ? 32   GLU A OE1 1 
ATOM   31   O OE2 . GLU A 1 8   ? 43.849  6.758   39.818  1.00 111.33 ? 32   GLU A OE2 1 
ATOM   32   N N   . ILE A 1 9   ? 41.982  4.635   44.099  1.00 75.59  ? 33   ILE A N   1 
ATOM   33   C CA  . ILE A 1 9   ? 42.475  3.293   44.372  1.00 75.59  ? 33   ILE A CA  1 
ATOM   34   C C   . ILE A 1 9   ? 42.394  2.569   43.062  1.00 75.59  ? 33   ILE A C   1 
ATOM   35   O O   . ILE A 1 9   ? 41.337  2.527   42.447  1.00 75.59  ? 33   ILE A O   1 
ATOM   36   C CB  . ILE A 1 9   ? 41.627  2.514   45.369  1.00 49.85  ? 33   ILE A CB  1 
ATOM   37   C CG1 . ILE A 1 9   ? 41.711  3.162   46.759  1.00 49.85  ? 33   ILE A CG1 1 
ATOM   38   C CG2 . ILE A 1 9   ? 42.113  1.070   45.413  1.00 49.85  ? 33   ILE A CG2 1 
ATOM   39   C CD1 . ILE A 1 9   ? 41.100  2.329   47.931  1.00 49.85  ? 33   ILE A CD1 1 
ATOM   40   N N   . LYS A 1 10  ? 43.512  2.018   42.621  1.00 116.97 ? 34   LYS A N   1 
ATOM   41   C CA  . LYS A 1 10  ? 43.530  1.297   41.366  1.00 116.97 ? 34   LYS A CA  1 
ATOM   42   C C   . LYS A 1 10  ? 44.128  -0.080  41.538  1.00 116.97 ? 34   LYS A C   1 
ATOM   43   O O   . LYS A 1 10  ? 45.310  -0.224  41.859  1.00 116.97 ? 34   LYS A O   1 
ATOM   44   C CB  . LYS A 1 10  ? 44.343  2.048   40.321  1.00 106.74 ? 34   LYS A CB  1 
ATOM   45   C CG  . LYS A 1 10  ? 43.675  3.224   39.663  1.00 106.74 ? 34   LYS A CG  1 
ATOM   46   C CD  . LYS A 1 10  ? 44.655  3.780   38.646  1.00 106.74 ? 34   LYS A CD  1 
ATOM   47   C CE  . LYS A 1 10  ? 44.022  4.751   37.670  1.00 106.74 ? 34   LYS A CE  1 
ATOM   48   N NZ  . LYS A 1 10  ? 45.040  5.234   36.686  1.00 106.74 ? 34   LYS A NZ  1 
ATOM   49   N N   . ILE A 1 11  ? 43.297  -1.091  41.337  1.00 70.42  ? 35   ILE A N   1 
ATOM   50   C CA  . ILE A 1 11  ? 43.724  -2.481  41.413  1.00 70.42  ? 35   ILE A CA  1 
ATOM   51   C C   . ILE A 1 11  ? 43.406  -2.972  39.995  1.00 70.42  ? 35   ILE A C   1 
ATOM   52   O O   . ILE A 1 11  ? 42.247  -2.951  39.590  1.00 70.42  ? 35   ILE A O   1 
ATOM   53   C CB  . ILE A 1 11  ? 42.876  -3.273  42.432  1.00 90.10  ? 35   ILE A CB  1 
ATOM   54   C CG1 . ILE A 1 11  ? 42.914  -2.595  43.805  1.00 90.10  ? 35   ILE A CG1 1 
ATOM   55   C CG2 . ILE A 1 11  ? 43.384  -4.704  42.527  1.00 90.10  ? 35   ILE A CG2 1 
ATOM   56   C CD1 . ILE A 1 11  ? 44.200  -2.775  44.551  1.00 90.10  ? 35   ILE A CD1 1 
ATOM   57   N N   . GLU A 1 12  ? 44.403  -3.376  39.213  1.00 93.94  ? 36   GLU A N   1 
ATOM   58   C CA  . GLU A 1 12  ? 44.076  -3.820  37.865  1.00 93.94  ? 36   GLU A CA  1 
ATOM   59   C C   . GLU A 1 12  ? 43.368  -5.174  37.915  1.00 93.94  ? 36   GLU A C   1 
ATOM   60   O O   . GLU A 1 12  ? 43.497  -5.923  38.892  1.00 93.94  ? 36   GLU A O   1 
ATOM   61   C CB  . GLU A 1 12  ? 45.328  -3.931  36.998  1.00 283.15 ? 36   GLU A CB  1 
ATOM   62   C CG  . GLU A 1 12  ? 45.003  -4.257  35.547  1.00 283.15 ? 36   GLU A CG  1 
ATOM   63   C CD  . GLU A 1 12  ? 46.232  -4.548  34.713  1.00 283.15 ? 36   GLU A CD  1 
ATOM   64   O OE1 . GLU A 1 12  ? 46.071  -4.873  33.518  1.00 283.15 ? 36   GLU A OE1 1 
ATOM   65   O OE2 . GLU A 1 12  ? 47.355  -4.453  35.250  1.00 283.15 ? 36   GLU A OE2 1 
ATOM   66   N N   . GLY A 1 13  ? 42.620  -5.479  36.856  1.00 127.04 ? 37   GLY A N   1 
ATOM   67   C CA  . GLY A 1 13  ? 41.896  -6.739  36.775  1.00 127.04 ? 37   GLY A CA  1 
ATOM   68   C C   . GLY A 1 13  ? 41.344  -7.023  35.384  1.00 127.04 ? 37   GLY A C   1 
ATOM   69   O O   . GLY A 1 13  ? 41.371  -6.151  34.507  1.00 127.04 ? 37   GLY A O   1 
ATOM   70   N N   . ASP A 1 14  ? 40.842  -8.243  35.183  1.00 103.02 ? 38   ASP A N   1 
ATOM   71   C CA  . ASP A 1 14  ? 40.282  -8.651  33.898  1.00 103.02 ? 38   ASP A CA  1 
ATOM   72   C C   . ASP A 1 14  ? 38.996  -7.888  33.629  1.00 103.02 ? 38   ASP A C   1 
ATOM   73   O O   . ASP A 1 14  ? 38.579  -7.732  32.488  1.00 103.02 ? 38   ASP A O   1 
ATOM   74   C CB  . ASP A 1 14  ? 39.986  -10.154 33.890  1.00 111.14 ? 38   ASP A CB  1 
ATOM   75   C CG  . ASP A 1 14  ? 41.234  -11.002 34.020  1.00 111.14 ? 38   ASP A CG  1 
ATOM   76   O OD1 . ASP A 1 14  ? 41.880  -10.935 35.081  1.00 111.14 ? 38   ASP A OD1 1 
ATOM   77   O OD2 . ASP A 1 14  ? 41.567  -11.737 33.065  1.00 111.14 ? 38   ASP A OD2 1 
ATOM   78   N N   . LEU A 1 15  ? 38.376  -7.417  34.700  1.00 65.30  ? 39   LEU A N   1 
ATOM   79   C CA  . LEU A 1 15  ? 37.129  -6.668  34.636  1.00 65.30  ? 39   LEU A CA  1 
ATOM   80   C C   . LEU A 1 15  ? 37.169  -5.740  35.842  1.00 65.30  ? 39   LEU A C   1 
ATOM   81   O O   . LEU A 1 15  ? 37.559  -6.172  36.942  1.00 65.30  ? 39   LEU A O   1 
ATOM   82   C CB  . LEU A 1 15  ? 35.966  -7.635  34.773  1.00 62.47  ? 39   LEU A CB  1 
ATOM   83   C CG  . LEU A 1 15  ? 34.933  -7.695  33.660  1.00 62.47  ? 39   LEU A CG  1 
ATOM   84   C CD1 . LEU A 1 15  ? 35.612  -7.988  32.346  1.00 62.47  ? 39   LEU A CD1 1 
ATOM   85   C CD2 . LEU A 1 15  ? 33.912  -8.769  33.982  1.00 62.47  ? 39   LEU A CD2 1 
ATOM   86   N N   . VAL A 1 16  ? 36.771  -4.481  35.669  1.00 88.42  ? 40   VAL A N   1 
ATOM   87   C CA  . VAL A 1 16  ? 36.833  -3.566  36.804  1.00 88.42  ? 40   VAL A CA  1 
ATOM   88   C C   . VAL A 1 16  ? 35.542  -2.920  37.233  1.00 88.42  ? 40   VAL A C   1 
ATOM   89   O O   . VAL A 1 16  ? 34.667  -2.629  36.421  1.00 88.42  ? 40   VAL A O   1 
ATOM   90   C CB  . VAL A 1 16  ? 37.845  -2.448  36.569  1.00 79.96  ? 40   VAL A CB  1 
ATOM   91   C CG1 . VAL A 1 16  ? 38.022  -1.626  37.828  1.00 79.96  ? 40   VAL A CG1 1 
ATOM   92   C CG2 . VAL A 1 16  ? 39.157  -3.037  36.177  1.00 79.96  ? 40   VAL A CG2 1 
ATOM   93   N N   . LEU A 1 17  ? 35.456  -2.679  38.534  1.00 56.27  ? 41   LEU A N   1 
ATOM   94   C CA  . LEU A 1 17  ? 34.287  -2.064  39.127  1.00 56.27  ? 41   LEU A CA  1 
ATOM   95   C C   . LEU A 1 17  ? 34.645  -0.727  39.717  1.00 56.27  ? 41   LEU A C   1 
ATOM   96   O O   . LEU A 1 17  ? 35.625  -0.619  40.456  1.00 56.27  ? 41   LEU A O   1 
ATOM   97   C CB  . LEU A 1 17  ? 33.735  -2.942  40.254  1.00 66.60  ? 41   LEU A CB  1 
ATOM   98   C CG  . LEU A 1 17  ? 33.204  -4.309  39.850  1.00 66.60  ? 41   LEU A CG  1 
ATOM   99   C CD1 . LEU A 1 17  ? 32.968  -5.178  41.062  1.00 66.60  ? 41   LEU A CD1 1 
ATOM   100  C CD2 . LEU A 1 17  ? 31.941  -4.098  39.052  1.00 66.60  ? 41   LEU A CD2 1 
ATOM   101  N N   . GLY A 1 18  ? 33.844  0.286   39.401  1.00 68.35  ? 42   GLY A N   1 
ATOM   102  C CA  . GLY A 1 18  ? 34.080  1.596   39.970  1.00 68.35  ? 42   GLY A CA  1 
ATOM   103  C C   . GLY A 1 18  ? 33.618  1.585   41.420  1.00 68.35  ? 42   GLY A C   1 
ATOM   104  O O   . GLY A 1 18  ? 32.902  0.678   41.847  1.00 68.35  ? 42   GLY A O   1 
ATOM   105  N N   . GLY A 1 19  ? 34.028  2.581   42.191  1.00 73.69  ? 43   GLY A N   1 
ATOM   106  C CA  . GLY A 1 19  ? 33.615  2.631   43.578  1.00 73.69  ? 43   GLY A CA  1 
ATOM   107  C C   . GLY A 1 19  ? 33.488  4.060   44.051  1.00 73.69  ? 43   GLY A C   1 
ATOM   108  O O   . GLY A 1 19  ? 34.382  4.865   43.813  1.00 73.69  ? 43   GLY A O   1 
ATOM   109  N N   . LEU A 1 20  ? 32.374  4.381   44.702  1.00 51.55  ? 44   LEU A N   1 
ATOM   110  C CA  . LEU A 1 20  ? 32.145  5.723   45.224  1.00 51.55  ? 44   LEU A CA  1 
ATOM   111  C C   . LEU A 1 20  ? 31.789  5.626   46.694  1.00 51.55  ? 44   LEU A C   1 
ATOM   112  O O   . LEU A 1 20  ? 30.845  4.938   47.065  1.00 51.55  ? 44   LEU A O   1 
ATOM   113  C CB  . LEU A 1 20  ? 31.006  6.414   44.478  1.00 46.15  ? 44   LEU A CB  1 
ATOM   114  C CG  . LEU A 1 20  ? 31.267  6.745   43.015  1.00 46.15  ? 44   LEU A CG  1 
ATOM   115  C CD1 . LEU A 1 20  ? 30.084  7.492   42.445  1.00 46.15  ? 44   LEU A CD1 1 
ATOM   116  C CD2 . LEU A 1 20  ? 32.517  7.603   42.894  1.00 46.15  ? 44   LEU A CD2 1 
ATOM   117  N N   . PHE A 1 21  ? 32.562  6.289   47.542  1.00 51.12  ? 45   PHE A N   1 
ATOM   118  C CA  . PHE A 1 21  ? 32.291  6.280   48.971  1.00 51.12  ? 45   PHE A CA  1 
ATOM   119  C C   . PHE A 1 21  ? 32.604  7.625   49.592  1.00 51.12  ? 45   PHE A C   1 
ATOM   120  O O   . PHE A 1 21  ? 33.603  8.261   49.267  1.00 51.12  ? 45   PHE A O   1 
ATOM   121  C CB  . PHE A 1 21  ? 33.134  5.242   49.676  1.00 61.59  ? 45   PHE A CB  1 
ATOM   122  C CG  . PHE A 1 21  ? 32.895  3.854   49.210  1.00 61.59  ? 45   PHE A CG  1 
ATOM   123  C CD1 . PHE A 1 21  ? 33.323  3.444   47.957  1.00 61.59  ? 45   PHE A CD1 1 
ATOM   124  C CD2 . PHE A 1 21  ? 32.256  2.944   50.023  1.00 61.59  ? 45   PHE A CD2 1 
ATOM   125  C CE1 . PHE A 1 21  ? 33.120  2.139   47.522  1.00 61.59  ? 45   PHE A CE1 1 
ATOM   126  C CE2 . PHE A 1 21  ? 32.051  1.639   49.597  1.00 61.59  ? 45   PHE A CE2 1 
ATOM   127  C CZ  . PHE A 1 21  ? 32.482  1.235   48.345  1.00 61.59  ? 45   PHE A CZ  1 
ATOM   128  N N   . PRO A 1 22  ? 31.739  8.084   50.491  1.00 53.87  ? 46   PRO A N   1 
ATOM   129  C CA  . PRO A 1 22  ? 31.898  9.355   51.194  1.00 53.87  ? 46   PRO A CA  1 
ATOM   130  C C   . PRO A 1 22  ? 33.013  9.168   52.228  1.00 53.87  ? 46   PRO A C   1 
ATOM   131  O O   . PRO A 1 22  ? 32.792  9.240   53.440  1.00 53.87  ? 46   PRO A O   1 
ATOM   132  C CB  . PRO A 1 22  ? 30.536  9.531   51.850  1.00 39.16  ? 46   PRO A CB  1 
ATOM   133  C CG  . PRO A 1 22  ? 30.157  8.143   52.179  1.00 39.16  ? 46   PRO A CG  1 
ATOM   134  C CD  . PRO A 1 22  ? 30.479  7.435   50.881  1.00 39.16  ? 46   PRO A CD  1 
ATOM   135  N N   . ILE A 1 23  ? 34.213  8.901   51.744  1.00 48.68  ? 47   ILE A N   1 
ATOM   136  C CA  . ILE A 1 23  ? 35.323  8.671   52.640  1.00 48.68  ? 47   ILE A CA  1 
ATOM   137  C C   . ILE A 1 23  ? 35.594  9.904   53.480  1.00 48.68  ? 47   ILE A C   1 
ATOM   138  O O   . ILE A 1 23  ? 35.891  9.786   54.663  1.00 48.68  ? 47   ILE A O   1 
ATOM   139  C CB  . ILE A 1 23  ? 36.574  8.238   51.861  1.00 46.21  ? 47   ILE A CB  1 
ATOM   140  C CG1 . ILE A 1 23  ? 36.245  7.006   51.018  1.00 46.21  ? 47   ILE A CG1 1 
ATOM   141  C CG2 . ILE A 1 23  ? 37.693  7.884   52.817  1.00 46.21  ? 47   ILE A CG2 1 
ATOM   142  C CD1 . ILE A 1 23  ? 37.330  6.628   50.109  1.00 46.21  ? 47   ILE A CD1 1 
ATOM   143  N N   . ASN A 1 24  ? 35.479  11.090  52.893  1.00 62.48  ? 48   ASN A N   1 
ATOM   144  C CA  . ASN A 1 24  ? 35.689  12.318  53.660  1.00 62.48  ? 48   ASN A CA  1 
ATOM   145  C C   . ASN A 1 24  ? 34.409  13.116  53.789  1.00 62.48  ? 48   ASN A C   1 
ATOM   146  O O   . ASN A 1 24  ? 33.594  13.162  52.868  1.00 62.48  ? 48   ASN A O   1 
ATOM   147  C CB  . ASN A 1 24  ? 36.753  13.185  53.015  1.00 87.62  ? 48   ASN A CB  1 
ATOM   148  C CG  . ASN A 1 24  ? 38.142  12.748  53.378  1.00 87.62  ? 48   ASN A CG  1 
ATOM   149  O OD1 . ASN A 1 24  ? 38.511  12.741  54.555  1.00 87.62  ? 48   ASN A OD1 1 
ATOM   150  N ND2 . ASN A 1 24  ? 38.931  12.380  52.372  1.00 87.62  ? 48   ASN A ND2 1 
ATOM   151  N N   . GLU A 1 25  ? 34.233  13.751  54.937  1.00 60.31  ? 49   GLU A N   1 
ATOM   152  C CA  . GLU A 1 25  ? 33.035  14.536  55.166  1.00 60.31  ? 49   GLU A CA  1 
ATOM   153  C C   . GLU A 1 25  ? 33.064  15.741  54.236  1.00 60.31  ? 49   GLU A C   1 
ATOM   154  O O   . GLU A 1 25  ? 34.107  16.072  53.691  1.00 60.31  ? 49   GLU A O   1 
ATOM   155  C CB  . GLU A 1 25  ? 32.967  14.984  56.626  1.00 128.73 ? 49   GLU A CB  1 
ATOM   156  C CG  . GLU A 1 25  ? 31.547  15.097  57.167  1.00 128.73 ? 49   GLU A CG  1 
ATOM   157  C CD  . GLU A 1 25  ? 30.858  13.741  57.344  1.00 128.73 ? 49   GLU A CD  1 
ATOM   158  O OE1 . GLU A 1 25  ? 31.380  12.908  58.127  1.00 128.73 ? 49   GLU A OE1 1 
ATOM   159  O OE2 . GLU A 1 25  ? 29.796  13.515  56.709  1.00 128.73 ? 49   GLU A OE2 1 
ATOM   160  N N   . LYS A 1 26  ? 31.920  16.382  54.028  1.00 99.24  ? 50   LYS A N   1 
ATOM   161  C CA  . LYS A 1 26  ? 31.858  17.559  53.167  1.00 99.24  ? 50   LYS A CA  1 
ATOM   162  C C   . LYS A 1 26  ? 32.731  18.634  53.823  1.00 99.24  ? 50   LYS A C   1 
ATOM   163  O O   . LYS A 1 26  ? 32.490  19.019  54.965  1.00 99.24  ? 50   LYS A O   1 
ATOM   164  C CB  . LYS A 1 26  ? 30.409  18.044  53.075  1.00 182.00 ? 50   LYS A CB  1 
ATOM   165  C CG  . LYS A 1 26  ? 30.182  19.217  52.139  1.00 182.00 ? 50   LYS A CG  1 
ATOM   166  C CD  . LYS A 1 26  ? 28.811  19.856  52.368  1.00 182.00 ? 50   LYS A CD  1 
ATOM   167  C CE  . LYS A 1 26  ? 28.728  20.537  53.741  1.00 182.00 ? 50   LYS A CE  1 
ATOM   168  N NZ  . LYS A 1 26  ? 27.408  21.193  54.004  1.00 182.00 ? 50   LYS A NZ  1 
ATOM   169  N N   . GLY A 1 27  ? 33.752  19.111  53.123  1.00 115.17 ? 51   GLY A N   1 
ATOM   170  C CA  . GLY A 1 27  ? 34.609  20.132  53.707  1.00 115.17 ? 51   GLY A CA  1 
ATOM   171  C C   . GLY A 1 27  ? 33.958  21.510  53.741  1.00 115.17 ? 51   GLY A C   1 
ATOM   172  O O   . GLY A 1 27  ? 33.208  21.859  52.827  1.00 115.17 ? 51   GLY A O   1 
ATOM   173  N N   . THR A 1 28  ? 34.236  22.297  54.783  1.00 99.64  ? 52   THR A N   1 
ATOM   174  C CA  . THR A 1 28  ? 33.663  23.640  54.909  1.00 99.64  ? 52   THR A CA  1 
ATOM   175  C C   . THR A 1 28  ? 34.586  24.696  54.325  1.00 99.64  ? 52   THR A C   1 
ATOM   176  O O   . THR A 1 28  ? 35.810  24.553  54.357  1.00 99.64  ? 52   THR A O   1 
ATOM   177  C CB  . THR A 1 28  ? 33.390  24.024  56.374  1.00 132.00 ? 52   THR A CB  1 
ATOM   178  O OG1 . THR A 1 28  ? 34.588  23.848  57.140  1.00 132.00 ? 52   THR A OG1 1 
ATOM   179  C CG2 . THR A 1 28  ? 32.265  23.176  56.954  1.00 132.00 ? 52   THR A CG2 1 
ATOM   180  N N   . GLY A 1 29  ? 33.986  25.760  53.801  1.00 144.26 ? 53   GLY A N   1 
ATOM   181  C CA  . GLY A 1 29  ? 34.761  26.829  53.209  1.00 144.26 ? 53   GLY A CA  1 
ATOM   182  C C   . GLY A 1 29  ? 35.105  26.514  51.770  1.00 144.26 ? 53   GLY A C   1 
ATOM   183  O O   . GLY A 1 29  ? 34.410  25.734  51.114  1.00 144.26 ? 53   GLY A O   1 
ATOM   184  N N   . THR A 1 30  ? 36.183  27.121  51.281  1.00 265.96 ? 54   THR A N   1 
ATOM   185  C CA  . THR A 1 30  ? 36.634  26.913  49.911  1.00 265.96 ? 54   THR A CA  1 
ATOM   186  C C   . THR A 1 30  ? 37.014  25.457  49.667  1.00 265.96 ? 54   THR A C   1 
ATOM   187  O O   . THR A 1 30  ? 36.806  24.931  48.572  1.00 265.96 ? 54   THR A O   1 
ATOM   188  C CB  . THR A 1 30  ? 37.844  27.806  49.587  1.00 192.12 ? 54   THR A CB  1 
ATOM   189  O OG1 . THR A 1 30  ? 38.856  27.616  50.584  1.00 192.12 ? 54   THR A OG1 1 
ATOM   190  C CG2 . THR A 1 30  ? 37.429  29.271  49.550  1.00 192.12 ? 54   THR A CG2 1 
ATOM   191  N N   . GLU A 1 31  ? 37.574  24.810  50.689  1.00 198.50 ? 55   GLU A N   1 
ATOM   192  C CA  . GLU A 1 31  ? 37.971  23.409  50.579  1.00 198.50 ? 55   GLU A CA  1 
ATOM   193  C C   . GLU A 1 31  ? 36.743  22.535  50.341  1.00 198.50 ? 55   GLU A C   1 
ATOM   194  O O   . GLU A 1 31  ? 35.608  22.973  50.553  1.00 198.50 ? 55   GLU A O   1 
ATOM   195  C CB  . GLU A 1 31  ? 38.699  22.958  51.848  1.00 191.93 ? 55   GLU A CB  1 
ATOM   196  C CG  . GLU A 1 31  ? 37.974  23.303  53.133  1.00 191.93 ? 55   GLU A CG  1 
ATOM   197  C CD  . GLU A 1 31  ? 38.680  22.768  54.362  1.00 191.93 ? 55   GLU A CD  1 
ATOM   198  O OE1 . GLU A 1 31  ? 39.907  22.972  54.479  1.00 191.93 ? 55   GLU A OE1 1 
ATOM   199  O OE2 . GLU A 1 31  ? 38.007  22.150  55.216  1.00 191.93 ? 55   GLU A OE2 1 
ATOM   200  N N   . GLU A 1 32  ? 36.972  21.298  49.907  1.00 137.88 ? 56   GLU A N   1 
ATOM   201  C CA  . GLU A 1 32  ? 35.878  20.383  49.614  1.00 137.88 ? 56   GLU A CA  1 
ATOM   202  C C   . GLU A 1 32  ? 35.797  19.174  50.523  1.00 137.88 ? 56   GLU A C   1 
ATOM   203  O O   . GLU A 1 32  ? 34.701  18.738  50.868  1.00 137.88 ? 56   GLU A O   1 
ATOM   204  C CB  . GLU A 1 32  ? 35.977  19.912  48.169  1.00 160.69 ? 56   GLU A CB  1 
ATOM   205  C CG  . GLU A 1 32  ? 35.733  21.003  47.166  1.00 160.69 ? 56   GLU A CG  1 
ATOM   206  C CD  . GLU A 1 32  ? 36.352  20.687  45.835  1.00 160.69 ? 56   GLU A CD  1 
ATOM   207  O OE1 . GLU A 1 32  ? 37.600  20.671  45.751  1.00 160.69 ? 56   GLU A OE1 1 
ATOM   208  O OE2 . GLU A 1 32  ? 35.592  20.447  44.877  1.00 160.69 ? 56   GLU A OE2 1 
ATOM   209  N N   . CYS A 1 33  ? 36.946  18.626  50.911  1.00 62.28  ? 57   CYS A N   1 
ATOM   210  C CA  . CYS A 1 33  ? 36.948  17.448  51.766  1.00 62.28  ? 57   CYS A CA  1 
ATOM   211  C C   . CYS A 1 33  ? 37.377  17.705  53.201  1.00 62.28  ? 57   CYS A C   1 
ATOM   212  O O   . CYS A 1 33  ? 38.518  18.069  53.460  1.00 62.28  ? 57   CYS A O   1 
ATOM   213  C CB  . CYS A 1 33  ? 37.828  16.383  51.131  1.00 136.19 ? 57   CYS A CB  1 
ATOM   214  S SG  . CYS A 1 33  ? 37.457  16.198  49.359  1.00 136.19 ? 57   CYS A SG  1 
ATOM   215  N N   . GLY A 1 34  ? 36.445  17.514  54.129  1.00 66.96  ? 58   GLY A N   1 
ATOM   216  C CA  . GLY A 1 34  ? 36.733  17.705  55.539  1.00 66.96  ? 58   GLY A CA  1 
ATOM   217  C C   . GLY A 1 34  ? 37.334  16.482  56.243  1.00 66.96  ? 58   GLY A C   1 
ATOM   218  O O   . GLY A 1 34  ? 38.210  15.800  55.689  1.00 66.96  ? 58   GLY A O   1 
ATOM   219  N N   . ARG A 1 35  ? 36.870  16.207  57.468  1.00 66.23  ? 59   ARG A N   1 
ATOM   220  C CA  . ARG A 1 35  ? 37.364  15.078  58.241  1.00 66.23  ? 59   ARG A CA  1 
ATOM   221  C C   . ARG A 1 35  ? 36.966  13.731  57.638  1.00 66.23  ? 59   ARG A C   1 
ATOM   222  O O   . ARG A 1 35  ? 36.035  13.647  56.841  1.00 66.23  ? 59   ARG A O   1 
ATOM   223  C CB  . ARG A 1 35  ? 36.894  15.198  59.688  1.00 125.21 ? 59   ARG A CB  1 
ATOM   224  C CG  . ARG A 1 35  ? 37.684  16.248  60.451  1.00 125.21 ? 59   ARG A CG  1 
ATOM   225  C CD  . ARG A 1 35  ? 37.181  16.499  61.873  1.00 125.21 ? 59   ARG A CD  1 
ATOM   226  N NE  . ARG A 1 35  ? 37.209  15.311  62.723  1.00 125.21 ? 59   ARG A NE  1 
ATOM   227  C CZ  . ARG A 1 35  ? 36.307  14.335  62.669  1.00 125.21 ? 59   ARG A CZ  1 
ATOM   228  N NH1 . ARG A 1 35  ? 35.301  14.405  61.804  1.00 125.21 ? 59   ARG A NH1 1 
ATOM   229  N NH2 . ARG A 1 35  ? 36.400  13.290  63.485  1.00 125.21 ? 59   ARG A NH2 1 
ATOM   230  N N   . ILE A 1 36  ? 37.706  12.685  57.995  1.00 58.51  ? 60   ILE A N   1 
ATOM   231  C CA  . ILE A 1 36  ? 37.452  11.352  57.485  1.00 58.51  ? 60   ILE A CA  1 
ATOM   232  C C   . ILE A 1 36  ? 36.147  10.890  58.034  1.00 58.51  ? 60   ILE A C   1 
ATOM   233  O O   . ILE A 1 36  ? 35.880  11.105  59.215  1.00 58.51  ? 60   ILE A O   1 
ATOM   234  C CB  . ILE A 1 36  ? 38.462  10.343  57.991  1.00 37.81  ? 60   ILE A CB  1 
ATOM   235  C CG1 . ILE A 1 36  ? 39.820  10.562  57.352  1.00 37.81  ? 60   ILE A CG1 1 
ATOM   236  C CG2 . ILE A 1 36  ? 37.983  8.958   57.691  1.00 37.81  ? 60   ILE A CG2 1 
ATOM   237  C CD1 . ILE A 1 36  ? 39.923  10.215  55.869  1.00 37.81  ? 60   ILE A CD1 1 
ATOM   238  N N   . ASN A 1 37  ? 35.328  10.267  57.190  1.00 83.47  ? 61   ASN A N   1 
ATOM   239  C CA  . ASN A 1 37  ? 34.062  9.713   57.646  1.00 83.47  ? 61   ASN A CA  1 
ATOM   240  C C   . ASN A 1 37  ? 34.557  8.351   58.108  1.00 83.47  ? 61   ASN A C   1 
ATOM   241  O O   . ASN A 1 37  ? 34.981  7.542   57.293  1.00 83.47  ? 61   ASN A O   1 
ATOM   242  C CB  . ASN A 1 37  ? 33.081  9.552   56.487  1.00 111.13 ? 61   ASN A CB  1 
ATOM   243  C CG  . ASN A 1 37  ? 31.645  9.441   56.959  1.00 111.13 ? 61   ASN A CG  1 
ATOM   244  O OD1 . ASN A 1 37  ? 31.342  8.715   57.910  1.00 111.13 ? 61   ASN A OD1 1 
ATOM   245  N ND2 . ASN A 1 37  ? 30.746  10.161  56.293  1.00 111.13 ? 61   ASN A ND2 1 
ATOM   246  N N   . GLU A 1 38  ? 34.541  8.099   59.409  1.00 79.45  ? 62   GLU A N   1 
ATOM   247  C CA  . GLU A 1 38  ? 35.059  6.832   59.896  1.00 79.45  ? 62   GLU A CA  1 
ATOM   248  C C   . GLU A 1 38  ? 34.238  5.577   59.595  1.00 79.45  ? 62   GLU A C   1 
ATOM   249  O O   . GLU A 1 38  ? 34.699  4.683   58.883  1.00 79.45  ? 62   GLU A O   1 
ATOM   250  C CB  . GLU A 1 38  ? 35.315  6.911   61.400  1.00 79.52  ? 62   GLU A CB  1 
ATOM   251  C CG  . GLU A 1 38  ? 36.479  7.795   61.816  1.00 79.52  ? 62   GLU A CG  1 
ATOM   252  C CD  . GLU A 1 38  ? 36.762  7.708   63.318  1.00 79.52  ? 62   GLU A CD  1 
ATOM   253  O OE1 . GLU A 1 38  ? 37.242  8.715   63.890  1.00 79.52  ? 62   GLU A OE1 1 
ATOM   254  O OE2 . GLU A 1 38  ? 36.506  6.636   63.932  1.00 79.52  ? 62   GLU A OE2 1 
ATOM   255  N N   . ASP A 1 39  ? 33.026  5.505   60.134  1.00 75.40  ? 63   ASP A N   1 
ATOM   256  C CA  . ASP A 1 39  ? 32.198  4.334   59.945  1.00 75.40  ? 63   ASP A CA  1 
ATOM   257  C C   . ASP A 1 39  ? 31.467  4.207   58.618  1.00 75.40  ? 63   ASP A C   1 
ATOM   258  O O   . ASP A 1 39  ? 31.404  3.114   58.074  1.00 75.40  ? 63   ASP A O   1 
ATOM   259  C CB  . ASP A 1 39  ? 31.227  4.200   61.117  1.00 133.84 ? 63   ASP A CB  1 
ATOM   260  C CG  . ASP A 1 39  ? 31.941  3.898   62.430  1.00 133.84 ? 63   ASP A CG  1 
ATOM   261  O OD1 . ASP A 1 39  ? 32.828  3.015   62.442  1.00 133.84 ? 63   ASP A OD1 1 
ATOM   262  O OD2 . ASP A 1 39  ? 31.610  4.536   63.453  1.00 133.84 ? 63   ASP A OD2 1 
ATOM   263  N N   . ARG A 1 40  ? 30.914  5.281   58.073  1.00 65.62  ? 64   ARG A N   1 
ATOM   264  C CA  . ARG A 1 40  ? 30.219  5.130   56.789  1.00 65.62  ? 64   ARG A CA  1 
ATOM   265  C C   . ARG A 1 40  ? 31.112  5.384   55.602  1.00 65.62  ? 64   ARG A C   1 
ATOM   266  O O   . ARG A 1 40  ? 30.698  5.177   54.476  1.00 65.62  ? 64   ARG A O   1 
ATOM   267  C CB  . ARG A 1 40  ? 29.000  6.042   56.686  1.00 69.77  ? 64   ARG A CB  1 
ATOM   268  C CG  . ARG A 1 40  ? 27.769  5.491   57.353  1.00 69.77  ? 64   ARG A CG  1 
ATOM   269  C CD  . ARG A 1 40  ? 26.608  6.447   57.254  1.00 69.77  ? 64   ARG A CD  1 
ATOM   270  N NE  . ARG A 1 40  ? 25.515  6.030   58.123  1.00 69.77  ? 64   ARG A NE  1 
ATOM   271  C CZ  . ARG A 1 40  ? 24.360  6.679   58.241  1.00 69.77  ? 64   ARG A CZ  1 
ATOM   272  N NH1 . ARG A 1 40  ? 24.146  7.790   57.530  1.00 69.77  ? 64   ARG A NH1 1 
ATOM   273  N NH2 . ARG A 1 40  ? 23.426  6.224   59.078  1.00 69.77  ? 64   ARG A NH2 1 
ATOM   274  N N   . GLY A 1 41  ? 32.330  5.844   55.859  1.00 83.55  ? 65   GLY A N   1 
ATOM   275  C CA  . GLY A 1 41  ? 33.265  6.096   54.783  1.00 83.55  ? 65   GLY A CA  1 
ATOM   276  C C   . GLY A 1 41  ? 34.291  4.973   54.720  1.00 83.55  ? 65   GLY A C   1 
ATOM   277  O O   . GLY A 1 41  ? 34.194  4.069   53.893  1.00 83.55  ? 65   GLY A O   1 
ATOM   278  N N   . ILE A 1 42  ? 35.270  5.014   55.615  1.00 66.38  ? 66   ILE A N   1 
ATOM   279  C CA  . ILE A 1 42  ? 36.324  4.005   55.666  1.00 66.38  ? 66   ILE A CA  1 
ATOM   280  C C   . ILE A 1 42  ? 35.826  2.560   55.748  1.00 66.38  ? 66   ILE A C   1 
ATOM   281  O O   . ILE A 1 42  ? 36.313  1.695   55.032  1.00 66.38  ? 66   ILE A O   1 
ATOM   282  C CB  . ILE A 1 42  ? 37.285  4.291   56.849  1.00 51.04  ? 66   ILE A CB  1 
ATOM   283  C CG1 . ILE A 1 42  ? 38.015  5.613   56.604  1.00 51.04  ? 66   ILE A CG1 1 
ATOM   284  C CG2 . ILE A 1 42  ? 38.285  3.156   57.007  1.00 51.04  ? 66   ILE A CG2 1 
ATOM   285  C CD1 . ILE A 1 42  ? 38.815  5.627   55.328  1.00 51.04  ? 66   ILE A CD1 1 
ATOM   286  N N   . GLN A 1 43  ? 34.865  2.283   56.611  1.00 62.38  ? 67   GLN A N   1 
ATOM   287  C CA  . GLN A 1 43  ? 34.386  0.925   56.698  1.00 62.38  ? 67   GLN A CA  1 
ATOM   288  C C   . GLN A 1 43  ? 33.806  0.485   55.392  1.00 62.38  ? 67   GLN A C   1 
ATOM   289  O O   . GLN A 1 43  ? 34.331  -0.419  54.756  1.00 62.38  ? 67   GLN A O   1 
ATOM   290  C CB  . GLN A 1 43  ? 33.327  0.783   57.748  1.00 57.40  ? 67   GLN A CB  1 
ATOM   291  C CG  . GLN A 1 43  ? 33.717  -0.190  58.788  1.00 57.40  ? 67   GLN A CG  1 
ATOM   292  C CD  . GLN A 1 43  ? 32.685  -0.284  59.866  1.00 57.40  ? 67   GLN A CD  1 
ATOM   293  O OE1 . GLN A 1 43  ? 31.598  -0.816  59.647  1.00 57.40  ? 67   GLN A OE1 1 
ATOM   294  N NE2 . GLN A 1 43  ? 33.002  0.254   61.045  1.00 57.40  ? 67   GLN A NE2 1 
ATOM   295  N N   . ARG A 1 44  ? 32.719  1.123   54.984  1.00 46.66  ? 68   ARG A N   1 
ATOM   296  C CA  . ARG A 1 44  ? 32.071  0.763   53.734  1.00 46.66  ? 68   ARG A CA  1 
ATOM   297  C C   . ARG A 1 44  ? 33.060  0.621   52.594  1.00 46.66  ? 68   ARG A C   1 
ATOM   298  O O   . ARG A 1 44  ? 32.905  -0.248  51.743  1.00 46.66  ? 68   ARG A O   1 
ATOM   299  C CB  . ARG A 1 44  ? 31.015  1.788   53.368  1.00 58.45  ? 68   ARG A CB  1 
ATOM   300  C CG  . ARG A 1 44  ? 29.845  1.804   54.303  1.00 58.45  ? 68   ARG A CG  1 
ATOM   301  C CD  . ARG A 1 44  ? 28.908  2.912   53.944  1.00 58.45  ? 68   ARG A CD  1 
ATOM   302  N NE  . ARG A 1 44  ? 27.771  2.908   54.837  1.00 58.45  ? 68   ARG A NE  1 
ATOM   303  C CZ  . ARG A 1 44  ? 26.808  3.810   54.793  1.00 58.45  ? 68   ARG A CZ  1 
ATOM   304  N NH1 . ARG A 1 44  ? 26.870  4.778   53.894  1.00 58.45  ? 68   ARG A NH1 1 
ATOM   305  N NH2 . ARG A 1 44  ? 25.782  3.737   55.630  1.00 58.45  ? 68   ARG A NH2 1 
ATOM   306  N N   . LEU A 1 45  ? 34.075  1.469   52.562  1.00 56.54  ? 69   LEU A N   1 
ATOM   307  C CA  . LEU A 1 45  ? 35.061  1.360   51.504  1.00 56.54  ? 69   LEU A CA  1 
ATOM   308  C C   . LEU A 1 45  ? 35.690  -0.011  51.655  1.00 56.54  ? 69   LEU A C   1 
ATOM   309  O O   . LEU A 1 45  ? 35.597  -0.843  50.760  1.00 56.54  ? 69   LEU A O   1 
ATOM   310  C CB  . LEU A 1 45  ? 36.137  2.420   51.663  1.00 60.55  ? 69   LEU A CB  1 
ATOM   311  C CG  . LEU A 1 45  ? 37.160  2.596   50.547  1.00 60.55  ? 69   LEU A CG  1 
ATOM   312  C CD1 . LEU A 1 45  ? 38.277  3.449   51.101  1.00 60.55  ? 69   LEU A CD1 1 
ATOM   313  C CD2 . LEU A 1 45  ? 37.717  1.283   50.088  1.00 60.55  ? 69   LEU A CD2 1 
ATOM   314  N N   . GLU A 1 46  ? 36.337  -0.246  52.788  1.00 65.01  ? 70   GLU A N   1 
ATOM   315  C CA  . GLU A 1 46  ? 36.971  -1.531  53.024  1.00 65.01  ? 70   GLU A CA  1 
ATOM   316  C C   . GLU A 1 46  ? 36.037  -2.700  52.684  1.00 65.01  ? 70   GLU A C   1 
ATOM   317  O O   . GLU A 1 46  ? 36.439  -3.670  52.031  1.00 65.01  ? 70   GLU A O   1 
ATOM   318  C CB  . GLU A 1 46  ? 37.425  -1.636  54.474  1.00 82.53  ? 70   GLU A CB  1 
ATOM   319  C CG  . GLU A 1 46  ? 38.665  -0.849  54.787  1.00 82.53  ? 70   GLU A CG  1 
ATOM   320  C CD  . GLU A 1 46  ? 39.830  -1.211  53.884  1.00 82.53  ? 70   GLU A CD  1 
ATOM   321  O OE1 . GLU A 1 46  ? 39.921  -2.369  53.440  1.00 82.53  ? 70   GLU A OE1 1 
ATOM   322  O OE2 . GLU A 1 46  ? 40.679  -0.340  53.622  1.00 82.53  ? 70   GLU A OE2 1 
ATOM   323  N N   . ALA A 1 47  ? 34.788  -2.622  53.119  1.00 42.56  ? 71   ALA A N   1 
ATOM   324  C CA  . ALA A 1 47  ? 33.871  -3.696  52.815  1.00 42.56  ? 71   ALA A CA  1 
ATOM   325  C C   . ALA A 1 47  ? 33.885  -3.986  51.318  1.00 42.56  ? 71   ALA A C   1 
ATOM   326  O O   . ALA A 1 47  ? 33.782  -5.132  50.920  1.00 42.56  ? 71   ALA A O   1 
ATOM   327  C CB  . ALA A 1 47  ? 32.477  -3.353  53.274  1.00 20.67  ? 71   ALA A CB  1 
ATOM   328  N N   . MET A 1 48  ? 34.025  -2.976  50.472  1.00 47.72  ? 72   MET A N   1 
ATOM   329  C CA  . MET A 1 48  ? 34.041  -3.271  49.051  1.00 47.72  ? 72   MET A CA  1 
ATOM   330  C C   . MET A 1 48  ? 35.291  -4.026  48.677  1.00 47.72  ? 72   MET A C   1 
ATOM   331  O O   . MET A 1 48  ? 35.249  -4.967  47.888  1.00 47.72  ? 72   MET A O   1 
ATOM   332  C CB  . MET A 1 48  ? 33.963  -2.017  48.200  1.00 51.22  ? 72   MET A CB  1 
ATOM   333  C CG  . MET A 1 48  ? 34.054  -2.370  46.744  1.00 51.22  ? 72   MET A CG  1 
ATOM   334  S SD  . MET A 1 48  ? 33.529  -1.093  45.681  1.00 51.22  ? 72   MET A SD  1 
ATOM   335  C CE  . MET A 1 48  ? 34.548  -1.459  44.308  1.00 51.22  ? 72   MET A CE  1 
ATOM   336  N N   . LEU A 1 49  ? 36.416  -3.587  49.218  1.00 68.72  ? 73   LEU A N   1 
ATOM   337  C CA  . LEU A 1 49  ? 37.677  -4.251  48.950  1.00 68.72  ? 73   LEU A CA  1 
ATOM   338  C C   . LEU A 1 49  ? 37.499  -5.685  49.410  1.00 68.72  ? 73   LEU A C   1 
ATOM   339  O O   . LEU A 1 49  ? 37.714  -6.627  48.646  1.00 68.72  ? 73   LEU A O   1 
ATOM   340  C CB  . LEU A 1 49  ? 38.797  -3.586  49.738  1.00 61.51  ? 73   LEU A CB  1 
ATOM   341  C CG  . LEU A 1 49  ? 39.637  -2.501  49.067  1.00 61.51  ? 73   LEU A CG  1 
ATOM   342  C CD1 . LEU A 1 49  ? 38.802  -1.505  48.287  1.00 61.51  ? 73   LEU A CD1 1 
ATOM   343  C CD2 . LEU A 1 49  ? 40.431  -1.828  50.182  1.00 61.51  ? 73   LEU A CD2 1 
ATOM   344  N N   . PHE A 1 50  ? 37.088  -5.845  50.662  1.00 63.65  ? 74   PHE A N   1 
ATOM   345  C CA  . PHE A 1 50  ? 36.857  -7.166  51.232  1.00 63.65  ? 74   PHE A CA  1 
ATOM   346  C C   . PHE A 1 50  ? 36.038  -8.041  50.285  1.00 63.65  ? 74   PHE A C   1 
ATOM   347  O O   . PHE A 1 50  ? 36.443  -9.134  49.937  1.00 63.65  ? 74   PHE A O   1 
ATOM   348  C CB  . PHE A 1 50  ? 36.124  -7.021  52.552  1.00 58.61  ? 74   PHE A CB  1 
ATOM   349  C CG  . PHE A 1 50  ? 35.492  -8.282  53.029  1.00 58.61  ? 74   PHE A CG  1 
ATOM   350  C CD1 . PHE A 1 50  ? 36.271  -9.309  53.525  1.00 58.61  ? 74   PHE A CD1 1 
ATOM   351  C CD2 . PHE A 1 50  ? 34.101  -8.426  53.013  1.00 58.61  ? 74   PHE A CD2 1 
ATOM   352  C CE1 . PHE A 1 50  ? 35.677  -10.464 54.008  1.00 58.61  ? 74   PHE A CE1 1 
ATOM   353  C CE2 . PHE A 1 50  ? 33.498  -9.569  53.490  1.00 58.61  ? 74   PHE A CE2 1 
ATOM   354  C CZ  . PHE A 1 50  ? 34.283  -10.595 53.992  1.00 58.61  ? 74   PHE A CZ  1 
ATOM   355  N N   . ALA A 1 51  ? 34.878  -7.547  49.883  1.00 50.10  ? 75   ALA A N   1 
ATOM   356  C CA  . ALA A 1 51  ? 34.016  -8.266  48.977  1.00 50.10  ? 75   ALA A CA  1 
ATOM   357  C C   . ALA A 1 51  ? 34.777  -8.660  47.729  1.00 50.10  ? 75   ALA A C   1 
ATOM   358  O O   . ALA A 1 51  ? 34.652  -9.784  47.269  1.00 50.10  ? 75   ALA A O   1 
ATOM   359  C CB  . ALA A 1 51  ? 32.831  -7.411  48.603  1.00 114.59 ? 75   ALA A CB  1 
ATOM   360  N N   . ILE A 1 52  ? 35.548  -7.740  47.159  1.00 51.94  ? 76   ILE A N   1 
ATOM   361  C CA  . ILE A 1 52  ? 36.325  -8.054  45.960  1.00 51.94  ? 76   ILE A CA  1 
ATOM   362  C C   . ILE A 1 52  ? 37.306  -9.151  46.326  1.00 51.94  ? 76   ILE A C   1 
ATOM   363  O O   . ILE A 1 52  ? 37.321  -10.207 45.710  1.00 51.94  ? 76   ILE A O   1 
ATOM   364  C CB  . ILE A 1 52  ? 37.112  -6.844  45.458  1.00 44.20  ? 76   ILE A CB  1 
ATOM   365  C CG1 . ILE A 1 52  ? 36.195  -5.893  44.700  1.00 44.20  ? 76   ILE A CG1 1 
ATOM   366  C CG2 . ILE A 1 52  ? 38.239  -7.317  44.559  1.00 44.20  ? 76   ILE A CG2 1 
ATOM   367  C CD1 . ILE A 1 52  ? 35.696  -6.496  43.413  1.00 44.20  ? 76   ILE A CD1 1 
ATOM   368  N N   . ASP A 1 53  ? 38.126  -8.894  47.331  1.00 82.03  ? 77   ASP A N   1 
ATOM   369  C CA  . ASP A 1 53  ? 39.076  -9.885  47.808  1.00 82.03  ? 77   ASP A CA  1 
ATOM   370  C C   . ASP A 1 53  ? 38.443  -11.284 47.832  1.00 82.03  ? 77   ASP A C   1 
ATOM   371  O O   . ASP A 1 53  ? 39.035  -12.262 47.370  1.00 82.03  ? 77   ASP A O   1 
ATOM   372  C CB  . ASP A 1 53  ? 39.516  -9.538  49.232  1.00 92.65  ? 77   ASP A CB  1 
ATOM   373  C CG  . ASP A 1 53  ? 40.569  -8.472  49.269  1.00 92.65  ? 77   ASP A CG  1 
ATOM   374  O OD1 . ASP A 1 53  ? 40.842  -7.897  48.194  1.00 92.65  ? 77   ASP A OD1 1 
ATOM   375  O OD2 . ASP A 1 53  ? 41.117  -8.216  50.364  1.00 92.65  ? 77   ASP A OD2 1 
ATOM   376  N N   . GLU A 1 54  ? 37.242  -11.361 48.396  1.00 63.37  ? 78   GLU A N   1 
ATOM   377  C CA  . GLU A 1 54  ? 36.498  -12.605 48.525  1.00 63.37  ? 78   GLU A CA  1 
ATOM   378  C C   . GLU A 1 54  ? 36.058  -13.179 47.204  1.00 63.37  ? 78   GLU A C   1 
ATOM   379  O O   . GLU A 1 54  ? 36.151  -14.370 46.995  1.00 63.37  ? 78   GLU A O   1 
ATOM   380  C CB  . GLU A 1 54  ? 35.280  -12.387 49.415  1.00 85.98  ? 78   GLU A CB  1 
ATOM   381  C CG  . GLU A 1 54  ? 35.663  -12.189 50.847  1.00 85.98  ? 78   GLU A CG  1 
ATOM   382  C CD  . GLU A 1 54  ? 36.357  -13.411 51.384  1.00 85.98  ? 78   GLU A CD  1 
ATOM   383  O OE1 . GLU A 1 54  ? 37.070  -13.316 52.406  1.00 85.98  ? 78   GLU A OE1 1 
ATOM   384  O OE2 . GLU A 1 54  ? 36.176  -14.484 50.775  1.00 85.98  ? 78   GLU A OE2 1 
ATOM   385  N N   . ILE A 1 55  ? 35.569  -12.345 46.311  1.00 50.91  ? 79   ILE A N   1 
ATOM   386  C CA  . ILE A 1 55  ? 35.130  -12.830 45.022  1.00 50.91  ? 79   ILE A CA  1 
ATOM   387  C C   . ILE A 1 55  ? 36.312  -13.385 44.207  1.00 50.91  ? 79   ILE A C   1 
ATOM   388  O O   . ILE A 1 55  ? 36.143  -14.239 43.306  1.00 50.91  ? 79   ILE A O   1 
ATOM   389  C CB  . ILE A 1 55  ? 34.396  -11.692 44.273  1.00 49.23  ? 79   ILE A CB  1 
ATOM   390  C CG1 . ILE A 1 55  ? 33.063  -11.443 44.965  1.00 49.23  ? 79   ILE A CG1 1 
ATOM   391  C CG2 . ILE A 1 55  ? 34.196  -12.021 42.785  1.00 49.23  ? 79   ILE A CG2 1 
ATOM   392  C CD1 . ILE A 1 55  ? 32.282  -10.319 44.345  1.00 49.23  ? 79   ILE A CD1 1 
ATOM   393  N N   . ASN A 1 56  ? 37.512  -12.913 44.527  1.00 87.61  ? 80   ASN A N   1 
ATOM   394  C CA  . ASN A 1 56  ? 38.698  -13.380 43.828  1.00 87.61  ? 80   ASN A CA  1 
ATOM   395  C C   . ASN A 1 56  ? 39.235  -14.673 44.454  1.00 87.61  ? 80   ASN A C   1 
ATOM   396  O O   . ASN A 1 56  ? 39.846  -15.503 43.783  1.00 87.61  ? 80   ASN A O   1 
ATOM   397  C CB  . ASN A 1 56  ? 39.776  -12.302 43.839  1.00 89.70  ? 80   ASN A CB  1 
ATOM   398  C CG  . ASN A 1 56  ? 39.401  -11.097 43.002  1.00 89.70  ? 80   ASN A CG  1 
ATOM   399  O OD1 . ASN A 1 56  ? 38.971  -11.228 41.848  1.00 89.70  ? 80   ASN A OD1 1 
ATOM   400  N ND2 . ASN A 1 56  ? 39.577  -9.908  43.574  1.00 89.70  ? 80   ASN A ND2 1 
ATOM   401  N N   . LYS A 1 57  ? 39.006  -14.844 45.746  1.00 77.83  ? 81   LYS A N   1 
ATOM   402  C CA  . LYS A 1 57  ? 39.455  -16.039 46.422  1.00 77.83  ? 81   LYS A CA  1 
ATOM   403  C C   . LYS A 1 57  ? 38.432  -17.140 46.117  1.00 77.83  ? 81   LYS A C   1 
ATOM   404  O O   . LYS A 1 57  ? 38.720  -18.328 46.262  1.00 77.83  ? 81   LYS A O   1 
ATOM   405  C CB  . LYS A 1 57  ? 39.548  -15.766 47.932  1.00 136.77 ? 81   LYS A CB  1 
ATOM   406  C CG  . LYS A 1 57  ? 40.358  -16.795 48.715  1.00 136.77 ? 81   LYS A CG  1 
ATOM   407  C CD  . LYS A 1 57  ? 40.879  -16.258 50.059  1.00 136.77 ? 81   LYS A CD  1 
ATOM   408  C CE  . LYS A 1 57  ? 39.857  -16.345 51.192  1.00 136.77 ? 81   LYS A CE  1 
ATOM   409  N NZ  . LYS A 1 57  ? 38.778  -15.334 51.106  1.00 136.77 ? 81   LYS A NZ  1 
ATOM   410  N N   . ASP A 1 58  ? 37.244  -16.735 45.665  1.00 86.23  ? 82   ASP A N   1 
ATOM   411  C CA  . ASP A 1 58  ? 36.163  -17.669 45.355  1.00 86.23  ? 82   ASP A CA  1 
ATOM   412  C C   . ASP A 1 58  ? 36.394  -18.384 44.038  1.00 86.23  ? 82   ASP A C   1 
ATOM   413  O O   . ASP A 1 58  ? 36.895  -17.771 43.085  1.00 86.23  ? 82   ASP A O   1 
ATOM   414  C CB  . ASP A 1 58  ? 34.825  -16.928 45.300  1.00 145.16 ? 82   ASP A CB  1 
ATOM   415  C CG  . ASP A 1 58  ? 33.641  -17.861 45.089  1.00 145.16 ? 82   ASP A CG  1 
ATOM   416  O OD1 . ASP A 1 58  ? 32.490  -17.371 45.113  1.00 145.16 ? 82   ASP A OD1 1 
ATOM   417  O OD2 . ASP A 1 58  ? 33.853  -19.080 44.902  1.00 145.16 ? 82   ASP A OD2 1 
ATOM   418  N N   . ASN A 1 59  ? 36.008  -19.669 44.004  1.00 82.39  ? 83   ASN A N   1 
ATOM   419  C CA  . ASN A 1 59  ? 36.146  -20.552 42.838  1.00 82.39  ? 83   ASN A CA  1 
ATOM   420  C C   . ASN A 1 59  ? 34.891  -20.725 41.994  1.00 82.39  ? 83   ASN A C   1 
ATOM   421  O O   . ASN A 1 59  ? 34.990  -20.896 40.780  1.00 82.39  ? 83   ASN A O   1 
ATOM   422  C CB  . ASN A 1 59  ? 36.609  -21.943 43.272  1.00 177.59 ? 83   ASN A CB  1 
ATOM   423  C CG  . ASN A 1 59  ? 38.066  -21.978 43.659  1.00 177.59 ? 83   ASN A CG  1 
ATOM   424  O OD1 . ASN A 1 59  ? 38.935  -21.589 42.876  1.00 177.59 ? 83   ASN A OD1 1 
ATOM   425  N ND2 . ASN A 1 59  ? 38.348  -22.454 44.868  1.00 177.59 ? 83   ASN A ND2 1 
ATOM   426  N N   . TYR A 1 60  ? 33.718  -20.679 42.626  1.00 92.38  ? 84   TYR A N   1 
ATOM   427  C CA  . TYR A 1 60  ? 32.447  -20.876 41.919  1.00 92.38  ? 84   TYR A CA  1 
ATOM   428  C C   . TYR A 1 60  ? 31.754  -19.616 41.386  1.00 92.38  ? 84   TYR A C   1 
ATOM   429  O O   . TYR A 1 60  ? 30.624  -19.667 40.867  1.00 92.38  ? 84   TYR A O   1 
ATOM   430  C CB  . TYR A 1 60  ? 31.486  -21.656 42.818  1.00 116.39 ? 84   TYR A CB  1 
ATOM   431  C CG  . TYR A 1 60  ? 32.015  -23.017 43.206  1.00 116.39 ? 84   TYR A CG  1 
ATOM   432  C CD1 . TYR A 1 60  ? 32.615  -23.228 44.447  1.00 116.39 ? 84   TYR A CD1 1 
ATOM   433  C CD2 . TYR A 1 60  ? 31.954  -24.087 42.310  1.00 116.39 ? 84   TYR A CD2 1 
ATOM   434  C CE1 . TYR A 1 60  ? 33.145  -24.474 44.788  1.00 116.39 ? 84   TYR A CE1 1 
ATOM   435  C CE2 . TYR A 1 60  ? 32.481  -25.332 42.636  1.00 116.39 ? 84   TYR A CE2 1 
ATOM   436  C CZ  . TYR A 1 60  ? 33.077  -25.522 43.875  1.00 116.39 ? 84   TYR A CZ  1 
ATOM   437  O OH  . TYR A 1 60  ? 33.618  -26.750 44.188  1.00 116.39 ? 84   TYR A OH  1 
ATOM   438  N N   . LEU A 1 61  ? 32.449  -18.490 41.499  1.00 105.97 ? 85   LEU A N   1 
ATOM   439  C CA  . LEU A 1 61  ? 31.932  -17.206 41.048  1.00 105.97 ? 85   LEU A CA  1 
ATOM   440  C C   . LEU A 1 61  ? 33.068  -16.417 40.441  1.00 105.97 ? 85   LEU A C   1 
ATOM   441  O O   . LEU A 1 61  ? 34.038  -16.076 41.126  1.00 105.97 ? 85   LEU A O   1 
ATOM   442  C CB  . LEU A 1 61  ? 31.351  -16.431 42.226  1.00 68.18  ? 85   LEU A CB  1 
ATOM   443  C CG  . LEU A 1 61  ? 31.048  -14.948 42.050  1.00 68.18  ? 85   LEU A CG  1 
ATOM   444  C CD1 . LEU A 1 61  ? 30.129  -14.670 40.858  1.00 68.18  ? 85   LEU A CD1 1 
ATOM   445  C CD2 . LEU A 1 61  ? 30.428  -14.475 43.347  1.00 68.18  ? 85   LEU A CD2 1 
ATOM   446  N N   . LEU A 1 62  ? 32.943  -16.134 39.151  1.00 92.65  ? 86   LEU A N   1 
ATOM   447  C CA  . LEU A 1 62  ? 33.956  -15.382 38.441  1.00 92.65  ? 86   LEU A CA  1 
ATOM   448  C C   . LEU A 1 62  ? 35.355  -15.796 38.910  1.00 92.65  ? 86   LEU A C   1 
ATOM   449  O O   . LEU A 1 62  ? 35.934  -15.217 39.855  1.00 92.65  ? 86   LEU A O   1 
ATOM   450  C CB  . LEU A 1 62  ? 33.721  -13.889 38.647  1.00 77.63  ? 86   LEU A CB  1 
ATOM   451  C CG  . LEU A 1 62  ? 33.451  -13.070 37.382  1.00 77.63  ? 86   LEU A CG  1 
ATOM   452  C CD1 . LEU A 1 62  ? 32.345  -13.682 36.561  1.00 77.63  ? 86   LEU A CD1 1 
ATOM   453  C CD2 . LEU A 1 62  ? 33.082  -11.657 37.787  1.00 77.63  ? 86   LEU A CD2 1 
ATOM   454  N N   . PRO A 1 63  ? 35.892  -16.851 38.274  1.00 164.71 ? 87   PRO A N   1 
ATOM   455  C CA  . PRO A 1 63  ? 37.212  -17.440 38.528  1.00 164.71 ? 87   PRO A CA  1 
ATOM   456  C C   . PRO A 1 63  ? 38.274  -16.937 37.550  1.00 164.71 ? 87   PRO A C   1 
ATOM   457  O O   . PRO A 1 63  ? 39.304  -16.397 37.955  1.00 164.71 ? 87   PRO A O   1 
ATOM   458  C CB  . PRO A 1 63  ? 36.954  -18.922 38.358  1.00 79.96  ? 87   PRO A CB  1 
ATOM   459  C CG  . PRO A 1 63  ? 35.983  -18.925 37.217  1.00 79.96  ? 87   PRO A CG  1 
ATOM   460  C CD  . PRO A 1 63  ? 35.035  -17.795 37.526  1.00 79.96  ? 87   PRO A CD  1 
ATOM   461  N N   . GLY A 1 64  ? 38.009  -17.117 36.262  1.00 114.67 ? 88   GLY A N   1 
ATOM   462  C CA  . GLY A 1 64  ? 38.947  -16.689 35.242  1.00 114.67 ? 88   GLY A CA  1 
ATOM   463  C C   . GLY A 1 64  ? 38.835  -15.218 34.911  1.00 114.67 ? 88   GLY A C   1 
ATOM   464  O O   . GLY A 1 64  ? 39.400  -14.742 33.921  1.00 114.67 ? 88   GLY A O   1 
ATOM   465  N N   . VAL A 1 65  ? 38.098  -14.491 35.741  1.00 85.50  ? 89   VAL A N   1 
ATOM   466  C CA  . VAL A 1 65  ? 37.924  -13.066 35.533  1.00 85.50  ? 89   VAL A CA  1 
ATOM   467  C C   . VAL A 1 65  ? 38.203  -12.353 36.842  1.00 85.50  ? 89   VAL A C   1 
ATOM   468  O O   . VAL A 1 65  ? 37.291  -12.142 37.622  1.00 85.50  ? 89   VAL A O   1 
ATOM   469  C CB  . VAL A 1 65  ? 36.481  -12.742 35.072  1.00 70.81  ? 89   VAL A CB  1 
ATOM   470  C CG1 . VAL A 1 65  ? 36.346  -11.268 34.732  1.00 70.81  ? 89   VAL A CG1 1 
ATOM   471  C CG2 . VAL A 1 65  ? 36.130  -13.574 33.867  1.00 70.81  ? 89   VAL A CG2 1 
ATOM   472  N N   . LYS A 1 66  ? 39.459  -11.999 37.095  1.00 104.00 ? 90   LYS A N   1 
ATOM   473  C CA  . LYS A 1 66  ? 39.808  -11.292 38.322  1.00 104.00 ? 90   LYS A CA  1 
ATOM   474  C C   . LYS A 1 66  ? 39.074  -9.950  38.338  1.00 104.00 ? 90   LYS A C   1 
ATOM   475  O O   . LYS A 1 66  ? 38.965  -9.284  37.302  1.00 104.00 ? 90   LYS A O   1 
ATOM   476  C CB  . LYS A 1 66  ? 41.317  -11.057 38.381  1.00 112.51 ? 90   LYS A CB  1 
ATOM   477  C CG  . LYS A 1 66  ? 41.788  -10.235 39.576  1.00 112.51 ? 90   LYS A CG  1 
ATOM   478  C CD  . LYS A 1 66  ? 43.319  -10.062 39.589  1.00 112.51 ? 90   LYS A CD  1 
ATOM   479  C CE  . LYS A 1 66  ? 43.793  -9.179  40.751  1.00 112.51 ? 90   LYS A CE  1 
ATOM   480  N NZ  . LYS A 1 66  ? 45.262  -8.933  40.749  1.00 112.51 ? 90   LYS A NZ  1 
ATOM   481  N N   . LEU A 1 67  ? 38.553  -9.558  39.500  1.00 67.31  ? 91   LEU A N   1 
ATOM   482  C CA  . LEU A 1 67  ? 37.846  -8.288  39.590  1.00 67.31  ? 91   LEU A CA  1 
ATOM   483  C C   . LEU A 1 67  ? 38.709  -7.159  40.109  1.00 67.31  ? 91   LEU A C   1 
ATOM   484  O O   . LEU A 1 67  ? 39.244  -7.209  41.231  1.00 67.31  ? 91   LEU A O   1 
ATOM   485  C CB  . LEU A 1 67  ? 36.612  -8.385  40.482  1.00 57.56  ? 91   LEU A CB  1 
ATOM   486  C CG  . LEU A 1 67  ? 35.372  -9.074  39.935  1.00 57.56  ? 91   LEU A CG  1 
ATOM   487  C CD1 . LEU A 1 67  ? 34.192  -8.511  40.667  1.00 57.56  ? 91   LEU A CD1 1 
ATOM   488  C CD2 . LEU A 1 67  ? 35.216  -8.826  38.451  1.00 57.56  ? 91   LEU A CD2 1 
ATOM   489  N N   . GLY A 1 68  ? 38.828  -6.133  39.277  1.00 78.84  ? 92   GLY A N   1 
ATOM   490  C CA  . GLY A 1 68  ? 39.602  -4.972  39.647  1.00 78.84  ? 92   GLY A CA  1 
ATOM   491  C C   . GLY A 1 68  ? 38.664  -3.862  40.064  1.00 78.84  ? 92   GLY A C   1 
ATOM   492  O O   . GLY A 1 68  ? 37.497  -3.820  39.667  1.00 78.84  ? 92   GLY A O   1 
ATOM   493  N N   . VAL A 1 69  ? 39.173  -2.948  40.872  1.00 65.05  ? 93   VAL A N   1 
ATOM   494  C CA  . VAL A 1 69  ? 38.348  -1.856  41.328  1.00 65.05  ? 93   VAL A CA  1 
ATOM   495  C C   . VAL A 1 69  ? 39.049  -0.534  41.139  1.00 65.05  ? 93   VAL A C   1 
ATOM   496  O O   . VAL A 1 69  ? 40.272  -0.464  41.132  1.00 65.05  ? 93   VAL A O   1 
ATOM   497  C CB  . VAL A 1 69  ? 38.023  -1.987  42.822  1.00 60.35  ? 93   VAL A CB  1 
ATOM   498  C CG1 . VAL A 1 69  ? 37.954  -3.453  43.208  1.00 60.35  ? 93   VAL A CG1 1 
ATOM   499  C CG2 . VAL A 1 69  ? 39.059  -1.250  43.654  1.00 60.35  ? 93   VAL A CG2 1 
ATOM   500  N N   . HIS A 1 70  ? 38.247  0.507   40.979  1.00 74.75  ? 94   HIS A N   1 
ATOM   501  C CA  . HIS A 1 70  ? 38.736  1.864   40.852  1.00 74.75  ? 94   HIS A CA  1 
ATOM   502  C C   . HIS A 1 70  ? 37.803  2.652   41.760  1.00 74.75  ? 94   HIS A C   1 
ATOM   503  O O   . HIS A 1 70  ? 36.707  3.032   41.357  1.00 74.75  ? 94   HIS A O   1 
ATOM   504  C CB  . HIS A 1 70  ? 38.624  2.354   39.425  1.00 88.88  ? 94   HIS A CB  1 
ATOM   505  C CG  . HIS A 1 70  ? 39.222  3.706   39.224  1.00 88.88  ? 94   HIS A CG  1 
ATOM   506  N ND1 . HIS A 1 70  ? 39.311  4.308   37.987  1.00 88.88  ? 94   HIS A ND1 1 
ATOM   507  C CD2 . HIS A 1 70  ? 39.763  4.576   40.108  1.00 88.88  ? 94   HIS A CD2 1 
ATOM   508  C CE1 . HIS A 1 70  ? 39.881  5.493   38.118  1.00 88.88  ? 94   HIS A CE1 1 
ATOM   509  N NE2 . HIS A 1 70  ? 40.165  5.680   39.396  1.00 88.88  ? 94   HIS A NE2 1 
ATOM   510  N N   . ILE A 1 71  ? 38.245  2.883   42.993  1.00 60.14  ? 95   ILE A N   1 
ATOM   511  C CA  . ILE A 1 71  ? 37.439  3.561   43.998  1.00 60.14  ? 95   ILE A CA  1 
ATOM   512  C C   . ILE A 1 71  ? 37.792  5.019   44.217  1.00 60.14  ? 95   ILE A C   1 
ATOM   513  O O   . ILE A 1 71  ? 38.939  5.333   44.411  1.00 60.14  ? 95   ILE A O   1 
ATOM   514  C CB  . ILE A 1 71  ? 37.577  2.817   45.323  1.00 73.93  ? 95   ILE A CB  1 
ATOM   515  C CG1 . ILE A 1 71  ? 37.340  1.333   45.078  1.00 73.93  ? 95   ILE A CG1 1 
ATOM   516  C CG2 . ILE A 1 71  ? 36.602  3.348   46.331  1.00 73.93  ? 95   ILE A CG2 1 
ATOM   517  C CD1 . ILE A 1 71  ? 37.069  0.544   46.313  1.00 73.93  ? 95   ILE A CD1 1 
ATOM   518  N N   . LEU A 1 72  ? 36.802  5.902   44.213  1.00 61.37  ? 96   LEU A N   1 
ATOM   519  C CA  . LEU A 1 72  ? 37.045  7.326   44.414  1.00 61.37  ? 96   LEU A CA  1 
ATOM   520  C C   . LEU A 1 72  ? 36.226  7.893   45.578  1.00 61.37  ? 96   LEU A C   1 
ATOM   521  O O   . LEU A 1 72  ? 35.058  7.536   45.754  1.00 61.37  ? 96   LEU A O   1 
ATOM   522  C CB  . LEU A 1 72  ? 36.662  8.084   43.161  1.00 57.69  ? 96   LEU A CB  1 
ATOM   523  C CG  . LEU A 1 72  ? 37.179  7.543   41.840  1.00 57.69  ? 96   LEU A CG  1 
ATOM   524  C CD1 . LEU A 1 72  ? 36.501  8.282   40.696  1.00 57.69  ? 96   LEU A CD1 1 
ATOM   525  C CD2 . LEU A 1 72  ? 38.675  7.728   41.776  1.00 57.69  ? 96   LEU A CD2 1 
ATOM   526  N N   . ASP A 1 73  ? 36.827  8.793   46.359  1.00 61.56  ? 97   ASP A N   1 
ATOM   527  C CA  . ASP A 1 73  ? 36.137  9.413   47.496  1.00 61.56  ? 97   ASP A CA  1 
ATOM   528  C C   . ASP A 1 73  ? 35.141  10.404  46.913  1.00 61.56  ? 97   ASP A C   1 
ATOM   529  O O   . ASP A 1 73  ? 35.430  11.017  45.898  1.00 61.56  ? 97   ASP A O   1 
ATOM   530  C CB  . ASP A 1 73  ? 37.146  10.153  48.384  1.00 63.99  ? 97   ASP A CB  1 
ATOM   531  C CG  . ASP A 1 73  ? 36.511  10.754  49.624  1.00 63.99  ? 97   ASP A CG  1 
ATOM   532  O OD1 . ASP A 1 73  ? 35.274  10.835  49.678  1.00 63.99  ? 97   ASP A OD1 1 
ATOM   533  O OD2 . ASP A 1 73  ? 37.239  11.157  50.550  1.00 63.99  ? 97   ASP A OD2 1 
ATOM   534  N N   . THR A 1 74  ? 33.974  10.563  47.532  1.00 44.91  ? 98   THR A N   1 
ATOM   535  C CA  . THR A 1 74  ? 32.968  11.513  47.030  1.00 44.91  ? 98   THR A CA  1 
ATOM   536  C C   . THR A 1 74  ? 32.863  12.789  47.887  1.00 44.91  ? 98   THR A C   1 
ATOM   537  O O   . THR A 1 74  ? 32.074  13.687  47.597  1.00 44.91  ? 98   THR A O   1 
ATOM   538  C CB  . THR A 1 74  ? 31.588  10.840  46.967  1.00 67.08  ? 98   THR A CB  1 
ATOM   539  O OG1 . THR A 1 74  ? 31.172  10.450  48.287  1.00 67.08  ? 98   THR A OG1 1 
ATOM   540  C CG2 . THR A 1 74  ? 31.656  9.598   46.080  1.00 67.08  ? 98   THR A CG2 1 
ATOM   541  N N   . CYS A 1 75  ? 33.678  12.849  48.942  1.00 66.43  ? 99   CYS A N   1 
ATOM   542  C CA  . CYS A 1 75  ? 33.704  13.960  49.887  1.00 66.43  ? 99   CYS A CA  1 
ATOM   543  C C   . CYS A 1 75  ? 32.302  14.429  50.230  1.00 66.43  ? 99   CYS A C   1 
ATOM   544  O O   . CYS A 1 75  ? 32.042  15.607  50.406  1.00 66.43  ? 99   CYS A O   1 
ATOM   545  C CB  . CYS A 1 75  ? 34.566  15.089  49.335  1.00 95.31  ? 99   CYS A CB  1 
ATOM   546  S SG  . CYS A 1 75  ? 36.295  14.532  49.213  1.00 95.31  ? 99   CYS A SG  1 
ATOM   547  N N   . SER A 1 76  ? 31.406  13.460  50.328  1.00 46.36  ? 100  SER A N   1 
ATOM   548  C CA  . SER A 1 76  ? 30.022  13.683  50.658  1.00 46.36  ? 100  SER A CA  1 
ATOM   549  C C   . SER A 1 76  ? 29.314  14.685  49.805  1.00 46.36  ? 100  SER A C   1 
ATOM   550  O O   . SER A 1 76  ? 28.142  14.948  50.060  1.00 46.36  ? 100  SER A O   1 
ATOM   551  C CB  . SER A 1 76  ? 29.892  14.120  52.101  1.00 63.86  ? 100  SER A CB  1 
ATOM   552  O OG  . SER A 1 76  ? 30.356  13.099  52.951  1.00 63.86  ? 100  SER A OG  1 
ATOM   553  N N   . ARG A 1 77  ? 29.979  15.256  48.804  1.00 63.66  ? 101  ARG A N   1 
ATOM   554  C CA  . ARG A 1 77  ? 29.319  16.275  47.980  1.00 63.66  ? 101  ARG A CA  1 
ATOM   555  C C   . ARG A 1 77  ? 28.954  15.740  46.620  1.00 63.66  ? 101  ARG A C   1 
ATOM   556  O O   . ARG A 1 77  ? 29.738  15.040  45.994  1.00 63.66  ? 101  ARG A O   1 
ATOM   557  C CB  . ARG A 1 77  ? 30.218  17.511  47.828  1.00 140.28 ? 101  ARG A CB  1 
ATOM   558  C CG  . ARG A 1 77  ? 29.555  18.668  47.083  1.00 140.28 ? 101  ARG A CG  1 
ATOM   559  C CD  . ARG A 1 77  ? 30.487  19.868  46.880  1.00 140.28 ? 101  ARG A CD  1 
ATOM   560  N NE  . ARG A 1 77  ? 30.618  20.717  48.063  1.00 140.28 ? 101  ARG A NE  1 
ATOM   561  C CZ  . ARG A 1 77  ? 31.437  20.478  49.082  1.00 140.28 ? 101  ARG A CZ  1 
ATOM   562  N NH1 . ARG A 1 77  ? 32.218  19.406  49.079  1.00 140.28 ? 101  ARG A NH1 1 
ATOM   563  N NH2 . ARG A 1 77  ? 31.480  21.324  50.103  1.00 140.28 ? 101  ARG A NH2 1 
ATOM   564  N N   . ASP A 1 78  ? 27.759  16.070  46.149  1.00 51.99  ? 102  ASP A N   1 
ATOM   565  C CA  . ASP A 1 78  ? 27.331  15.576  44.842  1.00 51.99  ? 102  ASP A CA  1 
ATOM   566  C C   . ASP A 1 78  ? 28.207  16.114  43.738  1.00 51.99  ? 102  ASP A C   1 
ATOM   567  O O   . ASP A 1 78  ? 28.847  15.361  43.029  1.00 51.99  ? 102  ASP A O   1 
ATOM   568  C CB  . ASP A 1 78  ? 25.858  15.924  44.573  1.00 98.02  ? 102  ASP A CB  1 
ATOM   569  C CG  . ASP A 1 78  ? 25.556  17.392  44.763  1.00 98.02  ? 102  ASP A CG  1 
ATOM   570  O OD1 . ASP A 1 78  ? 24.389  17.803  44.582  1.00 98.02  ? 102  ASP A OD1 1 
ATOM   571  O OD2 . ASP A 1 78  ? 26.491  18.142  45.098  1.00 98.02  ? 102  ASP A OD2 1 
ATOM   572  N N   . THR A 1 79  ? 28.254  17.426  43.611  1.00 82.31  ? 103  THR A N   1 
ATOM   573  C CA  . THR A 1 79  ? 29.056  18.052  42.582  1.00 82.31  ? 103  THR A CA  1 
ATOM   574  C C   . THR A 1 79  ? 30.452  17.474  42.516  1.00 82.31  ? 103  THR A C   1 
ATOM   575  O O   . THR A 1 79  ? 31.058  17.424  41.443  1.00 82.31  ? 103  THR A O   1 
ATOM   576  C CB  . THR A 1 79  ? 29.169  19.554  42.820  1.00 76.52  ? 103  THR A CB  1 
ATOM   577  O OG1 . THR A 1 79  ? 29.618  19.797  44.158  1.00 76.52  ? 103  THR A OG1 1 
ATOM   578  C CG2 . THR A 1 79  ? 27.824  20.216  42.621  1.00 76.52  ? 103  THR A CG2 1 
ATOM   579  N N   . TYR A 1 80  ? 30.958  17.030  43.660  1.00 67.84  ? 104  TYR A N   1 
ATOM   580  C CA  . TYR A 1 80  ? 32.304  16.477  43.722  1.00 67.84  ? 104  TYR A CA  1 
ATOM   581  C C   . TYR A 1 80  ? 32.370  15.045  43.203  1.00 67.84  ? 104  TYR A C   1 
ATOM   582  O O   . TYR A 1 80  ? 33.210  14.710  42.367  1.00 67.84  ? 104  TYR A O   1 
ATOM   583  C CB  . TYR A 1 80  ? 32.825  16.528  45.155  1.00 84.52  ? 104  TYR A CB  1 
ATOM   584  C CG  . TYR A 1 80  ? 34.256  16.057  45.301  1.00 84.52  ? 104  TYR A CG  1 
ATOM   585  C CD1 . TYR A 1 80  ? 35.302  16.764  44.720  1.00 84.52  ? 104  TYR A CD1 1 
ATOM   586  C CD2 . TYR A 1 80  ? 34.565  14.916  46.028  1.00 84.52  ? 104  TYR A CD2 1 
ATOM   587  C CE1 . TYR A 1 80  ? 36.615  16.351  44.863  1.00 84.52  ? 104  TYR A CE1 1 
ATOM   588  C CE2 . TYR A 1 80  ? 35.877  14.501  46.170  1.00 84.52  ? 104  TYR A CE2 1 
ATOM   589  C CZ  . TYR A 1 80  ? 36.892  15.227  45.586  1.00 84.52  ? 104  TYR A CZ  1 
ATOM   590  O OH  . TYR A 1 80  ? 38.192  14.830  45.729  1.00 84.52  ? 104  TYR A OH  1 
ATOM   591  N N   . ALA A 1 81  ? 31.491  14.195  43.714  1.00 61.36  ? 105  ALA A N   1 
ATOM   592  C CA  . ALA A 1 81  ? 31.461  12.814  43.273  1.00 61.36  ? 105  ALA A CA  1 
ATOM   593  C C   . ALA A 1 81  ? 31.230  12.837  41.770  1.00 61.36  ? 105  ALA A C   1 
ATOM   594  O O   . ALA A 1 81  ? 31.845  12.083  41.021  1.00 61.36  ? 105  ALA A O   1 
ATOM   595  C CB  . ALA A 1 81  ? 30.342  12.087  43.955  1.00 84.98  ? 105  ALA A CB  1 
ATOM   596  N N   . LEU A 1 82  ? 30.338  13.722  41.341  1.00 56.20  ? 106  LEU A N   1 
ATOM   597  C CA  . LEU A 1 82  ? 30.015  13.865  39.938  1.00 56.20  ? 106  LEU A CA  1 
ATOM   598  C C   . LEU A 1 82  ? 31.306  14.051  39.152  1.00 56.20  ? 106  LEU A C   1 
ATOM   599  O O   . LEU A 1 82  ? 31.584  13.302  38.213  1.00 56.20  ? 106  LEU A O   1 
ATOM   600  C CB  . LEU A 1 82  ? 29.097  15.063  39.747  1.00 59.08  ? 106  LEU A CB  1 
ATOM   601  C CG  . LEU A 1 82  ? 28.084  14.966  38.611  1.00 59.08  ? 106  LEU A CG  1 
ATOM   602  C CD1 . LEU A 1 82  ? 27.248  16.205  38.647  1.00 59.08  ? 106  LEU A CD1 1 
ATOM   603  C CD2 . LEU A 1 82  ? 28.758  14.824  37.264  1.00 59.08  ? 106  LEU A CD2 1 
ATOM   604  N N   . GLU A 1 83  ? 32.100  15.043  39.540  1.00 82.68  ? 107  GLU A N   1 
ATOM   605  C CA  . GLU A 1 83  ? 33.365  15.294  38.858  1.00 82.68  ? 107  GLU A CA  1 
ATOM   606  C C   . GLU A 1 83  ? 34.232  14.029  38.853  1.00 82.68  ? 107  GLU A C   1 
ATOM   607  O O   . GLU A 1 83  ? 34.753  13.619  37.814  1.00 82.68  ? 107  GLU A O   1 
ATOM   608  C CB  . GLU A 1 83  ? 34.122  16.448  39.533  1.00 198.61 ? 107  GLU A CB  1 
ATOM   609  C CG  . GLU A 1 83  ? 33.453  17.817  39.389  1.00 198.61 ? 107  GLU A CG  1 
ATOM   610  C CD  . GLU A 1 83  ? 34.324  18.962  39.900  1.00 198.61 ? 107  GLU A CD  1 
ATOM   611  O OE1 . GLU A 1 83  ? 35.472  19.094  39.423  1.00 198.61 ? 107  GLU A OE1 1 
ATOM   612  O OE2 . GLU A 1 83  ? 33.861  19.733  40.770  1.00 198.61 ? 107  GLU A OE2 1 
ATOM   613  N N   . GLN A 1 84  ? 34.379  13.407  40.018  1.00 63.45  ? 108  GLN A N   1 
ATOM   614  C CA  . GLN A 1 84  ? 35.178  12.193  40.142  1.00 63.45  ? 108  GLN A CA  1 
ATOM   615  C C   . GLN A 1 84  ? 34.657  11.135  39.186  1.00 63.45  ? 108  GLN A C   1 
ATOM   616  O O   . GLN A 1 84  ? 35.430  10.539  38.447  1.00 63.45  ? 108  GLN A O   1 
ATOM   617  C CB  . GLN A 1 84  ? 35.096  11.659  41.570  1.00 101.98 ? 108  GLN A CB  1 
ATOM   618  C CG  . GLN A 1 84  ? 35.653  12.599  42.617  1.00 101.98 ? 108  GLN A CG  1 
ATOM   619  C CD  . GLN A 1 84  ? 37.167  12.589  42.653  1.00 101.98 ? 108  GLN A CD  1 
ATOM   620  O OE1 . GLN A 1 84  ? 37.781  11.600  43.055  1.00 101.98 ? 108  GLN A OE1 1 
ATOM   621  N NE2 . GLN A 1 84  ? 37.778  13.689  42.232  1.00 101.98 ? 108  GLN A NE2 1 
ATOM   622  N N   . SER A 1 85  ? 33.339  10.919  39.214  1.00 64.64  ? 109  SER A N   1 
ATOM   623  C CA  . SER A 1 85  ? 32.673  9.926   38.382  1.00 64.64  ? 109  SER A CA  1 
ATOM   624  C C   . SER A 1 85  ? 33.008  10.101  36.928  1.00 64.64  ? 109  SER A C   1 
ATOM   625  O O   . SER A 1 85  ? 32.940  9.156   36.159  1.00 64.64  ? 109  SER A O   1 
ATOM   626  C CB  . SER A 1 85  ? 31.169  10.004  38.571  1.00 87.85  ? 109  SER A CB  1 
ATOM   627  O OG  . SER A 1 85  ? 30.836  9.649   39.897  1.00 87.85  ? 109  SER A OG  1 
ATOM   628  N N   . LEU A 1 86  ? 33.377  11.316  36.547  1.00 69.19  ? 110  LEU A N   1 
ATOM   629  C CA  . LEU A 1 86  ? 33.744  11.579  35.166  1.00 69.19  ? 110  LEU A CA  1 
ATOM   630  C C   . LEU A 1 86  ? 34.898  10.652  34.840  1.00 69.19  ? 110  LEU A C   1 
ATOM   631  O O   . LEU A 1 86  ? 35.145  10.325  33.688  1.00 69.19  ? 110  LEU A O   1 
ATOM   632  C CB  . LEU A 1 86  ? 34.170  13.031  35.013  1.00 68.18  ? 110  LEU A CB  1 
ATOM   633  C CG  . LEU A 1 86  ? 33.643  13.772  33.783  1.00 68.18  ? 110  LEU A CG  1 
ATOM   634  C CD1 . LEU A 1 86  ? 32.216  13.387  33.478  1.00 68.18  ? 110  LEU A CD1 1 
ATOM   635  C CD2 . LEU A 1 86  ? 33.723  15.258  34.057  1.00 68.18  ? 110  LEU A CD2 1 
ATOM   636  N N   . GLU A 1 87  ? 35.589  10.226  35.888  1.00 79.77  ? 111  GLU A N   1 
ATOM   637  C CA  . GLU A 1 87  ? 36.711  9.315   35.777  1.00 79.77  ? 111  GLU A CA  1 
ATOM   638  C C   . GLU A 1 87  ? 36.248  8.016   35.111  1.00 79.77  ? 111  GLU A C   1 
ATOM   639  O O   . GLU A 1 87  ? 36.958  7.447   34.295  1.00 79.77  ? 111  GLU A O   1 
ATOM   640  C CB  . GLU A 1 87  ? 37.243  8.995   37.172  1.00 172.23 ? 111  GLU A CB  1 
ATOM   641  C CG  . GLU A 1 87  ? 38.656  8.480   37.205  1.00 172.23 ? 111  GLU A CG  1 
ATOM   642  C CD  . GLU A 1 87  ? 39.660  9.573   36.937  1.00 172.23 ? 111  GLU A CD  1 
ATOM   643  O OE1 . GLU A 1 87  ? 40.877  9.279   36.948  1.00 172.23 ? 111  GLU A OE1 1 
ATOM   644  O OE2 . GLU A 1 87  ? 39.227  10.727  36.717  1.00 172.23 ? 111  GLU A OE2 1 
ATOM   645  N N   . PHE A 1 88  ? 35.053  7.546   35.453  1.00 79.45  ? 112  PHE A N   1 
ATOM   646  C CA  . PHE A 1 88  ? 34.564  6.290   34.897  1.00 79.45  ? 112  PHE A CA  1 
ATOM   647  C C   . PHE A 1 88  ? 34.067  6.357   33.464  1.00 79.45  ? 112  PHE A C   1 
ATOM   648  O O   . PHE A 1 88  ? 34.336  5.452   32.694  1.00 79.45  ? 112  PHE A O   1 
ATOM   649  C CB  . PHE A 1 88  ? 33.438  5.691   35.754  1.00 54.21  ? 112  PHE A CB  1 
ATOM   650  C CG  . PHE A 1 88  ? 33.720  5.668   37.237  1.00 54.21  ? 112  PHE A CG  1 
ATOM   651  C CD1 . PHE A 1 88  ? 33.014  6.513   38.097  1.00 54.21  ? 112  PHE A CD1 1 
ATOM   652  C CD2 . PHE A 1 88  ? 34.646  4.785   37.772  1.00 54.21  ? 112  PHE A CD2 1 
ATOM   653  C CE1 . PHE A 1 88  ? 33.220  6.477   39.457  1.00 54.21  ? 112  PHE A CE1 1 
ATOM   654  C CE2 . PHE A 1 88  ? 34.859  4.743   39.132  1.00 54.21  ? 112  PHE A CE2 1 
ATOM   655  C CZ  . PHE A 1 88  ? 34.145  5.590   39.979  1.00 54.21  ? 112  PHE A CZ  1 
ATOM   656  N N   . VAL A 1 89  ? 33.320  7.390   33.093  1.00 78.76  ? 113  VAL A N   1 
ATOM   657  C CA  . VAL A 1 89  ? 32.825  7.450   31.717  1.00 78.76  ? 113  VAL A CA  1 
ATOM   658  C C   . VAL A 1 89  ? 33.994  7.667   30.787  1.00 78.76  ? 113  VAL A C   1 
ATOM   659  O O   . VAL A 1 89  ? 34.002  7.180   29.663  1.00 78.76  ? 113  VAL A O   1 
ATOM   660  C CB  . VAL A 1 89  ? 31.823  8.598   31.480  1.00 76.65  ? 113  VAL A CB  1 
ATOM   661  C CG1 . VAL A 1 89  ? 30.647  8.482   32.441  1.00 76.65  ? 113  VAL A CG1 1 
ATOM   662  C CG2 . VAL A 1 89  ? 32.512  9.930   31.639  1.00 76.65  ? 113  VAL A CG2 1 
ATOM   663  N N   . ARG A 1 90  ? 34.981  8.413   31.267  1.00 96.06  ? 114  ARG A N   1 
ATOM   664  C CA  . ARG A 1 90  ? 36.178  8.697   30.495  1.00 96.06  ? 114  ARG A CA  1 
ATOM   665  C C   . ARG A 1 90  ? 36.926  7.375   30.362  1.00 96.06  ? 114  ARG A C   1 
ATOM   666  O O   . ARG A 1 90  ? 37.660  7.157   29.410  1.00 96.06  ? 114  ARG A O   1 
ATOM   667  C CB  . ARG A 1 90  ? 37.045  9.715   31.241  1.00 193.08 ? 114  ARG A CB  1 
ATOM   668  C CG  . ARG A 1 90  ? 38.215  10.258  30.443  1.00 193.08 ? 114  ARG A CG  1 
ATOM   669  C CD  . ARG A 1 90  ? 39.290  10.851  31.355  1.00 193.08 ? 114  ARG A CD  1 
ATOM   670  N NE  . ARG A 1 90  ? 38.784  11.907  32.233  1.00 193.08 ? 114  ARG A NE  1 
ATOM   671  C CZ  . ARG A 1 90  ? 39.528  12.561  33.124  1.00 193.08 ? 114  ARG A CZ  1 
ATOM   672  N NH1 . ARG A 1 90  ? 40.816  12.271  33.260  1.00 193.08 ? 114  ARG A NH1 1 
ATOM   673  N NH2 . ARG A 1 90  ? 38.985  13.505  33.884  1.00 193.08 ? 114  ARG A NH2 1 
ATOM   674  N N   . ALA A 1 91  ? 36.707  6.486   31.323  1.00 198.88 ? 115  ALA A N   1 
ATOM   675  C CA  . ALA A 1 91  ? 37.371  5.189   31.347  1.00 198.88 ? 115  ALA A CA  1 
ATOM   676  C C   . ALA A 1 91  ? 36.808  4.145   30.381  1.00 198.88 ? 115  ALA A C   1 
ATOM   677  O O   . ALA A 1 91  ? 37.210  2.981   30.423  1.00 198.88 ? 115  ALA A O   1 
ATOM   678  C CB  . ALA A 1 91  ? 37.358  4.638   32.772  1.00 187.05 ? 115  ALA A CB  1 
ATOM   679  N N   . SER A 1 92  ? 35.882  4.544   29.516  1.00 157.62 ? 116  SER A N   1 
ATOM   680  C CA  . SER A 1 92  ? 35.312  3.598   28.560  1.00 157.62 ? 116  SER A CA  1 
ATOM   681  C C   . SER A 1 92  ? 36.048  3.641   27.228  1.00 157.62 ? 116  SER A C   1 
ATOM   682  O O   . SER A 1 92  ? 35.935  2.720   26.416  1.00 157.62 ? 116  SER A O   1 
ATOM   683  C CB  . SER A 1 92  ? 33.821  3.877   28.334  1.00 94.47  ? 116  SER A CB  1 
ATOM   684  O OG  . SER A 1 92  ? 33.035  3.308   29.367  1.00 94.47  ? 116  SER A OG  1 
ATOM   685  N N   . LEU A 1 93  ? 36.811  4.708   27.015  1.00 223.57 ? 117  LEU A N   1 
ATOM   686  C CA  . LEU A 1 93  ? 37.571  4.885   25.781  1.00 223.57 ? 117  LEU A CA  1 
ATOM   687  C C   . LEU A 1 93  ? 38.772  3.943   25.705  1.00 223.57 ? 117  LEU A C   1 
ATOM   688  O O   . LEU A 1 93  ? 38.848  3.087   24.822  1.00 223.57 ? 117  LEU A O   1 
ATOM   689  C CB  . LEU A 1 93  ? 38.043  6.339   25.660  1.00 250.02 ? 117  LEU A CB  1 
ATOM   690  C CG  . LEU A 1 93  ? 36.968  7.416   25.452  1.00 250.02 ? 117  LEU A CG  1 
ATOM   691  C CD1 . LEU A 1 93  ? 35.981  7.419   26.616  1.00 250.02 ? 117  LEU A CD1 1 
ATOM   692  C CD2 . LEU A 1 93  ? 37.639  8.776   25.315  1.00 250.02 ? 117  LEU A CD2 1 
ATOM   693  N N   . ILE A 1 114 ? 46.433  3.632   31.193  1.00 218.68 ? 138  ILE A N   1 
ATOM   694  C CA  . ILE A 1 114 ? 46.042  4.388   32.378  1.00 218.68 ? 138  ILE A CA  1 
ATOM   695  C C   . ILE A 1 114 ? 44.529  4.323   32.627  1.00 218.68 ? 138  ILE A C   1 
ATOM   696  O O   . ILE A 1 114 ? 44.088  4.217   33.774  1.00 218.68 ? 138  ILE A O   1 
ATOM   697  C CB  . ILE A 1 114 ? 46.489  5.873   32.265  1.00 198.11 ? 138  ILE A CB  1 
ATOM   698  C CG1 . ILE A 1 114 ? 48.008  5.945   32.077  1.00 198.11 ? 138  ILE A CG1 1 
ATOM   699  C CG2 . ILE A 1 114 ? 46.081  6.651   33.517  1.00 198.11 ? 138  ILE A CG2 1 
ATOM   700  C CD1 . ILE A 1 114 ? 48.806  5.327   33.212  1.00 198.11 ? 138  ILE A CD1 1 
ATOM   701  N N   . PRO A 1 115 ? 43.712  4.385   31.558  1.00 209.34 ? 139  PRO A N   1 
ATOM   702  C CA  . PRO A 1 115 ? 42.255  4.324   31.730  1.00 209.34 ? 139  PRO A CA  1 
ATOM   703  C C   . PRO A 1 115 ? 41.779  2.901   32.027  1.00 209.34 ? 139  PRO A C   1 
ATOM   704  O O   . PRO A 1 115 ? 42.255  1.945   31.415  1.00 209.34 ? 139  PRO A O   1 
ATOM   705  C CB  . PRO A 1 115 ? 41.737  4.842   30.396  1.00 187.83 ? 139  PRO A CB  1 
ATOM   706  C CG  . PRO A 1 115 ? 42.747  4.310   29.440  1.00 187.83 ? 139  PRO A CG  1 
ATOM   707  C CD  . PRO A 1 115 ? 44.055  4.611   30.142  1.00 187.83 ? 139  PRO A CD  1 
ATOM   708  N N   . LEU A 1 116 ? 40.838  2.766   32.959  1.00 240.45 ? 140  LEU A N   1 
ATOM   709  C CA  . LEU A 1 116 ? 40.315  1.454   33.340  1.00 240.45 ? 140  LEU A CA  1 
ATOM   710  C C   . LEU A 1 116 ? 38.924  1.128   32.808  1.00 240.45 ? 140  LEU A C   1 
ATOM   711  O O   . LEU A 1 116 ? 37.963  1.849   33.071  1.00 240.45 ? 140  LEU A O   1 
ATOM   712  C CB  . LEU A 1 116 ? 40.304  1.316   34.862  1.00 162.42 ? 140  LEU A CB  1 
ATOM   713  C CG  . LEU A 1 116 ? 41.612  0.880   35.525  1.00 162.42 ? 140  LEU A CG  1 
ATOM   714  C CD1 . LEU A 1 116 ? 41.438  0.805   37.037  1.00 162.42 ? 140  LEU A CD1 1 
ATOM   715  C CD2 . LEU A 1 116 ? 42.019  -0.482  34.968  1.00 162.42 ? 140  LEU A CD2 1 
ATOM   716  N N   . LEU A 1 117 ? 38.820  0.022   32.077  1.00 160.20 ? 141  LEU A N   1 
ATOM   717  C CA  . LEU A 1 117 ? 37.541  -0.403  31.518  1.00 160.20 ? 141  LEU A CA  1 
ATOM   718  C C   . LEU A 1 117 ? 36.558  -0.764  32.633  1.00 160.20 ? 141  LEU A C   1 
ATOM   719  O O   . LEU A 1 117 ? 36.586  -1.877  33.169  1.00 160.20 ? 141  LEU A O   1 
ATOM   720  C CB  . LEU A 1 117 ? 37.733  -1.612  30.595  1.00 227.05 ? 141  LEU A CB  1 
ATOM   721  C CG  . LEU A 1 117 ? 36.465  -2.153  29.918  1.00 227.05 ? 141  LEU A CG  1 
ATOM   722  C CD1 . LEU A 1 117 ? 35.915  -1.110  28.949  1.00 227.05 ? 141  LEU A CD1 1 
ATOM   723  C CD2 . LEU A 1 117 ? 36.775  -3.450  29.184  1.00 227.05 ? 141  LEU A CD2 1 
ATOM   724  N N   . ILE A 1 118 ? 35.689  0.184   32.974  1.00 107.94 ? 142  ILE A N   1 
ATOM   725  C CA  . ILE A 1 118 ? 34.691  -0.011  34.017  1.00 107.94 ? 142  ILE A CA  1 
ATOM   726  C C   . ILE A 1 118 ? 33.544  -0.897  33.553  1.00 107.94 ? 142  ILE A C   1 
ATOM   727  O O   . ILE A 1 118 ? 33.029  -0.729  32.448  1.00 107.94 ? 142  ILE A O   1 
ATOM   728  C CB  . ILE A 1 118 ? 34.083  1.323   34.443  1.00 93.13  ? 142  ILE A CB  1 
ATOM   729  C CG1 . ILE A 1 118 ? 35.167  2.245   34.974  1.00 93.13  ? 142  ILE A CG1 1 
ATOM   730  C CG2 . ILE A 1 118 ? 33.051  1.093   35.510  1.00 93.13  ? 142  ILE A CG2 1 
ATOM   731  C CD1 . ILE A 1 118 ? 35.860  1.693   36.178  1.00 93.13  ? 142  ILE A CD1 1 
ATOM   732  N N   . ALA A 1 119 ? 33.137  -1.833  34.401  1.00 78.85  ? 143  ALA A N   1 
ATOM   733  C CA  . ALA A 1 119 ? 32.022  -2.722  34.078  1.00 78.85  ? 143  ALA A CA  1 
ATOM   734  C C   . ALA A 1 119 ? 30.733  -2.174  34.708  1.00 78.85  ? 143  ALA A C   1 
ATOM   735  O O   . ALA A 1 119 ? 29.663  -2.153  34.088  1.00 78.85  ? 143  ALA A O   1 
ATOM   736  C CB  . ALA A 1 119 ? 32.304  -4.117  34.602  1.00 89.26  ? 143  ALA A CB  1 
ATOM   737  N N   . GLY A 1 120 ? 30.855  -1.732  35.952  1.00 82.20  ? 144  GLY A N   1 
ATOM   738  C CA  . GLY A 1 120 ? 29.729  -1.176  36.672  1.00 82.20  ? 144  GLY A CA  1 
ATOM   739  C C   . GLY A 1 120 ? 30.241  -0.384  37.858  1.00 82.20  ? 144  GLY A C   1 
ATOM   740  O O   . GLY A 1 120 ? 31.344  -0.621  38.353  1.00 82.20  ? 144  GLY A O   1 
ATOM   741  N N   . VAL A 1 121 ? 29.452  0.574   38.314  1.00 65.10  ? 145  VAL A N   1 
ATOM   742  C CA  . VAL A 1 121 ? 29.857  1.380   39.452  1.00 65.10  ? 145  VAL A CA  1 
ATOM   743  C C   . VAL A 1 121 ? 29.057  0.991   40.677  1.00 65.10  ? 145  VAL A C   1 
ATOM   744  O O   . VAL A 1 121 ? 27.829  0.991   40.652  1.00 65.10  ? 145  VAL A O   1 
ATOM   745  C CB  . VAL A 1 121 ? 29.619  2.865   39.203  1.00 94.17  ? 145  VAL A CB  1 
ATOM   746  C CG1 . VAL A 1 121 ? 29.819  3.626   40.487  1.00 94.17  ? 145  VAL A CG1 1 
ATOM   747  C CG2 . VAL A 1 121 ? 30.567  3.375   38.147  1.00 94.17  ? 145  VAL A CG2 1 
ATOM   748  N N   . ILE A 1 122 ? 29.761  0.645   41.744  1.00 55.09  ? 146  ILE A N   1 
ATOM   749  C CA  . ILE A 1 122 ? 29.131  0.273   42.997  1.00 55.09  ? 146  ILE A CA  1 
ATOM   750  C C   . ILE A 1 122 ? 29.183  1.543   43.783  1.00 55.09  ? 146  ILE A C   1 
ATOM   751  O O   . ILE A 1 122 ? 30.227  1.921   44.280  1.00 55.09  ? 146  ILE A O   1 
ATOM   752  C CB  . ILE A 1 122 ? 29.949  -0.784  43.748  1.00 45.79  ? 146  ILE A CB  1 
ATOM   753  C CG1 . ILE A 1 122 ? 29.807  -2.140  43.055  1.00 45.79  ? 146  ILE A CG1 1 
ATOM   754  C CG2 . ILE A 1 122 ? 29.536  -0.845  45.185  1.00 45.79  ? 146  ILE A CG2 1 
ATOM   755  C CD1 . ILE A 1 122 ? 28.435  -2.752  43.102  1.00 45.79  ? 146  ILE A CD1 1 
ATOM   756  N N   . GLY A 1 123 ? 28.076  2.240   43.891  1.00 58.33  ? 147  GLY A N   1 
ATOM   757  C CA  . GLY A 1 123 ? 28.179  3.447   44.659  1.00 58.33  ? 147  GLY A CA  1 
ATOM   758  C C   . GLY A 1 123 ? 27.042  4.431   44.755  1.00 58.33  ? 147  GLY A C   1 
ATOM   759  O O   . GLY A 1 123 ? 26.037  4.405   44.032  1.00 58.33  ? 147  GLY A O   1 
ATOM   760  N N   . GLY A 1 124 ? 27.264  5.335   45.695  1.00 45.49  ? 148  GLY A N   1 
ATOM   761  C CA  . GLY A 1 124 ? 26.327  6.372   45.953  1.00 45.49  ? 148  GLY A CA  1 
ATOM   762  C C   . GLY A 1 124 ? 25.860  6.182   47.360  1.00 45.49  ? 148  GLY A C   1 
ATOM   763  O O   . GLY A 1 124 ? 24.902  5.472   47.581  1.00 45.49  ? 148  GLY A O   1 
ATOM   764  N N   . SER A 1 125 ? 26.538  6.764   48.330  1.00 44.22  ? 149  SER A N   1 
ATOM   765  C CA  . SER A 1 125 ? 26.016  6.631   49.668  1.00 44.22  ? 149  SER A CA  1 
ATOM   766  C C   . SER A 1 125 ? 24.831  7.615   49.789  1.00 44.22  ? 149  SER A C   1 
ATOM   767  O O   . SER A 1 125 ? 23.673  7.199   49.887  1.00 44.22  ? 149  SER A O   1 
ATOM   768  C CB  . SER A 1 125 ? 27.083  6.937   50.705  1.00 58.11  ? 149  SER A CB  1 
ATOM   769  O OG  . SER A 1 125 ? 27.049  5.943   51.714  1.00 58.11  ? 149  SER A OG  1 
ATOM   770  N N   . TYR A 1 126 ? 25.101  8.917   49.753  1.00 47.53  ? 150  TYR A N   1 
ATOM   771  C CA  . TYR A 1 126 ? 24.005  9.877   49.863  1.00 47.53  ? 150  TYR A CA  1 
ATOM   772  C C   . TYR A 1 126 ? 23.173  9.846   48.588  1.00 47.53  ? 150  TYR A C   1 
ATOM   773  O O   . TYR A 1 126 ? 23.719  9.755   47.499  1.00 47.53  ? 150  TYR A O   1 
ATOM   774  C CB  . TYR A 1 126 ? 24.536  11.301  50.118  1.00 69.52  ? 150  TYR A CB  1 
ATOM   775  C CG  . TYR A 1 126 ? 25.227  11.507  51.461  1.00 69.52  ? 150  TYR A CG  1 
ATOM   776  C CD1 . TYR A 1 126 ? 26.582  11.779  51.526  1.00 69.52  ? 150  TYR A CD1 1 
ATOM   777  C CD2 . TYR A 1 126 ? 24.526  11.407  52.663  1.00 69.52  ? 150  TYR A CD2 1 
ATOM   778  C CE1 . TYR A 1 126 ? 27.229  11.943  52.744  1.00 69.52  ? 150  TYR A CE1 1 
ATOM   779  C CE2 . TYR A 1 126 ? 25.166  11.565  53.895  1.00 69.52  ? 150  TYR A CE2 1 
ATOM   780  C CZ  . TYR A 1 126 ? 26.520  11.829  53.923  1.00 69.52  ? 150  TYR A CZ  1 
ATOM   781  O OH  . TYR A 1 126 ? 27.193  11.930  55.123  1.00 69.52  ? 150  TYR A OH  1 
ATOM   782  N N   . SER A 1 127 ? 21.852  9.913   48.729  1.00 61.18  ? 151  SER A N   1 
ATOM   783  C CA  . SER A 1 127 ? 20.967  9.883   47.569  1.00 61.18  ? 151  SER A CA  1 
ATOM   784  C C   . SER A 1 127 ? 21.398  10.995  46.663  1.00 61.18  ? 151  SER A C   1 
ATOM   785  O O   . SER A 1 127 ? 21.549  10.835  45.443  1.00 61.18  ? 151  SER A O   1 
ATOM   786  C CB  . SER A 1 127 ? 19.526  10.098  48.008  1.00 84.82  ? 151  SER A CB  1 
ATOM   787  O OG  . SER A 1 127 ? 19.086  9.002   48.796  1.00 84.82  ? 151  SER A OG  1 
ATOM   788  N N   . SER A 1 128 ? 21.620  12.124  47.316  1.00 69.22  ? 152  SER A N   1 
ATOM   789  C CA  . SER A 1 128 ? 22.052  13.364  46.692  1.00 69.22  ? 152  SER A CA  1 
ATOM   790  C C   . SER A 1 128 ? 23.070  13.096  45.573  1.00 69.22  ? 152  SER A C   1 
ATOM   791  O O   . SER A 1 128 ? 22.933  13.561  44.445  1.00 69.22  ? 152  SER A O   1 
ATOM   792  C CB  . SER A 1 128 ? 22.646  14.260  47.789  1.00 64.61  ? 152  SER A CB  1 
ATOM   793  O OG  . SER A 1 128 ? 21.943  14.094  49.036  1.00 64.61  ? 152  SER A OG  1 
ATOM   794  N N   . VAL A 1 129 ? 24.082  12.312  45.887  1.00 51.81  ? 153  VAL A N   1 
ATOM   795  C CA  . VAL A 1 129 ? 25.097  12.012  44.905  1.00 51.81  ? 153  VAL A CA  1 
ATOM   796  C C   . VAL A 1 129 ? 24.775  10.838  43.992  1.00 51.81  ? 153  VAL A C   1 
ATOM   797  O O   . VAL A 1 129 ? 25.215  10.804  42.847  1.00 51.81  ? 153  VAL A O   1 
ATOM   798  C CB  . VAL A 1 129 ? 26.499  11.793  45.578  1.00 47.84  ? 153  VAL A CB  1 
ATOM   799  C CG1 . VAL A 1 129 ? 26.360  11.115  46.949  1.00 47.84  ? 153  VAL A CG1 1 
ATOM   800  C CG2 . VAL A 1 129 ? 27.380  10.961  44.662  1.00 47.84  ? 153  VAL A CG2 1 
ATOM   801  N N   . SER A 1 130 ? 24.012  9.870   44.467  1.00 70.24  ? 154  SER A N   1 
ATOM   802  C CA  . SER A 1 130 ? 23.734  8.763   43.589  1.00 70.24  ? 154  SER A CA  1 
ATOM   803  C C   . SER A 1 130 ? 22.986  9.237   42.391  1.00 70.24  ? 154  SER A C   1 
ATOM   804  O O   . SER A 1 130 ? 23.214  8.744   41.289  1.00 70.24  ? 154  SER A O   1 
ATOM   805  C CB  . SER A 1 130 ? 22.947  7.694   44.292  1.00 52.36  ? 154  SER A CB  1 
ATOM   806  O OG  . SER A 1 130 ? 23.859  6.783   44.854  1.00 52.36  ? 154  SER A OG  1 
ATOM   807  N N   . ILE A 1 131 ? 22.102  10.207  42.591  1.00 68.18  ? 155  ILE A N   1 
ATOM   808  C CA  . ILE A 1 131 ? 21.338  10.726  41.466  1.00 68.18  ? 155  ILE A CA  1 
ATOM   809  C C   . ILE A 1 131 ? 22.273  11.478  40.527  1.00 68.18  ? 155  ILE A C   1 
ATOM   810  O O   . ILE A 1 131 ? 22.466  11.088  39.368  1.00 68.18  ? 155  ILE A O   1 
ATOM   811  C CB  . ILE A 1 131 ? 20.249  11.698  41.913  1.00 55.25  ? 155  ILE A CB  1 
ATOM   812  C CG1 . ILE A 1 131 ? 19.360  11.054  42.975  1.00 55.25  ? 155  ILE A CG1 1 
ATOM   813  C CG2 . ILE A 1 131 ? 19.430  12.119  40.706  1.00 55.25  ? 155  ILE A CG2 1 
ATOM   814  C CD1 . ILE A 1 131 ? 18.427  12.035  43.626  1.00 55.25  ? 155  ILE A CD1 1 
ATOM   815  N N   . GLN A 1 132 ? 22.854  12.560  41.035  1.00 67.57  ? 156  GLN A N   1 
ATOM   816  C CA  . GLN A 1 132 ? 23.761  13.352  40.237  1.00 67.57  ? 156  GLN A CA  1 
ATOM   817  C C   . GLN A 1 132 ? 24.674  12.439  39.454  1.00 67.57  ? 156  GLN A C   1 
ATOM   818  O O   . GLN A 1 132 ? 25.031  12.726  38.322  1.00 67.57  ? 156  GLN A O   1 
ATOM   819  C CB  . GLN A 1 132 ? 24.590  14.259  41.128  1.00 118.44 ? 156  GLN A CB  1 
ATOM   820  C CG  . GLN A 1 132 ? 23.992  15.623  41.295  1.00 118.44 ? 156  GLN A CG  1 
ATOM   821  C CD  . GLN A 1 132 ? 23.902  16.367  39.981  1.00 118.44 ? 156  GLN A CD  1 
ATOM   822  O OE1 . GLN A 1 132 ? 23.311  15.868  39.020  1.00 118.44 ? 156  GLN A OE1 1 
ATOM   823  N NE2 . GLN A 1 132 ? 24.487  17.573  39.929  1.00 118.44 ? 156  GLN A NE2 1 
ATOM   824  N N   . VAL A 1 133 ? 25.047  11.324  40.055  1.00 47.81  ? 157  VAL A N   1 
ATOM   825  C CA  . VAL A 1 133 ? 25.927  10.405  39.389  1.00 47.81  ? 157  VAL A CA  1 
ATOM   826  C C   . VAL A 1 133 ? 25.189  9.607   38.352  1.00 47.81  ? 157  VAL A C   1 
ATOM   827  O O   . VAL A 1 133 ? 25.662  9.473   37.232  1.00 47.81  ? 157  VAL A O   1 
ATOM   828  C CB  . VAL A 1 133 ? 26.560  9.465   40.381  1.00 43.21  ? 157  VAL A CB  1 
ATOM   829  C CG1 . VAL A 1 133 ? 27.326  8.390   39.661  1.00 43.21  ? 157  VAL A CG1 1 
ATOM   830  C CG2 . VAL A 1 133 ? 27.476  10.246  41.278  1.00 43.21  ? 157  VAL A CG2 1 
ATOM   831  N N   . ALA A 1 134 ? 24.034  9.073   38.714  1.00 93.07  ? 158  ALA A N   1 
ATOM   832  C CA  . ALA A 1 134 ? 23.258  8.283   37.772  1.00 93.07  ? 158  ALA A CA  1 
ATOM   833  C C   . ALA A 1 134 ? 23.061  9.064   36.479  1.00 93.07  ? 158  ALA A C   1 
ATOM   834  O O   . ALA A 1 134 ? 23.154  8.522   35.374  1.00 93.07  ? 158  ALA A O   1 
ATOM   835  C CB  . ALA A 1 134 ? 21.913  7.935   38.373  1.00 129.98 ? 158  ALA A CB  1 
ATOM   836  N N   . ASN A 1 135 ? 22.803  10.352  36.621  1.00 75.62  ? 159  ASN A N   1 
ATOM   837  C CA  . ASN A 1 135 ? 22.574  11.170  35.460  1.00 75.62  ? 159  ASN A CA  1 
ATOM   838  C C   . ASN A 1 135 ? 23.701  11.116  34.443  1.00 75.62  ? 159  ASN A C   1 
ATOM   839  O O   . ASN A 1 135 ? 23.494  11.415  33.276  1.00 75.62  ? 159  ASN A O   1 
ATOM   840  C CB  . ASN A 1 135 ? 22.310  12.601  35.902  1.00 99.50  ? 159  ASN A CB  1 
ATOM   841  C CG  . ASN A 1 135 ? 21.050  12.713  36.727  1.00 99.50  ? 159  ASN A CG  1 
ATOM   842  O OD1 . ASN A 1 135 ? 20.161  11.872  36.615  1.00 99.50  ? 159  ASN A OD1 1 
ATOM   843  N ND2 . ASN A 1 135 ? 20.952  13.756  37.547  1.00 99.50  ? 159  ASN A ND2 1 
ATOM   844  N N   . LEU A 1 136 ? 24.886  10.711  34.866  1.00 63.82  ? 160  LEU A N   1 
ATOM   845  C CA  . LEU A 1 136 ? 26.010  10.669  33.953  1.00 63.82  ? 160  LEU A CA  1 
ATOM   846  C C   . LEU A 1 136 ? 26.350  9.274   33.407  1.00 63.82  ? 160  LEU A C   1 
ATOM   847  O O   . LEU A 1 136 ? 26.736  9.141   32.237  1.00 63.82  ? 160  LEU A O   1 
ATOM   848  C CB  . LEU A 1 136 ? 27.233  11.260  34.640  1.00 59.56  ? 160  LEU A CB  1 
ATOM   849  C CG  . LEU A 1 136 ? 28.524  11.089  33.849  1.00 59.56  ? 160  LEU A CG  1 
ATOM   850  C CD1 . LEU A 1 136 ? 28.698  12.283  32.952  1.00 59.56  ? 160  LEU A CD1 1 
ATOM   851  C CD2 . LEU A 1 136 ? 29.702  10.942  34.794  1.00 59.56  ? 160  LEU A CD2 1 
ATOM   852  N N   . LEU A 1 137 ? 26.228  8.245   34.247  1.00 59.46  ? 161  LEU A N   1 
ATOM   853  C CA  . LEU A 1 137 ? 26.529  6.873   33.839  1.00 59.46  ? 161  LEU A CA  1 
ATOM   854  C C   . LEU A 1 137 ? 25.606  6.333   32.758  1.00 59.46  ? 161  LEU A C   1 
ATOM   855  O O   . LEU A 1 137 ? 26.003  5.448   31.980  1.00 59.46  ? 161  LEU A O   1 
ATOM   856  C CB  . LEU A 1 137 ? 26.455  5.947   35.041  1.00 81.92  ? 161  LEU A CB  1 
ATOM   857  C CG  . LEU A 1 137 ? 27.691  5.843   35.924  1.00 81.92  ? 161  LEU A CG  1 
ATOM   858  C CD1 . LEU A 1 137 ? 28.808  6.704   35.371  1.00 81.92  ? 161  LEU A CD1 1 
ATOM   859  C CD2 . LEU A 1 137 ? 27.330  6.241   37.326  1.00 81.92  ? 161  LEU A CD2 1 
ATOM   860  N N   . ARG A 1 138 ? 24.372  6.856   32.730  1.00 83.33  ? 162  ARG A N   1 
ATOM   861  C CA  . ARG A 1 138 ? 23.367  6.438   31.755  1.00 83.33  ? 162  ARG A CA  1 
ATOM   862  C C   . ARG A 1 138 ? 23.803  6.909   30.395  1.00 83.33  ? 162  ARG A C   1 
ATOM   863  O O   . ARG A 1 138 ? 23.685  6.186   29.414  1.00 83.33  ? 162  ARG A O   1 
ATOM   864  C CB  . ARG A 1 138 ? 22.000  7.019   32.095  1.00 113.05 ? 162  ARG A CB  1 
ATOM   865  C CG  . ARG A 1 138 ? 21.935  8.516   32.070  1.00 113.05 ? 162  ARG A CG  1 
ATOM   866  C CD  . ARG A 1 138 ? 20.528  8.980   32.417  1.00 113.05 ? 162  ARG A CD  1 
ATOM   867  N NE  . ARG A 1 138 ? 19.532  8.256   31.639  1.00 113.05 ? 162  ARG A NE  1 
ATOM   868  C CZ  . ARG A 1 138 ? 19.334  8.430   30.338  1.00 113.05 ? 162  ARG A CZ  1 
ATOM   869  N NH1 . ARG A 1 138 ? 20.059  9.317   29.673  1.00 113.05 ? 162  ARG A NH1 1 
ATOM   870  N NH2 . ARG A 1 138 ? 18.430  7.701   29.692  1.00 113.05 ? 162  ARG A NH2 1 
ATOM   871  N N   . LEU A 1 139 ? 24.328  8.124   30.341  1.00 90.41  ? 163  LEU A N   1 
ATOM   872  C CA  . LEU A 1 139 ? 24.815  8.674   29.091  1.00 90.41  ? 163  LEU A CA  1 
ATOM   873  C C   . LEU A 1 139 ? 25.912  7.798   28.496  1.00 90.41  ? 163  LEU A C   1 
ATOM   874  O O   . LEU A 1 139 ? 26.285  7.975   27.344  1.00 90.41  ? 163  LEU A O   1 
ATOM   875  C CB  . LEU A 1 139 ? 25.352  10.080  29.313  1.00 99.37  ? 163  LEU A CB  1 
ATOM   876  C CG  . LEU A 1 139 ? 24.361  11.230  29.128  1.00 99.37  ? 163  LEU A CG  1 
ATOM   877  C CD1 . LEU A 1 139 ? 23.111  10.971  29.918  1.00 99.37  ? 163  LEU A CD1 1 
ATOM   878  C CD2 . LEU A 1 139 ? 25.011  12.540  29.563  1.00 99.37  ? 163  LEU A CD2 1 
ATOM   879  N N   . PHE A 1 140 ? 26.436  6.860   29.277  1.00 74.32  ? 164  PHE A N   1 
ATOM   880  C CA  . PHE A 1 140 ? 27.475  5.977   28.776  1.00 74.32  ? 164  PHE A CA  1 
ATOM   881  C C   . PHE A 1 140 ? 27.163  4.525   29.067  1.00 74.32  ? 164  PHE A C   1 
ATOM   882  O O   . PHE A 1 140 ? 28.050  3.669   29.033  1.00 74.32  ? 164  PHE A O   1 
ATOM   883  C CB  . PHE A 1 140 ? 28.816  6.344   29.379  1.00 94.75  ? 164  PHE A CB  1 
ATOM   884  C CG  . PHE A 1 140 ? 29.209  7.743   29.115  1.00 94.75  ? 164  PHE A CG  1 
ATOM   885  C CD1 . PHE A 1 140 ? 28.637  8.783   29.831  1.00 94.75  ? 164  PHE A CD1 1 
ATOM   886  C CD2 . PHE A 1 140 ? 30.117  8.032   28.119  1.00 94.75  ? 164  PHE A CD2 1 
ATOM   887  C CE1 . PHE A 1 140 ? 28.963  10.093  29.554  1.00 94.75  ? 164  PHE A CE1 1 
ATOM   888  C CE2 . PHE A 1 140 ? 30.450  9.334   27.832  1.00 94.75  ? 164  PHE A CE2 1 
ATOM   889  C CZ  . PHE A 1 140 ? 29.872  10.371  28.550  1.00 94.75  ? 164  PHE A CZ  1 
ATOM   890  N N   . GLN A 1 141 ? 25.900  4.251   29.362  1.00 83.66  ? 165  GLN A N   1 
ATOM   891  C CA  . GLN A 1 141 ? 25.462  2.893   29.634  1.00 83.66  ? 165  GLN A CA  1 
ATOM   892  C C   . GLN A 1 141 ? 26.349  2.151   30.625  1.00 83.66  ? 165  GLN A C   1 
ATOM   893  O O   . GLN A 1 141 ? 27.032  1.177   30.272  1.00 83.66  ? 165  GLN A O   1 
ATOM   894  C CB  . GLN A 1 141 ? 25.397  2.120   28.324  1.00 186.56 ? 165  GLN A CB  1 
ATOM   895  C CG  . GLN A 1 141 ? 24.587  2.817   27.270  1.00 186.56 ? 165  GLN A CG  1 
ATOM   896  C CD  . GLN A 1 141 ? 25.020  2.412   25.894  1.00 186.56 ? 165  GLN A CD  1 
ATOM   897  O OE1 . GLN A 1 141 ? 26.163  2.647   25.501  1.00 186.56 ? 165  GLN A OE1 1 
ATOM   898  N NE2 . GLN A 1 141 ? 24.117  1.788   25.149  1.00 186.56 ? 165  GLN A NE2 1 
ATOM   899  N N   . ILE A 1 142 ? 26.351  2.619   31.869  1.00 69.05  ? 166  ILE A N   1 
ATOM   900  C CA  . ILE A 1 142 ? 27.140  1.966   32.890  1.00 69.05  ? 166  ILE A CA  1 
ATOM   901  C C   . ILE A 1 142 ? 26.241  1.580   34.035  1.00 69.05  ? 166  ILE A C   1 
ATOM   902  O O   . ILE A 1 142 ? 25.563  2.418   34.605  1.00 69.05  ? 166  ILE A O   1 
ATOM   903  C CB  . ILE A 1 142 ? 28.260  2.868   33.414  1.00 67.04  ? 166  ILE A CB  1 
ATOM   904  C CG1 . ILE A 1 142 ? 29.325  3.043   32.329  1.00 67.04  ? 166  ILE A CG1 1 
ATOM   905  C CG2 . ILE A 1 142 ? 28.884  2.239   34.654  1.00 67.04  ? 166  ILE A CG2 1 
ATOM   906  C CD1 . ILE A 1 142 ? 30.456  3.955   32.717  1.00 67.04  ? 166  ILE A CD1 1 
ATOM   907  N N   . PRO A 1 143 ? 26.200  0.290   34.370  1.00 60.59  ? 167  PRO A N   1 
ATOM   908  C CA  . PRO A 1 143 ? 25.335  -0.109  35.486  1.00 60.59  ? 167  PRO A CA  1 
ATOM   909  C C   . PRO A 1 143 ? 25.815  0.381   36.867  1.00 60.59  ? 167  PRO A C   1 
ATOM   910  O O   . PRO A 1 143 ? 26.963  0.175   37.270  1.00 60.59  ? 167  PRO A O   1 
ATOM   911  C CB  . PRO A 1 143 ? 25.304  -1.637  35.369  1.00 91.32  ? 167  PRO A CB  1 
ATOM   912  C CG  . PRO A 1 143 ? 26.621  -1.968  34.701  1.00 91.32  ? 167  PRO A CG  1 
ATOM   913  C CD  . PRO A 1 143 ? 26.752  -0.885  33.666  1.00 91.32  ? 167  PRO A CD  1 
ATOM   914  N N   . GLN A 1 144 ? 24.919  1.042   37.583  1.00 81.26  ? 168  GLN A N   1 
ATOM   915  C CA  . GLN A 1 144 ? 25.237  1.558   38.900  1.00 81.26  ? 168  GLN A CA  1 
ATOM   916  C C   . GLN A 1 144 ? 24.423  0.788   39.929  1.00 81.26  ? 168  GLN A C   1 
ATOM   917  O O   . GLN A 1 144 ? 23.329  0.320   39.636  1.00 81.26  ? 168  GLN A O   1 
ATOM   918  C CB  . GLN A 1 144 ? 24.885  3.048   38.968  1.00 60.73  ? 168  GLN A CB  1 
ATOM   919  C CG  . GLN A 1 144 ? 25.233  3.706   40.295  1.00 60.73  ? 168  GLN A CG  1 
ATOM   920  C CD  . GLN A 1 144 ? 24.779  5.144   40.360  1.00 60.73  ? 168  GLN A CD  1 
ATOM   921  O OE1 . GLN A 1 144 ? 24.480  5.760   39.333  1.00 60.73  ? 168  GLN A OE1 1 
ATOM   922  N NE2 . GLN A 1 144 ? 24.741  5.698   41.569  1.00 60.73  ? 168  GLN A NE2 1 
ATOM   923  N N   . ILE A 1 145 ? 24.957  0.653   41.132  1.00 56.05  ? 169  ILE A N   1 
ATOM   924  C CA  . ILE A 1 145 ? 24.250  -0.039  42.195  1.00 56.05  ? 169  ILE A CA  1 
ATOM   925  C C   . ILE A 1 145 ? 24.566  0.650   43.506  1.00 56.05  ? 169  ILE A C   1 
ATOM   926  O O   . ILE A 1 145 ? 25.726  0.708   43.902  1.00 56.05  ? 169  ILE A O   1 
ATOM   927  C CB  . ILE A 1 145 ? 24.726  -1.440  42.326  1.00 55.19  ? 169  ILE A CB  1 
ATOM   928  C CG1 . ILE A 1 145 ? 24.624  -2.123  40.986  1.00 55.19  ? 169  ILE A CG1 1 
ATOM   929  C CG2 . ILE A 1 145 ? 23.938  -2.152  43.386  1.00 55.19  ? 169  ILE A CG2 1 
ATOM   930  C CD1 . ILE A 1 145 ? 25.721  -3.113  40.795  1.00 55.19  ? 169  ILE A CD1 1 
ATOM   931  N N   . SER A 1 146 ? 23.570  1.181   44.197  1.00 46.91  ? 170  SER A N   1 
ATOM   932  C CA  . SER A 1 146 ? 23.891  1.835   45.451  1.00 46.91  ? 170  SER A CA  1 
ATOM   933  C C   . SER A 1 146 ? 23.630  0.902   46.595  1.00 46.91  ? 170  SER A C   1 
ATOM   934  O O   . SER A 1 146 ? 22.729  0.057   46.536  1.00 46.91  ? 170  SER A O   1 
ATOM   935  C CB  . SER A 1 146 ? 23.079  3.107   45.642  1.00 43.54  ? 170  SER A CB  1 
ATOM   936  O OG  . SER A 1 146 ? 23.227  3.591   46.967  1.00 43.54  ? 170  SER A OG  1 
ATOM   937  N N   . TYR A 1 147 ? 24.431  1.062   47.635  1.00 43.87  ? 171  TYR A N   1 
ATOM   938  C CA  . TYR A 1 147 ? 24.317  0.240   48.811  1.00 43.87  ? 171  TYR A CA  1 
ATOM   939  C C   . TYR A 1 147 ? 23.662  1.069   49.891  1.00 43.87  ? 171  TYR A C   1 
ATOM   940  O O   . TYR A 1 147 ? 23.622  0.644   51.037  1.00 43.87  ? 171  TYR A O   1 
ATOM   941  C CB  . TYR A 1 147 ? 25.705  -0.196  49.251  1.00 66.47  ? 171  TYR A CB  1 
ATOM   942  C CG  . TYR A 1 147 ? 26.673  0.969   49.295  1.00 66.47  ? 171  TYR A CG  1 
ATOM   943  C CD1 . TYR A 1 147 ? 26.594  1.936   50.304  1.00 66.47  ? 171  TYR A CD1 1 
ATOM   944  C CD2 . TYR A 1 147 ? 27.618  1.153   48.291  1.00 66.47  ? 171  TYR A CD2 1 
ATOM   945  C CE1 . TYR A 1 147 ? 27.429  3.058   50.306  1.00 66.47  ? 171  TYR A CE1 1 
ATOM   946  C CE2 . TYR A 1 147 ? 28.450  2.267   48.279  1.00 66.47  ? 171  TYR A CE2 1 
ATOM   947  C CZ  . TYR A 1 147 ? 28.345  3.213   49.285  1.00 66.47  ? 171  TYR A CZ  1 
ATOM   948  O OH  . TYR A 1 147 ? 29.130  4.337   49.253  1.00 66.47  ? 171  TYR A OH  1 
ATOM   949  N N   . ALA A 1 148 ? 23.136  2.244   49.555  1.00 45.30  ? 172  ALA A N   1 
ATOM   950  C CA  . ALA A 1 148 ? 22.534  3.055   50.600  1.00 45.30  ? 172  ALA A CA  1 
ATOM   951  C C   . ALA A 1 148 ? 21.642  4.213   50.198  1.00 45.30  ? 172  ALA A C   1 
ATOM   952  O O   . ALA A 1 148 ? 20.862  4.688   51.021  1.00 45.30  ? 172  ALA A O   1 
ATOM   953  C CB  . ALA A 1 148 ? 23.600  3.564   51.508  1.00 20.30  ? 172  ALA A CB  1 
ATOM   954  N N   . SER A 1 149 ? 21.749  4.704   48.971  1.00 55.63  ? 173  SER A N   1 
ATOM   955  C CA  . SER A 1 149 ? 20.887  5.806   48.557  1.00 55.63  ? 173  SER A CA  1 
ATOM   956  C C   . SER A 1 149 ? 19.465  5.346   48.673  1.00 55.63  ? 173  SER A C   1 
ATOM   957  O O   . SER A 1 149 ? 19.117  4.304   48.151  1.00 55.63  ? 173  SER A O   1 
ATOM   958  C CB  . SER A 1 149 ? 21.162  6.168   47.126  1.00 38.45  ? 173  SER A CB  1 
ATOM   959  O OG  . SER A 1 149 ? 22.491  6.598   47.029  1.00 38.45  ? 173  SER A OG  1 
ATOM   960  N N   . THR A 1 150 ? 18.620  6.110   49.335  1.00 60.69  ? 174  THR A N   1 
ATOM   961  C CA  . THR A 1 150 ? 17.267  5.643   49.481  1.00 60.69  ? 174  THR A CA  1 
ATOM   962  C C   . THR A 1 150 ? 16.166  6.488   48.884  1.00 60.69  ? 174  THR A C   1 
ATOM   963  O O   . THR A 1 150 ? 15.013  6.093   48.960  1.00 60.69  ? 174  THR A O   1 
ATOM   964  C CB  . THR A 1 150 ? 16.943  5.397   50.958  1.00 58.84  ? 174  THR A CB  1 
ATOM   965  O OG1 . THR A 1 150 ? 17.647  6.346   51.750  1.00 58.84  ? 174  THR A OG1 1 
ATOM   966  C CG2 . THR A 1 150 ? 17.375  4.031   51.385  1.00 58.84  ? 174  THR A CG2 1 
ATOM   967  N N   . SER A 1 151 ? 16.490  7.623   48.274  1.00 65.42  ? 175  SER A N   1 
ATOM   968  C CA  . SER A 1 151 ? 15.442  8.486   47.697  1.00 65.42  ? 175  SER A CA  1 
ATOM   969  C C   . SER A 1 151 ? 14.474  7.815   46.716  1.00 65.42  ? 175  SER A C   1 
ATOM   970  O O   . SER A 1 151 ? 14.872  7.123   45.765  1.00 65.42  ? 175  SER A O   1 
ATOM   971  C CB  . SER A 1 151 ? 16.043  9.696   46.996  1.00 95.12  ? 175  SER A CB  1 
ATOM   972  O OG  . SER A 1 151 ? 15.052  10.319  46.198  1.00 95.12  ? 175  SER A OG  1 
ATOM   973  N N   . ALA A 1 152 ? 13.188  8.054   46.948  1.00 79.03  ? 176  ALA A N   1 
ATOM   974  C CA  . ALA A 1 152 ? 12.165  7.470   46.113  1.00 79.03  ? 176  ALA A CA  1 
ATOM   975  C C   . ALA A 1 152 ? 12.390  7.926   44.694  1.00 79.03  ? 176  ALA A C   1 
ATOM   976  O O   . ALA A 1 152 ? 12.073  7.223   43.749  1.00 79.03  ? 176  ALA A O   1 
ATOM   977  C CB  . ALA A 1 152 ? 10.791  7.893   46.601  1.00 212.55 ? 176  ALA A CB  1 
ATOM   978  N N   . LYS A 1 153 ? 12.970  9.101   44.543  1.00 66.94  ? 177  LYS A N   1 
ATOM   979  C CA  . LYS A 1 153 ? 13.199  9.637   43.215  1.00 66.94  ? 177  LYS A CA  1 
ATOM   980  C C   . LYS A 1 153 ? 13.904  8.626   42.320  1.00 66.94  ? 177  LYS A C   1 
ATOM   981  O O   . LYS A 1 153 ? 13.613  8.521   41.131  1.00 66.94  ? 177  LYS A O   1 
ATOM   982  C CB  . LYS A 1 153 ? 14.013  10.926  43.311  1.00 126.93 ? 177  LYS A CB  1 
ATOM   983  C CG  . LYS A 1 153 ? 13.846  11.863  42.134  1.00 126.93 ? 177  LYS A CG  1 
ATOM   984  C CD  . LYS A 1 153 ? 14.326  13.253  42.514  1.00 126.93 ? 177  LYS A CD  1 
ATOM   985  C CE  . LYS A 1 153 ? 14.140  14.252  41.378  1.00 126.93 ? 177  LYS A CE  1 
ATOM   986  N NZ  . LYS A 1 153 ? 14.649  15.621  41.731  1.00 126.93 ? 177  LYS A NZ  1 
ATOM   987  N N   . LEU A 1 154 ? 14.811  7.857   42.905  1.00 78.97  ? 178  LEU A N   1 
ATOM   988  C CA  . LEU A 1 154 ? 15.572  6.885   42.136  1.00 78.97  ? 178  LEU A CA  1 
ATOM   989  C C   . LEU A 1 154 ? 14.773  5.706   41.654  1.00 78.97  ? 178  LEU A C   1 
ATOM   990  O O   . LEU A 1 154 ? 15.147  5.059   40.691  1.00 78.97  ? 178  LEU A O   1 
ATOM   991  C CB  . LEU A 1 154 ? 16.761  6.374   42.946  1.00 69.36  ? 178  LEU A CB  1 
ATOM   992  C CG  . LEU A 1 154 ? 17.905  7.362   43.144  1.00 69.36  ? 178  LEU A CG  1 
ATOM   993  C CD1 . LEU A 1 154 ? 18.908  6.751   44.090  1.00 69.36  ? 178  LEU A CD1 1 
ATOM   994  C CD2 . LEU A 1 154 ? 18.544  7.692   41.811  1.00 69.36  ? 178  LEU A CD2 1 
ATOM   995  N N   . SER A 1 155 ? 13.676  5.409   42.323  1.00 62.03  ? 179  SER A N   1 
ATOM   996  C CA  . SER A 1 155 ? 12.871  4.270   41.908  1.00 62.03  ? 179  SER A CA  1 
ATOM   997  C C   . SER A 1 155 ? 12.383  4.467   40.477  1.00 62.03  ? 179  SER A C   1 
ATOM   998  O O   . SER A 1 155 ? 12.153  3.493   39.762  1.00 62.03  ? 179  SER A O   1 
ATOM   999  C CB  . SER A 1 155 ? 11.664  4.071   42.852  1.00 89.57  ? 179  SER A CB  1 
ATOM   1000 O OG  . SER A 1 155 ? 12.009  3.500   44.111  1.00 89.57  ? 179  SER A OG  1 
ATOM   1001 N N   . ASP A 1 156 ? 12.234  5.728   40.067  1.00 76.41  ? 180  ASP A N   1 
ATOM   1002 C CA  . ASP A 1 156 ? 11.758  6.073   38.720  1.00 76.41  ? 180  ASP A CA  1 
ATOM   1003 C C   . ASP A 1 156 ? 12.681  5.575   37.599  1.00 76.41  ? 180  ASP A C   1 
ATOM   1004 O O   . ASP A 1 156 ? 13.593  6.275   37.172  1.00 76.41  ? 180  ASP A O   1 
ATOM   1005 C CB  . ASP A 1 156 ? 11.562  7.592   38.630  1.00 108.57 ? 180  ASP A CB  1 
ATOM   1006 C CG  . ASP A 1 156 ? 11.391  8.078   37.210  1.00 108.57 ? 180  ASP A CG  1 
ATOM   1007 O OD1 . ASP A 1 156 ? 10.828  7.327   36.387  1.00 108.57 ? 180  ASP A OD1 1 
ATOM   1008 O OD2 . ASP A 1 156 ? 11.813  9.221   36.928  1.00 108.57 ? 180  ASP A OD2 1 
ATOM   1009 N N   . LYS A 1 157 ? 12.419  4.368   37.110  1.00 77.61  ? 181  LYS A N   1 
ATOM   1010 C CA  . LYS A 1 157 ? 13.259  3.752   36.079  1.00 77.61  ? 181  LYS A CA  1 
ATOM   1011 C C   . LYS A 1 157 ? 13.177  4.331   34.674  1.00 77.61  ? 181  LYS A C   1 
ATOM   1012 O O   . LYS A 1 157 ? 13.607  3.685   33.712  1.00 77.61  ? 181  LYS A O   1 
ATOM   1013 C CB  . LYS A 1 157 ? 13.002  2.235   36.024  1.00 87.09  ? 181  LYS A CB  1 
ATOM   1014 C CG  . LYS A 1 157 ? 13.550  1.467   37.234  1.00 87.09  ? 181  LYS A CG  1 
ATOM   1015 C CD  . LYS A 1 157 ? 15.083  1.468   37.256  1.00 87.09  ? 181  LYS A CD  1 
ATOM   1016 C CE  . LYS A 1 157 ? 15.670  2.044   38.544  1.00 87.09  ? 181  LYS A CE  1 
ATOM   1017 N NZ  . LYS A 1 157 ? 15.216  3.428   38.783  1.00 87.09  ? 181  LYS A NZ  1 
ATOM   1018 N N   . SER A 1 158 ? 12.647  5.544   34.557  1.00 119.65 ? 182  SER A N   1 
ATOM   1019 C CA  . SER A 1 158 ? 12.537  6.198   33.257  1.00 119.65 ? 182  SER A CA  1 
ATOM   1020 C C   . SER A 1 158 ? 13.536  7.340   33.168  1.00 119.65 ? 182  SER A C   1 
ATOM   1021 O O   . SER A 1 158 ? 13.775  7.894   32.094  1.00 119.65 ? 182  SER A O   1 
ATOM   1022 C CB  . SER A 1 158 ? 11.124  6.743   33.049  1.00 139.04 ? 182  SER A CB  1 
ATOM   1023 O OG  . SER A 1 158 ? 10.843  7.785   33.966  1.00 139.04 ? 182  SER A OG  1 
ATOM   1024 N N   . ARG A 1 159 ? 14.106  7.687   34.317  1.00 104.77 ? 183  ARG A N   1 
ATOM   1025 C CA  . ARG A 1 159 ? 15.092  8.754   34.423  1.00 104.77 ? 183  ARG A CA  1 
ATOM   1026 C C   . ARG A 1 159 ? 16.409  8.177   34.916  1.00 104.77 ? 183  ARG A C   1 
ATOM   1027 O O   . ARG A 1 159 ? 17.473  8.741   34.682  1.00 104.77 ? 183  ARG A O   1 
ATOM   1028 C CB  . ARG A 1 159 ? 14.615  9.833   35.402  1.00 186.69 ? 183  ARG A CB  1 
ATOM   1029 C CG  . ARG A 1 159 ? 13.824  10.963  34.768  1.00 186.69 ? 183  ARG A CG  1 
ATOM   1030 C CD  . ARG A 1 159 ? 13.262  11.905  35.822  1.00 186.69 ? 183  ARG A CD  1 
ATOM   1031 N NE  . ARG A 1 159 ? 12.809  13.170  35.244  1.00 186.69 ? 183  ARG A NE  1 
ATOM   1032 C CZ  . ARG A 1 159 ? 13.621  14.135  34.814  1.00 186.69 ? 183  ARG A CZ  1 
ATOM   1033 N NH1 . ARG A 1 159 ? 14.938  13.987  34.895  1.00 186.69 ? 183  ARG A NH1 1 
ATOM   1034 N NH2 . ARG A 1 159 ? 13.118  15.251  34.300  1.00 186.69 ? 183  ARG A NH2 1 
ATOM   1035 N N   . TYR A 1 160 ? 16.329  7.047   35.601  1.00 84.63  ? 184  TYR A N   1 
ATOM   1036 C CA  . TYR A 1 160 ? 17.513  6.415   36.134  1.00 84.63  ? 184  TYR A CA  1 
ATOM   1037 C C   . TYR A 1 160 ? 17.537  4.999   35.634  1.00 84.63  ? 184  TYR A C   1 
ATOM   1038 O O   . TYR A 1 160 ? 17.614  4.063   36.414  1.00 84.63  ? 184  TYR A O   1 
ATOM   1039 C CB  . TYR A 1 160 ? 17.453  6.443   37.657  1.00 60.82  ? 184  TYR A CB  1 
ATOM   1040 C CG  . TYR A 1 160 ? 17.238  7.829   38.199  1.00 60.82  ? 184  TYR A CG  1 
ATOM   1041 C CD1 . TYR A 1 160 ? 16.222  8.083   39.109  1.00 60.82  ? 184  TYR A CD1 1 
ATOM   1042 C CD2 . TYR A 1 160 ? 17.993  8.905   37.721  1.00 60.82  ? 184  TYR A CD2 1 
ATOM   1043 C CE1 . TYR A 1 160 ? 15.942  9.379   39.526  1.00 60.82  ? 184  TYR A CE1 1 
ATOM   1044 C CE2 . TYR A 1 160 ? 17.729  10.204  38.121  1.00 60.82  ? 184  TYR A CE2 1 
ATOM   1045 C CZ  . TYR A 1 160 ? 16.694  10.445  39.023  1.00 60.82  ? 184  TYR A CZ  1 
ATOM   1046 O OH  . TYR A 1 160 ? 16.363  11.746  39.378  1.00 60.82  ? 184  TYR A OH  1 
ATOM   1047 N N   . ASP A 1 161 ? 17.479  4.852   34.319  1.00 88.08  ? 185  ASP A N   1 
ATOM   1048 C CA  . ASP A 1 161 ? 17.460  3.540   33.684  1.00 88.08  ? 185  ASP A CA  1 
ATOM   1049 C C   . ASP A 1 161 ? 18.660  2.620   33.859  1.00 88.08  ? 185  ASP A C   1 
ATOM   1050 O O   . ASP A 1 161 ? 18.597  1.465   33.432  1.00 88.08  ? 185  ASP A O   1 
ATOM   1051 C CB  . ASP A 1 161 ? 17.190  3.687   32.193  1.00 86.11  ? 185  ASP A CB  1 
ATOM   1052 C CG  . ASP A 1 161 ? 18.052  4.735   31.552  1.00 86.11  ? 185  ASP A CG  1 
ATOM   1053 O OD1 . ASP A 1 161 ? 18.145  4.738   30.312  1.00 86.11  ? 185  ASP A OD1 1 
ATOM   1054 O OD2 . ASP A 1 161 ? 18.626  5.563   32.283  1.00 86.11  ? 185  ASP A OD2 1 
ATOM   1055 N N   . TYR A 1 162 ? 19.746  3.103   34.458  1.00 67.09  ? 186  TYR A N   1 
ATOM   1056 C CA  . TYR A 1 162 ? 20.900  2.245   34.650  1.00 67.09  ? 186  TYR A CA  1 
ATOM   1057 C C   . TYR A 1 162 ? 21.276  2.124   36.099  1.00 67.09  ? 186  TYR A C   1 
ATOM   1058 O O   . TYR A 1 162 ? 22.390  1.717   36.421  1.00 67.09  ? 186  TYR A O   1 
ATOM   1059 C CB  . TYR A 1 162 ? 22.094  2.753   33.858  1.00 87.30  ? 186  TYR A CB  1 
ATOM   1060 C CG  . TYR A 1 162 ? 22.102  2.266   32.436  1.00 87.30  ? 186  TYR A CG  1 
ATOM   1061 C CD1 . TYR A 1 162 ? 21.228  2.804   31.487  1.00 87.30  ? 186  TYR A CD1 1 
ATOM   1062 C CD2 . TYR A 1 162 ? 22.940  1.214   32.049  1.00 87.30  ? 186  TYR A CD2 1 
ATOM   1063 C CE1 . TYR A 1 162 ? 21.183  2.299   30.178  1.00 87.30  ? 186  TYR A CE1 1 
ATOM   1064 C CE2 . TYR A 1 162 ? 22.903  0.699   30.748  1.00 87.30  ? 186  TYR A CE2 1 
ATOM   1065 C CZ  . TYR A 1 162 ? 22.024  1.243   29.820  1.00 87.30  ? 186  TYR A CZ  1 
ATOM   1066 O OH  . TYR A 1 162 ? 21.982  0.727   28.546  1.00 87.30  ? 186  TYR A OH  1 
ATOM   1067 N N   . PHE A 1 163 ? 20.336  2.466   36.973  1.00 67.54  ? 187  PHE A N   1 
ATOM   1068 C CA  . PHE A 1 163 ? 20.559  2.413   38.415  1.00 67.54  ? 187  PHE A CA  1 
ATOM   1069 C C   . PHE A 1 163 ? 19.794  1.293   39.071  1.00 67.54  ? 187  PHE A C   1 
ATOM   1070 O O   . PHE A 1 163 ? 18.705  0.929   38.652  1.00 67.54  ? 187  PHE A O   1 
ATOM   1071 C CB  . PHE A 1 163 ? 20.132  3.734   39.069  1.00 67.92  ? 187  PHE A CB  1 
ATOM   1072 C CG  . PHE A 1 163 ? 20.344  3.783   40.565  1.00 67.92  ? 187  PHE A CG  1 
ATOM   1073 C CD1 . PHE A 1 163 ? 21.466  4.383   41.103  1.00 67.92  ? 187  PHE A CD1 1 
ATOM   1074 C CD2 . PHE A 1 163 ? 19.419  3.221   41.436  1.00 67.92  ? 187  PHE A CD2 1 
ATOM   1075 C CE1 . PHE A 1 163 ? 21.659  4.416   42.479  1.00 67.92  ? 187  PHE A CE1 1 
ATOM   1076 C CE2 . PHE A 1 163 ? 19.612  3.254   42.823  1.00 67.92  ? 187  PHE A CE2 1 
ATOM   1077 C CZ  . PHE A 1 163 ? 20.729  3.850   43.336  1.00 67.92  ? 187  PHE A CZ  1 
ATOM   1078 N N   . ALA A 1 164 ? 20.382  0.764   40.126  1.00 64.50  ? 188  ALA A N   1 
ATOM   1079 C CA  . ALA A 1 164 ? 19.779  -0.289  40.913  1.00 64.50  ? 188  ALA A CA  1 
ATOM   1080 C C   . ALA A 1 164 ? 20.387  -0.094  42.286  1.00 64.50  ? 188  ALA A C   1 
ATOM   1081 O O   . ALA A 1 164 ? 21.419  0.555   42.427  1.00 64.50  ? 188  ALA A O   1 
ATOM   1082 C CB  . ALA A 1 164 ? 20.153  -1.659  40.356  1.00 60.30  ? 188  ALA A CB  1 
ATOM   1083 N N   . ARG A 1 165 ? 19.757  -0.619  43.313  1.00 54.34  ? 189  ARG A N   1 
ATOM   1084 C CA  . ARG A 1 165 ? 20.348  -0.467  44.611  1.00 54.34  ? 189  ARG A CA  1 
ATOM   1085 C C   . ARG A 1 165 ? 19.924  -1.650  45.412  1.00 54.34  ? 189  ARG A C   1 
ATOM   1086 O O   . ARG A 1 165 ? 19.018  -2.366  45.015  1.00 54.34  ? 189  ARG A O   1 
ATOM   1087 C CB  . ARG A 1 165 ? 19.887  0.830   45.259  1.00 63.98  ? 189  ARG A CB  1 
ATOM   1088 C CG  . ARG A 1 165 ? 18.496  0.813   45.827  1.00 63.98  ? 189  ARG A CG  1 
ATOM   1089 C CD  . ARG A 1 165 ? 17.571  1.731   45.045  1.00 63.98  ? 189  ARG A CD  1 
ATOM   1090 N NE  . ARG A 1 165 ? 17.217  2.973   45.734  1.00 63.98  ? 189  ARG A NE  1 
ATOM   1091 C CZ  . ARG A 1 165 ? 16.090  3.644   45.499  1.00 63.98  ? 189  ARG A CZ  1 
ATOM   1092 N NH1 . ARG A 1 165 ? 15.221  3.183   44.604  1.00 63.98  ? 189  ARG A NH1 1 
ATOM   1093 N NH2 . ARG A 1 165 ? 15.831  4.778   46.137  1.00 63.98  ? 189  ARG A NH2 1 
ATOM   1094 N N   . THR A 1 166 ? 20.580  -1.871  46.539  1.00 59.78  ? 190  THR A N   1 
ATOM   1095 C CA  . THR A 1 166 ? 20.244  -3.004  47.376  1.00 59.78  ? 190  THR A CA  1 
ATOM   1096 C C   . THR A 1 166 ? 19.561  -2.583  48.667  1.00 59.78  ? 190  THR A C   1 
ATOM   1097 O O   . THR A 1 166 ? 19.649  -3.282  49.665  1.00 59.78  ? 190  THR A O   1 
ATOM   1098 C CB  . THR A 1 166 ? 21.482  -3.759  47.719  1.00 44.67  ? 190  THR A CB  1 
ATOM   1099 O OG1 . THR A 1 166 ? 22.397  -2.857  48.326  1.00 44.67  ? 190  THR A OG1 1 
ATOM   1100 C CG2 . THR A 1 166 ? 22.129  -4.307  46.483  1.00 44.67  ? 190  THR A CG2 1 
ATOM   1101 N N   . VAL A 1 167 ? 18.896  -1.429  48.631  1.00 74.55  ? 191  VAL A N   1 
ATOM   1102 C CA  . VAL A 1 167 ? 18.153  -0.872  49.768  1.00 74.55  ? 191  VAL A CA  1 
ATOM   1103 C C   . VAL A 1 167 ? 16.841  -0.351  49.189  1.00 74.55  ? 191  VAL A C   1 
ATOM   1104 O O   . VAL A 1 167 ? 16.802  0.063   48.043  1.00 74.55  ? 191  VAL A O   1 
ATOM   1105 C CB  . VAL A 1 167 ? 18.888  0.302   50.409  1.00 63.02  ? 191  VAL A CB  1 
ATOM   1106 C CG1 . VAL A 1 167 ? 20.152  -0.168  51.064  1.00 63.02  ? 191  VAL A CG1 1 
ATOM   1107 C CG2 . VAL A 1 167 ? 19.208  1.327   49.350  1.00 63.02  ? 191  VAL A CG2 1 
ATOM   1108 N N   . PRO A 1 168 ? 15.758  -0.342  49.984  1.00 58.39  ? 192  PRO A N   1 
ATOM   1109 C CA  . PRO A 1 168 ? 14.418  0.111   49.596  1.00 58.39  ? 192  PRO A CA  1 
ATOM   1110 C C   . PRO A 1 168 ? 14.211  1.615   49.722  1.00 58.39  ? 192  PRO A C   1 
ATOM   1111 O O   . PRO A 1 168 ? 14.740  2.233   50.642  1.00 58.39  ? 192  PRO A O   1 
ATOM   1112 C CB  . PRO A 1 168 ? 13.540  -0.642  50.565  1.00 66.47  ? 192  PRO A CB  1 
ATOM   1113 C CG  . PRO A 1 168 ? 14.311  -0.468  51.824  1.00 66.47  ? 192  PRO A CG  1 
ATOM   1114 C CD  . PRO A 1 168 ? 15.761  -0.738  51.402  1.00 66.47  ? 192  PRO A CD  1 
ATOM   1115 N N   . PRO A 1 169 ? 13.395  2.210   48.832  1.00 75.01  ? 193  PRO A N   1 
ATOM   1116 C CA  . PRO A 1 169 ? 13.076  3.645   48.790  1.00 75.01  ? 193  PRO A CA  1 
ATOM   1117 C C   . PRO A 1 169 ? 12.425  4.158   50.065  1.00 75.01  ? 193  PRO A C   1 
ATOM   1118 O O   . PRO A 1 169 ? 11.760  3.395   50.762  1.00 75.01  ? 193  PRO A O   1 
ATOM   1119 C CB  . PRO A 1 169 ? 12.127  3.746   47.610  1.00 66.68  ? 193  PRO A CB  1 
ATOM   1120 C CG  . PRO A 1 169 ? 11.387  2.468   47.712  1.00 66.68  ? 193  PRO A CG  1 
ATOM   1121 C CD  . PRO A 1 169 ? 12.488  1.465   47.947  1.00 66.68  ? 193  PRO A CD  1 
ATOM   1122 N N   . ASP A 1 170 ? 12.599  5.449   50.352  1.00 110.40 ? 194  ASP A N   1 
ATOM   1123 C CA  . ASP A 1 170 ? 12.033  6.081   51.546  1.00 110.40 ? 194  ASP A CA  1 
ATOM   1124 C C   . ASP A 1 170 ? 10.508  6.058   51.586  1.00 110.40 ? 194  ASP A C   1 
ATOM   1125 O O   . ASP A 1 170 ? 9.898   6.361   52.615  1.00 110.40 ? 194  ASP A O   1 
ATOM   1126 C CB  . ASP A 1 170 ? 12.504  7.527   51.650  1.00 116.05 ? 194  ASP A CB  1 
ATOM   1127 C CG  . ASP A 1 170 ? 14.002  7.643   51.620  1.00 116.05 ? 194  ASP A CG  1 
ATOM   1128 O OD1 . ASP A 1 170 ? 14.658  6.744   52.209  1.00 116.05 ? 194  ASP A OD1 1 
ATOM   1129 O OD2 . ASP A 1 170 ? 14.498  8.634   51.018  1.00 116.05 ? 194  ASP A OD2 1 
ATOM   1130 N N   . PHE A 1 171 ? 9.896   5.710   50.462  1.00 95.83  ? 195  PHE A N   1 
ATOM   1131 C CA  . PHE A 1 171 ? 8.447   5.623   50.384  1.00 95.83  ? 195  PHE A CA  1 
ATOM   1132 C C   . PHE A 1 171 ? 7.971   4.617   51.429  1.00 95.83  ? 195  PHE A C   1 
ATOM   1133 O O   . PHE A 1 171 ? 6.881   4.735   51.965  1.00 95.83  ? 195  PHE A O   1 
ATOM   1134 C CB  . PHE A 1 171 ? 8.040   5.169   48.985  1.00 173.23 ? 195  PHE A CB  1 
ATOM   1135 C CG  . PHE A 1 171 ? 6.565   5.087   48.782  1.00 173.23 ? 195  PHE A CG  1 
ATOM   1136 C CD1 . PHE A 1 171 ? 5.773   6.221   48.906  1.00 173.23 ? 195  PHE A CD1 1 
ATOM   1137 C CD2 . PHE A 1 171 ? 5.964   3.873   48.457  1.00 173.23 ? 195  PHE A CD2 1 
ATOM   1138 C CE1 . PHE A 1 171 ? 4.399   6.148   48.708  1.00 173.23 ? 195  PHE A CE1 1 
ATOM   1139 C CE2 . PHE A 1 171 ? 4.595   3.780   48.256  1.00 173.23 ? 195  PHE A CE2 1 
ATOM   1140 C CZ  . PHE A 1 171 ? 3.806   4.918   48.380  1.00 173.23 ? 195  PHE A CZ  1 
ATOM   1141 N N   . TYR A 1 172 ? 8.809   3.634   51.724  1.00 88.12  ? 196  TYR A N   1 
ATOM   1142 C CA  . TYR A 1 172 ? 8.469   2.616   52.697  1.00 88.12  ? 196  TYR A CA  1 
ATOM   1143 C C   . TYR A 1 172 ? 8.977   2.944   54.078  1.00 88.12  ? 196  TYR A C   1 
ATOM   1144 O O   . TYR A 1 172 ? 8.592   2.289   55.041  1.00 88.12  ? 196  TYR A O   1 
ATOM   1145 C CB  . TYR A 1 172 ? 9.035   1.268   52.273  1.00 99.03  ? 196  TYR A CB  1 
ATOM   1146 C CG  . TYR A 1 172 ? 8.324   0.688   51.088  1.00 99.03  ? 196  TYR A CG  1 
ATOM   1147 C CD1 . TYR A 1 172 ? 7.961   1.492   50.022  1.00 99.03  ? 196  TYR A CD1 1 
ATOM   1148 C CD2 . TYR A 1 172 ? 8.030   -0.668  51.014  1.00 99.03  ? 196  TYR A CD2 1 
ATOM   1149 C CE1 . TYR A 1 172 ? 7.324   0.967   48.909  1.00 99.03  ? 196  TYR A CE1 1 
ATOM   1150 C CE2 . TYR A 1 172 ? 7.392   -1.205  49.899  1.00 99.03  ? 196  TYR A CE2 1 
ATOM   1151 C CZ  . TYR A 1 172 ? 7.044   -0.376  48.851  1.00 99.03  ? 196  TYR A CZ  1 
ATOM   1152 O OH  . TYR A 1 172 ? 6.425   -0.870  47.729  1.00 99.03  ? 196  TYR A OH  1 
ATOM   1153 N N   . GLN A 1 173 ? 9.853   3.936   54.188  1.00 78.57  ? 197  GLN A N   1 
ATOM   1154 C CA  . GLN A 1 173 ? 10.381  4.305   55.493  1.00 78.57  ? 197  GLN A CA  1 
ATOM   1155 C C   . GLN A 1 173 ? 9.467   5.358   56.069  1.00 78.57  ? 197  GLN A C   1 
ATOM   1156 O O   . GLN A 1 173 ? 9.156   5.338   57.259  1.00 78.57  ? 197  GLN A O   1 
ATOM   1157 C CB  . GLN A 1 173 ? 11.801  4.856   55.382  1.00 70.16  ? 197  GLN A CB  1 
ATOM   1158 C CG  . GLN A 1 173 ? 12.493  5.021   56.736  1.00 70.16  ? 197  GLN A CG  1 
ATOM   1159 C CD  . GLN A 1 173 ? 13.897  5.582   56.607  1.00 70.16  ? 197  GLN A CD  1 
ATOM   1160 O OE1 . GLN A 1 173 ? 14.607  5.749   57.600  1.00 70.16  ? 197  GLN A OE1 1 
ATOM   1161 N NE2 . GLN A 1 173 ? 14.303  5.879   55.371  1.00 70.16  ? 197  GLN A NE2 1 
ATOM   1162 N N   . ALA A 1 174 ? 9.029   6.279   55.219  1.00 94.72  ? 198  ALA A N   1 
ATOM   1163 C CA  . ALA A 1 174 ? 8.134   7.331   55.665  1.00 94.72  ? 198  ALA A CA  1 
ATOM   1164 C C   . ALA A 1 174 ? 6.919   6.656   56.268  1.00 94.72  ? 198  ALA A C   1 
ATOM   1165 O O   . ALA A 1 174 ? 6.477   7.031   57.351  1.00 94.72  ? 198  ALA A O   1 
ATOM   1166 C CB  . ALA A 1 174 ? 7.730   8.210   54.512  1.00 25.56  ? 198  ALA A CB  1 
ATOM   1167 N N   . LYS A 1 175 ? 6.381   5.659   55.568  1.00 64.95  ? 199  LYS A N   1 
ATOM   1168 C CA  . LYS A 1 175 ? 5.245   4.926   56.093  1.00 64.95  ? 199  LYS A CA  1 
ATOM   1169 C C   . LYS A 1 175 ? 5.623   4.442   57.498  1.00 64.95  ? 199  LYS A C   1 
ATOM   1170 O O   . LYS A 1 175 ? 4.970   4.766   58.492  1.00 64.95  ? 199  LYS A O   1 
ATOM   1171 C CB  . LYS A 1 175 ? 4.924   3.722   55.213  1.00 92.58  ? 199  LYS A CB  1 
ATOM   1172 C CG  . LYS A 1 175 ? 4.103   4.043   53.995  1.00 92.58  ? 199  LYS A CG  1 
ATOM   1173 C CD  . LYS A 1 175 ? 3.754   2.772   53.240  1.00 92.58  ? 199  LYS A CD  1 
ATOM   1174 C CE  . LYS A 1 175 ? 2.901   3.053   51.995  1.00 92.58  ? 199  LYS A CE  1 
ATOM   1175 N NZ  . LYS A 1 175 ? 1.483   3.471   52.311  1.00 92.58  ? 199  LYS A NZ  1 
ATOM   1176 N N   . ALA A 1 176 ? 6.688   3.660   57.578  1.00 67.34  ? 200  ALA A N   1 
ATOM   1177 C CA  . ALA A 1 176 ? 7.145   3.154   58.855  1.00 67.34  ? 200  ALA A CA  1 
ATOM   1178 C C   . ALA A 1 176 ? 7.207   4.273   59.898  1.00 67.34  ? 200  ALA A C   1 
ATOM   1179 O O   . ALA A 1 176 ? 6.900   4.068   61.079  1.00 67.34  ? 200  ALA A O   1 
ATOM   1180 C CB  . ALA A 1 176 ? 8.502   2.541   58.688  1.00 62.31  ? 200  ALA A CB  1 
ATOM   1181 N N   . MET A 1 177 ? 7.608   5.459   59.465  1.00 76.92  ? 201  MET A N   1 
ATOM   1182 C CA  . MET A 1 177 ? 7.703   6.567   60.392  1.00 76.92  ? 201  MET A CA  1 
ATOM   1183 C C   . MET A 1 177 ? 6.333   7.067   60.821  1.00 76.92  ? 201  MET A C   1 
ATOM   1184 O O   . MET A 1 177 ? 6.034   7.114   62.009  1.00 76.92  ? 201  MET A O   1 
ATOM   1185 C CB  . MET A 1 177 ? 8.513   7.697   59.775  1.00 82.52  ? 201  MET A CB  1 
ATOM   1186 C CG  . MET A 1 177 ? 9.965   7.343   59.537  1.00 82.52  ? 201  MET A CG  1 
ATOM   1187 S SD  . MET A 1 177 ? 10.885  8.787   58.999  1.00 82.52  ? 201  MET A SD  1 
ATOM   1188 C CE  . MET A 1 177 ? 11.649  9.248   60.541  1.00 82.52  ? 201  MET A CE  1 
ATOM   1189 N N   . ALA A 1 178 ? 5.494   7.439   59.865  1.00 96.86  ? 202  ALA A N   1 
ATOM   1190 C CA  . ALA A 1 178 ? 4.163   7.917   60.210  1.00 96.86  ? 202  ALA A CA  1 
ATOM   1191 C C   . ALA A 1 178 ? 3.445   6.887   61.078  1.00 96.86  ? 202  ALA A C   1 
ATOM   1192 O O   . ALA A 1 178 ? 2.806   7.237   62.068  1.00 96.86  ? 202  ALA A O   1 
ATOM   1193 C CB  . ALA A 1 178 ? 3.352   8.193   58.942  1.00 46.73  ? 202  ALA A CB  1 
ATOM   1194 N N   . GLU A 1 179 ? 3.555   5.614   60.713  1.00 86.03  ? 203  GLU A N   1 
ATOM   1195 C CA  . GLU A 1 179 ? 2.896   4.570   61.479  1.00 86.03  ? 203  GLU A CA  1 
ATOM   1196 C C   . GLU A 1 179 ? 3.402   4.521   62.918  1.00 86.03  ? 203  GLU A C   1 
ATOM   1197 O O   . GLU A 1 179 ? 2.743   3.967   63.791  1.00 86.03  ? 203  GLU A O   1 
ATOM   1198 C CB  . GLU A 1 179 ? 3.065   3.197   60.803  1.00 124.68 ? 203  GLU A CB  1 
ATOM   1199 C CG  . GLU A 1 179 ? 2.191   3.002   59.550  1.00 124.68 ? 203  GLU A CG  1 
ATOM   1200 C CD  . GLU A 1 179 ? 2.062   1.536   59.100  1.00 124.68 ? 203  GLU A CD  1 
ATOM   1201 O OE1 . GLU A 1 179 ? 1.394   1.283   58.069  1.00 124.68 ? 203  GLU A OE1 1 
ATOM   1202 O OE2 . GLU A 1 179 ? 2.618   0.636   59.771  1.00 124.68 ? 203  GLU A OE2 1 
ATOM   1203 N N   . ILE A 1 180 ? 4.566   5.105   63.176  1.00 95.37  ? 204  ILE A N   1 
ATOM   1204 C CA  . ILE A 1 180 ? 5.102   5.105   64.534  1.00 95.37  ? 204  ILE A CA  1 
ATOM   1205 C C   . ILE A 1 180 ? 4.482   6.217   65.366  1.00 95.37  ? 204  ILE A C   1 
ATOM   1206 O O   . ILE A 1 180 ? 4.347   6.093   66.577  1.00 95.37  ? 204  ILE A O   1 
ATOM   1207 C CB  . ILE A 1 180 ? 6.632   5.276   64.547  1.00 64.04  ? 204  ILE A CB  1 
ATOM   1208 C CG1 . ILE A 1 180 ? 7.295   3.980   64.098  1.00 64.04  ? 204  ILE A CG1 1 
ATOM   1209 C CG2 . ILE A 1 180 ? 7.104   5.684   65.944  1.00 64.04  ? 204  ILE A CG2 1 
ATOM   1210 C CD1 . ILE A 1 180 ? 8.715   3.861   64.541  1.00 64.04  ? 204  ILE A CD1 1 
ATOM   1211 N N   . LEU A 1 181 ? 4.113   7.309   64.710  1.00 123.28 ? 205  LEU A N   1 
ATOM   1212 C CA  . LEU A 1 181 ? 3.496   8.427   65.405  1.00 123.28 ? 205  LEU A CA  1 
ATOM   1213 C C   . LEU A 1 181 ? 2.013   8.132   65.559  1.00 123.28 ? 205  LEU A C   1 
ATOM   1214 O O   . LEU A 1 181 ? 1.436   8.337   66.625  1.00 123.28 ? 205  LEU A O   1 
ATOM   1215 C CB  . LEU A 1 181 ? 3.692   9.717   64.615  1.00 80.08  ? 205  LEU A CB  1 
ATOM   1216 C CG  . LEU A 1 181 ? 5.133   9.990   64.187  1.00 80.08  ? 205  LEU A CG  1 
ATOM   1217 C CD1 . LEU A 1 181 ? 5.227   11.433  63.684  1.00 80.08  ? 205  LEU A CD1 1 
ATOM   1218 C CD2 . LEU A 1 181 ? 6.088   9.750   65.363  1.00 80.08  ? 205  LEU A CD2 1 
ATOM   1219 N N   . ARG A 1 182 ? 1.405   7.646   64.485  1.00 87.26  ? 206  ARG A N   1 
ATOM   1220 C CA  . ARG A 1 182 ? -0.005  7.299   64.504  1.00 87.26  ? 206  ARG A CA  1 
ATOM   1221 C C   . ARG A 1 182 ? -0.265  6.274   65.623  1.00 87.26  ? 206  ARG A C   1 
ATOM   1222 O O   . ARG A 1 182 ? -1.379  6.152   66.123  1.00 87.26  ? 206  ARG A O   1 
ATOM   1223 C CB  . ARG A 1 182 ? -0.416  6.740   63.130  1.00 96.85  ? 206  ARG A CB  1 
ATOM   1224 C CG  . ARG A 1 182 ? -1.918  6.419   62.927  1.00 96.85  ? 206  ARG A CG  1 
ATOM   1225 C CD  . ARG A 1 182 ? -2.835  7.643   63.068  1.00 96.85  ? 206  ARG A CD  1 
ATOM   1226 N NE  . ARG A 1 182 ? -3.089  7.980   64.469  1.00 96.85  ? 206  ARG A NE  1 
ATOM   1227 C CZ  . ARG A 1 182 ? -3.610  9.129   64.893  1.00 96.85  ? 206  ARG A CZ  1 
ATOM   1228 N NH1 . ARG A 1 182 ? -3.943  10.071  64.017  1.00 96.85  ? 206  ARG A NH1 1 
ATOM   1229 N NH2 . ARG A 1 182 ? -3.779  9.341   66.199  1.00 96.85  ? 206  ARG A NH2 1 
ATOM   1230 N N   . PHE A 1 183 ? 0.757   5.539   66.035  1.00 88.01  ? 207  PHE A N   1 
ATOM   1231 C CA  . PHE A 1 183 ? 0.546   4.568   67.095  1.00 88.01  ? 207  PHE A CA  1 
ATOM   1232 C C   . PHE A 1 183 ? 0.598   5.252   68.434  1.00 88.01  ? 207  PHE A C   1 
ATOM   1233 O O   . PHE A 1 183 ? -0.030  4.783   69.373  1.00 88.01  ? 207  PHE A O   1 
ATOM   1234 C CB  . PHE A 1 183 ? 1.604   3.468   67.076  1.00 117.37 ? 207  PHE A CB  1 
ATOM   1235 C CG  . PHE A 1 183 ? 1.477   2.480   68.220  1.00 117.37 ? 207  PHE A CG  1 
ATOM   1236 C CD1 . PHE A 1 183 ? 0.475   1.521   68.222  1.00 117.37 ? 207  PHE A CD1 1 
ATOM   1237 C CD2 . PHE A 1 183 ? 2.378   2.503   69.286  1.00 117.37 ? 207  PHE A CD2 1 
ATOM   1238 C CE1 . PHE A 1 183 ? 0.378   0.602   69.264  1.00 117.37 ? 207  PHE A CE1 1 
ATOM   1239 C CE2 . PHE A 1 183 ? 2.285   1.588   70.330  1.00 117.37 ? 207  PHE A CE2 1 
ATOM   1240 C CZ  . PHE A 1 183 ? 1.288   0.637   70.319  1.00 117.37 ? 207  PHE A CZ  1 
ATOM   1241 N N   . PHE A 1 184 ? 1.371   6.335   68.530  1.00 119.05 ? 208  PHE A N   1 
ATOM   1242 C CA  . PHE A 1 184 ? 1.488   7.084   69.781  1.00 119.05 ? 208  PHE A CA  1 
ATOM   1243 C C   . PHE A 1 184 ? 0.707   8.385   69.712  1.00 119.05 ? 208  PHE A C   1 
ATOM   1244 O O   . PHE A 1 184 ? 1.098   9.396   70.300  1.00 119.05 ? 208  PHE A O   1 
ATOM   1245 C CB  . PHE A 1 184 ? 2.943   7.399   70.125  1.00 102.28 ? 208  PHE A CB  1 
ATOM   1246 C CG  . PHE A 1 184 ? 3.726   6.218   70.618  1.00 102.28 ? 208  PHE A CG  1 
ATOM   1247 C CD1 . PHE A 1 184 ? 4.388   5.380   69.726  1.00 102.28 ? 208  PHE A CD1 1 
ATOM   1248 C CD2 . PHE A 1 184 ? 3.823   5.956   71.970  1.00 102.28 ? 208  PHE A CD2 1 
ATOM   1249 C CE1 . PHE A 1 184 ? 5.139   4.299   70.178  1.00 102.28 ? 208  PHE A CE1 1 
ATOM   1250 C CE2 . PHE A 1 184 ? 4.571   4.877   72.426  1.00 102.28 ? 208  PHE A CE2 1 
ATOM   1251 C CZ  . PHE A 1 184 ? 5.230   4.048   71.528  1.00 102.28 ? 208  PHE A CZ  1 
ATOM   1252 N N   . ASN A 1 185 ? -0.398  8.337   68.974  1.00 147.16 ? 209  ASN A N   1 
ATOM   1253 C CA  . ASN A 1 185 ? -1.297  9.468   68.812  1.00 147.16 ? 209  ASN A CA  1 
ATOM   1254 C C   . ASN A 1 185 ? -0.590  10.825  68.764  1.00 147.16 ? 209  ASN A C   1 
ATOM   1255 O O   . ASN A 1 185 ? -1.150  11.848  69.149  1.00 147.16 ? 209  ASN A O   1 
ATOM   1256 C CB  . ASN A 1 185 ? -2.343  9.431   69.932  1.00 219.06 ? 209  ASN A CB  1 
ATOM   1257 C CG  . ASN A 1 185 ? -3.096  8.106   69.970  1.00 219.06 ? 209  ASN A CG  1 
ATOM   1258 O OD1 . ASN A 1 185 ? -2.493  7.051   69.783  1.00 219.06 ? 209  ASN A OD1 1 
ATOM   1259 N ND2 . ASN A 1 185 ? -4.402  8.145   70.224  1.00 219.06 ? 209  ASN A ND2 1 
ATOM   1260 N N   . TRP A 1 186 ? 0.650   10.830  68.295  1.00 115.07 ? 210  TRP A N   1 
ATOM   1261 C CA  . TRP A 1 186 ? 1.390   12.075  68.171  1.00 115.07 ? 210  TRP A CA  1 
ATOM   1262 C C   . TRP A 1 186 ? 0.819   12.781  66.940  1.00 115.07 ? 210  TRP A C   1 
ATOM   1263 O O   . TRP A 1 186 ? 1.455   12.815  65.877  1.00 115.07 ? 210  TRP A O   1 
ATOM   1264 C CB  . TRP A 1 186 ? 2.891   11.788  67.999  1.00 98.77  ? 210  TRP A CB  1 
ATOM   1265 C CG  . TRP A 1 186 ? 3.558   11.308  69.263  1.00 98.77  ? 210  TRP A CG  1 
ATOM   1266 C CD1 . TRP A 1 186 ? 3.377   11.807  70.523  1.00 98.77  ? 210  TRP A CD1 1 
ATOM   1267 C CD2 . TRP A 1 186 ? 4.538   10.276  69.383  1.00 98.77  ? 210  TRP A CD2 1 
ATOM   1268 N NE1 . TRP A 1 186 ? 4.185   11.151  71.421  1.00 98.77  ? 210  TRP A NE1 1 
ATOM   1269 C CE2 . TRP A 1 186 ? 4.909   10.202  70.749  1.00 98.77  ? 210  TRP A CE2 1 
ATOM   1270 C CE3 . TRP A 1 186 ? 5.140   9.402   68.475  1.00 98.77  ? 210  TRP A CE3 1 
ATOM   1271 C CZ2 . TRP A 1 186 ? 5.856   9.294   71.226  1.00 98.77  ? 210  TRP A CZ2 1 
ATOM   1272 C CZ3 . TRP A 1 186 ? 6.084   8.495   68.949  1.00 98.77  ? 210  TRP A CZ3 1 
ATOM   1273 C CH2 . TRP A 1 186 ? 6.430   8.449   70.315  1.00 98.77  ? 210  TRP A CH2 1 
ATOM   1274 N N   . THR A 1 187 ? -0.386  13.336  67.103  1.00 80.51  ? 211  THR A N   1 
ATOM   1275 C CA  . THR A 1 187 ? -1.116  14.016  66.025  1.00 80.51  ? 211  THR A CA  1 
ATOM   1276 C C   . THR A 1 187 ? -0.536  15.361  65.563  1.00 80.51  ? 211  THR A C   1 
ATOM   1277 O O   . THR A 1 187 ? -0.772  15.800  64.432  1.00 80.51  ? 211  THR A O   1 
ATOM   1278 C CB  . THR A 1 187 ? -2.592  14.239  66.431  1.00 177.13 ? 211  THR A CB  1 
ATOM   1279 O OG1 . THR A 1 187 ? -3.169  12.997  66.849  1.00 177.13 ? 211  THR A OG1 1 
ATOM   1280 C CG2 . THR A 1 187 ? -3.394  14.765  65.260  1.00 177.13 ? 211  THR A CG2 1 
ATOM   1281 N N   . TYR A 1 188 ? 0.235   16.002  66.431  1.00 80.56  ? 212  TYR A N   1 
ATOM   1282 C CA  . TYR A 1 188 ? 0.819   17.299  66.122  1.00 80.56  ? 212  TYR A CA  1 
ATOM   1283 C C   . TYR A 1 188 ? 2.318   17.249  66.364  1.00 80.56  ? 212  TYR A C   1 
ATOM   1284 O O   . TYR A 1 188 ? 2.761   17.352  67.504  1.00 80.56  ? 212  TYR A O   1 
ATOM   1285 C CB  . TYR A 1 188 ? 0.173   18.352  67.031  1.00 89.68  ? 212  TYR A CB  1 
ATOM   1286 C CG  . TYR A 1 188 ? 0.535   19.799  66.762  1.00 89.68  ? 212  TYR A CG  1 
ATOM   1287 C CD1 . TYR A 1 188 ? 0.288   20.386  65.517  1.00 89.68  ? 212  TYR A CD1 1 
ATOM   1288 C CD2 . TYR A 1 188 ? 1.065   20.602  67.774  1.00 89.68  ? 212  TYR A CD2 1 
ATOM   1289 C CE1 . TYR A 1 188 ? 0.556   21.739  65.288  1.00 89.68  ? 212  TYR A CE1 1 
ATOM   1290 C CE2 . TYR A 1 188 ? 1.335   21.954  67.555  1.00 89.68  ? 212  TYR A CE2 1 
ATOM   1291 C CZ  . TYR A 1 188 ? 1.078   22.511  66.311  1.00 89.68  ? 212  TYR A CZ  1 
ATOM   1292 O OH  . TYR A 1 188 ? 1.345   23.837  66.091  1.00 89.68  ? 212  TYR A OH  1 
ATOM   1293 N N   . VAL A 1 189 ? 3.100   17.078  65.303  1.00 91.49  ? 213  VAL A N   1 
ATOM   1294 C CA  . VAL A 1 189 ? 4.560   17.036  65.438  1.00 91.49  ? 213  VAL A CA  1 
ATOM   1295 C C   . VAL A 1 189 ? 5.235   17.942  64.415  1.00 91.49  ? 213  VAL A C   1 
ATOM   1296 O O   . VAL A 1 189 ? 4.622   18.320  63.408  1.00 91.49  ? 213  VAL A O   1 
ATOM   1297 C CB  . VAL A 1 189 ? 5.113   15.604  65.286  1.00 80.61  ? 213  VAL A CB  1 
ATOM   1298 C CG1 . VAL A 1 189 ? 4.658   14.761  66.443  1.00 80.61  ? 213  VAL A CG1 1 
ATOM   1299 C CG2 . VAL A 1 189 ? 4.635   14.984  63.987  1.00 80.61  ? 213  VAL A CG2 1 
ATOM   1300 N N   . SER A 1 190 ? 6.488   18.300  64.685  1.00 103.12 ? 214  SER A N   1 
ATOM   1301 C CA  . SER A 1 190 ? 7.247   19.181  63.798  1.00 103.12 ? 214  SER A CA  1 
ATOM   1302 C C   . SER A 1 190 ? 8.259   18.410  62.964  1.00 103.12 ? 214  SER A C   1 
ATOM   1303 O O   . SER A 1 190 ? 8.785   17.387  63.399  1.00 103.12 ? 214  SER A O   1 
ATOM   1304 C CB  . SER A 1 190 ? 7.983   20.262  64.610  1.00 113.18 ? 214  SER A CB  1 
ATOM   1305 O OG  . SER A 1 190 ? 7.112   21.282  65.077  1.00 113.18 ? 214  SER A OG  1 
ATOM   1306 N N   . THR A 1 191 ? 8.535   18.906  61.764  1.00 77.91  ? 215  THR A N   1 
ATOM   1307 C CA  . THR A 1 191 ? 9.492   18.246  60.901  1.00 77.91  ? 215  THR A CA  1 
ATOM   1308 C C   . THR A 1 191 ? 10.617  19.165  60.450  1.00 77.91  ? 215  THR A C   1 
ATOM   1309 O O   . THR A 1 191 ? 10.407  20.337  60.184  1.00 77.91  ? 215  THR A O   1 
ATOM   1310 C CB  . THR A 1 191 ? 8.816   17.667  59.644  1.00 79.58  ? 215  THR A CB  1 
ATOM   1311 O OG1 . THR A 1 191 ? 8.437   18.725  58.753  1.00 79.58  ? 215  THR A OG1 1 
ATOM   1312 C CG2 . THR A 1 191 ? 7.599   16.859  60.042  1.00 79.58  ? 215  THR A CG2 1 
ATOM   1313 N N   . VAL A 1 192 ? 11.819  18.610  60.380  1.00 63.62  ? 216  VAL A N   1 
ATOM   1314 C CA  . VAL A 1 192 ? 12.996  19.328  59.924  1.00 63.62  ? 216  VAL A CA  1 
ATOM   1315 C C   . VAL A 1 192 ? 13.752  18.322  59.048  1.00 63.62  ? 216  VAL A C   1 
ATOM   1316 O O   . VAL A 1 192 ? 14.074  17.214  59.484  1.00 63.62  ? 216  VAL A O   1 
ATOM   1317 C CB  . VAL A 1 192 ? 13.841  19.837  61.124  1.00 76.66  ? 216  VAL A CB  1 
ATOM   1318 C CG1 . VAL A 1 192 ? 13.598  18.979  62.340  1.00 76.66  ? 216  VAL A CG1 1 
ATOM   1319 C CG2 . VAL A 1 192 ? 15.310  19.857  60.765  1.00 76.66  ? 216  VAL A CG2 1 
ATOM   1320 N N   . ALA A 1 193 ? 14.004  18.707  57.801  1.00 74.94  ? 217  ALA A N   1 
ATOM   1321 C CA  . ALA A 1 193 ? 14.657  17.827  56.848  1.00 74.94  ? 217  ALA A CA  1 
ATOM   1322 C C   . ALA A 1 193 ? 15.858  18.422  56.129  1.00 74.94  ? 217  ALA A C   1 
ATOM   1323 O O   . ALA A 1 193 ? 15.821  19.567  55.693  1.00 74.94  ? 217  ALA A O   1 
ATOM   1324 C CB  . ALA A 1 193 ? 13.639  17.383  55.821  1.00 66.06  ? 217  ALA A CB  1 
ATOM   1325 N N   . SER A 1 194 ? 16.918  17.630  55.977  1.00 76.10  ? 218  SER A N   1 
ATOM   1326 C CA  . SER A 1 194 ? 18.113  18.092  55.276  1.00 76.10  ? 218  SER A CA  1 
ATOM   1327 C C   . SER A 1 194 ? 17.739  18.647  53.922  1.00 76.10  ? 218  SER A C   1 
ATOM   1328 O O   . SER A 1 194 ? 16.804  18.178  53.289  1.00 76.10  ? 218  SER A O   1 
ATOM   1329 C CB  . SER A 1 194 ? 19.097  16.945  55.048  1.00 87.44  ? 218  SER A CB  1 
ATOM   1330 O OG  . SER A 1 194 ? 19.749  16.569  56.239  1.00 87.44  ? 218  SER A OG  1 
ATOM   1331 N N   . GLU A 1 195 ? 18.459  19.659  53.479  1.00 91.83  ? 219  GLU A N   1 
ATOM   1332 C CA  . GLU A 1 195 ? 18.195  20.201  52.161  1.00 91.83  ? 219  GLU A CA  1 
ATOM   1333 C C   . GLU A 1 195 ? 18.841  19.117  51.301  1.00 91.83  ? 219  GLU A C   1 
ATOM   1334 O O   . GLU A 1 195 ? 19.736  18.409  51.779  1.00 91.83  ? 219  GLU A O   1 
ATOM   1335 C CB  . GLU A 1 195 ? 18.915  21.543  51.986  1.00 179.31 ? 219  GLU A CB  1 
ATOM   1336 C CG  . GLU A 1 195 ? 18.338  22.458  50.910  1.00 179.31 ? 219  GLU A CG  1 
ATOM   1337 C CD  . GLU A 1 195 ? 18.951  23.855  50.939  1.00 179.31 ? 219  GLU A CD  1 
ATOM   1338 O OE1 . GLU A 1 195 ? 20.151  23.991  50.610  1.00 179.31 ? 219  GLU A OE1 1 
ATOM   1339 O OE2 . GLU A 1 195 ? 18.233  24.818  51.299  1.00 179.31 ? 219  GLU A OE2 1 
ATOM   1340 N N   . GLY A 1 196 ? 18.388  18.961  50.061  1.00 114.06 ? 220  GLY A N   1 
ATOM   1341 C CA  . GLY A 1 196 ? 18.968  17.943  49.201  1.00 114.06 ? 220  GLY A CA  1 
ATOM   1342 C C   . GLY A 1 196 ? 18.025  16.791  48.932  1.00 114.06 ? 220  GLY A C   1 
ATOM   1343 O O   . GLY A 1 196 ? 17.268  16.387  49.812  1.00 114.06 ? 220  GLY A O   1 
ATOM   1344 N N   . ASP A 1 197 ? 18.086  16.256  47.716  1.00 96.43  ? 221  ASP A N   1 
ATOM   1345 C CA  . ASP A 1 197 ? 17.224  15.158  47.300  1.00 96.43  ? 221  ASP A CA  1 
ATOM   1346 C C   . ASP A 1 197 ? 16.902  14.118  48.355  1.00 96.43  ? 221  ASP A C   1 
ATOM   1347 O O   . ASP A 1 197 ? 15.843  13.494  48.297  1.00 96.43  ? 221  ASP A O   1 
ATOM   1348 C CB  . ASP A 1 197 ? 17.808  14.443  46.092  1.00 108.85 ? 221  ASP A CB  1 
ATOM   1349 C CG  . ASP A 1 197 ? 17.794  15.290  44.875  1.00 108.85 ? 221  ASP A CG  1 
ATOM   1350 O OD1 . ASP A 1 197 ? 18.817  15.947  44.609  1.00 108.85 ? 221  ASP A OD1 1 
ATOM   1351 O OD2 . ASP A 1 197 ? 16.748  15.310  44.195  1.00 108.85 ? 221  ASP A OD2 1 
ATOM   1352 N N   . TYR A 1 198 ? 17.796  13.906  49.315  1.00 67.46  ? 222  TYR A N   1 
ATOM   1353 C CA  . TYR A 1 198 ? 17.508  12.898  50.323  1.00 67.46  ? 222  TYR A CA  1 
ATOM   1354 C C   . TYR A 1 198 ? 16.440  13.337  51.298  1.00 67.46  ? 222  TYR A C   1 
ATOM   1355 O O   . TYR A 1 198 ? 15.373  12.729  51.373  1.00 67.46  ? 222  TYR A O   1 
ATOM   1356 C CB  . TYR A 1 198 ? 18.751  12.520  51.122  1.00 68.58  ? 222  TYR A CB  1 
ATOM   1357 C CG  . TYR A 1 198 ? 18.399  11.584  52.268  1.00 68.58  ? 222  TYR A CG  1 
ATOM   1358 C CD1 . TYR A 1 198 ? 17.986  10.284  52.029  1.00 68.58  ? 222  TYR A CD1 1 
ATOM   1359 C CD2 . TYR A 1 198 ? 18.420  12.026  53.584  1.00 68.58  ? 222  TYR A CD2 1 
ATOM   1360 C CE1 . TYR A 1 198 ? 17.604  9.460   53.058  1.00 68.58  ? 222  TYR A CE1 1 
ATOM   1361 C CE2 . TYR A 1 198 ? 18.036  11.207  54.619  1.00 68.58  ? 222  TYR A CE2 1 
ATOM   1362 C CZ  . TYR A 1 198 ? 17.629  9.926   54.351  1.00 68.58  ? 222  TYR A CZ  1 
ATOM   1363 O OH  . TYR A 1 198 ? 17.240  9.114   55.391  1.00 68.58  ? 222  TYR A OH  1 
ATOM   1364 N N   . GLY A 1 199 ? 16.753  14.389  52.049  1.00 77.40  ? 223  GLY A N   1 
ATOM   1365 C CA  . GLY A 1 199 ? 15.843  14.908  53.048  1.00 77.40  ? 223  GLY A CA  1 
ATOM   1366 C C   . GLY A 1 199 ? 14.566  15.422  52.444  1.00 77.40  ? 223  GLY A C   1 
ATOM   1367 O O   . GLY A 1 199 ? 13.478  15.118  52.927  1.00 77.40  ? 223  GLY A O   1 
ATOM   1368 N N   . GLU A 1 200 ? 14.688  16.201  51.381  1.00 89.16  ? 224  GLU A N   1 
ATOM   1369 C CA  . GLU A 1 200 ? 13.510  16.753  50.740  1.00 89.16  ? 224  GLU A CA  1 
ATOM   1370 C C   . GLU A 1 200 ? 12.496  15.678  50.367  1.00 89.16  ? 224  GLU A C   1 
ATOM   1371 O O   . GLU A 1 200 ? 11.440  15.585  51.000  1.00 89.16  ? 224  GLU A O   1 
ATOM   1372 C CB  . GLU A 1 200 ? 13.921  17.558  49.509  1.00 157.12 ? 224  GLU A CB  1 
ATOM   1373 C CG  . GLU A 1 200 ? 14.669  18.837  49.858  1.00 157.12 ? 224  GLU A CG  1 
ATOM   1374 C CD  . GLU A 1 200 ? 15.226  19.547  48.645  1.00 157.12 ? 224  GLU A CD  1 
ATOM   1375 O OE1 . GLU A 1 200 ? 14.453  19.816  47.704  1.00 157.12 ? 224  GLU A OE1 1 
ATOM   1376 O OE2 . GLU A 1 200 ? 16.439  19.842  48.635  1.00 157.12 ? 224  GLU A OE2 1 
ATOM   1377 N N   . THR A 1 201 ? 12.827  14.863  49.361  1.00 64.38  ? 225  THR A N   1 
ATOM   1378 C CA  . THR A 1 201 ? 11.943  13.795  48.878  1.00 64.38  ? 225  THR A CA  1 
ATOM   1379 C C   . THR A 1 201 ? 11.499  12.879  50.008  1.00 64.38  ? 225  THR A C   1 
ATOM   1380 O O   . THR A 1 201 ? 10.350  12.421  50.036  1.00 64.38  ? 225  THR A O   1 
ATOM   1381 C CB  . THR A 1 201 ? 12.636  12.915  47.822  1.00 84.47  ? 225  THR A CB  1 
ATOM   1382 O OG1 . THR A 1 201 ? 13.684  12.158  48.450  1.00 84.47  ? 225  THR A OG1 1 
ATOM   1383 C CG2 . THR A 1 201 ? 13.221  13.771  46.703  1.00 84.47  ? 225  THR A CG2 1 
ATOM   1384 N N   . GLY A 1 202 ? 12.429  12.607  50.923  1.00 61.62  ? 226  GLY A N   1 
ATOM   1385 C CA  . GLY A 1 202 ? 12.146  11.745  52.048  1.00 61.62  ? 226  GLY A CA  1 
ATOM   1386 C C   . GLY A 1 202 ? 11.116  12.349  52.976  1.00 61.62  ? 226  GLY A C   1 
ATOM   1387 O O   . GLY A 1 202 ? 10.379  11.640  53.645  1.00 61.62  ? 226  GLY A O   1 
ATOM   1388 N N   . ILE A 1 203 ? 11.047  13.664  53.039  1.00 76.07  ? 227  ILE A N   1 
ATOM   1389 C CA  . ILE A 1 203 ? 10.069  14.246  53.922  1.00 76.07  ? 227  ILE A CA  1 
ATOM   1390 C C   . ILE A 1 203 ? 8.766   14.393  53.176  1.00 76.07  ? 227  ILE A C   1 
ATOM   1391 O O   . ILE A 1 203 ? 7.701   14.188  53.747  1.00 76.07  ? 227  ILE A O   1 
ATOM   1392 C CB  . ILE A 1 203 ? 10.537  15.593  54.459  1.00 56.82  ? 227  ILE A CB  1 
ATOM   1393 C CG1 . ILE A 1 203 ? 10.517  15.555  55.988  1.00 56.82  ? 227  ILE A CG1 1 
ATOM   1394 C CG2 . ILE A 1 203 ? 9.681   16.698  53.923  1.00 56.82  ? 227  ILE A CG2 1 
ATOM   1395 C CD1 . ILE A 1 203 ? 9.265   14.988  56.576  1.00 56.82  ? 227  ILE A CD1 1 
ATOM   1396 N N   . GLU A 1 204 ? 8.846   14.739  51.894  1.00 88.66  ? 228  GLU A N   1 
ATOM   1397 C CA  . GLU A 1 204 ? 7.640   14.891  51.078  1.00 88.66  ? 228  GLU A CA  1 
ATOM   1398 C C   . GLU A 1 204 ? 6.885   13.593  51.155  1.00 88.66  ? 228  GLU A C   1 
ATOM   1399 O O   . GLU A 1 204 ? 5.667   13.548  50.999  1.00 88.66  ? 228  GLU A O   1 
ATOM   1400 C CB  . GLU A 1 204 ? 7.985   15.168  49.624  1.00 157.06 ? 228  GLU A CB  1 
ATOM   1401 C CG  . GLU A 1 204 ? 8.437   16.569  49.361  1.00 157.06 ? 228  GLU A CG  1 
ATOM   1402 C CD  . GLU A 1 204 ? 8.626   16.803  47.893  1.00 157.06 ? 228  GLU A CD  1 
ATOM   1403 O OE1 . GLU A 1 204 ? 7.680   16.489  47.137  1.00 157.06 ? 228  GLU A OE1 1 
ATOM   1404 O OE2 . GLU A 1 204 ? 9.710   17.294  47.499  1.00 157.06 ? 228  GLU A OE2 1 
ATOM   1405 N N   . ALA A 1 205 ? 7.639   12.530  51.392  1.00 88.01  ? 229  ALA A N   1 
ATOM   1406 C CA  . ALA A 1 205 ? 7.074   11.206  51.516  1.00 88.01  ? 229  ALA A CA  1 
ATOM   1407 C C   . ALA A 1 205 ? 6.364   11.144  52.863  1.00 88.01  ? 229  ALA A C   1 
ATOM   1408 O O   . ALA A 1 205 ? 5.225   10.710  52.954  1.00 88.01  ? 229  ALA A O   1 
ATOM   1409 C CB  . ALA A 1 205 ? 8.180   10.169  51.438  1.00 71.76  ? 229  ALA A CB  1 
ATOM   1410 N N   . PHE A 1 206 ? 7.034   11.587  53.913  1.00 72.83  ? 230  PHE A N   1 
ATOM   1411 C CA  . PHE A 1 206 ? 6.415   11.568  55.218  1.00 72.83  ? 230  PHE A CA  1 
ATOM   1412 C C   . PHE A 1 206 ? 5.231   12.522  55.267  1.00 72.83  ? 230  PHE A C   1 
ATOM   1413 O O   . PHE A 1 206 ? 4.203   12.198  55.848  1.00 72.83  ? 230  PHE A O   1 
ATOM   1414 C CB  . PHE A 1 206 ? 7.412   11.975  56.281  1.00 60.61  ? 230  PHE A CB  1 
ATOM   1415 C CG  . PHE A 1 206 ? 6.803   12.165  57.630  1.00 60.61  ? 230  PHE A CG  1 
ATOM   1416 C CD1 . PHE A 1 206 ? 6.352   11.075  58.356  1.00 60.61  ? 230  PHE A CD1 1 
ATOM   1417 C CD2 . PHE A 1 206 ? 6.724   13.434  58.194  1.00 60.61  ? 230  PHE A CD2 1 
ATOM   1418 C CE1 . PHE A 1 206 ? 5.840   11.241  59.631  1.00 60.61  ? 230  PHE A CE1 1 
ATOM   1419 C CE2 . PHE A 1 206 ? 6.216   13.616  59.459  1.00 60.61  ? 230  PHE A CE2 1 
ATOM   1420 C CZ  . PHE A 1 206 ? 5.772   12.516  60.188  1.00 60.61  ? 230  PHE A CZ  1 
ATOM   1421 N N   . GLU A 1 207 ? 5.383   13.702  54.673  1.00 86.56  ? 231  GLU A N   1 
ATOM   1422 C CA  . GLU A 1 207 ? 4.315   14.687  54.670  1.00 86.56  ? 231  GLU A CA  1 
ATOM   1423 C C   . GLU A 1 207 ? 2.992   14.051  54.244  1.00 86.56  ? 231  GLU A C   1 
ATOM   1424 O O   . GLU A 1 207 ? 1.992   14.181  54.948  1.00 86.56  ? 231  GLU A O   1 
ATOM   1425 C CB  . GLU A 1 207 ? 4.659   15.845  53.740  1.00 162.42 ? 231  GLU A CB  1 
ATOM   1426 C CG  . GLU A 1 207 ? 5.892   16.623  54.150  1.00 162.42 ? 231  GLU A CG  1 
ATOM   1427 C CD  . GLU A 1 207 ? 6.077   17.885  53.325  1.00 162.42 ? 231  GLU A CD  1 
ATOM   1428 O OE1 . GLU A 1 207 ? 6.093   17.791  52.078  1.00 162.42 ? 231  GLU A OE1 1 
ATOM   1429 O OE2 . GLU A 1 207 ? 6.208   18.973  53.922  1.00 162.42 ? 231  GLU A OE2 1 
ATOM   1430 N N   . GLN A 1 208 ? 2.986   13.361  53.099  1.00 87.12  ? 232  GLN A N   1 
ATOM   1431 C CA  . GLN A 1 208 ? 1.780   12.689  52.590  1.00 87.12  ? 232  GLN A CA  1 
ATOM   1432 C C   . GLN A 1 208 ? 1.255   11.647  53.581  1.00 87.12  ? 232  GLN A C   1 
ATOM   1433 O O   . GLN A 1 208 ? 0.132   11.737  54.069  1.00 87.12  ? 232  GLN A O   1 
ATOM   1434 C CB  . GLN A 1 208 ? 2.070   11.988  51.262  1.00 203.35 ? 232  GLN A CB  1 
ATOM   1435 C CG  . GLN A 1 208 ? 2.255   12.904  50.075  1.00 203.35 ? 232  GLN A CG  1 
ATOM   1436 C CD  . GLN A 1 208 ? 2.611   12.129  48.820  1.00 203.35 ? 232  GLN A CD  1 
ATOM   1437 O OE1 . GLN A 1 208 ? 1.910   11.188  48.438  1.00 203.35 ? 232  GLN A OE1 1 
ATOM   1438 N NE2 . GLN A 1 208 ? 3.707   12.516  48.174  1.00 203.35 ? 232  GLN A NE2 1 
ATOM   1439 N N   . GLU A 1 209 ? 2.075   10.648  53.874  1.00 88.91  ? 233  GLU A N   1 
ATOM   1440 C CA  . GLU A 1 209 ? 1.680   9.601   54.802  1.00 88.91  ? 233  GLU A CA  1 
ATOM   1441 C C   . GLU A 1 209 ? 1.249   10.210  56.126  1.00 88.91  ? 233  GLU A C   1 
ATOM   1442 O O   . GLU A 1 209 ? 0.532   9.578   56.892  1.00 88.91  ? 233  GLU A O   1 
ATOM   1443 C CB  . GLU A 1 209 ? 2.839   8.623   55.037  1.00 131.90 ? 233  GLU A CB  1 
ATOM   1444 C CG  . GLU A 1 209 ? 3.322   7.897   53.782  1.00 131.90 ? 233  GLU A CG  1 
ATOM   1445 C CD  . GLU A 1 209 ? 2.212   7.124   53.086  1.00 131.90 ? 233  GLU A CD  1 
ATOM   1446 O OE1 . GLU A 1 209 ? 1.556   6.296   53.758  1.00 131.90 ? 233  GLU A OE1 1 
ATOM   1447 O OE2 . GLU A 1 209 ? 1.996   7.342   51.870  1.00 131.90 ? 233  GLU A OE2 1 
ATOM   1448 N N   . ALA A 1 210 ? 1.686   11.437  56.389  1.00 97.81  ? 234  ALA A N   1 
ATOM   1449 C CA  . ALA A 1 210 ? 1.353   12.123  57.630  1.00 97.81  ? 234  ALA A CA  1 
ATOM   1450 C C   . ALA A 1 210 ? -0.098  12.579  57.637  1.00 97.81  ? 234  ALA A C   1 
ATOM   1451 O O   . ALA A 1 210 ? -0.820  12.343  58.607  1.00 97.81  ? 234  ALA A O   1 
ATOM   1452 C CB  . ALA A 1 210 ? 2.267   13.314  57.823  1.00 119.47 ? 234  ALA A CB  1 
ATOM   1453 N N   . ARG A 1 211 ? -0.512  13.240  56.553  1.00 121.11 ? 235  ARG A N   1 
ATOM   1454 C CA  . ARG A 1 211 ? -1.881  13.733  56.407  1.00 121.11 ? 235  ARG A CA  1 
ATOM   1455 C C   . ARG A 1 211 ? -2.843  12.561  56.497  1.00 121.11 ? 235  ARG A C   1 
ATOM   1456 O O   . ARG A 1 211 ? -3.781  12.577  57.292  1.00 121.11 ? 235  ARG A O   1 
ATOM   1457 C CB  . ARG A 1 211 ? -2.074  14.426  55.052  1.00 172.27 ? 235  ARG A CB  1 
ATOM   1458 C CG  . ARG A 1 211 ? -1.192  15.643  54.820  1.00 172.27 ? 235  ARG A CG  1 
ATOM   1459 C CD  . ARG A 1 211 ? -1.412  16.241  53.425  1.00 172.27 ? 235  ARG A CD  1 
ATOM   1460 N NE  . ARG A 1 211 ? -0.462  17.316  53.115  1.00 172.27 ? 235  ARG A NE  1 
ATOM   1461 C CZ  . ARG A 1 211 ? -0.429  17.996  51.968  1.00 172.27 ? 235  ARG A CZ  1 
ATOM   1462 N NH1 . ARG A 1 211 ? -1.296  17.724  51.001  1.00 172.27 ? 235  ARG A NH1 1 
ATOM   1463 N NH2 . ARG A 1 211 ? 0.475   18.951  51.785  1.00 172.27 ? 235  ARG A NH2 1 
ATOM   1464 N N   . LEU A 1 212 ? -2.582  11.538  55.689  1.00 82.37  ? 236  LEU A N   1 
ATOM   1465 C CA  . LEU A 1 212 ? -3.424  10.344  55.631  1.00 82.37  ? 236  LEU A CA  1 
ATOM   1466 C C   . LEU A 1 212 ? -3.769  9.663   56.955  1.00 82.37  ? 236  LEU A C   1 
ATOM   1467 O O   . LEU A 1 212 ? -4.779  8.960   57.045  1.00 82.37  ? 236  LEU A O   1 
ATOM   1468 C CB  . LEU A 1 212 ? -2.804  9.310   54.685  1.00 124.29 ? 236  LEU A CB  1 
ATOM   1469 C CG  . LEU A 1 212 ? -2.383  9.803   53.294  1.00 124.29 ? 236  LEU A CG  1 
ATOM   1470 C CD1 . LEU A 1 212 ? -2.203  8.596   52.381  1.00 124.29 ? 236  LEU A CD1 1 
ATOM   1471 C CD2 . LEU A 1 212 ? -3.426  10.746  52.700  1.00 124.29 ? 236  LEU A CD2 1 
ATOM   1472 N N   . ARG A 1 213 ? -2.945  9.860   57.979  1.00 71.54  ? 237  ARG A N   1 
ATOM   1473 C CA  . ARG A 1 213 ? -3.200  9.231   59.274  1.00 71.54  ? 237  ARG A CA  1 
ATOM   1474 C C   . ARG A 1 213 ? -3.612  10.286  60.286  1.00 71.54  ? 237  ARG A C   1 
ATOM   1475 O O   . ARG A 1 213 ? -3.484  10.088  61.502  1.00 71.54  ? 237  ARG A O   1 
ATOM   1476 C CB  . ARG A 1 213 ? -1.949  8.477   59.760  1.00 107.00 ? 237  ARG A CB  1 
ATOM   1477 C CG  . ARG A 1 213 ? -1.635  7.216   58.949  1.00 107.00 ? 237  ARG A CG  1 
ATOM   1478 C CD  . ARG A 1 213 ? -0.141  6.903   58.894  1.00 107.00 ? 237  ARG A CD  1 
ATOM   1479 N NE  . ARG A 1 213 ? 0.255   6.287   57.620  1.00 107.00 ? 237  ARG A NE  1 
ATOM   1480 C CZ  . ARG A 1 213 ? 0.084   5.004   57.309  1.00 107.00 ? 237  ARG A CZ  1 
ATOM   1481 N NH1 . ARG A 1 213 ? -0.478  4.172   58.183  1.00 107.00 ? 237  ARG A NH1 1 
ATOM   1482 N NH2 . ARG A 1 213 ? 0.474   4.553   56.122  1.00 107.00 ? 237  ARG A NH2 1 
ATOM   1483 N N   . ASN A 1 214 ? -4.120  11.406  59.766  1.00 107.78 ? 238  ASN A N   1 
ATOM   1484 C CA  . ASN A 1 214 ? -4.566  12.541  60.577  1.00 107.78 ? 238  ASN A CA  1 
ATOM   1485 C C   . ASN A 1 214 ? -3.476  13.022  61.529  1.00 107.78 ? 238  ASN A C   1 
ATOM   1486 O O   . ASN A 1 214 ? -3.598  12.918  62.759  1.00 107.78 ? 238  ASN A O   1 
ATOM   1487 C CB  . ASN A 1 214 ? -5.839  12.189  61.360  1.00 118.78 ? 238  ASN A CB  1 
ATOM   1488 C CG  . ASN A 1 214 ? -7.040  11.969  60.450  1.00 118.78 ? 238  ASN A CG  1 
ATOM   1489 O OD1 . ASN A 1 214 ? -7.328  12.788  59.570  1.00 118.78 ? 238  ASN A OD1 1 
ATOM   1490 N ND2 . ASN A 1 214 ? -7.749  10.860  60.659  1.00 118.78 ? 238  ASN A ND2 1 
ATOM   1491 N N   . ILE A 1 215 ? -2.402  13.539  60.931  1.00 127.42 ? 239  ILE A N   1 
ATOM   1492 C CA  . ILE A 1 215 ? -1.257  14.067  61.663  1.00 127.42 ? 239  ILE A CA  1 
ATOM   1493 C C   . ILE A 1 215 ? -0.936  15.442  61.076  1.00 127.42 ? 239  ILE A C   1 
ATOM   1494 O O   . ILE A 1 215 ? -0.600  15.569  59.893  1.00 127.42 ? 239  ILE A O   1 
ATOM   1495 C CB  . ILE A 1 215 ? -0.027  13.123  61.540  1.00 77.69  ? 239  ILE A CB  1 
ATOM   1496 C CG1 . ILE A 1 215 ? -0.393  11.729  62.068  1.00 77.69  ? 239  ILE A CG1 1 
ATOM   1497 C CG2 . ILE A 1 215 ? 1.131   13.666  62.350  1.00 77.69  ? 239  ILE A CG2 1 
ATOM   1498 C CD1 . ILE A 1 215 ? 0.687   10.696  61.945  1.00 77.69  ? 239  ILE A CD1 1 
ATOM   1499 N N   . CYS A 1 216 ? -1.077  16.470  61.912  1.00 100.06 ? 240  CYS A N   1 
ATOM   1500 C CA  . CYS A 1 216 ? -0.823  17.848  61.503  1.00 100.06 ? 240  CYS A CA  1 
ATOM   1501 C C   . CYS A 1 216 ? 0.618   18.217  61.797  1.00 100.06 ? 240  CYS A C   1 
ATOM   1502 O O   . CYS A 1 216 ? 1.146   17.953  62.890  1.00 100.06 ? 240  CYS A O   1 
ATOM   1503 C CB  . CYS A 1 216 ? -1.748  18.820  62.243  1.00 138.06 ? 240  CYS A CB  1 
ATOM   1504 S SG  . CYS A 1 216 ? -3.539  18.590  61.978  1.00 138.06 ? 240  CYS A SG  1 
ATOM   1505 N N   . ILE A 1 217 ? 1.248   18.834  60.806  1.00 97.97  ? 241  ILE A N   1 
ATOM   1506 C CA  . ILE A 1 217 ? 2.633   19.235  60.935  1.00 97.97  ? 241  ILE A CA  1 
ATOM   1507 C C   . ILE A 1 217 ? 2.736   20.660  61.432  1.00 97.97  ? 241  ILE A C   1 
ATOM   1508 O O   . ILE A 1 217 ? 2.393   21.614  60.726  1.00 97.97  ? 241  ILE A O   1 
ATOM   1509 C CB  . ILE A 1 217 ? 3.392   19.061  59.587  1.00 133.42 ? 241  ILE A CB  1 
ATOM   1510 C CG1 . ILE A 1 217 ? 3.794   17.589  59.431  1.00 133.42 ? 241  ILE A CG1 1 
ATOM   1511 C CG2 . ILE A 1 217 ? 4.617   19.967  59.529  1.00 133.42 ? 241  ILE A CG2 1 
ATOM   1512 C CD1 . ILE A 1 217 ? 4.611   17.278  58.196  1.00 133.42 ? 241  ILE A CD1 1 
ATOM   1513 N N   . ALA A 1 218 ? 3.207   20.775  62.671  1.00 89.08  ? 242  ALA A N   1 
ATOM   1514 C CA  . ALA A 1 218 ? 3.391   22.052  63.347  1.00 89.08  ? 242  ALA A CA  1 
ATOM   1515 C C   . ALA A 1 218 ? 4.200   23.020  62.486  1.00 89.08  ? 242  ALA A C   1 
ATOM   1516 O O   . ALA A 1 218 ? 3.643   23.790  61.698  1.00 89.08  ? 242  ALA A O   1 
ATOM   1517 C CB  . ALA A 1 218 ? 4.088   21.819  64.673  1.00 50.48  ? 242  ALA A CB  1 
ATOM   1518 N N   . THR A 1 219 ? 5.516   22.984  62.644  1.00 102.20 ? 243  THR A N   1 
ATOM   1519 C CA  . THR A 1 219 ? 6.380   23.844  61.858  1.00 102.20 ? 243  THR A CA  1 
ATOM   1520 C C   . THR A 1 219 ? 7.223   22.964  60.949  1.00 102.20 ? 243  THR A C   1 
ATOM   1521 O O   . THR A 1 219 ? 7.788   21.971  61.391  1.00 102.20 ? 243  THR A O   1 
ATOM   1522 C CB  . THR A 1 219 ? 7.300   24.682  62.752  1.00 133.95 ? 243  THR A CB  1 
ATOM   1523 O OG1 . THR A 1 219 ? 8.093   25.555  61.936  1.00 133.95 ? 243  THR A OG1 1 
ATOM   1524 C CG2 . THR A 1 219 ? 8.206   23.778  63.569  1.00 133.95 ? 243  THR A CG2 1 
ATOM   1525 N N   . ALA A 1 220 ? 7.288   23.323  59.674  1.00 90.23  ? 244  ALA A N   1 
ATOM   1526 C CA  . ALA A 1 220 ? 8.055   22.557  58.707  1.00 90.23  ? 244  ALA A CA  1 
ATOM   1527 C C   . ALA A 1 220 ? 9.442   23.157  58.550  1.00 90.23  ? 244  ALA A C   1 
ATOM   1528 O O   . ALA A 1 220 ? 9.631   24.082  57.759  1.00 90.23  ? 244  ALA A O   1 
ATOM   1529 C CB  . ALA A 1 220 ? 7.335   22.549  57.360  1.00 135.39 ? 244  ALA A CB  1 
ATOM   1530 N N   . GLU A 1 221 ? 10.407  22.628  59.300  1.00 97.47  ? 245  GLU A N   1 
ATOM   1531 C CA  . GLU A 1 221 ? 11.792  23.102  59.257  1.00 97.47  ? 245  GLU A CA  1 
ATOM   1532 C C   . GLU A 1 221 ? 12.673  22.371  58.248  1.00 97.47  ? 245  GLU A C   1 
ATOM   1533 O O   . GLU A 1 221 ? 12.418  21.216  57.906  1.00 97.47  ? 245  GLU A O   1 
ATOM   1534 C CB  . GLU A 1 221 ? 12.428  22.981  60.642  1.00 153.64 ? 245  GLU A CB  1 
ATOM   1535 C CG  . GLU A 1 221 ? 11.854  23.942  61.641  1.00 153.64 ? 245  GLU A CG  1 
ATOM   1536 C CD  . GLU A 1 221 ? 11.621  25.292  61.018  1.00 153.64 ? 245  GLU A CD  1 
ATOM   1537 O OE1 . GLU A 1 221 ? 12.541  25.794  60.336  1.00 153.64 ? 245  GLU A OE1 1 
ATOM   1538 O OE2 . GLU A 1 221 ? 10.519  25.848  61.203  1.00 153.64 ? 245  GLU A OE2 1 
ATOM   1539 N N   . LYS A 1 222 ? 13.707  23.057  57.767  1.00 100.89 ? 246  LYS A N   1 
ATOM   1540 C CA  . LYS A 1 222 ? 14.638  22.452  56.828  1.00 100.89 ? 246  LYS A CA  1 
ATOM   1541 C C   . LYS A 1 222 ? 15.960  23.212  56.828  1.00 100.89 ? 246  LYS A C   1 
ATOM   1542 O O   . LYS A 1 222 ? 15.986  24.412  56.596  1.00 100.89 ? 246  LYS A O   1 
ATOM   1543 C CB  . LYS A 1 222 ? 14.043  22.417  55.420  1.00 115.37 ? 246  LYS A CB  1 
ATOM   1544 C CG  . LYS A 1 222 ? 14.316  23.630  54.597  1.00 115.37 ? 246  LYS A CG  1 
ATOM   1545 C CD  . LYS A 1 222 ? 14.241  23.293  53.129  1.00 115.37 ? 246  LYS A CD  1 
ATOM   1546 C CE  . LYS A 1 222 ? 14.831  24.414  52.286  1.00 115.37 ? 246  LYS A CE  1 
ATOM   1547 N NZ  . LYS A 1 222 ? 14.778  24.098  50.832  1.00 115.37 ? 246  LYS A NZ  1 
ATOM   1548 N N   . VAL A 1 223 ? 17.052  22.507  57.112  1.00 97.81  ? 247  VAL A N   1 
ATOM   1549 C CA  . VAL A 1 223 ? 18.385  23.103  57.145  1.00 97.81  ? 247  VAL A CA  1 
ATOM   1550 C C   . VAL A 1 223 ? 18.980  23.094  55.743  1.00 97.81  ? 247  VAL A C   1 
ATOM   1551 O O   . VAL A 1 223 ? 18.266  22.809  54.786  1.00 97.81  ? 247  VAL A O   1 
ATOM   1552 C CB  . VAL A 1 223 ? 19.304  22.308  58.040  1.00 67.85  ? 247  VAL A CB  1 
ATOM   1553 C CG1 . VAL A 1 223 ? 18.646  22.104  59.376  1.00 67.85  ? 247  VAL A CG1 1 
ATOM   1554 C CG2 . VAL A 1 223 ? 19.637  20.990  57.374  1.00 67.85  ? 247  VAL A CG2 1 
ATOM   1555 N N   . GLY A 1 224 ? 20.276  23.382  55.614  1.00 157.62 ? 248  GLY A N   1 
ATOM   1556 C CA  . GLY A 1 224 ? 20.869  23.396  54.286  1.00 157.62 ? 248  GLY A CA  1 
ATOM   1557 C C   . GLY A 1 224 ? 22.379  23.338  54.101  1.00 157.62 ? 248  GLY A C   1 
ATOM   1558 O O   . GLY A 1 224 ? 23.106  22.736  54.896  1.00 157.62 ? 248  GLY A O   1 
ATOM   1559 N N   . ARG A 1 225 ? 22.833  23.977  53.019  1.00 194.62 ? 249  ARG A N   1 
ATOM   1560 C CA  . ARG A 1 225 ? 24.244  24.038  52.633  1.00 194.62 ? 249  ARG A CA  1 
ATOM   1561 C C   . ARG A 1 225 ? 25.003  25.167  53.322  1.00 194.62 ? 249  ARG A C   1 
ATOM   1562 O O   . ARG A 1 225 ? 24.417  26.188  53.687  1.00 194.62 ? 249  ARG A O   1 
ATOM   1563 C CB  . ARG A 1 225 ? 24.364  24.244  51.123  1.00 188.56 ? 249  ARG A CB  1 
ATOM   1564 C CG  . ARG A 1 225 ? 23.649  23.224  50.270  1.00 188.56 ? 249  ARG A CG  1 
ATOM   1565 C CD  . ARG A 1 225 ? 23.815  23.579  48.808  1.00 188.56 ? 249  ARG A CD  1 
ATOM   1566 N NE  . ARG A 1 225 ? 23.235  22.577  47.925  1.00 188.56 ? 249  ARG A NE  1 
ATOM   1567 C CZ  . ARG A 1 225 ? 23.318  22.622  46.601  1.00 188.56 ? 249  ARG A CZ  1 
ATOM   1568 N NH1 . ARG A 1 225 ? 23.959  23.625  46.014  1.00 188.56 ? 249  ARG A NH1 1 
ATOM   1569 N NH2 . ARG A 1 225 ? 22.764  21.665  45.864  1.00 188.56 ? 249  ARG A NH2 1 
ATOM   1570 N N   . SER A 1 226 ? 26.315  24.983  53.464  1.00 353.97 ? 250  SER A N   1 
ATOM   1571 C CA  . SER A 1 226 ? 27.198  25.968  54.094  1.00 353.97 ? 250  SER A CA  1 
ATOM   1572 C C   . SER A 1 226 ? 26.577  26.547  55.362  1.00 353.97 ? 250  SER A C   1 
ATOM   1573 O O   . SER A 1 226 ? 26.930  27.645  55.795  1.00 353.97 ? 250  SER A O   1 
ATOM   1574 C CB  . SER A 1 226 ? 27.528  27.100  53.106  1.00 151.10 ? 250  SER A CB  1 
ATOM   1575 O OG  . SER A 1 226 ? 28.450  28.032  53.654  1.00 151.10 ? 250  SER A OG  1 
ATOM   1576 N N   . ASN A 1 227 ? 25.653  25.796  55.953  1.00 211.68 ? 251  ASN A N   1 
ATOM   1577 C CA  . ASN A 1 227 ? 24.982  26.231  57.168  1.00 211.68 ? 251  ASN A CA  1 
ATOM   1578 C C   . ASN A 1 227 ? 25.910  26.154  58.374  1.00 211.68 ? 251  ASN A C   1 
ATOM   1579 O O   . ASN A 1 227 ? 26.679  25.202  58.528  1.00 211.68 ? 251  ASN A O   1 
ATOM   1580 C CB  . ASN A 1 227 ? 23.729  25.384  57.421  1.00 309.96 ? 251  ASN A CB  1 
ATOM   1581 C CG  . ASN A 1 227 ? 22.563  25.775  56.523  1.00 309.96 ? 251  ASN A CG  1 
ATOM   1582 O OD1 . ASN A 1 227 ? 22.669  25.748  55.299  1.00 309.96 ? 251  ASN A OD1 1 
ATOM   1583 N ND2 . ASN A 1 227 ? 21.443  26.140  57.136  1.00 309.96 ? 251  ASN A ND2 1 
ATOM   1584 N N   . ILE A 1 228 ? 25.827  27.172  59.224  1.00 157.44 ? 252  ILE A N   1 
ATOM   1585 C CA  . ILE A 1 228 ? 26.643  27.250  60.425  1.00 157.44 ? 252  ILE A CA  1 
ATOM   1586 C C   . ILE A 1 228 ? 25.719  27.080  61.623  1.00 157.44 ? 252  ILE A C   1 
ATOM   1587 O O   . ILE A 1 228 ? 24.572  26.669  61.473  1.00 157.44 ? 252  ILE A O   1 
ATOM   1588 C CB  . ILE A 1 228 ? 27.358  28.624  60.538  1.00 206.55 ? 252  ILE A CB  1 
ATOM   1589 C CG1 . ILE A 1 228 ? 27.847  29.095  59.161  1.00 206.55 ? 252  ILE A CG1 1 
ATOM   1590 C CG2 . ILE A 1 228 ? 28.545  28.511  61.489  1.00 206.55 ? 252  ILE A CG2 1 
ATOM   1591 C CD1 . ILE A 1 228 ? 26.760  29.673  58.261  1.00 206.55 ? 252  ILE A CD1 1 
ATOM   1592 N N   . ARG A 1 229 ? 26.223  27.410  62.806  1.00 171.97 ? 253  ARG A N   1 
ATOM   1593 C CA  . ARG A 1 229 ? 25.451  27.298  64.038  1.00 171.97 ? 253  ARG A CA  1 
ATOM   1594 C C   . ARG A 1 229 ? 24.136  28.097  64.007  1.00 171.97 ? 253  ARG A C   1 
ATOM   1595 O O   . ARG A 1 229 ? 23.061  27.559  64.294  1.00 171.97 ? 253  ARG A O   1 
ATOM   1596 C CB  . ARG A 1 229 ? 26.302  27.770  65.227  1.00 203.94 ? 253  ARG A CB  1 
ATOM   1597 C CG  . ARG A 1 229 ? 27.658  27.077  65.373  1.00 203.94 ? 253  ARG A CG  1 
ATOM   1598 C CD  . ARG A 1 229 ? 28.396  27.588  66.609  1.00 203.94 ? 253  ARG A CD  1 
ATOM   1599 N NE  . ARG A 1 229 ? 29.653  26.884  66.854  1.00 203.94 ? 253  ARG A NE  1 
ATOM   1600 C CZ  . ARG A 1 229 ? 30.411  27.058  67.935  1.00 203.94 ? 253  ARG A CZ  1 
ATOM   1601 N NH1 . ARG A 1 229 ? 30.041  27.915  68.879  1.00 203.94 ? 253  ARG A NH1 1 
ATOM   1602 N NH2 . ARG A 1 229 ? 31.538  26.373  68.077  1.00 203.94 ? 253  ARG A NH2 1 
ATOM   1603 N N   . LYS A 1 230 ? 24.231  29.379  63.655  1.00 230.99 ? 254  LYS A N   1 
ATOM   1604 C CA  . LYS A 1 230 ? 23.076  30.279  63.607  1.00 230.99 ? 254  LYS A CA  1 
ATOM   1605 C C   . LYS A 1 230 ? 21.843  29.772  62.863  1.00 230.99 ? 254  LYS A C   1 
ATOM   1606 O O   . LYS A 1 230 ? 20.716  30.066  63.262  1.00 230.99 ? 254  LYS A O   1 
ATOM   1607 C CB  . LYS A 1 230 ? 23.488  31.637  63.025  1.00 285.88 ? 254  LYS A CB  1 
ATOM   1608 C CG  . LYS A 1 230 ? 24.425  32.437  63.918  1.00 285.88 ? 254  LYS A CG  1 
ATOM   1609 C CD  . LYS A 1 230 ? 24.739  33.800  63.317  1.00 285.88 ? 254  LYS A CD  1 
ATOM   1610 C CE  . LYS A 1 230 ? 25.684  34.592  64.210  1.00 285.88 ? 254  LYS A CE  1 
ATOM   1611 N NZ  . LYS A 1 230 ? 26.006  35.932  63.645  1.00 285.88 ? 254  LYS A NZ  1 
ATOM   1612 N N   . SER A 1 231 ? 22.040  29.024  61.784  1.00 103.58 ? 255  SER A N   1 
ATOM   1613 C CA  . SER A 1 231 ? 20.899  28.517  61.033  1.00 103.58 ? 255  SER A CA  1 
ATOM   1614 C C   . SER A 1 231 ? 20.317  27.266  61.694  1.00 103.58 ? 255  SER A C   1 
ATOM   1615 O O   . SER A 1 231 ? 19.147  26.939  61.507  1.00 103.58 ? 255  SER A O   1 
ATOM   1616 C CB  . SER A 1 231 ? 21.298  28.224  59.587  1.00 96.16  ? 255  SER A CB  1 
ATOM   1617 O OG  . SER A 1 231 ? 20.168  28.346  58.735  1.00 96.16  ? 255  SER A OG  1 
ATOM   1618 N N   . TYR A 1 232 ? 21.139  26.569  62.469  1.00 89.95  ? 256  TYR A N   1 
ATOM   1619 C CA  . TYR A 1 232 ? 20.683  25.385  63.170  1.00 89.95  ? 256  TYR A CA  1 
ATOM   1620 C C   . TYR A 1 232 ? 19.938  25.822  64.410  1.00 89.95  ? 256  TYR A C   1 
ATOM   1621 O O   . TYR A 1 232 ? 18.871  25.285  64.713  1.00 89.95  ? 256  TYR A O   1 
ATOM   1622 C CB  . TYR A 1 232 ? 21.856  24.465  63.551  1.00 104.62 ? 256  TYR A CB  1 
ATOM   1623 C CG  . TYR A 1 232 ? 22.284  23.577  62.405  1.00 104.62 ? 256  TYR A CG  1 
ATOM   1624 C CD1 . TYR A 1 232 ? 23.170  24.040  61.436  1.00 104.62 ? 256  TYR A CD1 1 
ATOM   1625 C CD2 . TYR A 1 232 ? 21.709  22.315  62.219  1.00 104.62 ? 256  TYR A CD2 1 
ATOM   1626 C CE1 . TYR A 1 232 ? 23.467  23.281  60.311  1.00 104.62 ? 256  TYR A CE1 1 
ATOM   1627 C CE2 . TYR A 1 232 ? 21.996  21.552  61.092  1.00 104.62 ? 256  TYR A CE2 1 
ATOM   1628 C CZ  . TYR A 1 232 ? 22.875  22.047  60.143  1.00 104.62 ? 256  TYR A CZ  1 
ATOM   1629 O OH  . TYR A 1 232 ? 23.149  21.334  59.004  1.00 104.62 ? 256  TYR A OH  1 
ATOM   1630 N N   . ASP A 1 233 ? 20.501  26.793  65.130  1.00 118.56 ? 257  ASP A N   1 
ATOM   1631 C CA  . ASP A 1 233 ? 19.854  27.311  66.334  1.00 118.56 ? 257  ASP A CA  1 
ATOM   1632 C C   . ASP A 1 233 ? 18.524  27.890  65.888  1.00 118.56 ? 257  ASP A C   1 
ATOM   1633 O O   . ASP A 1 233 ? 17.488  27.661  66.521  1.00 118.56 ? 257  ASP A O   1 
ATOM   1634 C CB  . ASP A 1 233 ? 20.702  28.403  66.986  1.00 171.13 ? 257  ASP A CB  1 
ATOM   1635 C CG  . ASP A 1 233 ? 21.847  27.841  67.805  1.00 171.13 ? 257  ASP A CG  1 
ATOM   1636 O OD1 . ASP A 1 233 ? 21.570  27.075  68.757  1.00 171.13 ? 257  ASP A OD1 1 
ATOM   1637 O OD2 . ASP A 1 233 ? 23.017  28.169  67.501  1.00 171.13 ? 257  ASP A OD2 1 
ATOM   1638 N N   . SER A 1 234 ? 18.576  28.633  64.782  1.00 121.00 ? 258  SER A N   1 
ATOM   1639 C CA  . SER A 1 234 ? 17.402  29.250  64.167  1.00 121.00 ? 258  SER A CA  1 
ATOM   1640 C C   . SER A 1 234 ? 16.302  28.191  64.011  1.00 121.00 ? 258  SER A C   1 
ATOM   1641 O O   . SER A 1 234 ? 15.128  28.437  64.285  1.00 121.00 ? 258  SER A O   1 
ATOM   1642 C CB  . SER A 1 234 ? 17.791  29.815  62.798  1.00 151.83 ? 258  SER A CB  1 
ATOM   1643 O OG  . SER A 1 234 ? 16.652  30.168  62.038  1.00 151.83 ? 258  SER A OG  1 
ATOM   1644 N N   . VAL A 1 235 ? 16.703  27.007  63.567  1.00 107.76 ? 259  VAL A N   1 
ATOM   1645 C CA  . VAL A 1 235 ? 15.785  25.895  63.389  1.00 107.76 ? 259  VAL A CA  1 
ATOM   1646 C C   . VAL A 1 235 ? 15.280  25.420  64.744  1.00 107.76 ? 259  VAL A C   1 
ATOM   1647 O O   . VAL A 1 235 ? 14.122  25.038  64.885  1.00 107.76 ? 259  VAL A O   1 
ATOM   1648 C CB  . VAL A 1 235 ? 16.489  24.723  62.695  1.00 91.14  ? 259  VAL A CB  1 
ATOM   1649 C CG1 . VAL A 1 235 ? 15.583  23.499  62.678  1.00 91.14  ? 259  VAL A CG1 1 
ATOM   1650 C CG2 . VAL A 1 235 ? 16.891  25.133  61.295  1.00 91.14  ? 259  VAL A CG2 1 
ATOM   1651 N N   . ILE A 1 236 ? 16.161  25.428  65.737  1.00 108.85 ? 260  ILE A N   1 
ATOM   1652 C CA  . ILE A 1 236 ? 15.775  24.999  67.066  1.00 108.85 ? 260  ILE A CA  1 
ATOM   1653 C C   . ILE A 1 236 ? 14.773  26.003  67.594  1.00 108.85 ? 260  ILE A C   1 
ATOM   1654 O O   . ILE A 1 236 ? 13.722  25.629  68.121  1.00 108.85 ? 260  ILE A O   1 
ATOM   1655 C CB  . ILE A 1 236 ? 16.973  24.946  68.025  1.00 94.52  ? 260  ILE A CB  1 
ATOM   1656 C CG1 . ILE A 1 236 ? 18.004  23.941  67.527  1.00 94.52  ? 260  ILE A CG1 1 
ATOM   1657 C CG2 . ILE A 1 236 ? 16.506  24.485  69.398  1.00 94.52  ? 260  ILE A CG2 1 
ATOM   1658 C CD1 . ILE A 1 236 ? 17.493  22.520  67.566  1.00 94.52  ? 260  ILE A CD1 1 
ATOM   1659 N N   . ARG A 1 237 ? 15.101  27.284  67.449  1.00 121.86 ? 261  ARG A N   1 
ATOM   1660 C CA  . ARG A 1 237 ? 14.209  28.331  67.915  1.00 121.86 ? 261  ARG A CA  1 
ATOM   1661 C C   . ARG A 1 237 ? 12.817  27.986  67.418  1.00 121.86 ? 261  ARG A C   1 
ATOM   1662 O O   . ARG A 1 237 ? 11.909  27.729  68.210  1.00 121.86 ? 261  ARG A O   1 
ATOM   1663 C CB  . ARG A 1 237 ? 14.601  29.708  67.352  1.00 167.56 ? 261  ARG A CB  1 
ATOM   1664 C CG  . ARG A 1 237 ? 15.985  30.222  67.723  1.00 167.56 ? 261  ARG A CG  1 
ATOM   1665 C CD  . ARG A 1 237 ? 16.159  31.721  67.399  1.00 167.56 ? 261  ARG A CD  1 
ATOM   1666 N NE  . ARG A 1 237 ? 15.777  32.087  66.031  1.00 167.56 ? 261  ARG A NE  1 
ATOM   1667 C CZ  . ARG A 1 237 ? 14.549  32.450  65.653  1.00 167.56 ? 261  ARG A CZ  1 
ATOM   1668 N NH1 . ARG A 1 237 ? 13.562  32.501  66.539  1.00 167.56 ? 261  ARG A NH1 1 
ATOM   1669 N NH2 . ARG A 1 237 ? 14.304  32.767  64.384  1.00 167.56 ? 261  ARG A NH2 1 
ATOM   1670 N N   . GLU A 1 238 ? 12.670  27.955  66.094  1.00 99.76  ? 262  GLU A N   1 
ATOM   1671 C CA  . GLU A 1 238 ? 11.386  27.682  65.465  1.00 99.76  ? 262  GLU A CA  1 
ATOM   1672 C C   . GLU A 1 238 ? 10.739  26.384  65.901  1.00 99.76  ? 262  GLU A C   1 
ATOM   1673 O O   . GLU A 1 238 ? 9.532   26.241  65.793  1.00 99.76  ? 262  GLU A O   1 
ATOM   1674 C CB  . GLU A 1 238 ? 11.521  27.737  63.940  1.00 172.83 ? 262  GLU A CB  1 
ATOM   1675 C CG  . GLU A 1 238 ? 11.961  29.107  63.445  1.00 172.83 ? 262  GLU A CG  1 
ATOM   1676 C CD  . GLU A 1 238 ? 11.710  29.313  61.967  1.00 172.83 ? 262  GLU A CD  1 
ATOM   1677 O OE1 . GLU A 1 238 ? 10.547  29.157  61.537  1.00 172.83 ? 262  GLU A OE1 1 
ATOM   1678 O OE2 . GLU A 1 238 ? 12.672  29.640  61.238  1.00 172.83 ? 262  GLU A OE2 1 
ATOM   1679 N N   . LEU A 1 239 ? 11.529  25.441  66.401  1.00 104.21 ? 263  LEU A N   1 
ATOM   1680 C CA  . LEU A 1 239 ? 10.973  24.168  66.855  1.00 104.21 ? 263  LEU A CA  1 
ATOM   1681 C C   . LEU A 1 239 ? 10.383  24.421  68.215  1.00 104.21 ? 263  LEU A C   1 
ATOM   1682 O O   . LEU A 1 239 ? 9.544   23.663  68.715  1.00 104.21 ? 263  LEU A O   1 
ATOM   1683 C CB  . LEU A 1 239 ? 12.062  23.098  66.976  1.00 87.94  ? 263  LEU A CB  1 
ATOM   1684 C CG  . LEU A 1 239 ? 12.470  22.358  65.707  1.00 87.94  ? 263  LEU A CG  1 
ATOM   1685 C CD1 . LEU A 1 239 ? 13.611  21.428  66.045  1.00 87.94  ? 263  LEU A CD1 1 
ATOM   1686 C CD2 . LEU A 1 239 ? 11.291  21.571  65.153  1.00 87.94  ? 263  LEU A CD2 1 
ATOM   1687 N N   . LEU A 1 240 ? 10.842  25.514  68.800  1.00 98.68  ? 264  LEU A N   1 
ATOM   1688 C CA  . LEU A 1 240 ? 10.420  25.920  70.119  1.00 98.68  ? 264  LEU A CA  1 
ATOM   1689 C C   . LEU A 1 240 ? 9.201   26.852  70.079  1.00 98.68  ? 264  LEU A C   1 
ATOM   1690 O O   . LEU A 1 240 ? 8.454   26.942  71.053  1.00 98.68  ? 264  LEU A O   1 
ATOM   1691 C CB  . LEU A 1 240 ? 11.613  26.578  70.820  1.00 93.02  ? 264  LEU A CB  1 
ATOM   1692 C CG  . LEU A 1 240 ? 12.826  25.664  71.088  1.00 93.02  ? 264  LEU A CG  1 
ATOM   1693 C CD1 . LEU A 1 240 ? 14.081  26.506  71.286  1.00 93.02  ? 264  LEU A CD1 1 
ATOM   1694 C CD2 . LEU A 1 240 ? 12.569  24.798  72.321  1.00 93.02  ? 264  LEU A CD2 1 
ATOM   1695 N N   . GLN A 1 241 ? 8.998   27.526  68.947  1.00 135.88 ? 265  GLN A N   1 
ATOM   1696 C CA  . GLN A 1 241 ? 7.865   28.435  68.781  1.00 135.88 ? 265  GLN A CA  1 
ATOM   1697 C C   . GLN A 1 241 ? 6.549   27.674  68.673  1.00 135.88 ? 265  GLN A C   1 
ATOM   1698 O O   . GLN A 1 241 ? 5.491   28.276  68.506  1.00 135.88 ? 265  GLN A O   1 
ATOM   1699 C CB  . GLN A 1 241 ? 8.030   29.293  67.528  1.00 209.78 ? 265  GLN A CB  1 
ATOM   1700 C CG  . GLN A 1 241 ? 9.219   30.222  67.547  1.00 209.78 ? 265  GLN A CG  1 
ATOM   1701 C CD  . GLN A 1 241 ? 9.240   31.143  66.343  1.00 209.78 ? 265  GLN A CD  1 
ATOM   1702 O OE1 . GLN A 1 241 ? 8.991   30.714  65.213  1.00 209.78 ? 265  GLN A OE1 1 
ATOM   1703 N NE2 . GLN A 1 241 ? 9.547   32.416  66.575  1.00 209.78 ? 265  GLN A NE2 1 
ATOM   1704 N N   . LYS A 1 242 ? 6.623   26.351  68.746  1.00 102.63 ? 266  LYS A N   1 
ATOM   1705 C CA  . LYS A 1 242 ? 5.443   25.489  68.679  1.00 102.63 ? 266  LYS A CA  1 
ATOM   1706 C C   . LYS A 1 242 ? 5.673   24.429  69.747  1.00 102.63 ? 266  LYS A C   1 
ATOM   1707 O O   . LYS A 1 242 ? 5.616   23.236  69.463  1.00 102.63 ? 266  LYS A O   1 
ATOM   1708 C CB  . LYS A 1 242 ? 5.348   24.822  67.304  1.00 117.13 ? 266  LYS A CB  1 
ATOM   1709 C CG  . LYS A 1 242 ? 5.179   25.780  66.133  1.00 117.13 ? 266  LYS A CG  1 
ATOM   1710 C CD  . LYS A 1 242 ? 3.765   26.340  66.073  1.00 117.13 ? 266  LYS A CD  1 
ATOM   1711 C CE  . LYS A 1 242 ? 3.562   27.251  64.856  1.00 117.13 ? 266  LYS A CE  1 
ATOM   1712 N NZ  . LYS A 1 242 ? 2.156   27.763  64.707  1.00 117.13 ? 266  LYS A NZ  1 
ATOM   1713 N N   . PRO A 1 243 ? 5.927   24.861  70.999  1.00 88.69  ? 267  PRO A N   1 
ATOM   1714 C CA  . PRO A 1 243 ? 6.191   23.987  72.148  1.00 88.69  ? 267  PRO A CA  1 
ATOM   1715 C C   . PRO A 1 243 ? 5.121   22.966  72.478  1.00 88.69  ? 267  PRO A C   1 
ATOM   1716 O O   . PRO A 1 243 ? 5.244   22.247  73.467  1.00 88.69  ? 267  PRO A O   1 
ATOM   1717 C CB  . PRO A 1 243 ? 6.432   24.976  73.283  1.00 161.54 ? 267  PRO A CB  1 
ATOM   1718 C CG  . PRO A 1 243 ? 5.499   26.071  72.944  1.00 161.54 ? 267  PRO A CG  1 
ATOM   1719 C CD  . PRO A 1 243 ? 5.716   26.246  71.456  1.00 161.54 ? 267  PRO A CD  1 
ATOM   1720 N N   . ASN A 1 244 ? 4.074   22.901  71.661  1.00 156.39 ? 268  ASN A N   1 
ATOM   1721 C CA  . ASN A 1 244 ? 3.018   21.926  71.890  1.00 156.39 ? 268  ASN A CA  1 
ATOM   1722 C C   . ASN A 1 244 ? 3.447   20.586  71.296  1.00 156.39 ? 268  ASN A C   1 
ATOM   1723 O O   . ASN A 1 244 ? 3.105   19.516  71.809  1.00 156.39 ? 268  ASN A O   1 
ATOM   1724 C CB  . ASN A 1 244 ? 1.713   22.393  71.254  1.00 159.73 ? 268  ASN A CB  1 
ATOM   1725 C CG  . ASN A 1 244 ? 0.650   22.700  72.288  1.00 159.73 ? 268  ASN A CG  1 
ATOM   1726 O OD1 . ASN A 1 244 ? 0.312   21.853  73.124  1.00 159.73 ? 268  ASN A OD1 1 
ATOM   1727 N ND2 . ASN A 1 244 ? 0.115   23.915  72.241  1.00 159.73 ? 268  ASN A ND2 1 
ATOM   1728 N N   . ALA A 1 245 ? 4.206   20.668  70.206  1.00 90.52  ? 269  ALA A N   1 
ATOM   1729 C CA  . ALA A 1 245 ? 4.735   19.494  69.514  1.00 90.52  ? 269  ALA A CA  1 
ATOM   1730 C C   . ALA A 1 245 ? 6.090   19.154  70.119  1.00 90.52  ? 269  ALA A C   1 
ATOM   1731 O O   . ALA A 1 245 ? 7.102   19.800  69.808  1.00 90.52  ? 269  ALA A O   1 
ATOM   1732 C CB  . ALA A 1 245 ? 4.891   19.783  68.022  1.00 67.23  ? 269  ALA A CB  1 
ATOM   1733 N N   . ARG A 1 246 ? 6.095   18.149  70.989  1.00 135.31 ? 270  ARG A N   1 
ATOM   1734 C CA  . ARG A 1 246 ? 7.317   17.709  71.643  1.00 135.31 ? 270  ARG A CA  1 
ATOM   1735 C C   . ARG A 1 246 ? 8.031   16.653  70.789  1.00 135.31 ? 270  ARG A C   1 
ATOM   1736 O O   . ARG A 1 246 ? 9.174   16.283  71.063  1.00 135.31 ? 270  ARG A O   1 
ATOM   1737 C CB  . ARG A 1 246 ? 6.988   17.137  73.026  1.00 201.61 ? 270  ARG A CB  1 
ATOM   1738 C CG  . ARG A 1 246 ? 8.199   16.925  73.921  0.00 201.61 ? 270  ARG A CG  1 
ATOM   1739 C CD  . ARG A 1 246 ? 8.896   18.243  74.226  0.00 201.61 ? 270  ARG A CD  1 
ATOM   1740 N NE  . ARG A 1 246 ? 9.990   18.083  75.179  0.00 201.61 ? 270  ARG A NE  1 
ATOM   1741 C CZ  . ARG A 1 246 ? 9.836   17.673  76.434  0.00 201.61 ? 270  ARG A CZ  1 
ATOM   1742 N NH1 . ARG A 1 246 ? 8.628   17.380  76.896  0.00 201.61 ? 270  ARG A NH1 1 
ATOM   1743 N NH2 . ARG A 1 246 ? 10.890  17.558  77.230  0.00 201.61 ? 270  ARG A NH2 1 
ATOM   1744 N N   . VAL A 1 247 ? 7.355   16.180  69.746  1.00 79.64  ? 271  VAL A N   1 
ATOM   1745 C CA  . VAL A 1 247 ? 7.912   15.172  68.860  1.00 79.64  ? 271  VAL A CA  1 
ATOM   1746 C C   . VAL A 1 247 ? 8.378   15.781  67.532  1.00 79.64  ? 271  VAL A C   1 
ATOM   1747 O O   . VAL A 1 247 ? 7.570   16.303  66.752  1.00 79.64  ? 271  VAL A O   1 
ATOM   1748 C CB  . VAL A 1 247 ? 6.865   14.070  68.590  1.00 76.51  ? 271  VAL A CB  1 
ATOM   1749 C CG1 . VAL A 1 247 ? 7.452   12.957  67.753  1.00 76.51  ? 271  VAL A CG1 1 
ATOM   1750 C CG2 . VAL A 1 247 ? 6.385   13.506  69.885  1.00 76.51  ? 271  VAL A CG2 1 
ATOM   1751 N N   . VAL A 1 248 ? 9.685   15.718  67.283  1.00 85.86  ? 272  VAL A N   1 
ATOM   1752 C CA  . VAL A 1 248 ? 10.250  16.247  66.046  1.00 85.86  ? 272  VAL A CA  1 
ATOM   1753 C C   . VAL A 1 248 ? 10.707  15.122  65.137  1.00 85.86  ? 272  VAL A C   1 
ATOM   1754 O O   . VAL A 1 248 ? 11.484  14.248  65.543  1.00 85.86  ? 272  VAL A O   1 
ATOM   1755 C CB  . VAL A 1 248 ? 11.470  17.146  66.292  1.00 50.65  ? 272  VAL A CB  1 
ATOM   1756 C CG1 . VAL A 1 248 ? 11.908  17.811  64.997  1.00 50.65  ? 272  VAL A CG1 1 
ATOM   1757 C CG2 . VAL A 1 248 ? 11.142  18.166  67.317  1.00 50.65  ? 272  VAL A CG2 1 
ATOM   1758 N N   . VAL A 1 249 ? 10.212  15.163  63.904  1.00 82.74  ? 273  VAL A N   1 
ATOM   1759 C CA  . VAL A 1 249 ? 10.551  14.179  62.891  1.00 82.74  ? 273  VAL A CA  1 
ATOM   1760 C C   . VAL A 1 249 ? 11.778  14.656  62.143  1.00 82.74  ? 273  VAL A C   1 
ATOM   1761 O O   . VAL A 1 249 ? 11.854  15.802  61.708  1.00 82.74  ? 273  VAL A O   1 
ATOM   1762 C CB  . VAL A 1 249 ? 9.390   13.973  61.881  1.00 80.40  ? 273  VAL A CB  1 
ATOM   1763 C CG1 . VAL A 1 249 ? 9.902   13.305  60.618  1.00 80.40  ? 273  VAL A CG1 1 
ATOM   1764 C CG2 . VAL A 1 249 ? 8.322   13.082  62.494  1.00 80.40  ? 273  VAL A CG2 1 
ATOM   1765 N N   . LEU A 1 250 ? 12.745  13.770  61.992  1.00 66.36  ? 274  LEU A N   1 
ATOM   1766 C CA  . LEU A 1 250 ? 13.952  14.134  61.295  1.00 66.36  ? 274  LEU A CA  1 
ATOM   1767 C C   . LEU A 1 250 ? 14.210  13.271  60.078  1.00 66.36  ? 274  LEU A C   1 
ATOM   1768 O O   . LEU A 1 250 ? 14.296  12.047  60.181  1.00 66.36  ? 274  LEU A O   1 
ATOM   1769 C CB  . LEU A 1 250 ? 15.142  14.030  62.240  1.00 65.80  ? 274  LEU A CB  1 
ATOM   1770 C CG  . LEU A 1 250 ? 15.062  14.911  63.482  1.00 65.80  ? 274  LEU A CG  1 
ATOM   1771 C CD1 . LEU A 1 250 ? 16.259  14.650  64.385  1.00 65.80  ? 274  LEU A CD1 1 
ATOM   1772 C CD2 . LEU A 1 250 ? 15.017  16.353  63.057  1.00 65.80  ? 274  LEU A CD2 1 
ATOM   1773 N N   . PHE A 1 251 ? 14.311  13.924  58.922  1.00 57.20  ? 275  PHE A N   1 
ATOM   1774 C CA  . PHE A 1 251 ? 14.639  13.263  57.658  1.00 57.20  ? 275  PHE A CA  1 
ATOM   1775 C C   . PHE A 1 251 ? 15.873  14.013  57.171  1.00 57.20  ? 275  PHE A C   1 
ATOM   1776 O O   . PHE A 1 251 ? 15.843  14.720  56.165  1.00 57.20  ? 275  PHE A O   1 
ATOM   1777 C CB  . PHE A 1 251 ? 13.512  13.388  56.636  1.00 69.18  ? 275  PHE A CB  1 
ATOM   1778 C CG  . PHE A 1 251 ? 13.115  12.081  56.040  1.00 69.18  ? 275  PHE A CG  1 
ATOM   1779 C CD1 . PHE A 1 251 ? 12.048  11.357  56.568  1.00 69.18  ? 275  PHE A CD1 1 
ATOM   1780 C CD2 . PHE A 1 251 ? 13.858  11.526  55.006  1.00 69.18  ? 275  PHE A CD2 1 
ATOM   1781 C CE1 . PHE A 1 251 ? 11.733  10.097  56.078  1.00 69.18  ? 275  PHE A CE1 1 
ATOM   1782 C CE2 . PHE A 1 251 ? 13.552  10.273  54.513  1.00 69.18  ? 275  PHE A CE2 1 
ATOM   1783 C CZ  . PHE A 1 251 ? 12.487  9.554   55.051  1.00 69.18  ? 275  PHE A CZ  1 
ATOM   1784 N N   . MET A 1 252 ? 16.957  13.844  57.923  1.00 61.66  ? 276  MET A N   1 
ATOM   1785 C CA  . MET A 1 252 ? 18.202  14.523  57.640  1.00 61.66  ? 276  MET A CA  1 
ATOM   1786 C C   . MET A 1 252 ? 19.387  13.600  57.472  1.00 61.66  ? 276  MET A C   1 
ATOM   1787 O O   . MET A 1 252 ? 19.418  12.520  58.054  1.00 61.66  ? 276  MET A O   1 
ATOM   1788 C CB  . MET A 1 252 ? 18.524  15.504  58.764  1.00 97.02  ? 276  MET A CB  1 
ATOM   1789 C CG  . MET A 1 252 ? 17.455  16.538  59.038  1.00 97.02  ? 276  MET A CG  1 
ATOM   1790 S SD  . MET A 1 252 ? 18.019  17.676  60.314  1.00 97.02  ? 276  MET A SD  1 
ATOM   1791 C CE  . MET A 1 252 ? 18.052  16.608  61.723  1.00 97.02  ? 276  MET A CE  1 
ATOM   1792 N N   . ARG A 1 253 ? 20.350  14.076  56.676  1.00 47.58  ? 277  ARG A N   1 
ATOM   1793 C CA  . ARG A 1 253 ? 21.601  13.401  56.369  1.00 47.58  ? 277  ARG A CA  1 
ATOM   1794 C C   . ARG A 1 253 ? 22.328  13.184  57.652  1.00 47.58  ? 277  ARG A C   1 
ATOM   1795 O O   . ARG A 1 253 ? 22.081  13.882  58.624  1.00 47.58  ? 277  ARG A O   1 
ATOM   1796 C CB  . ARG A 1 253 ? 22.483  14.278  55.505  1.00 66.00  ? 277  ARG A CB  1 
ATOM   1797 C CG  . ARG A 1 253 ? 22.098  14.337  54.067  1.00 66.00  ? 277  ARG A CG  1 
ATOM   1798 C CD  . ARG A 1 253 ? 22.835  15.462  53.373  1.00 66.00  ? 277  ARG A CD  1 
ATOM   1799 N NE  . ARG A 1 253 ? 24.287  15.410  53.532  1.00 66.00  ? 277  ARG A NE  1 
ATOM   1800 C CZ  . ARG A 1 253 ? 25.129  15.172  52.535  1.00 66.00  ? 277  ARG A CZ  1 
ATOM   1801 N NH1 . ARG A 1 253 ? 24.651  14.954  51.309  1.00 66.00  ? 277  ARG A NH1 1 
ATOM   1802 N NH2 . ARG A 1 253 ? 26.441  15.182  52.758  1.00 66.00  ? 277  ARG A NH2 1 
ATOM   1803 N N   . SER A 1 254 ? 23.242  12.224  57.649  1.00 85.73  ? 278  SER A N   1 
ATOM   1804 C CA  . SER A 1 254 ? 24.022  11.933  58.841  1.00 85.73  ? 278  SER A CA  1 
ATOM   1805 C C   . SER A 1 254 ? 24.586  13.234  59.405  1.00 85.73  ? 278  SER A C   1 
ATOM   1806 O O   . SER A 1 254 ? 24.400  13.537  60.587  1.00 85.73  ? 278  SER A O   1 
ATOM   1807 C CB  . SER A 1 254 ? 25.159  10.958  58.503  1.00 130.81 ? 278  SER A CB  1 
ATOM   1808 O OG  . SER A 1 254 ? 25.959  10.672  59.637  1.00 130.81 ? 278  SER A OG  1 
ATOM   1809 N N   . ASP A 1 255 ? 25.240  14.016  58.549  1.00 88.05  ? 279  ASP A N   1 
ATOM   1810 C CA  . ASP A 1 255 ? 25.841  15.266  58.994  1.00 88.05  ? 279  ASP A CA  1 
ATOM   1811 C C   . ASP A 1 255 ? 24.843  16.314  59.514  1.00 88.05  ? 279  ASP A C   1 
ATOM   1812 O O   . ASP A 1 255 ? 24.911  16.720  60.679  1.00 88.05  ? 279  ASP A O   1 
ATOM   1813 C CB  . ASP A 1 255 ? 26.778  15.855  57.899  1.00 112.50 ? 279  ASP A CB  1 
ATOM   1814 C CG  . ASP A 1 255 ? 26.072  16.167  56.568  1.00 112.50 ? 279  ASP A CG  1 
ATOM   1815 O OD1 . ASP A 1 255 ? 25.126  16.981  56.560  1.00 112.50 ? 279  ASP A OD1 1 
ATOM   1816 O OD2 . ASP A 1 255 ? 26.488  15.621  55.518  1.00 112.50 ? 279  ASP A OD2 1 
ATOM   1817 N N   . ASP A 1 256 ? 23.903  16.738  58.681  1.00 86.42  ? 280  ASP A N   1 
ATOM   1818 C CA  . ASP A 1 256 ? 22.931  17.723  59.121  1.00 86.42  ? 280  ASP A CA  1 
ATOM   1819 C C   . ASP A 1 256 ? 22.198  17.279  60.378  1.00 86.42  ? 280  ASP A C   1 
ATOM   1820 O O   . ASP A 1 256 ? 21.696  18.112  61.124  1.00 86.42  ? 280  ASP A O   1 
ATOM   1821 C CB  . ASP A 1 256 ? 21.921  17.985  58.019  1.00 86.00  ? 280  ASP A CB  1 
ATOM   1822 C CG  . ASP A 1 256 ? 22.582  18.341  56.723  1.00 86.00  ? 280  ASP A CG  1 
ATOM   1823 O OD1 . ASP A 1 256 ? 23.599  19.054  56.779  1.00 86.00  ? 280  ASP A OD1 1 
ATOM   1824 O OD2 . ASP A 1 256 ? 22.095  17.923  55.650  1.00 86.00  ? 280  ASP A OD2 1 
ATOM   1825 N N   . SER A 1 257 ? 22.143  15.969  60.617  1.00 69.93  ? 281  SER A N   1 
ATOM   1826 C CA  . SER A 1 257 ? 21.438  15.435  61.775  1.00 69.93  ? 281  SER A CA  1 
ATOM   1827 C C   . SER A 1 257 ? 22.225  15.636  63.041  1.00 69.93  ? 281  SER A C   1 
ATOM   1828 O O   . SER A 1 257 ? 21.655  15.637  64.133  1.00 69.93  ? 281  SER A O   1 
ATOM   1829 C CB  . SER A 1 257 ? 21.125  13.953  61.574  1.00 86.97  ? 281  SER A CB  1 
ATOM   1830 O OG  . SER A 1 257 ? 20.160  13.787  60.546  1.00 86.97  ? 281  SER A OG  1 
ATOM   1831 N N   . ARG A 1 258 ? 23.533  15.809  62.890  1.00 117.50 ? 282  ARG A N   1 
ATOM   1832 C CA  . ARG A 1 258 ? 24.400  16.031  64.036  1.00 117.50 ? 282  ARG A CA  1 
ATOM   1833 C C   . ARG A 1 258 ? 24.399  17.518  64.376  1.00 117.50 ? 282  ARG A C   1 
ATOM   1834 O O   . ARG A 1 258 ? 24.220  17.895  65.537  1.00 117.50 ? 282  ARG A O   1 
ATOM   1835 C CB  . ARG A 1 258 ? 25.829  15.561  63.731  1.00 110.72 ? 282  ARG A CB  1 
ATOM   1836 C CG  . ARG A 1 258 ? 26.820  15.799  64.863  0.00 110.72 ? 282  ARG A CG  1 
ATOM   1837 C CD  . ARG A 1 258 ? 28.229  15.384  64.462  0.00 110.72 ? 282  ARG A CD  1 
ATOM   1838 N NE  . ARG A 1 258 ? 29.196  15.618  65.531  0.00 110.72 ? 282  ARG A NE  1 
ATOM   1839 C CZ  . ARG A 1 258 ? 30.497  15.365  65.432  0.00 110.72 ? 282  ARG A CZ  1 
ATOM   1840 N NH1 . ARG A 1 258 ? 30.993  14.866  64.308  0.00 110.72 ? 282  ARG A NH1 1 
ATOM   1841 N NH2 . ARG A 1 258 ? 31.303  15.609  66.456  0.00 110.72 ? 282  ARG A NH2 1 
ATOM   1842 N N   . GLU A 1 259 ? 24.585  18.357  63.357  1.00 81.56  ? 283  GLU A N   1 
ATOM   1843 C CA  . GLU A 1 259 ? 24.609  19.803  63.549  1.00 81.56  ? 283  GLU A CA  1 
ATOM   1844 C C   . GLU A 1 259 ? 23.353  20.283  64.258  1.00 81.56  ? 283  GLU A C   1 
ATOM   1845 O O   . GLU A 1 259 ? 23.406  21.180  65.098  1.00 81.56  ? 283  GLU A O   1 
ATOM   1846 C CB  . GLU A 1 259 ? 24.747  20.512  62.207  1.00 189.31 ? 283  GLU A CB  1 
ATOM   1847 C CG  . GLU A 1 259 ? 26.144  20.490  61.645  1.00 189.31 ? 283  GLU A CG  1 
ATOM   1848 C CD  . GLU A 1 259 ? 27.106  21.338  62.456  1.00 189.31 ? 283  GLU A CD  1 
ATOM   1849 O OE1 . GLU A 1 259 ? 27.306  21.049  63.656  1.00 189.31 ? 283  GLU A OE1 1 
ATOM   1850 O OE2 . GLU A 1 259 ? 27.664  22.300  61.887  1.00 189.31 ? 283  GLU A OE2 1 
ATOM   1851 N N   . LEU A 1 260 ? 22.223  19.676  63.916  1.00 79.22  ? 284  LEU A N   1 
ATOM   1852 C CA  . LEU A 1 260 ? 20.944  20.029  64.520  1.00 79.22  ? 284  LEU A CA  1 
ATOM   1853 C C   . LEU A 1 260 ? 20.976  19.710  66.005  1.00 79.22  ? 284  LEU A C   1 
ATOM   1854 O O   . LEU A 1 260 ? 20.677  20.566  66.824  1.00 79.22  ? 284  LEU A O   1 
ATOM   1855 C CB  . LEU A 1 260 ? 19.803  19.258  63.845  1.00 83.61  ? 284  LEU A CB  1 
ATOM   1856 C CG  . LEU A 1 260 ? 18.346  19.541  64.237  1.00 83.61  ? 284  LEU A CG  1 
ATOM   1857 C CD1 . LEU A 1 260 ? 18.068  19.071  65.648  1.00 83.61  ? 284  LEU A CD1 1 
ATOM   1858 C CD2 . LEU A 1 260 ? 18.072  21.022  64.099  1.00 83.61  ? 284  LEU A CD2 1 
ATOM   1859 N N   . ILE A 1 261 ? 21.333  18.480  66.356  1.00 73.16  ? 285  ILE A N   1 
ATOM   1860 C CA  . ILE A 1 261 ? 21.392  18.104  67.758  1.00 73.16  ? 285  ILE A CA  1 
ATOM   1861 C C   . ILE A 1 261 ? 22.414  18.938  68.502  1.00 73.16  ? 285  ILE A C   1 
ATOM   1862 O O   . ILE A 1 261 ? 22.219  19.269  69.675  1.00 73.16  ? 285  ILE A O   1 
ATOM   1863 C CB  . ILE A 1 261 ? 21.773  16.649  67.931  1.00 63.60  ? 285  ILE A CB  1 
ATOM   1864 C CG1 . ILE A 1 261 ? 20.625  15.767  67.467  1.00 63.60  ? 285  ILE A CG1 1 
ATOM   1865 C CG2 . ILE A 1 261 ? 22.079  16.370  69.399  1.00 63.60  ? 285  ILE A CG2 1 
ATOM   1866 C CD1 . ILE A 1 261 ? 19.363  15.955  68.288  1.00 63.60  ? 285  ILE A CD1 1 
ATOM   1867 N N   . ALA A 1 262 ? 23.512  19.261  67.822  1.00 83.76  ? 286  ALA A N   1 
ATOM   1868 C CA  . ALA A 1 262 ? 24.565  20.066  68.423  1.00 83.76  ? 286  ALA A CA  1 
ATOM   1869 C C   . ALA A 1 262 ? 23.924  21.369  68.835  1.00 83.76  ? 286  ALA A C   1 
ATOM   1870 O O   . ALA A 1 262 ? 24.026  21.785  69.981  1.00 83.76  ? 286  ALA A O   1 
ATOM   1871 C CB  . ALA A 1 262 ? 25.673  20.319  67.419  1.00 219.64 ? 286  ALA A CB  1 
ATOM   1872 N N   . ALA A 1 263 ? 23.244  21.999  67.887  1.00 78.03  ? 287  ALA A N   1 
ATOM   1873 C CA  . ALA A 1 263 ? 22.559  23.258  68.143  1.00 78.03  ? 287  ALA A CA  1 
ATOM   1874 C C   . ALA A 1 263 ? 21.578  23.083  69.283  1.00 78.03  ? 287  ALA A C   1 
ATOM   1875 O O   . ALA A 1 263 ? 21.680  23.741  70.315  1.00 78.03  ? 287  ALA A O   1 
ATOM   1876 C CB  . ALA A 1 263 ? 21.824  23.719  66.893  1.00 87.75  ? 287  ALA A CB  1 
ATOM   1877 N N   . ALA A 1 264 ? 20.630  22.181  69.089  1.00 80.95  ? 288  ALA A N   1 
ATOM   1878 C CA  . ALA A 1 264 ? 19.614  21.904  70.087  1.00 80.95  ? 288  ALA A CA  1 
ATOM   1879 C C   . ALA A 1 264 ? 20.188  21.718  71.489  1.00 80.95  ? 288  ALA A C   1 
ATOM   1880 O O   . ALA A 1 264 ? 19.464  21.855  72.478  1.00 80.95  ? 288  ALA A O   1 
ATOM   1881 C CB  . ALA A 1 264 ? 18.829  20.674  69.689  1.00 167.20 ? 288  ALA A CB  1 
ATOM   1882 N N   . ASN A 1 265 ? 21.476  21.409  71.588  1.00 99.88  ? 289  ASN A N   1 
ATOM   1883 C CA  . ASN A 1 265 ? 22.073  21.207  72.900  1.00 99.88  ? 289  ASN A CA  1 
ATOM   1884 C C   . ASN A 1 265 ? 22.624  22.478  73.540  1.00 99.88  ? 289  ASN A C   1 
ATOM   1885 O O   . ASN A 1 265 ? 22.460  22.703  74.750  1.00 99.88  ? 289  ASN A O   1 
ATOM   1886 C CB  . ASN A 1 265 ? 23.193  20.177  72.830  1.00 124.53 ? 289  ASN A CB  1 
ATOM   1887 C CG  . ASN A 1 265 ? 24.033  20.162  74.094  1.00 124.53 ? 289  ASN A CG  1 
ATOM   1888 O OD1 . ASN A 1 265 ? 23.523  19.913  75.191  1.00 124.53 ? 289  ASN A OD1 1 
ATOM   1889 N ND2 . ASN A 1 265 ? 25.325  20.447  73.950  1.00 124.53 ? 289  ASN A ND2 1 
ATOM   1890 N N   . ARG A 1 266 ? 23.289  23.300  72.733  1.00 117.82 ? 290  ARG A N   1 
ATOM   1891 C CA  . ARG A 1 266 ? 23.877  24.532  73.234  1.00 117.82 ? 290  ARG A CA  1 
ATOM   1892 C C   . ARG A 1 266 ? 22.838  25.280  74.017  1.00 117.82 ? 290  ARG A C   1 
ATOM   1893 O O   . ARG A 1 266 ? 23.157  25.962  74.984  1.00 117.82 ? 290  ARG A O   1 
ATOM   1894 C CB  . ARG A 1 266 ? 24.361  25.414  72.087  1.00 146.74 ? 290  ARG A CB  1 
ATOM   1895 C CG  . ARG A 1 266 ? 25.187  24.678  71.065  1.00 146.74 ? 290  ARG A CG  1 
ATOM   1896 C CD  . ARG A 1 266 ? 26.071  25.614  70.269  1.00 146.74 ? 290  ARG A CD  1 
ATOM   1897 N NE  . ARG A 1 266 ? 26.246  25.109  68.917  1.00 146.74 ? 290  ARG A NE  1 
ATOM   1898 C CZ  . ARG A 1 266 ? 25.303  25.181  67.987  1.00 146.74 ? 290  ARG A CZ  1 
ATOM   1899 N NH1 . ARG A 1 266 ? 24.141  25.747  68.277  1.00 146.74 ? 290  ARG A NH1 1 
ATOM   1900 N NH2 . ARG A 1 266 ? 25.508  24.672  66.780  1.00 146.74 ? 290  ARG A NH2 1 
ATOM   1901 N N   . VAL A 1 267 ? 21.587  25.127  73.597  1.00 79.20  ? 291  VAL A N   1 
ATOM   1902 C CA  . VAL A 1 267 ? 20.474  25.806  74.237  1.00 79.20  ? 291  VAL A CA  1 
ATOM   1903 C C   . VAL A 1 267 ? 19.502  24.866  74.966  1.00 79.20  ? 291  VAL A C   1 
ATOM   1904 O O   . VAL A 1 267 ? 18.286  25.043  74.908  1.00 79.20  ? 291  VAL A O   1 
ATOM   1905 C CB  . VAL A 1 267 ? 19.728  26.651  73.190  1.00 93.59  ? 291  VAL A CB  1 
ATOM   1906 C CG1 . VAL A 1 267 ? 20.627  27.777  72.702  1.00 93.59  ? 291  VAL A CG1 1 
ATOM   1907 C CG2 . VAL A 1 267 ? 19.362  25.795  72.006  1.00 93.59  ? 291  VAL A CG2 1 
ATOM   1908 N N   . ASN A 1 268 ? 20.066  23.885  75.671  1.00 87.79  ? 292  ASN A N   1 
ATOM   1909 C CA  . ASN A 1 268 ? 19.307  22.891  76.439  1.00 87.79  ? 292  ASN A CA  1 
ATOM   1910 C C   . ASN A 1 268 ? 17.882  22.631  75.968  1.00 87.79  ? 292  ASN A C   1 
ATOM   1911 O O   . ASN A 1 268 ? 16.982  22.440  76.785  1.00 87.79  ? 292  ASN A O   1 
ATOM   1912 C CB  . ASN A 1 268 ? 19.285  23.274  77.921  1.00 189.33 ? 292  ASN A CB  1 
ATOM   1913 C CG  . ASN A 1 268 ? 20.632  23.086  78.589  1.00 189.33 ? 292  ASN A CG  1 
ATOM   1914 O OD1 . ASN A 1 268 ? 20.826  23.473  79.746  1.00 189.33 ? 292  ASN A OD1 1 
ATOM   1915 N ND2 . ASN A 1 268 ? 21.573  22.482  77.865  1.00 189.33 ? 292  ASN A ND2 1 
ATOM   1916 N N   . ALA A 1 269 ? 17.686  22.617  74.652  1.00 100.36 ? 293  ALA A N   1 
ATOM   1917 C CA  . ALA A 1 269 ? 16.372  22.362  74.068  1.00 100.36 ? 293  ALA A CA  1 
ATOM   1918 C C   . ALA A 1 269 ? 16.131  20.867  74.115  1.00 100.36 ? 293  ALA A C   1 
ATOM   1919 O O   . ALA A 1 269 ? 17.063  20.089  73.919  1.00 100.36 ? 293  ALA A O   1 
ATOM   1920 C CB  . ALA A 1 269 ? 16.332  22.854  72.629  1.00 170.68 ? 293  ALA A CB  1 
ATOM   1921 N N   . SER A 1 270 ? 14.894  20.457  74.369  1.00 176.00 ? 294  SER A N   1 
ATOM   1922 C CA  . SER A 1 270 ? 14.592  19.034  74.449  1.00 176.00 ? 294  SER A CA  1 
ATOM   1923 C C   . SER A 1 270 ? 13.343  18.604  73.688  1.00 176.00 ? 294  SER A C   1 
ATOM   1924 O O   . SER A 1 270 ? 12.300  19.254  73.765  1.00 176.00 ? 294  SER A O   1 
ATOM   1925 C CB  . SER A 1 270 ? 14.461  18.617  75.918  1.00 171.25 ? 294  SER A CB  1 
ATOM   1926 O OG  . SER A 1 270 ? 14.127  17.243  76.035  1.00 171.25 ? 294  SER A OG  1 
ATOM   1927 N N   . PHE A 1 271 ? 13.466  17.506  72.946  1.00 113.26 ? 295  PHE A N   1 
ATOM   1928 C CA  . PHE A 1 271 ? 12.354  16.950  72.180  1.00 113.26 ? 295  PHE A CA  1 
ATOM   1929 C C   . PHE A 1 271 ? 12.499  15.429  72.101  1.00 113.26 ? 295  PHE A C   1 
ATOM   1930 O O   . PHE A 1 271 ? 13.481  14.859  72.583  1.00 113.26 ? 295  PHE A O   1 
ATOM   1931 C CB  . PHE A 1 271 ? 12.333  17.483  70.742  1.00 89.39  ? 295  PHE A CB  1 
ATOM   1932 C CG  . PHE A 1 271 ? 12.368  18.982  70.622  1.00 89.39  ? 295  PHE A CG  1 
ATOM   1933 C CD1 . PHE A 1 271 ? 13.518  19.696  70.927  1.00 89.39  ? 295  PHE A CD1 1 
ATOM   1934 C CD2 . PHE A 1 271 ? 11.283  19.667  70.094  1.00 89.39  ? 295  PHE A CD2 1 
ATOM   1935 C CE1 . PHE A 1 271 ? 13.586  21.064  70.696  1.00 89.39  ? 295  PHE A CE1 1 
ATOM   1936 C CE2 . PHE A 1 271 ? 11.342  21.034  69.859  1.00 89.39  ? 295  PHE A CE2 1 
ATOM   1937 C CZ  . PHE A 1 271 ? 12.495  21.734  70.156  1.00 89.39  ? 295  PHE A CZ  1 
ATOM   1938 N N   . THR A 1 272 ? 11.510  14.783  71.487  1.00 100.86 ? 296  THR A N   1 
ATOM   1939 C CA  . THR A 1 272 ? 11.525  13.336  71.287  1.00 100.86 ? 296  THR A CA  1 
ATOM   1940 C C   . THR A 1 272 ? 11.885  13.198  69.817  1.00 100.86 ? 296  THR A C   1 
ATOM   1941 O O   . THR A 1 272 ? 11.042  13.362  68.924  1.00 100.86 ? 296  THR A O   1 
ATOM   1942 C CB  . THR A 1 272 ? 10.150  12.695  71.507  1.00 117.36 ? 296  THR A CB  1 
ATOM   1943 O OG1 . THR A 1 272 ? 9.462   13.378  72.558  1.00 117.36 ? 296  THR A OG1 1 
ATOM   1944 C CG2 . THR A 1 272 ? 10.316  11.243  71.905  1.00 117.36 ? 296  THR A CG2 1 
ATOM   1945 N N   . TRP A 1 273 ? 13.153  12.912  69.569  1.00 89.44  ? 297  TRP A N   1 
ATOM   1946 C CA  . TRP A 1 273 ? 13.636  12.792  68.211  1.00 89.44  ? 297  TRP A CA  1 
ATOM   1947 C C   . TRP A 1 273 ? 13.242  11.509  67.482  1.00 89.44  ? 297  TRP A C   1 
ATOM   1948 O O   . TRP A 1 273 ? 13.526  10.395  67.928  1.00 89.44  ? 297  TRP A O   1 
ATOM   1949 C CB  . TRP A 1 273 ? 15.159  12.948  68.197  1.00 79.50  ? 297  TRP A CB  1 
ATOM   1950 C CG  . TRP A 1 273 ? 15.631  14.222  68.830  1.00 79.50  ? 297  TRP A CG  1 
ATOM   1951 C CD1 . TRP A 1 273 ? 16.192  14.375  70.074  1.00 79.50  ? 297  TRP A CD1 1 
ATOM   1952 C CD2 . TRP A 1 273 ? 15.559  15.529  68.264  1.00 79.50  ? 297  TRP A CD2 1 
ATOM   1953 N NE1 . TRP A 1 273 ? 16.475  15.703  70.307  1.00 79.50  ? 297  TRP A NE1 1 
ATOM   1954 C CE2 . TRP A 1 273 ? 16.097  16.430  69.207  1.00 79.50  ? 297  TRP A CE2 1 
ATOM   1955 C CE3 . TRP A 1 273 ? 15.095  16.029  67.047  1.00 79.50  ? 297  TRP A CE3 1 
ATOM   1956 C CZ2 . TRP A 1 273 ? 16.175  17.796  68.971  1.00 79.50  ? 297  TRP A CZ2 1 
ATOM   1957 C CZ3 . TRP A 1 273 ? 15.172  17.389  66.817  1.00 79.50  ? 297  TRP A CZ3 1 
ATOM   1958 C CH2 . TRP A 1 273 ? 15.711  18.255  67.769  1.00 79.50  ? 297  TRP A CH2 1 
ATOM   1959 N N   . VAL A 1 274 ? 12.563  11.687  66.359  1.00 82.26  ? 298  VAL A N   1 
ATOM   1960 C CA  . VAL A 1 274 ? 12.181  10.573  65.510  1.00 82.26  ? 298  VAL A CA  1 
ATOM   1961 C C   . VAL A 1 274 ? 12.936  10.831  64.216  1.00 82.26  ? 298  VAL A C   1 
ATOM   1962 O O   . VAL A 1 274 ? 12.560  11.708  63.430  1.00 82.26  ? 298  VAL A O   1 
ATOM   1963 C CB  . VAL A 1 274 ? 10.686  10.558  65.251  1.00 49.29  ? 298  VAL A CB  1 
ATOM   1964 C CG1 . VAL A 1 274 ? 10.396  10.041  63.837  1.00 49.29  ? 298  VAL A CG1 1 
ATOM   1965 C CG2 . VAL A 1 274 ? 10.026  9.689   66.298  1.00 49.29  ? 298  VAL A CG2 1 
ATOM   1966 N N   . ALA A 1 275 ? 14.013  10.078  64.005  1.00 61.45  ? 299  ALA A N   1 
ATOM   1967 C CA  . ALA A 1 275 ? 14.839  10.282  62.826  1.00 61.45  ? 299  ALA A CA  1 
ATOM   1968 C C   . ALA A 1 275 ? 14.949  9.125   61.845  1.00 61.45  ? 299  ALA A C   1 
ATOM   1969 O O   . ALA A 1 275 ? 14.885  7.954   62.216  1.00 61.45  ? 299  ALA A O   1 
ATOM   1970 C CB  . ALA A 1 275 ? 16.227  10.713  63.256  1.00 97.85  ? 299  ALA A CB  1 
ATOM   1971 N N   . SER A 1 276 ? 15.128  9.492   60.581  1.00 57.90  ? 300  SER A N   1 
ATOM   1972 C CA  . SER A 1 276 ? 15.279  8.547   59.489  1.00 57.90  ? 300  SER A CA  1 
ATOM   1973 C C   . SER A 1 276 ? 16.640  7.882   59.630  1.00 57.90  ? 300  SER A C   1 
ATOM   1974 O O   . SER A 1 276 ? 17.468  8.300   60.438  1.00 57.90  ? 300  SER A O   1 
ATOM   1975 C CB  . SER A 1 276 ? 15.212  9.277   58.147  1.00 90.45  ? 300  SER A CB  1 
ATOM   1976 O OG  . SER A 1 276 ? 16.254  10.234  58.048  1.00 90.45  ? 300  SER A OG  1 
ATOM   1977 N N   . ASP A 1 277 ? 16.880  6.854   58.828  1.00 72.30  ? 301  ASP A N   1 
ATOM   1978 C CA  . ASP A 1 277 ? 18.148  6.149   58.895  1.00 72.30  ? 301  ASP A CA  1 
ATOM   1979 C C   . ASP A 1 277 ? 19.268  7.161   58.843  1.00 72.30  ? 301  ASP A C   1 
ATOM   1980 O O   . ASP A 1 277 ? 20.312  6.941   59.432  1.00 72.30  ? 301  ASP A O   1 
ATOM   1981 C CB  . ASP A 1 277 ? 18.291  5.208   57.717  1.00 76.95  ? 301  ASP A CB  1 
ATOM   1982 C CG  . ASP A 1 277 ? 18.400  5.954   56.434  1.00 76.95  ? 301  ASP A CG  1 
ATOM   1983 O OD1 . ASP A 1 277 ? 17.476  6.747   56.156  1.00 76.95  ? 301  ASP A OD1 1 
ATOM   1984 O OD2 . ASP A 1 277 ? 19.406  5.769   55.720  1.00 76.95  ? 301  ASP A OD2 1 
ATOM   1985 N N   . GLY A 1 278 ? 19.055  8.265   58.128  1.00 68.89  ? 302  GLY A N   1 
ATOM   1986 C CA  . GLY A 1 278 ? 20.081  9.298   58.019  1.00 68.89  ? 302  GLY A CA  1 
ATOM   1987 C C   . GLY A 1 278 ? 20.891  9.442   59.296  1.00 68.89  ? 302  GLY A C   1 
ATOM   1988 O O   . GLY A 1 278 ? 22.121  9.556   59.277  1.00 68.89  ? 302  GLY A O   1 
ATOM   1989 N N   . TRP A 1 279 ? 20.171  9.448   60.413  1.00 80.31  ? 303  TRP A N   1 
ATOM   1990 C CA  . TRP A 1 279 ? 20.757  9.537   61.740  1.00 80.31  ? 303  TRP A CA  1 
ATOM   1991 C C   . TRP A 1 279 ? 21.002  8.072   62.066  1.00 80.31  ? 303  TRP A C   1 
ATOM   1992 O O   . TRP A 1 279 ? 22.090  7.677   62.482  1.00 80.31  ? 303  TRP A O   1 
ATOM   1993 C CB  . TRP A 1 279 ? 19.739  10.165  62.701  1.00 67.88  ? 303  TRP A CB  1 
ATOM   1994 C CG  . TRP A 1 279 ? 20.023  10.020  64.154  1.00 67.88  ? 303  TRP A CG  1 
ATOM   1995 C CD1 . TRP A 1 279 ? 20.620  8.967   64.764  1.00 67.88  ? 303  TRP A CD1 1 
ATOM   1996 C CD2 . TRP A 1 279 ? 19.572  10.880  65.203  1.00 67.88  ? 303  TRP A CD2 1 
ATOM   1997 N NE1 . TRP A 1 279 ? 20.564  9.104   66.126  1.00 67.88  ? 303  TRP A NE1 1 
ATOM   1998 C CE2 . TRP A 1 279 ? 19.923  10.272  66.425  1.00 67.88  ? 303  TRP A CE2 1 
ATOM   1999 C CE3 . TRP A 1 279 ? 18.896  12.104  65.233  1.00 67.88  ? 303  TRP A CE3 1 
ATOM   2000 C CZ2 . TRP A 1 279 ? 19.621  10.843  67.670  1.00 67.88  ? 303  TRP A CZ2 1 
ATOM   2001 C CZ3 . TRP A 1 279 ? 18.591  12.676  66.481  1.00 67.88  ? 303  TRP A CZ3 1 
ATOM   2002 C CH2 . TRP A 1 279 ? 18.956  12.040  67.677  1.00 67.88  ? 303  TRP A CH2 1 
ATOM   2003 N N   . GLY A 1 280 ? 19.975  7.263   61.844  1.00 77.99  ? 304  GLY A N   1 
ATOM   2004 C CA  . GLY A 1 280 ? 20.087  5.842   62.097  1.00 77.99  ? 304  GLY A CA  1 
ATOM   2005 C C   . GLY A 1 280 ? 20.463  5.499   63.519  1.00 77.99  ? 304  GLY A C   1 
ATOM   2006 O O   . GLY A 1 280 ? 19.945  6.086   64.474  1.00 77.99  ? 304  GLY A O   1 
ATOM   2007 N N   . ALA A 1 281 ? 21.369  4.537   63.659  1.00 63.30  ? 305  ALA A N   1 
ATOM   2008 C CA  . ALA A 1 281 ? 21.797  4.106   64.980  1.00 63.30  ? 305  ALA A CA  1 
ATOM   2009 C C   . ALA A 1 281 ? 23.228  4.508   65.246  1.00 63.30  ? 305  ALA A C   1 
ATOM   2010 O O   . ALA A 1 281 ? 23.920  3.876   66.037  1.00 63.30  ? 305  ALA A O   1 
ATOM   2011 C CB  . ALA A 1 281 ? 21.648  2.607   65.108  1.00 43.09  ? 305  ALA A CB  1 
ATOM   2012 N N   . GLN A 1 282 ? 23.665  5.566   64.581  1.00 72.55  ? 306  GLN A N   1 
ATOM   2013 C CA  . GLN A 1 282 ? 25.025  6.037   64.741  1.00 72.55  ? 306  GLN A CA  1 
ATOM   2014 C C   . GLN A 1 282 ? 25.232  6.625   66.122  1.00 72.55  ? 306  GLN A C   1 
ATOM   2015 O O   . GLN A 1 282 ? 24.524  7.552   66.526  1.00 72.55  ? 306  GLN A O   1 
ATOM   2016 C CB  . GLN A 1 282 ? 25.346  7.076   63.676  1.00 71.52  ? 306  GLN A CB  1 
ATOM   2017 C CG  . GLN A 1 282 ? 25.125  6.569   62.282  1.00 71.52  ? 306  GLN A CG  1 
ATOM   2018 C CD  . GLN A 1 282 ? 25.691  7.499   61.254  1.00 71.52  ? 306  GLN A CD  1 
ATOM   2019 O OE1 . GLN A 1 282 ? 26.912  7.603   61.096  1.00 71.52  ? 306  GLN A OE1 1 
ATOM   2020 N NE2 . GLN A 1 282 ? 24.809  8.201   60.548  1.00 71.52  ? 306  GLN A NE2 1 
ATOM   2021 N N   . GLU A 1 283 ? 26.208  6.079   66.846  1.00 102.71 ? 307  GLU A N   1 
ATOM   2022 C CA  . GLU A 1 283 ? 26.504  6.553   68.187  1.00 102.71 ? 307  GLU A CA  1 
ATOM   2023 C C   . GLU A 1 283 ? 27.429  7.741   68.055  1.00 102.71 ? 307  GLU A C   1 
ATOM   2024 O O   . GLU A 1 283 ? 27.763  8.394   69.036  1.00 102.71 ? 307  GLU A O   1 
ATOM   2025 C CB  . GLU A 1 283 ? 27.170  5.449   69.018  1.00 150.42 ? 307  GLU A CB  1 
ATOM   2026 C CG  . GLU A 1 283 ? 26.443  4.110   68.951  1.00 150.42 ? 307  GLU A CG  1 
ATOM   2027 C CD  . GLU A 1 283 ? 26.773  3.178   70.107  1.00 150.42 ? 307  GLU A CD  1 
ATOM   2028 O OE1 . GLU A 1 283 ? 27.970  2.919   70.353  1.00 150.42 ? 307  GLU A OE1 1 
ATOM   2029 O OE2 . GLU A 1 283 ? 25.826  2.695   70.766  1.00 150.42 ? 307  GLU A OE2 1 
ATOM   2030 N N   . SER A 1 284 ? 27.829  8.029   66.826  1.00 78.09  ? 308  SER A N   1 
ATOM   2031 C CA  . SER A 1 284 ? 28.733  9.134   66.581  1.00 78.09  ? 308  SER A CA  1 
ATOM   2032 C C   . SER A 1 284 ? 27.977  10.429  66.372  1.00 78.09  ? 308  SER A C   1 
ATOM   2033 O O   . SER A 1 284 ? 28.574  11.490  66.212  1.00 78.09  ? 308  SER A O   1 
ATOM   2034 C CB  . SER A 1 284 ? 29.593  8.852   65.348  1.00 83.36  ? 308  SER A CB  1 
ATOM   2035 O OG  . SER A 1 284 ? 28.957  9.311   64.170  1.00 83.36  ? 308  SER A OG  1 
ATOM   2036 N N   . ILE A 1 285 ? 26.657  10.342  66.373  1.00 98.21  ? 309  ILE A N   1 
ATOM   2037 C CA  . ILE A 1 285 ? 25.822  11.516  66.153  1.00 98.21  ? 309  ILE A CA  1 
ATOM   2038 C C   . ILE A 1 285 ? 25.502  12.190  67.474  1.00 98.21  ? 309  ILE A C   1 
ATOM   2039 O O   . ILE A 1 285 ? 25.557  13.411  67.608  1.00 98.21  ? 309  ILE A O   1 
ATOM   2040 C CB  . ILE A 1 285 ? 24.514  11.095  65.441  1.00 100.79 ? 309  ILE A CB  1 
ATOM   2041 C CG1 . ILE A 1 285 ? 24.849  10.623  64.030  1.00 100.79 ? 309  ILE A CG1 1 
ATOM   2042 C CG2 . ILE A 1 285 ? 23.519  12.230  65.418  1.00 100.79 ? 309  ILE A CG2 1 
ATOM   2043 C CD1 . ILE A 1 285 ? 23.704  9.994   63.330  1.00 100.79 ? 309  ILE A CD1 1 
ATOM   2044 N N   . VAL A 1 286 ? 25.186  11.363  68.455  1.00 92.01  ? 310  VAL A N   1 
ATOM   2045 C CA  . VAL A 1 286 ? 24.820  11.842  69.765  1.00 92.01  ? 310  VAL A CA  1 
ATOM   2046 C C   . VAL A 1 286 ? 26.056  12.232  70.583  1.00 92.01  ? 310  VAL A C   1 
ATOM   2047 O O   . VAL A 1 286 ? 25.931  12.808  71.667  1.00 92.01  ? 310  VAL A O   1 
ATOM   2048 C CB  . VAL A 1 286 ? 23.989  10.753  70.521  1.00 75.67  ? 310  VAL A CB  1 
ATOM   2049 C CG1 . VAL A 1 286 ? 23.275  11.378  71.713  1.00 75.67  ? 310  VAL A CG1 1 
ATOM   2050 C CG2 . VAL A 1 286 ? 22.978  10.099  69.581  1.00 75.67  ? 310  VAL A CG2 1 
ATOM   2051 N N   . LYS A 1 287 ? 27.248  11.932  70.069  1.00 108.24 ? 311  LYS A N   1 
ATOM   2052 C CA  . LYS A 1 287 ? 28.483  12.257  70.791  1.00 108.24 ? 311  LYS A CA  1 
ATOM   2053 C C   . LYS A 1 287 ? 28.641  13.761  71.029  1.00 108.24 ? 311  LYS A C   1 
ATOM   2054 O O   . LYS A 1 287 ? 28.788  14.544  70.092  1.00 108.24 ? 311  LYS A O   1 
ATOM   2055 C CB  . LYS A 1 287 ? 29.708  11.722  70.043  1.00 183.94 ? 311  LYS A CB  1 
ATOM   2056 C CG  . LYS A 1 287 ? 31.030  12.002  70.749  1.00 183.94 ? 311  LYS A CG  1 
ATOM   2057 C CD  . LYS A 1 287 ? 32.218  11.584  69.893  1.00 183.94 ? 311  LYS A CD  1 
ATOM   2058 C CE  . LYS A 1 287 ? 33.526  12.136  70.448  1.00 183.94 ? 311  LYS A CE  1 
ATOM   2059 N NZ  . LYS A 1 287 ? 34.685  11.851  69.551  1.00 183.94 ? 311  LYS A NZ  1 
ATOM   2060 N N   . GLY A 1 288 ? 28.610  14.148  72.300  1.00 99.67  ? 312  GLY A N   1 
ATOM   2061 C CA  . GLY A 1 288 ? 28.742  15.545  72.658  1.00 99.67  ? 312  GLY A CA  1 
ATOM   2062 C C   . GLY A 1 288 ? 27.399  16.125  73.035  1.00 99.67  ? 312  GLY A C   1 
ATOM   2063 O O   . GLY A 1 288 ? 27.282  17.320  73.286  1.00 99.67  ? 312  GLY A O   1 
ATOM   2064 N N   . SER A 1 289 ? 26.387  15.263  73.076  1.00 90.05  ? 313  SER A N   1 
ATOM   2065 C CA  . SER A 1 289 ? 25.013  15.649  73.411  1.00 90.05  ? 313  SER A CA  1 
ATOM   2066 C C   . SER A 1 289 ? 24.236  14.387  73.808  1.00 90.05  ? 313  SER A C   1 
ATOM   2067 O O   . SER A 1 289 ? 23.029  14.278  73.600  1.00 90.05  ? 313  SER A O   1 
ATOM   2068 C CB  . SER A 1 289 ? 24.335  16.308  72.198  1.00 130.41 ? 313  SER A CB  1 
ATOM   2069 O OG  . SER A 1 289 ? 25.112  17.373  71.669  1.00 130.41 ? 313  SER A OG  1 
ATOM   2070 N N   . GLU A 1 290 ? 24.956  13.434  74.377  1.00 150.04 ? 314  GLU A N   1 
ATOM   2071 C CA  . GLU A 1 290 ? 24.383  12.169  74.802  1.00 150.04 ? 314  GLU A CA  1 
ATOM   2072 C C   . GLU A 1 290 ? 23.007  12.270  75.454  1.00 150.04 ? 314  GLU A C   1 
ATOM   2073 O O   . GLU A 1 290 ? 22.260  11.297  75.446  1.00 150.04 ? 314  GLU A O   1 
ATOM   2074 C CB  . GLU A 1 290 ? 25.340  11.472  75.765  1.00 125.15 ? 314  GLU A CB  1 
ATOM   2075 C CG  . GLU A 1 290 ? 26.686  11.053  75.168  1.00 125.15 ? 314  GLU A CG  1 
ATOM   2076 C CD  . GLU A 1 290 ? 27.510  12.195  74.575  1.00 125.15 ? 314  GLU A CD  1 
ATOM   2077 O OE1 . GLU A 1 290 ? 27.470  13.337  75.094  1.00 125.15 ? 314  GLU A OE1 1 
ATOM   2078 O OE2 . GLU A 1 290 ? 28.225  11.926  73.589  1.00 125.15 ? 314  GLU A OE2 1 
ATOM   2079 N N   . HIS A 1 291 ? 22.674  13.429  76.022  1.00 161.95 ? 315  HIS A N   1 
ATOM   2080 C CA  . HIS A 1 291 ? 21.379  13.611  76.687  1.00 161.95 ? 315  HIS A CA  1 
ATOM   2081 C C   . HIS A 1 291 ? 20.327  14.394  75.891  1.00 161.95 ? 315  HIS A C   1 
ATOM   2082 O O   . HIS A 1 291 ? 19.153  14.019  75.884  1.00 161.95 ? 315  HIS A O   1 
ATOM   2083 C CB  . HIS A 1 291 ? 21.576  14.250  78.071  1.00 226.79 ? 315  HIS A CB  1 
ATOM   2084 C CG  . HIS A 1 291 ? 22.488  15.440  78.073  1.00 226.79 ? 315  HIS A CG  1 
ATOM   2085 N ND1 . HIS A 1 291 ? 22.170  16.629  77.451  1.00 226.79 ? 315  HIS A ND1 1 
ATOM   2086 C CD2 . HIS A 1 291 ? 23.709  15.624  78.632  1.00 226.79 ? 315  HIS A CD2 1 
ATOM   2087 C CE1 . HIS A 1 291 ? 23.154  17.493  77.627  1.00 226.79 ? 315  HIS A CE1 1 
ATOM   2088 N NE2 . HIS A 1 291 ? 24.100  16.908  78.339  1.00 226.79 ? 315  HIS A NE2 1 
ATOM   2089 N N   . VAL A 1 292 ? 20.741  15.472  75.227  1.00 104.58 ? 316  VAL A N   1 
ATOM   2090 C CA  . VAL A 1 292 ? 19.823  16.287  74.419  1.00 104.58 ? 316  VAL A CA  1 
ATOM   2091 C C   . VAL A 1 292 ? 19.172  15.418  73.338  1.00 104.58 ? 316  VAL A C   1 
ATOM   2092 O O   . VAL A 1 292 ? 18.166  15.799  72.725  1.00 104.58 ? 316  VAL A O   1 
ATOM   2093 C CB  . VAL A 1 292 ? 20.573  17.465  73.739  1.00 154.68 ? 316  VAL A CB  1 
ATOM   2094 C CG1 . VAL A 1 292 ? 19.628  18.261  72.863  1.00 154.68 ? 316  VAL A CG1 1 
ATOM   2095 C CG2 . VAL A 1 292 ? 21.177  18.365  74.797  1.00 154.68 ? 316  VAL A CG2 1 
ATOM   2096 N N   . ALA A 1 293 ? 19.756  14.242  73.120  1.00 114.28 ? 317  ALA A N   1 
ATOM   2097 C CA  . ALA A 1 293 ? 19.257  13.304  72.131  1.00 114.28 ? 317  ALA A CA  1 
ATOM   2098 C C   . ALA A 1 293 ? 18.663  12.065  72.801  1.00 114.28 ? 317  ALA A C   1 
ATOM   2099 O O   . ALA A 1 293 ? 18.048  11.231  72.136  1.00 114.28 ? 317  ALA A O   1 
ATOM   2100 C CB  . ALA A 1 293 ? 20.384  12.908  71.182  1.00 90.33  ? 317  ALA A CB  1 
ATOM   2101 N N   . TYR A 1 294 ? 18.842  11.949  74.116  1.00 96.89  ? 318  TYR A N   1 
ATOM   2102 C CA  . TYR A 1 294 ? 18.314  10.809  74.871  1.00 96.89  ? 318  TYR A CA  1 
ATOM   2103 C C   . TYR A 1 294 ? 16.848  10.534  74.548  1.00 96.89  ? 318  TYR A C   1 
ATOM   2104 O O   . TYR A 1 294 ? 16.127  11.409  74.054  1.00 96.89  ? 318  TYR A O   1 
ATOM   2105 C CB  . TYR A 1 294 ? 18.431  11.055  76.387  1.00 108.59 ? 318  TYR A CB  1 
ATOM   2106 C CG  . TYR A 1 294 ? 17.884  9.918   77.265  1.00 108.59 ? 318  TYR A CG  1 
ATOM   2107 C CD1 . TYR A 1 294 ? 18.645  8.770   77.518  1.00 108.59 ? 318  TYR A CD1 1 
ATOM   2108 C CD2 . TYR A 1 294 ? 16.582  9.970   77.797  1.00 108.59 ? 318  TYR A CD2 1 
ATOM   2109 C CE1 . TYR A 1 294 ? 18.127  7.704   78.267  1.00 108.59 ? 318  TYR A CE1 1 
ATOM   2110 C CE2 . TYR A 1 294 ? 16.058  8.898   78.544  1.00 108.59 ? 318  TYR A CE2 1 
ATOM   2111 C CZ  . TYR A 1 294 ? 16.840  7.773   78.766  1.00 108.59 ? 318  TYR A CZ  1 
ATOM   2112 O OH  . TYR A 1 294 ? 16.334  6.693   79.439  1.00 108.59 ? 318  TYR A OH  1 
ATOM   2113 N N   . GLY A 1 295 ? 16.428  9.304   74.843  1.00 136.23 ? 319  GLY A N   1 
ATOM   2114 C CA  . GLY A 1 295 ? 15.056  8.877   74.639  1.00 136.23 ? 319  GLY A CA  1 
ATOM   2115 C C   . GLY A 1 295 ? 14.478  9.218   73.291  1.00 136.23 ? 319  GLY A C   1 
ATOM   2116 O O   . GLY A 1 295 ? 13.300  9.563   73.186  1.00 136.23 ? 319  GLY A O   1 
ATOM   2117 N N   . ALA A 1 296 ? 15.303  9.122   72.258  1.00 96.46  ? 320  ALA A N   1 
ATOM   2118 C CA  . ALA A 1 296 ? 14.850  9.424   70.914  1.00 96.46  ? 320  ALA A CA  1 
ATOM   2119 C C   . ALA A 1 296 ? 14.545  8.125   70.198  1.00 96.46  ? 320  ALA A C   1 
ATOM   2120 O O   . ALA A 1 296 ? 14.866  7.046   70.691  1.00 96.46  ? 320  ALA A O   1 
ATOM   2121 C CB  . ALA A 1 296 ? 15.918  10.197  70.163  1.00 104.08 ? 320  ALA A CB  1 
ATOM   2122 N N   . ILE A 1 297 ? 13.922  8.236   69.031  1.00 82.66  ? 321  ILE A N   1 
ATOM   2123 C CA  . ILE A 1 297 ? 13.572  7.074   68.228  1.00 82.66  ? 321  ILE A CA  1 
ATOM   2124 C C   . ILE A 1 297 ? 14.058  7.271   66.790  1.00 82.66  ? 321  ILE A C   1 
ATOM   2125 O O   . ILE A 1 297 ? 13.682  8.234   66.112  1.00 82.66  ? 321  ILE A O   1 
ATOM   2126 C CB  . ILE A 1 297 ? 12.048  6.849   68.292  1.00 76.73  ? 321  ILE A CB  1 
ATOM   2127 C CG1 . ILE A 1 297 ? 11.707  6.263   69.660  1.00 76.73  ? 321  ILE A CG1 1 
ATOM   2128 C CG2 . ILE A 1 297 ? 11.570  5.958   67.163  1.00 76.73  ? 321  ILE A CG2 1 
ATOM   2129 C CD1 . ILE A 1 297 ? 10.242  5.886   69.824  1.00 76.73  ? 321  ILE A CD1 1 
ATOM   2130 N N   . THR A 1 298 ? 14.918  6.364   66.341  1.00 68.51  ? 322  THR A N   1 
ATOM   2131 C CA  . THR A 1 298 ? 15.464  6.444   64.992  1.00 68.51  ? 322  THR A CA  1 
ATOM   2132 C C   . THR A 1 298 ? 15.349  5.121   64.268  1.00 68.51  ? 322  THR A C   1 
ATOM   2133 O O   . THR A 1 298 ? 15.500  4.064   64.879  1.00 68.51  ? 322  THR A O   1 
ATOM   2134 C CB  . THR A 1 298 ? 16.940  6.833   65.019  1.00 81.87  ? 322  THR A CB  1 
ATOM   2135 O OG1 . THR A 1 298 ? 17.677  5.886   65.805  1.00 81.87  ? 322  THR A OG1 1 
ATOM   2136 C CG2 . THR A 1 298 ? 17.096  8.213   65.609  1.00 81.87  ? 322  THR A CG2 1 
ATOM   2137 N N   . LEU A 1 299 ? 15.091  5.186   62.964  1.00 65.08  ? 323  LEU A N   1 
ATOM   2138 C CA  . LEU A 1 299 ? 14.957  3.996   62.127  1.00 65.08  ? 323  LEU A CA  1 
ATOM   2139 C C   . LEU A 1 299 ? 16.229  3.642   61.373  1.00 65.08  ? 323  LEU A C   1 
ATOM   2140 O O   . LEU A 1 299 ? 17.056  4.503   61.109  1.00 65.08  ? 323  LEU A O   1 
ATOM   2141 C CB  . LEU A 1 299 ? 13.861  4.205   61.095  1.00 91.98  ? 323  LEU A CB  1 
ATOM   2142 C CG  . LEU A 1 299 ? 12.424  4.067   61.562  1.00 91.98  ? 323  LEU A CG  1 
ATOM   2143 C CD1 . LEU A 1 299 ? 11.510  4.317   60.364  1.00 91.98  ? 323  LEU A CD1 1 
ATOM   2144 C CD2 . LEU A 1 299 ? 12.194  2.670   62.157  1.00 91.98  ? 323  LEU A CD2 1 
ATOM   2145 N N   . GLU A 1 300 ? 16.390  2.372   61.028  1.00 63.86  ? 324  GLU A N   1 
ATOM   2146 C CA  . GLU A 1 300 ? 17.537  1.949   60.242  1.00 63.86  ? 324  GLU A CA  1 
ATOM   2147 C C   . GLU A 1 300 ? 17.059  0.818   59.324  1.00 63.86  ? 324  GLU A C   1 
ATOM   2148 O O   . GLU A 1 300 ? 15.950  0.322   59.503  1.00 63.86  ? 324  GLU A O   1 
ATOM   2149 C CB  . GLU A 1 300 ? 18.669  1.476   61.142  1.00 115.14 ? 324  GLU A CB  1 
ATOM   2150 C CG  . GLU A 1 300 ? 19.904  1.053   60.353  1.00 115.14 ? 324  GLU A CG  1 
ATOM   2151 C CD  . GLU A 1 300 ? 20.570  2.192   59.571  1.00 115.14 ? 324  GLU A CD  1 
ATOM   2152 O OE1 . GLU A 1 300 ? 21.381  2.934   60.175  1.00 115.14 ? 324  GLU A OE1 1 
ATOM   2153 O OE2 . GLU A 1 300 ? 20.285  2.338   58.357  1.00 115.14 ? 324  GLU A OE2 1 
ATOM   2154 N N   . LEU A 1 301 ? 17.849  0.431   58.322  1.00 61.83  ? 325  LEU A N   1 
ATOM   2155 C CA  . LEU A 1 301 ? 17.437  -0.657  57.442  1.00 61.83  ? 325  LEU A CA  1 
ATOM   2156 C C   . LEU A 1 301 ? 17.687  -1.965  58.164  1.00 61.83  ? 325  LEU A C   1 
ATOM   2157 O O   . LEU A 1 301 ? 18.565  -2.064  59.029  1.00 61.83  ? 325  LEU A O   1 
ATOM   2158 C CB  . LEU A 1 301 ? 18.213  -0.633  56.134  1.00 58.04  ? 325  LEU A CB  1 
ATOM   2159 C CG  . LEU A 1 301 ? 18.073  0.680   55.355  1.00 58.04  ? 325  LEU A CG  1 
ATOM   2160 C CD1 . LEU A 1 301 ? 18.422  0.495   53.841  1.00 58.04  ? 325  LEU A CD1 1 
ATOM   2161 C CD2 . LEU A 1 301 ? 16.641  1.164   55.520  1.00 58.04  ? 325  LEU A CD2 1 
ATOM   2162 N N   . ALA A 1 302 ? 16.903  -2.976  57.832  1.00 77.55  ? 326  ALA A N   1 
ATOM   2163 C CA  . ALA A 1 302 ? 17.054  -4.261  58.486  1.00 77.55  ? 326  ALA A CA  1 
ATOM   2164 C C   . ALA A 1 302 ? 18.257  -4.940  57.892  1.00 77.55  ? 326  ALA A C   1 
ATOM   2165 O O   . ALA A 1 302 ? 18.260  -5.223  56.698  1.00 77.55  ? 326  ALA A O   1 
ATOM   2166 C CB  . ALA A 1 302 ? 15.808  -5.107  58.259  1.00 204.33 ? 326  ALA A CB  1 
ATOM   2167 N N   . SER A 1 303 ? 19.281  -5.187  58.703  1.00 71.65  ? 327  SER A N   1 
ATOM   2168 C CA  . SER A 1 303 ? 20.473  -5.859  58.192  1.00 71.65  ? 327  SER A CA  1 
ATOM   2169 C C   . SER A 1 303 ? 21.161  -6.650  59.288  1.00 71.65  ? 327  SER A C   1 
ATOM   2170 O O   . SER A 1 303 ? 21.128  -6.261  60.449  1.00 71.65  ? 327  SER A O   1 
ATOM   2171 C CB  . SER A 1 303 ? 21.453  -4.853  57.613  1.00 82.54  ? 327  SER A CB  1 
ATOM   2172 O OG  . SER A 1 303 ? 21.965  -4.022  58.633  1.00 82.54  ? 327  SER A OG  1 
ATOM   2173 N N   . HIS A 1 304 ? 21.783  -7.766  58.921  1.00 125.48 ? 328  HIS A N   1 
ATOM   2174 C CA  . HIS A 1 304 ? 22.465  -8.612  59.891  1.00 125.48 ? 328  HIS A CA  1 
ATOM   2175 C C   . HIS A 1 304 ? 23.951  -8.548  59.597  1.00 125.48 ? 328  HIS A C   1 
ATOM   2176 O O   . HIS A 1 304 ? 24.378  -8.966  58.525  1.00 125.48 ? 328  HIS A O   1 
ATOM   2177 C CB  . HIS A 1 304 ? 21.984  -10.065 59.761  1.00 229.00 ? 328  HIS A CB  1 
ATOM   2178 C CG  . HIS A 1 304 ? 20.492  -10.224 59.795  1.00 229.00 ? 328  HIS A CG  1 
ATOM   2179 N ND1 . HIS A 1 304 ? 19.871  -11.438 59.590  1.00 229.00 ? 328  HIS A ND1 1 
ATOM   2180 C CD2 . HIS A 1 304 ? 19.499  -9.326  60.000  1.00 229.00 ? 328  HIS A CD2 1 
ATOM   2181 C CE1 . HIS A 1 304 ? 18.561  -11.280 59.665  1.00 229.00 ? 328  HIS A CE1 1 
ATOM   2182 N NE2 . HIS A 1 304 ? 18.309  -10.007 59.913  1.00 229.00 ? 328  HIS A NE2 1 
ATOM   2183 N N   . PRO A 1 305 ? 24.759  -8.031  60.540  1.00 82.47  ? 329  PRO A N   1 
ATOM   2184 C CA  . PRO A 1 305 ? 26.219  -7.906  60.400  1.00 82.47  ? 329  PRO A CA  1 
ATOM   2185 C C   . PRO A 1 305 ? 26.910  -9.051  59.655  1.00 82.47  ? 329  PRO A C   1 
ATOM   2186 O O   . PRO A 1 305 ? 26.541  -10.209 59.811  1.00 82.47  ? 329  PRO A O   1 
ATOM   2187 C CB  . PRO A 1 305 ? 26.705  -7.788  61.849  1.00 89.81  ? 329  PRO A CB  1 
ATOM   2188 C CG  . PRO A 1 305 ? 25.567  -8.332  62.663  1.00 89.81  ? 329  PRO A CG  1 
ATOM   2189 C CD  . PRO A 1 305 ? 24.369  -7.788  61.934  1.00 89.81  ? 329  PRO A CD  1 
ATOM   2190 N N   . VAL A 1 306 ? 27.912  -8.718  58.848  1.00 71.95  ? 330  VAL A N   1 
ATOM   2191 C CA  . VAL A 1 306 ? 28.650  -9.707  58.072  1.00 71.95  ? 330  VAL A CA  1 
ATOM   2192 C C   . VAL A 1 306 ? 29.832  -10.192 58.873  1.00 71.95  ? 330  VAL A C   1 
ATOM   2193 O O   . VAL A 1 306 ? 30.873  -9.532  58.897  1.00 71.95  ? 330  VAL A O   1 
ATOM   2194 C CB  . VAL A 1 306 ? 29.199  -9.096  56.819  1.00 40.79  ? 330  VAL A CB  1 
ATOM   2195 C CG1 . VAL A 1 306 ? 30.124  -10.060 56.149  1.00 40.79  ? 330  VAL A CG1 1 
ATOM   2196 C CG2 . VAL A 1 306 ? 28.079  -8.696  55.926  1.00 40.79  ? 330  VAL A CG2 1 
ATOM   2197 N N   . ARG A 1 307 ? 29.682  -11.348 59.508  1.00 109.96 ? 331  ARG A N   1 
ATOM   2198 C CA  . ARG A 1 307 ? 30.731  -11.909 60.351  1.00 109.96 ? 331  ARG A CA  1 
ATOM   2199 C C   . ARG A 1 307 ? 32.191  -11.754 59.879  1.00 109.96 ? 331  ARG A C   1 
ATOM   2200 O O   . ARG A 1 307 ? 33.022  -11.153 60.577  1.00 109.96 ? 331  ARG A O   1 
ATOM   2201 C CB  . ARG A 1 307 ? 30.424  -13.386 60.622  1.00 216.86 ? 331  ARG A CB  1 
ATOM   2202 C CG  . ARG A 1 307 ? 29.579  -13.632 61.873  1.00 216.86 ? 331  ARG A CG  1 
ATOM   2203 C CD  . ARG A 1 307 ? 30.382  -13.346 63.144  1.00 216.86 ? 331  ARG A CD  1 
ATOM   2204 N NE  . ARG A 1 307 ? 29.656  -13.687 64.367  1.00 216.86 ? 331  ARG A NE  1 
ATOM   2205 C CZ  . ARG A 1 307 ? 30.195  -13.683 65.584  1.00 216.86 ? 331  ARG A CZ  1 
ATOM   2206 N NH1 . ARG A 1 307 ? 31.469  -13.356 65.749  1.00 216.86 ? 331  ARG A NH1 1 
ATOM   2207 N NH2 . ARG A 1 307 ? 29.459  -14.009 66.637  1.00 216.86 ? 331  ARG A NH2 1 
ATOM   2208 N N   . GLN A 1 308 ? 32.500  -12.291 58.702  1.00 81.75  ? 332  GLN A N   1 
ATOM   2209 C CA  . GLN A 1 308 ? 33.861  -12.238 58.168  1.00 81.75  ? 332  GLN A CA  1 
ATOM   2210 C C   . GLN A 1 308 ? 34.426  -10.821 58.065  1.00 81.75  ? 332  GLN A C   1 
ATOM   2211 O O   . GLN A 1 308 ? 35.570  -10.580 58.433  1.00 81.75  ? 332  GLN A O   1 
ATOM   2212 C CB  . GLN A 1 308 ? 33.921  -12.952 56.809  1.00 118.98 ? 332  GLN A CB  1 
ATOM   2213 C CG  . GLN A 1 308 ? 33.630  -14.457 56.890  1.00 118.98 ? 332  GLN A CG  1 
ATOM   2214 C CD  . GLN A 1 308 ? 32.138  -14.793 56.969  1.00 118.98 ? 332  GLN A CD  1 
ATOM   2215 O OE1 . GLN A 1 308 ? 31.341  -14.064 57.569  1.00 118.98 ? 332  GLN A OE1 1 
ATOM   2216 N NE2 . GLN A 1 308 ? 31.761  -15.917 56.372  1.00 118.98 ? 332  GLN A NE2 1 
ATOM   2217 N N   . PHE A 1 309 ? 33.629  -9.879  57.579  1.00 47.13  ? 333  PHE A N   1 
ATOM   2218 C CA  . PHE A 1 309 ? 34.105  -8.517  57.484  1.00 47.13  ? 333  PHE A CA  1 
ATOM   2219 C C   . PHE A 1 309 ? 34.643  -8.025  58.825  1.00 47.13  ? 333  PHE A C   1 
ATOM   2220 O O   . PHE A 1 309 ? 35.629  -7.286  58.864  1.00 47.13  ? 333  PHE A O   1 
ATOM   2221 C CB  . PHE A 1 309 ? 32.997  -7.585  57.061  1.00 48.37  ? 333  PHE A CB  1 
ATOM   2222 C CG  . PHE A 1 309 ? 33.434  -6.163  56.962  1.00 48.37  ? 333  PHE A CG  1 
ATOM   2223 C CD1 . PHE A 1 309 ? 34.137  -5.725  55.844  1.00 48.37  ? 333  PHE A CD1 1 
ATOM   2224 C CD2 . PHE A 1 309 ? 33.172  -5.273  57.996  1.00 48.37  ? 333  PHE A CD2 1 
ATOM   2225 C CE1 . PHE A 1 309 ? 34.573  -4.432  55.746  1.00 48.37  ? 333  PHE A CE1 1 
ATOM   2226 C CE2 . PHE A 1 309 ? 33.603  -3.971  57.918  1.00 48.37  ? 333  PHE A CE2 1 
ATOM   2227 C CZ  . PHE A 1 309 ? 34.312  -3.543  56.780  1.00 48.37  ? 333  PHE A CZ  1 
ATOM   2228 N N   . ASP A 1 310 ? 33.982  -8.399  59.920  1.00 55.97  ? 334  ASP A N   1 
ATOM   2229 C CA  . ASP A 1 310 ? 34.446  -7.998  61.244  1.00 55.97  ? 334  ASP A CA  1 
ATOM   2230 C C   . ASP A 1 310 ? 35.900  -8.401  61.461  1.00 55.97  ? 334  ASP A C   1 
ATOM   2231 O O   . ASP A 1 310 ? 36.757  -7.565  61.755  1.00 55.97  ? 334  ASP A O   1 
ATOM   2232 C CB  . ASP A 1 310 ? 33.612  -8.646  62.334  1.00 108.02 ? 334  ASP A CB  1 
ATOM   2233 C CG  . ASP A 1 310 ? 32.471  -7.783  62.772  1.00 108.02 ? 334  ASP A CG  1 
ATOM   2234 O OD1 . ASP A 1 310 ? 32.706  -6.603  63.094  1.00 108.02 ? 334  ASP A OD1 1 
ATOM   2235 O OD2 . ASP A 1 310 ? 31.337  -8.292  62.805  1.00 108.02 ? 334  ASP A OD2 1 
ATOM   2236 N N   . ARG A 1 311 ? 36.181  -9.690  61.322  1.00 77.00  ? 335  ARG A N   1 
ATOM   2237 C CA  . ARG A 1 311 ? 37.542  -10.161 61.521  1.00 77.00  ? 335  ARG A CA  1 
ATOM   2238 C C   . ARG A 1 311 ? 38.452  -9.460  60.528  1.00 77.00  ? 335  ARG A C   1 
ATOM   2239 O O   . ARG A 1 311 ? 39.573  -9.093  60.850  1.00 77.00  ? 335  ARG A O   1 
ATOM   2240 C CB  . ARG A 1 311 ? 37.628  -11.682 61.339  1.00 206.78 ? 335  ARG A CB  1 
ATOM   2241 C CG  . ARG A 1 311 ? 38.878  -12.327 61.959  1.00 206.78 ? 335  ARG A CG  1 
ATOM   2242 C CD  . ARG A 1 311 ? 39.760  -13.011 60.916  1.00 206.78 ? 335  ARG A CD  1 
ATOM   2243 N NE  . ARG A 1 311 ? 39.052  -14.065 60.195  1.00 206.78 ? 335  ARG A NE  1 
ATOM   2244 C CZ  . ARG A 1 311 ? 39.597  -14.820 59.246  1.00 206.78 ? 335  ARG A CZ  1 
ATOM   2245 N NH1 . ARG A 1 311 ? 40.865  -14.641 58.900  1.00 206.78 ? 335  ARG A NH1 1 
ATOM   2246 N NH2 . ARG A 1 311 ? 38.873  -15.753 58.639  1.00 206.78 ? 335  ARG A NH2 1 
ATOM   2247 N N   . TYR A 1 312 ? 37.953  -9.256  59.321  1.00 52.05  ? 336  TYR A N   1 
ATOM   2248 C CA  . TYR A 1 312 ? 38.733  -8.593  58.289  1.00 52.05  ? 336  TYR A CA  1 
ATOM   2249 C C   . TYR A 1 312 ? 39.128  -7.161  58.615  1.00 52.05  ? 336  TYR A C   1 
ATOM   2250 O O   . TYR A 1 312 ? 40.299  -6.794  58.542  1.00 52.05  ? 336  TYR A O   1 
ATOM   2251 C CB  . TYR A 1 312 ? 37.965  -8.582  56.980  1.00 83.53  ? 336  TYR A CB  1 
ATOM   2252 C CG  . TYR A 1 312 ? 38.549  -7.632  55.982  1.00 83.53  ? 336  TYR A CG  1 
ATOM   2253 C CD1 . TYR A 1 312 ? 39.870  -7.749  55.584  1.00 83.53  ? 336  TYR A CD1 1 
ATOM   2254 C CD2 . TYR A 1 312 ? 37.782  -6.615  55.441  1.00 83.53  ? 336  TYR A CD2 1 
ATOM   2255 C CE1 . TYR A 1 312 ? 40.418  -6.875  54.667  1.00 83.53  ? 336  TYR A CE1 1 
ATOM   2256 C CE2 . TYR A 1 312 ? 38.314  -5.729  54.523  1.00 83.53  ? 336  TYR A CE2 1 
ATOM   2257 C CZ  . TYR A 1 312 ? 39.637  -5.859  54.134  1.00 83.53  ? 336  TYR A CZ  1 
ATOM   2258 O OH  . TYR A 1 312 ? 40.172  -4.974  53.210  1.00 83.53  ? 336  TYR A OH  1 
ATOM   2259 N N   . PHE A 1 313 ? 38.147  -6.341  58.958  1.00 52.03  ? 337  PHE A N   1 
ATOM   2260 C CA  . PHE A 1 313 ? 38.429  -4.953  59.264  1.00 52.03  ? 337  PHE A CA  1 
ATOM   2261 C C   . PHE A 1 313 ? 39.326  -4.855  60.475  1.00 52.03  ? 337  PHE A C   1 
ATOM   2262 O O   . PHE A 1 313 ? 40.350  -4.196  60.425  1.00 52.03  ? 337  PHE A O   1 
ATOM   2263 C CB  . PHE A 1 313 ? 37.130  -4.199  59.515  1.00 52.18  ? 337  PHE A CB  1 
ATOM   2264 C CG  . PHE A 1 313 ? 37.298  -2.713  59.653  1.00 52.18  ? 337  PHE A CG  1 
ATOM   2265 C CD1 . PHE A 1 313 ? 37.820  -1.965  58.610  1.00 52.18  ? 337  PHE A CD1 1 
ATOM   2266 C CD2 . PHE A 1 313 ? 36.858  -2.052  60.802  1.00 52.18  ? 337  PHE A CD2 1 
ATOM   2267 C CE1 . PHE A 1 313 ? 37.894  -0.589  58.702  1.00 52.18  ? 337  PHE A CE1 1 
ATOM   2268 C CE2 . PHE A 1 313 ? 36.930  -0.672  60.898  1.00 52.18  ? 337  PHE A CE2 1 
ATOM   2269 C CZ  . PHE A 1 313 ? 37.446  0.058   59.846  1.00 52.18  ? 337  PHE A CZ  1 
ATOM   2270 N N   . GLN A 1 314 ? 38.953  -5.526  61.555  1.00 68.00  ? 338  GLN A N   1 
ATOM   2271 C CA  . GLN A 1 314 ? 39.747  -5.464  62.767  1.00 68.00  ? 338  GLN A CA  1 
ATOM   2272 C C   . GLN A 1 314 ? 41.180  -5.912  62.556  1.00 68.00  ? 338  GLN A C   1 
ATOM   2273 O O   . GLN A 1 314 ? 42.018  -5.716  63.435  1.00 68.00  ? 338  GLN A O   1 
ATOM   2274 C CB  . GLN A 1 314 ? 39.126  -6.319  63.863  1.00 72.46  ? 338  GLN A CB  1 
ATOM   2275 C CG  . GLN A 1 314 ? 37.724  -5.940  64.205  1.00 72.46  ? 338  GLN A CG  1 
ATOM   2276 C CD  . GLN A 1 314 ? 37.221  -6.619  65.461  1.00 72.46  ? 338  GLN A CD  1 
ATOM   2277 O OE1 . GLN A 1 314 ? 37.712  -6.366  66.563  1.00 72.46  ? 338  GLN A OE1 1 
ATOM   2278 N NE2 . GLN A 1 314 ? 36.231  -7.492  65.302  1.00 72.46  ? 338  GLN A NE2 1 
ATOM   2279 N N   . SER A 1 315 ? 41.464  -6.507  61.398  1.00 72.50  ? 339  SER A N   1 
ATOM   2280 C CA  . SER A 1 315 ? 42.804  -7.010  61.104  1.00 72.50  ? 339  SER A CA  1 
ATOM   2281 C C   . SER A 1 315 ? 43.633  -5.967  60.407  1.00 72.50  ? 339  SER A C   1 
ATOM   2282 O O   . SER A 1 315 ? 44.811  -6.185  60.133  1.00 72.50  ? 339  SER A O   1 
ATOM   2283 C CB  . SER A 1 315 ? 42.738  -8.225  60.193  1.00 99.72  ? 339  SER A CB  1 
ATOM   2284 O OG  . SER A 1 315 ? 42.671  -7.811  58.838  1.00 99.72  ? 339  SER A OG  1 
ATOM   2285 N N   . LEU A 1 316 ? 43.012  -4.838  60.108  1.00 72.20  ? 340  LEU A N   1 
ATOM   2286 C CA  . LEU A 1 316 ? 43.703  -3.761  59.422  1.00 72.20  ? 340  LEU A CA  1 
ATOM   2287 C C   . LEU A 1 316 ? 44.501  -2.868  60.363  1.00 72.20  ? 340  LEU A C   1 
ATOM   2288 O O   . LEU A 1 316 ? 44.180  -2.748  61.567  1.00 72.20  ? 340  LEU A O   1 
ATOM   2289 C CB  . LEU A 1 316 ? 42.697  -2.905  58.660  1.00 50.34  ? 340  LEU A CB  1 
ATOM   2290 C CG  . LEU A 1 316 ? 41.928  -3.587  57.541  1.00 50.34  ? 340  LEU A CG  1 
ATOM   2291 C CD1 . LEU A 1 316 ? 40.754  -2.755  57.096  1.00 50.34  ? 340  LEU A CD1 1 
ATOM   2292 C CD2 . LEU A 1 316 ? 42.874  -3.810  56.409  1.00 50.34  ? 340  LEU A CD2 1 
ATOM   2293 N N   . ASN A 1 317 ? 45.543  -2.258  59.786  1.00 72.43  ? 341  ASN A N   1 
ATOM   2294 C CA  . ASN A 1 317 ? 46.448  -1.321  60.460  1.00 72.43  ? 341  ASN A CA  1 
ATOM   2295 C C   . ASN A 1 317 ? 47.349  -0.700  59.404  1.00 72.43  ? 341  ASN A C   1 
ATOM   2296 O O   . ASN A 1 317 ? 47.650  -1.322  58.387  1.00 72.43  ? 341  ASN A O   1 
ATOM   2297 C CB  . ASN A 1 317 ? 47.314  -2.016  61.501  1.00 83.74  ? 341  ASN A CB  1 
ATOM   2298 C CG  . ASN A 1 317 ? 48.227  -3.029  60.893  1.00 83.74  ? 341  ASN A CG  1 
ATOM   2299 O OD1 . ASN A 1 317 ? 48.127  -4.213  61.192  1.00 83.74  ? 341  ASN A OD1 1 
ATOM   2300 N ND2 . ASN A 1 317 ? 49.125  -2.580  60.023  1.00 83.74  ? 341  ASN A ND2 1 
ATOM   2301 N N   . PRO A 1 318 ? 47.815  0.530   59.653  1.00 96.99  ? 342  PRO A N   1 
ATOM   2302 C CA  . PRO A 1 318 ? 48.682  1.292   58.749  1.00 96.99  ? 342  PRO A CA  1 
ATOM   2303 C C   . PRO A 1 318 ? 49.925  0.600   58.230  1.00 96.99  ? 342  PRO A C   1 
ATOM   2304 O O   . PRO A 1 318 ? 50.538  1.078   57.275  1.00 96.99  ? 342  PRO A O   1 
ATOM   2305 C CB  . PRO A 1 318 ? 49.026  2.532   59.566  1.00 60.17  ? 342  PRO A CB  1 
ATOM   2306 C CG  . PRO A 1 318 ? 48.947  2.051   60.978  1.00 60.17  ? 342  PRO A CG  1 
ATOM   2307 C CD  . PRO A 1 318 ? 47.732  1.180   60.972  1.00 60.17  ? 342  PRO A CD  1 
ATOM   2308 N N   . TYR A 1 319 ? 50.296  -0.520  58.847  1.00 64.95  ? 343  TYR A N   1 
ATOM   2309 C CA  . TYR A 1 319 ? 51.499  -1.232  58.437  1.00 64.95  ? 343  TYR A CA  1 
ATOM   2310 C C   . TYR A 1 319 ? 51.201  -2.324  57.434  1.00 64.95  ? 343  TYR A C   1 
ATOM   2311 O O   . TYR A 1 319 ? 52.121  -2.839  56.806  1.00 64.95  ? 343  TYR A O   1 
ATOM   2312 C CB  . TYR A 1 319 ? 52.218  -1.846  59.649  1.00 155.08 ? 343  TYR A CB  1 
ATOM   2313 C CG  . TYR A 1 319 ? 52.450  -0.900  60.816  1.00 155.08 ? 343  TYR A CG  1 
ATOM   2314 C CD1 . TYR A 1 319 ? 51.589  -0.896  61.919  1.00 155.08 ? 343  TYR A CD1 1 
ATOM   2315 C CD2 . TYR A 1 319 ? 53.524  -0.008  60.818  1.00 155.08 ? 343  TYR A CD2 1 
ATOM   2316 C CE1 . TYR A 1 319 ? 51.792  -0.026  62.995  1.00 155.08 ? 343  TYR A CE1 1 
ATOM   2317 C CE2 . TYR A 1 319 ? 53.736  0.868   61.886  1.00 155.08 ? 343  TYR A CE2 1 
ATOM   2318 C CZ  . TYR A 1 319 ? 52.867  0.852   62.971  1.00 155.08 ? 343  TYR A CZ  1 
ATOM   2319 O OH  . TYR A 1 319 ? 53.070  1.710   64.028  1.00 155.08 ? 343  TYR A OH  1 
ATOM   2320 N N   . ASN A 1 320 ? 49.924  -2.687  57.294  1.00 76.51  ? 344  ASN A N   1 
ATOM   2321 C CA  . ASN A 1 320 ? 49.526  -3.731  56.348  1.00 76.51  ? 344  ASN A CA  1 
ATOM   2322 C C   . ASN A 1 320 ? 48.446  -3.335  55.337  1.00 76.51  ? 344  ASN A C   1 
ATOM   2323 O O   . ASN A 1 320 ? 48.155  -4.105  54.425  1.00 76.51  ? 344  ASN A O   1 
ATOM   2324 C CB  . ASN A 1 320 ? 49.064  -4.981  57.092  1.00 77.54  ? 344  ASN A CB  1 
ATOM   2325 C CG  . ASN A 1 320 ? 47.797  -4.754  57.876  1.00 77.54  ? 344  ASN A CG  1 
ATOM   2326 O OD1 . ASN A 1 320 ? 46.921  -4.000  57.462  1.00 77.54  ? 344  ASN A OD1 1 
ATOM   2327 N ND2 . ASN A 1 320 ? 47.680  -5.429  59.012  1.00 77.54  ? 344  ASN A ND2 1 
ATOM   2328 N N   . ASN A 1 321 ? 47.849  -2.153  55.506  1.00 80.18  ? 345  ASN A N   1 
ATOM   2329 C CA  . ASN A 1 321 ? 46.807  -1.647  54.599  1.00 80.18  ? 345  ASN A CA  1 
ATOM   2330 C C   . ASN A 1 321 ? 47.468  -0.561  53.770  1.00 80.18  ? 345  ASN A C   1 
ATOM   2331 O O   . ASN A 1 321 ? 47.385  0.617   54.111  1.00 80.18  ? 345  ASN A O   1 
ATOM   2332 C CB  . ASN A 1 321 ? 45.642  -1.029  55.399  1.00 87.06  ? 345  ASN A CB  1 
ATOM   2333 C CG  . ASN A 1 321 ? 44.348  -0.912  54.585  1.00 87.06  ? 345  ASN A CG  1 
ATOM   2334 O OD1 . ASN A 1 321 ? 44.377  -0.762  53.367  1.00 87.06  ? 345  ASN A OD1 1 
ATOM   2335 N ND2 . ASN A 1 321 ? 43.211  -0.970  55.270  1.00 87.06  ? 345  ASN A ND2 1 
ATOM   2336 N N   . HIS A 1 322 ? 48.131  -0.943  52.689  1.00 70.13  ? 346  HIS A N   1 
ATOM   2337 C CA  . HIS A 1 322 ? 48.810  0.057   51.882  1.00 70.13  ? 346  HIS A CA  1 
ATOM   2338 C C   . HIS A 1 322 ? 48.033  0.526   50.663  1.00 70.13  ? 346  HIS A C   1 
ATOM   2339 O O   . HIS A 1 322 ? 48.311  1.593   50.126  1.00 70.13  ? 346  HIS A O   1 
ATOM   2340 C CB  . HIS A 1 322 ? 50.192  -0.461  51.451  1.00 137.11 ? 346  HIS A CB  1 
ATOM   2341 C CG  . HIS A 1 322 ? 51.226  -0.405  52.537  1.00 137.11 ? 346  HIS A CG  1 
ATOM   2342 N ND1 . HIS A 1 322 ? 51.750  0.781   53.009  1.00 137.11 ? 346  HIS A ND1 1 
ATOM   2343 C CD2 . HIS A 1 322 ? 51.810  -1.387  53.263  1.00 137.11 ? 346  HIS A CD2 1 
ATOM   2344 C CE1 . HIS A 1 322 ? 52.608  0.528   53.980  1.00 137.11 ? 346  HIS A CE1 1 
ATOM   2345 N NE2 . HIS A 1 322 ? 52.662  -0.780  54.154  1.00 137.11 ? 346  HIS A NE2 1 
ATOM   2346 N N   . ARG A 1 323 ? 47.053  -0.261  50.237  1.00 78.45  ? 347  ARG A N   1 
ATOM   2347 C CA  . ARG A 1 323 ? 46.251  0.067   49.058  1.00 78.45  ? 347  ARG A CA  1 
ATOM   2348 C C   . ARG A 1 323 ? 45.162  1.102   49.327  1.00 78.45  ? 347  ARG A C   1 
ATOM   2349 O O   . ARG A 1 323 ? 44.557  1.616   48.389  1.00 78.45  ? 347  ARG A O   1 
ATOM   2350 C CB  . ARG A 1 323 ? 45.605  -1.207  48.512  1.00 85.21  ? 347  ARG A CB  1 
ATOM   2351 C CG  . ARG A 1 323 ? 44.669  -1.874  49.518  1.00 85.21  ? 347  ARG A CG  1 
ATOM   2352 C CD  . ARG A 1 323 ? 44.053  -3.154  49.002  1.00 85.21  ? 347  ARG A CD  1 
ATOM   2353 N NE  . ARG A 1 323 ? 43.021  -3.618  49.918  1.00 85.21  ? 347  ARG A NE  1 
ATOM   2354 C CZ  . ARG A 1 323 ? 42.450  -4.813  49.854  1.00 85.21  ? 347  ARG A CZ  1 
ATOM   2355 N NH1 . ARG A 1 323 ? 42.811  -5.675  48.916  1.00 85.21  ? 347  ARG A NH1 1 
ATOM   2356 N NH2 . ARG A 1 323 ? 41.512  -5.145  50.727  1.00 85.21  ? 347  ARG A NH2 1 
ATOM   2357 N N   . ASN A 1 324 ? 44.898  1.388   50.601  1.00 72.08  ? 348  ASN A N   1 
ATOM   2358 C CA  . ASN A 1 324 ? 43.876  2.368   50.988  1.00 72.08  ? 348  ASN A CA  1 
ATOM   2359 C C   . ASN A 1 324 ? 44.565  3.651   51.419  1.00 72.08  ? 348  ASN A C   1 
ATOM   2360 O O   . ASN A 1 324 ? 44.887  3.842   52.597  1.00 72.08  ? 348  ASN A O   1 
ATOM   2361 C CB  . ASN A 1 324 ? 43.028  1.857   52.152  1.00 61.89  ? 348  ASN A CB  1 
ATOM   2362 C CG  . ASN A 1 324 ? 42.018  2.874   52.611  1.00 61.89  ? 348  ASN A CG  1 
ATOM   2363 O OD1 . ASN A 1 324 ? 42.113  4.032   52.252  1.00 61.89  ? 348  ASN A OD1 1 
ATOM   2364 N ND2 . ASN A 1 324 ? 41.054  2.453   53.412  1.00 61.89  ? 348  ASN A ND2 1 
ATOM   2365 N N   . PRO A 1 325 ? 44.772  4.559   50.465  1.00 63.76  ? 349  PRO A N   1 
ATOM   2366 C CA  . PRO A 1 325 ? 45.419  5.850   50.645  1.00 63.76  ? 349  PRO A CA  1 
ATOM   2367 C C   . PRO A 1 325 ? 44.829  6.699   51.766  1.00 63.76  ? 349  PRO A C   1 
ATOM   2368 O O   . PRO A 1 325 ? 45.508  7.556   52.351  1.00 63.76  ? 349  PRO A O   1 
ATOM   2369 C CB  . PRO A 1 325 ? 45.263  6.481   49.275  1.00 60.75  ? 349  PRO A CB  1 
ATOM   2370 C CG  . PRO A 1 325 ? 43.971  5.944   48.819  1.00 60.75  ? 349  PRO A CG  1 
ATOM   2371 C CD  . PRO A 1 325 ? 44.106  4.504   49.156  1.00 60.75  ? 349  PRO A CD  1 
ATOM   2372 N N   . TRP A 1 326 ? 43.568  6.464   52.080  1.00 70.61  ? 350  TRP A N   1 
ATOM   2373 C CA  . TRP A 1 326 ? 42.932  7.222   53.143  1.00 70.61  ? 350  TRP A CA  1 
ATOM   2374 C C   . TRP A 1 326 ? 43.153  6.590   54.529  1.00 70.61  ? 350  TRP A C   1 
ATOM   2375 O O   . TRP A 1 326 ? 42.925  7.226   55.561  1.00 70.61  ? 350  TRP A O   1 
ATOM   2376 C CB  . TRP A 1 326 ? 41.433  7.318   52.862  1.00 60.40  ? 350  TRP A CB  1 
ATOM   2377 C CG  . TRP A 1 326 ? 41.110  7.943   51.575  1.00 60.40  ? 350  TRP A CG  1 
ATOM   2378 C CD1 . TRP A 1 326 ? 41.074  9.269   51.315  1.00 60.40  ? 350  TRP A CD1 1 
ATOM   2379 C CD2 . TRP A 1 326 ? 40.778  7.280   50.347  1.00 60.40  ? 350  TRP A CD2 1 
ATOM   2380 N NE1 . TRP A 1 326 ? 40.740  9.492   49.997  1.00 60.40  ? 350  TRP A NE1 1 
ATOM   2381 C CE2 . TRP A 1 326 ? 40.554  8.282   49.378  1.00 60.40  ? 350  TRP A CE2 1 
ATOM   2382 C CE3 . TRP A 1 326 ? 40.654  5.940   49.965  1.00 60.40  ? 350  TRP A CE3 1 
ATOM   2383 C CZ2 . TRP A 1 326 ? 40.206  7.988   48.053  1.00 60.40  ? 350  TRP A CZ2 1 
ATOM   2384 C CZ3 . TRP A 1 326 ? 40.308  5.648   48.643  1.00 60.40  ? 350  TRP A CZ3 1 
ATOM   2385 C CH2 . TRP A 1 326 ? 40.093  6.670   47.708  1.00 60.40  ? 350  TRP A CH2 1 
ATOM   2386 N N   . PHE A 1 327 ? 43.614  5.345   54.555  1.00 69.15  ? 351  PHE A N   1 
ATOM   2387 C CA  . PHE A 1 327 ? 43.769  4.662   55.821  1.00 69.15  ? 351  PHE A CA  1 
ATOM   2388 C C   . PHE A 1 327 ? 44.538  5.402   56.899  1.00 69.15  ? 351  PHE A C   1 
ATOM   2389 O O   . PHE A 1 327 ? 44.063  5.492   58.040  1.00 69.15  ? 351  PHE A O   1 
ATOM   2390 C CB  . PHE A 1 327 ? 44.373  3.268   55.626  1.00 57.33  ? 351  PHE A CB  1 
ATOM   2391 C CG  . PHE A 1 327 ? 43.950  2.294   56.692  1.00 57.33  ? 351  PHE A CG  1 
ATOM   2392 C CD1 . PHE A 1 327 ? 42.637  1.842   56.751  1.00 57.33  ? 351  PHE A CD1 1 
ATOM   2393 C CD2 . PHE A 1 327 ? 44.817  1.926   57.703  1.00 57.33  ? 351  PHE A CD2 1 
ATOM   2394 C CE1 . PHE A 1 327 ? 42.193  1.051   57.801  1.00 57.33  ? 351  PHE A CE1 1 
ATOM   2395 C CE2 . PHE A 1 327 ? 44.375  1.127   58.767  1.00 57.33  ? 351  PHE A CE2 1 
ATOM   2396 C CZ  . PHE A 1 327 ? 43.061  0.696   58.813  1.00 57.33  ? 351  PHE A CZ  1 
ATOM   2397 N N   . ARG A 1 328 ? 45.714  5.926   56.546  1.00 74.93  ? 352  ARG A N   1 
ATOM   2398 C CA  . ARG A 1 328 ? 46.566  6.642   57.499  1.00 74.93  ? 352  ARG A CA  1 
ATOM   2399 C C   . ARG A 1 328 ? 45.806  7.771   58.183  1.00 74.93  ? 352  ARG A C   1 
ATOM   2400 O O   . ARG A 1 328 ? 45.709  7.819   59.416  1.00 74.93  ? 352  ARG A O   1 
ATOM   2401 C CB  . ARG A 1 328 ? 47.792  7.204   56.786  1.00 119.18 ? 352  ARG A CB  1 
ATOM   2402 C CG  . ARG A 1 328 ? 48.585  6.170   55.994  1.00 119.18 ? 352  ARG A CG  1 
ATOM   2403 C CD  . ARG A 1 328 ? 49.855  6.771   55.368  1.00 119.18 ? 352  ARG A CD  1 
ATOM   2404 N NE  . ARG A 1 328 ? 50.833  7.177   56.376  1.00 119.18 ? 352  ARG A NE  1 
ATOM   2405 C CZ  . ARG A 1 328 ? 51.518  6.330   57.138  1.00 119.18 ? 352  ARG A CZ  1 
ATOM   2406 N NH1 . ARG A 1 328 ? 51.348  5.018   57.014  1.00 119.18 ? 352  ARG A NH1 1 
ATOM   2407 N NH2 . ARG A 1 328 ? 52.368  6.800   58.039  1.00 119.18 ? 352  ARG A NH2 1 
ATOM   2408 N N   . ASP A 1 329 ? 45.266  8.675   57.368  1.00 88.49  ? 353  ASP A N   1 
ATOM   2409 C CA  . ASP A 1 329 ? 44.491  9.808   57.857  1.00 88.49  ? 353  ASP A CA  1 
ATOM   2410 C C   . ASP A 1 329 ? 43.371  9.316   58.765  1.00 88.49  ? 353  ASP A C   1 
ATOM   2411 O O   . ASP A 1 329 ? 43.055  9.954   59.766  1.00 88.49  ? 353  ASP A O   1 
ATOM   2412 C CB  . ASP A 1 329 ? 43.915  10.584  56.678  1.00 96.52  ? 353  ASP A CB  1 
ATOM   2413 C CG  . ASP A 1 329 ? 44.989  11.271  55.859  1.00 96.52  ? 353  ASP A CG  1 
ATOM   2414 O OD1 . ASP A 1 329 ? 45.322  12.438  56.173  1.00 96.52  ? 353  ASP A OD1 1 
ATOM   2415 O OD2 . ASP A 1 329 ? 45.515  10.637  54.912  1.00 96.52  ? 353  ASP A OD2 1 
ATOM   2416 N N   . PHE A 1 330 ? 42.767  8.185   58.404  1.00 55.81  ? 354  PHE A N   1 
ATOM   2417 C CA  . PHE A 1 330 ? 41.708  7.571   59.200  1.00 55.81  ? 354  PHE A CA  1 
ATOM   2418 C C   . PHE A 1 330 ? 42.329  7.133   60.514  1.00 55.81  ? 354  PHE A C   1 
ATOM   2419 O O   . PHE A 1 330 ? 41.814  7.411   61.589  1.00 55.81  ? 354  PHE A O   1 
ATOM   2420 C CB  . PHE A 1 330 ? 41.167  6.349   58.475  1.00 65.69  ? 354  PHE A CB  1 
ATOM   2421 C CG  . PHE A 1 330 ? 40.504  5.351   59.375  1.00 65.69  ? 354  PHE A CG  1 
ATOM   2422 C CD1 . PHE A 1 330 ? 39.380  5.697   60.120  1.00 65.69  ? 354  PHE A CD1 1 
ATOM   2423 C CD2 . PHE A 1 330 ? 40.996  4.049   59.467  1.00 65.69  ? 354  PHE A CD2 1 
ATOM   2424 C CE1 . PHE A 1 330 ? 38.750  4.757   60.949  1.00 65.69  ? 354  PHE A CE1 1 
ATOM   2425 C CE2 . PHE A 1 330 ? 40.377  3.098   60.292  1.00 65.69  ? 354  PHE A CE2 1 
ATOM   2426 C CZ  . PHE A 1 330 ? 39.249  3.456   61.036  1.00 65.69  ? 354  PHE A CZ  1 
ATOM   2427 N N   . TRP A 1 331 ? 43.459  6.450   60.408  1.00 61.93  ? 355  TRP A N   1 
ATOM   2428 C CA  . TRP A 1 331 ? 44.151  5.962   61.580  1.00 61.93  ? 355  TRP A CA  1 
ATOM   2429 C C   . TRP A 1 331 ? 44.516  7.109   62.493  1.00 61.93  ? 355  TRP A C   1 
ATOM   2430 O O   . TRP A 1 331 ? 44.129  7.100   63.663  1.00 61.93  ? 355  TRP A O   1 
ATOM   2431 C CB  . TRP A 1 331 ? 45.402  5.179   61.173  1.00 75.45  ? 355  TRP A CB  1 
ATOM   2432 C CG  . TRP A 1 331 ? 45.960  4.312   62.270  1.00 75.45  ? 355  TRP A CG  1 
ATOM   2433 C CD1 . TRP A 1 331 ? 46.859  4.672   63.216  1.00 75.45  ? 355  TRP A CD1 1 
ATOM   2434 C CD2 . TRP A 1 331 ? 45.640  2.944   62.529  1.00 75.45  ? 355  TRP A CD2 1 
ATOM   2435 N NE1 . TRP A 1 331 ? 47.129  3.621   64.053  1.00 75.45  ? 355  TRP A NE1 1 
ATOM   2436 C CE2 . TRP A 1 331 ? 46.391  2.541   63.653  1.00 75.45  ? 355  TRP A CE2 1 
ATOM   2437 C CE3 . TRP A 1 331 ? 44.787  2.011   61.919  1.00 75.45  ? 355  TRP A CE3 1 
ATOM   2438 C CZ2 . TRP A 1 331 ? 46.324  1.255   64.182  1.00 75.45  ? 355  TRP A CZ2 1 
ATOM   2439 C CZ3 . TRP A 1 331 ? 44.718  0.732   62.442  1.00 75.45  ? 355  TRP A CZ3 1 
ATOM   2440 C CH2 . TRP A 1 331 ? 45.485  0.367   63.566  1.00 75.45  ? 355  TRP A CH2 1 
ATOM   2441 N N   . GLU A 1 332 ? 45.245  8.098   61.974  1.00 53.19  ? 356  GLU A N   1 
ATOM   2442 C CA  . GLU A 1 332 ? 45.638  9.227   62.806  1.00 53.19  ? 356  GLU A CA  1 
ATOM   2443 C C   . GLU A 1 332 ? 44.425  9.887   63.467  1.00 53.19  ? 356  GLU A C   1 
ATOM   2444 O O   . GLU A 1 332 ? 44.479  10.315  64.629  1.00 53.19  ? 356  GLU A O   1 
ATOM   2445 C CB  . GLU A 1 332 ? 46.380  10.272  61.986  1.00 88.84  ? 356  GLU A CB  1 
ATOM   2446 C CG  . GLU A 1 332 ? 47.816  9.962   61.744  1.00 88.84  ? 356  GLU A CG  1 
ATOM   2447 C CD  . GLU A 1 332 ? 48.472  10.923  60.756  1.00 88.84  ? 356  GLU A CD  1 
ATOM   2448 O OE1 . GLU A 1 332 ? 49.706  10.821  60.537  1.00 88.84  ? 356  GLU A OE1 1 
ATOM   2449 O OE2 . GLU A 1 332 ? 47.758  11.780  60.187  1.00 88.84  ? 356  GLU A OE2 1 
ATOM   2450 N N   . GLN A 1 333 ? 43.317  9.959   62.734  1.00 73.92  ? 357  GLN A N   1 
ATOM   2451 C CA  . GLN A 1 333 ? 42.119  10.619  63.250  1.00 73.92  ? 357  GLN A CA  1 
ATOM   2452 C C   . GLN A 1 333 ? 41.390  9.824   64.301  1.00 73.92  ? 357  GLN A C   1 
ATOM   2453 O O   . GLN A 1 333 ? 40.905  10.385  65.281  1.00 73.92  ? 357  GLN A O   1 
ATOM   2454 C CB  . GLN A 1 333 ? 41.162  10.952  62.102  1.00 81.73  ? 357  GLN A CB  1 
ATOM   2455 C CG  . GLN A 1 333 ? 39.845  11.590  62.530  1.00 81.73  ? 357  GLN A CG  1 
ATOM   2456 C CD  . GLN A 1 333 ? 38.933  11.873  61.351  1.00 81.73  ? 357  GLN A CD  1 
ATOM   2457 O OE1 . GLN A 1 333 ? 39.278  12.641  60.459  1.00 81.73  ? 357  GLN A OE1 1 
ATOM   2458 N NE2 . GLN A 1 333 ? 37.767  11.250  61.341  1.00 81.73  ? 357  GLN A NE2 1 
ATOM   2459 N N   . LYS A 1 334 ? 41.316  8.515   64.092  1.00 81.23  ? 358  LYS A N   1 
ATOM   2460 C CA  . LYS A 1 334 ? 40.619  7.635   65.022  1.00 81.23  ? 358  LYS A CA  1 
ATOM   2461 C C   . LYS A 1 334 ? 41.344  7.524   66.344  1.00 81.23  ? 358  LYS A C   1 
ATOM   2462 O O   . LYS A 1 334 ? 40.730  7.560   67.404  1.00 81.23  ? 358  LYS A O   1 
ATOM   2463 C CB  . LYS A 1 334 ? 40.470  6.228   64.433  1.00 87.49  ? 358  LYS A CB  1 
ATOM   2464 C CG  . LYS A 1 334 ? 39.654  5.276   65.309  1.00 87.49  ? 358  LYS A CG  1 
ATOM   2465 C CD  . LYS A 1 334 ? 39.792  3.832   64.846  1.00 87.49  ? 358  LYS A CD  1 
ATOM   2466 C CE  . LYS A 1 334 ? 38.797  2.907   65.543  1.00 87.49  ? 358  LYS A CE  1 
ATOM   2467 N NZ  . LYS A 1 334 ? 37.428  2.945   64.930  1.00 87.49  ? 358  LYS A NZ  1 
ATOM   2468 N N   . PHE A 1 335 ? 42.660  7.405   66.274  1.00 91.59  ? 359  PHE A N   1 
ATOM   2469 C CA  . PHE A 1 335 ? 43.445  7.231   67.469  1.00 91.59  ? 359  PHE A CA  1 
ATOM   2470 C C   . PHE A 1 335 ? 44.040  8.492   68.053  1.00 91.59  ? 359  PHE A C   1 
ATOM   2471 O O   . PHE A 1 335 ? 44.689  8.442   69.101  1.00 91.59  ? 359  PHE A O   1 
ATOM   2472 C CB  . PHE A 1 335 ? 44.538  6.212   67.189  1.00 62.10  ? 359  PHE A CB  1 
ATOM   2473 C CG  . PHE A 1 335 ? 44.010  4.848   66.837  1.00 62.10  ? 359  PHE A CG  1 
ATOM   2474 C CD1 . PHE A 1 335 ? 44.430  4.200   65.668  1.00 62.10  ? 359  PHE A CD1 1 
ATOM   2475 C CD2 . PHE A 1 335 ? 43.070  4.224   67.649  1.00 62.10  ? 359  PHE A CD2 1 
ATOM   2476 C CE1 . PHE A 1 335 ? 43.914  2.953   65.313  1.00 62.10  ? 359  PHE A CE1 1 
ATOM   2477 C CE2 . PHE A 1 335 ? 42.551  2.979   67.301  1.00 62.10  ? 359  PHE A CE2 1 
ATOM   2478 C CZ  . PHE A 1 335 ? 42.974  2.342   66.124  1.00 62.10  ? 359  PHE A CZ  1 
ATOM   2479 N N   . GLN A 1 336 ? 43.806  9.623   67.400  1.00 99.44  ? 360  GLN A N   1 
ATOM   2480 C CA  . GLN A 1 336 ? 44.344  10.889  67.886  1.00 99.44  ? 360  GLN A CA  1 
ATOM   2481 C C   . GLN A 1 336 ? 45.861  10.863  67.692  1.00 99.44  ? 360  GLN A C   1 
ATOM   2482 O O   . GLN A 1 336 ? 46.588  11.674  68.256  1.00 99.44  ? 360  GLN A O   1 
ATOM   2483 C CB  . GLN A 1 336 ? 44.003  11.080  69.370  1.00 118.81 ? 360  GLN A CB  1 
ATOM   2484 C CG  . GLN A 1 336 ? 42.510  11.030  69.687  1.00 118.81 ? 360  GLN A CG  1 
ATOM   2485 C CD  . GLN A 1 336 ? 41.767  12.297  69.280  1.00 118.81 ? 360  GLN A CD  1 
ATOM   2486 O OE1 . GLN A 1 336 ? 41.820  12.732  68.125  1.00 118.81 ? 360  GLN A OE1 1 
ATOM   2487 N NE2 . GLN A 1 336 ? 41.063  12.892  70.237  1.00 118.81 ? 360  GLN A NE2 1 
ATOM   2488 N N   . CYS A 1 337 ? 46.322  9.905   66.892  1.00 88.66  ? 361  CYS A N   1 
ATOM   2489 C CA  . CYS A 1 337 ? 47.733  9.725   66.558  1.00 88.66  ? 361  CYS A CA  1 
ATOM   2490 C C   . CYS A 1 337 ? 48.426  10.977  66.081  1.00 88.66  ? 361  CYS A C   1 
ATOM   2491 O O   . CYS A 1 337 ? 48.051  12.100  66.396  1.00 88.66  ? 361  CYS A O   1 
ATOM   2492 C CB  . CYS A 1 337 ? 47.877  8.741   65.412  1.00 142.16 ? 361  CYS A CB  1 
ATOM   2493 S SG  . CYS A 1 337 ? 47.774  7.016   65.874  1.00 142.16 ? 361  CYS A SG  1 
ATOM   2494 N N   . SER A 1 338 ? 49.443  10.717  65.265  1.00 61.06  ? 362  SER A N   1 
ATOM   2495 C CA  . SER A 1 338 ? 50.277  11.709  64.602  1.00 61.06  ? 362  SER A CA  1 
ATOM   2496 C C   . SER A 1 338 ? 51.400  10.899  63.994  1.00 61.06  ? 362  SER A C   1 
ATOM   2497 O O   . SER A 1 338 ? 51.770  9.876   64.544  1.00 61.06  ? 362  SER A O   1 
ATOM   2498 C CB  . SER A 1 338 ? 50.830  12.729  65.601  1.00 178.04 ? 362  SER A CB  1 
ATOM   2499 O OG  . SER A 1 338 ? 51.411  13.838  64.927  1.00 178.04 ? 362  SER A OG  1 
ATOM   2500 N N   . LEU A 1 339 ? 51.919  11.329  62.853  1.00 140.81 ? 363  LEU A N   1 
ATOM   2501 C CA  . LEU A 1 339 ? 53.012  10.619  62.196  1.00 140.81 ? 363  LEU A CA  1 
ATOM   2502 C C   . LEU A 1 339 ? 53.844  11.597  61.367  1.00 140.81 ? 363  LEU A C   1 
ATOM   2503 O O   . LEU A 1 339 ? 53.552  12.792  61.341  1.00 140.81 ? 363  LEU A O   1 
ATOM   2504 C CB  . LEU A 1 339 ? 52.464  9.502   61.292  1.00 93.64  ? 363  LEU A CB  1 
ATOM   2505 C CG  . LEU A 1 339 ? 52.197  8.098   61.842  1.00 93.64  ? 363  LEU A CG  1 
ATOM   2506 C CD1 . LEU A 1 339 ? 53.379  7.704   62.737  1.00 93.64  ? 363  LEU A CD1 1 
ATOM   2507 C CD2 . LEU A 1 339 ? 50.887  8.034   62.605  1.00 93.64  ? 363  LEU A CD2 1 
ATOM   2508 N N   . GLN A 1 340 ? 54.877  11.096  60.692  1.00 172.49 ? 364  GLN A N   1 
ATOM   2509 C CA  . GLN A 1 340 ? 55.723  11.953  59.864  1.00 172.49 ? 364  GLN A CA  1 
ATOM   2510 C C   . GLN A 1 340 ? 55.005  12.339  58.566  1.00 172.49 ? 364  GLN A C   1 
ATOM   2511 O O   . GLN A 1 340 ? 55.267  13.399  57.987  1.00 172.49 ? 364  GLN A O   1 
ATOM   2512 C CB  . GLN A 1 340 ? 57.054  11.256  59.557  1.00 154.29 ? 364  GLN A CB  1 
ATOM   2513 C CG  . GLN A 1 340 ? 57.906  10.980  60.799  1.00 154.29 ? 364  GLN A CG  1 
ATOM   2514 C CD  . GLN A 1 340 ? 58.114  12.216  61.673  1.00 154.29 ? 364  GLN A CD  1 
ATOM   2515 O OE1 . GLN A 1 340 ? 58.653  13.229  61.225  1.00 154.29 ? 364  GLN A OE1 1 
ATOM   2516 N NE2 . GLN A 1 340 ? 57.684  12.130  62.930  1.00 154.29 ? 364  GLN A NE2 1 
ATOM   2517 N N   . ASN A 1 341 ? 54.101  11.472  58.116  1.00 360.75 ? 365  ASN A N   1 
ATOM   2518 C CA  . ASN A 1 341 ? 53.315  11.732  56.911  1.00 360.75 ? 365  ASN A CA  1 
ATOM   2519 C C   . ASN A 1 341 ? 52.098  12.554  57.322  1.00 360.75 ? 365  ASN A C   1 
ATOM   2520 O O   . ASN A 1 341 ? 50.988  12.336  56.833  1.00 360.75 ? 365  ASN A O   1 
ATOM   2521 C CB  . ASN A 1 341 ? 52.847  10.421  56.260  1.00 220.85 ? 365  ASN A CB  1 
ATOM   2522 C CG  . ASN A 1 341 ? 53.927  9.758   55.418  1.00 220.85 ? 365  ASN A CG  1 
ATOM   2523 O OD1 . ASN A 1 341 ? 53.651  8.820   54.668  1.00 220.85 ? 365  ASN A OD1 1 
ATOM   2524 N ND2 . ASN A 1 341 ? 55.160  10.241  55.539  1.00 220.85 ? 365  ASN A ND2 1 
ATOM   2525 N N   . LYS A 1 342 ? 52.319  13.499  58.229  1.00 282.57 ? 366  LYS A N   1 
ATOM   2526 C CA  . LYS A 1 342 ? 51.252  14.355  58.729  1.00 282.57 ? 366  LYS A CA  1 
ATOM   2527 C C   . LYS A 1 342 ? 51.698  15.818  58.652  1.00 282.57 ? 366  LYS A C   1 
ATOM   2528 O O   . LYS A 1 342 ? 52.668  16.141  57.962  1.00 282.57 ? 366  LYS A O   1 
ATOM   2529 C CB  . LYS A 1 342 ? 50.929  13.969  60.178  1.00 112.03 ? 366  LYS A CB  1 
ATOM   2530 C CG  . LYS A 1 342 ? 49.608  14.516  60.718  1.00 112.03 ? 366  LYS A CG  1 
ATOM   2531 C CD  . LYS A 1 342 ? 49.455  14.218  62.213  1.00 112.03 ? 366  LYS A CD  1 
ATOM   2532 C CE  . LYS A 1 342 ? 48.065  14.583  62.740  1.00 112.03 ? 366  LYS A CE  1 
ATOM   2533 N NZ  . LYS A 1 342 ? 47.934  14.384  64.224  1.00 112.03 ? 366  LYS A NZ  1 
ATOM   2534 N N   . ARG A 1 343 ? 50.984  16.697  59.354  1.00 381.36 ? 367  ARG A N   1 
ATOM   2535 C CA  . ARG A 1 343 ? 51.305  18.123  59.375  1.00 381.36 ? 367  ARG A CA  1 
ATOM   2536 C C   . ARG A 1 343 ? 52.300  18.404  60.503  1.00 381.36 ? 367  ARG A C   1 
ATOM   2537 O O   . ARG A 1 343 ? 53.509  18.245  60.334  1.00 381.36 ? 367  ARG A O   1 
ATOM   2538 C CB  . ARG A 1 343 ? 50.033  18.955  59.596  1.00 241.29 ? 367  ARG A CB  1 
ATOM   2539 C CG  . ARG A 1 343 ? 48.899  18.698  58.603  1.00 241.29 ? 367  ARG A CG  1 
ATOM   2540 C CD  . ARG A 1 343 ? 49.193  19.248  57.209  1.00 241.29 ? 367  ARG A CD  1 
ATOM   2541 N NE  . ARG A 1 343 ? 48.087  18.998  56.281  1.00 241.29 ? 367  ARG A NE  1 
ATOM   2542 C CZ  . ARG A 1 343 ? 48.052  19.413  55.017  1.00 241.29 ? 367  ARG A CZ  1 
ATOM   2543 N NH1 . ARG A 1 343 ? 49.063  20.107  54.513  1.00 241.29 ? 367  ARG A NH1 1 
ATOM   2544 N NH2 . ARG A 1 343 ? 47.005  19.129  54.253  1.00 241.29 ? 367  ARG A NH2 1 
ATOM   2545 N N   . ASN A 1 344 ? 51.776  18.818  61.654  1.00 440.18 ? 368  ASN A N   1 
ATOM   2546 C CA  . ASN A 1 344 ? 52.591  19.122  62.830  1.00 440.18 ? 368  ASN A CA  1 
ATOM   2547 C C   . ASN A 1 344 ? 51.698  19.085  64.069  1.00 440.18 ? 368  ASN A C   1 
ATOM   2548 O O   . ASN A 1 344 ? 51.002  20.060  64.362  1.00 440.18 ? 368  ASN A O   1 
ATOM   2549 C CB  . ASN A 1 344 ? 53.221  20.515  62.698  1.00 224.78 ? 368  ASN A CB  1 
ATOM   2550 C CG  . ASN A 1 344 ? 54.189  20.613  61.536  0.00 224.78 ? 368  ASN A CG  1 
ATOM   2551 O OD1 . ASN A 1 344 ? 55.200  19.913  61.495  0.00 224.78 ? 368  ASN A OD1 1 
ATOM   2552 N ND2 . ASN A 1 344 ? 53.885  21.489  60.585  0.00 224.78 ? 368  ASN A ND2 1 
ATOM   2553 N N   . HIS A 1 345 ? 51.712  17.971  64.798  1.00 195.58 ? 369  HIS A N   1 
ATOM   2554 C CA  . HIS A 1 345 ? 50.871  17.864  65.985  1.00 195.58 ? 369  HIS A CA  1 
ATOM   2555 C C   . HIS A 1 345 ? 51.522  17.223  67.212  1.00 195.58 ? 369  HIS A C   1 
ATOM   2556 O O   . HIS A 1 345 ? 52.744  17.046  67.263  1.00 195.58 ? 369  HIS A O   1 
ATOM   2557 C CB  . HIS A 1 345 ? 49.571  17.129  65.627  1.00 279.83 ? 369  HIS A CB  1 
ATOM   2558 C CG  . HIS A 1 345 ? 48.654  17.922  64.742  1.00 279.83 ? 369  HIS A CG  1 
ATOM   2559 N ND1 . HIS A 1 345 ? 48.073  19.107  65.142  1.00 279.83 ? 369  HIS A ND1 1 
ATOM   2560 C CD2 . HIS A 1 345 ? 48.227  17.705  63.476  1.00 279.83 ? 369  HIS A CD2 1 
ATOM   2561 C CE1 . HIS A 1 345 ? 47.328  19.584  64.160  1.00 279.83 ? 369  HIS A CE1 1 
ATOM   2562 N NE2 . HIS A 1 345 ? 47.405  18.752  63.138  1.00 279.83 ? 369  HIS A NE2 1 
ATOM   2563 N N   . ARG A 1 346 ? 50.685  16.895  68.198  1.00 99.16  ? 370  ARG A N   1 
ATOM   2564 C CA  . ARG A 1 346 ? 51.116  16.297  69.457  1.00 99.16  ? 370  ARG A CA  1 
ATOM   2565 C C   . ARG A 1 346 ? 50.794  14.797  69.578  1.00 99.16  ? 370  ARG A C   1 
ATOM   2566 O O   . ARG A 1 346 ? 49.973  14.263  68.837  1.00 99.16  ? 370  ARG A O   1 
ATOM   2567 C CB  . ARG A 1 346 ? 50.474  17.053  70.626  1.00 260.80 ? 370  ARG A CB  1 
ATOM   2568 C CG  . ARG A 1 346 ? 50.736  18.562  70.635  1.00 260.80 ? 370  ARG A CG  1 
ATOM   2569 C CD  . ARG A 1 346 ? 52.201  18.892  70.904  1.00 260.80 ? 370  ARG A CD  1 
ATOM   2570 N NE  . ARG A 1 346 ? 52.435  20.332  71.023  1.00 260.80 ? 370  ARG A NE  1 
ATOM   2571 C CZ  . ARG A 1 346 ? 53.605  20.880  71.343  1.00 260.80 ? 370  ARG A CZ  1 
ATOM   2572 N NH1 . ARG A 1 346 ? 54.662  20.113  71.580  1.00 260.80 ? 370  ARG A NH1 1 
ATOM   2573 N NH2 . ARG A 1 346 ? 53.720  22.198  71.428  1.00 260.80 ? 370  ARG A NH2 1 
ATOM   2574 N N   . GLN A 1 347 ? 51.464  14.148  70.535  1.00 120.73 ? 371  GLN A N   1 
ATOM   2575 C CA  . GLN A 1 347 ? 51.348  12.718  70.856  1.00 120.73 ? 371  GLN A CA  1 
ATOM   2576 C C   . GLN A 1 347 ? 51.597  11.800  69.668  1.00 120.73 ? 371  GLN A C   1 
ATOM   2577 O O   . GLN A 1 347 ? 50.780  11.712  68.760  1.00 120.73 ? 371  GLN A O   1 
ATOM   2578 C CB  . GLN A 1 347 ? 49.982  12.408  71.461  1.00 162.87 ? 371  GLN A CB  1 
ATOM   2579 C CG  . GLN A 1 347 ? 49.948  11.115  72.261  1.00 162.87 ? 371  GLN A CG  1 
ATOM   2580 C CD  . GLN A 1 347 ? 48.542  10.739  72.703  1.00 162.87 ? 371  GLN A CD  1 
ATOM   2581 O OE1 . GLN A 1 347 ? 47.799  11.569  73.234  1.00 162.87 ? 371  GLN A OE1 1 
ATOM   2582 N NE2 . GLN A 1 347 ? 48.171  9.480   72.492  1.00 162.87 ? 371  GLN A NE2 1 
ATOM   2583 N N   . VAL A 1 348 ? 52.739  11.121  69.673  1.00 130.47 ? 372  VAL A N   1 
ATOM   2584 C CA  . VAL A 1 348 ? 53.078  10.207  68.587  1.00 130.47 ? 372  VAL A CA  1 
ATOM   2585 C C   . VAL A 1 348 ? 52.211  8.980   68.772  1.00 130.47 ? 372  VAL A C   1 
ATOM   2586 O O   . VAL A 1 348 ? 51.430  8.930   69.716  1.00 130.47 ? 372  VAL A O   1 
ATOM   2587 C CB  . VAL A 1 348 ? 54.555  9.799   68.635  1.00 104.49 ? 372  VAL A CB  1 
ATOM   2588 C CG1 . VAL A 1 348 ? 54.797  8.862   69.811  1.00 104.49 ? 372  VAL A CG1 1 
ATOM   2589 C CG2 . VAL A 1 348 ? 54.959  9.164   67.321  1.00 104.49 ? 372  VAL A CG2 1 
ATOM   2590 N N   . CYS A 1 349 ? 52.351  7.981   67.907  1.00 88.29  ? 373  CYS A N   1 
ATOM   2591 C CA  . CYS A 1 349 ? 51.499  6.807   68.037  1.00 88.29  ? 373  CYS A CA  1 
ATOM   2592 C C   . CYS A 1 349 ? 52.059  5.422   68.232  1.00 88.29  ? 373  CYS A C   1 
ATOM   2593 O O   . CYS A 1 349 ? 52.846  4.936   67.414  1.00 88.29  ? 373  CYS A O   1 
ATOM   2594 C CB  . CYS A 1 349 ? 50.529  6.750   66.890  1.00 211.05 ? 373  CYS A CB  1 
ATOM   2595 S SG  . CYS A 1 349 ? 48.875  6.999   67.556  1.00 211.05 ? 373  CYS A SG  1 
ATOM   2596 N N   . ASP A 1 350 ? 51.577  4.777   69.302  1.00 91.75  ? 374  ASP A N   1 
ATOM   2597 C CA  . ASP A 1 350 ? 51.997  3.438   69.704  1.00 91.75  ? 374  ASP A CA  1 
ATOM   2598 C C   . ASP A 1 350 ? 51.803  2.410   68.617  1.00 91.75  ? 374  ASP A C   1 
ATOM   2599 O O   . ASP A 1 350 ? 50.759  2.382   67.961  1.00 91.75  ? 374  ASP A O   1 
ATOM   2600 C CB  . ASP A 1 350 ? 51.240  2.997   70.951  1.00 117.41 ? 374  ASP A CB  1 
ATOM   2601 C CG  . ASP A 1 350 ? 51.652  1.620   71.411  1.00 117.41 ? 374  ASP A CG  1 
ATOM   2602 O OD1 . ASP A 1 350 ? 52.808  1.454   71.859  1.00 117.41 ? 374  ASP A OD1 1 
ATOM   2603 O OD2 . ASP A 1 350 ? 50.821  0.697   71.315  1.00 117.41 ? 374  ASP A OD2 1 
ATOM   2604 N N   . LYS A 1 351 ? 52.818  1.568   68.434  1.00 85.58  ? 375  LYS A N   1 
ATOM   2605 C CA  . LYS A 1 351 ? 52.796  0.518   67.419  1.00 85.58  ? 375  LYS A CA  1 
ATOM   2606 C C   . LYS A 1 351 ? 51.687  -0.498  67.717  1.00 85.58  ? 375  LYS A C   1 
ATOM   2607 O O   . LYS A 1 351 ? 50.982  -0.946  66.811  1.00 85.58  ? 375  LYS A O   1 
ATOM   2608 C CB  . LYS A 1 351 ? 54.156  -0.184  67.384  1.00 214.76 ? 375  LYS A CB  1 
ATOM   2609 C CG  . LYS A 1 351 ? 55.333  0.782   67.360  1.00 214.76 ? 375  LYS A CG  1 
ATOM   2610 C CD  . LYS A 1 351 ? 56.662  0.072   67.571  1.00 214.76 ? 375  LYS A CD  1 
ATOM   2611 C CE  . LYS A 1 351 ? 57.798  1.077   67.721  1.00 214.76 ? 375  LYS A CE  1 
ATOM   2612 N NZ  . LYS A 1 351 ? 59.102  0.421   68.004  1.00 214.76 ? 375  LYS A NZ  1 
ATOM   2613 N N   . HIS A 1 352 ? 51.536  -0.837  68.997  1.00 111.60 ? 376  HIS A N   1 
ATOM   2614 C CA  . HIS A 1 352 ? 50.544  -1.806  69.454  1.00 111.60 ? 376  HIS A CA  1 
ATOM   2615 C C   . HIS A 1 352 ? 49.127  -1.269  69.467  1.00 111.60 ? 376  HIS A C   1 
ATOM   2616 O O   . HIS A 1 352 ? 48.277  -1.716  70.235  1.00 111.60 ? 376  HIS A O   1 
ATOM   2617 C CB  . HIS A 1 352 ? 50.904  -2.288  70.851  1.00 133.87 ? 376  HIS A CB  1 
ATOM   2618 C CG  . HIS A 1 352 ? 52.247  -2.923  70.924  1.00 133.87 ? 376  HIS A CG  1 
ATOM   2619 N ND1 . HIS A 1 352 ? 52.564  -4.059  70.213  1.00 133.87 ? 376  HIS A ND1 1 
ATOM   2620 C CD2 . HIS A 1 352 ? 53.372  -2.555  71.577  1.00 133.87 ? 376  HIS A CD2 1 
ATOM   2621 C CE1 . HIS A 1 352 ? 53.831  -4.364  70.423  1.00 133.87 ? 376  HIS A CE1 1 
ATOM   2622 N NE2 . HIS A 1 352 ? 54.344  -3.467  71.247  1.00 133.87 ? 376  HIS A NE2 1 
ATOM   2623 N N   . LEU A 1 353 ? 48.879  -0.293  68.618  1.00 84.61  ? 377  LEU A N   1 
ATOM   2624 C CA  . LEU A 1 353 ? 47.560  0.295   68.513  1.00 84.61  ? 377  LEU A CA  1 
ATOM   2625 C C   . LEU A 1 353 ? 46.862  -0.584  67.476  1.00 84.61  ? 377  LEU A C   1 
ATOM   2626 O O   . LEU A 1 353 ? 47.493  -1.035  66.514  1.00 84.61  ? 377  LEU A O   1 
ATOM   2627 C CB  . LEU A 1 353 ? 47.700  1.727   67.993  1.00 84.83  ? 377  LEU A CB  1 
ATOM   2628 C CG  . LEU A 1 353 ? 46.823  2.867   68.494  1.00 84.83  ? 377  LEU A CG  1 
ATOM   2629 C CD1 . LEU A 1 353 ? 47.082  3.159   69.949  1.00 84.83  ? 377  LEU A CD1 1 
ATOM   2630 C CD2 . LEU A 1 353 ? 47.151  4.078   67.681  1.00 84.83  ? 377  LEU A CD2 1 
ATOM   2631 N N   . ALA A 1 354 ? 45.580  -0.858  67.670  1.00 79.92  ? 378  ALA A N   1 
ATOM   2632 C CA  . ALA A 1 354 ? 44.865  -1.674  66.690  1.00 79.92  ? 378  ALA A CA  1 
ATOM   2633 C C   . ALA A 1 354 ? 43.348  -1.521  66.770  1.00 79.92  ? 378  ALA A C   1 
ATOM   2634 O O   . ALA A 1 354 ? 42.828  -0.973  67.755  1.00 79.92  ? 378  ALA A O   1 
ATOM   2635 C CB  . ALA A 1 354 ? 45.259  -3.134  66.837  1.00 155.53 ? 378  ALA A CB  1 
ATOM   2636 N N   . ILE A 1 355 ? 42.654  -1.974  65.720  1.00 87.82  ? 379  ILE A N   1 
ATOM   2637 C CA  . ILE A 1 355 ? 41.193  -1.899  65.661  1.00 87.82  ? 379  ILE A CA  1 
ATOM   2638 C C   . ILE A 1 355 ? 40.643  -3.183  66.275  1.00 87.82  ? 379  ILE A C   1 
ATOM   2639 O O   . ILE A 1 355 ? 40.730  -4.261  65.676  1.00 87.82  ? 379  ILE A O   1 
ATOM   2640 C CB  . ILE A 1 355 ? 40.680  -1.805  64.211  1.00 64.32  ? 379  ILE A CB  1 
ATOM   2641 C CG1 . ILE A 1 355 ? 41.226  -0.565  63.523  1.00 64.32  ? 379  ILE A CG1 1 
ATOM   2642 C CG2 . ILE A 1 355 ? 39.179  -1.729  64.204  1.00 64.32  ? 379  ILE A CG2 1 
ATOM   2643 C CD1 . ILE A 1 355 ? 40.743  -0.402  62.085  1.00 64.32  ? 379  ILE A CD1 1 
ATOM   2644 N N   . ASP A 1 356 ? 40.077  -3.077  67.468  1.00 67.55  ? 380  ASP A N   1 
ATOM   2645 C CA  . ASP A 1 356 ? 39.564  -4.263  68.119  1.00 67.55  ? 380  ASP A CA  1 
ATOM   2646 C C   . ASP A 1 356 ? 38.115  -4.104  68.506  1.00 67.55  ? 380  ASP A C   1 
ATOM   2647 O O   . ASP A 1 356 ? 37.452  -3.161  68.065  1.00 67.55  ? 380  ASP A O   1 
ATOM   2648 C CB  . ASP A 1 356 ? 40.396  -4.606  69.359  1.00 107.26 ? 380  ASP A CB  1 
ATOM   2649 C CG  . ASP A 1 356 ? 40.207  -3.610  70.488  1.00 107.26 ? 380  ASP A CG  1 
ATOM   2650 O OD1 . ASP A 1 356 ? 40.758  -2.499  70.397  1.00 107.26 ? 380  ASP A OD1 1 
ATOM   2651 O OD2 . ASP A 1 356 ? 39.503  -3.933  71.470  1.00 107.26 ? 380  ASP A OD2 1 
ATOM   2652 N N   . SER A 1 357 ? 37.644  -5.038  69.332  1.00 70.01  ? 381  SER A N   1 
ATOM   2653 C CA  . SER A 1 357 ? 36.275  -5.062  69.803  1.00 70.01  ? 381  SER A CA  1 
ATOM   2654 C C   . SER A 1 357 ? 35.978  -3.974  70.826  1.00 70.01  ? 381  SER A C   1 
ATOM   2655 O O   . SER A 1 357 ? 34.856  -3.869  71.330  1.00 70.01  ? 381  SER A O   1 
ATOM   2656 C CB  . SER A 1 357 ? 35.958  -6.429  70.405  1.00 122.17 ? 381  SER A CB  1 
ATOM   2657 O OG  . SER A 1 357 ? 36.764  -6.680  71.543  1.00 122.17 ? 381  SER A OG  1 
ATOM   2658 N N   . SER A 1 358 ? 36.965  -3.153  71.137  1.00 96.18  ? 382  SER A N   1 
ATOM   2659 C CA  . SER A 1 358 ? 36.729  -2.100  72.105  1.00 96.18  ? 382  SER A CA  1 
ATOM   2660 C C   . SER A 1 358 ? 36.560  -0.750  71.423  1.00 96.18  ? 382  SER A C   1 
ATOM   2661 O O   . SER A 1 358 ? 35.999  0.182   72.006  1.00 96.18  ? 382  SER A O   1 
ATOM   2662 C CB  . SER A 1 358 ? 37.876  -2.041  73.121  1.00 161.32 ? 382  SER A CB  1 
ATOM   2663 O OG  . SER A 1 358 ? 39.094  -1.648  72.516  1.00 161.32 ? 382  SER A OG  1 
ATOM   2664 N N   . ASN A 1 359 ? 37.024  -0.640  70.184  1.00 85.26  ? 383  ASN A N   1 
ATOM   2665 C CA  . ASN A 1 359 ? 36.920  0.631   69.483  1.00 85.26  ? 383  ASN A CA  1 
ATOM   2666 C C   . ASN A 1 359 ? 36.202  0.568   68.157  1.00 85.26  ? 383  ASN A C   1 
ATOM   2667 O O   . ASN A 1 359 ? 36.231  1.549   67.407  1.00 85.26  ? 383  ASN A O   1 
ATOM   2668 C CB  . ASN A 1 359 ? 38.313  1.220   69.240  1.00 82.14  ? 383  ASN A CB  1 
ATOM   2669 C CG  . ASN A 1 359 ? 39.265  0.232   68.580  1.00 82.14  ? 383  ASN A CG  1 
ATOM   2670 O OD1 . ASN A 1 359 ? 38.868  -0.582  67.747  1.00 82.14  ? 383  ASN A OD1 1 
ATOM   2671 N ND2 . ASN A 1 359 ? 40.542  0.317   68.945  1.00 82.14  ? 383  ASN A ND2 1 
ATOM   2672 N N   . TYR A 1 360 ? 35.537  -0.552  67.869  1.00 64.68  ? 384  TYR A N   1 
ATOM   2673 C CA  . TYR A 1 360 ? 34.886  -0.707  66.570  1.00 64.68  ? 384  TYR A CA  1 
ATOM   2674 C C   . TYR A 1 360 ? 33.631  -1.535  66.513  1.00 64.68  ? 384  TYR A C   1 
ATOM   2675 O O   . TYR A 1 360 ? 33.621  -2.676  66.925  1.00 64.68  ? 384  TYR A O   1 
ATOM   2676 C CB  . TYR A 1 360 ? 35.894  -1.286  65.576  1.00 64.03  ? 384  TYR A CB  1 
ATOM   2677 C CG  . TYR A 1 360 ? 35.284  -2.154  64.528  1.00 64.03  ? 384  TYR A CG  1 
ATOM   2678 C CD1 . TYR A 1 360 ? 34.459  -1.622  63.559  1.00 64.03  ? 384  TYR A CD1 1 
ATOM   2679 C CD2 . TYR A 1 360 ? 35.476  -3.518  64.546  1.00 64.03  ? 384  TYR A CD2 1 
ATOM   2680 C CE1 . TYR A 1 360 ? 33.821  -2.438  62.628  1.00 64.03  ? 384  TYR A CE1 1 
ATOM   2681 C CE2 . TYR A 1 360 ? 34.845  -4.347  63.622  1.00 64.03  ? 384  TYR A CE2 1 
ATOM   2682 C CZ  . TYR A 1 360 ? 34.011  -3.801  62.665  1.00 64.03  ? 384  TYR A CZ  1 
ATOM   2683 O OH  . TYR A 1 360 ? 33.331  -4.616  61.776  1.00 64.03  ? 384  TYR A OH  1 
ATOM   2684 N N   . GLU A 1 361 ? 32.580  -0.947  65.960  1.00 83.85  ? 385  GLU A N   1 
ATOM   2685 C CA  . GLU A 1 361 ? 31.302  -1.621  65.800  1.00 83.85  ? 385  GLU A CA  1 
ATOM   2686 C C   . GLU A 1 361 ? 30.956  -1.521  64.315  1.00 83.85  ? 385  GLU A C   1 
ATOM   2687 O O   . GLU A 1 361 ? 30.947  -0.427  63.736  1.00 83.85  ? 385  GLU A O   1 
ATOM   2688 C CB  . GLU A 1 361 ? 30.225  -0.940  66.656  1.00 183.58 ? 385  GLU A CB  1 
ATOM   2689 C CG  . GLU A 1 361 ? 28.849  -1.594  66.576  1.00 183.58 ? 385  GLU A CG  1 
ATOM   2690 C CD  . GLU A 1 361 ? 27.846  -0.984  67.543  1.00 183.58 ? 385  GLU A CD  1 
ATOM   2691 O OE1 . GLU A 1 361 ? 28.045  -1.112  68.770  1.00 183.58 ? 385  GLU A OE1 1 
ATOM   2692 O OE2 . GLU A 1 361 ? 26.860  -0.374  67.074  1.00 183.58 ? 385  GLU A OE2 1 
ATOM   2693 N N   . GLN A 1 362 ? 30.696  -2.669  63.697  1.00 73.79  ? 386  GLN A N   1 
ATOM   2694 C CA  . GLN A 1 362 ? 30.362  -2.715  62.285  1.00 73.79  ? 386  GLN A CA  1 
ATOM   2695 C C   . GLN A 1 362 ? 29.145  -1.878  61.928  1.00 73.79  ? 386  GLN A C   1 
ATOM   2696 O O   . GLN A 1 362 ? 28.076  -2.052  62.511  1.00 73.79  ? 386  GLN A O   1 
ATOM   2697 C CB  . GLN A 1 362 ? 30.134  -4.158  61.843  1.00 74.27  ? 386  GLN A CB  1 
ATOM   2698 C CG  . GLN A 1 362 ? 29.472  -4.274  60.485  1.00 74.27  ? 386  GLN A CG  1 
ATOM   2699 C CD  . GLN A 1 362 ? 29.746  -5.595  59.795  1.00 74.27  ? 386  GLN A CD  1 
ATOM   2700 O OE1 . GLN A 1 362 ? 29.018  -5.985  58.889  1.00 74.27  ? 386  GLN A OE1 1 
ATOM   2701 N NE2 . GLN A 1 362 ? 30.809  -6.283  60.208  1.00 74.27  ? 386  GLN A NE2 1 
ATOM   2702 N N   . GLU A 1 363 ? 29.333  -0.976  60.962  1.00 75.29  ? 387  GLU A N   1 
ATOM   2703 C CA  . GLU A 1 363 ? 28.300  -0.079  60.441  1.00 75.29  ? 387  GLU A CA  1 
ATOM   2704 C C   . GLU A 1 363 ? 27.090  -0.876  59.914  1.00 75.29  ? 387  GLU A C   1 
ATOM   2705 O O   . GLU A 1 363 ? 27.249  -1.920  59.267  1.00 75.29  ? 387  GLU A O   1 
ATOM   2706 C CB  . GLU A 1 363 ? 28.905  0.761   59.313  1.00 76.99  ? 387  GLU A CB  1 
ATOM   2707 C CG  . GLU A 1 363 ? 28.154  2.030   58.951  1.00 76.99  ? 387  GLU A CG  1 
ATOM   2708 C CD  . GLU A 1 363 ? 27.029  1.818   57.952  1.00 76.99  ? 387  GLU A CD  1 
ATOM   2709 O OE1 . GLU A 1 363 ? 27.280  1.303   56.835  1.00 76.99  ? 387  GLU A OE1 1 
ATOM   2710 O OE2 . GLU A 1 363 ? 25.883  2.189   58.285  1.00 76.99  ? 387  GLU A OE2 1 
ATOM   2711 N N   . SER A 1 364 ? 25.885  -0.373  60.184  1.00 72.18  ? 388  SER A N   1 
ATOM   2712 C CA  . SER A 1 364 ? 24.646  -1.036  59.770  1.00 72.18  ? 388  SER A CA  1 
ATOM   2713 C C   . SER A 1 364 ? 24.511  -1.460  58.299  1.00 72.18  ? 388  SER A C   1 
ATOM   2714 O O   . SER A 1 364 ? 24.058  -2.561  57.999  1.00 72.18  ? 388  SER A O   1 
ATOM   2715 C CB  . SER A 1 364 ? 23.448  -0.163  60.140  1.00 171.65 ? 388  SER A CB  1 
ATOM   2716 O OG  . SER A 1 364 ? 22.259  -0.721  59.615  1.00 171.65 ? 388  SER A OG  1 
ATOM   2717 N N   . LYS A 1 365 ? 24.910  -0.594  57.382  1.00 54.80  ? 389  LYS A N   1 
ATOM   2718 C CA  . LYS A 1 365 ? 24.772  -0.895  55.977  1.00 54.80  ? 389  LYS A CA  1 
ATOM   2719 C C   . LYS A 1 365 ? 25.855  -1.737  55.327  1.00 54.80  ? 389  LYS A C   1 
ATOM   2720 O O   . LYS A 1 365 ? 25.707  -2.151  54.170  1.00 54.80  ? 389  LYS A O   1 
ATOM   2721 C CB  . LYS A 1 365 ? 24.614  0.404   55.207  1.00 58.94  ? 389  LYS A CB  1 
ATOM   2722 C CG  . LYS A 1 365 ? 23.341  1.111   55.547  1.00 58.94  ? 389  LYS A CG  1 
ATOM   2723 C CD  . LYS A 1 365 ? 22.942  2.104   54.470  1.00 58.94  ? 389  LYS A CD  1 
ATOM   2724 C CE  . LYS A 1 365 ? 21.620  2.802   54.817  1.00 58.94  ? 389  LYS A CE  1 
ATOM   2725 N NZ  . LYS A 1 365 ? 21.589  3.424   56.210  1.00 58.94  ? 389  LYS A NZ  1 
ATOM   2726 N N   . ILE A 1 366 ? 26.937  -2.010  56.047  1.00 63.65  ? 390  ILE A N   1 
ATOM   2727 C CA  . ILE A 1 366 ? 28.016  -2.785  55.453  1.00 63.65  ? 390  ILE A CA  1 
ATOM   2728 C C   . ILE A 1 366 ? 27.483  -3.966  54.660  1.00 63.65  ? 390  ILE A C   1 
ATOM   2729 O O   . ILE A 1 366 ? 28.006  -4.295  53.600  1.00 63.65  ? 390  ILE A O   1 
ATOM   2730 C CB  . ILE A 1 366 ? 29.004  -3.277  56.510  1.00 72.53  ? 390  ILE A CB  1 
ATOM   2731 C CG1 . ILE A 1 366 ? 29.813  -2.093  57.037  1.00 72.53  ? 390  ILE A CG1 1 
ATOM   2732 C CG2 . ILE A 1 366 ? 29.939  -4.309  55.914  1.00 72.53  ? 390  ILE A CG2 1 
ATOM   2733 C CD1 . ILE A 1 366 ? 30.641  -1.379  55.984  1.00 72.53  ? 390  ILE A CD1 1 
ATOM   2734 N N   . MET A 1 367 ? 26.434  -4.597  55.174  1.00 59.13  ? 391  MET A N   1 
ATOM   2735 C CA  . MET A 1 367 ? 25.819  -5.725  54.488  1.00 59.13  ? 391  MET A CA  1 
ATOM   2736 C C   . MET A 1 367 ? 25.429  -5.345  53.045  1.00 59.13  ? 391  MET A C   1 
ATOM   2737 O O   . MET A 1 367 ? 25.789  -6.033  52.089  1.00 59.13  ? 391  MET A O   1 
ATOM   2738 C CB  . MET A 1 367 ? 24.587  -6.167  55.272  1.00 78.53  ? 391  MET A CB  1 
ATOM   2739 C CG  . MET A 1 367 ? 23.828  -7.343  54.682  1.00 78.53  ? 391  MET A CG  1 
ATOM   2740 S SD  . MET A 1 367 ? 22.312  -7.695  55.621  1.00 78.53  ? 391  MET A SD  1 
ATOM   2741 C CE  . MET A 1 367 ? 21.171  -6.603  54.814  1.00 78.53  ? 391  MET A CE  1 
ATOM   2742 N N   . PHE A 1 368 ? 24.704  -4.242  52.893  1.00 53.07  ? 392  PHE A N   1 
ATOM   2743 C CA  . PHE A 1 368 ? 24.273  -3.772  51.578  1.00 53.07  ? 392  PHE A CA  1 
ATOM   2744 C C   . PHE A 1 368 ? 25.417  -3.505  50.615  1.00 53.07  ? 392  PHE A C   1 
ATOM   2745 O O   . PHE A 1 368 ? 25.286  -3.676  49.403  1.00 53.07  ? 392  PHE A O   1 
ATOM   2746 C CB  . PHE A 1 368 ? 23.459  -2.509  51.739  1.00 58.66  ? 392  PHE A CB  1 
ATOM   2747 C CG  . PHE A 1 368 ? 22.303  -2.678  52.642  1.00 58.66  ? 392  PHE A CG  1 
ATOM   2748 C CD1 . PHE A 1 368 ? 22.416  -2.404  53.991  1.00 58.66  ? 392  PHE A CD1 1 
ATOM   2749 C CD2 . PHE A 1 368 ? 21.109  -3.166  52.160  1.00 58.66  ? 392  PHE A CD2 1 
ATOM   2750 C CE1 . PHE A 1 368 ? 21.338  -2.619  54.859  1.00 58.66  ? 392  PHE A CE1 1 
ATOM   2751 C CE2 . PHE A 1 368 ? 20.048  -3.381  53.005  1.00 58.66  ? 392  PHE A CE2 1 
ATOM   2752 C CZ  . PHE A 1 368 ? 20.158  -3.108  54.361  1.00 58.66  ? 392  PHE A CZ  1 
ATOM   2753 N N   . VAL A 1 369 ? 26.535  -3.050  51.161  1.00 64.77  ? 393  VAL A N   1 
ATOM   2754 C CA  . VAL A 1 369 ? 27.692  -2.797  50.338  1.00 64.77  ? 393  VAL A CA  1 
ATOM   2755 C C   . VAL A 1 369 ? 28.089  -4.115  49.693  1.00 64.77  ? 393  VAL A C   1 
ATOM   2756 O O   . VAL A 1 369 ? 28.161  -4.220  48.468  1.00 64.77  ? 393  VAL A O   1 
ATOM   2757 C CB  . VAL A 1 369 ? 28.857  -2.308  51.180  1.00 77.96  ? 393  VAL A CB  1 
ATOM   2758 C CG1 . VAL A 1 369 ? 30.117  -2.238  50.322  1.00 77.96  ? 393  VAL A CG1 1 
ATOM   2759 C CG2 . VAL A 1 369 ? 28.523  -0.961  51.779  1.00 77.96  ? 393  VAL A CG2 1 
ATOM   2760 N N   . VAL A 1 370 ? 28.314  -5.125  50.536  1.00 47.02  ? 394  VAL A N   1 
ATOM   2761 C CA  . VAL A 1 370 ? 28.739  -6.450  50.091  1.00 47.02  ? 394  VAL A CA  1 
ATOM   2762 C C   . VAL A 1 370 ? 27.805  -7.102  49.103  1.00 47.02  ? 394  VAL A C   1 
ATOM   2763 O O   . VAL A 1 370 ? 28.244  -7.708  48.136  1.00 47.02  ? 394  VAL A O   1 
ATOM   2764 C CB  . VAL A 1 370 ? 28.939  -7.397  51.268  1.00 35.14  ? 394  VAL A CB  1 
ATOM   2765 C CG1 . VAL A 1 370 ? 29.464  -8.696  50.776  1.00 35.14  ? 394  VAL A CG1 1 
ATOM   2766 C CG2 . VAL A 1 370 ? 29.935  -6.806  52.246  1.00 35.14  ? 394  VAL A CG2 1 
ATOM   2767 N N   . ASN A 1 371 ? 26.512  -6.987  49.341  1.00 50.20  ? 395  ASN A N   1 
ATOM   2768 C CA  . ASN A 1 371 ? 25.560  -7.565  48.414  1.00 50.20  ? 395  ASN A CA  1 
ATOM   2769 C C   . ASN A 1 371 ? 25.580  -6.799  47.112  1.00 50.20  ? 395  ASN A C   1 
ATOM   2770 O O   . ASN A 1 371 ? 25.487  -7.384  46.044  1.00 50.20  ? 395  ASN A O   1 
ATOM   2771 C CB  . ASN A 1 371 ? 24.163  -7.509  48.997  1.00 58.07  ? 395  ASN A CB  1 
ATOM   2772 C CG  . ASN A 1 371 ? 23.967  -8.498  50.106  1.00 58.07  ? 395  ASN A CG  1 
ATOM   2773 O OD1 . ASN A 1 371 ? 24.938  -8.962  50.736  1.00 58.07  ? 395  ASN A OD1 1 
ATOM   2774 N ND2 . ASN A 1 371 ? 22.705  -8.831  50.368  1.00 58.07  ? 395  ASN A ND2 1 
ATOM   2775 N N   . ALA A 1 372 ? 25.692  -5.481  47.215  1.00 54.55  ? 396  ALA A N   1 
ATOM   2776 C CA  . ALA A 1 372 ? 25.718  -4.622  46.043  1.00 54.55  ? 396  ALA A CA  1 
ATOM   2777 C C   . ALA A 1 372 ? 26.776  -5.125  45.083  1.00 54.55  ? 396  ALA A C   1 
ATOM   2778 O O   . ALA A 1 372 ? 26.515  -5.297  43.896  1.00 54.55  ? 396  ALA A O   1 
ATOM   2779 C CB  . ALA A 1 372 ? 26.021  -3.209  46.455  1.00 129.17 ? 396  ALA A CB  1 
ATOM   2780 N N   . VAL A 1 373 ? 27.969  -5.363  45.610  1.00 69.43  ? 397  VAL A N   1 
ATOM   2781 C CA  . VAL A 1 373 ? 29.081  -5.863  44.818  1.00 69.43  ? 397  VAL A CA  1 
ATOM   2782 C C   . VAL A 1 373 ? 28.825  -7.287  44.293  1.00 69.43  ? 397  VAL A C   1 
ATOM   2783 O O   . VAL A 1 373 ? 28.967  -7.532  43.092  1.00 69.43  ? 397  VAL A O   1 
ATOM   2784 C CB  . VAL A 1 373 ? 30.364  -5.861  45.655  1.00 69.27  ? 397  VAL A CB  1 
ATOM   2785 C CG1 . VAL A 1 373 ? 31.521  -6.406  44.863  1.00 69.27  ? 397  VAL A CG1 1 
ATOM   2786 C CG2 . VAL A 1 373 ? 30.655  -4.469  46.110  1.00 69.27  ? 397  VAL A CG2 1 
ATOM   2787 N N   . TYR A 1 374 ? 28.459  -8.223  45.175  1.00 71.16  ? 398  TYR A N   1 
ATOM   2788 C CA  . TYR A 1 374 ? 28.201  -9.588  44.727  1.00 71.16  ? 398  TYR A CA  1 
ATOM   2789 C C   . TYR A 1 374 ? 27.188  -9.575  43.609  1.00 71.16  ? 398  TYR A C   1 
ATOM   2790 O O   . TYR A 1 374 ? 27.317  -10.323 42.651  1.00 71.16  ? 398  TYR A O   1 
ATOM   2791 C CB  . TYR A 1 374 ? 27.713  -10.487 45.866  1.00 51.73  ? 398  TYR A CB  1 
ATOM   2792 C CG  . TYR A 1 374 ? 28.850  -11.171 46.576  1.00 51.73  ? 398  TYR A CG  1 
ATOM   2793 C CD1 . TYR A 1 374 ? 29.633  -10.485 47.485  1.00 51.73  ? 398  TYR A CD1 1 
ATOM   2794 C CD2 . TYR A 1 374 ? 29.232  -12.458 46.238  1.00 51.73  ? 398  TYR A CD2 1 
ATOM   2795 C CE1 . TYR A 1 374 ? 30.779  -11.061 48.032  1.00 51.73  ? 398  TYR A CE1 1 
ATOM   2796 C CE2 . TYR A 1 374 ? 30.375  -13.033 46.773  1.00 51.73  ? 398  TYR A CE2 1 
ATOM   2797 C CZ  . TYR A 1 374 ? 31.143  -12.324 47.664  1.00 51.73  ? 398  TYR A CZ  1 
ATOM   2798 O OH  . TYR A 1 374 ? 32.307  -12.837 48.161  1.00 51.73  ? 398  TYR A OH  1 
ATOM   2799 N N   . ALA A 1 375 ? 26.181  -8.725  43.723  1.00 56.01  ? 399  ALA A N   1 
ATOM   2800 C CA  . ALA A 1 375 ? 25.192  -8.624  42.671  1.00 56.01  ? 399  ALA A CA  1 
ATOM   2801 C C   . ALA A 1 375 ? 25.955  -8.375  41.376  1.00 56.01  ? 399  ALA A C   1 
ATOM   2802 O O   . ALA A 1 375 ? 25.972  -9.207  40.480  1.00 56.01  ? 399  ALA A O   1 
ATOM   2803 C CB  . ALA A 1 375 ? 24.268  -7.474  42.945  1.00 62.51  ? 399  ALA A CB  1 
ATOM   2804 N N   . MET A 1 376 ? 26.603  -7.221  41.296  1.00 57.08  ? 400  MET A N   1 
ATOM   2805 C CA  . MET A 1 376 ? 27.379  -6.847  40.125  1.00 57.08  ? 400  MET A CA  1 
ATOM   2806 C C   . MET A 1 376 ? 28.148  -8.042  39.596  1.00 57.08  ? 400  MET A C   1 
ATOM   2807 O O   . MET A 1 376 ? 28.167  -8.296  38.393  1.00 57.08  ? 400  MET A O   1 
ATOM   2808 C CB  . MET A 1 376 ? 28.361  -5.752  40.498  1.00 68.64  ? 400  MET A CB  1 
ATOM   2809 C CG  . MET A 1 376 ? 28.901  -5.009  39.326  1.00 68.64  ? 400  MET A CG  1 
ATOM   2810 S SD  . MET A 1 376 ? 27.606  -4.089  38.528  1.00 68.64  ? 400  MET A SD  1 
ATOM   2811 C CE  . MET A 1 376 ? 27.073  -5.284  37.348  1.00 68.64  ? 400  MET A CE  1 
ATOM   2812 N N   . ALA A 1 377 ? 28.768  -8.774  40.520  1.00 65.48  ? 401  ALA A N   1 
ATOM   2813 C CA  . ALA A 1 377 ? 29.571  -9.959  40.204  1.00 65.48  ? 401  ALA A CA  1 
ATOM   2814 C C   . ALA A 1 377 ? 28.748  -11.100 39.643  1.00 65.48  ? 401  ALA A C   1 
ATOM   2815 O O   . ALA A 1 377 ? 29.022  -11.602 38.557  1.00 65.48  ? 401  ALA A O   1 
ATOM   2816 C CB  . ALA A 1 377 ? 30.314  -10.430 41.440  1.00 52.09  ? 401  ALA A CB  1 
ATOM   2817 N N   . HIS A 1 378 ? 27.754  -11.538 40.397  1.00 72.36  ? 402  HIS A N   1 
ATOM   2818 C CA  . HIS A 1 378 ? 26.902  -12.604 39.906  1.00 72.36  ? 402  HIS A CA  1 
ATOM   2819 C C   . HIS A 1 378 ? 26.404  -12.199 38.520  1.00 72.36  ? 402  HIS A C   1 
ATOM   2820 O O   . HIS A 1 378 ? 26.331  -13.022 37.616  1.00 72.36  ? 402  HIS A O   1 
ATOM   2821 C CB  . HIS A 1 378 ? 25.717  -12.829 40.848  1.00 72.73  ? 402  HIS A CB  1 
ATOM   2822 C CG  . HIS A 1 378 ? 26.017  -13.760 41.973  1.00 72.73  ? 402  HIS A CG  1 
ATOM   2823 N ND1 . HIS A 1 378 ? 26.034  -15.127 41.817  1.00 72.73  ? 402  HIS A ND1 1 
ATOM   2824 C CD2 . HIS A 1 378 ? 26.384  -13.523 43.254  1.00 72.73  ? 402  HIS A CD2 1 
ATOM   2825 C CE1 . HIS A 1 378 ? 26.404  -15.692 42.955  1.00 72.73  ? 402  HIS A CE1 1 
ATOM   2826 N NE2 . HIS A 1 378 ? 26.622  -14.742 43.843  1.00 72.73  ? 402  HIS A NE2 1 
ATOM   2827 N N   . ALA A 1 379 ? 26.077  -10.922 38.357  1.00 61.89  ? 403  ALA A N   1 
ATOM   2828 C CA  . ALA A 1 379 ? 25.598  -10.426 37.077  1.00 61.89  ? 403  ALA A CA  1 
ATOM   2829 C C   . ALA A 1 379 ? 26.655  -10.725 36.034  1.00 61.89  ? 403  ALA A C   1 
ATOM   2830 O O   . ALA A 1 379 ? 26.396  -11.446 35.084  1.00 61.89  ? 403  ALA A O   1 
ATOM   2831 C CB  . ALA A 1 379 ? 25.344  -8.926  37.146  1.00 119.62 ? 403  ALA A CB  1 
ATOM   2832 N N   . LEU A 1 380 ? 27.850  -10.176 36.202  1.00 99.60  ? 404  LEU A N   1 
ATOM   2833 C CA  . LEU A 1 380 ? 28.900  -10.443 35.236  1.00 99.60  ? 404  LEU A CA  1 
ATOM   2834 C C   . LEU A 1 380 ? 29.063  -11.948 35.089  1.00 99.60  ? 404  LEU A C   1 
ATOM   2835 O O   . LEU A 1 380 ? 29.113  -12.463 33.973  1.00 99.60  ? 404  LEU A O   1 
ATOM   2836 C CB  . LEU A 1 380 ? 30.214  -9.825  35.689  1.00 90.70  ? 404  LEU A CB  1 
ATOM   2837 C CG  . LEU A 1 380 ? 30.209  -8.304  35.811  1.00 90.70  ? 404  LEU A CG  1 
ATOM   2838 C CD1 . LEU A 1 380 ? 31.589  -7.843  36.251  1.00 90.70  ? 404  LEU A CD1 1 
ATOM   2839 C CD2 . LEU A 1 380 ? 29.815  -7.675  34.479  1.00 90.70  ? 404  LEU A CD2 1 
ATOM   2840 N N   . HIS A 1 381 ? 29.121  -12.655 36.215  1.00 60.44  ? 405  HIS A N   1 
ATOM   2841 C CA  . HIS A 1 381 ? 29.278  -14.106 36.177  1.00 60.44  ? 405  HIS A CA  1 
ATOM   2842 C C   . HIS A 1 381 ? 28.313  -14.785 35.231  1.00 60.44  ? 405  HIS A C   1 
ATOM   2843 O O   . HIS A 1 381 ? 28.680  -15.732 34.565  1.00 60.44  ? 405  HIS A O   1 
ATOM   2844 C CB  . HIS A 1 381 ? 29.113  -14.729 37.557  1.00 81.31  ? 405  HIS A CB  1 
ATOM   2845 C CG  . HIS A 1 381 ? 29.385  -16.207 37.585  1.00 81.31  ? 405  HIS A CG  1 
ATOM   2846 N ND1 . HIS A 1 381 ? 30.476  -16.776 36.966  1.00 81.31  ? 405  HIS A ND1 1 
ATOM   2847 C CD2 . HIS A 1 381 ? 28.753  -17.220 38.226  1.00 81.31  ? 405  HIS A CD2 1 
ATOM   2848 C CE1 . HIS A 1 381 ? 30.508  -18.070 37.229  1.00 81.31  ? 405  HIS A CE1 1 
ATOM   2849 N NE2 . HIS A 1 381 ? 29.475  -18.366 37.993  1.00 81.31  ? 405  HIS A NE2 1 
ATOM   2850 N N   . LYS A 1 382 ? 27.072  -14.334 35.174  1.00 84.80  ? 406  LYS A N   1 
ATOM   2851 C CA  . LYS A 1 382 ? 26.164  -14.982 34.255  1.00 84.80  ? 406  LYS A CA  1 
ATOM   2852 C C   . LYS A 1 382 ? 26.658  -14.612 32.874  1.00 84.80  ? 406  LYS A C   1 
ATOM   2853 O O   . LYS A 1 382 ? 26.944  -15.489 32.071  1.00 84.80  ? 406  LYS A O   1 
ATOM   2854 C CB  . LYS A 1 382 ? 24.711  -14.524 34.458  1.00 45.49  ? 406  LYS A CB  1 
ATOM   2855 C CG  . LYS A 1 382 ? 23.708  -15.181 33.520  0.00 45.49  ? 406  LYS A CG  1 
ATOM   2856 C CD  . LYS A 1 382 ? 22.322  -14.569 33.666  0.00 45.49  ? 406  LYS A CD  1 
ATOM   2857 C CE  . LYS A 1 382 ? 21.767  -14.765 35.068  0.00 45.49  ? 406  LYS A CE  1 
ATOM   2858 N NZ  . LYS A 1 382 ? 20.425  -14.140 35.225  0.00 45.49  ? 406  LYS A NZ  1 
ATOM   2859 N N   . MET A 1 383 ? 26.801  -13.319 32.608  1.00 83.65  ? 407  MET A N   1 
ATOM   2860 C CA  . MET A 1 383 ? 27.251  -12.877 31.291  1.00 83.65  ? 407  MET A CA  1 
ATOM   2861 C C   . MET A 1 383 ? 28.436  -13.687 30.834  1.00 83.65  ? 407  MET A C   1 
ATOM   2862 O O   . MET A 1 383 ? 28.560  -13.973 29.646  1.00 83.65  ? 407  MET A O   1 
ATOM   2863 C CB  . MET A 1 383 ? 27.636  -11.399 31.283  1.00 84.66  ? 407  MET A CB  1 
ATOM   2864 C CG  . MET A 1 383 ? 27.865  -10.889 29.882  1.00 84.66  ? 407  MET A CG  1 
ATOM   2865 S SD  . MET A 1 383 ? 27.928  -9.119  29.739  1.00 84.66  ? 407  MET A SD  1 
ATOM   2866 C CE  . MET A 1 383 ? 26.225  -8.644  30.011  1.00 84.66  ? 407  MET A CE  1 
ATOM   2867 N N   . GLN A 1 384 ? 29.306  -14.049 31.773  1.00 92.14  ? 408  GLN A N   1 
ATOM   2868 C CA  . GLN A 1 384 ? 30.472  -14.860 31.453  1.00 92.14  ? 408  GLN A CA  1 
ATOM   2869 C C   . GLN A 1 384 ? 30.032  -16.205 30.881  1.00 92.14  ? 408  GLN A C   1 
ATOM   2870 O O   . GLN A 1 384 ? 30.233  -16.464 29.691  1.00 92.14  ? 408  GLN A O   1 
ATOM   2871 C CB  . GLN A 1 384 ? 31.336  -15.066 32.702  1.00 101.76 ? 408  GLN A CB  1 
ATOM   2872 C CG  . GLN A 1 384 ? 32.131  -16.380 32.792  1.00 101.76 ? 408  GLN A CG  1 
ATOM   2873 C CD  . GLN A 1 384 ? 32.891  -16.724 31.527  1.00 101.76 ? 408  GLN A CD  1 
ATOM   2874 O OE1 . GLN A 1 384 ? 33.518  -15.867 30.902  1.00 101.76 ? 408  GLN A OE1 1 
ATOM   2875 N NE2 . GLN A 1 384 ? 32.849  -17.996 31.149  1.00 101.76 ? 408  GLN A NE2 1 
ATOM   2876 N N   . ARG A 1 385 ? 29.411  -17.052 31.706  1.00 83.41  ? 409  ARG A N   1 
ATOM   2877 C CA  . ARG A 1 385 ? 28.980  -18.365 31.237  1.00 83.41  ? 409  ARG A CA  1 
ATOM   2878 C C   . ARG A 1 385 ? 28.028  -18.305 30.054  1.00 83.41  ? 409  ARG A C   1 
ATOM   2879 O O   . ARG A 1 385 ? 28.080  -19.171 29.193  1.00 83.41  ? 409  ARG A O   1 
ATOM   2880 C CB  . ARG A 1 385 ? 28.381  -19.192 32.383  1.00 116.68 ? 409  ARG A CB  1 
ATOM   2881 C CG  . ARG A 1 385 ? 29.283  -20.354 32.795  1.00 116.68 ? 409  ARG A CG  1 
ATOM   2882 C CD  . ARG A 1 385 ? 28.873  -20.976 34.118  1.00 116.68 ? 409  ARG A CD  1 
ATOM   2883 N NE  . ARG A 1 385 ? 29.907  -21.881 34.636  1.00 116.68 ? 409  ARG A NE  1 
ATOM   2884 C CZ  . ARG A 1 385 ? 29.975  -22.340 35.894  1.00 116.68 ? 409  ARG A CZ  1 
ATOM   2885 N NH1 . ARG A 1 385 ? 29.063  -21.990 36.797  1.00 116.68 ? 409  ARG A NH1 1 
ATOM   2886 N NH2 . ARG A 1 385 ? 30.973  -23.139 36.265  1.00 116.68 ? 409  ARG A NH2 1 
ATOM   2887 N N   . THR A 1 386 ? 27.178  -17.288 29.980  1.00 87.45  ? 410  THR A N   1 
ATOM   2888 C CA  . THR A 1 386 ? 26.260  -17.194 28.855  1.00 87.45  ? 410  THR A CA  1 
ATOM   2889 C C   . THR A 1 386 ? 26.976  -16.845 27.564  1.00 87.45  ? 410  THR A C   1 
ATOM   2890 O O   . THR A 1 386 ? 26.836  -17.550 26.560  1.00 87.45  ? 410  THR A O   1 
ATOM   2891 C CB  . THR A 1 386 ? 25.173  -16.153 29.104  1.00 114.87 ? 410  THR A CB  1 
ATOM   2892 O OG1 . THR A 1 386 ? 24.406  -16.562 30.236  1.00 114.87 ? 410  THR A OG1 1 
ATOM   2893 C CG2 . THR A 1 386 ? 24.246  -16.037 27.901  1.00 114.87 ? 410  THR A CG2 1 
ATOM   2894 N N   . LEU A 1 387 ? 27.747  -15.761 27.582  1.00 91.74  ? 411  LEU A N   1 
ATOM   2895 C CA  . LEU A 1 387 ? 28.469  -15.338 26.383  1.00 91.74  ? 411  LEU A CA  1 
ATOM   2896 C C   . LEU A 1 387 ? 29.654  -16.209 26.019  1.00 91.74  ? 411  LEU A C   1 
ATOM   2897 O O   . LEU A 1 387 ? 30.045  -16.251 24.854  1.00 91.74  ? 411  LEU A O   1 
ATOM   2898 C CB  . LEU A 1 387 ? 28.970  -13.890 26.512  1.00 94.43  ? 411  LEU A CB  1 
ATOM   2899 C CG  . LEU A 1 387 ? 28.001  -12.737 26.205  1.00 94.43  ? 411  LEU A CG  1 
ATOM   2900 C CD1 . LEU A 1 387 ? 28.761  -11.418 26.150  1.00 94.43  ? 411  LEU A CD1 1 
ATOM   2901 C CD2 . LEU A 1 387 ? 27.305  -12.972 24.871  1.00 94.43  ? 411  LEU A CD2 1 
ATOM   2902 N N   . CYS A 1 388 ? 30.209  -16.921 26.994  1.00 114.50 ? 412  CYS A N   1 
ATOM   2903 C CA  . CYS A 1 388 ? 31.398  -17.717 26.730  1.00 114.50 ? 412  CYS A CA  1 
ATOM   2904 C C   . CYS A 1 388 ? 31.503  -19.098 27.330  1.00 114.50 ? 412  CYS A C   1 
ATOM   2905 O O   . CYS A 1 388 ? 32.278  -19.330 28.262  1.00 114.50 ? 412  CYS A O   1 
ATOM   2906 C CB  . CYS A 1 388 ? 32.575  -16.893 27.145  1.00 141.62 ? 412  CYS A CB  1 
ATOM   2907 S SG  . CYS A 1 388 ? 32.406  -15.338 26.254  1.00 141.62 ? 412  CYS A SG  1 
ATOM   2908 N N   . PRO A 1 389 ? 30.768  -20.050 26.750  1.00 111.49 ? 413  PRO A N   1 
ATOM   2909 C CA  . PRO A 1 389 ? 30.679  -21.457 27.136  1.00 111.49 ? 413  PRO A CA  1 
ATOM   2910 C C   . PRO A 1 389 ? 31.995  -22.222 27.232  1.00 111.49 ? 413  PRO A C   1 
ATOM   2911 O O   . PRO A 1 389 ? 32.167  -23.046 28.137  1.00 111.49 ? 413  PRO A O   1 
ATOM   2912 C CB  . PRO A 1 389 ? 29.750  -22.033 26.073  1.00 120.49 ? 413  PRO A CB  1 
ATOM   2913 C CG  . PRO A 1 389 ? 30.089  -21.202 24.870  1.00 120.49 ? 413  PRO A CG  1 
ATOM   2914 C CD  . PRO A 1 389 ? 30.110  -19.827 25.450  1.00 120.49 ? 413  PRO A CD  1 
ATOM   2915 N N   . GLN A 1 390 ? 32.919  -21.934 26.315  1.00 93.77  ? 414  GLN A N   1 
ATOM   2916 C CA  . GLN A 1 390 ? 34.203  -22.639 26.262  1.00 93.77  ? 414  GLN A CA  1 
ATOM   2917 C C   . GLN A 1 390 ? 35.141  -22.514 27.462  1.00 93.77  ? 414  GLN A C   1 
ATOM   2918 O O   . GLN A 1 390 ? 35.417  -23.502 28.148  1.00 93.77  ? 414  GLN A O   1 
ATOM   2919 C CB  . GLN A 1 390 ? 34.948  -22.246 24.982  1.00 187.01 ? 414  GLN A CB  1 
ATOM   2920 C CG  . GLN A 1 390 ? 34.270  -22.725 23.692  1.00 187.01 ? 414  GLN A CG  1 
ATOM   2921 C CD  . GLN A 1 390 ? 34.213  -24.249 23.568  1.00 187.01 ? 414  GLN A CD  1 
ATOM   2922 O OE1 . GLN A 1 390 ? 35.245  -24.923 23.491  1.00 187.01 ? 414  GLN A OE1 1 
ATOM   2923 N NE2 . GLN A 1 390 ? 33.001  -24.795 23.547  1.00 187.01 ? 414  GLN A NE2 1 
ATOM   2924 N N   . THR A 1 391 ? 35.631  -21.303 27.705  1.00 120.77 ? 415  THR A N   1 
ATOM   2925 C CA  . THR A 1 391 ? 36.553  -21.040 28.813  1.00 120.77 ? 415  THR A CA  1 
ATOM   2926 C C   . THR A 1 391 ? 35.893  -20.467 30.062  1.00 120.77 ? 415  THR A C   1 
ATOM   2927 O O   . THR A 1 391 ? 34.668  -20.331 30.149  1.00 120.77 ? 415  THR A O   1 
ATOM   2928 C CB  . THR A 1 391 ? 37.653  -20.044 28.391  1.00 185.24 ? 415  THR A CB  1 
ATOM   2929 O OG1 . THR A 1 391 ? 37.043  -18.886 27.804  1.00 185.24 ? 415  THR A OG1 1 
ATOM   2930 C CG2 . THR A 1 391 ? 38.611  -20.683 27.396  1.00 185.24 ? 415  THR A CG2 1 
ATOM   2931 N N   . THR A 1 392 ? 36.739  -20.139 31.031  1.00 89.19  ? 416  THR A N   1 
ATOM   2932 C CA  . THR A 1 392 ? 36.309  -19.540 32.289  1.00 89.19  ? 416  THR A CA  1 
ATOM   2933 C C   . THR A 1 392 ? 36.835  -18.106 32.307  1.00 89.19  ? 416  THR A C   1 
ATOM   2934 O O   . THR A 1 392 ? 36.513  -17.315 33.198  1.00 89.19  ? 416  THR A O   1 
ATOM   2935 C CB  . THR A 1 392 ? 36.893  -20.284 33.527  1.00 123.36 ? 416  THR A CB  1 
ATOM   2936 O OG1 . THR A 1 392 ? 38.302  -20.457 33.358  1.00 123.36 ? 416  THR A OG1 1 
ATOM   2937 C CG2 . THR A 1 392 ? 36.238  -21.643 33.724  1.00 123.36 ? 416  THR A CG2 1 
ATOM   2938 N N   . LYS A 1 393 ? 37.646  -17.784 31.304  1.00 93.66  ? 417  LYS A N   1 
ATOM   2939 C CA  . LYS A 1 393 ? 38.244  -16.463 31.179  1.00 93.66  ? 417  LYS A CA  1 
ATOM   2940 C C   . LYS A 1 393 ? 37.405  -15.492 30.347  1.00 93.66  ? 417  LYS A C   1 
ATOM   2941 O O   . LYS A 1 393 ? 36.388  -15.867 29.751  1.00 93.66  ? 417  LYS A O   1 
ATOM   2942 C CB  . LYS A 1 393 ? 39.649  -16.590 30.587  1.00 77.69  ? 417  LYS A CB  1 
ATOM   2943 C CG  . LYS A 1 393 ? 40.588  -17.433 31.431  0.00 77.69  ? 417  LYS A CG  1 
ATOM   2944 C CD  . LYS A 1 393 ? 41.970  -17.520 30.812  0.00 77.69  ? 417  LYS A CD  1 
ATOM   2945 C CE  . LYS A 1 393 ? 42.899  -18.358 31.674  0.00 77.69  ? 417  LYS A CE  1 
ATOM   2946 N NZ  . LYS A 1 393 ? 44.264  -18.456 31.091  0.00 77.69  ? 417  LYS A NZ  1 
ATOM   2947 N N   . LEU A 1 394 ? 37.843  -14.238 30.317  1.00 73.00  ? 418  LEU A N   1 
ATOM   2948 C CA  . LEU A 1 394 ? 37.134  -13.206 29.590  1.00 73.00  ? 418  LEU A CA  1 
ATOM   2949 C C   . LEU A 1 394 ? 37.434  -13.384 28.124  1.00 73.00  ? 418  LEU A C   1 
ATOM   2950 O O   . LEU A 1 394 ? 38.528  -13.091 27.676  1.00 73.00  ? 418  LEU A O   1 
ATOM   2951 C CB  . LEU A 1 394 ? 37.583  -11.821 30.064  1.00 78.67  ? 418  LEU A CB  1 
ATOM   2952 C CG  . LEU A 1 394 ? 36.531  -10.702 30.105  1.00 78.67  ? 418  LEU A CG  1 
ATOM   2953 C CD1 . LEU A 1 394 ? 35.844  -10.573 28.732  1.00 78.67  ? 418  LEU A CD1 1 
ATOM   2954 C CD2 . LEU A 1 394 ? 35.499  -11.007 31.201  1.00 78.67  ? 418  LEU A CD2 1 
ATOM   2955 N N   . CYS A 1 395 ? 36.440  -13.870 27.395  1.00 102.33 ? 419  CYS A N   1 
ATOM   2956 C CA  . CYS A 1 395 ? 36.479  -14.151 25.955  1.00 102.33 ? 419  CYS A CA  1 
ATOM   2957 C C   . CYS A 1 395 ? 36.310  -12.912 25.098  1.00 102.33 ? 419  CYS A C   1 
ATOM   2958 O O   . CYS A 1 395 ? 36.213  -11.797 25.605  1.00 102.33 ? 419  CYS A O   1 
ATOM   2959 C CB  . CYS A 1 395 ? 35.323  -15.043 25.668  1.00 278.91 ? 419  CYS A CB  1 
ATOM   2960 S SG  . CYS A 1 395 ? 34.083  -14.396 26.819  1.00 278.91 ? 419  CYS A SG  1 
ATOM   2961 N N   . ASP A 1 396 ? 36.224  -13.134 23.790  1.00 127.26 ? 420  ASP A N   1 
ATOM   2962 C CA  . ASP A 1 396 ? 36.058  -12.050 22.840  1.00 127.26 ? 420  ASP A CA  1 
ATOM   2963 C C   . ASP A 1 396 ? 34.650  -11.492 22.887  1.00 127.26 ? 420  ASP A C   1 
ATOM   2964 O O   . ASP A 1 396 ? 34.444  -10.306 22.642  1.00 127.26 ? 420  ASP A O   1 
ATOM   2965 C CB  . ASP A 1 396 ? 36.385  -12.530 21.426  1.00 216.24 ? 420  ASP A CB  1 
ATOM   2966 C CG  . ASP A 1 396 ? 37.812  -12.214 21.023  1.00 216.24 ? 420  ASP A CG  1 
ATOM   2967 O OD1 . ASP A 1 396 ? 38.716  -12.332 21.878  1.00 216.24 ? 420  ASP A OD1 1 
ATOM   2968 O OD2 . ASP A 1 396 ? 38.033  -11.853 19.848  1.00 216.24 ? 420  ASP A OD2 1 
ATOM   2969 N N   . ALA A 1 397 ? 33.681  -12.340 23.212  1.00 116.64 ? 421  ALA A N   1 
ATOM   2970 C CA  . ALA A 1 397 ? 32.293  -11.893 23.286  1.00 116.64 ? 421  ALA A CA  1 
ATOM   2971 C C   . ALA A 1 397 ? 32.127  -10.756 24.298  1.00 116.64 ? 421  ALA A C   1 
ATOM   2972 O O   . ALA A 1 397 ? 31.400  -9.781  24.050  1.00 116.64 ? 421  ALA A O   1 
ATOM   2973 C CB  . ALA A 1 397 ? 31.398  -13.055 23.666  1.00 229.38 ? 421  ALA A CB  1 
ATOM   2974 N N   . MET A 1 398 ? 32.809  -10.895 25.434  1.00 147.87 ? 422  MET A N   1 
ATOM   2975 C CA  . MET A 1 398 ? 32.757  -9.912  26.509  1.00 147.87 ? 422  MET A CA  1 
ATOM   2976 C C   . MET A 1 398 ? 33.905  -8.920  26.522  1.00 147.87 ? 422  MET A C   1 
ATOM   2977 O O   . MET A 1 398 ? 34.009  -8.124  27.447  1.00 147.87 ? 422  MET A O   1 
ATOM   2978 C CB  . MET A 1 398 ? 32.732  -10.605 27.873  1.00 90.20  ? 422  MET A CB  1 
ATOM   2979 C CG  . MET A 1 398 ? 31.363  -11.076 28.350  1.00 90.20  ? 422  MET A CG  1 
ATOM   2980 S SD  . MET A 1 398 ? 31.215  -11.079 30.167  1.00 90.20  ? 422  MET A SD  1 
ATOM   2981 C CE  . MET A 1 398 ? 32.367  -12.329 30.577  1.00 90.20  ? 422  MET A CE  1 
ATOM   2982 N N   . LYS A 1 399 ? 34.780  -8.966  25.526  1.00 135.70 ? 423  LYS A N   1 
ATOM   2983 C CA  . LYS A 1 399 ? 35.895  -8.031  25.505  1.00 135.70 ? 423  LYS A CA  1 
ATOM   2984 C C   . LYS A 1 399 ? 35.302  -6.657  25.779  1.00 135.70 ? 423  LYS A C   1 
ATOM   2985 O O   . LYS A 1 399 ? 35.778  -5.929  26.651  1.00 135.70 ? 423  LYS A O   1 
ATOM   2986 C CB  . LYS A 1 399 ? 36.595  -8.049  24.145  1.00 197.24 ? 423  LYS A CB  1 
ATOM   2987 C CG  . LYS A 1 399 ? 38.126  -8.015  24.221  1.00 197.24 ? 423  LYS A CG  1 
ATOM   2988 C CD  . LYS A 1 399 ? 38.699  -9.293  24.845  1.00 197.24 ? 423  LYS A CD  1 
ATOM   2989 C CE  . LYS A 1 399 ? 40.226  -9.328  24.779  1.00 197.24 ? 423  LYS A CE  1 
ATOM   2990 N NZ  . LYS A 1 399 ? 40.789  -10.606 25.306  1.00 197.24 ? 423  LYS A NZ  1 
ATOM   2991 N N   . ILE A 1 400 ? 34.246  -6.318  25.045  1.00 102.46 ? 424  ILE A N   1 
ATOM   2992 C CA  . ILE A 1 400 ? 33.562  -5.044  25.229  1.00 102.46 ? 424  ILE A CA  1 
ATOM   2993 C C   . ILE A 1 400 ? 32.122  -5.330  25.641  1.00 102.46 ? 424  ILE A C   1 
ATOM   2994 O O   . ILE A 1 400 ? 31.319  -5.782  24.827  1.00 102.46 ? 424  ILE A O   1 
ATOM   2995 C CB  . ILE A 1 400 ? 33.556  -4.209  23.936  1.00 110.18 ? 424  ILE A CB  1 
ATOM   2996 C CG1 . ILE A 1 400 ? 33.020  -5.041  22.775  1.00 110.18 ? 424  ILE A CG1 1 
ATOM   2997 C CG2 . ILE A 1 400 ? 34.959  -3.720  23.628  1.00 110.18 ? 424  ILE A CG2 1 
ATOM   2998 C CD1 . ILE A 1 400 ? 32.797  -4.239  21.519  1.00 110.18 ? 424  ILE A CD1 1 
ATOM   2999 N N   . LEU A 1 401 ? 31.798  -5.064  26.906  1.00 127.53 ? 425  LEU A N   1 
ATOM   3000 C CA  . LEU A 1 401 ? 30.458  -5.322  27.447  1.00 127.53 ? 425  LEU A CA  1 
ATOM   3001 C C   . LEU A 1 401 ? 29.335  -4.499  26.829  1.00 127.53 ? 425  LEU A C   1 
ATOM   3002 O O   . LEU A 1 401 ? 29.554  -3.421  26.270  1.00 127.53 ? 425  LEU A O   1 
ATOM   3003 C CB  . LEU A 1 401 ? 30.442  -5.093  28.962  1.00 102.54 ? 425  LEU A CB  1 
ATOM   3004 C CG  . LEU A 1 401 ? 31.458  -5.859  29.805  1.00 102.54 ? 425  LEU A CG  1 
ATOM   3005 C CD1 . LEU A 1 401 ? 31.500  -5.293  31.212  1.00 102.54 ? 425  LEU A CD1 1 
ATOM   3006 C CD2 . LEU A 1 401 ? 31.087  -7.314  29.816  1.00 102.54 ? 425  LEU A CD2 1 
ATOM   3007 N N   . ASP A 1 402 ? 28.125  -5.033  26.943  1.00 110.22 ? 426  ASP A N   1 
ATOM   3008 C CA  . ASP A 1 402 ? 26.931  -4.374  26.434  1.00 110.22 ? 426  ASP A CA  1 
ATOM   3009 C C   . ASP A 1 402 ? 26.184  -3.890  27.672  1.00 110.22 ? 426  ASP A C   1 
ATOM   3010 O O   . ASP A 1 402 ? 25.363  -4.609  28.243  1.00 110.22 ? 426  ASP A O   1 
ATOM   3011 C CB  . ASP A 1 402 ? 26.059  -5.369  25.665  1.00 153.16 ? 426  ASP A CB  1 
ATOM   3012 C CG  . ASP A 1 402 ? 24.839  -4.716  25.038  1.00 153.16 ? 426  ASP A CG  1 
ATOM   3013 O OD1 . ASP A 1 402 ? 24.386  -3.670  25.555  1.00 153.16 ? 426  ASP A OD1 1 
ATOM   3014 O OD2 . ASP A 1 402 ? 24.326  -5.262  24.035  1.00 153.16 ? 426  ASP A OD2 1 
ATOM   3015 N N   . GLY A 1 403 ? 26.479  -2.675  28.103  1.00 85.41  ? 427  GLY A N   1 
ATOM   3016 C CA  . GLY A 1 403 ? 25.824  -2.171  29.289  1.00 85.41  ? 427  GLY A CA  1 
ATOM   3017 C C   . GLY A 1 403 ? 24.375  -2.590  29.382  1.00 85.41  ? 427  GLY A C   1 
ATOM   3018 O O   . GLY A 1 403 ? 24.023  -3.424  30.219  1.00 85.41  ? 427  GLY A O   1 
ATOM   3019 N N   . LYS A 1 404 ? 23.558  -2.008  28.504  1.00 84.02  ? 428  LYS A N   1 
ATOM   3020 C CA  . LYS A 1 404 ? 22.121  -2.250  28.434  1.00 84.02  ? 428  LYS A CA  1 
ATOM   3021 C C   . LYS A 1 404 ? 21.802  -3.705  28.760  1.00 84.02  ? 428  LYS A C   1 
ATOM   3022 O O   . LYS A 1 404 ? 20.928  -4.005  29.590  1.00 84.02  ? 428  LYS A O   1 
ATOM   3023 C CB  . LYS A 1 404 ? 21.620  -1.894  27.031  1.00 146.11 ? 428  LYS A CB  1 
ATOM   3024 C CG  . LYS A 1 404 ? 20.132  -1.592  26.927  1.00 146.11 ? 428  LYS A CG  1 
ATOM   3025 C CD  . LYS A 1 404 ? 19.817  -0.953  25.571  1.00 146.11 ? 428  LYS A CD  1 
ATOM   3026 C CE  . LYS A 1 404 ? 18.376  -0.451  25.486  1.00 146.11 ? 428  LYS A CE  1 
ATOM   3027 N NZ  . LYS A 1 404 ? 18.107  0.316   24.229  1.00 146.11 ? 428  LYS A NZ  1 
ATOM   3028 N N   . LYS A 1 405 ? 22.532  -4.596  28.098  1.00 83.28  ? 429  LYS A N   1 
ATOM   3029 C CA  . LYS A 1 405 ? 22.388  -6.029  28.280  1.00 83.28  ? 429  LYS A CA  1 
ATOM   3030 C C   . LYS A 1 405 ? 22.715  -6.373  29.731  1.00 83.28  ? 429  LYS A C   1 
ATOM   3031 O O   . LYS A 1 405 ? 21.873  -6.897  30.448  1.00 83.28  ? 429  LYS A O   1 
ATOM   3032 C CB  . LYS A 1 405 ? 23.351  -6.771  27.347  1.00 200.03 ? 429  LYS A CB  1 
ATOM   3033 C CG  . LYS A 1 405 ? 22.715  -7.790  26.405  1.00 200.03 ? 429  LYS A CG  1 
ATOM   3034 C CD  . LYS A 1 405 ? 21.778  -7.142  25.394  1.00 200.03 ? 429  LYS A CD  1 
ATOM   3035 C CE  . LYS A 1 405 ? 21.547  -8.065  24.204  1.00 200.03 ? 429  LYS A CE  1 
ATOM   3036 N NZ  . LYS A 1 405 ? 21.167  -9.451  24.617  1.00 200.03 ? 429  LYS A NZ  1 
ATOM   3037 N N   . LEU A 1 406 ? 23.932  -6.068  30.174  1.00 80.67  ? 430  LEU A N   1 
ATOM   3038 C CA  . LEU A 1 406 ? 24.314  -6.386  31.542  1.00 80.67  ? 430  LEU A CA  1 
ATOM   3039 C C   . LEU A 1 406 ? 23.268  -5.907  32.526  1.00 80.67  ? 430  LEU A C   1 
ATOM   3040 O O   . LEU A 1 406 ? 22.970  -6.592  33.491  1.00 80.67  ? 430  LEU A O   1 
ATOM   3041 C CB  . LEU A 1 406 ? 25.669  -5.765  31.895  1.00 50.64  ? 430  LEU A CB  1 
ATOM   3042 C CG  . LEU A 1 406 ? 26.210  -6.007  33.325  1.00 50.64  ? 430  LEU A CG  1 
ATOM   3043 C CD1 . LEU A 1 406 ? 26.345  -7.503  33.656  1.00 50.64  ? 430  LEU A CD1 1 
ATOM   3044 C CD2 . LEU A 1 406 ? 27.569  -5.321  33.452  1.00 50.64  ? 430  LEU A CD2 1 
ATOM   3045 N N   . TYR A 1 407 ? 22.692  -4.744  32.269  1.00 62.96  ? 431  TYR A N   1 
ATOM   3046 C CA  . TYR A 1 407 ? 21.705  -4.196  33.176  1.00 62.96  ? 431  TYR A CA  1 
ATOM   3047 C C   . TYR A 1 407 ? 20.371  -4.907  33.190  1.00 62.96  ? 431  TYR A C   1 
ATOM   3048 O O   . TYR A 1 407 ? 19.681  -4.848  34.208  1.00 62.96  ? 431  TYR A O   1 
ATOM   3049 C CB  . TYR A 1 407 ? 21.473  -2.733  32.883  1.00 63.17  ? 431  TYR A CB  1 
ATOM   3050 C CG  . TYR A 1 407 ? 20.576  -2.095  33.885  1.00 63.17  ? 431  TYR A CG  1 
ATOM   3051 C CD1 . TYR A 1 407 ? 20.983  -1.925  35.191  1.00 63.17  ? 431  TYR A CD1 1 
ATOM   3052 C CD2 . TYR A 1 407 ? 19.302  -1.685  33.535  1.00 63.17  ? 431  TYR A CD2 1 
ATOM   3053 C CE1 . TYR A 1 407 ? 20.134  -1.355  36.140  1.00 63.17  ? 431  TYR A CE1 1 
ATOM   3054 C CE2 . TYR A 1 407 ? 18.439  -1.118  34.480  1.00 63.17  ? 431  TYR A CE2 1 
ATOM   3055 C CZ  . TYR A 1 407 ? 18.864  -0.960  35.779  1.00 63.17  ? 431  TYR A CZ  1 
ATOM   3056 O OH  . TYR A 1 407 ? 18.013  -0.436  36.718  1.00 63.17  ? 431  TYR A OH  1 
ATOM   3057 N N   . LYS A 1 408 ? 20.006  -5.555  32.072  1.00 78.34  ? 432  LYS A N   1 
ATOM   3058 C CA  . LYS A 1 408 ? 18.749  -6.335  31.926  1.00 78.34  ? 432  LYS A CA  1 
ATOM   3059 C C   . LYS A 1 408 ? 19.100  -7.838  31.829  1.00 78.34  ? 432  LYS A C   1 
ATOM   3060 O O   . LYS A 1 408 ? 18.532  -8.587  31.034  1.00 78.34  ? 432  LYS A O   1 
ATOM   3061 C CB  . LYS A 1 408 ? 18.021  -5.921  30.655  1.00 113.62 ? 432  LYS A CB  1 
ATOM   3062 C CG  . LYS A 1 408 ? 18.084  -4.433  30.352  1.00 113.62 ? 432  LYS A CG  1 
ATOM   3063 C CD  . LYS A 1 408 ? 17.224  -3.634  31.294  1.00 113.62 ? 432  LYS A CD  1 
ATOM   3064 C CE  . LYS A 1 408 ? 17.095  -2.195  30.823  1.00 113.62 ? 432  LYS A CE  1 
ATOM   3065 N NZ  . LYS A 1 408 ? 16.335  -2.078  29.547  1.00 113.62 ? 432  LYS A NZ  1 
ATOM   3066 N N   . GLU A 1 409 ? 20.086  -8.225  32.636  1.00 93.62  ? 433  GLU A N   1 
ATOM   3067 C CA  . GLU A 1 409 ? 20.654  -9.572  32.779  1.00 93.62  ? 433  GLU A CA  1 
ATOM   3068 C C   . GLU A 1 409 ? 21.182  -9.485  34.214  1.00 93.62  ? 433  GLU A C   1 
ATOM   3069 O O   . GLU A 1 409 ? 21.744  -10.425 34.762  1.00 93.62  ? 433  GLU A O   1 
ATOM   3070 C CB  . GLU A 1 409 ? 21.807  -9.774  31.760  1.00 87.28  ? 433  GLU A CB  1 
ATOM   3071 C CG  . GLU A 1 409 ? 23.068  -10.565 32.228  1.00 87.28  ? 433  GLU A CG  1 
ATOM   3072 C CD  . GLU A 1 409 ? 23.615  -11.581 31.173  1.00 87.28  ? 433  GLU A CD  1 
ATOM   3073 O OE1 . GLU A 1 409 ? 23.592  -11.296 29.941  1.00 87.28  ? 433  GLU A OE1 1 
ATOM   3074 O OE2 . GLU A 1 409 ? 24.082  -12.675 31.584  1.00 87.28  ? 433  GLU A OE2 1 
ATOM   3075 N N   . TYR A 1 410 ? 20.950  -8.308  34.798  1.00 90.18  ? 434  TYR A N   1 
ATOM   3076 C CA  . TYR A 1 410 ? 21.344  -7.934  36.152  1.00 90.18  ? 434  TYR A CA  1 
ATOM   3077 C C   . TYR A 1 410 ? 20.131  -7.811  37.061  1.00 90.18  ? 434  TYR A C   1 
ATOM   3078 O O   . TYR A 1 410 ? 20.066  -8.462  38.105  1.00 90.18  ? 434  TYR A O   1 
ATOM   3079 C CB  . TYR A 1 410 ? 22.069  -6.594  36.123  1.00 104.72 ? 434  TYR A CB  1 
ATOM   3080 C CG  . TYR A 1 410 ? 22.477  -6.130  37.484  1.00 104.72 ? 434  TYR A CG  1 
ATOM   3081 C CD1 . TYR A 1 410 ? 22.944  -7.047  38.430  1.00 104.72 ? 434  TYR A CD1 1 
ATOM   3082 C CD2 . TYR A 1 410 ? 22.428  -4.782  37.826  1.00 104.72 ? 434  TYR A CD2 1 
ATOM   3083 C CE1 . TYR A 1 410 ? 23.354  -6.643  39.684  1.00 104.72 ? 434  TYR A CE1 1 
ATOM   3084 C CE2 . TYR A 1 410 ? 22.837  -4.355  39.082  1.00 104.72 ? 434  TYR A CE2 1 
ATOM   3085 C CZ  . TYR A 1 410 ? 23.301  -5.295  40.011  1.00 104.72 ? 434  TYR A CZ  1 
ATOM   3086 O OH  . TYR A 1 410 ? 23.707  -4.900  41.271  1.00 104.72 ? 434  TYR A OH  1 
ATOM   3087 N N   . LEU A 1 411 ? 19.189  -6.950  36.678  1.00 68.94  ? 435  LEU A N   1 
ATOM   3088 C CA  . LEU A 1 411 ? 17.982  -6.797  37.464  1.00 68.94  ? 435  LEU A CA  1 
ATOM   3089 C C   . LEU A 1 411 ? 17.417  -8.194  37.722  1.00 68.94  ? 435  LEU A C   1 
ATOM   3090 O O   . LEU A 1 411 ? 17.094  -8.558  38.860  1.00 68.94  ? 435  LEU A O   1 
ATOM   3091 C CB  . LEU A 1 411 ? 16.944  -5.972  36.714  1.00 93.64  ? 435  LEU A CB  1 
ATOM   3092 C CG  . LEU A 1 411 ? 17.262  -4.495  36.543  1.00 93.64  ? 435  LEU A CG  1 
ATOM   3093 C CD1 . LEU A 1 411 ? 16.053  -3.767  35.981  1.00 93.64  ? 435  LEU A CD1 1 
ATOM   3094 C CD2 . LEU A 1 411 ? 17.621  -3.910  37.880  1.00 93.64  ? 435  LEU A CD2 1 
ATOM   3095 N N   . LEU A 1 412 ? 17.316  -8.980  36.652  1.00 103.90 ? 436  LEU A N   1 
ATOM   3096 C CA  . LEU A 1 412 ? 16.788  -10.339 36.714  1.00 103.90 ? 436  LEU A CA  1 
ATOM   3097 C C   . LEU A 1 412 ? 17.607  -11.244 37.624  1.00 103.90 ? 436  LEU A C   1 
ATOM   3098 O O   . LEU A 1 412 ? 17.521  -12.460 37.522  1.00 103.90 ? 436  LEU A O   1 
ATOM   3099 C CB  . LEU A 1 412 ? 16.739  -10.929 35.300  1.00 161.14 ? 436  LEU A CB  1 
ATOM   3100 C CG  . LEU A 1 412 ? 15.720  -10.302 34.337  1.00 161.14 ? 436  LEU A CG  1 
ATOM   3101 C CD1 . LEU A 1 412 ? 16.157  -10.486 32.887  1.00 161.14 ? 436  LEU A CD1 1 
ATOM   3102 C CD2 . LEU A 1 412 ? 14.350  -10.927 34.576  1.00 161.14 ? 436  LEU A CD2 1 
ATOM   3103 N N   . LYS A 1 413 ? 18.385  -10.661 38.527  1.00 72.08  ? 437  LYS A N   1 
ATOM   3104 C CA  . LYS A 1 413 ? 19.215  -11.462 39.407  1.00 72.08  ? 437  LYS A CA  1 
ATOM   3105 C C   . LYS A 1 413 ? 18.537  -11.917 40.694  1.00 72.08  ? 437  LYS A C   1 
ATOM   3106 O O   . LYS A 1 413 ? 17.644  -11.250 41.194  1.00 72.08  ? 437  LYS A O   1 
ATOM   3107 C CB  . LYS A 1 413 ? 20.492  -10.704 39.749  1.00 132.41 ? 437  LYS A CB  1 
ATOM   3108 C CG  . LYS A 1 413 ? 21.576  -11.588 40.311  1.00 132.41 ? 437  LYS A CG  1 
ATOM   3109 C CD  . LYS A 1 413 ? 22.048  -12.637 39.283  1.00 132.41 ? 437  LYS A CD  1 
ATOM   3110 C CE  . LYS A 1 413 ? 21.068  -13.825 39.105  1.00 132.41 ? 437  LYS A CE  1 
ATOM   3111 N NZ  . LYS A 1 413 ? 21.479  -14.839 38.066  1.00 132.41 ? 437  LYS A NZ  1 
ATOM   3112 N N   . ILE A 1 414 ? 18.963  -13.068 41.208  1.00 60.06  ? 438  ILE A N   1 
ATOM   3113 C CA  . ILE A 1 414 ? 18.462  -13.647 42.459  1.00 60.06  ? 438  ILE A CA  1 
ATOM   3114 C C   . ILE A 1 414 ? 19.582  -14.571 42.972  1.00 60.06  ? 438  ILE A C   1 
ATOM   3115 O O   . ILE A 1 414 ? 20.030  -15.449 42.228  1.00 60.06  ? 438  ILE A O   1 
ATOM   3116 C CB  . ILE A 1 414 ? 17.168  -14.529 42.251  1.00 125.48 ? 438  ILE A CB  1 
ATOM   3117 C CG1 . ILE A 1 414 ? 15.965  -13.676 41.844  1.00 125.48 ? 438  ILE A CG1 1 
ATOM   3118 C CG2 . ILE A 1 414 ? 16.811  -15.260 43.548  1.00 125.48 ? 438  ILE A CG2 1 
ATOM   3119 C CD1 . ILE A 1 414 ? 14.665  -14.472 41.706  1.00 125.48 ? 438  ILE A CD1 1 
ATOM   3120 N N   . GLN A 1 415 ? 20.043  -14.386 44.213  1.00 57.75  ? 439  GLN A N   1 
ATOM   3121 C CA  . GLN A 1 415 ? 21.105  -15.241 44.767  1.00 57.75  ? 439  GLN A CA  1 
ATOM   3122 C C   . GLN A 1 415 ? 21.099  -15.219 46.285  1.00 57.75  ? 439  GLN A C   1 
ATOM   3123 O O   . GLN A 1 415 ? 20.619  -14.258 46.876  1.00 57.75  ? 439  GLN A O   1 
ATOM   3124 C CB  . GLN A 1 415 ? 22.488  -14.797 44.248  1.00 57.52  ? 439  GLN A CB  1 
ATOM   3125 C CG  . GLN A 1 415 ? 23.427  -14.053 45.239  1.00 57.52  ? 439  GLN A CG  1 
ATOM   3126 C CD  . GLN A 1 415 ? 23.627  -12.553 44.915  1.00 57.52  ? 439  GLN A CD  1 
ATOM   3127 O OE1 . GLN A 1 415 ? 23.368  -12.082 43.800  1.00 57.52  ? 439  GLN A OE1 1 
ATOM   3128 N NE2 . GLN A 1 415 ? 24.104  -11.810 45.898  1.00 57.52  ? 439  GLN A NE2 1 
ATOM   3129 N N   . PHE A 1 416 ? 21.609  -16.273 46.919  1.00 77.11  ? 440  PHE A N   1 
ATOM   3130 C CA  . PHE A 1 416 ? 21.675  -16.328 48.379  1.00 77.11  ? 440  PHE A CA  1 
ATOM   3131 C C   . PHE A 1 416 ? 22.795  -15.371 48.793  1.00 77.11  ? 440  PHE A C   1 
ATOM   3132 O O   . PHE A 1 416 ? 23.928  -15.506 48.317  1.00 77.11  ? 440  PHE A O   1 
ATOM   3133 C CB  . PHE A 1 416 ? 21.999  -17.747 48.840  1.00 193.69 ? 440  PHE A CB  1 
ATOM   3134 C CG  . PHE A 1 416 ? 20.811  -18.504 49.357  1.00 193.69 ? 440  PHE A CG  1 
ATOM   3135 C CD1 . PHE A 1 416 ? 20.764  -19.893 49.267  1.00 193.69 ? 440  PHE A CD1 1 
ATOM   3136 C CD2 . PHE A 1 416 ? 19.749  -17.833 49.961  1.00 193.69 ? 440  PHE A CD2 1 
ATOM   3137 C CE1 . PHE A 1 416 ? 19.675  -20.606 49.768  1.00 193.69 ? 440  PHE A CE1 1 
ATOM   3138 C CE2 . PHE A 1 416 ? 18.654  -18.534 50.467  1.00 193.69 ? 440  PHE A CE2 1 
ATOM   3139 C CZ  . PHE A 1 416 ? 18.617  -19.925 50.370  1.00 193.69 ? 440  PHE A CZ  1 
ATOM   3140 N N   . THR A 1 417 ? 22.476  -14.396 49.651  1.00 84.79  ? 441  THR A N   1 
ATOM   3141 C CA  . THR A 1 417 ? 23.448  -13.398 50.119  1.00 84.79  ? 441  THR A CA  1 
ATOM   3142 C C   . THR A 1 417 ? 24.803  -14.032 50.325  1.00 84.79  ? 441  THR A C   1 
ATOM   3143 O O   . THR A 1 417 ? 24.881  -15.165 50.799  1.00 84.79  ? 441  THR A O   1 
ATOM   3144 C CB  . THR A 1 417 ? 23.040  -12.777 51.452  1.00 231.96 ? 441  THR A CB  1 
ATOM   3145 O OG1 . THR A 1 417 ? 22.994  -13.802 52.450  1.00 231.96 ? 441  THR A OG1 1 
ATOM   3146 C CG2 . THR A 1 417 ? 21.683  -12.102 51.334  1.00 231.96 ? 441  THR A CG2 1 
ATOM   3147 N N   . ALA A 1 418 ? 25.866  -13.298 49.987  1.00 52.99  ? 442  ALA A N   1 
ATOM   3148 C CA  . ALA A 1 418 ? 27.213  -13.837 50.113  1.00 52.99  ? 442  ALA A CA  1 
ATOM   3149 C C   . ALA A 1 418 ? 27.282  -14.634 51.417  1.00 52.99  ? 442  ALA A C   1 
ATOM   3150 O O   . ALA A 1 418 ? 27.125  -14.082 52.520  1.00 52.99  ? 442  ALA A O   1 
ATOM   3151 C CB  . ALA A 1 418 ? 28.224  -12.724 50.077  1.00 71.09  ? 442  ALA A CB  1 
ATOM   3152 N N   . PRO A 1 419 ? 27.482  -15.965 51.284  1.00 356.21 ? 443  PRO A N   1 
ATOM   3153 C CA  . PRO A 1 419 ? 27.585  -17.017 52.307  1.00 356.21 ? 443  PRO A CA  1 
ATOM   3154 C C   . PRO A 1 419 ? 28.072  -16.521 53.651  1.00 356.21 ? 443  PRO A C   1 
ATOM   3155 O O   . PRO A 1 419 ? 28.133  -17.262 54.633  1.00 356.21 ? 443  PRO A O   1 
ATOM   3156 C CB  . PRO A 1 419 ? 28.526  -18.048 51.665  1.00 225.48 ? 443  PRO A CB  1 
ATOM   3157 C CG  . PRO A 1 419 ? 29.212  -17.285 50.555  1.00 225.48 ? 443  PRO A CG  1 
ATOM   3158 C CD  . PRO A 1 419 ? 28.090  -16.443 50.032  1.00 225.48 ? 443  PRO A CD  1 
ATOM   3159 N N   . PHE A 1 420 ? 28.414  -15.244 53.665  1.00 135.41 ? 444  PHE A N   1 
ATOM   3160 C CA  . PHE A 1 420 ? 28.875  -14.545 54.836  1.00 135.41 ? 444  PHE A CA  1 
ATOM   3161 C C   . PHE A 1 420 ? 27.699  -14.432 55.799  1.00 135.41 ? 444  PHE A C   1 
ATOM   3162 O O   . PHE A 1 420 ? 27.825  -13.898 56.908  1.00 135.41 ? 444  PHE A O   1 
ATOM   3163 C CB  . PHE A 1 420 ? 29.337  -13.178 54.395  1.00 72.05  ? 444  PHE A CB  1 
ATOM   3164 C CG  . PHE A 1 420 ? 30.407  -13.217 53.365  1.00 72.05  ? 444  PHE A CG  1 
ATOM   3165 C CD1 . PHE A 1 420 ? 30.484  -12.231 52.391  1.00 72.05  ? 444  PHE A CD1 1 
ATOM   3166 C CD2 . PHE A 1 420 ? 31.365  -14.212 53.387  1.00 72.05  ? 444  PHE A CD2 1 
ATOM   3167 C CE1 . PHE A 1 420 ? 31.506  -12.229 51.439  1.00 72.05  ? 444  PHE A CE1 1 
ATOM   3168 C CE2 . PHE A 1 420 ? 32.393  -14.226 52.447  1.00 72.05  ? 444  PHE A CE2 1 
ATOM   3169 C CZ  . PHE A 1 420 ? 32.465  -13.226 51.465  1.00 72.05  ? 444  PHE A CZ  1 
ATOM   3170 N N   . ASN A 1 421 ? 26.556  -14.940 55.346  1.00 140.03 ? 445  ASN A N   1 
ATOM   3171 C CA  . ASN A 1 421 ? 25.321  -14.947 56.122  1.00 140.03 ? 445  ASN A CA  1 
ATOM   3172 C C   . ASN A 1 421 ? 24.994  -16.348 56.644  1.00 140.03 ? 445  ASN A C   1 
ATOM   3173 O O   . ASN A 1 421 ? 24.963  -17.314 55.876  1.00 140.03 ? 445  ASN A O   1 
ATOM   3174 C CB  . ASN A 1 421 ? 24.171  -14.456 55.255  1.00 140.94 ? 445  ASN A CB  1 
ATOM   3175 C CG  . ASN A 1 421 ? 22.847  -15.056 55.663  1.00 140.94 ? 445  ASN A CG  1 
ATOM   3176 O OD1 . ASN A 1 421 ? 22.432  -14.945 56.813  1.00 140.94 ? 445  ASN A OD1 1 
ATOM   3177 N ND2 . ASN A 1 421 ? 22.175  -15.699 54.718  1.00 140.94 ? 445  ASN A ND2 1 
ATOM   3178 N N   . PRO A 1 422 ? 24.731  -16.471 57.960  1.00 265.49 ? 446  PRO A N   1 
ATOM   3179 C CA  . PRO A 1 422 ? 24.406  -17.759 58.584  1.00 265.49 ? 446  PRO A CA  1 
ATOM   3180 C C   . PRO A 1 422 ? 23.128  -18.428 58.066  1.00 265.49 ? 446  PRO A C   1 
ATOM   3181 O O   . PRO A 1 422 ? 23.190  -19.464 57.400  1.00 265.49 ? 446  PRO A O   1 
ATOM   3182 C CB  . PRO A 1 422 ? 24.327  -17.411 60.073  1.00 205.68 ? 446  PRO A CB  1 
ATOM   3183 C CG  . PRO A 1 422 ? 23.859  -15.987 60.063  1.00 205.68 ? 446  PRO A CG  1 
ATOM   3184 C CD  . PRO A 1 422 ? 24.698  -15.384 58.959  1.00 205.68 ? 446  PRO A CD  1 
ATOM   3185 N N   . ASN A 1 423 ? 21.975  -17.834 58.371  1.00 367.13 ? 447  ASN A N   1 
ATOM   3186 C CA  . ASN A 1 423 ? 20.691  -18.388 57.944  1.00 367.13 ? 447  ASN A CA  1 
ATOM   3187 C C   . ASN A 1 423 ? 20.469  -18.270 56.439  1.00 367.13 ? 447  ASN A C   1 
ATOM   3188 O O   . ASN A 1 423 ? 21.334  -17.797 55.705  1.00 367.13 ? 447  ASN A O   1 
ATOM   3189 C CB  . ASN A 1 423 ? 19.531  -17.708 58.698  1.00 178.70 ? 447  ASN A CB  1 
ATOM   3190 C CG  . ASN A 1 423 ? 19.323  -16.252 58.291  1.00 178.70 ? 447  ASN A CG  1 
ATOM   3191 O OD1 . ASN A 1 423 ? 18.940  -15.959 57.157  1.00 178.70 ? 447  ASN A OD1 1 
ATOM   3192 N ND2 . ASN A 1 423 ? 19.570  -15.336 59.225  1.00 178.70 ? 447  ASN A ND2 1 
ATOM   3193 N N   . LYS A 1 424 ? 19.307  -18.726 55.989  1.00 158.12 ? 448  LYS A N   1 
ATOM   3194 C CA  . LYS A 1 424 ? 18.937  -18.673 54.583  1.00 158.12 ? 448  LYS A CA  1 
ATOM   3195 C C   . LYS A 1 424 ? 17.446  -18.384 54.559  1.00 158.12 ? 448  LYS A C   1 
ATOM   3196 O O   . LYS A 1 424 ? 16.920  -17.814 53.600  1.00 158.12 ? 448  LYS A O   1 
ATOM   3197 C CB  . LYS A 1 424 ? 19.208  -20.017 53.902  1.00 304.96 ? 448  LYS A CB  1 
ATOM   3198 C CG  . LYS A 1 424 ? 20.671  -20.445 53.884  1.00 304.96 ? 448  LYS A CG  1 
ATOM   3199 C CD  . LYS A 1 424 ? 20.860  -21.718 53.059  1.00 304.96 ? 448  LYS A CD  1 
ATOM   3200 C CE  . LYS A 1 424 ? 22.331  -22.105 52.931  1.00 304.96 ? 448  LYS A CE  1 
ATOM   3201 N NZ  . LYS A 1 424 ? 22.530  -23.277 52.028  1.00 304.96 ? 448  LYS A NZ  1 
ATOM   3202 N N   . GLY A 1 425 ? 16.780  -18.787 55.641  1.00 222.00 ? 449  GLY A N   1 
ATOM   3203 C CA  . GLY A 1 425 ? 15.348  -18.595 55.774  1.00 222.00 ? 449  GLY A CA  1 
ATOM   3204 C C   . GLY A 1 425 ? 14.980  -17.287 56.443  1.00 222.00 ? 449  GLY A C   1 
ATOM   3205 O O   . GLY A 1 425 ? 14.614  -17.246 57.619  1.00 222.00 ? 449  GLY A O   1 
ATOM   3206 N N   . ALA A 1 426 ? 15.082  -16.211 55.674  1.00 290.64 ? 450  ALA A N   1 
ATOM   3207 C CA  . ALA A 1 426 ? 14.764  -14.870 56.141  1.00 290.64 ? 450  ALA A CA  1 
ATOM   3208 C C   . ALA A 1 426 ? 14.741  -13.994 54.897  1.00 290.64 ? 450  ALA A C   1 
ATOM   3209 O O   . ALA A 1 426 ? 14.931  -12.778 54.968  1.00 290.64 ? 450  ALA A O   1 
ATOM   3210 C CB  . ALA A 1 426 ? 15.832  -14.381 57.119  1.00 169.04 ? 450  ALA A CB  1 
ATOM   3211 N N   . ASP A 1 427 ? 14.506  -14.637 53.756  1.00 238.94 ? 451  ASP A N   1 
ATOM   3212 C CA  . ASP A 1 427 ? 14.468  -13.954 52.473  1.00 238.94 ? 451  ASP A CA  1 
ATOM   3213 C C   . ASP A 1 427 ? 15.791  -13.212 52.305  1.00 238.94 ? 451  ASP A C   1 
ATOM   3214 O O   . ASP A 1 427 ? 15.854  -12.140 51.701  1.00 238.94 ? 451  ASP A O   1 
ATOM   3215 C CB  . ASP A 1 427 ? 13.289  -12.978 52.427  1.00 278.72 ? 451  ASP A CB  1 
ATOM   3216 C CG  . ASP A 1 427 ? 12.940  -12.550 51.015  1.00 278.72 ? 451  ASP A CG  1 
ATOM   3217 O OD1 . ASP A 1 427 ? 13.774  -11.879 50.371  1.00 278.72 ? 451  ASP A OD1 1 
ATOM   3218 O OD2 . ASP A 1 427 ? 11.831  -12.890 50.548  1.00 278.72 ? 451  ASP A OD2 1 
ATOM   3219 N N   . SER A 1 428 ? 16.846  -13.800 52.864  1.00 107.60 ? 452  SER A N   1 
ATOM   3220 C CA  . SER A 1 428 ? 18.189  -13.237 52.792  1.00 107.60 ? 452  SER A CA  1 
ATOM   3221 C C   . SER A 1 428 ? 18.739  -13.566 51.425  1.00 107.60 ? 452  SER A C   1 
ATOM   3222 O O   . SER A 1 428 ? 19.771  -14.207 51.297  1.00 107.60 ? 452  SER A O   1 
ATOM   3223 C CB  . SER A 1 428 ? 19.095  -13.860 53.853  1.00 102.87 ? 452  SER A CB  1 
ATOM   3224 O OG  . SER A 1 428 ? 19.302  -15.244 53.596  1.00 102.87 ? 452  SER A OG  1 
ATOM   3225 N N   . ILE A 1 429 ? 18.012  -13.160 50.399  1.00 84.02  ? 453  ILE A N   1 
ATOM   3226 C CA  . ILE A 1 429 ? 18.450  -13.391 49.043  1.00 84.02  ? 453  ILE A CA  1 
ATOM   3227 C C   . ILE A 1 429 ? 18.388  -12.042 48.356  1.00 84.02  ? 453  ILE A C   1 
ATOM   3228 O O   . ILE A 1 429 ? 17.400  -11.314 48.480  1.00 84.02  ? 453  ILE A O   1 
ATOM   3229 C CB  . ILE A 1 429 ? 17.545  -14.414 48.301  1.00 80.53  ? 453  ILE A CB  1 
ATOM   3230 C CG1 . ILE A 1 429 ? 16.255  -13.758 47.820  1.00 80.53  ? 453  ILE A CG1 1 
ATOM   3231 C CG2 . ILE A 1 429 ? 17.224  -15.580 49.222  1.00 80.53  ? 453  ILE A CG2 1 
ATOM   3232 C CD1 . ILE A 1 429 ? 15.590  -14.535 46.697  1.00 80.53  ? 453  ILE A CD1 1 
ATOM   3233 N N   . VAL A 1 430 ? 19.452  -11.696 47.648  1.00 69.53  ? 454  VAL A N   1 
ATOM   3234 C CA  . VAL A 1 430 ? 19.484  -10.422 46.969  1.00 69.53  ? 454  VAL A CA  1 
ATOM   3235 C C   . VAL A 1 430 ? 18.771  -10.511 45.623  1.00 69.53  ? 454  VAL A C   1 
ATOM   3236 O O   . VAL A 1 430 ? 18.879  -11.507 44.912  1.00 69.53  ? 454  VAL A O   1 
ATOM   3237 C CB  . VAL A 1 430 ? 20.949  -9.957  46.792  1.00 53.51  ? 454  VAL A CB  1 
ATOM   3238 C CG1 . VAL A 1 430 ? 21.799  -10.564 47.894  1.00 53.51  ? 454  VAL A CG1 1 
ATOM   3239 C CG2 . VAL A 1 430 ? 21.491  -10.327 45.419  1.00 53.51  ? 454  VAL A CG2 1 
ATOM   3240 N N   . LYS A 1 431 ? 18.012  -9.478  45.296  1.00 62.61  ? 455  LYS A N   1 
ATOM   3241 C CA  . LYS A 1 431 ? 17.306  -9.424  44.030  1.00 62.61  ? 455  LYS A CA  1 
ATOM   3242 C C   . LYS A 1 431 ? 16.820  -7.989  43.902  1.00 62.61  ? 455  LYS A C   1 
ATOM   3243 O O   . LYS A 1 431 ? 17.060  -7.184  44.816  1.00 62.61  ? 455  LYS A O   1 
ATOM   3244 C CB  . LYS A 1 431 ? 16.139  -10.415 44.016  1.00 118.47 ? 455  LYS A CB  1 
ATOM   3245 C CG  . LYS A 1 431 ? 15.138  -10.269 45.148  1.00 118.47 ? 455  LYS A CG  1 
ATOM   3246 C CD  . LYS A 1 431 ? 13.989  -11.278 44.989  1.00 118.47 ? 455  LYS A CD  1 
ATOM   3247 C CE  . LYS A 1 431 ? 12.894  -11.081 46.042  1.00 118.47 ? 455  LYS A CE  1 
ATOM   3248 N NZ  . LYS A 1 431 ? 11.790  -12.088 45.939  1.00 118.47 ? 455  LYS A NZ  1 
ATOM   3249 N N   . PHE A 1 432 ? 16.165  -7.645  42.793  1.00 79.95  ? 456  PHE A N   1 
ATOM   3250 C CA  . PHE A 1 432 ? 15.674  -6.280  42.624  1.00 79.95  ? 456  PHE A CA  1 
ATOM   3251 C C   . PHE A 1 432 ? 14.228  -6.242  42.126  1.00 79.95  ? 456  PHE A C   1 
ATOM   3252 O O   . PHE A 1 432 ? 13.798  -7.147  41.404  1.00 79.95  ? 456  PHE A O   1 
ATOM   3253 C CB  . PHE A 1 432 ? 16.537  -5.512  41.624  1.00 47.68  ? 456  PHE A CB  1 
ATOM   3254 C CG  . PHE A 1 432 ? 18.027  -5.608  41.870  1.00 47.68  ? 456  PHE A CG  1 
ATOM   3255 C CD1 . PHE A 1 432 ? 18.786  -6.634  41.312  1.00 47.68  ? 456  PHE A CD1 1 
ATOM   3256 C CD2 . PHE A 1 432 ? 18.677  -4.657  42.638  1.00 47.68  ? 456  PHE A CD2 1 
ATOM   3257 C CE1 . PHE A 1 432 ? 20.148  -6.700  41.515  1.00 47.68  ? 456  PHE A CE1 1 
ATOM   3258 C CE2 . PHE A 1 432 ? 20.049  -4.724  42.842  1.00 47.68  ? 456  PHE A CE2 1 
ATOM   3259 C CZ  . PHE A 1 432 ? 20.772  -5.745  42.281  1.00 47.68  ? 456  PHE A CZ  1 
ATOM   3260 N N   . ASP A 1 433 ? 13.492  -5.190  42.506  1.00 81.07  ? 457  ASP A N   1 
ATOM   3261 C CA  . ASP A 1 433 ? 12.099  -4.992  42.085  1.00 81.07  ? 457  ASP A CA  1 
ATOM   3262 C C   . ASP A 1 433 ? 12.051  -4.616  40.625  1.00 81.07  ? 457  ASP A C   1 
ATOM   3263 O O   . ASP A 1 433 ? 13.070  -4.622  39.935  1.00 81.07  ? 457  ASP A O   1 
ATOM   3264 C CB  . ASP A 1 433 ? 11.425  -3.860  42.858  1.00 123.65 ? 457  ASP A CB  1 
ATOM   3265 C CG  . ASP A 1 433 ? 11.216  -4.191  44.313  1.00 123.65 ? 457  ASP A CG  1 
ATOM   3266 O OD1 . ASP A 1 433 ? 11.219  -5.397  44.662  1.00 123.65 ? 457  ASP A OD1 1 
ATOM   3267 O OD2 . ASP A 1 433 ? 11.031  -3.240  45.107  1.00 123.65 ? 457  ASP A OD2 1 
ATOM   3268 N N   . THR A 1 434 ? 10.854  -4.288  40.154  1.00 135.07 ? 458  THR A N   1 
ATOM   3269 C CA  . THR A 1 434 ? 10.675  -3.883  38.768  1.00 135.07 ? 458  THR A CA  1 
ATOM   3270 C C   . THR A 1 434 ? 11.240  -2.486  38.647  1.00 135.07 ? 458  THR A C   1 
ATOM   3271 O O   . THR A 1 434 ? 11.264  -1.910  37.557  1.00 135.07 ? 458  THR A O   1 
ATOM   3272 C CB  . THR A 1 434 ? 9.189   -3.858  38.373  1.00 113.43 ? 458  THR A CB  1 
ATOM   3273 O OG1 . THR A 1 434 ? 8.399   -3.510  39.517  1.00 113.43 ? 458  THR A OG1 1 
ATOM   3274 C CG2 . THR A 1 434 ? 8.756   -5.212  37.841  1.00 113.43 ? 458  THR A CG2 1 
ATOM   3275 N N   . PHE A 1 435 ? 11.693  -1.954  39.785  1.00 96.79  ? 459  PHE A N   1 
ATOM   3276 C CA  . PHE A 1 435 ? 12.268  -0.616  39.847  1.00 96.79  ? 459  PHE A CA  1 
ATOM   3277 C C   . PHE A 1 435 ? 13.766  -0.652  40.138  1.00 96.79  ? 459  PHE A C   1 
ATOM   3278 O O   . PHE A 1 435 ? 14.449  0.364   40.062  1.00 96.79  ? 459  PHE A O   1 
ATOM   3279 C CB  . PHE A 1 435 ? 11.581  0.211   40.929  1.00 117.47 ? 459  PHE A CB  1 
ATOM   3280 C CG  . PHE A 1 435 ? 10.087  0.185   40.859  1.00 117.47 ? 459  PHE A CG  1 
ATOM   3281 C CD1 . PHE A 1 435 ? 9.359   -0.741  41.599  1.00 117.47 ? 459  PHE A CD1 1 
ATOM   3282 C CD2 . PHE A 1 435 ? 9.400   1.109   40.074  1.00 117.47 ? 459  PHE A CD2 1 
ATOM   3283 C CE1 . PHE A 1 435 ? 7.967   -0.742  41.563  1.00 117.47 ? 459  PHE A CE1 1 
ATOM   3284 C CE2 . PHE A 1 435 ? 8.003   1.116   40.031  1.00 117.47 ? 459  PHE A CE2 1 
ATOM   3285 C CZ  . PHE A 1 435 ? 7.287   0.190   40.778  1.00 117.47 ? 459  PHE A CZ  1 
ATOM   3286 N N   . GLY A 1 436 ? 14.276  -1.823  40.484  1.00 78.93  ? 460  GLY A N   1 
ATOM   3287 C CA  . GLY A 1 436 ? 15.689  -1.927  40.780  1.00 78.93  ? 460  GLY A CA  1 
ATOM   3288 C C   . GLY A 1 436 ? 16.004  -1.589  42.220  1.00 78.93  ? 460  GLY A C   1 
ATOM   3289 O O   . GLY A 1 436 ? 17.155  -1.352  42.561  1.00 78.93  ? 460  GLY A O   1 
ATOM   3290 N N   . ASP A 1 437 ? 14.987  -1.540  43.070  1.00 66.51  ? 461  ASP A N   1 
ATOM   3291 C CA  . ASP A 1 437 ? 15.215  -1.245  44.467  1.00 66.51  ? 461  ASP A CA  1 
ATOM   3292 C C   . ASP A 1 437 ? 15.137  -2.519  45.298  1.00 66.51  ? 461  ASP A C   1 
ATOM   3293 O O   . ASP A 1 437 ? 15.035  -3.623  44.742  1.00 66.51  ? 461  ASP A O   1 
ATOM   3294 C CB  . ASP A 1 437 ? 14.242  -0.180  44.970  1.00 125.99 ? 461  ASP A CB  1 
ATOM   3295 C CG  . ASP A 1 437 ? 12.934  -0.199  44.240  1.00 125.99 ? 461  ASP A CG  1 
ATOM   3296 O OD1 . ASP A 1 437 ? 12.171  0.780   44.396  1.00 125.99 ? 461  ASP A OD1 1 
ATOM   3297 O OD2 . ASP A 1 437 ? 12.661  -1.184  43.516  1.00 125.99 ? 461  ASP A OD2 1 
ATOM   3298 N N   . GLY A 1 438 ? 15.211  -2.375  46.620  1.00 85.62  ? 462  GLY A N   1 
ATOM   3299 C CA  . GLY A 1 438 ? 15.194  -3.541  47.477  1.00 85.62  ? 462  GLY A CA  1 
ATOM   3300 C C   . GLY A 1 438 ? 13.972  -3.669  48.343  1.00 85.62  ? 462  GLY A C   1 
ATOM   3301 O O   . GLY A 1 438 ? 13.000  -2.938  48.173  1.00 85.62  ? 462  GLY A O   1 
ATOM   3302 N N   . MET A 1 439 ? 14.037  -4.606  49.285  1.00 79.43  ? 463  MET A N   1 
ATOM   3303 C CA  . MET A 1 439 ? 12.937  -4.877  50.213  1.00 79.43  ? 463  MET A CA  1 
ATOM   3304 C C   . MET A 1 439 ? 12.838  -3.865  51.357  1.00 79.43  ? 463  MET A C   1 
ATOM   3305 O O   . MET A 1 439 ? 13.806  -3.625  52.082  1.00 79.43  ? 463  MET A O   1 
ATOM   3306 C CB  . MET A 1 439 ? 13.095  -6.287  50.795  1.00 198.68 ? 463  MET A CB  1 
ATOM   3307 C CG  . MET A 1 439 ? 13.092  -7.407  49.765  1.00 198.68 ? 463  MET A CG  1 
ATOM   3308 S SD  . MET A 1 439 ? 11.543  -7.498  48.847  1.00 198.68 ? 463  MET A SD  1 
ATOM   3309 C CE  . MET A 1 439 ? 10.621  -8.677  49.844  1.00 198.68 ? 463  MET A CE  1 
ATOM   3310 N N   . GLY A 1 440 ? 11.660  -3.282  51.521  1.00 73.20  ? 464  GLY A N   1 
ATOM   3311 C CA  . GLY A 1 440 ? 11.476  -2.322  52.590  1.00 73.20  ? 464  GLY A CA  1 
ATOM   3312 C C   . GLY A 1 440 ? 11.349  -2.901  54.000  1.00 73.20  ? 464  GLY A C   1 
ATOM   3313 O O   . GLY A 1 440 ? 10.246  -2.976  54.549  1.00 73.20  ? 464  GLY A O   1 
ATOM   3314 N N   . ARG A 1 441 ? 12.464  -3.314  54.593  1.00 70.18  ? 465  ARG A N   1 
ATOM   3315 C CA  . ARG A 1 441 ? 12.445  -3.846  55.941  1.00 70.18  ? 465  ARG A CA  1 
ATOM   3316 C C   . ARG A 1 441 ? 13.233  -2.890  56.832  1.00 70.18  ? 465  ARG A C   1 
ATOM   3317 O O   . ARG A 1 441 ? 14.425  -2.736  56.639  1.00 70.18  ? 465  ARG A O   1 
ATOM   3318 C CB  . ARG A 1 441 ? 13.108  -5.218  55.966  1.00 166.37 ? 465  ARG A CB  1 
ATOM   3319 C CG  . ARG A 1 441 ? 12.323  -6.320  55.287  1.00 166.37 ? 465  ARG A CG  1 
ATOM   3320 C CD  . ARG A 1 441 ? 11.017  -6.591  56.016  1.00 166.37 ? 465  ARG A CD  1 
ATOM   3321 N NE  . ARG A 1 441 ? 10.431  -7.878  55.647  1.00 166.37 ? 465  ARG A NE  1 
ATOM   3322 C CZ  . ARG A 1 441 ? 10.990  -9.056  55.908  1.00 166.37 ? 465  ARG A CZ  1 
ATOM   3323 N NH1 . ARG A 1 441 ? 12.155  -9.117  56.542  1.00 166.37 ? 465  ARG A NH1 1 
ATOM   3324 N NH2 . ARG A 1 441 ? 10.379  -10.174 55.540  1.00 166.37 ? 465  ARG A NH2 1 
ATOM   3325 N N   . TYR A 1 442 ? 12.596  -2.251  57.806  1.00 70.61  ? 466  TYR A N   1 
ATOM   3326 C CA  . TYR A 1 442 ? 13.312  -1.330  58.678  1.00 70.61  ? 466  TYR A CA  1 
ATOM   3327 C C   . TYR A 1 442 ? 13.242  -1.711  60.139  1.00 70.61  ? 466  TYR A C   1 
ATOM   3328 O O   . TYR A 1 442 ? 12.283  -2.338  60.571  1.00 70.61  ? 466  TYR A O   1 
ATOM   3329 C CB  . TYR A 1 442 ? 12.750  0.059   58.534  1.00 70.36  ? 466  TYR A CB  1 
ATOM   3330 C CG  . TYR A 1 442 ? 12.680  0.513   57.113  1.00 70.36  ? 466  TYR A CG  1 
ATOM   3331 C CD1 . TYR A 1 442 ? 11.696  0.039   56.252  1.00 70.36  ? 466  TYR A CD1 1 
ATOM   3332 C CD2 . TYR A 1 442 ? 13.589  1.435   56.622  1.00 70.36  ? 466  TYR A CD2 1 
ATOM   3333 C CE1 . TYR A 1 442 ? 11.621  0.485   54.929  1.00 70.36  ? 466  TYR A CE1 1 
ATOM   3334 C CE2 . TYR A 1 442 ? 13.524  1.884   55.310  1.00 70.36  ? 466  TYR A CE2 1 
ATOM   3335 C CZ  . TYR A 1 442 ? 12.545  1.411   54.475  1.00 70.36  ? 466  TYR A CZ  1 
ATOM   3336 O OH  . TYR A 1 442 ? 12.508  1.892   53.198  1.00 70.36  ? 466  TYR A OH  1 
ATOM   3337 N N   . ASN A 1 443 ? 14.260  -1.323  60.903  1.00 63.71  ? 467  ASN A N   1 
ATOM   3338 C CA  . ASN A 1 443 ? 14.304  -1.599  62.334  1.00 63.71  ? 467  ASN A CA  1 
ATOM   3339 C C   . ASN A 1 443 ? 14.080  -0.323  63.119  1.00 63.71  ? 467  ASN A C   1 
ATOM   3340 O O   . ASN A 1 443 ? 14.663  0.717   62.805  1.00 63.71  ? 467  ASN A O   1 
ATOM   3341 C CB  . ASN A 1 443 ? 15.642  -2.182  62.740  1.00 81.85  ? 467  ASN A CB  1 
ATOM   3342 C CG  . ASN A 1 443 ? 15.797  -3.588  62.304  1.00 81.85  ? 467  ASN A CG  1 
ATOM   3343 O OD1 . ASN A 1 443 ? 14.845  -4.363  62.370  1.00 81.85  ? 467  ASN A OD1 1 
ATOM   3344 N ND2 . ASN A 1 443 ? 16.999  -3.953  61.864  1.00 81.85  ? 467  ASN A ND2 1 
ATOM   3345 N N   . VAL A 1 444 ? 13.242  -0.404  64.147  1.00 55.27  ? 468  VAL A N   1 
ATOM   3346 C CA  . VAL A 1 444 ? 12.944  0.752   64.980  1.00 55.27  ? 468  VAL A CA  1 
ATOM   3347 C C   . VAL A 1 444 ? 13.884  0.784   66.179  1.00 55.27  ? 468  VAL A C   1 
ATOM   3348 O O   . VAL A 1 444 ? 14.078  -0.224  66.855  1.00 55.27  ? 468  VAL A O   1 
ATOM   3349 C CB  . VAL A 1 444 ? 11.507  0.700   65.458  1.00 72.30  ? 468  VAL A CB  1 
ATOM   3350 C CG1 . VAL A 1 444 ? 11.140  2.009   66.105  1.00 72.30  ? 468  VAL A CG1 1 
ATOM   3351 C CG2 . VAL A 1 444 ? 10.601  0.391   64.291  1.00 72.30  ? 468  VAL A CG2 1 
ATOM   3352 N N   . PHE A 1 445 ? 14.471  1.946   66.437  1.00 87.58  ? 469  PHE A N   1 
ATOM   3353 C CA  . PHE A 1 445 ? 15.415  2.075   67.529  1.00 87.58  ? 469  PHE A CA  1 
ATOM   3354 C C   . PHE A 1 445 ? 15.076  3.119   68.557  1.00 87.58  ? 469  PHE A C   1 
ATOM   3355 O O   . PHE A 1 445 ? 14.391  4.108   68.261  1.00 87.58  ? 469  PHE A O   1 
ATOM   3356 C CB  . PHE A 1 445 ? 16.795  2.376   66.977  1.00 84.66  ? 469  PHE A CB  1 
ATOM   3357 C CG  . PHE A 1 445 ? 17.474  1.188   66.429  1.00 84.66  ? 469  PHE A CG  1 
ATOM   3358 C CD1 . PHE A 1 445 ? 16.827  0.360   65.526  1.00 84.66  ? 469  PHE A CD1 1 
ATOM   3359 C CD2 . PHE A 1 445 ? 18.751  0.865   66.833  1.00 84.66  ? 469  PHE A CD2 1 
ATOM   3360 C CE1 . PHE A 1 445 ? 17.441  -0.779  65.033  1.00 84.66  ? 469  PHE A CE1 1 
ATOM   3361 C CE2 . PHE A 1 445 ? 19.379  -0.280  66.343  1.00 84.66  ? 469  PHE A CE2 1 
ATOM   3362 C CZ  . PHE A 1 445 ? 18.717  -1.102  65.441  1.00 84.66  ? 469  PHE A CZ  1 
ATOM   3363 N N   . ASN A 1 446 ? 15.594  2.885   69.767  1.00 79.50  ? 470  ASN A N   1 
ATOM   3364 C CA  . ASN A 1 446 ? 15.410  3.768   70.920  1.00 79.50  ? 470  ASN A CA  1 
ATOM   3365 C C   . ASN A 1 446 ? 16.795  4.089   71.467  1.00 79.50  ? 470  ASN A C   1 
ATOM   3366 O O   . ASN A 1 446 ? 17.563  3.179   71.768  1.00 79.50  ? 470  ASN A O   1 
ATOM   3367 C CB  . ASN A 1 446 ? 14.577  3.058   71.999  1.00 110.76 ? 470  ASN A CB  1 
ATOM   3368 C CG  . ASN A 1 446 ? 14.332  3.922   73.224  1.00 110.76 ? 470  ASN A CG  1 
ATOM   3369 O OD1 . ASN A 1 446 ? 13.993  3.419   74.299  1.00 110.76 ? 470  ASN A OD1 1 
ATOM   3370 N ND2 . ASN A 1 446 ? 14.488  5.225   73.064  1.00 110.76 ? 470  ASN A ND2 1 
ATOM   3371 N N   . LEU A 1 447 ? 17.120  5.375   71.576  1.00 116.17 ? 471  LEU A N   1 
ATOM   3372 C CA  . LEU A 1 447 ? 18.420  5.784   72.102  1.00 116.17 ? 471  LEU A CA  1 
ATOM   3373 C C   . LEU A 1 447 ? 18.367  5.883   73.615  1.00 116.17 ? 471  LEU A C   1 
ATOM   3374 O O   . LEU A 1 447 ? 17.760  6.804   74.155  1.00 116.17 ? 471  LEU A O   1 
ATOM   3375 C CB  . LEU A 1 447 ? 18.839  7.143   71.544  1.00 128.13 ? 471  LEU A CB  1 
ATOM   3376 C CG  . LEU A 1 447 ? 20.114  7.684   72.196  1.00 128.13 ? 471  LEU A CG  1 
ATOM   3377 C CD1 . LEU A 1 447 ? 21.232  6.657   72.096  1.00 128.13 ? 471  LEU A CD1 1 
ATOM   3378 C CD2 . LEU A 1 447 ? 20.512  8.978   71.521  1.00 128.13 ? 471  LEU A CD2 1 
ATOM   3379 N N   . GLN A 1 448 ? 19.014  4.944   74.295  1.00 130.46 ? 472  GLN A N   1 
ATOM   3380 C CA  . GLN A 1 448 ? 19.012  4.942   75.749  1.00 130.46 ? 472  GLN A CA  1 
ATOM   3381 C C   . GLN A 1 448 ? 20.363  4.689   76.413  1.00 130.46 ? 472  GLN A C   1 
ATOM   3382 O O   . GLN A 1 448 ? 21.280  4.121   75.820  1.00 130.46 ? 472  GLN A O   1 
ATOM   3383 C CB  . GLN A 1 448 ? 17.993  3.930   76.266  1.00 111.47 ? 472  GLN A CB  1 
ATOM   3384 C CG  . GLN A 1 448 ? 17.995  2.612   75.536  1.00 111.47 ? 472  GLN A CG  1 
ATOM   3385 C CD  . GLN A 1 448 ? 17.171  1.571   76.255  1.00 111.47 ? 472  GLN A CD  1 
ATOM   3386 O OE1 . GLN A 1 448 ? 17.627  0.971   77.230  1.00 111.47 ? 472  GLN A OE1 1 
ATOM   3387 N NE2 . GLN A 1 448 ? 15.941  1.364   75.793  1.00 111.47 ? 472  GLN A NE2 1 
ATOM   3388 N N   . GLN A 1 449 ? 20.464  5.127   77.664  1.00 169.54 ? 473  GLN A N   1 
ATOM   3389 C CA  . GLN A 1 449 ? 21.671  4.981   78.470  1.00 169.54 ? 473  GLN A CA  1 
ATOM   3390 C C   . GLN A 1 449 ? 21.274  4.387   79.819  1.00 169.54 ? 473  GLN A C   1 
ATOM   3391 O O   . GLN A 1 449 ? 20.318  4.845   80.449  1.00 169.54 ? 473  GLN A O   1 
ATOM   3392 C CB  . GLN A 1 449 ? 22.334  6.352   78.659  1.00 236.18 ? 473  GLN A CB  1 
ATOM   3393 C CG  . GLN A 1 449 ? 23.464  6.398   79.681  1.00 236.18 ? 473  GLN A CG  1 
ATOM   3394 C CD  . GLN A 1 449 ? 22.966  6.420   81.116  1.00 236.18 ? 473  GLN A CD  1 
ATOM   3395 O OE1 . GLN A 1 449 ? 22.210  7.309   81.511  1.00 236.18 ? 473  GLN A OE1 1 
ATOM   3396 N NE2 . GLN A 1 449 ? 23.392  5.443   81.905  1.00 236.18 ? 473  GLN A NE2 1 
ATOM   3397 N N   . THR A 1 450 ? 21.998  3.360   80.253  1.00 185.64 ? 474  THR A N   1 
ATOM   3398 C CA  . THR A 1 450 ? 21.701  2.716   81.528  1.00 185.64 ? 474  THR A CA  1 
ATOM   3399 C C   . THR A 1 450 ? 22.880  2.785   82.495  1.00 185.64 ? 474  THR A C   1 
ATOM   3400 O O   . THR A 1 450 ? 22.699  3.032   83.689  1.00 185.64 ? 474  THR A O   1 
ATOM   3401 C CB  . THR A 1 450 ? 21.296  1.230   81.331  1.00 169.85 ? 474  THR A CB  1 
ATOM   3402 O OG1 . THR A 1 450 ? 22.251  0.580   80.483  1.00 169.85 ? 474  THR A OG1 1 
ATOM   3403 C CG2 . THR A 1 450 ? 19.901  1.126   80.714  1.00 169.85 ? 474  THR A CG2 1 
ATOM   3404 N N   . GLY A 1 451 ? 24.087  2.578   81.974  1.00 213.08 ? 475  GLY A N   1 
ATOM   3405 C CA  . GLY A 1 451 ? 25.265  2.618   82.820  1.00 213.08 ? 475  GLY A CA  1 
ATOM   3406 C C   . GLY A 1 451 ? 26.282  3.666   82.409  1.00 213.08 ? 475  GLY A C   1 
ATOM   3407 O O   . GLY A 1 451 ? 27.377  3.329   81.961  1.00 213.08 ? 475  GLY A O   1 
ATOM   3408 N N   . GLY A 1 452 ? 25.923  4.937   82.561  1.00 151.98 ? 476  GLY A N   1 
ATOM   3409 C CA  . GLY A 1 452 ? 26.829  6.013   82.203  1.00 151.98 ? 476  GLY A CA  1 
ATOM   3410 C C   . GLY A 1 452 ? 27.231  6.017   80.740  1.00 151.98 ? 476  GLY A C   1 
ATOM   3411 O O   . GLY A 1 452 ? 27.989  6.892   80.310  1.00 151.98 ? 476  GLY A O   1 
ATOM   3412 N N   . LYS A 1 453 ? 26.729  5.046   79.976  1.00 153.70 ? 477  LYS A N   1 
ATOM   3413 C CA  . LYS A 1 453 ? 27.047  4.945   78.552  1.00 153.70 ? 477  LYS A CA  1 
ATOM   3414 C C   . LYS A 1 453 ? 25.803  4.881   77.668  1.00 153.70 ? 477  LYS A C   1 
ATOM   3415 O O   . LYS A 1 453 ? 24.860  4.137   77.952  1.00 153.70 ? 477  LYS A O   1 
ATOM   3416 C CB  . LYS A 1 453 ? 27.926  3.722   78.280  1.00 206.15 ? 477  LYS A CB  1 
ATOM   3417 C CG  . LYS A 1 453 ? 28.378  3.623   76.831  1.00 206.15 ? 477  LYS A CG  1 
ATOM   3418 C CD  . LYS A 1 453 ? 29.304  2.443   76.596  1.00 206.15 ? 477  LYS A CD  1 
ATOM   3419 C CE  . LYS A 1 453 ? 29.784  2.404   75.148  1.00 206.15 ? 477  LYS A CE  1 
ATOM   3420 N NZ  . LYS A 1 453 ? 30.713  1.265   74.881  1.00 206.15 ? 477  LYS A NZ  1 
ATOM   3421 N N   . TYR A 1 454 ? 25.829  5.665   76.589  1.00 92.11  ? 478  TYR A N   1 
ATOM   3422 C CA  . TYR A 1 454 ? 24.736  5.767   75.615  1.00 92.11  ? 478  TYR A CA  1 
ATOM   3423 C C   . TYR A 1 454 ? 24.825  4.689   74.530  1.00 92.11  ? 478  TYR A C   1 
ATOM   3424 O O   . TYR A 1 454 ? 25.888  4.457   73.949  1.00 92.11  ? 478  TYR A O   1 
ATOM   3425 C CB  . TYR A 1 454 ? 24.766  7.156   74.969  1.00 215.30 ? 478  TYR A CB  1 
ATOM   3426 C CG  . TYR A 1 454 ? 26.066  7.474   74.246  1.00 215.30 ? 478  TYR A CG  1 
ATOM   3427 C CD1 . TYR A 1 454 ? 26.198  7.265   72.870  1.00 215.30 ? 478  TYR A CD1 1 
ATOM   3428 C CD2 . TYR A 1 454 ? 27.162  7.993   74.936  1.00 215.30 ? 478  TYR A CD2 1 
ATOM   3429 C CE1 . TYR A 1 454 ? 27.388  7.572   72.202  1.00 215.30 ? 478  TYR A CE1 1 
ATOM   3430 C CE2 . TYR A 1 454 ? 28.354  8.303   74.278  1.00 215.30 ? 478  TYR A CE2 1 
ATOM   3431 C CZ  . TYR A 1 454 ? 28.459  8.093   72.912  1.00 215.30 ? 478  TYR A CZ  1 
ATOM   3432 O OH  . TYR A 1 454 ? 29.625  8.423   72.259  1.00 215.30 ? 478  TYR A OH  1 
ATOM   3433 N N   . SER A 1 455 ? 23.700  4.038   74.259  1.00 106.82 ? 479  SER A N   1 
ATOM   3434 C CA  . SER A 1 455 ? 23.648  2.987   73.249  1.00 106.82 ? 479  SER A CA  1 
ATOM   3435 C C   . SER A 1 455 ? 22.293  2.948   72.545  1.00 106.82 ? 479  SER A C   1 
ATOM   3436 O O   . SER A 1 455 ? 21.334  3.571   72.989  1.00 106.82 ? 479  SER A O   1 
ATOM   3437 C CB  . SER A 1 455 ? 23.951  1.628   73.901  1.00 145.75 ? 479  SER A CB  1 
ATOM   3438 O OG  . SER A 1 455 ? 23.240  1.451   75.118  1.00 145.75 ? 479  SER A OG  1 
ATOM   3439 N N   . TYR A 1 456 ? 22.216  2.235   71.432  1.00 91.73  ? 480  TYR A N   1 
ATOM   3440 C CA  . TYR A 1 456 ? 20.955  2.138   70.718  1.00 91.73  ? 480  TYR A CA  1 
ATOM   3441 C C   . TYR A 1 456 ? 20.343  0.760   70.927  1.00 91.73  ? 480  TYR A C   1 
ATOM   3442 O O   . TYR A 1 456 ? 21.000  -0.255  70.677  1.00 91.73  ? 480  TYR A O   1 
ATOM   3443 C CB  . TYR A 1 456 ? 21.157  2.352   69.218  1.00 71.40  ? 480  TYR A CB  1 
ATOM   3444 C CG  . TYR A 1 456 ? 21.453  3.764   68.806  1.00 71.40  ? 480  TYR A CG  1 
ATOM   3445 C CD1 . TYR A 1 456 ? 22.657  4.354   69.118  1.00 71.40  ? 480  TYR A CD1 1 
ATOM   3446 C CD2 . TYR A 1 456 ? 20.524  4.507   68.094  1.00 71.40  ? 480  TYR A CD2 1 
ATOM   3447 C CE1 . TYR A 1 456 ? 22.935  5.650   68.734  1.00 71.40  ? 480  TYR A CE1 1 
ATOM   3448 C CE2 . TYR A 1 456 ? 20.791  5.809   67.706  1.00 71.40  ? 480  TYR A CE2 1 
ATOM   3449 C CZ  . TYR A 1 456 ? 22.001  6.371   68.031  1.00 71.40  ? 480  TYR A CZ  1 
ATOM   3450 O OH  . TYR A 1 456 ? 22.287  7.660   67.663  1.00 71.40  ? 480  TYR A OH  1 
ATOM   3451 N N   . LEU A 1 457 ? 19.088  0.711   71.369  1.00 88.02  ? 481  LEU A N   1 
ATOM   3452 C CA  . LEU A 1 457 ? 18.425  -0.577  71.569  1.00 88.02  ? 481  LEU A CA  1 
ATOM   3453 C C   . LEU A 1 457 ? 17.326  -0.838  70.541  1.00 88.02  ? 481  LEU A C   1 
ATOM   3454 O O   . LEU A 1 457 ? 16.430  -0.012  70.333  1.00 88.02  ? 481  LEU A O   1 
ATOM   3455 C CB  . LEU A 1 457 ? 17.820  -0.679  72.966  1.00 123.69 ? 481  LEU A CB  1 
ATOM   3456 C CG  . LEU A 1 457 ? 17.118  -2.024  73.179  1.00 123.69 ? 481  LEU A CG  1 
ATOM   3457 C CD1 . LEU A 1 457 ? 18.153  -3.147  73.140  1.00 123.69 ? 481  LEU A CD1 1 
ATOM   3458 C CD2 . LEU A 1 457 ? 16.371  -2.023  74.501  1.00 123.69 ? 481  LEU A CD2 1 
ATOM   3459 N N   . LYS A 1 458 ? 17.406  -1.990  69.887  1.00 105.42 ? 482  LYS A N   1 
ATOM   3460 C CA  . LYS A 1 458 ? 16.402  -2.339  68.909  1.00 105.42 ? 482  LYS A CA  1 
ATOM   3461 C C   . LYS A 1 458 ? 15.118  -2.555  69.666  1.00 105.42 ? 482  LYS A C   1 
ATOM   3462 O O   . LYS A 1 458 ? 15.085  -3.335  70.614  1.00 105.42 ? 482  LYS A O   1 
ATOM   3463 C CB  . LYS A 1 458 ? 16.772  -3.627  68.178  1.00 120.49 ? 482  LYS A CB  1 
ATOM   3464 C CG  . LYS A 1 458 ? 15.617  -4.193  67.356  1.00 120.49 ? 482  LYS A CG  1 
ATOM   3465 C CD  . LYS A 1 458 ? 16.045  -5.323  66.432  1.00 120.49 ? 482  LYS A CD  1 
ATOM   3466 C CE  . LYS A 1 458 ? 14.874  -5.783  65.565  1.00 120.49 ? 482  LYS A CE  1 
ATOM   3467 N NZ  . LYS A 1 458 ? 15.267  -6.856  64.606  1.00 120.49 ? 482  LYS A NZ  1 
ATOM   3468 N N   . VAL A 1 459 ? 14.063  -1.862  69.263  1.00 75.96  ? 483  VAL A N   1 
ATOM   3469 C CA  . VAL A 1 459 ? 12.780  -2.027  69.929  1.00 75.96  ? 483  VAL A CA  1 
ATOM   3470 C C   . VAL A 1 459 ? 11.640  -2.120  68.928  1.00 75.96  ? 483  VAL A C   1 
ATOM   3471 O O   . VAL A 1 459 ? 10.739  -1.291  68.928  1.00 75.96  ? 483  VAL A O   1 
ATOM   3472 C CB  . VAL A 1 459 ? 12.489  -0.865  70.930  1.00 62.22  ? 483  VAL A CB  1 
ATOM   3473 C CG1 . VAL A 1 459 ? 13.471  -0.933  72.114  1.00 62.22  ? 483  VAL A CG1 1 
ATOM   3474 C CG2 . VAL A 1 459 ? 12.563  0.498   70.226  1.00 62.22  ? 483  VAL A CG2 1 
ATOM   3475 N N   . GLY A 1 460 ? 11.681  -3.140  68.079  1.00 111.83 ? 484  GLY A N   1 
ATOM   3476 C CA  . GLY A 1 460 ? 10.637  -3.310  67.083  1.00 111.83 ? 484  GLY A CA  1 
ATOM   3477 C C   . GLY A 1 460 ? 11.135  -3.021  65.684  1.00 111.83 ? 484  GLY A C   1 
ATOM   3478 O O   . GLY A 1 460 ? 12.250  -2.542  65.505  1.00 111.83 ? 484  GLY A O   1 
ATOM   3479 N N   . HIS A 1 461 ? 10.301  -3.286  64.689  1.00 63.69  ? 485  HIS A N   1 
ATOM   3480 C CA  . HIS A 1 461 ? 10.695  -3.075  63.301  1.00 63.69  ? 485  HIS A CA  1 
ATOM   3481 C C   . HIS A 1 461 ? 9.465   -2.826  62.454  1.00 63.69  ? 485  HIS A C   1 
ATOM   3482 O O   . HIS A 1 461 ? 8.332   -2.799  62.939  1.00 63.69  ? 485  HIS A O   1 
ATOM   3483 C CB  . HIS A 1 461 ? 11.289  -4.339  62.756  1.00 146.61 ? 485  HIS A CB  1 
ATOM   3484 C CG  . HIS A 1 461 ? 10.272  -5.436  62.677  1.00 146.61 ? 485  HIS A CG  1 
ATOM   3485 N ND1 . HIS A 1 461 ? 9.887   -6.178  63.785  1.00 146.61 ? 485  HIS A ND1 1 
ATOM   3486 C CD2 . HIS A 1 461 ? 9.448   -5.821  61.662  1.00 146.61 ? 485  HIS A CD2 1 
ATOM   3487 C CE1 . HIS A 1 461 ? 8.872   -6.970  63.455  1.00 146.61 ? 485  HIS A CE1 1 
ATOM   3488 N NE2 . HIS A 1 461 ? 8.583   -6.771  62.174  1.00 146.61 ? 485  HIS A NE2 1 
ATOM   3489 N N   . TRP A 1 462 ? 9.687   -2.736  61.154  1.00 65.19  ? 486  TRP A N   1 
ATOM   3490 C CA  . TRP A 1 462 ? 8.581   -2.512  60.261  1.00 65.19  ? 486  TRP A CA  1 
ATOM   3491 C C   . TRP A 1 462 ? 8.671   -3.371  58.983  1.00 65.19  ? 486  TRP A C   1 
ATOM   3492 O O   . TRP A 1 462 ? 9.570   -3.224  58.167  1.00 65.19  ? 486  TRP A O   1 
ATOM   3493 C CB  . TRP A 1 462 ? 8.521   -1.049  59.943  1.00 63.11  ? 486  TRP A CB  1 
ATOM   3494 C CG  . TRP A 1 462 ? 7.371   -0.721  59.182  1.00 63.11  ? 486  TRP A CG  1 
ATOM   3495 C CD1 . TRP A 1 462 ? 6.241   -0.144  59.637  1.00 63.11  ? 486  TRP A CD1 1 
ATOM   3496 C CD2 . TRP A 1 462 ? 7.215   -0.881  57.768  1.00 63.11  ? 486  TRP A CD2 1 
ATOM   3497 N NE1 . TRP A 1 462 ? 5.375   0.089   58.591  1.00 63.11  ? 486  TRP A NE1 1 
ATOM   3498 C CE2 . TRP A 1 462 ? 5.951   -0.352  57.430  1.00 63.11  ? 486  TRP A CE2 1 
ATOM   3499 C CE3 . TRP A 1 462 ? 8.029   -1.409  56.749  1.00 63.11  ? 486  TRP A CE3 1 
ATOM   3500 C CZ2 . TRP A 1 462 ? 5.469   -0.336  56.111  1.00 63.11  ? 486  TRP A CZ2 1 
ATOM   3501 C CZ3 . TRP A 1 462 ? 7.558   -1.396  55.433  1.00 63.11  ? 486  TRP A CZ3 1 
ATOM   3502 C CH2 . TRP A 1 462 ? 6.286   -0.857  55.126  1.00 63.11  ? 486  TRP A CH2 1 
ATOM   3503 N N   . ALA A 1 463 ? 7.712   -4.282  58.830  1.00 109.75 ? 487  ALA A N   1 
ATOM   3504 C CA  . ALA A 1 463 ? 7.658   -5.207  57.694  1.00 109.75 ? 487  ALA A CA  1 
ATOM   3505 C C   . ALA A 1 463 ? 6.729   -4.656  56.618  1.00 109.75 ? 487  ALA A C   1 
ATOM   3506 O O   . ALA A 1 463 ? 7.049   -4.676  55.412  1.00 109.75 ? 487  ALA A O   1 
ATOM   3507 C CB  . ALA A 1 463 ? 7.160   -6.604  58.161  1.00 80.78  ? 487  ALA A CB  1 
ATOM   3508 N N   . GLU A 1 464 ? 5.568   -4.178  57.043  1.00 93.63  ? 488  GLU A N   1 
ATOM   3509 C CA  . GLU A 1 464 ? 4.612   -3.604  56.097  1.00 93.63  ? 488  GLU A CA  1 
ATOM   3510 C C   . GLU A 1 464 ? 3.572   -3.077  57.063  1.00 93.63  ? 488  GLU A C   1 
ATOM   3511 O O   . GLU A 1 464 ? 2.548   -2.440  56.687  1.00 93.63  ? 488  GLU A O   1 
ATOM   3512 C CB  . GLU A 1 464 ? 4.028   -4.691  55.181  1.00 137.03 ? 488  GLU A CB  1 
ATOM   3513 C CG  . GLU A 1 464 ? 3.478   -4.155  53.834  1.00 137.03 ? 488  GLU A CG  1 
ATOM   3514 C CD  . GLU A 1 464 ? 2.851   -5.301  52.933  1.00 137.03 ? 488  GLU A CD  1 
ATOM   3515 O OE1 . GLU A 1 464 ? 3.420   -6.463  52.971  1.00 137.03 ? 488  GLU A OE1 1 
ATOM   3516 O OE2 . GLU A 1 464 ? 1.813   -5.049  52.196  1.00 137.03 ? 488  GLU A OE2 1 
ATOM   3517 N N   . THR A 1 465 ? 3.889   -3.361  58.328  1.00 101.44 ? 489  THR A N   1 
ATOM   3518 C CA  . THR A 1 465 ? 3.072   -2.993  59.475  1.00 101.44 ? 489  THR A CA  1 
ATOM   3519 C C   . THR A 1 465 ? 4.054   -2.823  60.598  1.00 101.44 ? 489  THR A C   1 
ATOM   3520 O O   . THR A 1 465 ? 5.044   -3.589  60.699  1.00 101.44 ? 489  THR A O   1 
ATOM   3521 C CB  . THR A 1 465 ? 2.086   -4.133  59.904  1.00 106.88 ? 489  THR A CB  1 
ATOM   3522 O OG1 . THR A 1 465 ? 2.799   -5.397  59.951  1.00 106.88 ? 489  THR A OG1 1 
ATOM   3523 C CG2 . THR A 1 465 ? 0.839   -4.182  58.949  1.00 106.88 ? 489  THR A CG2 1 
ATOM   3524 N N   . LEU A 1 466 ? 3.768   -1.847  61.455  1.00 79.88  ? 490  LEU A N   1 
ATOM   3525 C CA  . LEU A 1 466 ? 4.656   -1.592  62.571  1.00 79.88  ? 490  LEU A CA  1 
ATOM   3526 C C   . LEU A 1 466 ? 4.705   -2.777  63.537  1.00 79.88  ? 490  LEU A C   1 
ATOM   3527 O O   . LEU A 1 466 ? 4.018   -3.791  63.374  1.00 79.88  ? 490  LEU A O   1 
ATOM   3528 C CB  . LEU A 1 466 ? 4.249   -0.302  63.301  1.00 91.61  ? 490  LEU A CB  1 
ATOM   3529 C CG  . LEU A 1 466 ? 5.137   0.078   64.500  1.00 91.61  ? 490  LEU A CG  1 
ATOM   3530 C CD1 . LEU A 1 466 ? 6.629   0.068   64.089  1.00 91.61  ? 490  LEU A CD1 1 
ATOM   3531 C CD2 . LEU A 1 466 ? 4.685   1.458   65.052  1.00 91.61  ? 490  LEU A CD2 1 
ATOM   3532 N N   . SER A 1 467 ? 5.538   -2.617  64.543  1.00 65.90  ? 491  SER A N   1 
ATOM   3533 C CA  . SER A 1 467 ? 5.737   -3.628  65.530  1.00 65.90  ? 491  SER A CA  1 
ATOM   3534 C C   . SER A 1 467 ? 6.765   -2.998  66.469  1.00 65.90  ? 491  SER A C   1 
ATOM   3535 O O   . SER A 1 467 ? 7.625   -2.234  66.010  1.00 65.90  ? 491  SER A O   1 
ATOM   3536 C CB  . SER A 1 467 ? 6.292   -4.871  64.836  1.00 90.44  ? 491  SER A CB  1 
ATOM   3537 O OG  . SER A 1 467 ? 6.368   -5.956  65.750  1.00 90.44  ? 491  SER A OG  1 
ATOM   3538 N N   . LEU A 1 468 ? 6.669   -3.277  67.772  1.00 106.07 ? 492  LEU A N   1 
ATOM   3539 C CA  . LEU A 1 468 ? 7.615   -2.705  68.766  1.00 106.07 ? 492  LEU A CA  1 
ATOM   3540 C C   . LEU A 1 468 ? 7.190   -3.058  70.199  1.00 106.07 ? 492  LEU A C   1 
ATOM   3541 O O   . LEU A 1 468 ? 5.997   -2.902  70.545  1.00 106.07 ? 492  LEU A O   1 
ATOM   3542 C CB  . LEU A 1 468 ? 7.723   -1.167  68.588  1.00 59.97  ? 492  LEU A CB  1 
ATOM   3543 C CG  . LEU A 1 468 ? 6.533   -0.202  68.480  1.00 59.97  ? 492  LEU A CG  1 
ATOM   3544 C CD1 . LEU A 1 468 ? 7.029   1.104   67.847  1.00 59.97  ? 492  LEU A CD1 1 
ATOM   3545 C CD2 . LEU A 1 468 ? 5.421   -0.782  67.623  1.00 59.97  ? 492  LEU A CD2 1 
ATOM   3546 N N   . ASP A 1 469 ? 8.118   -3.524  71.043  1.00 108.44 ? 493  ASP A N   1 
ATOM   3547 C CA  . ASP A 1 469 ? 7.656   -3.905  72.379  1.00 108.44 ? 493  ASP A CA  1 
ATOM   3548 C C   . ASP A 1 469 ? 7.467   -2.771  73.398  1.00 108.44 ? 493  ASP A C   1 
ATOM   3549 O O   . ASP A 1 469 ? 7.700   -2.944  74.628  1.00 108.44 ? 493  ASP A O   1 
ATOM   3550 C CB  . ASP A 1 469 ? 8.502   -5.049  72.975  1.00 140.67 ? 493  ASP A CB  1 
ATOM   3551 C CG  . ASP A 1 469 ? 9.966   -4.665  73.169  1.00 140.67 ? 493  ASP A CG  1 
ATOM   3552 O OD1 . ASP A 1 469 ? 10.592  -4.359  72.098  1.00 140.67 ? 493  ASP A OD1 1 
ATOM   3553 O OD2 . ASP A 1 469 ? 10.453  -4.674  74.365  1.00 140.67 ? 493  ASP A OD2 1 
ATOM   3554 N N   . VAL A 1 470 ? 7.029   -1.632  72.847  1.00 111.07 ? 494  VAL A N   1 
ATOM   3555 C CA  . VAL A 1 470 ? 6.687   -0.407  73.583  1.00 111.07 ? 494  VAL A CA  1 
ATOM   3556 C C   . VAL A 1 470 ? 7.273   -0.257  74.989  1.00 111.07 ? 494  VAL A C   1 
ATOM   3557 O O   . VAL A 1 470 ? 8.076   0.667   75.262  1.00 111.07 ? 494  VAL A O   1 
ATOM   3558 C CB  . VAL A 1 470 ? 5.155   -0.289  73.715  1.00 100.75 ? 494  VAL A CB  1 
ATOM   3559 C CG1 . VAL A 1 470 ? 4.802   0.876   74.653  1.00 100.75 ? 494  VAL A CG1 1 
ATOM   3560 C CG2 . VAL A 1 470 ? 4.525   -0.116  72.319  1.00 100.75 ? 494  VAL A CG2 1 
ATOM   3561 N N   . ASP A 1 471 ? 6.825   -1.142  75.884  1.00 116.19 ? 495  ASP A N   1 
ATOM   3562 C CA  . ASP A 1 471 ? 7.300   -1.155  77.262  1.00 116.19 ? 495  ASP A CA  1 
ATOM   3563 C C   . ASP A 1 471 ? 8.788   -1.454  77.277  1.00 116.19 ? 495  ASP A C   1 
ATOM   3564 O O   . ASP A 1 471 ? 9.359   -1.892  78.287  1.00 116.19 ? 495  ASP A O   1 
ATOM   3565 C CB  . ASP A 1 471 ? 6.526   -2.204  78.064  1.00 172.09 ? 495  ASP A CB  1 
ATOM   3566 C CG  . ASP A 1 471 ? 5.188   -1.648  78.595  1.00 172.09 ? 495  ASP A CG  1 
ATOM   3567 O OD1 . ASP A 1 471 ? 5.254   -0.809  79.562  1.00 172.09 ? 495  ASP A OD1 1 
ATOM   3568 O OD2 . ASP A 1 471 ? 4.093   -2.028  78.037  1.00 172.09 ? 495  ASP A OD2 1 
ATOM   3569 N N   . SER A 1 472 ? 9.397   -1.187  76.131  1.00 104.33 ? 496  SER A N   1 
ATOM   3570 C CA  . SER A 1 472 ? 10.812  -1.388  75.877  1.00 104.33 ? 496  SER A CA  1 
ATOM   3571 C C   . SER A 1 472 ? 11.493  -0.006  75.805  1.00 104.33 ? 496  SER A C   1 
ATOM   3572 O O   . SER A 1 472 ? 12.666  0.178   76.202  1.00 104.33 ? 496  SER A O   1 
ATOM   3573 C CB  . SER A 1 472 ? 10.920  -2.085  74.535  1.00 141.62 ? 496  SER A CB  1 
ATOM   3574 O OG  . SER A 1 472 ? 9.950   -1.514  73.633  1.00 141.62 ? 496  SER A OG  1 
ATOM   3575 N N   . ILE A 1 473 ? 10.726  0.947   75.286  1.00 97.30  ? 497  ILE A N   1 
ATOM   3576 C CA  . ILE A 1 473 ? 11.174  2.314   75.098  1.00 97.30  ? 497  ILE A CA  1 
ATOM   3577 C C   . ILE A 1 473 ? 11.392  3.139   76.378  1.00 97.30  ? 497  ILE A C   1 
ATOM   3578 O O   . ILE A 1 473 ? 10.533  3.178   77.284  1.00 97.30  ? 497  ILE A O   1 
ATOM   3579 C CB  . ILE A 1 473 ? 10.156  3.089   74.223  1.00 109.74 ? 497  ILE A CB  1 
ATOM   3580 C CG1 . ILE A 1 473 ? 9.849   2.261   72.958  1.00 109.74 ? 497  ILE A CG1 1 
ATOM   3581 C CG2 . ILE A 1 473 ? 10.696  4.532   73.921  1.00 109.74 ? 497  ILE A CG2 1 
ATOM   3582 C CD1 . ILE A 1 473 ? 8.540   2.681   72.226  1.00 109.74 ? 497  ILE A CD1 1 
ATOM   3583 N N   . HIS A 1 474 ? 12.547  3.799   76.437  1.00 102.79 ? 498  HIS A N   1 
ATOM   3584 C CA  . HIS A 1 474 ? 12.865  4.673   77.559  1.00 102.79 ? 498  HIS A CA  1 
ATOM   3585 C C   . HIS A 1 474 ? 12.672  6.060   76.968  1.00 102.79 ? 498  HIS A C   1 
ATOM   3586 O O   . HIS A 1 474 ? 13.407  6.439   76.038  1.00 102.79 ? 498  HIS A O   1 
ATOM   3587 C CB  . HIS A 1 474 ? 14.329  4.508   77.986  1.00 139.39 ? 498  HIS A CB  1 
ATOM   3588 C CG  . HIS A 1 474 ? 14.595  3.250   78.752  1.00 139.39 ? 498  HIS A CG  1 
ATOM   3589 N ND1 . HIS A 1 474 ? 13.713  2.183   78.768  1.00 139.39 ? 498  HIS A ND1 1 
ATOM   3590 C CD2 . HIS A 1 474 ? 15.669  2.867   79.497  1.00 139.39 ? 498  HIS A CD2 1 
ATOM   3591 C CE1 . HIS A 1 474 ? 14.236  1.195   79.486  1.00 139.39 ? 498  HIS A CE1 1 
ATOM   3592 N NE2 . HIS A 1 474 ? 15.422  1.582   79.940  1.00 139.39 ? 498  HIS A NE2 1 
ATOM   3593 N N   . TRP A 1 475 ? 11.708  6.830   77.471  1.00 100.62 ? 499  TRP A N   1 
ATOM   3594 C CA  . TRP A 1 475 ? 11.536  8.168   76.884  1.00 100.62 ? 499  TRP A CA  1 
ATOM   3595 C C   . TRP A 1 475 ? 12.315  9.278   77.611  1.00 100.62 ? 499  TRP A C   1 
ATOM   3596 O O   . TRP A 1 475 ? 12.927  9.041   78.683  1.00 100.62 ? 499  TRP A O   1 
ATOM   3597 C CB  . TRP A 1 475 ? 10.049  8.515   76.824  1.00 104.38 ? 499  TRP A CB  1 
ATOM   3598 C CG  . TRP A 1 475 ? 9.258   7.358   76.294  1.00 104.38 ? 499  TRP A CG  1 
ATOM   3599 C CD1 . TRP A 1 475 ? 8.743   6.296   77.015  1.00 104.38 ? 499  TRP A CD1 1 
ATOM   3600 C CD2 . TRP A 1 475 ? 8.888   7.134   74.927  1.00 104.38 ? 499  TRP A CD2 1 
ATOM   3601 N NE1 . TRP A 1 475 ? 8.061   5.430   76.167  1.00 104.38 ? 499  TRP A NE1 1 
ATOM   3602 C CE2 . TRP A 1 475 ? 8.132   5.920   74.885  1.00 104.38 ? 499  TRP A CE2 1 
ATOM   3603 C CE3 . TRP A 1 475 ? 9.118   7.838   73.729  1.00 104.38 ? 499  TRP A CE3 1 
ATOM   3604 C CZ2 . TRP A 1 475 ? 7.601   5.400   73.683  1.00 104.38 ? 499  TRP A CZ2 1 
ATOM   3605 C CZ3 . TRP A 1 475 ? 8.588   7.317   72.524  1.00 104.38 ? 499  TRP A CZ3 1 
ATOM   3606 C CH2 . TRP A 1 475 ? 7.837   6.108   72.517  1.00 104.38 ? 499  TRP A CH2 1 
ATOM   3607 N N   . SER A 1 476 ? 12.340  10.464  76.988  1.00 128.00 ? 500  SER A N   1 
ATOM   3608 C CA  . SER A 1 476 ? 12.976  11.628  77.618  1.00 128.00 ? 500  SER A CA  1 
ATOM   3609 C C   . SER A 1 476 ? 11.952  12.020  78.723  1.00 128.00 ? 500  SER A C   1 
ATOM   3610 O O   . SER A 1 476 ? 10.696  12.008  78.466  1.00 128.00 ? 500  SER A O   1 
ATOM   3611 C CB  . SER A 1 476 ? 13.135  12.793  76.618  1.00 105.22 ? 500  SER A CB  1 
ATOM   3612 O OG  . SER A 1 476 ? 13.637  13.969  77.270  1.00 105.22 ? 500  SER A OG  1 
ATOM   3613 N N   . ARG A 1 477 ? 12.455  12.354  79.929  1.00 139.00 ? 501  ARG A N   1 
ATOM   3614 C CA  . ARG A 1 477 ? 11.538  12.690  81.038  1.00 139.00 ? 501  ARG A CA  1 
ATOM   3615 C C   . ARG A 1 477 ? 10.815  11.350  81.369  1.00 139.00 ? 501  ARG A C   1 
ATOM   3616 O O   . ARG A 1 477 ? 9.655   11.313  81.851  1.00 139.00 ? 501  ARG A O   1 
ATOM   3617 C CB  . ARG A 1 477 ? 10.505  13.811  80.583  1.00 77.97  ? 501  ARG A CB  1 
ATOM   3618 N N   . ASN A 1 478 ? 11.535  10.265  81.041  1.00 135.35 ? 502  ASN A N   1 
ATOM   3619 C CA  . ASN A 1 478 ? 11.118  8.879   81.277  1.00 135.35 ? 502  ASN A CA  1 
ATOM   3620 C C   . ASN A 1 478 ? 9.588   8.759   81.330  1.00 135.35 ? 502  ASN A C   1 
ATOM   3621 O O   . ASN A 1 478 ? 8.979   8.195   82.280  1.00 135.35 ? 502  ASN A O   1 
ATOM   3622 C CB  . ASN A 1 478 ? 11.756  8.420   82.593  1.00 159.82 ? 502  ASN A CB  1 
ATOM   3623 C CG  . ASN A 1 478 ? 12.390  9.601   83.352  1.00 159.82 ? 502  ASN A CG  1 
ATOM   3624 O OD1 . ASN A 1 478 ? 13.547  10.010  83.045  1.00 159.82 ? 502  ASN A OD1 1 
ATOM   3625 N ND2 . ASN A 1 478 ? 11.620  10.196  84.311  1.00 159.82 ? 502  ASN A ND2 1 
ATOM   3626 N N   . SER A 1 479 ? 8.962   9.318   80.311  1.00 113.75 ? 503  SER A N   1 
ATOM   3627 C CA  . SER A 1 479 ? 7.521   9.243   80.256  1.00 113.75 ? 503  SER A CA  1 
ATOM   3628 C C   . SER A 1 479 ? 7.116   9.179   78.777  1.00 113.75 ? 503  SER A C   1 
ATOM   3629 O O   . SER A 1 479 ? 7.677   9.939   77.937  1.00 113.75 ? 503  SER A O   1 
ATOM   3630 C CB  . SER A 1 479 ? 6.901   10.480  80.954  1.00 136.04 ? 503  SER A CB  1 
ATOM   3631 O OG  . SER A 1 479 ? 5.464   10.489  80.846  1.00 136.04 ? 503  SER A OG  1 
ATOM   3632 N N   . VAL A 1 480 ? 6.187   8.261   78.457  1.00 115.63 ? 504  VAL A N   1 
ATOM   3633 C CA  . VAL A 1 480 ? 5.691   8.160   77.080  1.00 115.63 ? 504  VAL A CA  1 
ATOM   3634 C C   . VAL A 1 480 ? 5.123   9.560   76.732  1.00 115.63 ? 504  VAL A C   1 
ATOM   3635 O O   . VAL A 1 480 ? 4.083   10.017  77.268  1.00 115.63 ? 504  VAL A O   1 
ATOM   3636 C CB  . VAL A 1 480 ? 4.586   7.048   76.922  1.00 123.92 ? 504  VAL A CB  1 
ATOM   3637 C CG1 . VAL A 1 480 ? 3.754   6.908   78.259  1.00 123.92 ? 504  VAL A CG1 1 
ATOM   3638 C CG2 . VAL A 1 480 ? 3.667   7.389   75.684  1.00 123.92 ? 504  VAL A CG2 1 
ATOM   3639 N N   . PRO A 1 481 ? 5.836   10.260  75.837  1.00 111.44 ? 505  PRO A N   1 
ATOM   3640 C CA  . PRO A 1 481 ? 5.551   11.610  75.328  1.00 111.44 ? 505  PRO A CA  1 
ATOM   3641 C C   . PRO A 1 481 ? 4.147   11.770  74.757  1.00 111.44 ? 505  PRO A C   1 
ATOM   3642 O O   . PRO A 1 481 ? 3.392   10.781  74.596  1.00 111.44 ? 505  PRO A O   1 
ATOM   3643 C CB  . PRO A 1 481 ? 6.638   11.826  74.265  1.00 109.12 ? 505  PRO A CB  1 
ATOM   3644 C CG  . PRO A 1 481 ? 7.781   10.895  74.767  1.00 109.12 ? 505  PRO A CG  1 
ATOM   3645 C CD  . PRO A 1 481 ? 6.984   9.662   75.131  1.00 109.12 ? 505  PRO A CD  1 
ATOM   3646 N N   . THR A 1 482 ? 3.814   13.034  74.479  1.00 132.49 ? 506  THR A N   1 
ATOM   3647 C CA  . THR A 1 482 ? 2.504   13.418  73.935  1.00 132.49 ? 506  THR A CA  1 
ATOM   3648 C C   . THR A 1 482 ? 2.668   14.638  73.017  1.00 132.49 ? 506  THR A C   1 
ATOM   3649 O O   . THR A 1 482 ? 3.170   15.702  73.458  1.00 132.49 ? 506  THR A O   1 
ATOM   3650 C CB  . THR A 1 482 ? 1.515   13.839  75.064  1.00 194.53 ? 506  THR A CB  1 
ATOM   3651 O OG1 . THR A 1 482 ? 1.693   12.990  76.219  1.00 194.53 ? 506  THR A OG1 1 
ATOM   3652 C CG2 . THR A 1 482 ? 0.043   13.769  74.534  1.00 194.53 ? 506  THR A CG2 1 
ATOM   3653 N N   . SER A 1 483 ? 2.239   14.502  71.764  1.00 87.37  ? 507  SER A N   1 
ATOM   3654 C CA  . SER A 1 483 ? 2.360   15.608  70.840  1.00 87.37  ? 507  SER A CA  1 
ATOM   3655 C C   . SER A 1 483 ? 1.071   15.826  70.079  1.00 87.37  ? 507  SER A C   1 
ATOM   3656 O O   . SER A 1 483 ? 0.830   15.188  69.048  1.00 87.37  ? 507  SER A O   1 
ATOM   3657 C CB  . SER A 1 483 ? 3.501   15.354  69.874  1.00 72.59  ? 507  SER A CB  1 
ATOM   3658 O OG  . SER A 1 483 ? 4.029   16.578  69.408  1.00 72.59  ? 507  SER A OG  1 
ATOM   3659 N N   . GLN A 1 484 ? 0.246   16.732  70.610  1.00 158.98 ? 508  GLN A N   1 
ATOM   3660 C CA  . GLN A 1 484 ? -1.045  17.089  70.027  1.00 158.98 ? 508  GLN A CA  1 
ATOM   3661 C C   . GLN A 1 484 ? -1.152  18.601  69.914  1.00 158.98 ? 508  GLN A C   1 
ATOM   3662 O O   . GLN A 1 484 ? -0.341  19.329  70.481  1.00 158.98 ? 508  GLN A O   1 
ATOM   3663 C CB  . GLN A 1 484 ? -2.185  16.563  70.897  1.00 141.34 ? 508  GLN A CB  1 
ATOM   3664 C CG  . GLN A 1 484 ? -2.251  15.055  70.961  1.00 141.34 ? 508  GLN A CG  1 
ATOM   3665 C CD  . GLN A 1 484 ? -3.311  14.566  71.916  1.00 141.34 ? 508  GLN A CD  1 
ATOM   3666 O OE1 . GLN A 1 484 ? -3.211  14.771  73.127  1.00 141.34 ? 508  GLN A OE1 1 
ATOM   3667 N NE2 . GLN A 1 484 ? -4.340  13.916  71.377  1.00 141.34 ? 508  GLN A NE2 1 
ATOM   3668 N N   . CYS A 1 485 ? -2.159  19.070  69.189  1.00 153.08 ? 509  CYS A N   1 
ATOM   3669 C CA  . CYS A 1 485 ? -2.339  20.503  68.997  1.00 153.08 ? 509  CYS A CA  1 
ATOM   3670 C C   . CYS A 1 485 ? -2.890  21.242  70.218  1.00 153.08 ? 509  CYS A C   1 
ATOM   3671 O O   . CYS A 1 485 ? -2.229  22.131  70.758  1.00 153.08 ? 509  CYS A O   1 
ATOM   3672 C CB  . CYS A 1 485 ? -3.250  20.761  67.796  1.00 145.85 ? 509  CYS A CB  1 
ATOM   3673 S SG  . CYS A 1 485 ? -3.241  22.507  67.276  1.00 145.85 ? 509  CYS A SG  1 
ATOM   3674 N N   . SER A 1 486 ? -4.103  20.880  70.639  1.00 150.57 ? 510  SER A N   1 
ATOM   3675 C CA  . SER A 1 486 ? -4.752  21.517  71.788  1.00 150.57 ? 510  SER A CA  1 
ATOM   3676 C C   . SER A 1 486 ? -4.925  20.539  72.946  1.00 150.57 ? 510  SER A C   1 
ATOM   3677 O O   . SER A 1 486 ? -5.027  19.331  72.734  1.00 150.57 ? 510  SER A O   1 
ATOM   3678 C CB  . SER A 1 486 ? -6.122  22.074  71.376  1.00 179.11 ? 510  SER A CB  1 
ATOM   3679 O OG  . SER A 1 486 ? -6.762  22.725  72.461  1.00 179.11 ? 510  SER A OG  1 
ATOM   3680 N N   . ASP A 1 487 ? -4.961  21.071  74.166  1.00 142.21 ? 511  ASP A N   1 
ATOM   3681 C CA  . ASP A 1 487 ? -5.116  20.257  75.372  1.00 142.21 ? 511  ASP A CA  1 
ATOM   3682 C C   . ASP A 1 487 ? -6.453  19.518  75.406  1.00 142.21 ? 511  ASP A C   1 
ATOM   3683 O O   . ASP A 1 487 ? -7.375  19.856  74.670  1.00 142.21 ? 511  ASP A O   1 
ATOM   3684 C CB  . ASP A 1 487 ? -4.987  21.142  76.615  1.00 190.26 ? 511  ASP A CB  1 
ATOM   3685 C CG  . ASP A 1 487 ? -3.582  21.677  76.809  1.00 190.26 ? 511  ASP A CG  1 
ATOM   3686 O OD1 . ASP A 1 487 ? -3.391  22.544  77.686  1.00 190.26 ? 511  ASP A OD1 1 
ATOM   3687 O OD2 . ASP A 1 487 ? -2.665  21.227  76.091  1.00 190.26 ? 511  ASP A OD2 1 
ATOM   3688 N N   . PRO A 1 488 ? -6.572  18.492  76.261  1.00 139.63 ? 512  PRO A N   1 
ATOM   3689 C CA  . PRO A 1 488 ? -7.812  17.717  76.377  1.00 139.63 ? 512  PRO A CA  1 
ATOM   3690 C C   . PRO A 1 488 ? -8.878  18.499  77.151  1.00 139.63 ? 512  PRO A C   1 
ATOM   3691 O O   . PRO A 1 488 ? -8.550  19.303  78.028  1.00 139.63 ? 512  PRO A O   1 
ATOM   3692 C CB  . PRO A 1 488 ? -7.356  16.471  77.117  1.00 174.73 ? 512  PRO A CB  1 
ATOM   3693 C CG  . PRO A 1 488 ? -6.326  17.029  78.052  1.00 174.73 ? 512  PRO A CG  1 
ATOM   3694 C CD  . PRO A 1 488 ? -5.533  17.951  77.154  1.00 174.73 ? 512  PRO A CD  1 
ATOM   3695 N N   . CYS A 1 489 ? -10.149 18.262  76.834  1.00 146.65 ? 513  CYS A N   1 
ATOM   3696 C CA  . CYS A 1 489 ? -11.234 18.974  77.505  1.00 146.65 ? 513  CYS A CA  1 
ATOM   3697 C C   . CYS A 1 489 ? -11.516 18.482  78.909  1.00 146.65 ? 513  CYS A C   1 
ATOM   3698 O O   . CYS A 1 489 ? -11.113 17.387  79.302  1.00 146.65 ? 513  CYS A O   1 
ATOM   3699 C CB  . CYS A 1 489 ? -12.535 18.899  76.695  1.00 123.96 ? 513  CYS A CB  1 
ATOM   3700 S SG  . CYS A 1 489 ? -12.510 19.786  75.103  1.00 123.96 ? 513  CYS A SG  1 
ATOM   3701 N N   . ALA A 1 490 ? -12.221 19.319  79.658  1.00 126.98 ? 514  ALA A N   1 
ATOM   3702 C CA  . ALA A 1 490 ? -12.609 19.021  81.026  1.00 127.72 ? 514  ALA A CA  1 
ATOM   3703 C C   . ALA A 1 490 ? -13.923 18.238  81.001  1.00 127.74 ? 514  ALA A C   1 
ATOM   3704 O O   . ALA A 1 490 ? -14.956 18.758  80.581  1.00 127.03 ? 514  ALA A O   1 
ATOM   3705 C CB  . ALA A 1 490 ? -12.786 20.322  81.801  1.00 117.00 ? 514  ALA A CB  1 
ATOM   3706 N N   . PRO A 1 491 ? -13.903 16.974  81.449  1.00 119.28 ? 515  PRO A N   1 
ATOM   3707 C CA  . PRO A 1 491 ? -15.168 16.241  81.416  1.00 120.30 ? 515  PRO A CA  1 
ATOM   3708 C C   . PRO A 1 491 ? -16.187 17.063  82.169  1.00 121.85 ? 515  PRO A C   1 
ATOM   3709 O O   . PRO A 1 491 ? -17.201 17.481  81.602  1.00 120.70 ? 515  PRO A O   1 
ATOM   3710 C CB  . PRO A 1 491 ? -14.828 14.938  82.131  1.00 199.02 ? 515  PRO A CB  1 
ATOM   3711 C CG  . PRO A 1 491 ? -13.815 15.380  83.140  1.00 198.24 ? 515  PRO A CG  1 
ATOM   3712 C CD  . PRO A 1 491 ? -12.926 16.291  82.313  1.00 199.11 ? 515  PRO A CD  1 
ATOM   3713 N N   . ASN A 1 492 ? -15.880 17.299  83.444  1.00 304.61 ? 516  ASN A N   1 
ATOM   3714 C CA  . ASN A 1 492 ? -16.712 18.079  84.353  1.00 305.27 ? 516  ASN A CA  1 
ATOM   3715 C C   . ASN A 1 492 ? -17.565 19.109  83.616  1.00 305.61 ? 516  ASN A C   1 
ATOM   3716 O O   . ASN A 1 492 ? -18.724 19.333  83.975  1.00 306.91 ? 516  ASN A O   1 
ATOM   3717 C CB  . ASN A 1 492 ? -15.827 18.790  85.396  1.00 221.23 ? 516  ASN A CB  1 
ATOM   3718 C CG  . ASN A 1 492 ? -15.545 17.930  86.627  1.00 222.75 ? 516  ASN A CG  1 
ATOM   3719 O OD1 . ASN A 1 492 ? -16.429 17.703  87.458  1.00 222.76 ? 516  ASN A OD1 1 
ATOM   3720 N ND2 . ASN A 1 492 ? -14.308 17.453  86.749  1.00 222.23 ? 516  ASN A ND2 1 
ATOM   3721 N N   . GLU A 1 493 ? -16.998 19.724  82.580  1.00 130.38 ? 517  GLU A N   1 
ATOM   3722 C CA  . GLU A 1 493 ? -17.725 20.735  81.823  1.00 128.84 ? 517  GLU A CA  1 
ATOM   3723 C C   . GLU A 1 493 ? -17.588 20.574  80.298  1.00 125.42 ? 517  GLU A C   1 
ATOM   3724 O O   . GLU A 1 493 ? -18.357 19.861  79.648  1.00 125.47 ? 517  GLU A O   1 
ATOM   3725 C CB  . GLU A 1 493 ? -17.230 22.130  82.241  1.00 193.74 ? 517  GLU A CB  1 
ATOM   3726 C CG  . GLU A 1 493 ? -18.304 23.221  82.271  1.00 198.74 ? 517  GLU A CG  1 
ATOM   3727 C CD  . GLU A 1 493 ? -19.046 23.308  83.606  1.00 201.35 ? 517  GLU A CD  1 
ATOM   3728 O OE1 . GLU A 1 493 ? -18.384 23.520  84.648  1.00 202.16 ? 517  GLU A OE1 1 
ATOM   3729 O OE2 . GLU A 1 493 ? -20.290 23.176  83.615  1.00 202.17 ? 517  GLU A OE2 1 
ATOM   3730 N N   . MET A 1 494 ? -16.583 21.261  79.765  1.00 98.20  ? 518  MET A N   1 
ATOM   3731 C CA  . MET A 1 494 ? -16.231 21.331  78.352  1.00 93.77  ? 518  MET A CA  1 
ATOM   3732 C C   . MET A 1 494 ? -16.640 20.245  77.346  1.00 91.33  ? 518  MET A C   1 
ATOM   3733 O O   . MET A 1 494 ? -16.947 19.103  77.696  1.00 91.53  ? 518  MET A O   1 
ATOM   3734 C CB  . MET A 1 494 ? -14.733 21.578  78.274  1.00 108.24 ? 518  MET A CB  1 
ATOM   3735 C CG  . MET A 1 494 ? -14.190 22.229  79.543  1.00 109.24 ? 518  MET A CG  1 
ATOM   3736 S SD  . MET A 1 494 ? -12.931 23.469  79.214  1.00 110.61 ? 518  MET A SD  1 
ATOM   3737 C CE  . MET A 1 494 ? -11.353 22.463  79.221  1.00 109.32 ? 518  MET A CE  1 
ATOM   3738 N N   . LYS A 1 495 ? -16.644 20.655  76.079  1.00 82.21  ? 519  LYS A N   1 
ATOM   3739 C CA  . LYS A 1 495 ? -17.002 19.821  74.928  1.00 80.57  ? 519  LYS A CA  1 
ATOM   3740 C C   . LYS A 1 495 ? -15.945 20.100  73.857  1.00 82.21  ? 519  LYS A C   1 
ATOM   3741 O O   . LYS A 1 495 ? -15.428 21.212  73.767  1.00 80.58  ? 519  LYS A O   1 
ATOM   3742 C CB  . LYS A 1 495 ? -18.380 20.224  74.388  1.00 91.27  ? 519  LYS A CB  1 
ATOM   3743 C CG  . LYS A 1 495 ? -18.437 21.693  73.966  1.00 88.07  ? 519  LYS A CG  1 
ATOM   3744 C CD  . LYS A 1 495 ? -19.831 22.172  73.605  1.00 81.76  ? 519  LYS A CD  1 
ATOM   3745 C CE  . LYS A 1 495 ? -20.155 21.880  72.160  1.00 78.19  ? 519  LYS A CE  1 
ATOM   3746 N NZ  . LYS A 1 495 ? -21.521 22.367  71.786  1.00 84.40  ? 519  LYS A NZ  1 
ATOM   3747 N N   . ASN A 1 496 ? -15.628 19.098  73.047  1.00 99.83  ? 520  ASN A N   1 
ATOM   3748 C CA  . ASN A 1 496 ? -14.624 19.253  71.999  1.00 99.83  ? 520  ASN A CA  1 
ATOM   3749 C C   . ASN A 1 496 ? -15.204 20.046  70.823  1.00 99.83  ? 520  ASN A C   1 
ATOM   3750 O O   . ASN A 1 496 ? -16.281 19.717  70.327  1.00 99.83  ? 520  ASN A O   1 
ATOM   3751 C CB  . ASN A 1 496 ? -14.170 17.868  71.521  1.00 168.65 ? 520  ASN A CB  1 
ATOM   3752 C CG  . ASN A 1 496 ? -12.672 17.789  71.274  1.00 168.65 ? 520  ASN A CG  1 
ATOM   3753 O OD1 . ASN A 1 496 ? -12.120 18.565  70.499  1.00 168.65 ? 520  ASN A OD1 1 
ATOM   3754 N ND2 . ASN A 1 496 ? -12.010 16.841  71.931  1.00 168.65 ? 520  ASN A ND2 1 
ATOM   3755 N N   . MET A 1 497 ? -14.502 21.092  70.385  1.00 75.55  ? 521  MET A N   1 
ATOM   3756 C CA  . MET A 1 497 ? -14.963 21.897  69.253  1.00 75.55  ? 521  MET A CA  1 
ATOM   3757 C C   . MET A 1 497 ? -13.904 21.986  68.149  1.00 75.55  ? 521  MET A C   1 
ATOM   3758 O O   . MET A 1 497 ? -12.765 22.379  68.414  1.00 75.55  ? 521  MET A O   1 
ATOM   3759 C CB  . MET A 1 497 ? -15.331 23.305  69.719  1.00 152.16 ? 521  MET A CB  1 
ATOM   3760 C CG  . MET A 1 497 ? -16.590 23.375  70.561  1.00 152.16 ? 521  MET A CG  1 
ATOM   3761 S SD  . MET A 1 497 ? -18.043 22.788  69.676  1.00 152.16 ? 521  MET A SD  1 
ATOM   3762 C CE  . MET A 1 497 ? -18.380 24.202  68.629  1.00 152.16 ? 521  MET A CE  1 
ATOM   3763 N N   . GLN A 1 498 ? -14.289 21.639  66.915  1.00 121.67 ? 522  GLN A N   1 
ATOM   3764 C CA  . GLN A 1 498 ? -13.375 21.663  65.758  1.00 121.67 ? 522  GLN A CA  1 
ATOM   3765 C C   . GLN A 1 498 ? -13.610 22.838  64.776  1.00 121.67 ? 522  GLN A C   1 
ATOM   3766 O O   . GLN A 1 498 ? -14.674 22.935  64.146  1.00 121.67 ? 522  GLN A O   1 
ATOM   3767 C CB  . GLN A 1 498 ? -13.484 20.339  64.976  1.00 127.06 ? 522  GLN A CB  1 
ATOM   3768 C CG  . GLN A 1 498 ? -13.319 19.050  65.792  1.00 127.06 ? 522  GLN A CG  1 
ATOM   3769 C CD  . GLN A 1 498 ? -11.902 18.821  66.320  1.00 127.06 ? 522  GLN A CD  1 
ATOM   3770 O OE1 . GLN A 1 498 ? -11.599 17.762  66.870  1.00 127.06 ? 522  GLN A OE1 1 
ATOM   3771 N NE2 . GLN A 1 498 ? -11.038 19.813  66.162  1.00 127.06 ? 522  GLN A NE2 1 
ATOM   3772 N N   . PRO A 1 499 ? -12.610 23.736  64.624  1.00 211.10 ? 523  PRO A N   1 
ATOM   3773 C CA  . PRO A 1 499 ? -12.700 24.899  63.724  1.00 211.10 ? 523  PRO A CA  1 
ATOM   3774 C C   . PRO A 1 499 ? -12.484 24.630  62.223  1.00 211.10 ? 523  PRO A C   1 
ATOM   3775 O O   . PRO A 1 499 ? -13.431 24.666  61.436  1.00 211.10 ? 523  PRO A O   1 
ATOM   3776 C CB  . PRO A 1 499 ? -11.659 25.863  64.304  1.00 194.88 ? 523  PRO A CB  1 
ATOM   3777 C CG  . PRO A 1 499 ? -10.610 24.942  64.823  1.00 194.88 ? 523  PRO A CG  1 
ATOM   3778 C CD  . PRO A 1 499 ? -11.419 23.843  65.493  1.00 194.88 ? 523  PRO A CD  1 
ATOM   3779 N N   . GLY A 1 500 ? -11.239 24.371  61.831  1.00 241.81 ? 524  GLY A N   1 
ATOM   3780 C CA  . GLY A 1 500 ? -10.944 24.114  60.430  1.00 241.81 ? 524  GLY A CA  1 
ATOM   3781 C C   . GLY A 1 500 ? -10.202 22.814  60.162  1.00 241.81 ? 524  GLY A C   1 
ATOM   3782 O O   . GLY A 1 500 ? -10.660 21.990  59.367  1.00 241.81 ? 524  GLY A O   1 
ATOM   3783 N N   . ASP A 1 501 ? -9.055  22.629  60.816  1.00 212.74 ? 525  ASP A N   1 
ATOM   3784 C CA  . ASP A 1 501 ? -8.256  21.417  60.637  1.00 212.74 ? 525  ASP A CA  1 
ATOM   3785 C C   . ASP A 1 501 ? -8.851  20.209  61.360  1.00 212.74 ? 525  ASP A C   1 
ATOM   3786 O O   . ASP A 1 501 ? -10.054 20.159  61.605  1.00 212.74 ? 525  ASP A O   1 
ATOM   3787 C CB  . ASP A 1 501 ? -6.795  21.651  61.084  1.00 169.36 ? 525  ASP A CB  1 
ATOM   3788 C CG  . ASP A 1 501 ? -6.676  22.419  62.401  1.00 169.36 ? 525  ASP A CG  1 
ATOM   3789 O OD1 . ASP A 1 501 ? -6.984  23.630  62.423  1.00 169.36 ? 525  ASP A OD1 1 
ATOM   3790 O OD2 . ASP A 1 501 ? -6.261  21.812  63.410  1.00 169.36 ? 525  ASP A OD2 1 
ATOM   3791 N N   . VAL A 1 502 ? -8.011  19.231  61.687  1.00 124.19 ? 526  VAL A N   1 
ATOM   3792 C CA  . VAL A 1 502 ? -8.478  18.033  62.377  1.00 124.19 ? 526  VAL A CA  1 
ATOM   3793 C C   . VAL A 1 502 ? -7.665  17.626  63.607  1.00 124.19 ? 526  VAL A C   1 
ATOM   3794 O O   . VAL A 1 502 ? -7.895  16.558  64.177  1.00 124.19 ? 526  VAL A O   1 
ATOM   3795 C CB  . VAL A 1 502 ? -8.539  16.825  61.420  1.00 127.73 ? 526  VAL A CB  1 
ATOM   3796 C CG1 . VAL A 1 502 ? -9.900  16.764  60.749  1.00 127.73 ? 526  VAL A CG1 1 
ATOM   3797 C CG2 . VAL A 1 502 ? -7.441  16.937  60.376  1.00 127.73 ? 526  VAL A CG2 1 
ATOM   3798 N N   . CYS A 1 503 ? -6.726  18.471  64.022  1.00 140.57 ? 527  CYS A N   1 
ATOM   3799 C CA  . CYS A 1 503 ? -5.915  18.169  65.197  1.00 140.57 ? 527  CYS A CA  1 
ATOM   3800 C C   . CYS A 1 503 ? -6.119  19.245  66.254  1.00 140.57 ? 527  CYS A C   1 
ATOM   3801 O O   . CYS A 1 503 ? -6.028  18.983  67.458  1.00 140.57 ? 527  CYS A O   1 
ATOM   3802 C CB  . CYS A 1 503 ? -4.435  18.121  64.828  1.00 280.80 ? 527  CYS A CB  1 
ATOM   3803 S SG  . CYS A 1 503 ? -4.040  17.166  63.333  1.00 280.80 ? 527  CYS A SG  1 
ATOM   3804 N N   . CYS A 1 504 ? -6.397  20.457  65.785  1.00 175.77 ? 528  CYS A N   1 
ATOM   3805 C CA  . CYS A 1 504 ? -6.596  21.603  66.660  1.00 175.77 ? 528  CYS A CA  1 
ATOM   3806 C C   . CYS A 1 504 ? -8.058  21.861  66.979  1.00 175.77 ? 528  CYS A C   1 
ATOM   3807 O O   . CYS A 1 504 ? -8.886  22.011  66.083  1.00 175.77 ? 528  CYS A O   1 
ATOM   3808 C CB  . CYS A 1 504 ? -5.975  22.834  66.017  1.00 246.94 ? 528  CYS A CB  1 
ATOM   3809 S SG  . CYS A 1 504 ? -4.256  22.527  65.512  1.00 246.94 ? 528  CYS A SG  1 
ATOM   3810 N N   . TRP A 1 505 ? -8.359  21.935  68.271  1.00 137.40 ? 529  TRP A N   1 
ATOM   3811 C CA  . TRP A 1 505 ? -9.723  22.143  68.728  1.00 137.40 ? 529  TRP A CA  1 
ATOM   3812 C C   . TRP A 1 505 ? -9.782  23.118  69.895  1.00 137.40 ? 529  TRP A C   1 
ATOM   3813 O O   . TRP A 1 505 ? -8.744  23.508  70.437  1.00 137.40 ? 529  TRP A O   1 
ATOM   3814 C CB  . TRP A 1 505 ? -10.307 20.801  69.164  1.00 130.33 ? 529  TRP A CB  1 
ATOM   3815 C CG  . TRP A 1 505 ? -9.673  20.239  70.415  1.00 130.33 ? 529  TRP A CG  1 
ATOM   3816 C CD1 . TRP A 1 505 ? -9.839  20.695  71.687  1.00 130.33 ? 529  TRP A CD1 1 
ATOM   3817 C CD2 . TRP A 1 505 ? -8.815  19.090  70.512  1.00 130.33 ? 529  TRP A CD2 1 
ATOM   3818 N NE1 . TRP A 1 505 ? -9.151  19.904  72.572  1.00 130.33 ? 529  TRP A NE1 1 
ATOM   3819 C CE2 . TRP A 1 505 ? -8.514  18.910  71.880  1.00 130.33 ? 529  TRP A CE2 1 
ATOM   3820 C CE3 . TRP A 1 505 ? -8.275  18.194  69.577  1.00 130.33 ? 529  TRP A CE3 1 
ATOM   3821 C CZ2 . TRP A 1 505 ? -7.696  17.868  72.341  1.00 130.33 ? 529  TRP A CZ2 1 
ATOM   3822 C CZ3 . TRP A 1 505 ? -7.460  17.157  70.035  1.00 130.33 ? 529  TRP A CZ3 1 
ATOM   3823 C CH2 . TRP A 1 505 ? -7.181  17.005  71.407  1.00 130.33 ? 529  TRP A CH2 1 
ATOM   3824 N N   . ILE A 1 506 ? -11.002 23.501  70.274  1.00 93.43  ? 530  ILE A N   1 
ATOM   3825 C CA  . ILE A 1 506 ? -11.218 24.405  71.407  1.00 93.43  ? 530  ILE A CA  1 
ATOM   3826 C C   . ILE A 1 506 ? -12.175 23.746  72.398  1.00 93.43  ? 530  ILE A C   1 
ATOM   3827 O O   . ILE A 1 506 ? -13.109 23.053  71.995  1.00 93.43  ? 530  ILE A O   1 
ATOM   3828 C CB  . ILE A 1 506 ? -11.815 25.778  70.971  1.00 113.06 ? 530  ILE A CB  1 
ATOM   3829 C CG1 . ILE A 1 506 ? -13.109 25.564  70.201  1.00 113.06 ? 530  ILE A CG1 1 
ATOM   3830 C CG2 . ILE A 1 506 ? -10.829 26.546  70.109  1.00 113.06 ? 530  ILE A CG2 1 
ATOM   3831 C CD1 . ILE A 1 506 ? -13.731 26.849  69.718  1.00 113.06 ? 530  ILE A CD1 1 
ATOM   3832 N N   . CYS A 1 507 ? -11.927 23.944  73.689  1.00 100.80 ? 531  CYS A N   1 
ATOM   3833 C CA  . CYS A 1 507 ? -12.783 23.362  74.706  1.00 100.80 ? 531  CYS A CA  1 
ATOM   3834 C C   . CYS A 1 507 ? -13.780 24.355  75.284  1.00 100.80 ? 531  CYS A C   1 
ATOM   3835 O O   . CYS A 1 507 ? -13.426 25.267  76.037  1.00 100.80 ? 531  CYS A O   1 
ATOM   3836 C CB  . CYS A 1 507 ? -11.953 22.744  75.829  1.00 119.47 ? 531  CYS A CB  1 
ATOM   3837 S SG  . CYS A 1 507 ? -11.081 21.234  75.313  1.00 119.47 ? 531  CYS A SG  1 
ATOM   3838 N N   . ILE A 1 508 ? -15.037 24.145  74.908  1.00 75.95  ? 532  ILE A N   1 
ATOM   3839 C CA  . ILE A 1 508 ? -16.162 24.961  75.325  1.00 75.95  ? 532  ILE A CA  1 
ATOM   3840 C C   . ILE A 1 508 ? -16.827 24.281  76.504  1.00 75.95  ? 532  ILE A C   1 
ATOM   3841 O O   . ILE A 1 508 ? -17.160 23.104  76.430  1.00 75.95  ? 532  ILE A O   1 
ATOM   3842 C CB  . ILE A 1 508 ? -17.206 25.076  74.185  1.00 111.01 ? 532  ILE A CB  1 
ATOM   3843 C CG1 . ILE A 1 508 ? -16.761 26.124  73.167  1.00 111.01 ? 532  ILE A CG1 1 
ATOM   3844 C CG2 . ILE A 1 508 ? -18.564 25.398  74.745  1.00 111.01 ? 532  ILE A CG2 1 
ATOM   3845 C CD1 . ILE A 1 508 ? -16.532 27.511  73.766  1.00 111.01 ? 532  ILE A CD1 1 
ATOM   3846 N N   . PRO A 1 509 ? -17.004 25.001  77.624  1.00 78.68  ? 533  PRO A N   1 
ATOM   3847 C CA  . PRO A 1 509 ? -17.655 24.388  78.789  1.00 78.68  ? 533  PRO A CA  1 
ATOM   3848 C C   . PRO A 1 509 ? -19.168 24.417  78.553  1.00 78.68  ? 533  PRO A C   1 
ATOM   3849 O O   . PRO A 1 509 ? -19.654 25.190  77.727  1.00 78.68  ? 533  PRO A O   1 
ATOM   3850 C CB  . PRO A 1 509 ? -17.204 25.283  79.940  1.00 105.57 ? 533  PRO A CB  1 
ATOM   3851 C CG  . PRO A 1 509 ? -17.093 26.629  79.292  1.00 105.57 ? 533  PRO A CG  1 
ATOM   3852 C CD  . PRO A 1 509 ? -16.438 26.321  77.966  1.00 105.57 ? 533  PRO A CD  1 
ATOM   3853 N N   . CYS A 1 510 ? -19.923 23.591  79.262  1.00 78.61  ? 534  CYS A N   1 
ATOM   3854 C CA  . CYS A 1 510 ? -21.362 23.592  79.038  1.00 78.61  ? 534  CYS A CA  1 
ATOM   3855 C C   . CYS A 1 510 ? -22.210 24.216  80.109  1.00 78.61  ? 534  CYS A C   1 
ATOM   3856 O O   . CYS A 1 510 ? -21.730 24.604  81.177  1.00 78.61  ? 534  CYS A O   1 
ATOM   3857 C CB  . CYS A 1 510 ? -21.835 22.191  78.826  1.00 111.17 ? 534  CYS A CB  1 
ATOM   3858 S SG  . CYS A 1 510 ? -20.739 21.359  77.673  1.00 111.17 ? 534  CYS A SG  1 
ATOM   3859 N N   . GLU A 1 511 ? -23.496 24.316  79.813  1.00 107.30 ? 535  GLU A N   1 
ATOM   3860 C CA  . GLU A 1 511 ? -24.388 24.902  80.777  1.00 107.30 ? 535  GLU A CA  1 
ATOM   3861 C C   . GLU A 1 511 ? -24.758 23.813  81.747  1.00 107.30 ? 535  GLU A C   1 
ATOM   3862 O O   . GLU A 1 511 ? -25.180 22.725  81.353  1.00 107.30 ? 535  GLU A O   1 
ATOM   3863 C CB  . GLU A 1 511 ? -25.612 25.519  80.094  1.00 134.85 ? 535  GLU A CB  1 
ATOM   3864 C CG  . GLU A 1 511 ? -25.301 26.823  79.327  1.00 134.85 ? 535  GLU A CG  1 
ATOM   3865 C CD  . GLU A 1 511 ? -24.479 27.844  80.144  1.00 134.85 ? 535  GLU A CD  1 
ATOM   3866 O OE1 . GLU A 1 511 ? -24.244 28.964  79.640  1.00 134.85 ? 535  GLU A OE1 1 
ATOM   3867 O OE2 . GLU A 1 511 ? -24.057 27.539  81.283  1.00 134.85 ? 535  GLU A OE2 1 
ATOM   3868 N N   . PRO A 1 512 ? -24.565 24.085  83.042  1.00 133.99 ? 536  PRO A N   1 
ATOM   3869 C CA  . PRO A 1 512 ? -24.867 23.131  84.106  1.00 133.99 ? 536  PRO A CA  1 
ATOM   3870 C C   . PRO A 1 512 ? -26.136 22.332  83.866  1.00 133.99 ? 536  PRO A C   1 
ATOM   3871 O O   . PRO A 1 512 ? -26.363 21.317  84.512  1.00 133.99 ? 536  PRO A O   1 
ATOM   3872 C CB  . PRO A 1 512 ? -24.938 24.014  85.353  1.00 93.63  ? 536  PRO A CB  1 
ATOM   3873 C CG  . PRO A 1 512 ? -25.188 25.411  84.794  1.00 93.63  ? 536  PRO A CG  1 
ATOM   3874 C CD  . PRO A 1 512 ? -24.311 25.424  83.597  1.00 93.63  ? 536  PRO A CD  1 
ATOM   3875 N N   . TYR A 1 513 ? -26.948 22.776  82.916  1.00 77.46  ? 537  TYR A N   1 
ATOM   3876 C CA  . TYR A 1 513 ? -28.193 22.087  82.619  1.00 77.46  ? 537  TYR A CA  1 
ATOM   3877 C C   . TYR A 1 513 ? -28.193 21.186  81.380  1.00 77.46  ? 537  TYR A C   1 
ATOM   3878 O O   . TYR A 1 513 ? -29.242 20.620  81.036  1.00 77.46  ? 537  TYR A O   1 
ATOM   3879 C CB  . TYR A 1 513 ? -29.355 23.105  82.523  1.00 99.00  ? 537  TYR A CB  1 
ATOM   3880 C CG  . TYR A 1 513 ? -29.307 24.067  81.345  1.00 99.00  ? 537  TYR A CG  1 
ATOM   3881 C CD1 . TYR A 1 513 ? -29.634 23.645  80.064  1.00 99.00  ? 537  TYR A CD1 1 
ATOM   3882 C CD2 . TYR A 1 513 ? -28.910 25.393  81.515  1.00 99.00  ? 537  TYR A CD2 1 
ATOM   3883 C CE1 . TYR A 1 513 ? -29.560 24.511  78.979  1.00 99.00  ? 537  TYR A CE1 1 
ATOM   3884 C CE2 . TYR A 1 513 ? -28.833 26.270  80.434  1.00 99.00  ? 537  TYR A CE2 1 
ATOM   3885 C CZ  . TYR A 1 513 ? -29.154 25.818  79.167  1.00 99.00  ? 537  TYR A CZ  1 
ATOM   3886 O OH  . TYR A 1 513 ? -29.021 26.647  78.074  1.00 99.00  ? 537  TYR A OH  1 
ATOM   3887 N N   . GLU A 1 514 ? -27.038 21.032  80.721  1.00 77.47  ? 538  GLU A N   1 
ATOM   3888 C CA  . GLU A 1 514 ? -26.944 20.203  79.507  1.00 77.47  ? 538  GLU A CA  1 
ATOM   3889 C C   . GLU A 1 514 ? -25.843 19.156  79.557  1.00 77.47  ? 538  GLU A C   1 
ATOM   3890 O O   . GLU A 1 514 ? -24.773 19.402  80.106  1.00 77.47  ? 538  GLU A O   1 
ATOM   3891 C CB  . GLU A 1 514 ? -26.732 21.097  78.287  1.00 92.39  ? 538  GLU A CB  1 
ATOM   3892 C CG  . GLU A 1 514 ? -25.755 22.241  78.521  1.00 92.39  ? 538  GLU A CG  1 
ATOM   3893 C CD  . GLU A 1 514 ? -25.742 23.231  77.372  1.00 92.39  ? 538  GLU A CD  1 
ATOM   3894 O OE1 . GLU A 1 514 ? -24.981 24.229  77.420  1.00 92.39  ? 538  GLU A OE1 1 
ATOM   3895 O OE2 . GLU A 1 514 ? -26.509 23.001  76.412  1.00 92.39  ? 538  GLU A OE2 1 
ATOM   3896 N N   . TYR A 1 515 ? -26.103 17.984  78.988  1.00 96.42  ? 539  TYR A N   1 
ATOM   3897 C CA  . TYR A 1 515 ? -25.093 16.929  78.966  1.00 96.42  ? 539  TYR A CA  1 
ATOM   3898 C C   . TYR A 1 515 ? -24.346 16.968  77.630  1.00 96.42  ? 539  TYR A C   1 
ATOM   3899 O O   . TYR A 1 515 ? -24.336 17.998  76.963  1.00 96.42  ? 539  TYR A O   1 
ATOM   3900 C CB  . TYR A 1 515 ? -25.759 15.566  79.176  1.00 118.52 ? 539  TYR A CB  1 
ATOM   3901 C CG  . TYR A 1 515 ? -26.543 15.025  78.004  1.00 118.52 ? 539  TYR A CG  1 
ATOM   3902 C CD1 . TYR A 1 515 ? -25.917 14.286  77.001  1.00 118.52 ? 539  TYR A CD1 1 
ATOM   3903 C CD2 . TYR A 1 515 ? -27.920 15.193  77.926  1.00 118.52 ? 539  TYR A CD2 1 
ATOM   3904 C CE1 . TYR A 1 515 ? -26.642 13.717  75.950  1.00 118.52 ? 539  TYR A CE1 1 
ATOM   3905 C CE2 . TYR A 1 515 ? -28.659 14.626  76.879  1.00 118.52 ? 539  TYR A CE2 1 
ATOM   3906 C CZ  . TYR A 1 515 ? -28.012 13.887  75.900  1.00 118.52 ? 539  TYR A CZ  1 
ATOM   3907 O OH  . TYR A 1 515 ? -28.738 13.282  74.898  1.00 118.52 ? 539  TYR A OH  1 
ATOM   3908 N N   . LEU A 1 516 ? -23.706 15.872  77.238  1.00 79.38  ? 540  LEU A N   1 
ATOM   3909 C CA  . LEU A 1 516 ? -23.010 15.845  75.953  1.00 79.38  ? 540  LEU A CA  1 
ATOM   3910 C C   . LEU A 1 516 ? -23.410 14.611  75.174  1.00 79.38  ? 540  LEU A C   1 
ATOM   3911 O O   . LEU A 1 516 ? -23.004 13.503  75.531  1.00 79.38  ? 540  LEU A O   1 
ATOM   3912 C CB  . LEU A 1 516 ? -21.490 15.822  76.131  1.00 59.92  ? 540  LEU A CB  1 
ATOM   3913 C CG  . LEU A 1 516 ? -20.899 16.924  77.009  1.00 59.92  ? 540  LEU A CG  1 
ATOM   3914 C CD1 . LEU A 1 516 ? -21.334 16.606  78.448  1.00 59.92  ? 540  LEU A CD1 1 
ATOM   3915 C CD2 . LEU A 1 516 ? -19.353 17.048  76.883  1.00 59.92  ? 540  LEU A CD2 1 
ATOM   3916 N N   . VAL A 1 517 ? -24.213 14.786  74.127  1.00 119.21 ? 541  VAL A N   1 
ATOM   3917 C CA  . VAL A 1 517 ? -24.608 13.651  73.304  1.00 119.21 ? 541  VAL A CA  1 
ATOM   3918 C C   . VAL A 1 517 ? -23.320 12.913  72.950  1.00 119.21 ? 541  VAL A C   1 
ATOM   3919 O O   . VAL A 1 517 ? -23.311 11.694  72.762  1.00 119.21 ? 541  VAL A O   1 
ATOM   3920 C CB  . VAL A 1 517 ? -25.301 14.110  72.009  1.00 164.96 ? 541  VAL A CB  1 
ATOM   3921 C CG1 . VAL A 1 517 ? -25.383 12.959  71.000  1.00 164.96 ? 541  VAL A CG1 1 
ATOM   3922 C CG2 . VAL A 1 517 ? -26.681 14.609  72.338  1.00 164.96 ? 541  VAL A CG2 1 
ATOM   3923 N N   . ASP A 1 518 ? -22.228 13.668  72.866  1.00 88.94  ? 542  ASP A N   1 
ATOM   3924 C CA  . ASP A 1 518 ? -20.921 13.105  72.560  1.00 88.94  ? 542  ASP A CA  1 
ATOM   3925 C C   . ASP A 1 518 ? -19.791 14.059  72.974  1.00 88.94  ? 542  ASP A C   1 
ATOM   3926 O O   . ASP A 1 518 ? -20.028 15.135  73.529  1.00 88.94  ? 542  ASP A O   1 
ATOM   3927 C CB  . ASP A 1 518 ? -20.831 12.769  71.066  1.00 102.17 ? 542  ASP A CB  1 
ATOM   3928 C CG  . ASP A 1 518 ? -20.944 13.994  70.180  1.00 102.17 ? 542  ASP A CG  1 
ATOM   3929 O OD1 . ASP A 1 518 ? -21.479 13.858  69.061  1.00 102.17 ? 542  ASP A OD1 1 
ATOM   3930 O OD2 . ASP A 1 518 ? -20.489 15.084  70.586  1.00 102.17 ? 542  ASP A OD2 1 
ATOM   3931 N N   . GLU A 1 519 ? -18.560 13.653  72.702  1.00 108.53 ? 543  GLU A N   1 
ATOM   3932 C CA  . GLU A 1 519 ? -17.401 14.453  73.051  1.00 108.53 ? 543  GLU A CA  1 
ATOM   3933 C C   . GLU A 1 519 ? -17.517 15.903  72.570  1.00 108.53 ? 543  GLU A C   1 
ATOM   3934 O O   . GLU A 1 519 ? -17.220 16.833  73.316  1.00 108.53 ? 543  GLU A O   1 
ATOM   3935 C CB  . GLU A 1 519 ? -16.141 13.811  72.452  1.00 137.28 ? 543  GLU A CB  1 
ATOM   3936 C CG  . GLU A 1 519 ? -14.825 14.409  72.961  1.00 137.28 ? 543  GLU A CG  1 
ATOM   3937 C CD  . GLU A 1 519 ? -13.620 13.998  72.128  1.00 137.28 ? 543  GLU A CD  1 
ATOM   3938 O OE1 . GLU A 1 519 ? -12.480 14.391  72.481  1.00 137.28 ? 543  GLU A OE1 1 
ATOM   3939 O OE2 . GLU A 1 519 ? -13.827 13.287  71.119  1.00 137.28 ? 543  GLU A OE2 1 
ATOM   3940 N N   . PHE A 1 520 ? -17.970 16.084  71.331  1.00 91.21  ? 544  PHE A N   1 
ATOM   3941 C CA  . PHE A 1 520 ? -18.070 17.405  70.714  1.00 91.21  ? 544  PHE A CA  1 
ATOM   3942 C C   . PHE A 1 520 ? -19.387 18.144  70.891  1.00 91.21  ? 544  PHE A C   1 
ATOM   3943 O O   . PHE A 1 520 ? -19.443 19.368  70.784  1.00 91.21  ? 544  PHE A O   1 
ATOM   3944 C CB  . PHE A 1 520 ? -17.819 17.306  69.204  1.00 142.02 ? 544  PHE A CB  1 
ATOM   3945 C CG  . PHE A 1 520 ? -16.796 16.281  68.813  1.00 142.02 ? 544  PHE A CG  1 
ATOM   3946 C CD1 . PHE A 1 520 ? -17.071 14.921  68.937  1.00 142.02 ? 544  PHE A CD1 1 
ATOM   3947 C CD2 . PHE A 1 520 ? -15.554 16.671  68.328  1.00 142.02 ? 544  PHE A CD2 1 
ATOM   3948 C CE1 . PHE A 1 520 ? -16.120 13.963  68.586  1.00 142.02 ? 544  PHE A CE1 1 
ATOM   3949 C CE2 . PHE A 1 520 ? -14.592 15.724  67.973  1.00 142.02 ? 544  PHE A CE2 1 
ATOM   3950 C CZ  . PHE A 1 520 ? -14.877 14.366  68.103  1.00 142.02 ? 544  PHE A CZ  1 
ATOM   3951 N N   . THR A 1 521 ? -20.451 17.411  71.154  1.00 77.22  ? 545  THR A N   1 
ATOM   3952 C CA  . THR A 1 521 ? -21.750 18.041  71.259  1.00 77.22  ? 545  THR A CA  1 
ATOM   3953 C C   . THR A 1 521 ? -22.333 18.170  72.661  1.00 77.22  ? 545  THR A C   1 
ATOM   3954 O O   . THR A 1 521 ? -22.644 17.170  73.315  1.00 77.22  ? 545  THR A O   1 
ATOM   3955 C CB  . THR A 1 521 ? -22.761 17.295  70.340  1.00 121.29 ? 545  THR A CB  1 
ATOM   3956 O OG1 . THR A 1 521 ? -22.330 17.401  68.977  1.00 121.29 ? 545  THR A OG1 1 
ATOM   3957 C CG2 . THR A 1 521 ? -24.155 17.880  70.456  1.00 121.29 ? 545  THR A CG2 1 
ATOM   3958 N N   . CYS A 1 522 ? -22.473 19.409  73.129  1.00 96.60  ? 546  CYS A N   1 
ATOM   3959 C CA  . CYS A 1 522 ? -23.072 19.621  74.428  1.00 96.60  ? 546  CYS A CA  1 
ATOM   3960 C C   . CYS A 1 522 ? -24.542 19.803  74.220  1.00 96.60  ? 546  CYS A C   1 
ATOM   3961 O O   . CYS A 1 522 ? -24.949 20.827  73.707  1.00 96.60  ? 546  CYS A O   1 
ATOM   3962 C CB  . CYS A 1 522 ? -22.502 20.840  75.146  1.00 97.92  ? 546  CYS A CB  1 
ATOM   3963 S SG  . CYS A 1 522 ? -22.033 20.127  76.735  1.00 97.92  ? 546  CYS A SG  1 
ATOM   3964 N N   . MET A 1 523 ? -25.339 18.806  74.598  1.00 105.91 ? 547  MET A N   1 
ATOM   3965 C CA  . MET A 1 523 ? -26.788 18.886  74.424  1.00 105.91 ? 547  MET A CA  1 
ATOM   3966 C C   . MET A 1 523 ? -27.552 19.171  75.715  1.00 105.91 ? 547  MET A C   1 
ATOM   3967 O O   . MET A 1 523 ? -27.278 18.606  76.775  1.00 105.91 ? 547  MET A O   1 
ATOM   3968 C CB  . MET A 1 523 ? -27.323 17.603  73.793  1.00 111.96 ? 547  MET A CB  1 
ATOM   3969 C CG  . MET A 1 523 ? -28.767 17.705  73.336  1.00 111.96 ? 547  MET A CG  1 
ATOM   3970 S SD  . MET A 1 523 ? -29.336 16.244  72.420  1.00 111.96 ? 547  MET A SD  1 
ATOM   3971 C CE  . MET A 1 523 ? -28.786 16.649  70.735  1.00 111.96 ? 547  MET A CE  1 
ATOM   3972 N N   . ASP A 1 524 ? -28.529 20.058  75.603  1.00 113.19 ? 548  ASP A N   1 
ATOM   3973 C CA  . ASP A 1 524 ? -29.346 20.458  76.735  1.00 113.19 ? 548  ASP A CA  1 
ATOM   3974 C C   . ASP A 1 524 ? -30.276 19.368  77.200  1.00 113.19 ? 548  ASP A C   1 
ATOM   3975 O O   . ASP A 1 524 ? -30.864 18.651  76.390  1.00 113.19 ? 548  ASP A O   1 
ATOM   3976 C CB  . ASP A 1 524 ? -30.163 21.698  76.376  1.00 133.24 ? 548  ASP A CB  1 
ATOM   3977 C CG  . ASP A 1 524 ? -31.465 21.777  77.140  1.00 133.24 ? 548  ASP A CG  1 
ATOM   3978 O OD1 . ASP A 1 524 ? -31.438 21.917  78.384  1.00 133.24 ? 548  ASP A OD1 1 
ATOM   3979 O OD2 . ASP A 1 524 ? -32.520 21.690  76.482  1.00 133.24 ? 548  ASP A OD2 1 
ATOM   3980 N N   . CYS A 1 525 ? -30.402 19.259  78.518  1.00 129.88 ? 549  CYS A N   1 
ATOM   3981 C CA  . CYS A 1 525 ? -31.286 18.274  79.125  1.00 129.88 ? 549  CYS A CA  1 
ATOM   3982 C C   . CYS A 1 525 ? -32.737 18.751  78.955  1.00 129.88 ? 549  CYS A C   1 
ATOM   3983 O O   . CYS A 1 525 ? -33.609 18.000  78.497  1.00 129.88 ? 549  CYS A O   1 
ATOM   3984 C CB  . CYS A 1 525 ? -30.924 18.076  80.607  1.00 113.56 ? 549  CYS A CB  1 
ATOM   3985 S SG  . CYS A 1 525 ? -29.567 16.885  80.927  1.00 113.56 ? 549  CYS A SG  1 
ATOM   3986 N N   . GLY A 1 526 ? -32.995 20.003  79.315  1.00 166.17 ? 550  GLY A N   1 
ATOM   3987 C CA  . GLY A 1 526 ? -34.331 20.526  79.122  1.00 166.17 ? 550  GLY A CA  1 
ATOM   3988 C C   . GLY A 1 526 ? -35.131 21.000  80.313  1.00 166.17 ? 550  GLY A C   1 
ATOM   3989 O O   . GLY A 1 526 ? -34.587 21.564  81.265  1.00 166.17 ? 550  GLY A O   1 
ATOM   3990 N N   . PRO A 1 527 ? -36.459 20.795  80.257  1.00 149.36 ? 551  PRO A N   1 
ATOM   3991 C CA  . PRO A 1 527 ? -37.431 21.170  81.285  1.00 149.36 ? 551  PRO A CA  1 
ATOM   3992 C C   . PRO A 1 527 ? -37.527 20.183  82.447  1.00 149.36 ? 551  PRO A C   1 
ATOM   3993 O O   . PRO A 1 527 ? -37.637 18.971  82.247  1.00 149.36 ? 551  PRO A O   1 
ATOM   3994 C CB  . PRO A 1 527 ? -38.727 21.259  80.494  1.00 189.46 ? 551  PRO A CB  1 
ATOM   3995 C CG  . PRO A 1 527 ? -38.573 20.137  79.502  1.00 189.46 ? 551  PRO A CG  1 
ATOM   3996 C CD  . PRO A 1 527 ? -37.146 20.309  79.040  1.00 189.46 ? 551  PRO A CD  1 
ATOM   3997 N N   . GLY A 1 528 ? -37.482 20.718  83.662  1.00 191.37 ? 552  GLY A N   1 
ATOM   3998 C CA  . GLY A 1 528 ? -37.580 19.888  84.849  1.00 191.37 ? 552  GLY A CA  1 
ATOM   3999 C C   . GLY A 1 528 ? -36.583 18.750  84.910  1.00 191.37 ? 552  GLY A C   1 
ATOM   4000 O O   . GLY A 1 528 ? -36.907 17.661  85.388  1.00 191.37 ? 552  GLY A O   1 
ATOM   4001 N N   . GLN A 1 529 ? -35.370 18.995  84.426  1.00 148.85 ? 553  GLN A N   1 
ATOM   4002 C CA  . GLN A 1 529 ? -34.332 17.973  84.445  1.00 148.85 ? 553  GLN A CA  1 
ATOM   4003 C C   . GLN A 1 529 ? -32.946 18.552  84.687  1.00 148.85 ? 553  GLN A C   1 
ATOM   4004 O O   . GLN A 1 529 ? -32.748 19.769  84.640  1.00 148.85 ? 553  GLN A O   1 
ATOM   4005 C CB  . GLN A 1 529 ? -34.343 17.188  83.140  1.00 122.19 ? 553  GLN A CB  1 
ATOM   4006 C CG  . GLN A 1 529 ? -35.665 16.533  82.874  1.00 122.19 ? 553  GLN A CG  1 
ATOM   4007 C CD  . GLN A 1 529 ? -35.638 15.717  81.620  1.00 122.19 ? 553  GLN A CD  1 
ATOM   4008 O OE1 . GLN A 1 529 ? -34.836 14.799  81.492  1.00 122.19 ? 553  GLN A OE1 1 
ATOM   4009 N NE2 . GLN A 1 529 ? -36.515 16.043  80.678  1.00 122.19 ? 553  GLN A NE2 1 
ATOM   4010 N N   . TRP A 1 530 ? -31.990 17.669  84.952  1.00 104.48 ? 554  TRP A N   1 
ATOM   4011 C CA  . TRP A 1 530 ? -30.625 18.083  85.215  1.00 104.48 ? 554  TRP A CA  1 
ATOM   4012 C C   . TRP A 1 530 ? -29.697 16.997  84.680  1.00 104.48 ? 554  TRP A C   1 
ATOM   4013 O O   . TRP A 1 530 ? -30.062 15.822  84.667  1.00 104.48 ? 554  TRP A O   1 
ATOM   4014 C CB  . TRP A 1 530 ? -30.441 18.263  86.715  1.00 127.78 ? 554  TRP A CB  1 
ATOM   4015 C CG  . TRP A 1 530 ? -29.307 19.136  87.059  1.00 127.78 ? 554  TRP A CG  1 
ATOM   4016 C CD1 . TRP A 1 530 ? -28.152 18.773  87.688  1.00 127.78 ? 554  TRP A CD1 1 
ATOM   4017 C CD2 . TRP A 1 530 ? -29.200 20.539  86.796  1.00 127.78 ? 554  TRP A CD2 1 
ATOM   4018 N NE1 . TRP A 1 530 ? -27.326 19.867  87.838  1.00 127.78 ? 554  TRP A NE1 1 
ATOM   4019 C CE2 . TRP A 1 530 ? -27.945 20.965  87.300  1.00 127.78 ? 554  TRP A CE2 1 
ATOM   4020 C CE3 . TRP A 1 530 ? -30.043 21.482  86.186  1.00 127.78 ? 554  TRP A CE3 1 
ATOM   4021 C CZ2 . TRP A 1 530 ? -27.509 22.292  87.211  1.00 127.78 ? 554  TRP A CZ2 1 
ATOM   4022 C CZ3 . TRP A 1 530 ? -29.612 22.803  86.097  1.00 127.78 ? 554  TRP A CZ3 1 
ATOM   4023 C CH2 . TRP A 1 530 ? -28.353 23.194  86.611  1.00 127.78 ? 554  TRP A CH2 1 
ATOM   4024 N N   . PRO A 1 531 ? -28.490 17.372  84.218  1.00 119.18 ? 555  PRO A N   1 
ATOM   4025 C CA  . PRO A 1 531 ? -27.518 16.416  83.679  1.00 119.18 ? 555  PRO A CA  1 
ATOM   4026 C C   . PRO A 1 531 ? -26.746 15.713  84.787  1.00 119.18 ? 555  PRO A C   1 
ATOM   4027 O O   . PRO A 1 531 ? -26.308 16.362  85.739  1.00 119.18 ? 555  PRO A O   1 
ATOM   4028 C CB  . PRO A 1 531 ? -26.609 17.305  82.852  1.00 133.77 ? 555  PRO A CB  1 
ATOM   4029 C CG  . PRO A 1 531 ? -26.505 18.516  83.724  1.00 133.77 ? 555  PRO A CG  1 
ATOM   4030 C CD  . PRO A 1 531 ? -27.961 18.746  84.123  1.00 133.77 ? 555  PRO A CD  1 
ATOM   4031 N N   . THR A 1 532 ? -26.569 14.400  84.658  1.00 158.31 ? 556  THR A N   1 
ATOM   4032 C CA  . THR A 1 532 ? -25.840 13.620  85.658  1.00 158.31 ? 556  THR A CA  1 
ATOM   4033 C C   . THR A 1 532 ? -24.480 14.238  85.989  1.00 158.31 ? 556  THR A C   1 
ATOM   4034 O O   . THR A 1 532 ? -23.997 15.118  85.274  1.00 158.31 ? 556  THR A O   1 
ATOM   4035 C CB  . THR A 1 532 ? -25.625 12.171  85.188  1.00 128.64 ? 556  THR A CB  1 
ATOM   4036 O OG1 . THR A 1 532 ? -25.115 12.176  83.850  1.00 128.64 ? 556  THR A OG1 1 
ATOM   4037 C CG2 . THR A 1 532 ? -26.933 11.393  85.237  1.00 128.64 ? 556  THR A CG2 1 
ATOM   4038 N N   . ALA A 1 533 ? -23.866 13.765  87.070  1.00 122.03 ? 557  ALA A N   1 
ATOM   4039 C CA  . ALA A 1 533 ? -22.576 14.285  87.524  1.00 122.03 ? 557  ALA A CA  1 
ATOM   4040 C C   . ALA A 1 533 ? -21.476 14.240  86.469  1.00 122.03 ? 557  ALA A C   1 
ATOM   4041 O O   . ALA A 1 533 ? -20.763 15.227  86.250  1.00 122.03 ? 557  ALA A O   1 
ATOM   4042 C CB  . ALA A 1 533 ? -22.128 13.528  88.766  1.00 265.63 ? 557  ALA A CB  1 
ATOM   4043 N N   . ASP A 1 534 ? -21.343 13.082  85.833  1.00 173.71 ? 558  ASP A N   1 
ATOM   4044 C CA  . ASP A 1 534 ? -20.344 12.854  84.798  1.00 173.71 ? 558  ASP A CA  1 
ATOM   4045 C C   . ASP A 1 534 ? -20.738 13.521  83.479  1.00 173.71 ? 558  ASP A C   1 
ATOM   4046 O O   . ASP A 1 534 ? -19.925 13.607  82.558  1.00 173.71 ? 558  ASP A O   1 
ATOM   4047 C CB  . ASP A 1 534 ? -20.209 11.361  84.570  1.00 137.13 ? 558  ASP A CB  1 
ATOM   4048 C CG  . ASP A 1 534 ? -21.507 10.740  84.100  1.00 137.13 ? 558  ASP A CG  1 
ATOM   4049 O OD1 . ASP A 1 534 ? -21.949 11.083  82.985  1.00 137.13 ? 558  ASP A OD1 1 
ATOM   4050 O OD2 . ASP A 1 534 ? -22.092 9.927   84.845  1.00 137.13 ? 558  ASP A OD2 1 
ATOM   4051 N N   . LEU A 1 535 ? -21.993 13.967  83.396  1.00 126.58 ? 559  LEU A N   1 
ATOM   4052 C CA  . LEU A 1 535 ? -22.537 14.628  82.207  1.00 126.58 ? 559  LEU A CA  1 
ATOM   4053 C C   . LEU A 1 535 ? -22.795 13.655  81.062  1.00 126.58 ? 559  LEU A C   1 
ATOM   4054 O O   . LEU A 1 535 ? -22.414 13.908  79.923  1.00 126.58 ? 559  LEU A O   1 
ATOM   4055 C CB  . LEU A 1 535 ? -21.602 15.754  81.736  1.00 151.52 ? 559  LEU A CB  1 
ATOM   4056 C CG  . LEU A 1 535 ? -21.651 17.131  82.424  1.00 151.52 ? 559  LEU A CG  1 
ATOM   4057 C CD1 . LEU A 1 535 ? -21.475 17.015  83.936  1.00 151.52 ? 559  LEU A CD1 1 
ATOM   4058 C CD2 . LEU A 1 535 ? -20.559 18.008  81.832  1.00 151.52 ? 559  LEU A CD2 1 
ATOM   4059 N N   . SER A 1 536 ? -23.452 12.543  81.371  1.00 114.07 ? 560  SER A N   1 
ATOM   4060 C CA  . SER A 1 536 ? -23.769 11.543  80.359  1.00 114.07 ? 560  SER A CA  1 
ATOM   4061 C C   . SER A 1 536 ? -25.281 11.369  80.192  1.00 114.07 ? 560  SER A C   1 
ATOM   4062 O O   . SER A 1 536 ? -25.741 10.690  79.266  1.00 114.07 ? 560  SER A O   1 
ATOM   4063 C CB  . SER A 1 536 ? -23.135 10.192  80.719  1.00 142.00 ? 560  SER A CB  1 
ATOM   4064 O OG  . SER A 1 536 ? -23.638 9.682   81.943  1.00 142.00 ? 560  SER A OG  1 
ATOM   4065 N N   . GLY A 1 537 ? -26.046 11.986  81.092  1.00 128.19 ? 561  GLY A N   1 
ATOM   4066 C CA  . GLY A 1 537 ? -27.496 11.880  81.039  1.00 128.19 ? 561  GLY A CA  1 
ATOM   4067 C C   . GLY A 1 537 ? -28.227 12.898  81.898  1.00 128.19 ? 561  GLY A C   1 
ATOM   4068 O O   . GLY A 1 537 ? -27.611 13.793  82.480  1.00 128.19 ? 561  GLY A O   1 
ATOM   4069 N N   . CYS A 1 538 ? -29.547 12.752  81.990  1.00 170.35 ? 562  CYS A N   1 
ATOM   4070 C CA  . CYS A 1 538 ? -30.358 13.685  82.766  1.00 170.35 ? 562  CYS A CA  1 
ATOM   4071 C C   . CYS A 1 538 ? -31.237 13.003  83.814  1.00 170.35 ? 562  CYS A C   1 
ATOM   4072 O O   . CYS A 1 538 ? -31.966 12.056  83.503  1.00 170.35 ? 562  CYS A O   1 
ATOM   4073 C CB  . CYS A 1 538 ? -31.235 14.499  81.820  1.00 241.03 ? 562  CYS A CB  1 
ATOM   4074 S SG  . CYS A 1 538 ? -30.366 15.111  80.339  1.00 241.03 ? 562  CYS A SG  1 
ATOM   4075 N N   . TYR A 1 539 ? -31.178 13.503  85.049  1.00 115.74 ? 563  TYR A N   1 
ATOM   4076 C CA  . TYR A 1 539 ? -31.958 12.928  86.137  1.00 115.74 ? 563  TYR A CA  1 
ATOM   4077 C C   . TYR A 1 539 ? -33.144 13.777  86.553  1.00 115.74 ? 563  TYR A C   1 
ATOM   4078 O O   . TYR A 1 539 ? -32.994 14.862  87.106  1.00 115.74 ? 563  TYR A O   1 
ATOM   4079 C CB  . TYR A 1 539 ? -31.055 12.620  87.346  1.00 114.42 ? 563  TYR A CB  1 
ATOM   4080 C CG  . TYR A 1 539 ? -30.493 13.801  88.113  1.00 114.42 ? 563  TYR A CG  1 
ATOM   4081 C CD1 . TYR A 1 539 ? -31.252 14.451  89.078  1.00 114.42 ? 563  TYR A CD1 1 
ATOM   4082 C CD2 . TYR A 1 539 ? -29.182 14.231  87.908  1.00 114.42 ? 563  TYR A CD2 1 
ATOM   4083 C CE1 . TYR A 1 539 ? -30.722 15.500  89.826  1.00 114.42 ? 563  TYR A CE1 1 
ATOM   4084 C CE2 . TYR A 1 539 ? -28.639 15.281  88.651  1.00 114.42 ? 563  TYR A CE2 1 
ATOM   4085 C CZ  . TYR A 1 539 ? -29.417 15.916  89.611  1.00 114.42 ? 563  TYR A CZ  1 
ATOM   4086 O OH  . TYR A 1 539 ? -28.908 16.974  90.347  1.00 114.42 ? 563  TYR A OH  1 
ATOM   4087 N N   . ASN A 1 540 ? -34.328 13.251  86.261  1.00 187.88 ? 564  ASN A N   1 
ATOM   4088 C CA  . ASN A 1 540 ? -35.594 13.903  86.563  1.00 187.88 ? 564  ASN A CA  1 
ATOM   4089 C C   . ASN A 1 540 ? -35.659 14.463  87.980  1.00 187.88 ? 564  ASN A C   1 
ATOM   4090 O O   . ASN A 1 540 ? -35.625 13.720  88.960  1.00 187.88 ? 564  ASN A O   1 
ATOM   4091 C CB  . ASN A 1 540 ? -36.736 12.910  86.334  1.00 162.23 ? 564  ASN A CB  1 
ATOM   4092 C CG  . ASN A 1 540 ? -36.857 12.478  84.875  1.00 162.23 ? 564  ASN A CG  1 
ATOM   4093 O OD1 . ASN A 1 540 ? -37.367 13.227  84.039  1.00 162.23 ? 564  ASN A OD1 1 
ATOM   4094 N ND2 . ASN A 1 540 ? -36.379 11.270  84.564  1.00 162.23 ? 564  ASN A ND2 1 
ATOM   4095 N N   . LEU A 1 541 ? -35.760 15.784  88.071  1.00 234.40 ? 565  LEU A N   1 
ATOM   4096 C CA  . LEU A 1 541 ? -35.828 16.479  89.350  1.00 234.40 ? 565  LEU A CA  1 
ATOM   4097 C C   . LEU A 1 541 ? -37.259 16.604  89.873  1.00 234.40 ? 565  LEU A C   1 
ATOM   4098 O O   . LEU A 1 541 ? -38.199 16.786  89.096  1.00 234.40 ? 565  LEU A O   1 
ATOM   4099 C CB  . LEU A 1 541 ? -35.207 17.872  89.210  1.00 151.78 ? 565  LEU A CB  1 
ATOM   4100 C CG  . LEU A 1 541 ? -33.679 17.918  89.169  1.00 151.78 ? 565  LEU A CG  1 
ATOM   4101 C CD1 . LEU A 1 541 ? -33.180 19.315  88.811  1.00 151.78 ? 565  LEU A CD1 1 
ATOM   4102 C CD2 . LEU A 1 541 ? -33.156 17.495  90.530  1.00 151.78 ? 565  LEU A CD2 1 
ATOM   4103 N N   . PRO A 1 542 ? -37.438 16.500  91.203  1.00 368.89 ? 566  PRO A N   1 
ATOM   4104 C CA  . PRO A 1 542 ? -38.741 16.599  91.875  1.00 368.89 ? 566  PRO A CA  1 
ATOM   4105 C C   . PRO A 1 542 ? -39.209 18.048  92.088  1.00 368.89 ? 566  PRO A C   1 
ATOM   4106 O O   . PRO A 1 542 ? -39.507 18.755  91.123  1.00 368.89 ? 566  PRO A O   1 
ATOM   4107 C CB  . PRO A 1 542 ? -38.497 15.860  93.187  1.00 211.83 ? 566  PRO A CB  1 
ATOM   4108 C CG  . PRO A 1 542 ? -37.082 16.215  93.494  1.00 211.83 ? 566  PRO A CG  1 
ATOM   4109 C CD  . PRO A 1 542 ? -36.402 16.045  92.150  1.00 211.83 ? 566  PRO A CD  1 
ATOM   4110 N N   . GLU A 1 543 ? -39.282 18.475  93.350  1.00 151.30 ? 567  GLU A N   1 
ATOM   4111 C CA  . GLU A 1 543 ? -39.703 19.835  93.701  1.00 151.30 ? 567  GLU A CA  1 
ATOM   4112 C C   . GLU A 1 543 ? -41.184 20.075  93.389  1.00 151.30 ? 567  GLU A C   1 
ATOM   4113 O O   . GLU A 1 543 ? -41.942 20.417  94.323  1.00 151.30 ? 567  GLU A O   1 
ATOM   4114 C CB  . GLU A 1 543 ? -38.847 20.859  92.945  1.00 253.39 ? 567  GLU A CB  1 
ATOM   4115 C CG  . GLU A 1 543 ? -38.857 22.263  93.531  1.00 253.39 ? 567  GLU A CG  1 
ATOM   4116 C CD  . GLU A 1 543 ? -37.962 22.394  94.749  1.00 253.39 ? 567  GLU A CD  1 
ATOM   4117 O OE1 . GLU A 1 543 ? -38.186 21.665  95.736  1.00 253.39 ? 567  GLU A OE1 1 
ATOM   4118 O OE2 . GLU A 1 543 ? -37.031 23.228  94.716  1.00 253.39 ? 567  GLU A OE2 1 
ATOM   4119 N N   . ARG B 1 6   ? 42.038  12.806  15.357  1.00 195.00 ? 30   ARG B N   1 
ATOM   4120 C CA  . ARG B 1 6   ? 41.416  13.673  16.405  1.00 195.00 ? 30   ARG B CA  1 
ATOM   4121 C C   . ARG B 1 6   ? 41.819  15.146  16.270  1.00 195.00 ? 30   ARG B C   1 
ATOM   4122 O O   . ARG B 1 6   ? 42.854  15.575  16.792  1.00 195.00 ? 30   ARG B O   1 
ATOM   4123 C CB  . ARG B 1 6   ? 41.795  13.170  17.799  1.00 201.27 ? 30   ARG B CB  1 
ATOM   4124 C CG  . ARG B 1 6   ? 41.227  14.013  18.931  1.00 201.27 ? 30   ARG B CG  1 
ATOM   4125 C CD  . ARG B 1 6   ? 39.709  13.942  18.967  1.00 201.27 ? 30   ARG B CD  1 
ATOM   4126 N NE  . ARG B 1 6   ? 39.139  14.866  19.943  1.00 201.27 ? 30   ARG B NE  1 
ATOM   4127 C CZ  . ARG B 1 6   ? 39.406  14.848  21.246  1.00 201.27 ? 30   ARG B CZ  1 
ATOM   4128 N NH1 . ARG B 1 6   ? 40.241  13.949  21.749  1.00 201.27 ? 30   ARG B NH1 1 
ATOM   4129 N NH2 . ARG B 1 6   ? 38.834  15.734  22.049  1.00 201.27 ? 30   ARG B NH2 1 
ATOM   4130 N N   . ARG B 1 7   ? 40.984  15.916  15.577  1.00 135.90 ? 31   ARG B N   1 
ATOM   4131 C CA  . ARG B 1 7   ? 41.234  17.335  15.355  1.00 135.90 ? 31   ARG B CA  1 
ATOM   4132 C C   . ARG B 1 7   ? 40.244  18.238  16.079  1.00 135.90 ? 31   ARG B C   1 
ATOM   4133 O O   . ARG B 1 7   ? 39.031  18.021  16.051  1.00 135.90 ? 31   ARG B O   1 
ATOM   4134 C CB  . ARG B 1 7   ? 41.205  17.641  13.856  1.00 237.63 ? 31   ARG B CB  1 
ATOM   4135 C CG  . ARG B 1 7   ? 42.368  17.031  13.098  1.00 237.63 ? 31   ARG B CG  1 
ATOM   4136 C CD  . ARG B 1 7   ? 42.306  17.329  11.613  1.00 237.63 ? 31   ARG B CD  1 
ATOM   4137 N NE  . ARG B 1 7   ? 41.281  16.546  10.930  1.00 237.63 ? 31   ARG B NE  1 
ATOM   4138 C CZ  . ARG B 1 7   ? 41.129  16.516  9.610   1.00 237.63 ? 31   ARG B CZ  1 
ATOM   4139 N NH1 . ARG B 1 7   ? 41.938  17.229  8.837   1.00 237.63 ? 31   ARG B NH1 1 
ATOM   4140 N NH2 . ARG B 1 7   ? 40.176  15.770  9.059   1.00 237.63 ? 31   ARG B NH2 1 
ATOM   4141 N N   . GLU B 1 8   ? 40.787  19.260  16.726  1.00 117.25 ? 32   GLU B N   1 
ATOM   4142 C CA  . GLU B 1 8   ? 39.996  20.224  17.468  1.00 117.25 ? 32   GLU B CA  1 
ATOM   4143 C C   . GLU B 1 8   ? 40.513  21.616  17.129  1.00 117.25 ? 32   GLU B C   1 
ATOM   4144 O O   . GLU B 1 8   ? 41.394  21.766  16.290  1.00 117.25 ? 32   GLU B O   1 
ATOM   4145 C CB  . GLU B 1 8   ? 40.134  19.956  18.970  1.00 127.41 ? 32   GLU B CB  1 
ATOM   4146 C CG  . GLU B 1 8   ? 41.578  19.781  19.433  1.00 127.41 ? 32   GLU B CG  1 
ATOM   4147 C CD  . GLU B 1 8   ? 41.698  19.465  20.915  1.00 127.41 ? 32   GLU B CD  1 
ATOM   4148 O OE1 . GLU B 1 8   ? 41.079  18.480  21.370  1.00 127.41 ? 32   GLU B OE1 1 
ATOM   4149 O OE2 . GLU B 1 8   ? 42.419  20.200  21.622  1.00 127.41 ? 32   GLU B OE2 1 
ATOM   4150 N N   . ILE B 1 9   ? 39.946  22.632  17.763  1.00 114.60 ? 33   ILE B N   1 
ATOM   4151 C CA  . ILE B 1 9   ? 40.387  23.999  17.546  1.00 114.60 ? 33   ILE B CA  1 
ATOM   4152 C C   . ILE B 1 9   ? 40.533  24.660  18.897  1.00 114.60 ? 33   ILE B C   1 
ATOM   4153 O O   . ILE B 1 9   ? 39.568  24.751  19.658  1.00 114.60 ? 33   ILE B O   1 
ATOM   4154 C CB  . ILE B 1 9   ? 39.385  24.826  16.732  1.00 112.50 ? 33   ILE B CB  1 
ATOM   4155 C CG1 . ILE B 1 9   ? 39.293  24.286  15.308  1.00 112.50 ? 33   ILE B CG1 1 
ATOM   4156 C CG2 . ILE B 1 9   ? 39.832  26.278  16.701  1.00 112.50 ? 33   ILE B CG2 1 
ATOM   4157 C CD1 . ILE B 1 9   ? 38.496  25.185  14.371  1.00 112.50 ? 33   ILE B CD1 1 
ATOM   4158 N N   . LYS B 1 10  ? 41.741  25.120  19.194  1.00 110.10 ? 34   LYS B N   1 
ATOM   4159 C CA  . LYS B 1 10  ? 42.004  25.777  20.462  1.00 110.10 ? 34   LYS B CA  1 
ATOM   4160 C C   . LYS B 1 10  ? 42.595  27.168  20.298  1.00 110.10 ? 34   LYS B C   1 
ATOM   4161 O O   . LYS B 1 10  ? 43.731  27.337  19.850  1.00 110.10 ? 34   LYS B O   1 
ATOM   4162 C CB  . LYS B 1 10  ? 42.962  24.950  21.309  1.00 106.85 ? 34   LYS B CB  1 
ATOM   4163 C CG  . LYS B 1 10  ? 42.367  23.765  22.053  1.00 106.85 ? 34   LYS B CG  1 
ATOM   4164 C CD  . LYS B 1 10  ? 43.492  23.122  22.865  1.00 106.85 ? 34   LYS B CD  1 
ATOM   4165 C CE  . LYS B 1 10  ? 43.047  22.010  23.784  1.00 106.85 ? 34   LYS B CE  1 
ATOM   4166 N NZ  . LYS B 1 10  ? 44.254  21.449  24.464  1.00 106.85 ? 34   LYS B NZ  1 
ATOM   4167 N N   . ILE B 1 11  ? 41.806  28.162  20.669  1.00 94.94  ? 35   ILE B N   1 
ATOM   4168 C CA  . ILE B 1 11  ? 42.227  29.548  20.617  1.00 94.94  ? 35   ILE B CA  1 
ATOM   4169 C C   . ILE B 1 11  ? 42.124  29.975  22.076  1.00 94.94  ? 35   ILE B C   1 
ATOM   4170 O O   . ILE B 1 11  ? 41.017  30.027  22.616  1.00 94.94  ? 35   ILE B O   1 
ATOM   4171 C CB  . ILE B 1 11  ? 41.244  30.402  19.788  1.00 159.41 ? 35   ILE B CB  1 
ATOM   4172 C CG1 . ILE B 1 11  ? 41.081  29.817  18.381  1.00 159.41 ? 35   ILE B CG1 1 
ATOM   4173 C CG2 . ILE B 1 11  ? 41.734  31.843  19.730  1.00 159.41 ? 35   ILE B CG2 1 
ATOM   4174 C CD1 . ILE B 1 11  ? 42.296  29.975  17.483  1.00 159.41 ? 35   ILE B CD1 1 
ATOM   4175 N N   . GLU B 1 12  ? 43.248  30.257  22.730  1.00 116.62 ? 36   GLU B N   1 
ATOM   4176 C CA  . GLU B 1 12  ? 43.164  30.651  24.131  1.00 116.62 ? 36   GLU B CA  1 
ATOM   4177 C C   . GLU B 1 12  ? 42.482  32.013  24.271  1.00 116.62 ? 36   GLU B C   1 
ATOM   4178 O O   . GLU B 1 12  ? 42.451  32.799  23.319  1.00 116.62 ? 36   GLU B O   1 
ATOM   4179 C CB  . GLU B 1 12  ? 44.545  30.690  24.783  1.00 180.37 ? 36   GLU B CB  1 
ATOM   4180 C CG  . GLU B 1 12  ? 44.458  30.909  26.284  1.00 180.37 ? 36   GLU B CG  1 
ATOM   4181 C CD  . GLU B 1 12  ? 45.800  31.145  26.926  1.00 180.37 ? 36   GLU B CD  1 
ATOM   4182 O OE1 . GLU B 1 12  ? 45.831  31.406  28.147  1.00 180.37 ? 36   GLU B OE1 1 
ATOM   4183 O OE2 . GLU B 1 12  ? 46.822  31.072  26.212  1.00 180.37 ? 36   GLU B OE2 1 
ATOM   4184 N N   . GLY B 1 13  ? 41.930  32.275  25.458  1.00 87.28  ? 37   GLY B N   1 
ATOM   4185 C CA  . GLY B 1 13  ? 41.245  33.531  25.728  1.00 87.28  ? 37   GLY B CA  1 
ATOM   4186 C C   . GLY B 1 13  ? 40.965  33.739  27.208  1.00 87.28  ? 37   GLY B C   1 
ATOM   4187 O O   . GLY B 1 13  ? 41.200  32.847  28.027  1.00 87.28  ? 37   GLY B O   1 
ATOM   4188 N N   . ASP B 1 14  ? 40.469  34.924  27.556  1.00 101.01 ? 38   ASP B N   1 
ATOM   4189 C CA  . ASP B 1 14  ? 40.141  35.247  28.943  1.00 101.01 ? 38   ASP B CA  1 
ATOM   4190 C C   . ASP B 1 14  ? 38.879  34.499  29.372  1.00 101.01 ? 38   ASP B C   1 
ATOM   4191 O O   . ASP B 1 14  ? 38.621  34.303  30.561  1.00 101.01 ? 38   ASP B O   1 
ATOM   4192 C CB  . ASP B 1 14  ? 39.911  36.753  29.092  1.00 149.63 ? 38   ASP B CB  1 
ATOM   4193 C CG  . ASP B 1 14  ? 41.159  37.567  28.814  1.00 149.63 ? 38   ASP B CG  1 
ATOM   4194 O OD1 . ASP B 1 14  ? 41.656  37.524  27.670  1.00 149.63 ? 38   ASP B OD1 1 
ATOM   4195 O OD2 . ASP B 1 14  ? 41.641  38.250  29.744  1.00 149.63 ? 38   ASP B OD2 1 
ATOM   4196 N N   . LEU B 1 15  ? 38.101  34.092  28.376  1.00 89.48  ? 39   LEU B N   1 
ATOM   4197 C CA  . LEU B 1 15  ? 36.855  33.370  28.568  1.00 89.48  ? 39   LEU B CA  1 
ATOM   4198 C C   . LEU B 1 15  ? 36.704  32.506  27.341  1.00 89.48  ? 39   LEU B C   1 
ATOM   4199 O O   . LEU B 1 15  ? 36.918  32.990  26.238  1.00 89.48  ? 39   LEU B O   1 
ATOM   4200 C CB  . LEU B 1 15  ? 35.699  34.354  28.621  1.00 42.49  ? 39   LEU B CB  1 
ATOM   4201 C CG  . LEU B 1 15  ? 34.866  34.273  29.894  1.00 42.49  ? 39   LEU B CG  1 
ATOM   4202 C CD1 . LEU B 1 15  ? 35.811  34.457  31.101  1.00 42.49  ? 39   LEU B CD1 1 
ATOM   4203 C CD2 . LEU B 1 15  ? 33.717  35.303  29.864  1.00 42.49  ? 39   LEU B CD2 1 
ATOM   4204 N N   . VAL B 1 16  ? 36.331  31.245  27.506  1.00 84.38  ? 40   VAL B N   1 
ATOM   4205 C CA  . VAL B 1 16  ? 36.197  30.390  26.334  1.00 84.38  ? 40   VAL B CA  1 
ATOM   4206 C C   . VAL B 1 16  ? 34.814  29.814  26.043  1.00 84.38  ? 40   VAL B C   1 
ATOM   4207 O O   . VAL B 1 16  ? 34.037  29.541  26.956  1.00 84.38  ? 40   VAL B O   1 
ATOM   4208 C CB  . VAL B 1 16  ? 37.191  29.235  26.401  1.00 62.97  ? 40   VAL B CB  1 
ATOM   4209 C CG1 . VAL B 1 16  ? 37.147  28.420  25.108  1.00 62.97  ? 40   VAL B CG1 1 
ATOM   4210 C CG2 . VAL B 1 16  ? 38.571  29.788  26.633  1.00 62.97  ? 40   VAL B CG2 1 
ATOM   4211 N N   . LEU B 1 17  ? 34.523  29.630  24.756  1.00 83.93  ? 41   LEU B N   1 
ATOM   4212 C CA  . LEU B 1 17  ? 33.249  29.080  24.311  1.00 83.93  ? 41   LEU B CA  1 
ATOM   4213 C C   . LEU B 1 17  ? 33.465  27.768  23.587  1.00 83.93  ? 41   LEU B C   1 
ATOM   4214 O O   . LEU B 1 17  ? 34.295  27.677  22.693  1.00 83.93  ? 41   LEU B O   1 
ATOM   4215 C CB  . LEU B 1 17  ? 32.574  30.047  23.363  1.00 70.22  ? 41   LEU B CB  1 
ATOM   4216 C CG  . LEU B 1 17  ? 32.185  31.372  23.997  1.00 70.22  ? 41   LEU B CG  1 
ATOM   4217 C CD1 . LEU B 1 17  ? 31.755  32.329  22.910  1.00 70.22  ? 41   LEU B CD1 1 
ATOM   4218 C CD2 . LEU B 1 17  ? 31.069  31.159  24.995  1.00 70.22  ? 41   LEU B CD2 1 
ATOM   4219 N N   . GLY B 1 18  ? 32.724  26.742  23.967  1.00 96.99  ? 42   GLY B N   1 
ATOM   4220 C CA  . GLY B 1 18  ? 32.889  25.481  23.281  1.00 96.99  ? 42   GLY B CA  1 
ATOM   4221 C C   . GLY B 1 18  ? 32.165  25.582  21.954  1.00 96.99  ? 42   GLY B C   1 
ATOM   4222 O O   . GLY B 1 18  ? 31.332  26.477  21.770  1.00 96.99  ? 42   GLY B O   1 
ATOM   4223 N N   . GLY B 1 19  ? 32.480  24.680  21.026  1.00 58.99  ? 43   GLY B N   1 
ATOM   4224 C CA  . GLY B 1 19  ? 31.814  24.698  19.737  1.00 58.99  ? 43   GLY B CA  1 
ATOM   4225 C C   . GLY B 1 19  ? 31.575  23.311  19.193  1.00 58.99  ? 43   GLY B C   1 
ATOM   4226 O O   . GLY B 1 19  ? 32.474  22.476  19.201  1.00 58.99  ? 43   GLY B O   1 
ATOM   4227 N N   . LEU B 1 20  ? 30.359  23.065  18.723  1.00 87.05  ? 44   LEU B N   1 
ATOM   4228 C CA  . LEU B 1 20  ? 30.016  21.766  18.155  1.00 87.05  ? 44   LEU B CA  1 
ATOM   4229 C C   . LEU B 1 20  ? 29.413  21.909  16.768  1.00 87.05  ? 44   LEU B C   1 
ATOM   4230 O O   . LEU B 1 20  ? 28.364  22.525  16.603  1.00 87.05  ? 44   LEU B O   1 
ATOM   4231 C CB  . LEU B 1 20  ? 29.026  21.034  19.056  1.00 98.93  ? 44   LEU B CB  1 
ATOM   4232 C CG  . LEU B 1 20  ? 29.555  20.565  20.412  1.00 98.93  ? 44   LEU B CG  1 
ATOM   4233 C CD1 . LEU B 1 20  ? 28.455  19.826  21.139  1.00 98.93  ? 44   LEU B CD1 1 
ATOM   4234 C CD2 . LEU B 1 20  ? 30.758  19.656  20.220  1.00 98.93  ? 44   LEU B CD2 1 
ATOM   4235 N N   . PHE B 1 21  ? 30.082  21.341  15.772  1.00 87.99  ? 45   PHE B N   1 
ATOM   4236 C CA  . PHE B 1 21  ? 29.603  21.422  14.405  1.00 87.99  ? 45   PHE B CA  1 
ATOM   4237 C C   . PHE B 1 21  ? 29.790  20.104  13.683  1.00 87.99  ? 45   PHE B C   1 
ATOM   4238 O O   . PHE B 1 21  ? 30.799  19.422  13.856  1.00 87.99  ? 45   PHE B O   1 
ATOM   4239 C CB  . PHE B 1 21  ? 30.358  22.490  13.623  1.00 88.27  ? 45   PHE B CB  1 
ATOM   4240 C CG  . PHE B 1 21  ? 30.251  23.850  14.197  1.00 88.27  ? 45   PHE B CG  1 
ATOM   4241 C CD1 . PHE B 1 21  ? 31.016  24.217  15.286  1.00 88.27  ? 45   PHE B CD1 1 
ATOM   4242 C CD2 . PHE B 1 21  ? 29.388  24.775  13.642  1.00 88.27  ? 45   PHE B CD2 1 
ATOM   4243 C CE1 . PHE B 1 21  ? 30.922  25.496  15.819  1.00 88.27  ? 45   PHE B CE1 1 
ATOM   4244 C CE2 . PHE B 1 21  ? 29.283  26.055  14.162  1.00 88.27  ? 45   PHE B CE2 1 
ATOM   4245 C CZ  . PHE B 1 21  ? 30.052  26.417  15.253  1.00 88.27  ? 45   PHE B CZ  1 
ATOM   4246 N N   . PRO B 1 22  ? 28.815  19.732  12.853  1.00 119.63 ? 46   PRO B N   1 
ATOM   4247 C CA  . PRO B 1 22  ? 28.828  18.499  12.067  1.00 119.63 ? 46   PRO B CA  1 
ATOM   4248 C C   . PRO B 1 22  ? 29.760  18.716  10.886  1.00 119.63 ? 46   PRO B C   1 
ATOM   4249 O O   . PRO B 1 22  ? 29.349  18.652  9.728   1.00 119.63 ? 46   PRO B O   1 
ATOM   4250 C CB  . PRO B 1 22  ? 27.385  18.373  11.637  1.00 107.52 ? 46   PRO B CB  1 
ATOM   4251 C CG  . PRO B 1 22  ? 27.004  19.804  11.425  1.00 107.52 ? 46   PRO B CG  1 
ATOM   4252 C CD  . PRO B 1 22  ? 27.560  20.472  12.645  1.00 107.52 ? 46   PRO B CD  1 
ATOM   4253 N N   . ILE B 1 23  ? 31.019  18.990  11.194  1.00 107.37 ? 47   ILE B N   1 
ATOM   4254 C CA  . ILE B 1 23  ? 32.005  19.253  10.169  1.00 107.37 ? 47   ILE B CA  1 
ATOM   4255 C C   . ILE B 1 23  ? 32.120  18.092  9.205   1.00 107.37 ? 47   ILE B C   1 
ATOM   4256 O O   . ILE B 1 23  ? 32.278  18.294  8.013   1.00 107.37 ? 47   ILE B O   1 
ATOM   4257 C CB  . ILE B 1 23  ? 33.361  19.564  10.797  1.00 102.88 ? 47   ILE B CB  1 
ATOM   4258 C CG1 . ILE B 1 23  ? 33.216  20.770  11.724  1.00 102.88 ? 47   ILE B CG1 1 
ATOM   4259 C CG2 . ILE B 1 23  ? 34.371  19.886  9.721   1.00 102.88 ? 47   ILE B CG2 1 
ATOM   4260 C CD1 . ILE B 1 23  ? 34.469  21.140  12.442  1.00 102.88 ? 47   ILE B CD1 1 
ATOM   4261 N N   . ASN B 1 24  ? 32.034  16.872  9.711   1.00 94.97  ? 48   ASN B N   1 
ATOM   4262 C CA  . ASN B 1 24  ? 32.098  15.705  8.841   1.00 94.97  ? 48   ASN B CA  1 
ATOM   4263 C C   . ASN B 1 24  ? 30.764  14.961  8.872   1.00 94.97  ? 48   ASN B C   1 
ATOM   4264 O O   . ASN B 1 24  ? 30.052  14.952  9.883   1.00 94.97  ? 48   ASN B O   1 
ATOM   4265 C CB  . ASN B 1 24  ? 33.234  14.766  9.264   1.00 115.84 ? 48   ASN B CB  1 
ATOM   4266 C CG  . ASN B 1 24  ? 34.587  15.220  8.747   1.00 115.84 ? 48   ASN B CG  1 
ATOM   4267 O OD1 . ASN B 1 24  ? 34.774  15.389  7.546   1.00 115.84 ? 48   ASN B OD1 1 
ATOM   4268 N ND2 . ASN B 1 24  ? 35.540  15.410  9.652   1.00 115.84 ? 48   ASN B ND2 1 
ATOM   4269 N N   . GLU B 1 25  ? 30.418  14.351  7.748   1.00 133.87 ? 49   GLU B N   1 
ATOM   4270 C CA  . GLU B 1 25  ? 29.173  13.604  7.660   1.00 133.87 ? 49   GLU B CA  1 
ATOM   4271 C C   . GLU B 1 25  ? 29.332  12.326  8.480   1.00 133.87 ? 49   GLU B C   1 
ATOM   4272 O O   . GLU B 1 25  ? 30.446  11.934  8.831   1.00 133.87 ? 49   GLU B O   1 
ATOM   4273 C CB  . GLU B 1 25  ? 28.869  13.254  6.199   1.00 234.95 ? 49   GLU B CB  1 
ATOM   4274 C CG  . GLU B 1 25  ? 27.387  13.186  5.863   1.00 234.95 ? 49   GLU B CG  1 
ATOM   4275 C CD  . GLU B 1 25  ? 26.725  14.552  5.892   1.00 234.95 ? 49   GLU B CD  1 
ATOM   4276 O OE1 . GLU B 1 25  ? 27.146  15.440  5.117   1.00 234.95 ? 49   GLU B OE1 1 
ATOM   4277 O OE2 . GLU B 1 25  ? 25.783  14.737  6.690   1.00 234.95 ? 49   GLU B OE2 1 
ATOM   4278 N N   . LYS B 1 26  ? 28.215  11.680  8.789   1.00 115.43 ? 50   LYS B N   1 
ATOM   4279 C CA  . LYS B 1 26  ? 28.255  10.447  9.558   1.00 115.43 ? 50   LYS B CA  1 
ATOM   4280 C C   . LYS B 1 26  ? 28.997  9.407   8.724   1.00 115.43 ? 50   LYS B C   1 
ATOM   4281 O O   . LYS B 1 26  ? 28.575  9.093   7.615   1.00 115.43 ? 50   LYS B O   1 
ATOM   4282 C CB  . LYS B 1 26  ? 26.828  9.972   9.843   1.00 173.21 ? 50   LYS B CB  1 
ATOM   4283 C CG  . LYS B 1 26  ? 26.736  8.745   10.738  1.00 173.21 ? 50   LYS B CG  1 
ATOM   4284 C CD  . LYS B 1 26  ? 25.337  8.129   10.693  1.00 173.21 ? 50   LYS B CD  1 
ATOM   4285 C CE  . LYS B 1 26  ? 25.027  7.534   9.317   1.00 173.21 ? 50   LYS B CE  1 
ATOM   4286 N NZ  . LYS B 1 26  ? 23.668  6.920   9.237   1.00 173.21 ? 50   LYS B NZ  1 
ATOM   4287 N N   . GLY B 1 27  ? 30.101  8.882   9.243   1.00 149.17 ? 51   GLY B N   1 
ATOM   4288 C CA  . GLY B 1 27  ? 30.846  7.884   8.495   1.00 149.17 ? 51   GLY B CA  1 
ATOM   4289 C C   . GLY B 1 27  ? 30.166  6.520   8.489   1.00 149.17 ? 51   GLY B C   1 
ATOM   4290 O O   . GLY B 1 27  ? 29.573  6.121   9.495   1.00 149.17 ? 51   GLY B O   1 
ATOM   4291 N N   . THR B 1 28  ? 30.253  5.801   7.366   1.00 170.74 ? 52   THR B N   1 
ATOM   4292 C CA  . THR B 1 28  ? 29.644  4.472   7.235   1.00 170.74 ? 52   THR B CA  1 
ATOM   4293 C C   . THR B 1 28  ? 30.612  3.354   7.594   1.00 170.74 ? 52   THR B C   1 
ATOM   4294 O O   . THR B 1 28  ? 31.813  3.457   7.357   1.00 170.74 ? 52   THR B O   1 
ATOM   4295 C CB  . THR B 1 28  ? 29.157  4.200   5.801   1.00 142.78 ? 52   THR B CB  1 
ATOM   4296 O OG1 . THR B 1 28  ? 30.255  4.356   4.894   1.00 142.78 ? 52   THR B OG1 1 
ATOM   4297 C CG2 . THR B 1 28  ? 28.025  5.153   5.423   1.00 142.78 ? 52   THR B CG2 1 
ATOM   4298 N N   . GLY B 1 29  ? 30.074  2.275   8.150   1.00 210.42 ? 53   GLY B N   1 
ATOM   4299 C CA  . GLY B 1 29  ? 30.910  1.157   8.535   1.00 210.42 ? 53   GLY B CA  1 
ATOM   4300 C C   . GLY B 1 29  ? 31.496  1.375   9.913   1.00 210.42 ? 53   GLY B C   1 
ATOM   4301 O O   . GLY B 1 29  ? 30.936  2.120   10.717  1.00 210.42 ? 53   GLY B O   1 
ATOM   4302 N N   . THR B 1 30  ? 32.626  0.727   10.184  1.00 246.27 ? 54   THR B N   1 
ATOM   4303 C CA  . THR B 1 30  ? 33.294  0.850   11.475  1.00 246.27 ? 54   THR B CA  1 
ATOM   4304 C C   . THR B 1 30  ? 33.730  2.286   11.751  1.00 246.27 ? 54   THR B C   1 
ATOM   4305 O O   . THR B 1 30  ? 33.688  2.745   12.894  1.00 246.27 ? 54   THR B O   1 
ATOM   4306 C CB  . THR B 1 30  ? 34.535  -0.073  11.558  1.00 196.41 ? 54   THR B CB  1 
ATOM   4307 O OG1 . THR B 1 30  ? 35.400  0.184   10.446  1.00 196.41 ? 54   THR B OG1 1 
ATOM   4308 C CG2 . THR B 1 30  ? 34.117  -1.538  11.543  1.00 196.41 ? 54   THR B CG2 1 
ATOM   4309 N N   . GLU B 1 31  ? 34.149  2.993   10.704  1.00 221.01 ? 55   GLU B N   1 
ATOM   4310 C CA  . GLU B 1 31  ? 34.581  4.378   10.852  1.00 221.01 ? 55   GLU B CA  1 
ATOM   4311 C C   . GLU B 1 31  ? 33.420  5.240   11.343  1.00 221.01 ? 55   GLU B C   1 
ATOM   4312 O O   . GLU B 1 31  ? 32.262  4.817   11.303  1.00 221.01 ? 55   GLU B O   1 
ATOM   4313 C CB  . GLU B 1 31  ? 35.129  4.919   9.524   1.00 218.38 ? 55   GLU B CB  1 
ATOM   4314 C CG  . GLU B 1 31  ? 34.241  4.663   8.318   1.00 218.38 ? 55   GLU B CG  1 
ATOM   4315 C CD  . GLU B 1 31  ? 34.784  5.293   7.045   1.00 218.38 ? 55   GLU B CD  1 
ATOM   4316 O OE1 . GLU B 1 31  ? 35.971  5.065   6.725   1.00 218.38 ? 55   GLU B OE1 1 
ATOM   4317 O OE2 . GLU B 1 31  ? 34.019  6.010   6.362   1.00 218.38 ? 55   GLU B OE2 1 
ATOM   4318 N N   . GLU B 1 32  ? 33.733  6.447   11.804  1.00 189.05 ? 56   GLU B N   1 
ATOM   4319 C CA  . GLU B 1 32  ? 32.714  7.347   12.326  1.00 189.05 ? 56   GLU B CA  1 
ATOM   4320 C C   . GLU B 1 32  ? 32.515  8.616   11.516  1.00 189.05 ? 56   GLU B C   1 
ATOM   4321 O O   . GLU B 1 32  ? 31.394  9.103   11.393  1.00 189.05 ? 56   GLU B O   1 
ATOM   4322 C CB  . GLU B 1 32  ? 33.055  7.721   13.765  1.00 171.02 ? 56   GLU B CB  1 
ATOM   4323 C CG  . GLU B 1 32  ? 32.978  6.556   14.732  1.00 171.02 ? 56   GLU B CG  1 
ATOM   4324 C CD  . GLU B 1 32  ? 33.797  6.788   15.987  1.00 171.02 ? 56   GLU B CD  1 
ATOM   4325 O OE1 . GLU B 1 32  ? 35.043  6.768   15.899  1.00 171.02 ? 56   GLU B OE1 1 
ATOM   4326 O OE2 . GLU B 1 32  ? 33.197  6.995   17.061  1.00 171.02 ? 56   GLU B OE2 1 
ATOM   4327 N N   . CYS B 1 33  ? 33.596  9.154   10.964  1.00 155.02 ? 57   CYS B N   1 
ATOM   4328 C CA  . CYS B 1 33  ? 33.492  10.385  10.192  1.00 155.02 ? 57   CYS B CA  1 
ATOM   4329 C C   . CYS B 1 33  ? 33.705  10.195  8.691   1.00 155.02 ? 57   CYS B C   1 
ATOM   4330 O O   . CYS B 1 33  ? 34.774  9.769   8.253   1.00 155.02 ? 57   CYS B O   1 
ATOM   4331 C CB  . CYS B 1 33  ? 34.486  11.404  10.742  1.00 239.27 ? 57   CYS B CB  1 
ATOM   4332 S SG  . CYS B 1 33  ? 34.405  11.562  12.555  1.00 239.27 ? 57   CYS B SG  1 
ATOM   4333 N N   . GLY B 1 34  ? 32.676  10.522  7.910   1.00 122.65 ? 58   GLY B N   1 
ATOM   4334 C CA  . GLY B 1 34  ? 32.753  10.389  6.463   1.00 122.65 ? 58   GLY B CA  1 
ATOM   4335 C C   . GLY B 1 34  ? 33.266  11.634  5.754   1.00 122.65 ? 58   GLY B C   1 
ATOM   4336 O O   . GLY B 1 34  ? 34.241  12.246  6.184   1.00 122.65 ? 58   GLY B O   1 
ATOM   4337 N N   . ARG B 1 35  ? 32.611  12.014  4.662   1.00 125.73 ? 59   ARG B N   1 
ATOM   4338 C CA  . ARG B 1 35  ? 33.025  13.191  3.903   1.00 125.73 ? 59   ARG B CA  1 
ATOM   4339 C C   . ARG B 1 35  ? 32.716  14.508  4.608   1.00 125.73 ? 59   ARG B C   1 
ATOM   4340 O O   . ARG B 1 35  ? 31.840  14.576  5.466   1.00 125.73 ? 59   ARG B O   1 
ATOM   4341 C CB  . ARG B 1 35  ? 32.373  13.172  2.520   1.00 243.83 ? 59   ARG B CB  1 
ATOM   4342 C CG  . ARG B 1 35  ? 32.983  12.143  1.581   1.00 243.83 ? 59   ARG B CG  1 
ATOM   4343 C CD  . ARG B 1 35  ? 32.232  12.011  0.261   1.00 243.83 ? 59   ARG B CD  1 
ATOM   4344 N NE  . ARG B 1 35  ? 32.166  13.255  -0.503  1.00 243.83 ? 59   ARG B NE  1 
ATOM   4345 C CZ  . ARG B 1 35  ? 31.304  14.240  -0.266  1.00 243.83 ? 59   ARG B CZ  1 
ATOM   4346 N NH1 . ARG B 1 35  ? 30.424  14.136  0.721   1.00 243.83 ? 59   ARG B NH1 1 
ATOM   4347 N NH2 . ARG B 1 35  ? 31.315  15.329  -1.022  1.00 243.83 ? 59   ARG B NH2 1 
ATOM   4348 N N   . ILE B 1 36  ? 33.453  15.553  4.245   1.00 85.84  ? 60   ILE B N   1 
ATOM   4349 C CA  . ILE B 1 36  ? 33.255  16.874  4.842   1.00 85.84  ? 60   ILE B CA  1 
ATOM   4350 C C   . ILE B 1 36  ? 31.866  17.408  4.534   1.00 85.84  ? 60   ILE B C   1 
ATOM   4351 O O   . ILE B 1 36  ? 31.386  17.320  3.410   1.00 85.84  ? 60   ILE B O   1 
ATOM   4352 C CB  . ILE B 1 36  ? 34.274  17.933  4.296   1.00 97.05  ? 60   ILE B CB  1 
ATOM   4353 C CG1 . ILE B 1 36  ? 35.697  17.603  4.756   1.00 97.05  ? 60   ILE B CG1 1 
ATOM   4354 C CG2 . ILE B 1 36  ? 33.870  19.346  4.735   1.00 97.05  ? 60   ILE B CG2 1 
ATOM   4355 C CD1 . ILE B 1 36  ? 35.972  17.861  6.215   1.00 97.05  ? 60   ILE B CD1 1 
ATOM   4356 N N   . ASN B 1 37  ? 31.211  17.950  5.544   1.00 132.22 ? 61   ASN B N   1 
ATOM   4357 C CA  . ASN B 1 37  ? 29.918  18.552  5.325   1.00 132.22 ? 61   ASN B CA  1 
ATOM   4358 C C   . ASN B 1 37  ? 30.400  19.930  4.884   1.00 132.22 ? 61   ASN B C   1 
ATOM   4359 O O   . ASN B 1 37  ? 31.012  20.656  5.671   1.00 132.22 ? 61   ASN B O   1 
ATOM   4360 C CB  . ASN B 1 37  ? 29.148  18.654  6.637   1.00 151.22 ? 61   ASN B CB  1 
ATOM   4361 C CG  . ASN B 1 37  ? 27.669  18.801  6.422   1.00 151.22 ? 61   ASN B CG  1 
ATOM   4362 O OD1 . ASN B 1 37  ? 27.225  19.608  5.603   1.00 151.22 ? 61   ASN B OD1 1 
ATOM   4363 N ND2 . ASN B 1 37  ? 26.888  18.021  7.158   1.00 151.22 ? 61   ASN B ND2 1 
ATOM   4364 N N   . GLU B 1 38  ? 30.162  20.289  3.629   1.00 136.83 ? 62   GLU B N   1 
ATOM   4365 C CA  . GLU B 1 38  ? 30.632  21.580  3.134   1.00 136.83 ? 62   GLU B CA  1 
ATOM   4366 C C   . GLU B 1 38  ? 29.891  22.818  3.643   1.00 136.83 ? 62   GLU B C   1 
ATOM   4367 O O   . GLU B 1 38  ? 30.470  23.659  4.341   1.00 136.83 ? 62   GLU B O   1 
ATOM   4368 C CB  . GLU B 1 38  ? 30.631  21.597  1.597   1.00 168.32 ? 62   GLU B CB  1 
ATOM   4369 C CG  . GLU B 1 38  ? 31.633  20.654  0.942   1.00 168.32 ? 62   GLU B CG  1 
ATOM   4370 C CD  . GLU B 1 38  ? 31.725  20.853  -0.562  1.00 168.32 ? 62   GLU B CD  1 
ATOM   4371 O OE1 . GLU B 1 38  ? 32.180  19.923  -1.257  1.00 168.32 ? 62   GLU B OE1 1 
ATOM   4372 O OE2 . GLU B 1 38  ? 31.352  21.942  -1.050  1.00 168.32 ? 62   GLU B OE2 1 
ATOM   4373 N N   . ASP B 1 39  ? 28.614  22.927  3.301   1.00 142.98 ? 63   ASP B N   1 
ATOM   4374 C CA  . ASP B 1 39  ? 27.851  24.095  3.694   1.00 142.98 ? 63   ASP B CA  1 
ATOM   4375 C C   . ASP B 1 39  ? 27.332  24.163  5.129   1.00 142.98 ? 63   ASP B C   1 
ATOM   4376 O O   . ASP B 1 39  ? 27.362  25.231  5.736   1.00 142.98 ? 63   ASP B O   1 
ATOM   4377 C CB  . ASP B 1 39  ? 26.715  24.318  2.696   1.00 208.39 ? 63   ASP B CB  1 
ATOM   4378 C CG  . ASP B 1 39  ? 27.230  24.669  1.307   1.00 208.39 ? 63   ASP B CG  1 
ATOM   4379 O OD1 . ASP B 1 39  ? 28.144  25.516  1.205   1.00 208.39 ? 63   ASP B OD1 1 
ATOM   4380 O OD2 . ASP B 1 39  ? 26.722  24.107  0.315   1.00 208.39 ? 63   ASP B OD2 1 
ATOM   4381 N N   . ARG B 1 40  ? 26.854  23.058  5.688   1.00 121.21 ? 64   ARG B N   1 
ATOM   4382 C CA  . ARG B 1 40  ? 26.375  23.120  7.067   1.00 121.21 ? 64   ARG B CA  1 
ATOM   4383 C C   . ARG B 1 40  ? 27.462  22.795  8.086   1.00 121.21 ? 64   ARG B C   1 
ATOM   4384 O O   . ARG B 1 40  ? 27.285  23.003  9.282   1.00 121.21 ? 64   ARG B O   1 
ATOM   4385 C CB  . ARG B 1 40  ? 25.179  22.195  7.271   1.00 204.57 ? 64   ARG B CB  1 
ATOM   4386 C CG  . ARG B 1 40  ? 23.881  22.785  6.773   1.00 204.57 ? 64   ARG B CG  1 
ATOM   4387 C CD  . ARG B 1 40  ? 22.714  21.862  7.040   1.00 204.57 ? 64   ARG B CD  1 
ATOM   4388 N NE  . ARG B 1 40  ? 21.498  22.354  6.402   1.00 204.57 ? 64   ARG B NE  1 
ATOM   4389 C CZ  . ARG B 1 40  ? 20.328  21.729  6.443   1.00 204.57 ? 64   ARG B CZ  1 
ATOM   4390 N NH1 . ARG B 1 40  ? 20.209  20.579  7.096   1.00 204.57 ? 64   ARG B NH1 1 
ATOM   4391 N NH2 . ARG B 1 40  ? 19.279  22.250  5.819   1.00 204.57 ? 64   ARG B NH2 1 
ATOM   4392 N N   . GLY B 1 41  ? 28.589  22.286  7.608   1.00 127.87 ? 65   GLY B N   1 
ATOM   4393 C CA  . GLY B 1 41  ? 29.683  21.962  8.501   1.00 127.87 ? 65   GLY B CA  1 
ATOM   4394 C C   . GLY B 1 41  ? 30.714  23.070  8.487   1.00 127.87 ? 65   GLY B C   1 
ATOM   4395 O O   . GLY B 1 41  ? 30.741  23.918  9.375   1.00 127.87 ? 65   GLY B O   1 
ATOM   4396 N N   . ILE B 1 42  ? 31.553  23.073  7.458   1.00 113.07 ? 66   ILE B N   1 
ATOM   4397 C CA  . ILE B 1 42  ? 32.605  24.072  7.306   1.00 113.07 ? 66   ILE B CA  1 
ATOM   4398 C C   . ILE B 1 42  ? 32.171  25.538  7.392   1.00 113.07 ? 66   ILE B C   1 
ATOM   4399 O O   . ILE B 1 42  ? 32.835  26.353  8.041   1.00 113.07 ? 66   ILE B O   1 
ATOM   4400 C CB  . ILE B 1 42  ? 33.343  23.855  5.986   1.00 97.69  ? 66   ILE B CB  1 
ATOM   4401 C CG1 . ILE B 1 42  ? 34.057  22.507  6.034   1.00 97.69  ? 66   ILE B CG1 1 
ATOM   4402 C CG2 . ILE B 1 42  ? 34.341  24.981  5.750   1.00 97.69  ? 66   ILE B CG2 1 
ATOM   4403 C CD1 . ILE B 1 42  ? 35.071  22.420  7.148   1.00 97.69  ? 66   ILE B CD1 1 
ATOM   4404 N N   . GLN B 1 43  ? 31.071  25.886  6.737   1.00 104.21 ? 67   GLN B N   1 
ATOM   4405 C CA  . GLN B 1 43  ? 30.612  27.267  6.784   1.00 104.21 ? 67   GLN B CA  1 
ATOM   4406 C C   . GLN B 1 43  ? 30.231  27.657  8.196   1.00 104.21 ? 67   GLN B C   1 
ATOM   4407 O O   . GLN B 1 43  ? 30.844  28.540  8.792   1.00 104.21 ? 67   GLN B O   1 
ATOM   4408 C CB  . GLN B 1 43  ? 29.411  27.463  5.875   1.00 136.62 ? 67   GLN B CB  1 
ATOM   4409 C CG  . GLN B 1 43  ? 29.625  28.531  4.836   1.00 136.62 ? 67   GLN B CG  1 
ATOM   4410 C CD  . GLN B 1 43  ? 28.423  28.696  3.950   1.00 136.62 ? 67   GLN B CD  1 
ATOM   4411 O OE1 . GLN B 1 43  ? 27.392  29.215  4.373   1.00 136.62 ? 67   GLN B OE1 1 
ATOM   4412 N NE2 . GLN B 1 43  ? 28.540  28.240  2.713   1.00 136.62 ? 67   GLN B NE2 1 
ATOM   4413 N N   . ARG B 1 44  ? 29.213  26.994  8.728   1.00 121.62 ? 68   ARG B N   1 
ATOM   4414 C CA  . ARG B 1 44  ? 28.758  27.274  10.077  1.00 121.62 ? 68   ARG B CA  1 
ATOM   4415 C C   . ARG B 1 44  ? 29.926  27.363  11.048  1.00 121.62 ? 68   ARG B C   1 
ATOM   4416 O O   . ARG B 1 44  ? 29.939  28.225  11.923  1.00 121.62 ? 68   ARG B O   1 
ATOM   4417 C CB  . ARG B 1 44  ? 27.781  26.200  10.538  1.00 102.50 ? 68   ARG B CB  1 
ATOM   4418 C CG  . ARG B 1 44  ? 26.455  26.267  9.834   1.00 102.50 ? 68   ARG B CG  1 
ATOM   4419 C CD  . ARG B 1 44  ? 25.542  25.149  10.271  1.00 102.50 ? 68   ARG B CD  1 
ATOM   4420 N NE  . ARG B 1 44  ? 24.259  25.233  9.585   1.00 102.50 ? 68   ARG B NE  1 
ATOM   4421 C CZ  . ARG B 1 44  ? 23.307  24.312  9.666   1.00 102.50 ? 68   ARG B CZ  1 
ATOM   4422 N NH1 . ARG B 1 44  ? 23.497  23.230  10.406  1.00 102.50 ? 68   ARG B NH1 1 
ATOM   4423 N NH2 . ARG B 1 44  ? 22.163  24.476  9.013   1.00 102.50 ? 68   ARG B NH2 1 
ATOM   4424 N N   . LEU B 1 45  ? 30.905  26.475  10.896  1.00 92.89  ? 69   LEU B N   1 
ATOM   4425 C CA  . LEU B 1 45  ? 32.074  26.493  11.769  1.00 92.89  ? 69   LEU B CA  1 
ATOM   4426 C C   . LEU B 1 45  ? 32.710  27.864  11.635  1.00 92.89  ? 69   LEU B C   1 
ATOM   4427 O O   . LEU B 1 45  ? 32.777  28.636  12.585  1.00 92.89  ? 69   LEU B O   1 
ATOM   4428 C CB  . LEU B 1 45  ? 33.084  25.437  11.336  1.00 79.87  ? 69   LEU B CB  1 
ATOM   4429 C CG  . LEU B 1 45  ? 34.290  25.180  12.242  1.00 79.87  ? 69   LEU B CG  1 
ATOM   4430 C CD1 . LEU B 1 45  ? 35.252  24.257  11.505  1.00 79.87  ? 69   LEU B CD1 1 
ATOM   4431 C CD2 . LEU B 1 45  ? 34.994  26.476  12.613  1.00 79.87  ? 69   LEU B CD2 1 
ATOM   4432 N N   . GLU B 1 46  ? 33.190  28.158  10.438  1.00 98.42  ? 70   GLU B N   1 
ATOM   4433 C CA  . GLU B 1 46  ? 33.813  29.440  10.198  1.00 98.42  ? 70   GLU B CA  1 
ATOM   4434 C C   . GLU B 1 46  ? 32.960  30.558  10.765  1.00 98.42  ? 70   GLU B C   1 
ATOM   4435 O O   . GLU B 1 46  ? 33.470  31.441  11.437  1.00 98.42  ? 70   GLU B O   1 
ATOM   4436 C CB  . GLU B 1 46  ? 34.021  29.652  8.704   1.00 107.98 ? 70   GLU B CB  1 
ATOM   4437 C CG  . GLU B 1 46  ? 35.159  28.840  8.120   1.00 107.98 ? 70   GLU B CG  1 
ATOM   4438 C CD  . GLU B 1 46  ? 36.470  29.101  8.827   1.00 107.98 ? 70   GLU B CD  1 
ATOM   4439 O OE1 . GLU B 1 46  ? 36.692  30.246  9.280   1.00 107.98 ? 70   GLU B OE1 1 
ATOM   4440 O OE2 . GLU B 1 46  ? 37.284  28.161  8.920   1.00 107.98 ? 70   GLU B OE2 1 
ATOM   4441 N N   . ALA B 1 47  ? 31.659  30.508  10.513  1.00 89.35  ? 71   ALA B N   1 
ATOM   4442 C CA  . ALA B 1 47  ? 30.771  31.550  11.003  1.00 89.35  ? 71   ALA B CA  1 
ATOM   4443 C C   . ALA B 1 47  ? 30.995  31.835  12.474  1.00 89.35  ? 71   ALA B C   1 
ATOM   4444 O O   . ALA B 1 47  ? 30.886  32.980  12.913  1.00 89.35  ? 71   ALA B O   1 
ATOM   4445 C CB  . ALA B 1 47  ? 29.320  31.168  10.766  1.00 70.97  ? 71   ALA B CB  1 
ATOM   4446 N N   . MET B 1 48  ? 31.302  30.800  13.247  1.00 113.76 ? 72   MET B N   1 
ATOM   4447 C CA  . MET B 1 48  ? 31.529  31.015  14.668  1.00 113.76 ? 72   MET B CA  1 
ATOM   4448 C C   . MET B 1 48  ? 32.855  31.713  14.855  1.00 113.76 ? 72   MET B C   1 
ATOM   4449 O O   . MET B 1 48  ? 32.966  32.641  15.647  1.00 113.76 ? 72   MET B O   1 
ATOM   4450 C CB  . MET B 1 48  ? 31.536  29.701  15.450  1.00 101.51 ? 72   MET B CB  1 
ATOM   4451 C CG  . MET B 1 48  ? 31.706  29.928  16.949  1.00 101.51 ? 72   MET B CG  1 
ATOM   4452 S SD  . MET B 1 48  ? 31.482  28.489  18.003  1.00 101.51 ? 72   MET B SD  1 
ATOM   4453 C CE  . MET B 1 48  ? 32.762  28.762  19.138  1.00 101.51 ? 72   MET B CE  1 
ATOM   4454 N N   . LEU B 1 49  ? 33.865  31.255  14.127  1.00 97.02  ? 73   LEU B N   1 
ATOM   4455 C CA  . LEU B 1 49  ? 35.181  31.864  14.211  1.00 97.02  ? 73   LEU B CA  1 
ATOM   4456 C C   . LEU B 1 49  ? 35.002  33.332  13.860  1.00 97.02  ? 73   LEU B C   1 
ATOM   4457 O O   . LEU B 1 49  ? 35.465  34.216  14.567  1.00 97.02  ? 73   LEU B O   1 
ATOM   4458 C CB  . LEU B 1 49  ? 36.133  31.196  13.218  1.00 117.14 ? 73   LEU B CB  1 
ATOM   4459 C CG  . LEU B 1 49  ? 37.106  30.109  13.697  1.00 117.14 ? 73   LEU B CG  1 
ATOM   4460 C CD1 . LEU B 1 49  ? 36.425  29.076  14.545  1.00 117.14 ? 73   LEU B CD1 1 
ATOM   4461 C CD2 . LEU B 1 49  ? 37.711  29.446  12.483  1.00 117.14 ? 73   LEU B CD2 1 
ATOM   4462 N N   . PHE B 1 50  ? 34.306  33.575  12.760  1.00 89.55  ? 74   PHE B N   1 
ATOM   4463 C CA  . PHE B 1 50  ? 34.034  34.922  12.292  1.00 89.55  ? 74   PHE B CA  1 
ATOM   4464 C C   . PHE B 1 50  ? 33.441  35.760  13.404  1.00 89.55  ? 74   PHE B C   1 
ATOM   4465 O O   . PHE B 1 50  ? 33.979  36.815  13.741  1.00 89.55  ? 74   PHE B O   1 
ATOM   4466 C CB  . PHE B 1 50  ? 33.059  34.872  11.109  1.00 96.69  ? 74   PHE B CB  1 
ATOM   4467 C CG  . PHE B 1 50  ? 32.400  36.193  10.798  1.00 96.69  ? 74   PHE B CG  1 
ATOM   4468 C CD1 . PHE B 1 50  ? 33.141  37.268  10.307  1.00 96.69  ? 74   PHE B CD1 1 
ATOM   4469 C CD2 . PHE B 1 50  ? 31.031  36.363  11.011  1.00 96.69  ? 74   PHE B CD2 1 
ATOM   4470 C CE1 . PHE B 1 50  ? 32.520  38.493  10.033  1.00 96.69  ? 74   PHE B CE1 1 
ATOM   4471 C CE2 . PHE B 1 50  ? 30.401  37.582  10.740  1.00 96.69  ? 74   PHE B CE2 1 
ATOM   4472 C CZ  . PHE B 1 50  ? 31.142  38.648  10.253  1.00 96.69  ? 74   PHE B CZ  1 
ATOM   4473 N N   . ALA B 1 51  ? 32.329  35.284  13.964  1.00 90.16  ? 75   ALA B N   1 
ATOM   4474 C CA  . ALA B 1 51  ? 31.625  35.986  15.039  1.00 90.16  ? 75   ALA B CA  1 
ATOM   4475 C C   . ALA B 1 51  ? 32.556  36.298  16.209  1.00 90.16  ? 75   ALA B C   1 
ATOM   4476 O O   . ALA B 1 51  ? 32.522  37.398  16.762  1.00 90.16  ? 75   ALA B O   1 
ATOM   4477 C CB  . ALA B 1 51  ? 30.432  35.157  15.513  1.00 113.02 ? 75   ALA B CB  1 
ATOM   4478 N N   . ILE B 1 52  ? 33.381  35.325  16.589  1.00 85.21  ? 76   ILE B N   1 
ATOM   4479 C CA  . ILE B 1 52  ? 34.336  35.521  17.673  1.00 85.21  ? 76   ILE B CA  1 
ATOM   4480 C C   . ILE B 1 52  ? 35.247  36.663  17.239  1.00 85.21  ? 76   ILE B C   1 
ATOM   4481 O O   . ILE B 1 52  ? 35.301  37.709  17.891  1.00 85.21  ? 76   ILE B O   1 
ATOM   4482 C CB  . ILE B 1 52  ? 35.178  34.242  17.920  1.00 89.65  ? 76   ILE B CB  1 
ATOM   4483 C CG1 . ILE B 1 52  ? 34.373  33.251  18.761  1.00 89.65  ? 76   ILE B CG1 1 
ATOM   4484 C CG2 . ILE B 1 52  ? 36.480  34.588  18.608  1.00 89.65  ? 76   ILE B CG2 1 
ATOM   4485 C CD1 . ILE B 1 52  ? 33.975  33.781  20.138  1.00 89.65  ? 76   ILE B CD1 1 
ATOM   4486 N N   . ASP B 1 53  ? 35.948  36.448  16.123  1.00 146.38 ? 77   ASP B N   1 
ATOM   4487 C CA  . ASP B 1 53  ? 36.851  37.439  15.544  1.00 146.38 ? 77   ASP B CA  1 
ATOM   4488 C C   . ASP B 1 53  ? 36.243  38.813  15.693  1.00 146.38 ? 77   ASP B C   1 
ATOM   4489 O O   . ASP B 1 53  ? 36.892  39.742  16.159  1.00 146.38 ? 77   ASP B O   1 
ATOM   4490 C CB  . ASP B 1 53  ? 37.060  37.165  14.057  1.00 129.48 ? 77   ASP B CB  1 
ATOM   4491 C CG  . ASP B 1 53  ? 38.046  36.060  13.808  1.00 129.48 ? 77   ASP B CG  1 
ATOM   4492 O OD1 . ASP B 1 53  ? 38.502  35.443  14.791  1.00 129.48 ? 77   ASP B OD1 1 
ATOM   4493 O OD2 . ASP B 1 53  ? 38.367  35.811  12.630  1.00 129.48 ? 77   ASP B OD2 1 
ATOM   4494 N N   . GLU B 1 54  ? 34.984  38.922  15.289  1.00 108.66 ? 78   GLU B N   1 
ATOM   4495 C CA  . GLU B 1 54  ? 34.251  40.173  15.352  1.00 108.66 ? 78   GLU B CA  1 
ATOM   4496 C C   . GLU B 1 54  ? 34.045  40.688  16.763  1.00 108.66 ? 78   GLU B C   1 
ATOM   4497 O O   . GLU B 1 54  ? 34.224  41.878  17.036  1.00 108.66 ? 78   GLU B O   1 
ATOM   4498 C CB  . GLU B 1 54  ? 32.901  40.012  14.655  1.00 192.86 ? 78   GLU B CB  1 
ATOM   4499 C CG  . GLU B 1 54  ? 33.041  39.900  13.158  1.00 192.86 ? 78   GLU B CG  1 
ATOM   4500 C CD  . GLU B 1 54  ? 33.674  41.139  12.570  1.00 192.86 ? 78   GLU B CD  1 
ATOM   4501 O OE1 . GLU B 1 54  ? 34.212  41.060  11.446  1.00 192.86 ? 78   GLU B OE1 1 
ATOM   4502 O OE2 . GLU B 1 54  ? 33.626  42.198  13.236  1.00 192.86 ? 78   GLU B OE2 1 
ATOM   4503 N N   . ILE B 1 55  ? 33.666  39.797  17.664  1.00 131.67 ? 79   ILE B N   1 
ATOM   4504 C CA  . ILE B 1 55  ? 33.431  40.200  19.037  1.00 131.67 ? 79   ILE B CA  1 
ATOM   4505 C C   . ILE B 1 55  ? 34.722  40.671  19.700  1.00 131.67 ? 79   ILE B C   1 
ATOM   4506 O O   . ILE B 1 55  ? 34.703  41.438  20.667  1.00 131.67 ? 79   ILE B O   1 
ATOM   4507 C CB  . ILE B 1 55  ? 32.790  39.046  19.820  1.00 102.33 ? 79   ILE B CB  1 
ATOM   4508 C CG1 . ILE B 1 55  ? 31.372  38.824  19.299  1.00 102.33 ? 79   ILE B CG1 1 
ATOM   4509 C CG2 . ILE B 1 55  ? 32.756  39.365  21.296  1.00 102.33 ? 79   ILE B CG2 1 
ATOM   4510 C CD1 . ILE B 1 55  ? 30.650  37.704  19.971  1.00 102.33 ? 79   ILE B CD1 1 
ATOM   4511 N N   . ASN B 1 56  ? 35.848  40.224  19.161  1.00 131.35 ? 80   ASN B N   1 
ATOM   4512 C CA  . ASN B 1 56  ? 37.137  40.622  19.701  1.00 131.35 ? 80   ASN B CA  1 
ATOM   4513 C C   . ASN B 1 56  ? 37.576  41.960  19.099  1.00 131.35 ? 80   ASN B C   1 
ATOM   4514 O O   . ASN B 1 56  ? 38.255  42.755  19.750  1.00 131.35 ? 80   ASN B O   1 
ATOM   4515 C CB  . ASN B 1 56  ? 38.195  39.546  19.418  1.00 116.79 ? 80   ASN B CB  1 
ATOM   4516 C CG  . ASN B 1 56  ? 37.972  38.273  20.221  1.00 116.79 ? 80   ASN B CG  1 
ATOM   4517 O OD1 . ASN B 1 56  ? 37.748  38.320  21.433  1.00 116.79 ? 80   ASN B OD1 1 
ATOM   4518 N ND2 . ASN B 1 56  ? 38.050  37.128  19.549  1.00 116.79 ? 80   ASN B ND2 1 
ATOM   4519 N N   . LYS B 1 57  ? 37.184  42.208  17.853  1.00 146.02 ? 81   LYS B N   1 
ATOM   4520 C CA  . LYS B 1 57  ? 37.541  43.455  17.189  1.00 146.02 ? 81   LYS B CA  1 
ATOM   4521 C C   . LYS B 1 57  ? 36.604  44.548  17.705  1.00 146.02 ? 81   LYS B C   1 
ATOM   4522 O O   . LYS B 1 57  ? 36.891  45.737  17.577  1.00 146.02 ? 81   LYS B O   1 
ATOM   4523 C CB  . LYS B 1 57  ? 37.419  43.296  15.662  1.00 206.78 ? 81   LYS B CB  1 
ATOM   4524 C CG  . LYS B 1 57  ? 38.135  44.376  14.850  1.00 206.78 ? 81   LYS B CG  1 
ATOM   4525 C CD  . LYS B 1 57  ? 38.431  43.946  13.403  1.00 206.78 ? 81   LYS B CD  1 
ATOM   4526 C CE  . LYS B 1 57  ? 37.238  44.096  12.461  1.00 206.78 ? 81   LYS B CE  1 
ATOM   4527 N NZ  . LYS B 1 57  ? 36.172  43.087  12.685  1.00 206.78 ? 81   LYS B NZ  1 
ATOM   4528 N N   . ASP B 1 58  ? 35.494  44.132  18.313  1.00 141.86 ? 82   ASP B N   1 
ATOM   4529 C CA  . ASP B 1 58  ? 34.507  45.063  18.855  1.00 141.86 ? 82   ASP B CA  1 
ATOM   4530 C C   . ASP B 1 58  ? 34.964  45.699  20.170  1.00 141.86 ? 82   ASP B C   1 
ATOM   4531 O O   . ASP B 1 58  ? 35.630  45.058  20.991  1.00 141.86 ? 82   ASP B O   1 
ATOM   4532 C CB  . ASP B 1 58  ? 33.171  44.347  19.064  1.00 120.19 ? 82   ASP B CB  1 
ATOM   4533 C CG  . ASP B 1 58  ? 32.064  45.284  19.559  1.00 120.19 ? 82   ASP B CG  1 
ATOM   4534 O OD1 . ASP B 1 58  ? 30.905  44.824  19.656  1.00 120.19 ? 82   ASP B OD1 1 
ATOM   4535 O OD2 . ASP B 1 58  ? 32.335  46.471  19.852  1.00 120.19 ? 82   ASP B OD2 1 
ATOM   4536 N N   . ASN B 1 59  ? 34.583  46.962  20.357  1.00 123.03 ? 83   ASN B N   1 
ATOM   4537 C CA  . ASN B 1 59  ? 34.937  47.738  21.541  1.00 123.03 ? 83   ASN B CA  1 
ATOM   4538 C C   . ASN B 1 59  ? 33.809  47.886  22.552  1.00 123.03 ? 83   ASN B C   1 
ATOM   4539 O O   . ASN B 1 59  ? 34.073  48.014  23.743  1.00 123.03 ? 83   ASN B O   1 
ATOM   4540 C CB  . ASN B 1 59  ? 35.395  49.149  21.142  1.00 255.72 ? 83   ASN B CB  1 
ATOM   4541 C CG  . ASN B 1 59  ? 36.787  49.175  20.537  1.00 255.72 ? 83   ASN B CG  1 
ATOM   4542 O OD1 . ASN B 1 59  ? 37.751  48.714  21.147  1.00 255.72 ? 83   ASN B OD1 1 
ATOM   4543 N ND2 . ASN B 1 59  ? 36.899  49.734  19.334  1.00 255.72 ? 83   ASN B ND2 1 
ATOM   4544 N N   . TYR B 1 60  ? 32.560  47.882  22.087  1.00 110.70 ? 84   TYR B N   1 
ATOM   4545 C CA  . TYR B 1 60  ? 31.412  48.059  22.987  1.00 110.70 ? 84   TYR B CA  1 
ATOM   4546 C C   . TYR B 1 60  ? 30.756  46.779  23.516  1.00 110.70 ? 84   TYR B C   1 
ATOM   4547 O O   . TYR B 1 60  ? 29.684  46.816  24.143  1.00 110.70 ? 84   TYR B O   1 
ATOM   4548 C CB  . TYR B 1 60  ? 30.350  48.929  22.313  1.00 307.77 ? 84   TYR B CB  1 
ATOM   4549 C CG  . TYR B 1 60  ? 30.851  50.303  21.938  1.00 307.77 ? 84   TYR B CG  1 
ATOM   4550 C CD1 . TYR B 1 60  ? 31.300  50.575  20.646  1.00 307.77 ? 84   TYR B CD1 1 
ATOM   4551 C CD2 . TYR B 1 60  ? 30.913  51.324  22.887  1.00 307.77 ? 84   TYR B CD2 1 
ATOM   4552 C CE1 . TYR B 1 60  ? 31.802  51.830  20.308  1.00 307.77 ? 84   TYR B CE1 1 
ATOM   4553 C CE2 . TYR B 1 60  ? 31.415  52.581  22.562  1.00 307.77 ? 84   TYR B CE2 1 
ATOM   4554 C CZ  . TYR B 1 60  ? 31.858  52.827  21.271  1.00 307.77 ? 84   TYR B CZ  1 
ATOM   4555 O OH  . TYR B 1 60  ? 32.370  54.063  20.948  1.00 307.77 ? 84   TYR B OH  1 
ATOM   4556 N N   . LEU B 1 61  ? 31.411  45.653  23.260  1.00 150.93 ? 85   LEU B N   1 
ATOM   4557 C CA  . LEU B 1 61  ? 30.935  44.351  23.706  1.00 150.93 ? 85   LEU B CA  1 
ATOM   4558 C C   . LEU B 1 61  ? 32.135  43.496  24.083  1.00 150.93 ? 85   LEU B C   1 
ATOM   4559 O O   . LEU B 1 61  ? 32.952  43.147  23.227  1.00 150.93 ? 85   LEU B O   1 
ATOM   4560 C CB  . LEU B 1 61  ? 30.141  43.671  22.593  1.00 174.13 ? 85   LEU B CB  1 
ATOM   4561 C CG  . LEU B 1 61  ? 29.862  42.172  22.729  1.00 174.13 ? 85   LEU B CG  1 
ATOM   4562 C CD1 . LEU B 1 61  ? 29.123  41.873  24.020  1.00 174.13 ? 85   LEU B CD1 1 
ATOM   4563 C CD2 . LEU B 1 61  ? 29.048  41.718  21.532  1.00 174.13 ? 85   LEU B CD2 1 
ATOM   4564 N N   . LEU B 1 62  ? 32.241  43.172  25.369  1.00 127.37 ? 86   LEU B N   1 
ATOM   4565 C CA  . LEU B 1 62  ? 33.340  42.359  25.867  1.00 127.37 ? 86   LEU B CA  1 
ATOM   4566 C C   . LEU B 1 62  ? 34.668  42.786  25.238  1.00 127.37 ? 86   LEU B C   1 
ATOM   4567 O O   . LEU B 1 62  ? 35.116  42.241  24.217  1.00 127.37 ? 86   LEU B O   1 
ATOM   4568 C CB  . LEU B 1 62  ? 33.060  40.879  25.596  1.00 107.45 ? 86   LEU B CB  1 
ATOM   4569 C CG  . LEU B 1 62  ? 32.901  39.978  26.823  1.00 107.45 ? 86   LEU B CG  1 
ATOM   4570 C CD1 . LEU B 1 62  ? 31.886  40.563  27.776  1.00 107.45 ? 86   LEU B CD1 1 
ATOM   4571 C CD2 . LEU B 1 62  ? 32.482  38.598  26.373  1.00 107.45 ? 86   LEU B CD2 1 
ATOM   4572 N N   . PRO B 1 63  ? 35.299  43.800  25.839  1.00 116.58 ? 87   PRO B N   1 
ATOM   4573 C CA  . PRO B 1 63  ? 36.574  44.387  25.432  1.00 116.58 ? 87   PRO B CA  1 
ATOM   4574 C C   . PRO B 1 63  ? 37.774  43.818  26.186  1.00 116.58 ? 87   PRO B C   1 
ATOM   4575 O O   . PRO B 1 63  ? 38.741  43.346  25.568  1.00 116.58 ? 87   PRO B O   1 
ATOM   4576 C CB  . PRO B 1 63  ? 36.366  45.859  25.735  1.00 91.32  ? 87   PRO B CB  1 
ATOM   4577 C CG  . PRO B 1 63  ? 35.592  45.806  26.998  1.00 91.32  ? 87   PRO B CG  1 
ATOM   4578 C CD  . PRO B 1 63  ? 34.576  44.714  26.744  1.00 91.32  ? 87   PRO B CD  1 
ATOM   4579 N N   . GLY B 1 64  ? 37.704  43.879  27.516  1.00 154.96 ? 88   GLY B N   1 
ATOM   4580 C CA  . GLY B 1 64  ? 38.781  43.380  28.354  1.00 154.96 ? 88   GLY B CA  1 
ATOM   4581 C C   . GLY B 1 64  ? 38.704  41.884  28.592  1.00 154.96 ? 88   GLY B C   1 
ATOM   4582 O O   . GLY B 1 64  ? 39.416  41.338  29.439  1.00 154.96 ? 88   GLY B O   1 
ATOM   4583 N N   . VAL B 1 65  ? 37.829  41.222  27.842  1.00 93.38  ? 89   VAL B N   1 
ATOM   4584 C CA  . VAL B 1 65  ? 37.646  39.782  27.949  1.00 93.38  ? 89   VAL B CA  1 
ATOM   4585 C C   . VAL B 1 65  ? 37.691  39.140  26.567  1.00 93.38  ? 89   VAL B C   1 
ATOM   4586 O O   . VAL B 1 65  ? 36.659  38.983  25.914  1.00 93.38  ? 89   VAL B O   1 
ATOM   4587 C CB  . VAL B 1 65  ? 36.297  39.445  28.599  1.00 101.46 ? 89   VAL B CB  1 
ATOM   4588 C CG1 . VAL B 1 65  ? 36.192  37.959  28.824  1.00 101.46 ? 89   VAL B CG1 1 
ATOM   4589 C CG2 . VAL B 1 65  ? 36.157  40.189  29.910  1.00 101.46 ? 89   VAL B CG2 1 
ATOM   4590 N N   . LYS B 1 66  ? 38.889  38.785  26.116  1.00 88.74  ? 90   LYS B N   1 
ATOM   4591 C CA  . LYS B 1 66  ? 39.046  38.152  24.813  1.00 88.74  ? 90   LYS B CA  1 
ATOM   4592 C C   . LYS B 1 66  ? 38.308  36.818  24.832  1.00 88.74  ? 90   LYS B C   1 
ATOM   4593 O O   . LYS B 1 66  ? 38.399  36.072  25.801  1.00 88.74  ? 90   LYS B O   1 
ATOM   4594 C CB  . LYS B 1 66  ? 40.530  37.918  24.513  1.00 148.71 ? 90   LYS B CB  1 
ATOM   4595 C CG  . LYS B 1 66  ? 40.802  37.150  23.222  1.00 148.71 ? 90   LYS B CG  1 
ATOM   4596 C CD  . LYS B 1 66  ? 42.302  36.939  22.983  1.00 148.71 ? 90   LYS B CD  1 
ATOM   4597 C CE  . LYS B 1 66  ? 42.568  36.116  21.720  1.00 148.71 ? 90   LYS B CE  1 
ATOM   4598 N NZ  . LYS B 1 66  ? 44.022  35.887  21.482  1.00 148.71 ? 90   LYS B NZ  1 
ATOM   4599 N N   . LEU B 1 67  ? 37.570  36.515  23.770  1.00 77.95  ? 91   LEU B N   1 
ATOM   4600 C CA  . LEU B 1 67  ? 36.838  35.257  23.711  1.00 77.95  ? 91   LEU B CA  1 
ATOM   4601 C C   . LEU B 1 67  ? 37.589  34.166  22.982  1.00 77.95  ? 91   LEU B C   1 
ATOM   4602 O O   . LEU B 1 67  ? 37.860  34.275  21.788  1.00 77.95  ? 91   LEU B O   1 
ATOM   4603 C CB  . LEU B 1 67  ? 35.482  35.435  23.035  1.00 65.26  ? 91   LEU B CB  1 
ATOM   4604 C CG  . LEU B 1 67  ? 34.429  36.204  23.824  1.00 65.26  ? 91   LEU B CG  1 
ATOM   4605 C CD1 . LEU B 1 67  ? 33.070  35.881  23.258  1.00 65.26  ? 91   LEU B CD1 1 
ATOM   4606 C CD2 . LEU B 1 67  ? 34.488  35.806  25.285  1.00 65.26  ? 91   LEU B CD2 1 
ATOM   4607 N N   . GLY B 1 68  ? 37.924  33.114  23.718  1.00 98.42  ? 92   GLY B N   1 
ATOM   4608 C CA  . GLY B 1 68  ? 38.612  31.981  23.134  1.00 98.42  ? 92   GLY B CA  1 
ATOM   4609 C C   . GLY B 1 68  ? 37.587  30.935  22.736  1.00 98.42  ? 92   GLY B C   1 
ATOM   4610 O O   . GLY B 1 68  ? 36.442  30.955  23.201  1.00 98.42  ? 92   GLY B O   1 
ATOM   4611 N N   . VAL B 1 69  ? 37.972  30.021  21.860  1.00 66.05  ? 93   VAL B N   1 
ATOM   4612 C CA  . VAL B 1 69  ? 37.032  28.997  21.453  1.00 66.05  ? 93   VAL B CA  1 
ATOM   4613 C C   . VAL B 1 69  ? 37.681  27.635  21.443  1.00 66.05  ? 93   VAL B C   1 
ATOM   4614 O O   . VAL B 1 69  ? 38.887  27.514  21.274  1.00 66.05  ? 93   VAL B O   1 
ATOM   4615 C CB  . VAL B 1 69  ? 36.456  29.244  20.039  1.00 68.41  ? 93   VAL B CB  1 
ATOM   4616 C CG1 . VAL B 1 69  ? 36.349  30.731  19.770  1.00 68.41  ? 93   VAL B CG1 1 
ATOM   4617 C CG2 . VAL B 1 69  ? 37.301  28.536  18.993  1.00 68.41  ? 93   VAL B CG2 1 
ATOM   4618 N N   . HIS B 1 70  ? 36.866  26.614  21.643  1.00 106.34 ? 94   HIS B N   1 
ATOM   4619 C CA  . HIS B 1 70  ? 37.333  25.254  21.617  1.00 106.34 ? 94   HIS B CA  1 
ATOM   4620 C C   . HIS B 1 70  ? 36.242  24.582  20.828  1.00 106.34 ? 94   HIS B C   1 
ATOM   4621 O O   . HIS B 1 70  ? 35.172  24.273  21.355  1.00 106.34 ? 94   HIS B O   1 
ATOM   4622 C CB  . HIS B 1 70  ? 37.420  24.673  23.020  1.00 107.13 ? 94   HIS B CB  1 
ATOM   4623 C CG  . HIS B 1 70  ? 38.008  23.298  23.053  1.00 107.13 ? 94   HIS B CG  1 
ATOM   4624 N ND1 . HIS B 1 70  ? 38.316  22.644  24.226  1.00 107.13 ? 94   HIS B ND1 1 
ATOM   4625 C CD2 . HIS B 1 70  ? 38.351  22.456  22.050  1.00 107.13 ? 94   HIS B CD2 1 
ATOM   4626 C CE1 . HIS B 1 70  ? 38.825  21.457  23.944  1.00 107.13 ? 94   HIS B CE1 1 
ATOM   4627 N NE2 . HIS B 1 70  ? 38.857  21.318  22.631  1.00 107.13 ? 94   HIS B NE2 1 
ATOM   4628 N N   . ILE B 1 71  ? 36.509  24.383  19.547  1.00 108.93 ? 95   ILE B N   1 
ATOM   4629 C CA  . ILE B 1 71  ? 35.529  23.781  18.669  1.00 108.93 ? 95   ILE B CA  1 
ATOM   4630 C C   . ILE B 1 71  ? 35.825  22.329  18.345  1.00 108.93 ? 95   ILE B C   1 
ATOM   4631 O O   . ILE B 1 71  ? 36.972  21.970  18.106  1.00 108.93 ? 95   ILE B O   1 
ATOM   4632 C CB  . ILE B 1 71  ? 35.451  24.587  17.394  1.00 81.24  ? 95   ILE B CB  1 
ATOM   4633 C CG1 . ILE B 1 71  ? 35.350  26.058  17.772  1.00 81.24  ? 95   ILE B CG1 1 
ATOM   4634 C CG2 . ILE B 1 71  ? 34.261  24.141  16.560  1.00 81.24  ? 95   ILE B CG2 1 
ATOM   4635 C CD1 . ILE B 1 71  ? 34.713  26.903  16.722  1.00 81.24  ? 95   ILE B CD1 1 
ATOM   4636 N N   . LEU B 1 72  ? 34.785  21.497  18.341  1.00 69.35  ? 96   LEU B N   1 
ATOM   4637 C CA  . LEU B 1 72  ? 34.940  20.075  18.048  1.00 69.35  ? 96   LEU B CA  1 
ATOM   4638 C C   . LEU B 1 72  ? 33.950  19.602  16.979  1.00 69.35  ? 96   LEU B C   1 
ATOM   4639 O O   . LEU B 1 72  ? 32.808  20.056  16.932  1.00 69.35  ? 96   LEU B O   1 
ATOM   4640 C CB  . LEU B 1 72  ? 34.738  19.250  19.324  1.00 78.21  ? 96   LEU B CB  1 
ATOM   4641 C CG  . LEU B 1 72  ? 35.545  19.621  20.570  1.00 78.21  ? 96   LEU B CG  1 
ATOM   4642 C CD1 . LEU B 1 72  ? 35.030  18.811  21.742  1.00 78.21  ? 96   LEU B CD1 1 
ATOM   4643 C CD2 . LEU B 1 72  ? 37.026  19.370  20.348  1.00 78.21  ? 96   LEU B CD2 1 
ATOM   4644 N N   . ASP B 1 73  ? 34.395  18.684  16.125  1.00 103.99 ? 97   ASP B N   1 
ATOM   4645 C CA  . ASP B 1 73  ? 33.541  18.142  15.072  1.00 103.99 ? 97   ASP B CA  1 
ATOM   4646 C C   . ASP B 1 73  ? 32.631  17.107  15.706  1.00 103.99 ? 97   ASP B C   1 
ATOM   4647 O O   . ASP B 1 73  ? 33.064  16.369  16.587  1.00 103.99 ? 97   ASP B O   1 
ATOM   4648 C CB  . ASP B 1 73  ? 34.388  17.462  13.997  1.00 130.81 ? 97   ASP B CB  1 
ATOM   4649 C CG  . ASP B 1 73  ? 33.556  16.961  12.831  1.00 130.81 ? 97   ASP B CG  1 
ATOM   4650 O OD1 . ASP B 1 73  ? 32.318  16.911  12.958  1.00 130.81 ? 97   ASP B OD1 1 
ATOM   4651 O OD2 . ASP B 1 73  ? 34.140  16.611  11.788  1.00 130.81 ? 97   ASP B OD2 1 
ATOM   4652 N N   . THR B 1 74  ? 31.378  17.040  15.266  1.00 66.53  ? 98   THR B N   1 
ATOM   4653 C CA  . THR B 1 74  ? 30.453  16.064  15.829  1.00 66.53  ? 98   THR B CA  1 
ATOM   4654 C C   . THR B 1 74  ? 30.193  14.920  14.876  1.00 66.53  ? 98   THR B C   1 
ATOM   4655 O O   . THR B 1 74  ? 29.401  14.044  15.179  1.00 66.53  ? 98   THR B O   1 
ATOM   4656 C CB  . THR B 1 74  ? 29.085  16.687  16.200  1.00 72.40  ? 98   THR B CB  1 
ATOM   4657 O OG1 . THR B 1 74  ? 28.396  17.088  15.014  1.00 72.40  ? 98   THR B OG1 1 
ATOM   4658 C CG2 . THR B 1 74  ? 29.276  17.889  17.098  1.00 72.40  ? 98   THR B CG2 1 
ATOM   4659 N N   . CYS B 1 75  ? 30.860  14.925  13.730  1.00 95.36  ? 99   CYS B N   1 
ATOM   4660 C CA  . CYS B 1 75  ? 30.681  13.882  12.731  1.00 95.36  ? 99   CYS B CA  1 
ATOM   4661 C C   . CYS B 1 75  ? 29.247  13.421  12.621  1.00 95.36  ? 99   CYS B C   1 
ATOM   4662 O O   . CYS B 1 75  ? 28.974  12.230  12.520  1.00 95.36  ? 99   CYS B O   1 
ATOM   4663 C CB  . CYS B 1 75  ? 31.593  12.707  13.033  1.00 106.09 ? 99   CYS B CB  1 
ATOM   4664 S SG  . CYS B 1 75  ? 33.316  13.251  12.878  1.00 106.09 ? 99   CYS B SG  1 
ATOM   4665 N N   . SER B 1 76  ? 28.333  14.383  12.656  1.00 93.61  ? 100  SER B N   1 
ATOM   4666 C CA  . SER B 1 76  ? 26.900  14.132  12.531  1.00 93.61  ? 100  SER B CA  1 
ATOM   4667 C C   . SER B 1 76  ? 26.295  13.057  13.427  1.00 93.61  ? 100  SER B C   1 
ATOM   4668 O O   . SER B 1 76  ? 25.098  12.799  13.356  1.00 93.61  ? 100  SER B O   1 
ATOM   4669 C CB  . SER B 1 76  ? 26.568  13.802  11.077  1.00 95.99  ? 100  SER B CB  1 
ATOM   4670 O OG  . SER B 1 76  ? 26.987  14.843  10.213  1.00 95.99  ? 100  SER B OG  1 
ATOM   4671 N N   . ARG B 1 77  ? 27.097  12.428  14.272  1.00 125.06 ? 101  ARG B N   1 
ATOM   4672 C CA  . ARG B 1 77  ? 26.559  11.386  15.129  1.00 125.06 ? 101  ARG B CA  1 
ATOM   4673 C C   . ARG B 1 77  ? 26.435  11.880  16.559  1.00 125.06 ? 101  ARG B C   1 
ATOM   4674 O O   . ARG B 1 77  ? 27.333  12.548  17.070  1.00 125.06 ? 101  ARG B O   1 
ATOM   4675 C CB  . ARG B 1 77  ? 27.461  10.154  15.075  1.00 146.13 ? 101  ARG B CB  1 
ATOM   4676 C CG  . ARG B 1 77  ? 26.925  8.971   15.852  1.00 146.13 ? 101  ARG B CG  1 
ATOM   4677 C CD  . ARG B 1 77  ? 27.877  7.770   15.830  1.00 146.13 ? 101  ARG B CD  1 
ATOM   4678 N NE  . ARG B 1 77  ? 27.818  6.982   14.595  1.00 146.13 ? 101  ARG B NE  1 
ATOM   4679 C CZ  . ARG B 1 77  ? 28.469  7.273   13.470  1.00 146.13 ? 101  ARG B CZ  1 
ATOM   4680 N NH1 . ARG B 1 77  ? 29.246  8.347   13.400  1.00 146.13 ? 101  ARG B NH1 1 
ATOM   4681 N NH2 . ARG B 1 77  ? 28.350  6.478   12.414  1.00 146.13 ? 101  ARG B NH2 1 
ATOM   4682 N N   . ASP B 1 78  ? 25.319  11.562  17.205  1.00 100.05 ? 102  ASP B N   1 
ATOM   4683 C CA  . ASP B 1 78  ? 25.118  11.983  18.588  1.00 100.05 ? 102  ASP B CA  1 
ATOM   4684 C C   . ASP B 1 78  ? 26.152  11.347  19.531  1.00 100.05 ? 102  ASP B C   1 
ATOM   4685 O O   . ASP B 1 78  ? 26.935  12.050  20.176  1.00 100.05 ? 102  ASP B O   1 
ATOM   4686 C CB  . ASP B 1 78  ? 23.695  11.641  19.045  1.00 123.33 ? 102  ASP B CB  1 
ATOM   4687 C CG  . ASP B 1 78  ? 23.358  10.172  18.869  1.00 123.33 ? 102  ASP B CG  1 
ATOM   4688 O OD1 . ASP B 1 78  ? 22.222  9.780   19.226  1.00 123.33 ? 102  ASP B OD1 1 
ATOM   4689 O OD2 . ASP B 1 78  ? 24.223  9.412   18.375  1.00 123.33 ? 102  ASP B OD2 1 
ATOM   4690 N N   . THR B 1 79  ? 26.167  10.021  19.595  1.00 85.95  ? 103  THR B N   1 
ATOM   4691 C CA  . THR B 1 79  ? 27.098  9.319   20.461  1.00 85.95  ? 103  THR B CA  1 
ATOM   4692 C C   . THR B 1 79  ? 28.511  9.852   20.337  1.00 85.95  ? 103  THR B C   1 
ATOM   4693 O O   . THR B 1 79  ? 29.287  9.776   21.286  1.00 85.95  ? 103  THR B O   1 
ATOM   4694 C CB  . THR B 1 79  ? 27.142  7.820   20.152  1.00 174.73 ? 103  THR B CB  1 
ATOM   4695 O OG1 . THR B 1 79  ? 27.469  7.628   18.770  1.00 174.73 ? 103  THR B OG1 1 
ATOM   4696 C CG2 . THR B 1 79  ? 25.803  7.175   20.460  1.00 174.73 ? 103  THR B CG2 1 
ATOM   4697 N N   . TYR B 1 80  ? 28.845  10.390  19.170  1.00 93.86  ? 104  TYR B N   1 
ATOM   4698 C CA  . TYR B 1 80  ? 30.184  10.913  18.939  1.00 93.86  ? 104  TYR B CA  1 
ATOM   4699 C C   . TYR B 1 80  ? 30.351  12.302  19.526  1.00 93.86  ? 104  TYR B C   1 
ATOM   4700 O O   . TYR B 1 80  ? 31.313  12.573  20.248  1.00 93.86  ? 104  TYR B O   1 
ATOM   4701 C CB  . TYR B 1 80  ? 30.488  10.950  17.441  1.00 107.87 ? 104  TYR B CB  1 
ATOM   4702 C CG  . TYR B 1 80  ? 31.896  11.404  17.110  1.00 107.87 ? 104  TYR B CG  1 
ATOM   4703 C CD1 . TYR B 1 80  ? 33.005  10.651  17.503  1.00 107.87 ? 104  TYR B CD1 1 
ATOM   4704 C CD2 . TYR B 1 80  ? 32.118  12.592  16.410  1.00 107.87 ? 104  TYR B CD2 1 
ATOM   4705 C CE1 . TYR B 1 80  ? 34.300  11.070  17.207  1.00 107.87 ? 104  TYR B CE1 1 
ATOM   4706 C CE2 . TYR B 1 80  ? 33.404  13.019  16.109  1.00 107.87 ? 104  TYR B CE2 1 
ATOM   4707 C CZ  . TYR B 1 80  ? 34.493  12.256  16.508  1.00 107.87 ? 104  TYR B CZ  1 
ATOM   4708 O OH  . TYR B 1 80  ? 35.771  12.674  16.196  1.00 107.87 ? 104  TYR B OH  1 
ATOM   4709 N N   . ALA B 1 81  ? 29.416  13.188  19.210  1.00 78.98  ? 105  ALA B N   1 
ATOM   4710 C CA  . ALA B 1 81  ? 29.484  14.542  19.733  1.00 78.98  ? 105  ALA B CA  1 
ATOM   4711 C C   . ALA B 1 81  ? 29.504  14.432  21.246  1.00 78.98  ? 105  ALA B C   1 
ATOM   4712 O O   . ALA B 1 81  ? 30.251  15.132  21.925  1.00 78.98  ? 105  ALA B O   1 
ATOM   4713 C CB  . ALA B 1 81  ? 28.281  15.337  19.282  1.00 92.51  ? 105  ALA B CB  1 
ATOM   4714 N N   . LEU B 1 82  ? 28.681  13.529  21.764  1.00 74.90  ? 106  LEU B N   1 
ATOM   4715 C CA  . LEU B 1 82  ? 28.591  13.301  23.202  1.00 74.90  ? 106  LEU B CA  1 
ATOM   4716 C C   . LEU B 1 82  ? 29.972  13.055  23.767  1.00 74.90  ? 106  LEU B C   1 
ATOM   4717 O O   . LEU B 1 82  ? 30.402  13.727  24.695  1.00 74.90  ? 106  LEU B O   1 
ATOM   4718 C CB  . LEU B 1 82  ? 27.707  12.091  23.492  1.00 93.00  ? 106  LEU B CB  1 
ATOM   4719 C CG  . LEU B 1 82  ? 26.934  12.117  24.812  1.00 93.00  ? 106  LEU B CG  1 
ATOM   4720 C CD1 . LEU B 1 82  ? 26.004  10.936  24.845  1.00 93.00  ? 106  LEU B CD1 1 
ATOM   4721 C CD2 . LEU B 1 82  ? 27.872  12.086  25.992  1.00 93.00  ? 106  LEU B CD2 1 
ATOM   4722 N N   . GLU B 1 83  ? 30.661  12.076  23.203  1.00 82.73  ? 107  GLU B N   1 
ATOM   4723 C CA  . GLU B 1 83  ? 32.000  11.762  23.651  1.00 82.73  ? 107  GLU B CA  1 
ATOM   4724 C C   . GLU B 1 83  ? 32.855  13.024  23.584  1.00 82.73  ? 107  GLU B C   1 
ATOM   4725 O O   . GLU B 1 83  ? 33.545  13.379  24.545  1.00 82.73  ? 107  GLU B O   1 
ATOM   4726 C CB  . GLU B 1 83  ? 32.614  10.656  22.777  1.00 123.64 ? 107  GLU B CB  1 
ATOM   4727 C CG  . GLU B 1 83  ? 31.946  9.287   22.941  1.00 123.64 ? 107  GLU B CG  1 
ATOM   4728 C CD  . GLU B 1 83  ? 32.699  8.150   22.257  1.00 123.64 ? 107  GLU B CD  1 
ATOM   4729 O OE1 . GLU B 1 83  ? 33.900  7.966   22.553  1.00 123.64 ? 107  GLU B OE1 1 
ATOM   4730 O OE2 . GLU B 1 83  ? 32.082  7.435   21.435  1.00 123.64 ? 107  GLU B OE2 1 
ATOM   4731 N N   . GLN B 1 84  ? 32.798  13.710  22.445  1.00 83.60  ? 108  GLN B N   1 
ATOM   4732 C CA  . GLN B 1 84  ? 33.578  14.932  22.262  1.00 83.60  ? 108  GLN B CA  1 
ATOM   4733 C C   . GLN B 1 84  ? 33.259  15.915  23.382  1.00 83.60  ? 108  GLN B C   1 
ATOM   4734 O O   . GLN B 1 84  ? 34.153  16.390  24.079  1.00 83.60  ? 108  GLN B O   1 
ATOM   4735 C CB  . GLN B 1 84  ? 33.267  15.559  20.892  1.00 110.88 ? 108  GLN B CB  1 
ATOM   4736 C CG  . GLN B 1 84  ? 33.693  14.702  19.696  1.00 110.88 ? 108  GLN B CG  1 
ATOM   4737 C CD  . GLN B 1 84  ? 35.207  14.683  19.475  1.00 110.88 ? 108  GLN B CD  1 
ATOM   4738 O OE1 . GLN B 1 84  ? 35.802  15.690  19.078  1.00 110.88 ? 108  GLN B OE1 1 
ATOM   4739 N NE2 . GLN B 1 84  ? 35.835  13.531  19.731  1.00 110.88 ? 108  GLN B NE2 1 
ATOM   4740 N N   . SER B 1 85  ? 31.968  16.187  23.553  1.00 68.41  ? 109  SER B N   1 
ATOM   4741 C CA  . SER B 1 85  ? 31.460  17.111  24.562  1.00 68.41  ? 109  SER B CA  1 
ATOM   4742 C C   . SER B 1 85  ? 32.043  16.837  25.931  1.00 68.41  ? 109  SER B C   1 
ATOM   4743 O O   . SER B 1 85  ? 32.120  17.719  26.778  1.00 68.41  ? 109  SER B O   1 
ATOM   4744 C CB  . SER B 1 85  ? 29.942  17.004  24.635  1.00 99.93  ? 109  SER B CB  1 
ATOM   4745 O OG  . SER B 1 85  ? 29.361  17.275  23.374  1.00 99.93  ? 109  SER B OG  1 
ATOM   4746 N N   . LEU B 1 86  ? 32.446  15.597  26.148  1.00 77.03  ? 110  LEU B N   1 
ATOM   4747 C CA  . LEU B 1 86  ? 33.031  15.232  27.419  1.00 77.03  ? 110  LEU B CA  1 
ATOM   4748 C C   . LEU B 1 86  ? 34.231  16.146  27.607  1.00 77.03  ? 110  LEU B C   1 
ATOM   4749 O O   . LEU B 1 86  ? 34.650  16.432  28.723  1.00 77.03  ? 110  LEU B O   1 
ATOM   4750 C CB  . LEU B 1 86  ? 33.454  13.763  27.391  1.00 72.48  ? 110  LEU B CB  1 
ATOM   4751 C CG  . LEU B 1 86  ? 33.150  12.950  28.652  1.00 72.48  ? 110  LEU B CG  1 
ATOM   4752 C CD1 . LEU B 1 86  ? 31.785  13.336  29.205  1.00 72.48  ? 110  LEU B CD1 1 
ATOM   4753 C CD2 . LEU B 1 86  ? 33.205  11.461  28.320  1.00 72.48  ? 110  LEU B CD2 1 
ATOM   4754 N N   . GLU B 1 87  ? 34.764  16.615  26.491  1.00 79.98  ? 111  GLU B N   1 
ATOM   4755 C CA  . GLU B 1 87  ? 35.899  17.513  26.497  1.00 79.98  ? 111  GLU B CA  1 
ATOM   4756 C C   . GLU B 1 87  ? 35.576  18.783  27.305  1.00 79.98  ? 111  GLU B C   1 
ATOM   4757 O O   . GLU B 1 87  ? 36.410  19.285  28.065  1.00 79.98  ? 111  GLU B O   1 
ATOM   4758 C CB  . GLU B 1 87  ? 36.241  17.897  25.058  1.00 189.24 ? 111  GLU B CB  1 
ATOM   4759 C CG  . GLU B 1 87  ? 37.662  18.370  24.846  1.00 189.24 ? 111  GLU B CG  1 
ATOM   4760 C CD  . GLU B 1 87  ? 38.666  17.243  24.932  1.00 189.24 ? 111  GLU B CD  1 
ATOM   4761 O OE1 . GLU B 1 87  ? 39.876  17.515  24.782  1.00 189.24 ? 111  GLU B OE1 1 
ATOM   4762 O OE2 . GLU B 1 87  ? 38.244  16.086  25.146  1.00 189.24 ? 111  GLU B OE2 1 
ATOM   4763 N N   . PHE B 1 88  ? 34.367  19.306  27.159  1.00 70.84  ? 112  PHE B N   1 
ATOM   4764 C CA  . PHE B 1 88  ? 34.021  20.524  27.876  1.00 70.84  ? 112  PHE B CA  1 
ATOM   4765 C C   . PHE B 1 88  ? 33.757  20.379  29.370  1.00 70.84  ? 112  PHE B C   1 
ATOM   4766 O O   . PHE B 1 88  ? 34.184  21.234  30.140  1.00 70.84  ? 112  PHE B O   1 
ATOM   4767 C CB  . PHE B 1 88  ? 32.811  21.186  27.246  1.00 77.33  ? 112  PHE B CB  1 
ATOM   4768 C CG  . PHE B 1 88  ? 32.867  21.256  25.748  1.00 77.33  ? 112  PHE B CG  1 
ATOM   4769 C CD1 . PHE B 1 88  ? 32.020  20.472  24.970  1.00 77.33  ? 112  PHE B CD1 1 
ATOM   4770 C CD2 . PHE B 1 88  ? 33.724  22.141  25.116  1.00 77.33  ? 112  PHE B CD2 1 
ATOM   4771 C CE1 . PHE B 1 88  ? 32.022  20.574  23.605  1.00 77.33  ? 112  PHE B CE1 1 
ATOM   4772 C CE2 . PHE B 1 88  ? 33.732  22.247  23.739  1.00 77.33  ? 112  PHE B CE2 1 
ATOM   4773 C CZ  . PHE B 1 88  ? 32.879  21.464  22.987  1.00 77.33  ? 112  PHE B CZ  1 
ATOM   4774 N N   . VAL B 1 89  ? 33.045  19.334  29.795  1.00 91.92  ? 113  VAL B N   1 
ATOM   4775 C CA  . VAL B 1 89  ? 32.764  19.177  31.225  1.00 91.92  ? 113  VAL B CA  1 
ATOM   4776 C C   . VAL B 1 89  ? 34.051  18.864  31.941  1.00 91.92  ? 113  VAL B C   1 
ATOM   4777 O O   . VAL B 1 89  ? 34.240  19.262  33.083  1.00 91.92  ? 113  VAL B O   1 
ATOM   4778 C CB  . VAL B 1 89  ? 31.774  18.044  31.520  1.00 133.50 ? 113  VAL B CB  1 
ATOM   4779 C CG1 . VAL B 1 89  ? 30.486  18.276  30.770  1.00 133.50 ? 113  VAL B CG1 1 
ATOM   4780 C CG2 . VAL B 1 89  ? 32.388  16.712  31.146  1.00 133.50 ? 113  VAL B CG2 1 
ATOM   4781 N N   . ARG B 1 90  ? 34.934  18.144  31.258  1.00 102.12 ? 114  ARG B N   1 
ATOM   4782 C CA  . ARG B 1 90  ? 36.231  17.778  31.816  1.00 102.12 ? 114  ARG B CA  1 
ATOM   4783 C C   . ARG B 1 90  ? 37.053  19.058  31.915  1.00 102.12 ? 114  ARG B C   1 
ATOM   4784 O O   . ARG B 1 90  ? 37.981  19.170  32.724  1.00 102.12 ? 114  ARG B O   1 
ATOM   4785 C CB  . ARG B 1 90  ? 36.940  16.787  30.892  1.00 241.31 ? 114  ARG B CB  1 
ATOM   4786 C CG  . ARG B 1 90  ? 38.212  16.191  31.470  1.00 241.31 ? 114  ARG B CG  1 
ATOM   4787 C CD  . ARG B 1 90  ? 39.128  15.649  30.376  1.00 241.31 ? 114  ARG B CD  1 
ATOM   4788 N NE  . ARG B 1 90  ? 38.480  14.651  29.529  1.00 241.31 ? 114  ARG B NE  1 
ATOM   4789 C CZ  . ARG B 1 90  ? 39.066  14.061  28.491  1.00 241.31 ? 114  ARG B CZ  1 
ATOM   4790 N NH1 . ARG B 1 90  ? 40.317  14.367  28.168  1.00 241.31 ? 114  ARG B NH1 1 
ATOM   4791 N NH2 . ARG B 1 90  ? 38.401  13.162  27.774  1.00 241.31 ? 114  ARG B NH2 1 
ATOM   4792 N N   . ALA B 1 91  ? 36.678  20.030  31.091  1.00 217.27 ? 115  ALA B N   1 
ATOM   4793 C CA  . ALA B 1 91  ? 37.358  21.316  31.029  1.00 217.27 ? 115  ALA B CA  1 
ATOM   4794 C C   . ALA B 1 91  ? 36.973  22.302  32.136  1.00 217.27 ? 115  ALA B C   1 
ATOM   4795 O O   . ALA B 1 91  ? 37.399  23.460  32.111  1.00 217.27 ? 115  ALA B O   1 
ATOM   4796 C CB  . ALA B 1 91  ? 37.119  21.950  29.662  1.00 228.14 ? 115  ALA B CB  1 
ATOM   4797 N N   . SER B 1 92  ? 36.169  21.859  33.098  1.00 362.07 ? 116  SER B N   1 
ATOM   4798 C CA  . SER B 1 92  ? 35.767  22.739  34.194  1.00 362.07 ? 116  SER B CA  1 
ATOM   4799 C C   . SER B 1 92  ? 36.699  22.591  35.394  1.00 362.07 ? 116  SER B C   1 
ATOM   4800 O O   . SER B 1 92  ? 36.727  23.446  36.282  1.00 362.07 ? 116  SER B O   1 
ATOM   4801 C CB  . SER B 1 92  ? 34.318  22.453  34.613  1.00 113.60 ? 116  SER B CB  1 
ATOM   4802 O OG  . SER B 1 92  ? 33.393  23.099  33.747  1.00 113.60 ? 116  SER B OG  1 
ATOM   4803 N N   . LEU B 1 93  ? 37.471  21.510  35.407  1.00 216.92 ? 117  LEU B N   1 
ATOM   4804 C CA  . LEU B 1 93  ? 38.403  21.244  36.497  1.00 216.92 ? 117  LEU B CA  1 
ATOM   4805 C C   . LEU B 1 93  ? 39.615  22.173  36.462  1.00 216.92 ? 117  LEU B C   1 
ATOM   4806 O O   . LEU B 1 93  ? 39.817  22.980  37.372  1.00 216.92 ? 117  LEU B O   1 
ATOM   4807 C CB  . LEU B 1 93  ? 38.864  19.783  36.445  1.00 196.34 ? 117  LEU B CB  1 
ATOM   4808 C CG  . LEU B 1 93  ? 37.810  18.711  36.755  1.00 196.34 ? 117  LEU B CG  1 
ATOM   4809 C CD1 . LEU B 1 93  ? 36.658  18.800  35.763  1.00 196.34 ? 117  LEU B CD1 1 
ATOM   4810 C CD2 . LEU B 1 93  ? 38.457  17.334  36.702  1.00 196.34 ? 117  LEU B CD2 1 
ATOM   4811 N N   . ILE B 1 114 ? 46.356  22.745  29.863  1.00 287.74 ? 138  ILE B N   1 
ATOM   4812 C CA  . ILE B 1 114 ? 45.770  22.075  28.709  1.00 287.74 ? 138  ILE B CA  1 
ATOM   4813 C C   . ILE B 1 114 ? 44.239  22.165  28.711  1.00 287.74 ? 138  ILE B C   1 
ATOM   4814 O O   . ILE B 1 114 ? 43.626  22.341  27.660  1.00 287.74 ? 138  ILE B O   1 
ATOM   4815 C CB  . ILE B 1 114 ? 46.211  20.586  28.647  1.00 159.02 ? 138  ILE B CB  1 
ATOM   4816 C CG1 . ILE B 1 114 ? 47.740  20.497  28.597  1.00 159.02 ? 138  ILE B CG1 1 
ATOM   4817 C CG2 . ILE B 1 114 ? 45.619  19.904  27.413  1.00 159.02 ? 138  ILE B CG2 1 
ATOM   4818 C CD1 . ILE B 1 114 ? 48.368  21.156  27.387  1.00 159.02 ? 138  ILE B CD1 1 
ATOM   4819 N N   . PRO B 1 115 ? 43.601  22.046  29.889  1.00 189.18 ? 139  PRO B N   1 
ATOM   4820 C CA  . PRO B 1 115 ? 42.137  22.130  29.940  1.00 189.18 ? 139  PRO B CA  1 
ATOM   4821 C C   . PRO B 1 115 ? 41.646  23.578  29.809  1.00 189.18 ? 139  PRO B C   1 
ATOM   4822 O O   . PRO B 1 115 ? 42.235  24.496  30.389  1.00 189.18 ? 139  PRO B O   1 
ATOM   4823 C CB  . PRO B 1 115 ? 41.813  21.523  31.299  1.00 214.01 ? 139  PRO B CB  1 
ATOM   4824 C CG  . PRO B 1 115 ? 42.971  21.972  32.130  1.00 214.01 ? 139  PRO B CG  1 
ATOM   4825 C CD  . PRO B 1 115 ? 44.147  21.702  31.215  1.00 214.01 ? 139  PRO B CD  1 
ATOM   4826 N N   . LEU B 1 116 ? 40.570  23.775  29.049  1.00 153.69 ? 140  LEU B N   1 
ATOM   4827 C CA  . LEU B 1 116 ? 40.007  25.110  28.831  1.00 153.69 ? 140  LEU B CA  1 
ATOM   4828 C C   . LEU B 1 116 ? 38.719  25.421  29.602  1.00 153.69 ? 140  LEU B C   1 
ATOM   4829 O O   . LEU B 1 116 ? 37.698  24.755  29.422  1.00 153.69 ? 140  LEU B O   1 
ATOM   4830 C CB  . LEU B 1 116 ? 39.758  25.337  27.334  1.00 93.33  ? 140  LEU B CB  1 
ATOM   4831 C CG  . LEU B 1 116 ? 40.940  25.846  26.500  1.00 93.33  ? 140  LEU B CG  1 
ATOM   4832 C CD1 . LEU B 1 116 ? 40.503  26.057  25.062  1.00 93.33  ? 140  LEU B CD1 1 
ATOM   4833 C CD2 . LEU B 1 116 ? 41.460  27.159  27.083  1.00 93.33  ? 140  LEU B CD2 1 
ATOM   4834 N N   . LEU B 1 117 ? 38.771  26.449  30.446  1.00 115.24 ? 141  LEU B N   1 
ATOM   4835 C CA  . LEU B 1 117 ? 37.608  26.852  31.224  1.00 115.24 ? 141  LEU B CA  1 
ATOM   4836 C C   . LEU B 1 117 ? 36.487  27.314  30.297  1.00 115.24 ? 141  LEU B C   1 
ATOM   4837 O O   . LEU B 1 117 ? 36.486  28.466  29.835  1.00 115.24 ? 141  LEU B O   1 
ATOM   4838 C CB  . LEU B 1 117 ? 37.970  27.993  32.175  1.00 155.45 ? 141  LEU B CB  1 
ATOM   4839 C CG  . LEU B 1 117 ? 36.824  28.508  33.055  1.00 155.45 ? 141  LEU B CG  1 
ATOM   4840 C CD1 . LEU B 1 117 ? 36.397  27.410  34.022  1.00 155.45 ? 141  LEU B CD1 1 
ATOM   4841 C CD2 . LEU B 1 117 ? 37.262  29.759  33.817  1.00 155.45 ? 141  LEU B CD2 1 
ATOM   4842 N N   . ILE B 1 118 ? 35.540  26.412  30.033  1.00 97.07  ? 142  ILE B N   1 
ATOM   4843 C CA  . ILE B 1 118 ? 34.392  26.706  29.174  1.00 97.07  ? 142  ILE B CA  1 
ATOM   4844 C C   . ILE B 1 118 ? 33.331  27.567  29.857  1.00 97.07  ? 142  ILE B C   1 
ATOM   4845 O O   . ILE B 1 118 ? 32.947  27.316  31.000  1.00 97.07  ? 142  ILE B O   1 
ATOM   4846 C CB  . ILE B 1 118 ? 33.704  25.434  28.720  1.00 76.12  ? 142  ILE B CB  1 
ATOM   4847 C CG1 . ILE B 1 118 ? 34.704  24.545  27.982  1.00 76.12  ? 142  ILE B CG1 1 
ATOM   4848 C CG2 . ILE B 1 118 ? 32.506  25.789  27.852  1.00 76.12  ? 142  ILE B CG2 1 
ATOM   4849 C CD1 . ILE B 1 118 ? 35.255  25.147  26.705  1.00 76.12  ? 142  ILE B CD1 1 
ATOM   4850 N N   . ALA B 1 119 ? 32.847  28.577  29.147  1.00 89.44  ? 143  ALA B N   1 
ATOM   4851 C CA  . ALA B 1 119 ? 31.834  29.459  29.698  1.00 89.44  ? 143  ALA B CA  1 
ATOM   4852 C C   . ALA B 1 119 ? 30.466  29.025  29.203  1.00 89.44  ? 143  ALA B C   1 
ATOM   4853 O O   . ALA B 1 119 ? 29.487  29.059  29.951  1.00 89.44  ? 143  ALA B O   1 
ATOM   4854 C CB  . ALA B 1 119 ? 32.108  30.892  29.284  1.00 76.80  ? 143  ALA B CB  1 
ATOM   4855 N N   . GLY B 1 120 ? 30.413  28.616  27.938  1.00 89.24  ? 144  GLY B N   1 
ATOM   4856 C CA  . GLY B 1 120 ? 29.166  28.180  27.339  1.00 89.24  ? 144  GLY B CA  1 
ATOM   4857 C C   . GLY B 1 120 ? 29.464  27.441  26.058  1.00 89.24  ? 144  GLY B C   1 
ATOM   4858 O O   . GLY B 1 120 ? 30.497  27.678  25.436  1.00 89.24  ? 144  GLY B O   1 
ATOM   4859 N N   . VAL B 1 121 ? 28.579  26.535  25.666  1.00 83.93  ? 145  VAL B N   1 
ATOM   4860 C CA  . VAL B 1 121 ? 28.791  25.782  24.443  1.00 83.93  ? 145  VAL B CA  1 
ATOM   4861 C C   . VAL B 1 121 ? 27.824  26.261  23.401  1.00 83.93  ? 145  VAL B C   1 
ATOM   4862 O O   . VAL B 1 121 ? 26.618  26.322  23.650  1.00 83.93  ? 145  VAL B O   1 
ATOM   4863 C CB  . VAL B 1 121 ? 28.573  24.262  24.638  1.00 65.94  ? 145  VAL B CB  1 
ATOM   4864 C CG1 . VAL B 1 121 ? 28.541  23.568  23.294  1.00 65.94  ? 145  VAL B CG1 1 
ATOM   4865 C CG2 . VAL B 1 121 ? 29.696  23.677  25.468  1.00 65.94  ? 145  VAL B CG2 1 
ATOM   4866 N N   . ILE B 1 122 ? 28.378  26.625  22.247  1.00 92.85  ? 146  ILE B N   1 
ATOM   4867 C CA  . ILE B 1 122 ? 27.602  27.077  21.096  1.00 92.85  ? 146  ILE B CA  1 
ATOM   4868 C C   . ILE B 1 122 ? 27.517  25.835  20.221  1.00 92.85  ? 146  ILE B C   1 
ATOM   4869 O O   . ILE B 1 122 ? 28.506  25.443  19.603  1.00 92.85  ? 146  ILE B O   1 
ATOM   4870 C CB  . ILE B 1 122 ? 28.336  28.188  20.289  1.00 73.91  ? 146  ILE B CB  1 
ATOM   4871 C CG1 . ILE B 1 122 ? 28.306  29.513  21.043  1.00 73.91  ? 146  ILE B CG1 1 
ATOM   4872 C CG2 . ILE B 1 122 ? 27.680  28.372  18.953  1.00 73.91  ? 146  ILE B CG2 1 
ATOM   4873 C CD1 . ILE B 1 122 ? 26.905  30.034  21.291  1.00 73.91  ? 146  ILE B CD1 1 
ATOM   4874 N N   . GLY B 1 123 ? 26.360  25.190  20.172  1.00 78.36  ? 147  GLY B N   1 
ATOM   4875 C CA  . GLY B 1 123 ? 26.314  24.007  19.354  1.00 78.36  ? 147  GLY B CA  1 
ATOM   4876 C C   . GLY B 1 123 ? 25.116  23.101  19.395  1.00 78.36  ? 147  GLY B C   1 
ATOM   4877 O O   . GLY B 1 123 ? 24.191  23.222  20.207  1.00 78.36  ? 147  GLY B O   1 
ATOM   4878 N N   . GLY B 1 124 ? 25.187  22.156  18.469  1.00 125.36 ? 148  GLY B N   1 
ATOM   4879 C CA  . GLY B 1 124 ? 24.149  21.180  18.287  1.00 125.36 ? 148  GLY B CA  1 
ATOM   4880 C C   . GLY B 1 124 ? 23.454  21.502  16.984  1.00 125.36 ? 148  GLY B C   1 
ATOM   4881 O O   . GLY B 1 124 ? 22.520  22.302  16.964  1.00 125.36 ? 148  GLY B O   1 
ATOM   4882 N N   . SER B 1 125 ? 23.919  20.922  15.883  1.00 98.47  ? 149  SER B N   1 
ATOM   4883 C CA  . SER B 1 125 ? 23.253  21.180  14.622  1.00 98.47  ? 149  SER B CA  1 
ATOM   4884 C C   . SER B 1 125 ? 22.029  20.272  14.591  1.00 98.47  ? 149  SER B C   1 
ATOM   4885 O O   . SER B 1 125 ? 20.896  20.747  14.680  1.00 98.47  ? 149  SER B O   1 
ATOM   4886 C CB  . SER B 1 125 ? 24.176  20.889  13.452  1.00 98.12  ? 149  SER B CB  1 
ATOM   4887 O OG  . SER B 1 125 ? 24.109  21.957  12.519  1.00 98.12  ? 149  SER B OG  1 
ATOM   4888 N N   . TYR B 1 126 ? 22.251  18.965  14.487  1.00 78.11  ? 150  TYR B N   1 
ATOM   4889 C CA  . TYR B 1 126 ? 21.129  18.027  14.493  1.00 78.11  ? 150  TYR B CA  1 
ATOM   4890 C C   . TYR B 1 126 ? 20.507  17.978  15.896  1.00 78.11  ? 150  TYR B C   1 
ATOM   4891 O O   . TYR B 1 126 ? 21.219  17.936  16.897  1.00 78.11  ? 150  TYR B O   1 
ATOM   4892 C CB  . TYR B 1 126 ? 21.597  16.624  14.101  1.00 153.80 ? 150  TYR B CB  1 
ATOM   4893 C CG  . TYR B 1 126 ? 22.101  16.520  12.687  1.00 153.80 ? 150  TYR B CG  1 
ATOM   4894 C CD1 . TYR B 1 126 ? 23.435  16.225  12.424  1.00 153.80 ? 150  TYR B CD1 1 
ATOM   4895 C CD2 . TYR B 1 126 ? 21.246  16.729  11.606  1.00 153.80 ? 150  TYR B CD2 1 
ATOM   4896 C CE1 . TYR B 1 126 ? 23.907  16.141  11.117  1.00 153.80 ? 150  TYR B CE1 1 
ATOM   4897 C CE2 . TYR B 1 126 ? 21.709  16.651  10.294  1.00 153.80 ? 150  TYR B CE2 1 
ATOM   4898 C CZ  . TYR B 1 126 ? 23.041  16.357  10.059  1.00 153.80 ? 150  TYR B CZ  1 
ATOM   4899 O OH  . TYR B 1 126 ? 23.522  16.295  8.773   1.00 153.80 ? 150  TYR B OH  1 
ATOM   4900 N N   . SER B 1 127 ? 19.181  17.990  15.978  1.00 83.46  ? 151  SER B N   1 
ATOM   4901 C CA  . SER B 1 127 ? 18.527  17.934  17.280  1.00 83.46  ? 151  SER B CA  1 
ATOM   4902 C C   . SER B 1 127 ? 19.064  16.733  18.036  1.00 83.46  ? 151  SER B C   1 
ATOM   4903 O O   . SER B 1 127 ? 19.393  16.817  19.219  1.00 83.46  ? 151  SER B O   1 
ATOM   4904 C CB  . SER B 1 127 ? 17.021  17.789  17.109  1.00 99.74  ? 151  SER B CB  1 
ATOM   4905 O OG  . SER B 1 127 ? 16.487  18.925  16.464  1.00 99.74  ? 151  SER B OG  1 
ATOM   4906 N N   . SER B 1 128 ? 19.158  15.620  17.314  1.00 101.18 ? 152  SER B N   1 
ATOM   4907 C CA  . SER B 1 128 ? 19.644  14.339  17.829  1.00 101.18 ? 152  SER B CA  1 
ATOM   4908 C C   . SER B 1 128 ? 20.838  14.505  18.772  1.00 101.18 ? 152  SER B C   1 
ATOM   4909 O O   . SER B 1 128 ? 20.870  13.919  19.850  1.00 101.18 ? 152  SER B O   1 
ATOM   4910 C CB  . SER B 1 128 ? 20.036  13.432  16.651  1.00 133.51 ? 152  SER B CB  1 
ATOM   4911 O OG  . SER B 1 128 ? 19.129  13.570  15.562  1.00 133.51 ? 152  SER B OG  1 
ATOM   4912 N N   . VAL B 1 129 ? 21.814  15.310  18.359  1.00 71.21  ? 153  VAL B N   1 
ATOM   4913 C CA  . VAL B 1 129 ? 23.007  15.543  19.165  1.00 71.21  ? 153  VAL B CA  1 
ATOM   4914 C C   . VAL B 1 129 ? 22.869  16.677  20.176  1.00 71.21  ? 153  VAL B C   1 
ATOM   4915 O O   . VAL B 1 129 ? 23.492  16.656  21.230  1.00 71.21  ? 153  VAL B O   1 
ATOM   4916 C CB  . VAL B 1 129 ? 24.270  15.780  18.271  1.00 80.91  ? 153  VAL B CB  1 
ATOM   4917 C CG1 . VAL B 1 129 ? 23.913  16.557  17.026  1.00 80.91  ? 153  VAL B CG1 1 
ATOM   4918 C CG2 . VAL B 1 129 ? 25.328  16.528  19.062  1.00 80.91  ? 153  VAL B CG2 1 
ATOM   4919 N N   . SER B 1 130 ? 22.058  17.674  19.880  1.00 77.08  ? 154  SER B N   1 
ATOM   4920 C CA  . SER B 1 130 ? 21.917  18.729  20.853  1.00 77.08  ? 154  SER B CA  1 
ATOM   4921 C C   . SER B 1 130 ? 21.376  18.152  22.140  1.00 77.08  ? 154  SER B C   1 
ATOM   4922 O O   . SER B 1 130 ? 21.854  18.490  23.216  1.00 77.08  ? 154  SER B O   1 
ATOM   4923 C CB  . SER B 1 130 ? 21.003  19.822  20.337  1.00 70.50  ? 154  SER B CB  1 
ATOM   4924 O OG  . SER B 1 130 ? 21.787  20.786  19.668  1.00 70.50  ? 154  SER B OG  1 
ATOM   4925 N N   . ILE B 1 131 ? 20.390  17.267  22.036  1.00 77.09  ? 155  ILE B N   1 
ATOM   4926 C CA  . ILE B 1 131 ? 19.814  16.659  23.228  1.00 77.09  ? 155  ILE B CA  1 
ATOM   4927 C C   . ILE B 1 131 ? 20.881  15.844  23.935  1.00 77.09  ? 155  ILE B C   1 
ATOM   4928 O O   . ILE B 1 131 ? 21.256  16.155  25.061  1.00 77.09  ? 155  ILE B O   1 
ATOM   4929 C CB  . ILE B 1 131 ? 18.644  15.718  22.890  1.00 80.33  ? 155  ILE B CB  1 
ATOM   4930 C CG1 . ILE B 1 131 ? 17.605  16.450  22.045  1.00 80.33  ? 155  ILE B CG1 1 
ATOM   4931 C CG2 . ILE B 1 131 ? 17.988  15.216  24.173  1.00 80.33  ? 155  ILE B CG2 1 
ATOM   4932 C CD1 . ILE B 1 131 ? 16.497  15.531  21.535  1.00 80.33  ? 155  ILE B CD1 1 
ATOM   4933 N N   . GLN B 1 132 ? 21.371  14.804  23.268  1.00 85.62  ? 156  GLN B N   1 
ATOM   4934 C CA  . GLN B 1 132 ? 22.396  13.937  23.846  1.00 85.62  ? 156  GLN B CA  1 
ATOM   4935 C C   . GLN B 1 132 ? 23.485  14.726  24.541  1.00 85.62  ? 156  GLN B C   1 
ATOM   4936 O O   . GLN B 1 132 ? 24.099  14.256  25.491  1.00 85.62  ? 156  GLN B O   1 
ATOM   4937 C CB  . GLN B 1 132 ? 23.034  13.058  22.773  1.00 125.97 ? 156  GLN B CB  1 
ATOM   4938 C CG  . GLN B 1 132 ? 22.394  11.699  22.641  1.00 125.97 ? 156  GLN B CG  1 
ATOM   4939 C CD  . GLN B 1 132 ? 22.510  10.887  23.913  1.00 125.97 ? 156  GLN B CD  1 
ATOM   4940 O OE1 . GLN B 1 132 ? 22.074  11.321  24.982  1.00 125.97 ? 156  GLN B OE1 1 
ATOM   4941 N NE2 . GLN B 1 132 ? 23.099  9.697   23.805  1.00 125.97 ? 156  GLN B NE2 1 
ATOM   4942 N N   . VAL B 1 133 ? 23.729  15.933  24.056  1.00 58.30  ? 157  VAL B N   1 
ATOM   4943 C CA  . VAL B 1 133 ? 24.751  16.779  24.636  1.00 58.30  ? 157  VAL B CA  1 
ATOM   4944 C C   . VAL B 1 133 ? 24.186  17.538  25.819  1.00 58.30  ? 157  VAL B C   1 
ATOM   4945 O O   . VAL B 1 133 ? 24.816  17.626  26.863  1.00 58.30  ? 157  VAL B O   1 
ATOM   4946 C CB  . VAL B 1 133 ? 25.287  17.757  23.595  1.00 44.27  ? 157  VAL B CB  1 
ATOM   4947 C CG1 . VAL B 1 133 ? 26.130  18.817  24.256  1.00 44.27  ? 157  VAL B CG1 1 
ATOM   4948 C CG2 . VAL B 1 133 ? 26.104  16.997  22.574  1.00 44.27  ? 157  VAL B CG2 1 
ATOM   4949 N N   . ALA B 1 134 ? 22.991  18.085  25.654  1.00 68.64  ? 158  ALA B N   1 
ATOM   4950 C CA  . ALA B 1 134 ? 22.357  18.825  26.730  1.00 68.64  ? 158  ALA B CA  1 
ATOM   4951 C C   . ALA B 1 134 ? 22.352  17.955  27.967  1.00 68.64  ? 158  ALA B C   1 
ATOM   4952 O O   . ALA B 1 134 ? 22.630  18.415  29.066  1.00 68.64  ? 158  ALA B O   1 
ATOM   4953 C CB  . ALA B 1 134 ? 20.933  19.180  26.354  1.00 63.05  ? 158  ALA B CB  1 
ATOM   4954 N N   . ASN B 1 135 ? 22.039  16.685  27.782  1.00 86.00  ? 159  ASN B N   1 
ATOM   4955 C CA  . ASN B 1 135 ? 21.984  15.769  28.904  1.00 86.00  ? 159  ASN B CA  1 
ATOM   4956 C C   . ASN B 1 135 ? 23.260  15.729  29.748  1.00 86.00  ? 159  ASN B C   1 
ATOM   4957 O O   . ASN B 1 135 ? 23.239  15.300  30.902  1.00 86.00  ? 159  ASN B O   1 
ATOM   4958 C CB  . ASN B 1 135 ? 21.646  14.360  28.409  1.00 103.83 ? 159  ASN B CB  1 
ATOM   4959 C CG  . ASN B 1 135 ? 20.262  14.275  27.820  1.00 103.83 ? 159  ASN B CG  1 
ATOM   4960 O OD1 . ASN B 1 135 ? 19.405  15.115  28.107  1.00 103.83 ? 159  ASN B OD1 1 
ATOM   4961 N ND2 . ASN B 1 135 ? 20.024  13.252  27.005  1.00 103.83 ? 159  ASN B ND2 1 
ATOM   4962 N N   . LEU B 1 136 ? 24.367  16.188  29.185  1.00 72.10  ? 160  LEU B N   1 
ATOM   4963 C CA  . LEU B 1 136 ? 25.636  16.164  29.903  1.00 72.10  ? 160  LEU B CA  1 
ATOM   4964 C C   . LEU B 1 136 ? 26.060  17.514  30.494  1.00 72.10  ? 160  LEU B C   1 
ATOM   4965 O O   . LEU B 1 136 ? 26.598  17.567  31.606  1.00 72.10  ? 160  LEU B O   1 
ATOM   4966 C CB  . LEU B 1 136 ? 26.728  15.646  28.975  1.00 38.97  ? 160  LEU B CB  1 
ATOM   4967 C CG  . LEU B 1 136 ? 28.134  15.742  29.538  1.00 38.97  ? 160  LEU B CG  1 
ATOM   4968 C CD1 . LEU B 1 136 ? 28.440  14.493  30.319  1.00 38.97  ? 160  LEU B CD1 1 
ATOM   4969 C CD2 . LEU B 1 136 ? 29.118  15.930  28.403  1.00 38.97  ? 160  LEU B CD2 1 
ATOM   4970 N N   . LEU B 1 137 ? 25.827  18.596  29.747  1.00 67.25  ? 161  LEU B N   1 
ATOM   4971 C CA  . LEU B 1 137 ? 26.186  19.943  30.197  1.00 67.25  ? 161  LEU B CA  1 
ATOM   4972 C C   . LEU B 1 137 ? 25.422  20.380  31.429  1.00 67.25  ? 161  LEU B C   1 
ATOM   4973 O O   . LEU B 1 137 ? 25.947  21.112  32.258  1.00 67.25  ? 161  LEU B O   1 
ATOM   4974 C CB  . LEU B 1 137 ? 25.976  20.975  29.080  1.00 70.75  ? 161  LEU B CB  1 
ATOM   4975 C CG  . LEU B 1 137 ? 27.104  21.189  28.053  1.00 70.75  ? 161  LEU B CG  1 
ATOM   4976 C CD1 . LEU B 1 137 ? 28.334  20.324  28.368  1.00 70.75  ? 161  LEU B CD1 1 
ATOM   4977 C CD2 . LEU B 1 137 ? 26.561  20.873  26.654  1.00 70.75  ? 161  LEU B CD2 1 
ATOM   4978 N N   . ARG B 1 138 ? 24.180  19.938  31.552  1.00 78.90  ? 162  ARG B N   1 
ATOM   4979 C CA  . ARG B 1 138 ? 23.383  20.304  32.705  1.00 78.90  ? 162  ARG B CA  1 
ATOM   4980 C C   . ARG B 1 138 ? 24.064  19.725  33.940  1.00 78.90  ? 162  ARG B C   1 
ATOM   4981 O O   . ARG B 1 138 ? 24.136  20.359  34.988  1.00 78.90  ? 162  ARG B O   1 
ATOM   4982 C CB  . ARG B 1 138 ? 21.968  19.747  32.569  1.00 158.56 ? 162  ARG B CB  1 
ATOM   4983 C CG  . ARG B 1 138 ? 21.891  18.230  32.518  1.00 158.56 ? 162  ARG B CG  1 
ATOM   4984 C CD  . ARG B 1 138 ? 20.450  17.781  32.362  1.00 158.56 ? 162  ARG B CD  1 
ATOM   4985 N NE  . ARG B 1 138 ? 19.593  18.450  33.332  1.00 158.56 ? 162  ARG B NE  1 
ATOM   4986 C CZ  . ARG B 1 138 ? 19.627  18.215  34.637  1.00 158.56 ? 162  ARG B CZ  1 
ATOM   4987 N NH1 . ARG B 1 138 ? 20.471  17.318  35.124  1.00 158.56 ? 162  ARG B NH1 1 
ATOM   4988 N NH2 . ARG B 1 138 ? 18.833  18.887  35.458  1.00 158.56 ? 162  ARG B NH2 1 
ATOM   4989 N N   . LEU B 1 139 ? 24.580  18.513  33.819  1.00 89.40  ? 163  LEU B N   1 
ATOM   4990 C CA  . LEU B 1 139 ? 25.240  17.891  34.946  1.00 89.40  ? 163  LEU B CA  1 
ATOM   4991 C C   . LEU B 1 139 ? 26.413  18.727  35.421  1.00 89.40  ? 163  LEU B C   1 
ATOM   4992 O O   . LEU B 1 139 ? 26.939  18.508  36.513  1.00 89.40  ? 163  LEU B O   1 
ATOM   4993 C CB  . LEU B 1 139 ? 25.729  16.505  34.565  1.00 51.45  ? 163  LEU B CB  1 
ATOM   4994 C CG  . LEU B 1 139 ? 24.759  15.370  34.861  1.00 51.45  ? 163  LEU B CG  1 
ATOM   4995 C CD1 . LEU B 1 139 ? 23.365  15.683  34.320  1.00 51.45  ? 163  LEU B CD1 1 
ATOM   4996 C CD2 . LEU B 1 139 ? 25.342  14.090  34.248  1.00 51.45  ? 163  LEU B CD2 1 
ATOM   4997 N N   . PHE B 1 140 ? 26.833  19.687  34.606  1.00 67.41  ? 164  PHE B N   1 
ATOM   4998 C CA  . PHE B 1 140 ? 27.960  20.517  34.988  1.00 67.41  ? 164  PHE B CA  1 
ATOM   4999 C C   . PHE B 1 140 ? 27.643  21.976  34.818  1.00 67.41  ? 164  PHE B C   1 
ATOM   5000 O O   . PHE B 1 140 ? 28.539  22.793  34.661  1.00 67.41  ? 164  PHE B O   1 
ATOM   5001 C CB  . PHE B 1 140 ? 29.203  20.165  34.168  1.00 81.14  ? 164  PHE B CB  1 
ATOM   5002 C CG  . PHE B 1 140 ? 29.626  18.742  34.302  1.00 81.14  ? 164  PHE B CG  1 
ATOM   5003 C CD1 . PHE B 1 140 ? 28.963  17.743  33.607  1.00 81.14  ? 164  PHE B CD1 1 
ATOM   5004 C CD2 . PHE B 1 140 ? 30.657  18.390  35.151  1.00 81.14  ? 164  PHE B CD2 1 
ATOM   5005 C CE1 . PHE B 1 140 ? 29.323  16.410  33.759  1.00 81.14  ? 164  PHE B CE1 1 
ATOM   5006 C CE2 . PHE B 1 140 ? 31.026  17.061  35.313  1.00 81.14  ? 164  PHE B CE2 1 
ATOM   5007 C CZ  . PHE B 1 140 ? 30.362  16.069  34.619  1.00 81.14  ? 164  PHE B CZ  1 
ATOM   5008 N N   . GLN B 1 141 ? 26.361  22.301  34.834  1.00 67.97  ? 165  GLN B N   1 
ATOM   5009 C CA  . GLN B 1 141 ? 25.910  23.687  34.711  1.00 67.97  ? 165  GLN B CA  1 
ATOM   5010 C C   . GLN B 1 141 ? 26.633  24.529  33.652  1.00 67.97  ? 165  GLN B C   1 
ATOM   5011 O O   . GLN B 1 141 ? 27.260  25.534  33.963  1.00 67.97  ? 165  GLN B O   1 
ATOM   5012 C CB  . GLN B 1 141 ? 26.027  24.367  36.071  1.00 124.91 ? 165  GLN B CB  1 
ATOM   5013 C CG  . GLN B 1 141 ? 25.408  23.575  37.198  1.00 124.91 ? 165  GLN B CG  1 
ATOM   5014 C CD  . GLN B 1 141 ? 26.069  23.875  38.515  1.00 124.91 ? 165  GLN B CD  1 
ATOM   5015 O OE1 . GLN B 1 141 ? 27.254  23.589  38.711  1.00 124.91 ? 165  GLN B OE1 1 
ATOM   5016 N NE2 . GLN B 1 141 ? 25.315  24.464  39.430  1.00 124.91 ? 165  GLN B NE2 1 
ATOM   5017 N N   . ILE B 1 142 ? 26.530  24.119  32.397  1.00 70.38  ? 166  ILE B N   1 
ATOM   5018 C CA  . ILE B 1 142 ? 27.158  24.842  31.297  1.00 70.38  ? 166  ILE B CA  1 
ATOM   5019 C C   . ILE B 1 142 ? 26.091  25.273  30.315  1.00 70.38  ? 166  ILE B C   1 
ATOM   5020 O O   . ILE B 1 142 ? 25.411  24.439  29.728  1.00 70.38  ? 166  ILE B O   1 
ATOM   5021 C CB  . ILE B 1 142 ? 28.130  23.955  30.528  1.00 54.54  ? 166  ILE B CB  1 
ATOM   5022 C CG1 . ILE B 1 142 ? 29.339  23.627  31.394  1.00 54.54  ? 166  ILE B CG1 1 
ATOM   5023 C CG2 . ILE B 1 142 ? 28.521  24.639  29.248  1.00 54.54  ? 166  ILE B CG2 1 
ATOM   5024 C CD1 . ILE B 1 142 ? 30.281  22.648  30.745  1.00 54.54  ? 166  ILE B CD1 1 
ATOM   5025 N N   . PRO B 1 143 ? 25.926  26.575  30.115  1.00 70.97  ? 167  PRO B N   1 
ATOM   5026 C CA  . PRO B 1 143 ? 24.902  27.023  29.170  1.00 70.97  ? 167  PRO B CA  1 
ATOM   5027 C C   . PRO B 1 143 ? 25.174  26.625  27.693  1.00 70.97  ? 167  PRO B C   1 
ATOM   5028 O O   . PRO B 1 143 ? 26.263  26.859  27.150  1.00 70.97  ? 167  PRO B O   1 
ATOM   5029 C CB  . PRO B 1 143 ? 24.847  28.534  29.417  1.00 86.30  ? 167  PRO B CB  1 
ATOM   5030 C CG  . PRO B 1 143 ? 26.211  28.855  29.914  1.00 86.30  ? 167  PRO B CG  1 
ATOM   5031 C CD  . PRO B 1 143 ? 26.530  27.706  30.826  1.00 86.30  ? 167  PRO B CD  1 
ATOM   5032 N N   . GLN B 1 144 ? 24.174  26.003  27.062  1.00 72.42  ? 168  GLN B N   1 
ATOM   5033 C CA  . GLN B 1 144 ? 24.264  25.543  25.675  1.00 72.42  ? 168  GLN B CA  1 
ATOM   5034 C C   . GLN B 1 144 ? 23.312  26.360  24.832  1.00 72.42  ? 168  GLN B C   1 
ATOM   5035 O O   . GLN B 1 144 ? 22.243  26.756  25.306  1.00 72.42  ? 168  GLN B O   1 
ATOM   5036 C CB  . GLN B 1 144 ? 23.853  24.080  25.584  1.00 73.30  ? 168  GLN B CB  1 
ATOM   5037 C CG  . GLN B 1 144 ? 24.069  23.464  24.221  1.00 73.30  ? 168  GLN B CG  1 
ATOM   5038 C CD  . GLN B 1 144 ? 23.608  22.010  24.142  1.00 73.30  ? 168  GLN B CD  1 
ATOM   5039 O OE1 . GLN B 1 144 ? 23.569  21.300  25.148  1.00 73.30  ? 168  GLN B OE1 1 
ATOM   5040 N NE2 . GLN B 1 144 ? 23.279  21.560  22.936  1.00 73.30  ? 168  GLN B NE2 1 
ATOM   5041 N N   . ILE B 1 145 ? 23.695  26.615  23.585  1.00 83.79  ? 169  ILE B N   1 
ATOM   5042 C CA  . ILE B 1 145 ? 22.858  27.389  22.666  1.00 83.79  ? 169  ILE B CA  1 
ATOM   5043 C C   . ILE B 1 145 ? 22.953  26.781  21.291  1.00 83.79  ? 169  ILE B C   1 
ATOM   5044 O O   . ILE B 1 145 ? 24.036  26.721  20.715  1.00 83.79  ? 169  ILE B O   1 
ATOM   5045 C CB  . ILE B 1 145 ? 23.327  28.837  22.531  1.00 74.78  ? 169  ILE B CB  1 
ATOM   5046 C CG1 . ILE B 1 145 ? 23.469  29.464  23.900  1.00 74.78  ? 169  ILE B CG1 1 
ATOM   5047 C CG2 . ILE B 1 145 ? 22.319  29.633  21.761  1.00 74.78  ? 169  ILE B CG2 1 
ATOM   5048 C CD1 . ILE B 1 145 ? 24.627  30.398  23.982  1.00 74.78  ? 169  ILE B CD1 1 
ATOM   5049 N N   . SER B 1 146 ? 21.830  26.325  20.754  1.00 93.09  ? 170  SER B N   1 
ATOM   5050 C CA  . SER B 1 146 ? 21.874  25.748  19.428  1.00 93.09  ? 170  SER B CA  1 
ATOM   5051 C C   . SER B 1 146 ? 21.441  26.759  18.389  1.00 93.09  ? 170  SER B C   1 
ATOM   5052 O O   . SER B 1 146 ? 20.538  27.571  18.618  1.00 93.09  ? 170  SER B O   1 
ATOM   5053 C CB  . SER B 1 146 ? 20.989  24.522  19.321  1.00 65.94  ? 170  SER B CB  1 
ATOM   5054 O OG  . SER B 1 146 ? 21.091  24.002  18.010  1.00 65.94  ? 170  SER B OG  1 
ATOM   5055 N N   . TYR B 1 147 ? 22.105  26.687  17.242  1.00 75.58  ? 171  TYR B N   1 
ATOM   5056 C CA  . TYR B 1 147 ? 21.852  27.568  16.115  1.00 75.58  ? 171  TYR B CA  1 
ATOM   5057 C C   . TYR B 1 147 ? 21.030  26.833  15.059  1.00 75.58  ? 171  TYR B C   1 
ATOM   5058 O O   . TYR B 1 147 ? 20.837  27.334  13.966  1.00 75.58  ? 171  TYR B O   1 
ATOM   5059 C CB  . TYR B 1 147 ? 23.190  27.991  15.520  1.00 94.53  ? 171  TYR B CB  1 
ATOM   5060 C CG  . TYR B 1 147 ? 24.094  26.805  15.280  1.00 94.53  ? 171  TYR B CG  1 
ATOM   5061 C CD1 . TYR B 1 147 ? 23.783  25.857  14.305  1.00 94.53  ? 171  TYR B CD1 1 
ATOM   5062 C CD2 . TYR B 1 147 ? 25.239  26.605  16.051  1.00 94.53  ? 171  TYR B CD2 1 
ATOM   5063 C CE1 . TYR B 1 147 ? 24.591  24.735  14.101  1.00 94.53  ? 171  TYR B CE1 1 
ATOM   5064 C CE2 . TYR B 1 147 ? 26.056  25.489  15.856  1.00 94.53  ? 171  TYR B CE2 1 
ATOM   5065 C CZ  . TYR B 1 147 ? 25.725  24.558  14.878  1.00 94.53  ? 171  TYR B CZ  1 
ATOM   5066 O OH  . TYR B 1 147 ? 26.525  23.458  14.662  1.00 94.53  ? 171  TYR B OH  1 
ATOM   5067 N N   . ALA B 1 148 ? 20.546  25.640  15.382  1.00 82.60  ? 172  ALA B N   1 
ATOM   5068 C CA  . ALA B 1 148 ? 19.785  24.891  14.401  1.00 82.60  ? 172  ALA B CA  1 
ATOM   5069 C C   . ALA B 1 148 ? 18.889  23.764  14.910  1.00 82.60  ? 172  ALA B C   1 
ATOM   5070 O O   . ALA B 1 148 ? 17.875  23.481  14.289  1.00 82.60  ? 172  ALA B O   1 
ATOM   5071 C CB  . ALA B 1 148 ? 20.735  24.356  13.355  1.00 45.61  ? 172  ALA B CB  1 
ATOM   5072 N N   . SER B 1 149 ? 19.243  23.104  16.007  1.00 96.18  ? 173  SER B N   1 
ATOM   5073 C CA  . SER B 1 149 ? 18.390  22.029  16.505  1.00 96.18  ? 173  SER B CA  1 
ATOM   5074 C C   . SER B 1 149 ? 16.987  22.573  16.722  1.00 96.18  ? 173  SER B C   1 
ATOM   5075 O O   . SER B 1 149 ? 16.797  23.587  17.394  1.00 96.18  ? 173  SER B O   1 
ATOM   5076 C CB  . SER B 1 149 ? 18.928  21.467  17.809  1.00 91.13  ? 173  SER B CB  1 
ATOM   5077 O OG  . SER B 1 149 ? 20.154  20.806  17.578  1.00 91.13  ? 173  SER B OG  1 
ATOM   5078 N N   . THR B 1 150 ? 15.996  21.885  16.168  1.00 86.91  ? 174  THR B N   1 
ATOM   5079 C CA  . THR B 1 150 ? 14.625  22.349  16.276  1.00 86.91  ? 174  THR B CA  1 
ATOM   5080 C C   . THR B 1 150 ? 13.609  21.444  16.975  1.00 86.91  ? 174  THR B C   1 
ATOM   5081 O O   . THR B 1 150 ? 12.464  21.857  17.169  1.00 86.91  ? 174  THR B O   1 
ATOM   5082 C CB  . THR B 1 150 ? 14.098  22.705  14.884  1.00 104.03 ? 174  THR B CB  1 
ATOM   5083 O OG1 . THR B 1 150 ? 14.585  21.748  13.932  1.00 104.03 ? 174  THR B OG1 1 
ATOM   5084 C CG2 . THR B 1 150 ? 14.561  24.091  14.486  1.00 104.03 ? 174  THR B CG2 1 
ATOM   5085 N N   . SER B 1 151 ? 14.006  20.234  17.369  1.00 86.54  ? 175  SER B N   1 
ATOM   5086 C CA  . SER B 1 151 ? 13.068  19.327  18.042  1.00 86.54  ? 175  SER B CA  1 
ATOM   5087 C C   . SER B 1 151 ? 12.279  19.967  19.171  1.00 86.54  ? 175  SER B C   1 
ATOM   5088 O O   . SER B 1 151 ? 12.846  20.610  20.056  1.00 86.54  ? 175  SER B O   1 
ATOM   5089 C CB  . SER B 1 151 ? 13.785  18.116  18.622  1.00 71.03  ? 175  SER B CB  1 
ATOM   5090 O OG  . SER B 1 151 ? 12.949  17.501  19.588  1.00 71.03  ? 175  SER B OG  1 
ATOM   5091 N N   . ALA B 1 152 ? 10.971  19.766  19.156  1.00 100.32 ? 176  ALA B N   1 
ATOM   5092 C CA  . ALA B 1 152 ? 10.119  20.325  20.191  1.00 100.32 ? 176  ALA B CA  1 
ATOM   5093 C C   . ALA B 1 152 ? 10.515  19.755  21.544  1.00 100.32 ? 176  ALA B C   1 
ATOM   5094 O O   . ALA B 1 152 ? 10.280  20.371  22.577  1.00 100.32 ? 176  ALA B O   1 
ATOM   5095 C CB  . ALA B 1 152 ? 8.661   20.000  19.898  1.00 292.14 ? 176  ALA B CB  1 
ATOM   5096 N N   . LYS B 1 153 ? 11.125  18.578  21.533  1.00 76.30  ? 177  LYS B N   1 
ATOM   5097 C CA  . LYS B 1 153 ? 11.527  17.939  22.775  1.00 76.30  ? 177  LYS B CA  1 
ATOM   5098 C C   . LYS B 1 153 ? 12.371  18.875  23.631  1.00 76.30  ? 177  LYS B C   1 
ATOM   5099 O O   . LYS B 1 153 ? 12.205  18.912  24.847  1.00 76.30  ? 177  LYS B O   1 
ATOM   5100 C CB  . LYS B 1 153 ? 12.299  16.649  22.473  1.00 118.69 ? 177  LYS B CB  1 
ATOM   5101 C CG  . LYS B 1 153 ? 12.282  15.612  23.593  1.00 118.69 ? 177  LYS B CG  1 
ATOM   5102 C CD  . LYS B 1 153 ? 12.677  14.234  23.058  1.00 118.69 ? 177  LYS B CD  1 
ATOM   5103 C CE  . LYS B 1 153 ? 12.623  13.154  24.138  1.00 118.69 ? 177  LYS B CE  1 
ATOM   5104 N NZ  . LYS B 1 153 ? 13.073  11.811  23.655  1.00 118.69 ? 177  LYS B NZ  1 
ATOM   5105 N N   . LEU B 1 154 ? 13.253  19.640  22.989  1.00 94.70  ? 178  LEU B N   1 
ATOM   5106 C CA  . LEU B 1 154 ? 14.139  20.575  23.685  1.00 94.70  ? 178  LEU B CA  1 
ATOM   5107 C C   . LEU B 1 154 ? 13.457  21.750  24.363  1.00 94.70  ? 178  LEU B C   1 
ATOM   5108 O O   . LEU B 1 154 ? 14.010  22.327  25.291  1.00 94.70  ? 178  LEU B O   1 
ATOM   5109 C CB  . LEU B 1 154 ? 15.195  21.117  22.728  1.00 84.62  ? 178  LEU B CB  1 
ATOM   5110 C CG  . LEU B 1 154 ? 16.244  20.104  22.288  1.00 84.62  ? 178  LEU B CG  1 
ATOM   5111 C CD1 . LEU B 1 154 ? 17.112  20.708  21.207  1.00 84.62  ? 178  LEU B CD1 1 
ATOM   5112 C CD2 . LEU B 1 154 ? 17.079  19.688  23.475  1.00 84.62  ? 178  LEU B CD2 1 
ATOM   5113 N N   . SER B 1 155 ? 12.269  22.119  23.900  1.00 97.34  ? 179  SER B N   1 
ATOM   5114 C CA  . SER B 1 155 ? 11.559  23.237  24.503  1.00 97.34  ? 179  SER B CA  1 
ATOM   5115 C C   . SER B 1 155 ? 11.264  22.949  25.969  1.00 97.34  ? 179  SER B C   1 
ATOM   5116 O O   . SER B 1 155 ? 11.138  23.869  26.768  1.00 97.34  ? 179  SER B O   1 
ATOM   5117 C CB  . SER B 1 155 ? 10.253  23.523  23.752  1.00 120.24 ? 179  SER B CB  1 
ATOM   5118 O OG  . SER B 1 155 ? 10.504  24.120  22.490  1.00 120.24 ? 179  SER B OG  1 
ATOM   5119 N N   . ASP B 1 156 ? 11.166  21.670  26.316  1.00 91.31  ? 180  ASP B N   1 
ATOM   5120 C CA  . ASP B 1 156 ? 10.884  21.235  27.692  1.00 91.31  ? 180  ASP B CA  1 
ATOM   5121 C C   . ASP B 1 156 ? 11.983  21.646  28.668  1.00 91.31  ? 180  ASP B C   1 
ATOM   5122 O O   . ASP B 1 156 ? 12.925  20.896  28.925  1.00 91.31  ? 180  ASP B O   1 
ATOM   5123 C CB  . ASP B 1 156 ? 10.698  19.711  27.719  1.00 130.78 ? 180  ASP B CB  1 
ATOM   5124 C CG  . ASP B 1 156 ? 10.778  19.131  29.117  1.00 130.78 ? 180  ASP B CG  1 
ATOM   5125 O OD1 . ASP B 1 156 ? 10.390  19.835  30.073  1.00 130.78 ? 180  ASP B OD1 1 
ATOM   5126 O OD2 . ASP B 1 156 ? 11.214  17.967  29.253  1.00 130.78 ? 180  ASP B OD2 1 
ATOM   5127 N N   . LYS B 1 157 ? 11.838  22.835  29.231  1.00 121.60 ? 181  LYS B N   1 
ATOM   5128 C CA  . LYS B 1 157 ? 12.837  23.364  30.138  1.00 121.60 ? 181  LYS B CA  1 
ATOM   5129 C C   . LYS B 1 157 ? 12.962  22.668  31.493  1.00 121.60 ? 181  LYS B C   1 
ATOM   5130 O O   . LYS B 1 157 ? 13.579  23.204  32.411  1.00 121.60 ? 181  LYS B O   1 
ATOM   5131 C CB  . LYS B 1 157 ? 12.597  24.868  30.328  1.00 112.04 ? 181  LYS B CB  1 
ATOM   5132 C CG  . LYS B 1 157 ? 12.947  25.727  29.102  1.00 112.04 ? 181  LYS B CG  1 
ATOM   5133 C CD  . LYS B 1 157 ? 14.448  25.745  28.849  1.00 112.04 ? 181  LYS B CD  1 
ATOM   5134 C CE  . LYS B 1 157 ? 14.823  25.183  27.478  1.00 112.04 ? 181  LYS B CE  1 
ATOM   5135 N NZ  . LYS B 1 157 ? 14.337  23.799  27.258  1.00 112.04 ? 181  LYS B NZ  1 
ATOM   5136 N N   . SER B 1 158 ? 12.399  21.475  31.624  1.00 109.41 ? 182  SER B N   1 
ATOM   5137 C CA  . SER B 1 158 ? 12.494  20.757  32.891  1.00 109.41 ? 182  SER B CA  1 
ATOM   5138 C C   . SER B 1 158 ? 13.469  19.598  32.756  1.00 109.41 ? 182  SER B C   1 
ATOM   5139 O O   . SER B 1 158 ? 13.843  18.966  33.747  1.00 109.41 ? 182  SER B O   1 
ATOM   5140 C CB  . SER B 1 158 ? 11.120  20.229  33.314  1.00 263.26 ? 182  SER B CB  1 
ATOM   5141 O OG  . SER B 1 158 ? 10.657  19.230  32.423  1.00 263.26 ? 182  SER B OG  1 
ATOM   5142 N N   . ARG B 1 159 ? 13.874  19.326  31.518  1.00 97.18  ? 183  ARG B N   1 
ATOM   5143 C CA  . ARG B 1 159 ? 14.798  18.238  31.213  1.00 97.18  ? 183  ARG B CA  1 
ATOM   5144 C C   . ARG B 1 159 ? 16.049  18.793  30.572  1.00 97.18  ? 183  ARG B C   1 
ATOM   5145 O O   . ARG B 1 159 ? 17.109  18.178  30.637  1.00 97.18  ? 183  ARG B O   1 
ATOM   5146 C CB  . ARG B 1 159 ? 14.148  17.227  30.256  1.00 175.53 ? 183  ARG B CB  1 
ATOM   5147 C CG  . ARG B 1 159 ? 13.462  16.036  30.931  1.00 175.53 ? 183  ARG B CG  1 
ATOM   5148 C CD  . ARG B 1 159 ? 12.691  15.180  29.919  1.00 175.53 ? 183  ARG B CD  1 
ATOM   5149 N NE  . ARG B 1 159 ? 12.281  13.892  30.477  1.00 175.53 ? 183  ARG B NE  1 
ATOM   5150 C CZ  . ARG B 1 159 ? 13.116  12.886  30.729  1.00 175.53 ? 183  ARG B CZ  1 
ATOM   5151 N NH1 . ARG B 1 159 ? 14.412  13.015  30.470  1.00 175.53 ? 183  ARG B NH1 1 
ATOM   5152 N NH2 . ARG B 1 159 ? 12.661  11.749  31.241  1.00 175.53 ? 183  ARG B NH2 1 
ATOM   5153 N N   . TYR B 1 160 ? 15.918  19.959  29.951  1.00 80.96  ? 184  TYR B N   1 
ATOM   5154 C CA  . TYR B 1 160 ? 17.041  20.609  29.280  1.00 80.96  ? 184  TYR B CA  1 
ATOM   5155 C C   . TYR B 1 160 ? 17.190  21.994  29.848  1.00 80.96  ? 184  TYR B C   1 
ATOM   5156 O O   . TYR B 1 160 ? 17.218  22.965  29.106  1.00 80.96  ? 184  TYR B O   1 
ATOM   5157 C CB  . TYR B 1 160 ? 16.758  20.689  27.784  1.00 84.10  ? 184  TYR B CB  1 
ATOM   5158 C CG  . TYR B 1 160 ? 16.393  19.345  27.219  1.00 84.10  ? 184  TYR B CG  1 
ATOM   5159 C CD1 . TYR B 1 160 ? 15.217  19.156  26.500  1.00 84.10  ? 184  TYR B CD1 1 
ATOM   5160 C CD2 . TYR B 1 160 ? 17.198  18.238  27.468  1.00 84.10  ? 184  TYR B CD2 1 
ATOM   5161 C CE1 . TYR B 1 160 ? 14.848  17.886  26.048  1.00 84.10  ? 184  TYR B CE1 1 
ATOM   5162 C CE2 . TYR B 1 160 ? 16.842  16.970  27.027  1.00 84.10  ? 184  TYR B CE2 1 
ATOM   5163 C CZ  . TYR B 1 160 ? 15.667  16.793  26.321  1.00 84.10  ? 184  TYR B CZ  1 
ATOM   5164 O OH  . TYR B 1 160 ? 15.317  15.516  25.925  1.00 84.10  ? 184  TYR B OH  1 
ATOM   5165 N N   . ASP B 1 161 ? 17.292  22.070  31.170  1.00 101.30 ? 185  ASP B N   1 
ATOM   5166 C CA  . ASP B 1 161 ? 17.378  23.337  31.884  1.00 101.30 ? 185  ASP B CA  1 
ATOM   5167 C C   . ASP B 1 161 ? 18.537  24.275  31.592  1.00 101.30 ? 185  ASP B C   1 
ATOM   5168 O O   . ASP B 1 161 ? 18.537  25.409  32.081  1.00 101.30 ? 185  ASP B O   1 
ATOM   5169 C CB  . ASP B 1 161 ? 17.307  23.086  33.388  1.00 107.24 ? 185  ASP B CB  1 
ATOM   5170 C CG  . ASP B 1 161 ? 18.197  21.951  33.824  1.00 107.24 ? 185  ASP B CG  1 
ATOM   5171 O OD1 . ASP B 1 161 ? 18.420  21.828  35.048  1.00 107.24 ? 185  ASP B OD1 1 
ATOM   5172 O OD2 . ASP B 1 161 ? 18.667  21.182  32.950  1.00 107.24 ? 185  ASP B OD2 1 
ATOM   5173 N N   . TYR B 1 162 ? 19.521  23.828  30.815  1.00 92.13  ? 186  TYR B N   1 
ATOM   5174 C CA  . TYR B 1 162 ? 20.660  24.693  30.492  1.00 92.13  ? 186  TYR B CA  1 
ATOM   5175 C C   . TYR B 1 162 ? 20.811  24.903  29.007  1.00 92.13  ? 186  TYR B C   1 
ATOM   5176 O O   . TYR B 1 162 ? 21.861  25.312  28.532  1.00 92.13  ? 186  TYR B O   1 
ATOM   5177 C CB  . TYR B 1 162 ? 21.963  24.122  31.057  1.00 113.93 ? 186  TYR B CB  1 
ATOM   5178 C CG  . TYR B 1 162 ? 22.196  24.510  32.494  1.00 113.93 ? 186  TYR B CG  1 
ATOM   5179 C CD1 . TYR B 1 162 ? 21.444  23.944  33.522  1.00 113.93 ? 186  TYR B CD1 1 
ATOM   5180 C CD2 . TYR B 1 162 ? 23.116  25.495  32.822  1.00 113.93 ? 186  TYR B CD2 1 
ATOM   5181 C CE1 . TYR B 1 162 ? 21.597  24.354  34.839  1.00 113.93 ? 186  TYR B CE1 1 
ATOM   5182 C CE2 . TYR B 1 162 ? 23.279  25.912  34.134  1.00 113.93 ? 186  TYR B CE2 1 
ATOM   5183 C CZ  . TYR B 1 162 ? 22.514  25.337  35.136  1.00 113.93 ? 186  TYR B CZ  1 
ATOM   5184 O OH  . TYR B 1 162 ? 22.665  25.747  36.437  1.00 113.93 ? 186  TYR B OH  1 
ATOM   5185 N N   . PHE B 1 163 ? 19.739  24.636  28.279  1.00 80.63  ? 187  PHE B N   1 
ATOM   5186 C CA  . PHE B 1 163 ? 19.744  24.762  26.833  1.00 80.63  ? 187  PHE B CA  1 
ATOM   5187 C C   . PHE B 1 163 ? 18.895  25.905  26.369  1.00 80.63  ? 187  PHE B C   1 
ATOM   5188 O O   . PHE B 1 163 ? 17.880  26.228  26.963  1.00 80.63  ? 187  PHE B O   1 
ATOM   5189 C CB  . PHE B 1 163 ? 19.212  23.487  26.179  1.00 105.63 ? 187  PHE B CB  1 
ATOM   5190 C CG  . PHE B 1 163 ? 19.184  23.538  24.675  1.00 105.63 ? 187  PHE B CG  1 
ATOM   5191 C CD1 . PHE B 1 163 ? 20.198  22.957  23.931  1.00 105.63 ? 187  PHE B CD1 1 
ATOM   5192 C CD2 . PHE B 1 163 ? 18.149  24.178  24.009  1.00 105.63 ? 187  PHE B CD2 1 
ATOM   5193 C CE1 . PHE B 1 163 ? 20.184  23.010  22.549  1.00 105.63 ? 187  PHE B CE1 1 
ATOM   5194 C CE2 . PHE B 1 163 ? 18.132  24.237  22.626  1.00 105.63 ? 187  PHE B CE2 1 
ATOM   5195 C CZ  . PHE B 1 163 ? 19.151  23.651  21.894  1.00 105.63 ? 187  PHE B CZ  1 
ATOM   5196 N N   . ALA B 1 164 ? 19.323  26.488  25.267  1.00 75.92  ? 188  ALA B N   1 
ATOM   5197 C CA  . ALA B 1 164 ? 18.632  27.590  24.649  1.00 75.92  ? 188  ALA B CA  1 
ATOM   5198 C C   . ALA B 1 164 ? 19.052  27.467  23.199  1.00 75.92  ? 188  ALA B C   1 
ATOM   5199 O O   . ALA B 1 164 ? 20.040  26.810  22.889  1.00 75.92  ? 188  ALA B O   1 
ATOM   5200 C CB  . ALA B 1 164 ? 19.113  28.916  25.243  1.00 38.71  ? 188  ALA B CB  1 
ATOM   5201 N N   . ARG B 1 165 ? 18.296  28.066  22.298  1.00 73.65  ? 189  ARG B N   1 
ATOM   5202 C CA  . ARG B 1 165 ? 18.677  28.008  20.904  1.00 73.65  ? 189  ARG B CA  1 
ATOM   5203 C C   . ARG B 1 165 ? 18.168  29.293  20.281  1.00 73.65  ? 189  ARG B C   1 
ATOM   5204 O O   . ARG B 1 165 ? 17.411  30.033  20.902  1.00 73.65  ? 189  ARG B O   1 
ATOM   5205 C CB  . ARG B 1 165 ? 18.071  26.768  20.229  1.00 104.94 ? 189  ARG B CB  1 
ATOM   5206 C CG  . ARG B 1 165 ? 16.579  26.867  19.903  1.00 104.94 ? 189  ARG B CG  1 
ATOM   5207 C CD  . ARG B 1 165 ? 15.689  25.986  20.774  1.00 104.94 ? 189  ARG B CD  1 
ATOM   5208 N NE  . ARG B 1 165 ? 15.273  24.752  20.108  1.00 104.94 ? 189  ARG B NE  1 
ATOM   5209 C CZ  . ARG B 1 165 ? 14.208  24.041  20.467  1.00 104.94 ? 189  ARG B CZ  1 
ATOM   5210 N NH1 . ARG B 1 165 ? 13.442  24.440  21.483  1.00 104.94 ? 189  ARG B NH1 1 
ATOM   5211 N NH2 . ARG B 1 165 ? 13.910  22.928  19.817  1.00 104.94 ? 189  ARG B NH2 1 
ATOM   5212 N N   . THR B 1 166 ? 18.587  29.570  19.062  1.00 124.29 ? 190  THR B N   1 
ATOM   5213 C CA  . THR B 1 166 ? 18.152  30.781  18.395  1.00 124.29 ? 190  THR B CA  1 
ATOM   5214 C C   . THR B 1 166 ? 17.229  30.459  17.216  1.00 124.29 ? 190  THR B C   1 
ATOM   5215 O O   . THR B 1 166 ? 17.103  31.242  16.275  1.00 124.29 ? 190  THR B O   1 
ATOM   5216 C CB  . THR B 1 166 ? 19.364  31.550  17.908  1.00 95.98  ? 190  THR B CB  1 
ATOM   5217 O OG1 . THR B 1 166 ? 20.191  30.678  17.133  1.00 95.98  ? 190  THR B OG1 1 
ATOM   5218 C CG2 . THR B 1 166 ? 20.171  32.042  19.077  1.00 95.98  ? 190  THR B CG2 1 
ATOM   5219 N N   . VAL B 1 167 ? 16.587  29.297  17.284  1.00 89.44  ? 191  VAL B N   1 
ATOM   5220 C CA  . VAL B 1 167 ? 15.673  28.828  16.253  1.00 89.44  ? 191  VAL B CA  1 
ATOM   5221 C C   . VAL B 1 167 ? 14.430  28.310  16.979  1.00 89.44  ? 191  VAL B C   1 
ATOM   5222 O O   . VAL B 1 167 ? 14.513  27.898  18.138  1.00 89.44  ? 191  VAL B O   1 
ATOM   5223 C CB  . VAL B 1 167 ? 16.318  27.683  15.436  1.00 89.29  ? 191  VAL B CB  1 
ATOM   5224 C CG1 . VAL B 1 167 ? 17.578  28.178  14.744  1.00 89.29  ? 191  VAL B CG1 1 
ATOM   5225 C CG2 . VAL B 1 167 ? 16.667  26.525  16.348  1.00 89.29  ? 191  VAL B CG2 1 
ATOM   5226 N N   . PRO B 1 168 ? 13.263  28.320  16.311  1.00 90.01  ? 192  PRO B N   1 
ATOM   5227 C CA  . PRO B 1 168 ? 11.994  27.857  16.888  1.00 90.01  ? 192  PRO B CA  1 
ATOM   5228 C C   . PRO B 1 168 ? 11.771  26.366  16.708  1.00 90.01  ? 192  PRO B C   1 
ATOM   5229 O O   . PRO B 1 168 ? 12.268  25.762  15.756  1.00 90.01  ? 192  PRO B O   1 
ATOM   5230 C CB  . PRO B 1 168 ? 10.975  28.658  16.118  1.00 99.54  ? 192  PRO B CB  1 
ATOM   5231 C CG  . PRO B 1 168 ? 11.558  28.593  14.738  1.00 99.54  ? 192  PRO B CG  1 
ATOM   5232 C CD  . PRO B 1 168 ? 13.040  28.870  14.962  1.00 99.54  ? 192  PRO B CD  1 
ATOM   5233 N N   . PRO B 1 169 ? 10.986  25.759  17.606  1.00 107.18 ? 193  PRO B N   1 
ATOM   5234 C CA  . PRO B 1 169 ? 10.664  24.328  17.587  1.00 107.18 ? 193  PRO B CA  1 
ATOM   5235 C C   . PRO B 1 169 ? 9.823   23.902  16.374  1.00 107.18 ? 193  PRO B C   1 
ATOM   5236 O O   . PRO B 1 169 ? 9.155   24.723  15.743  1.00 107.18 ? 193  PRO B O   1 
ATOM   5237 C CB  . PRO B 1 169 ? 9.925   24.132  18.911  1.00 79.52  ? 193  PRO B CB  1 
ATOM   5238 C CG  . PRO B 1 169 ? 9.185   25.406  19.049  1.00 79.52  ? 193  PRO B CG  1 
ATOM   5239 C CD  . PRO B 1 169 ? 10.225  26.450  18.659  1.00 79.52  ? 193  PRO B CD  1 
ATOM   5240 N N   . ASP B 1 170 ? 9.856   22.611  16.060  1.00 180.58 ? 194  ASP B N   1 
ATOM   5241 C CA  . ASP B 1 170 ? 9.102   22.069  14.934  1.00 180.58 ? 194  ASP B CA  1 
ATOM   5242 C C   . ASP B 1 170 ? 7.585   22.178  15.109  1.00 180.58 ? 194  ASP B C   1 
ATOM   5243 O O   . ASP B 1 170 ? 6.825   21.994  14.158  1.00 180.58 ? 194  ASP B O   1 
ATOM   5244 C CB  . ASP B 1 170 ? 9.466   20.602  14.712  1.00 109.67 ? 194  ASP B CB  1 
ATOM   5245 C CG  . ASP B 1 170 ? 10.925  20.405  14.374  1.00 109.67 ? 194  ASP B CG  1 
ATOM   5246 O OD1 . ASP B 1 170 ? 11.494  21.273  13.670  1.00 109.67 ? 194  ASP B OD1 1 
ATOM   5247 O OD2 . ASP B 1 170 ? 11.491  19.371  14.799  1.00 109.67 ? 194  ASP B OD2 1 
ATOM   5248 N N   . PHE B 1 171 ? 7.147   22.459  16.330  1.00 111.45 ? 195  PHE B N   1 
ATOM   5249 C CA  . PHE B 1 171 ? 5.725   22.604  16.621  1.00 111.45 ? 195  PHE B CA  1 
ATOM   5250 C C   . PHE B 1 171 ? 5.132   23.687  15.720  1.00 111.45 ? 195  PHE B C   1 
ATOM   5251 O O   . PHE B 1 171 ? 3.954   23.658  15.388  1.00 111.45 ? 195  PHE B O   1 
ATOM   5252 C CB  . PHE B 1 171 ? 5.539   22.988  18.095  1.00 198.79 ? 195  PHE B CB  1 
ATOM   5253 C CG  . PHE B 1 171 ? 4.102   23.035  18.544  1.00 198.79 ? 195  PHE B CG  1 
ATOM   5254 C CD1 . PHE B 1 171 ? 3.332   21.878  18.592  1.00 198.79 ? 195  PHE B CD1 1 
ATOM   5255 C CD2 . PHE B 1 171 ? 3.526   24.234  18.946  1.00 198.79 ? 195  PHE B CD2 1 
ATOM   5256 C CE1 . PHE B 1 171 ? 2.008   21.917  19.038  1.00 198.79 ? 195  PHE B CE1 1 
ATOM   5257 C CE2 . PHE B 1 171 ? 2.206   24.284  19.392  1.00 198.79 ? 195  PHE B CE2 1 
ATOM   5258 C CZ  . PHE B 1 171 ? 1.446   23.123  19.439  1.00 198.79 ? 195  PHE B CZ  1 
ATOM   5259 N N   . TYR B 1 172 ? 5.968   24.639  15.323  1.00 132.63 ? 196  TYR B N   1 
ATOM   5260 C CA  . TYR B 1 172 ? 5.537   25.741  14.474  1.00 132.63 ? 196  TYR B CA  1 
ATOM   5261 C C   . TYR B 1 172 ? 5.845   25.483  13.018  1.00 132.63 ? 196  TYR B C   1 
ATOM   5262 O O   . TYR B 1 172 ? 5.371   26.201  12.151  1.00 132.63 ? 196  TYR B O   1 
ATOM   5263 C CB  . TYR B 1 172 ? 6.216   27.041  14.911  1.00 135.13 ? 196  TYR B CB  1 
ATOM   5264 C CG  . TYR B 1 172 ? 5.755   27.534  16.263  1.00 135.13 ? 196  TYR B CG  1 
ATOM   5265 C CD1 . TYR B 1 172 ? 5.427   26.631  17.277  1.00 135.13 ? 196  TYR B CD1 1 
ATOM   5266 C CD2 . TYR B 1 172 ? 5.647   28.898  16.535  1.00 135.13 ? 196  TYR B CD2 1 
ATOM   5267 C CE1 . TYR B 1 172 ? 4.999   27.065  18.524  1.00 135.13 ? 196  TYR B CE1 1 
ATOM   5268 C CE2 . TYR B 1 172 ? 5.219   29.348  17.789  1.00 135.13 ? 196  TYR B CE2 1 
ATOM   5269 C CZ  . TYR B 1 172 ? 4.894   28.418  18.780  1.00 135.13 ? 196  TYR B CZ  1 
ATOM   5270 O OH  . TYR B 1 172 ? 4.450   28.818  20.024  1.00 135.13 ? 196  TYR B OH  1 
ATOM   5271 N N   . GLN B 1 173 ? 6.652   24.469  12.743  1.00 173.33 ? 197  GLN B N   1 
ATOM   5272 C CA  . GLN B 1 173 ? 6.986   24.147  11.365  1.00 173.33 ? 197  GLN B CA  1 
ATOM   5273 C C   . GLN B 1 173 ? 5.959   23.139  10.893  1.00 173.33 ? 197  GLN B C   1 
ATOM   5274 O O   . GLN B 1 173 ? 5.479   23.208  9.761   1.00 173.33 ? 197  GLN B O   1 
ATOM   5275 C CB  . GLN B 1 173 ? 8.390   23.548  11.274  1.00 137.67 ? 197  GLN B CB  1 
ATOM   5276 C CG  . GLN B 1 173 ? 8.928   23.404  9.859   1.00 137.67 ? 197  GLN B CG  1 
ATOM   5277 C CD  . GLN B 1 173 ? 10.368  22.914  9.829   1.00 137.67 ? 197  GLN B CD  1 
ATOM   5278 O OE1 . GLN B 1 173 ? 10.969  22.785  8.766   1.00 137.67 ? 197  GLN B OE1 1 
ATOM   5279 N NE2 . GLN B 1 173 ? 10.925  22.637  11.002  1.00 137.67 ? 197  GLN B NE2 1 
ATOM   5280 N N   . ALA B 1 174 ? 5.622   22.204  11.775  1.00 145.40 ? 198  ALA B N   1 
ATOM   5281 C CA  . ALA B 1 174 ? 4.632   21.187  11.465  1.00 145.40 ? 198  ALA B CA  1 
ATOM   5282 C C   . ALA B 1 174 ? 3.367   21.914  11.028  1.00 145.40 ? 198  ALA B C   1 
ATOM   5283 O O   . ALA B 1 174 ? 2.790   21.597  9.988   1.00 145.40 ? 198  ALA B O   1 
ATOM   5284 C CB  . ALA B 1 174 ? 4.360   20.330  12.694  1.00 82.91  ? 198  ALA B CB  1 
ATOM   5285 N N   . LYS B 1 175 ? 2.947   22.897  11.824  1.00 118.12 ? 199  LYS B N   1 
ATOM   5286 C CA  . LYS B 1 175 ? 1.763   23.690  11.504  1.00 118.12 ? 199  LYS B CA  1 
ATOM   5287 C C   . LYS B 1 175 ? 1.938   24.232  10.094  1.00 118.12 ? 199  LYS B C   1 
ATOM   5288 O O   . LYS B 1 175 ? 1.118   23.979  9.214   1.00 118.12 ? 199  LYS B O   1 
ATOM   5289 C CB  . LYS B 1 175 ? 1.606   24.857  12.486  1.00 269.62 ? 199  LYS B CB  1 
ATOM   5290 C CG  . LYS B 1 175 ? 1.042   24.476  13.849  1.00 269.62 ? 199  LYS B CG  1 
ATOM   5291 C CD  . LYS B 1 175 ? 0.870   25.706  14.737  1.00 269.62 ? 199  LYS B CD  1 
ATOM   5292 C CE  . LYS B 1 175 ? 0.164   25.375  16.050  1.00 269.62 ? 199  LYS B CE  1 
ATOM   5293 N NZ  . LYS B 1 175 ? -1.262  24.977  15.855  1.00 269.62 ? 199  LYS B NZ  1 
ATOM   5294 N N   . ALA B 1 176 ? 3.021   24.969  9.885   1.00 140.04 ? 200  ALA B N   1 
ATOM   5295 C CA  . ALA B 1 176 ? 3.322   25.532  8.580   1.00 140.04 ? 200  ALA B CA  1 
ATOM   5296 C C   . ALA B 1 176 ? 3.194   24.469  7.491   1.00 140.04 ? 200  ALA B C   1 
ATOM   5297 O O   . ALA B 1 176 ? 2.706   24.751  6.400   1.00 140.04 ? 200  ALA B O   1 
ATOM   5298 C CB  . ALA B 1 176 ? 4.725   26.114  8.574   1.00 178.04 ? 200  ALA B CB  1 
ATOM   5299 N N   . MET B 1 177 ? 3.626   23.247  7.778   1.00 140.45 ? 201  MET B N   1 
ATOM   5300 C CA  . MET B 1 177 ? 3.528   22.189  6.783   1.00 140.45 ? 201  MET B CA  1 
ATOM   5301 C C   . MET B 1 177 ? 2.088   21.753  6.537   1.00 140.45 ? 201  MET B C   1 
ATOM   5302 O O   . MET B 1 177 ? 1.616   21.792  5.401   1.00 140.45 ? 201  MET B O   1 
ATOM   5303 C CB  . MET B 1 177 ? 4.364   20.983  7.191   1.00 147.59 ? 201  MET B CB  1 
ATOM   5304 C CG  . MET B 1 177 ? 5.849   21.224  7.094   1.00 147.59 ? 201  MET B CG  1 
ATOM   5305 S SD  . MET B 1 177 ? 6.793   19.707  7.315   1.00 147.59 ? 201  MET B SD  1 
ATOM   5306 C CE  . MET B 1 177 ? 7.515   19.512  5.711   1.00 147.59 ? 201  MET B CE  1 
ATOM   5307 N N   . ALA B 1 178 ? 1.385   21.338  7.587   1.00 244.28 ? 202  ALA B N   1 
ATOM   5308 C CA  . ALA B 1 178 ? 0.001   20.904  7.421   1.00 244.28 ? 202  ALA B CA  1 
ATOM   5309 C C   . ALA B 1 178 ? -0.826  21.996  6.749   1.00 244.28 ? 202  ALA B C   1 
ATOM   5310 O O   . ALA B 1 178 ? -1.633  21.710  5.865   1.00 244.28 ? 202  ALA B O   1 
ATOM   5311 C CB  . ALA B 1 178 ? -0.612  20.526  8.765   1.00 94.65  ? 202  ALA B CB  1 
ATOM   5312 N N   . GLU B 1 179 ? -0.623  23.247  7.156   1.00 111.85 ? 203  GLU B N   1 
ATOM   5313 C CA  . GLU B 1 179 ? -1.369  24.343  6.551   1.00 111.85 ? 203  GLU B CA  1 
ATOM   5314 C C   . GLU B 1 179 ? -1.063  24.478  5.067   1.00 111.85 ? 203  GLU B C   1 
ATOM   5315 O O   . GLU B 1 179 ? -1.801  25.138  4.350   1.00 111.85 ? 203  GLU B O   1 
ATOM   5316 C CB  . GLU B 1 179 ? -1.084  25.672  7.258   1.00 157.46 ? 203  GLU B CB  1 
ATOM   5317 C CG  . GLU B 1 179 ? -1.813  25.829  8.589   1.00 157.46 ? 203  GLU B CG  1 
ATOM   5318 C CD  . GLU B 1 179 ? -1.775  27.254  9.124   1.00 157.46 ? 203  GLU B CD  1 
ATOM   5319 O OE1 . GLU B 1 179 ? -2.303  27.481  10.235  1.00 157.46 ? 203  GLU B OE1 1 
ATOM   5320 O OE2 . GLU B 1 179 ? -1.225  28.145  8.438   1.00 157.46 ? 203  GLU B OE2 1 
ATOM   5321 N N   . ILE B 1 180 ? 0.023   23.861  4.603   1.00 148.30 ? 204  ILE B N   1 
ATOM   5322 C CA  . ILE B 1 180 ? 0.371   23.921  3.183   1.00 148.30 ? 204  ILE B CA  1 
ATOM   5323 C C   . ILE B 1 180 ? -0.394  22.861  2.413   1.00 148.30 ? 204  ILE B C   1 
ATOM   5324 O O   . ILE B 1 180 ? -0.717  23.042  1.240   1.00 148.30 ? 204  ILE B O   1 
ATOM   5325 C CB  . ILE B 1 180 ? 1.889   23.716  2.933   1.00 149.11 ? 204  ILE B CB  1 
ATOM   5326 C CG1 . ILE B 1 180 ? 2.601   25.070  2.966   1.00 149.11 ? 204  ILE B CG1 1 
ATOM   5327 C CG2 . ILE B 1 180 ? 2.124   23.023  1.584   1.00 149.11 ? 204  ILE B CG2 1 
ATOM   5328 C CD1 . ILE B 1 180 ? 4.056   25.017  2.543   1.00 149.11 ? 204  ILE B CD1 1 
ATOM   5329 N N   . LEU B 1 181 ? -0.677  21.747  3.072   1.00 186.48 ? 205  LEU B N   1 
ATOM   5330 C CA  . LEU B 1 181 ? -1.419  20.683  2.425   1.00 186.48 ? 205  LEU B CA  1 
ATOM   5331 C C   . LEU B 1 181 ? -2.903  21.007  2.519   1.00 186.48 ? 205  LEU B C   1 
ATOM   5332 O O   . LEU B 1 181 ? -3.651  20.819  1.560   1.00 186.48 ? 205  LEU B O   1 
ATOM   5333 C CB  . LEU B 1 181 ? -1.122  19.338  3.090   1.00 131.38 ? 205  LEU B CB  1 
ATOM   5334 C CG  . LEU B 1 181 ? 0.352   18.926  3.223   1.00 131.38 ? 205  LEU B CG  1 
ATOM   5335 C CD1 . LEU B 1 181 ? 0.400   17.410  3.328   1.00 131.38 ? 205  LEU B CD1 1 
ATOM   5336 C CD2 . LEU B 1 181 ? 1.185   19.392  2.035   1.00 131.38 ? 205  LEU B CD2 1 
ATOM   5337 N N   . ARG B 1 182 ? -3.322  21.507  3.677   1.00 173.95 ? 206  ARG B N   1 
ATOM   5338 C CA  . ARG B 1 182 ? -4.717  21.874  3.891   1.00 173.95 ? 206  ARG B CA  1 
ATOM   5339 C C   . ARG B 1 182 ? -5.149  22.952  2.891   1.00 173.95 ? 206  ARG B C   1 
ATOM   5340 O O   . ARG B 1 182 ? -6.341  23.133  2.641   1.00 173.95 ? 206  ARG B O   1 
ATOM   5341 C CB  . ARG B 1 182 ? -4.911  22.379  5.325   1.00 266.53 ? 206  ARG B CB  1 
ATOM   5342 C CG  . ARG B 1 182 ? -6.342  22.773  5.692   1.00 266.53 ? 206  ARG B CG  1 
ATOM   5343 C CD  . ARG B 1 182 ? -7.308  21.595  5.616   1.00 266.53 ? 206  ARG B CD  1 
ATOM   5344 N NE  . ARG B 1 182 ? -7.677  21.266  4.242   1.00 266.53 ? 206  ARG B NE  1 
ATOM   5345 C CZ  . ARG B 1 182 ? -8.439  20.234  3.896   1.00 266.53 ? 206  ARG B CZ  1 
ATOM   5346 N NH1 . ARG B 1 182 ? -8.918  19.418  4.824   1.00 266.53 ? 206  ARG B NH1 1 
ATOM   5347 N NH2 . ARG B 1 182 ? -8.727  20.018  2.620   1.00 266.53 ? 206  ARG B NH2 1 
ATOM   5348 N N   . PHE B 1 183 ? -4.181  23.667  2.321   1.00 173.39 ? 207  PHE B N   1 
ATOM   5349 C CA  . PHE B 1 183 ? -4.489  24.707  1.341   1.00 173.39 ? 207  PHE B CA  1 
ATOM   5350 C C   . PHE B 1 183 ? -4.636  24.090  -0.045  1.00 173.39 ? 207  PHE B C   1 
ATOM   5351 O O   . PHE B 1 183 ? -5.374  24.603  -0.880  1.00 173.39 ? 207  PHE B O   1 
ATOM   5352 C CB  . PHE B 1 183 ? -3.391  25.770  1.304   1.00 203.32 ? 207  PHE B CB  1 
ATOM   5353 C CG  . PHE B 1 183 ? -3.644  26.872  0.308   1.00 203.32 ? 207  PHE B CG  1 
ATOM   5354 C CD1 . PHE B 1 183 ? -4.618  27.839  0.547   1.00 203.32 ? 207  PHE B CD1 1 
ATOM   5355 C CD2 . PHE B 1 183 ? -2.903  26.942  -0.871  1.00 203.32 ? 207  PHE B CD2 1 
ATOM   5356 C CE1 . PHE B 1 183 ? -4.846  28.864  -0.375  1.00 203.32 ? 207  PHE B CE1 1 
ATOM   5357 C CE2 . PHE B 1 183 ? -3.121  27.961  -1.800  1.00 203.32 ? 207  PHE B CE2 1 
ATOM   5358 C CZ  . PHE B 1 183 ? -4.094  28.924  -1.552  1.00 203.32 ? 207  PHE B CZ  1 
ATOM   5359 N N   . PHE B 1 184 ? -3.923  22.995  -0.291  1.00 195.80 ? 208  PHE B N   1 
ATOM   5360 C CA  . PHE B 1 184 ? -4.008  22.313  -1.578  1.00 195.80 ? 208  PHE B CA  1 
ATOM   5361 C C   . PHE B 1 184 ? -4.821  21.026  -1.460  1.00 195.80 ? 208  PHE B C   1 
ATOM   5362 O O   . PHE B 1 184 ? -4.547  20.034  -2.139  1.00 195.80 ? 208  PHE B O   1 
ATOM   5363 C CB  . PHE B 1 184 ? -2.613  21.999  -2.127  1.00 162.47 ? 208  PHE B CB  1 
ATOM   5364 C CG  . PHE B 1 184 ? -1.878  23.203  -2.649  1.00 162.47 ? 208  PHE B CG  1 
ATOM   5365 C CD1 . PHE B 1 184 ? -1.170  24.035  -1.790  1.00 162.47 ? 208  PHE B CD1 1 
ATOM   5366 C CD2 . PHE B 1 184 ? -1.902  23.511  -4.005  1.00 162.47 ? 208  PHE B CD2 1 
ATOM   5367 C CE1 . PHE B 1 184 ? -0.494  25.157  -2.276  1.00 162.47 ? 208  PHE B CE1 1 
ATOM   5368 C CE2 . PHE B 1 184 ? -1.231  24.630  -4.497  1.00 162.47 ? 208  PHE B CE2 1 
ATOM   5369 C CZ  . PHE B 1 184 ? -0.525  25.453  -3.630  1.00 162.47 ? 208  PHE B CZ  1 
ATOM   5370 N N   . ASN B 1 185 ? -5.821  21.065  -0.584  1.00 215.89 ? 209  ASN B N   1 
ATOM   5371 C CA  . ASN B 1 185 ? -6.721  19.943  -0.342  1.00 215.89 ? 209  ASN B CA  1 
ATOM   5372 C C   . ASN B 1 185 ? -6.054  18.573  -0.423  1.00 215.89 ? 209  ASN B C   1 
ATOM   5373 O O   . ASN B 1 185 ? -6.707  17.582  -0.746  1.00 215.89 ? 209  ASN B O   1 
ATOM   5374 C CB  . ASN B 1 185 ? -7.900  20.002  -1.324  1.00 253.31 ? 209  ASN B CB  1 
ATOM   5375 C CG  . ASN B 1 185 ? -8.698  21.295  -1.214  1.00 253.31 ? 209  ASN B CG  1 
ATOM   5376 O OD1 . ASN B 1 185 ? -8.140  22.390  -1.274  1.00 253.31 ? 209  ASN B OD1 1 
ATOM   5377 N ND2 . ASN B 1 185 ? -10.013 21.171  -1.063  1.00 253.31 ? 209  ASN B ND2 1 
ATOM   5378 N N   . TRP B 1 186 ? -4.755  18.515  -0.142  1.00 162.02 ? 210  TRP B N   1 
ATOM   5379 C CA  . TRP B 1 186 ? -4.043  17.244  -0.166  1.00 162.02 ? 210  TRP B CA  1 
ATOM   5380 C C   . TRP B 1 186 ? -4.445  16.499  1.104   1.00 162.02 ? 210  TRP B C   1 
ATOM   5381 O O   . TRP B 1 186 ? -3.679  16.412  2.064   1.00 162.02 ? 210  TRP B O   1 
ATOM   5382 C CB  . TRP B 1 186 ? -2.525  17.469  -0.206  1.00 175.02 ? 210  TRP B CB  1 
ATOM   5383 C CG  . TRP B 1 186 ? -2.033  18.030  -1.512  1.00 175.02 ? 210  TRP B CG  1 
ATOM   5384 C CD1 . TRP B 1 186 ? -2.424  17.646  -2.759  1.00 175.02 ? 210  TRP B CD1 1 
ATOM   5385 C CD2 . TRP B 1 186 ? -1.028  19.040  -1.702  1.00 175.02 ? 210  TRP B CD2 1 
ATOM   5386 N NE1 . TRP B 1 186 ? -1.729  18.348  -3.713  1.00 175.02 ? 210  TRP B NE1 1 
ATOM   5387 C CE2 . TRP B 1 186 ? -0.863  19.210  -3.092  1.00 175.02 ? 210  TRP B CE2 1 
ATOM   5388 C CE3 . TRP B 1 186 ? -0.249  19.814  -0.832  1.00 175.02 ? 210  TRP B CE3 1 
ATOM   5389 C CZ2 . TRP B 1 186 ? 0.046   20.125  -3.636  1.00 175.02 ? 210  TRP B CZ2 1 
ATOM   5390 C CZ3 . TRP B 1 186 ? 0.660   20.726  -1.374  1.00 175.02 ? 210  TRP B CZ3 1 
ATOM   5391 C CH2 . TRP B 1 186 ? 0.797   20.870  -2.763  1.00 175.02 ? 210  TRP B CH2 1 
ATOM   5392 N N   . THR B 1 187 ? -5.666  15.973  1.088   1.00 159.37 ? 211  THR B N   1 
ATOM   5393 C CA  . THR B 1 187 ? -6.257  15.247  2.212   1.00 159.37 ? 211  THR B CA  1 
ATOM   5394 C C   . THR B 1 187 ? -5.648  13.868  2.494   1.00 159.37 ? 211  THR B C   1 
ATOM   5395 O O   . THR B 1 187 ? -5.729  13.362  3.612   1.00 159.37 ? 211  THR B O   1 
ATOM   5396 C CB  . THR B 1 187 ? -7.778  15.067  1.980   1.00 177.01 ? 211  THR B CB  1 
ATOM   5397 O OG1 . THR B 1 187 ? -8.372  16.340  1.696   1.00 177.01 ? 211  THR B OG1 1 
ATOM   5398 C CG2 . THR B 1 187 ? -8.445  14.460  3.205   1.00 177.01 ? 211  THR B CG2 1 
ATOM   5399 N N   . TYR B 1 188 ? -5.035  13.265  1.484   1.00 188.11 ? 212  TYR B N   1 
ATOM   5400 C CA  . TYR B 1 188 ? -4.447  11.938  1.632   1.00 188.11 ? 212  TYR B CA  1 
ATOM   5401 C C   . TYR B 1 188 ? -2.991  11.963  1.173   1.00 188.11 ? 212  TYR B C   1 
ATOM   5402 O O   . TYR B 1 188 ? -2.716  11.902  -0.024  1.00 188.11 ? 212  TYR B O   1 
ATOM   5403 C CB  . TYR B 1 188 ? -5.262  10.944  0.787   1.00 219.83 ? 212  TYR B CB  1 
ATOM   5404 C CG  . TYR B 1 188 ? -4.915  9.467   0.915   1.00 219.83 ? 212  TYR B CG  1 
ATOM   5405 C CD1 . TYR B 1 188 ? -5.036  8.797   2.134   1.00 219.83 ? 212  TYR B CD1 1 
ATOM   5406 C CD2 . TYR B 1 188 ? -4.529  8.724   -0.206  1.00 219.83 ? 212  TYR B CD2 1 
ATOM   5407 C CE1 . TYR B 1 188 ? -4.785  7.424   2.231   1.00 219.83 ? 212  TYR B CE1 1 
ATOM   5408 C CE2 . TYR B 1 188 ? -4.277  7.355   -0.118  1.00 219.83 ? 212  TYR B CE2 1 
ATOM   5409 C CZ  . TYR B 1 188 ? -4.408  6.713   1.101   1.00 219.83 ? 212  TYR B CZ  1 
ATOM   5410 O OH  . TYR B 1 188 ? -4.166  5.363   1.191   1.00 219.83 ? 212  TYR B OH  1 
ATOM   5411 N N   . VAL B 1 189 ? -2.061  12.062  2.119   1.00 136.62 ? 213  VAL B N   1 
ATOM   5412 C CA  . VAL B 1 189 ? -0.638  12.080  1.782   1.00 136.62 ? 213  VAL B CA  1 
ATOM   5413 C C   . VAL B 1 189 ? 0.149   11.095  2.650   1.00 136.62 ? 213  VAL B C   1 
ATOM   5414 O O   . VAL B 1 189 ? -0.326  10.665  3.698   1.00 136.62 ? 213  VAL B O   1 
ATOM   5415 C CB  . VAL B 1 189 ? -0.044  13.503  1.935   1.00 93.47  ? 213  VAL B CB  1 
ATOM   5416 C CG1 . VAL B 1 189 ? -0.663  14.441  0.896   1.00 93.47  ? 213  VAL B CG1 1 
ATOM   5417 C CG2 . VAL B 1 189 ? -0.300  14.023  3.341   1.00 93.47  ? 213  VAL B CG2 1 
ATOM   5418 N N   . SER B 1 190 ? 1.341   10.723  2.195   1.00 197.68 ? 214  SER B N   1 
ATOM   5419 C CA  . SER B 1 190 ? 2.183   9.791   2.935   1.00 197.68 ? 214  SER B CA  1 
ATOM   5420 C C   . SER B 1 190 ? 3.335   10.504  3.626   1.00 197.68 ? 214  SER B C   1 
ATOM   5421 O O   . SER B 1 190 ? 3.821   11.529  3.145   1.00 197.68 ? 214  SER B O   1 
ATOM   5422 C CB  . SER B 1 190 ? 2.737   8.713   2.004   1.00 140.16 ? 214  SER B CB  1 
ATOM   5423 O OG  . SER B 1 190 ? 1.802   7.665   1.838   1.00 140.16 ? 214  SER B OG  1 
ATOM   5424 N N   . THR B 1 191 ? 3.771   9.949   4.755   1.00 171.39 ? 215  THR B N   1 
ATOM   5425 C CA  . THR B 1 191 ? 4.864   10.533  5.521   1.00 171.39 ? 215  THR B CA  1 
ATOM   5426 C C   . THR B 1 191 ? 6.010   9.562   5.739   1.00 171.39 ? 215  THR B C   1 
ATOM   5427 O O   . THR B 1 191 ? 5.813   8.369   5.953   1.00 171.39 ? 215  THR B O   1 
ATOM   5428 C CB  . THR B 1 191 ? 4.402   11.003  6.917   1.00 140.55 ? 215  THR B CB  1 
ATOM   5429 O OG1 . THR B 1 191 ? 4.016   9.865   7.700   1.00 140.55 ? 215  THR B OG1 1 
ATOM   5430 C CG2 . THR B 1 191 ? 3.229   11.963  6.802   1.00 140.55 ? 215  THR B CG2 1 
ATOM   5431 N N   . VAL B 1 192 ? 7.214   10.103  5.685   1.00 159.84 ? 216  VAL B N   1 
ATOM   5432 C CA  . VAL B 1 192 ? 8.419   9.334   5.903   1.00 159.84 ? 216  VAL B CA  1 
ATOM   5433 C C   . VAL B 1 192 ? 9.348   10.272  6.678   1.00 159.84 ? 216  VAL B C   1 
ATOM   5434 O O   . VAL B 1 192 ? 9.680   11.362  6.210   1.00 159.84 ? 216  VAL B O   1 
ATOM   5435 C CB  . VAL B 1 192 ? 9.018   8.877   4.549   1.00 144.18 ? 216  VAL B CB  1 
ATOM   5436 C CG1 . VAL B 1 192 ? 8.652   9.874   3.468   1.00 144.18 ? 216  VAL B CG1 1 
ATOM   5437 C CG2 . VAL B 1 192 ? 10.528  8.713   4.657   1.00 144.18 ? 216  VAL B CG2 1 
ATOM   5438 N N   . ALA B 1 193 ? 9.739   9.854   7.879   1.00 151.95 ? 217  ALA B N   1 
ATOM   5439 C CA  . ALA B 1 193 ? 10.590  10.678  8.730   1.00 151.95 ? 217  ALA B CA  1 
ATOM   5440 C C   . ALA B 1 193 ? 11.849  9.980   9.233   1.00 151.95 ? 217  ALA B C   1 
ATOM   5441 O O   . ALA B 1 193 ? 11.819  8.797   9.590   1.00 151.95 ? 217  ALA B O   1 
ATOM   5442 C CB  . ALA B 1 193 ? 9.781   11.178  9.910   1.00 202.05 ? 217  ALA B CB  1 
ATOM   5443 N N   . SER B 1 194 ? 12.950  10.731  9.271   1.00 120.93 ? 218  SER B N   1 
ATOM   5444 C CA  . SER B 1 194 ? 14.228  10.201  9.734   1.00 120.93 ? 218  SER B CA  1 
ATOM   5445 C C   . SER B 1 194 ? 14.076  9.623   11.123  1.00 120.93 ? 218  SER B C   1 
ATOM   5446 O O   . SER B 1 194 ? 13.296  10.123  11.929  1.00 120.93 ? 218  SER B O   1 
ATOM   5447 C CB  . SER B 1 194 ? 15.295  11.298  9.776   1.00 98.69  ? 218  SER B CB  1 
ATOM   5448 O OG  . SER B 1 194 ? 15.785  11.618  8.485   1.00 98.69  ? 218  SER B OG  1 
ATOM   5449 N N   . GLU B 1 195 ? 14.810  8.555   11.400  1.00 164.59 ? 219  GLU B N   1 
ATOM   5450 C CA  . GLU B 1 195 ? 14.756  7.959   12.720  1.00 164.59 ? 219  GLU B CA  1 
ATOM   5451 C C   . GLU B 1 195 ? 15.548  8.972   13.537  1.00 164.59 ? 219  GLU B C   1 
ATOM   5452 O O   . GLU B 1 195 ? 16.381  9.686   12.981  1.00 164.59 ? 219  GLU B O   1 
ATOM   5453 C CB  . GLU B 1 195 ? 15.443  6.587   12.713  1.00 250.02 ? 219  GLU B CB  1 
ATOM   5454 C CG  . GLU B 1 195 ? 15.023  5.661   13.851  1.00 250.02 ? 219  GLU B CG  1 
ATOM   5455 C CD  . GLU B 1 195 ? 15.530  4.238   13.671  1.00 250.02 ? 219  GLU B CD  1 
ATOM   5456 O OE1 . GLU B 1 195 ? 16.763  4.035   13.680  1.00 250.02 ? 219  GLU B OE1 1 
ATOM   5457 O OE2 . GLU B 1 195 ? 14.694  3.321   13.519  1.00 250.02 ? 219  GLU B OE2 1 
ATOM   5458 N N   . GLY B 1 196 ? 15.281  9.063   14.835  1.00 142.97 ? 220  GLY B N   1 
ATOM   5459 C CA  . GLY B 1 196 ? 16.005  10.019  15.654  1.00 142.97 ? 220  GLY B CA  1 
ATOM   5460 C C   . GLY B 1 196 ? 15.145  11.182  16.103  1.00 142.97 ? 220  GLY B C   1 
ATOM   5461 O O   . GLY B 1 196 ? 14.314  11.681  15.346  1.00 142.97 ? 220  GLY B O   1 
ATOM   5462 N N   . ASP B 1 197 ? 15.365  11.620  17.338  1.00 125.27 ? 221  ASP B N   1 
ATOM   5463 C CA  . ASP B 1 197 ? 14.612  12.712  17.938  1.00 125.27 ? 221  ASP B CA  1 
ATOM   5464 C C   . ASP B 1 197 ? 14.195  13.820  16.990  1.00 125.27 ? 221  ASP B C   1 
ATOM   5465 O O   . ASP B 1 197 ? 13.191  14.482  17.234  1.00 125.27 ? 221  ASP B O   1 
ATOM   5466 C CB  . ASP B 1 197 ? 15.387  13.316  19.113  1.00 130.98 ? 221  ASP B CB  1 
ATOM   5467 C CG  . ASP B 1 197 ? 15.594  12.323  20.250  1.00 130.98 ? 221  ASP B CG  1 
ATOM   5468 O OD1 . ASP B 1 197 ? 16.613  11.607  20.243  1.00 130.98 ? 221  ASP B OD1 1 
ATOM   5469 O OD2 . ASP B 1 197 ? 14.732  12.244  21.149  1.00 130.98 ? 221  ASP B OD2 1 
ATOM   5470 N N   . TYR B 1 198 ? 14.939  14.037  15.911  1.00 114.04 ? 222  TYR B N   1 
ATOM   5471 C CA  . TYR B 1 198 ? 14.546  15.095  14.989  1.00 114.04 ? 222  TYR B CA  1 
ATOM   5472 C C   . TYR B 1 198 ? 13.326  14.747  14.161  1.00 114.04 ? 222  TYR B C   1 
ATOM   5473 O O   . TYR B 1 198 ? 12.273  15.377  14.279  1.00 114.04 ? 222  TYR B O   1 
ATOM   5474 C CB  . TYR B 1 198 ? 15.661  15.447  14.021  1.00 112.65 ? 222  TYR B CB  1 
ATOM   5475 C CG  . TYR B 1 198 ? 15.186  16.451  13.000  1.00 112.65 ? 222  TYR B CG  1 
ATOM   5476 C CD1 . TYR B 1 198 ? 14.613  17.656  13.403  1.00 112.65 ? 222  TYR B CD1 1 
ATOM   5477 C CD2 . TYR B 1 198 ? 15.304  16.201  11.642  1.00 112.65 ? 222  TYR B CD2 1 
ATOM   5478 C CE1 . TYR B 1 198 ? 14.172  18.584  12.482  1.00 112.65 ? 222  TYR B CE1 1 
ATOM   5479 C CE2 . TYR B 1 198 ? 14.868  17.126  10.709  1.00 112.65 ? 222  TYR B CE2 1 
ATOM   5480 C CZ  . TYR B 1 198 ? 14.302  18.316  11.136  1.00 112.65 ? 222  TYR B CZ  1 
ATOM   5481 O OH  . TYR B 1 198 ? 13.868  19.239  10.212  1.00 112.65 ? 222  TYR B OH  1 
ATOM   5482 N N   . GLY B 1 199 ? 13.491  13.753  13.298  1.00 124.99 ? 223  GLY B N   1 
ATOM   5483 C CA  . GLY B 1 199 ? 12.400  13.335  12.445  1.00 124.99 ? 223  GLY B CA  1 
ATOM   5484 C C   . GLY B 1 199 ? 11.200  12.854  13.229  1.00 124.99 ? 223  GLY B C   1 
ATOM   5485 O O   . GLY B 1 199 ? 10.076  13.278  12.980  1.00 124.99 ? 223  GLY B O   1 
ATOM   5486 N N   . GLU B 1 200 ? 11.437  11.967  14.185  1.00 131.15 ? 224  GLU B N   1 
ATOM   5487 C CA  . GLU B 1 200 ? 10.352  11.431  14.986  1.00 131.15 ? 224  GLU B CA  1 
ATOM   5488 C C   . GLU B 1 200 ? 9.458   12.519  15.566  1.00 131.15 ? 224  GLU B C   1 
ATOM   5489 O O   . GLU B 1 200 ? 8.318   12.682  15.133  1.00 131.15 ? 224  GLU B O   1 
ATOM   5490 C CB  . GLU B 1 200 ? 10.910  10.558  16.111  1.00 183.24 ? 224  GLU B CB  1 
ATOM   5491 C CG  . GLU B 1 200 ? 11.467  9.234   15.632  1.00 183.24 ? 224  GLU B CG  1 
ATOM   5492 C CD  . GLU B 1 200 ? 12.167  8.471   16.731  1.00 183.24 ? 224  GLU B CD  1 
ATOM   5493 O OE1 . GLU B 1 200 ? 11.537  8.232   17.782  1.00 183.24 ? 224  GLU B OE1 1 
ATOM   5494 O OE2 . GLU B 1 200 ? 13.346  8.109   16.542  1.00 183.24 ? 224  GLU B OE2 1 
ATOM   5495 N N   . THR B 1 201 ? 9.977   13.266  16.537  1.00 127.07 ? 225  THR B N   1 
ATOM   5496 C CA  . THR B 1 201 ? 9.203   14.320  17.192  1.00 127.07 ? 225  THR B CA  1 
ATOM   5497 C C   . THR B 1 201 ? 8.634   15.301  16.196  1.00 127.07 ? 225  THR B C   1 
ATOM   5498 O O   . THR B 1 201 ? 7.532   15.808  16.382  1.00 127.07 ? 225  THR B O   1 
ATOM   5499 C CB  . THR B 1 201 ? 10.051  15.121  18.187  1.00 162.04 ? 225  THR B CB  1 
ATOM   5500 O OG1 . THR B 1 201 ? 10.971  15.952  17.466  1.00 162.04 ? 225  THR B OG1 1 
ATOM   5501 C CG2 . THR B 1 201 ? 10.811  14.179  19.114  1.00 162.04 ? 225  THR B CG2 1 
ATOM   5502 N N   . GLY B 1 202 ? 9.405   15.570  15.148  1.00 105.94 ? 226  GLY B N   1 
ATOM   5503 C CA  . GLY B 1 202 ? 8.973   16.499  14.118  1.00 105.94 ? 226  GLY B CA  1 
ATOM   5504 C C   . GLY B 1 202 ? 7.779   15.998  13.319  1.00 105.94 ? 226  GLY B C   1 
ATOM   5505 O O   . GLY B 1 202 ? 6.966   16.787  12.826  1.00 105.94 ? 226  GLY B O   1 
ATOM   5506 N N   . ILE B 1 203 ? 7.666   14.683  13.177  1.00 160.84 ? 227  ILE B N   1 
ATOM   5507 C CA  . ILE B 1 203 ? 6.545   14.128  12.438  1.00 160.84 ? 227  ILE B CA  1 
ATOM   5508 C C   . ILE B 1 203 ? 5.361   13.967  13.378  1.00 160.84 ? 227  ILE B C   1 
ATOM   5509 O O   . ILE B 1 203 ? 4.224   14.218  12.989  1.00 160.84 ? 227  ILE B O   1 
ATOM   5510 C CB  . ILE B 1 203 ? 6.905   12.767  11.771  1.00 103.19 ? 227  ILE B CB  1 
ATOM   5511 C CG1 . ILE B 1 203 ? 6.707   12.880  10.257  1.00 103.19 ? 227  ILE B CG1 1 
ATOM   5512 C CG2 . ILE B 1 203 ? 6.052   11.636  12.325  1.00 103.19 ? 227  ILE B CG2 1 
ATOM   5513 C CD1 . ILE B 1 203 ? 5.362   13.445  9.858   1.00 103.19 ? 227  ILE B CD1 1 
ATOM   5514 N N   . GLU B 1 204 ? 5.630   13.556  14.616  1.00 137.66 ? 228  GLU B N   1 
ATOM   5515 C CA  . GLU B 1 204 ? 4.571   13.391  15.604  1.00 137.66 ? 228  GLU B CA  1 
ATOM   5516 C C   . GLU B 1 204 ? 3.873   14.728  15.732  1.00 137.66 ? 228  GLU B C   1 
ATOM   5517 O O   . GLU B 1 204 ? 2.707   14.803  16.117  1.00 137.66 ? 228  GLU B O   1 
ATOM   5518 C CB  . GLU B 1 204 ? 5.142   12.981  16.958  1.00 202.82 ? 228  GLU B CB  1 
ATOM   5519 C CG  . GLU B 1 204 ? 5.596   11.539  17.019  1.00 202.82 ? 228  GLU B CG  1 
ATOM   5520 C CD  . GLU B 1 204 ? 5.998   11.126  18.417  1.00 202.82 ? 228  GLU B CD  1 
ATOM   5521 O OE1 . GLU B 1 204 ? 5.185   11.320  19.348  1.00 202.82 ? 228  GLU B OE1 1 
ATOM   5522 O OE2 . GLU B 1 204 ? 7.122   10.607  18.586  1.00 202.82 ? 228  GLU B OE2 1 
ATOM   5523 N N   . ALA B 1 205 ? 4.609   15.784  15.406  1.00 171.60 ? 229  ALA B N   1 
ATOM   5524 C CA  . ALA B 1 205 ? 4.080   17.134  15.456  1.00 171.60 ? 229  ALA B CA  1 
ATOM   5525 C C   . ALA B 1 205 ? 3.168   17.289  14.255  1.00 171.60 ? 229  ALA B C   1 
ATOM   5526 O O   . ALA B 1 205 ? 2.043   17.769  14.379  1.00 171.60 ? 229  ALA B O   1 
ATOM   5527 C CB  . ALA B 1 205 ? 5.214   18.146  15.394  1.00 293.42 ? 229  ALA B CB  1 
ATOM   5528 N N   . PHE B 1 206 ? 3.656   16.869  13.091  1.00 156.92 ? 230  PHE B N   1 
ATOM   5529 C CA  . PHE B 1 206 ? 2.863   16.953  11.869  1.00 156.92 ? 230  PHE B CA  1 
ATOM   5530 C C   . PHE B 1 206 ? 1.634   16.048  11.948  1.00 156.92 ? 230  PHE B C   1 
ATOM   5531 O O   . PHE B 1 206 ? 0.534   16.448  11.561  1.00 156.92 ? 230  PHE B O   1 
ATOM   5532 C CB  . PHE B 1 206 ? 3.697   16.551  10.651  1.00 140.88 ? 230  PHE B CB  1 
ATOM   5533 C CG  . PHE B 1 206 ? 2.897   16.451  9.383   1.00 140.88 ? 230  PHE B CG  1 
ATOM   5534 C CD1 . PHE B 1 206 ? 2.278   17.580  8.846   1.00 140.88 ? 230  PHE B CD1 1 
ATOM   5535 C CD2 . PHE B 1 206 ? 2.739   15.224  8.742   1.00 140.88 ? 230  PHE B CD2 1 
ATOM   5536 C CE1 . PHE B 1 206 ? 1.513   17.491  7.693   1.00 140.88 ? 230  PHE B CE1 1 
ATOM   5537 C CE2 . PHE B 1 206 ? 1.977   15.122  7.588   1.00 140.88 ? 230  PHE B CE2 1 
ATOM   5538 C CZ  . PHE B 1 206 ? 1.361   16.258  7.061   1.00 140.88 ? 230  PHE B CZ  1 
ATOM   5539 N N   . GLU B 1 207 ? 1.833   14.828  12.444  1.00 192.14 ? 231  GLU B N   1 
ATOM   5540 C CA  . GLU B 1 207 ? 0.747   13.864  12.579  1.00 192.14 ? 231  GLU B CA  1 
ATOM   5541 C C   . GLU B 1 207 ? -0.470  14.504  13.245  1.00 192.14 ? 231  GLU B C   1 
ATOM   5542 O O   . GLU B 1 207 ? -1.581  14.416  12.723  1.00 192.14 ? 231  GLU B O   1 
ATOM   5543 C CB  . GLU B 1 207 ? 1.203   12.648  13.393  1.00 208.66 ? 231  GLU B CB  1 
ATOM   5544 C CG  . GLU B 1 207 ? 2.334   11.844  12.760  1.00 208.66 ? 231  GLU B CG  1 
ATOM   5545 C CD  . GLU B 1 207 ? 2.612   10.540  13.496  1.00 208.66 ? 231  GLU B CD  1 
ATOM   5546 O OE1 . GLU B 1 207 ? 2.858   10.583  14.720  1.00 208.66 ? 231  GLU B OE1 1 
ATOM   5547 O OE2 . GLU B 1 207 ? 2.588   9.470   12.852  1.00 208.66 ? 231  GLU B OE2 1 
ATOM   5548 N N   . GLN B 1 208 ? -0.257  15.145  14.392  1.00 152.53 ? 232  GLN B N   1 
ATOM   5549 C CA  . GLN B 1 208 ? -1.339  15.805  15.117  1.00 152.53 ? 232  GLN B CA  1 
ATOM   5550 C C   . GLN B 1 208 ? -1.977  16.903  14.275  1.00 152.53 ? 232  GLN B C   1 
ATOM   5551 O O   . GLN B 1 208 ? -3.173  16.860  13.995  1.00 152.53 ? 232  GLN B O   1 
ATOM   5552 C CB  . GLN B 1 208 ? -0.826  16.414  16.422  1.00 261.56 ? 232  GLN B CB  1 
ATOM   5553 C CG  . GLN B 1 208 ? -0.464  15.403  17.490  1.00 261.56 ? 232  GLN B CG  1 
ATOM   5554 C CD  . GLN B 1 208 ? 0.030   16.062  18.762  1.00 261.56 ? 232  GLN B CD  1 
ATOM   5555 O OE1 . GLN B 1 208 ? -0.651  16.911  19.337  1.00 261.56 ? 232  GLN B OE1 1 
ATOM   5556 N NE2 . GLN B 1 208 ? 1.218   15.672  19.211  1.00 261.56 ? 232  GLN B NE2 1 
ATOM   5557 N N   . GLU B 1 209 ? -1.177  17.888  13.875  1.00 153.96 ? 233  GLU B N   1 
ATOM   5558 C CA  . GLU B 1 209 ? -1.675  18.998  13.064  1.00 153.96 ? 233  GLU B CA  1 
ATOM   5559 C C   . GLU B 1 209 ? -2.328  18.494  11.785  1.00 153.96 ? 233  GLU B C   1 
ATOM   5560 O O   . GLU B 1 209 ? -3.129  19.194  11.170  1.00 153.96 ? 233  GLU B O   1 
ATOM   5561 C CB  . GLU B 1 209 ? -0.536  19.956  12.711  1.00 276.58 ? 233  GLU B CB  1 
ATOM   5562 C CG  . GLU B 1 209 ? 0.108   20.623  13.913  1.00 276.58 ? 233  GLU B CG  1 
ATOM   5563 C CD  . GLU B 1 209 ? -0.893  21.387  14.758  1.00 276.58 ? 233  GLU B CD  1 
ATOM   5564 O OE1 . GLU B 1 209 ? -1.596  22.258  14.204  1.00 276.58 ? 233  GLU B OE1 1 
ATOM   5565 O OE2 . GLU B 1 209 ? -0.974  21.119  15.976  1.00 276.58 ? 233  GLU B OE2 1 
ATOM   5566 N N   . ALA B 1 210 ? -1.975  17.273  11.393  1.00 189.50 ? 234  ALA B N   1 
ATOM   5567 C CA  . ALA B 1 210 ? -2.523  16.650  10.192  1.00 189.50 ? 234  ALA B CA  1 
ATOM   5568 C C   . ALA B 1 210 ? -3.979  16.236  10.409  1.00 189.50 ? 234  ALA B C   1 
ATOM   5569 O O   . ALA B 1 210 ? -4.856  16.575  9.613   1.00 189.50 ? 234  ALA B O   1 
ATOM   5570 C CB  . ALA B 1 210 ? -1.684  15.435  9.810   1.00 174.68 ? 234  ALA B CB  1 
ATOM   5571 N N   . ARG B 1 211 ? -4.230  15.496  11.486  1.00 134.33 ? 235  ARG B N   1 
ATOM   5572 C CA  . ARG B 1 211 ? -5.580  15.050  11.803  1.00 134.33 ? 235  ARG B CA  1 
ATOM   5573 C C   . ARG B 1 211 ? -6.522  16.243  11.935  1.00 134.33 ? 235  ARG B C   1 
ATOM   5574 O O   . ARG B 1 211 ? -7.580  16.276  11.312  1.00 134.33 ? 235  ARG B O   1 
ATOM   5575 C CB  . ARG B 1 211 ? -5.599  14.261  13.119  1.00 214.14 ? 235  ARG B CB  1 
ATOM   5576 C CG  . ARG B 1 211 ? -4.729  13.014  13.145  1.00 214.14 ? 235  ARG B CG  1 
ATOM   5577 C CD  . ARG B 1 211 ? -4.865  12.294  14.486  1.00 214.14 ? 235  ARG B CD  1 
ATOM   5578 N NE  . ARG B 1 211 ? -3.903  11.204  14.642  1.00 214.14 ? 235  ARG B NE  1 
ATOM   5579 C CZ  . ARG B 1 211 ? -3.783  10.459  15.739  1.00 214.14 ? 235  ARG B CZ  1 
ATOM   5580 N NH1 . ARG B 1 211 ? -4.568  10.682  16.785  1.00 214.14 ? 235  ARG B NH1 1 
ATOM   5581 N NH2 . ARG B 1 211 ? -2.870  9.495   15.794  1.00 214.14 ? 235  ARG B NH2 1 
ATOM   5582 N N   . LEU B 1 212 ? -6.119  17.220  12.744  1.00 147.32 ? 236  LEU B N   1 
ATOM   5583 C CA  . LEU B 1 212 ? -6.915  18.419  13.012  1.00 147.32 ? 236  LEU B CA  1 
ATOM   5584 C C   . LEU B 1 212 ? -7.419  19.191  11.791  1.00 147.32 ? 236  LEU B C   1 
ATOM   5585 O O   . LEU B 1 212 ? -8.401  19.933  11.884  1.00 147.32 ? 236  LEU B O   1 
ATOM   5586 C CB  . LEU B 1 212 ? -6.134  19.375  13.924  1.00 198.81 ? 236  LEU B CB  1 
ATOM   5587 C CG  . LEU B 1 212 ? -5.644  18.824  15.269  1.00 198.81 ? 236  LEU B CG  1 
ATOM   5588 C CD1 . LEU B 1 212 ? -5.145  19.972  16.123  1.00 198.81 ? 236  LEU B CD1 1 
ATOM   5589 C CD2 . LEU B 1 212 ? -6.766  18.094  15.990  1.00 198.81 ? 236  LEU B CD2 1 
ATOM   5590 N N   . ARG B 1 213 ? -6.754  19.029  10.654  1.00 326.09 ? 237  ARG B N   1 
ATOM   5591 C CA  . ARG B 1 213 ? -7.169  19.726  9.442   1.00 326.09 ? 237  ARG B CA  1 
ATOM   5592 C C   . ARG B 1 213 ? -7.746  18.722  8.450   1.00 326.09 ? 237  ARG B C   1 
ATOM   5593 O O   . ARG B 1 213 ? -7.777  18.962  7.243   1.00 326.09 ? 237  ARG B O   1 
ATOM   5594 C CB  . ARG B 1 213 ? -5.975  20.478  8.841   1.00 206.51 ? 237  ARG B CB  1 
ATOM   5595 C CG  . ARG B 1 213 ? -5.417  21.557  9.779   1.00 206.51 ? 237  ARG B CG  1 
ATOM   5596 C CD  . ARG B 1 213 ? -3.991  21.982  9.425   1.00 206.51 ? 237  ARG B CD  1 
ATOM   5597 N NE  . ARG B 1 213 ? -3.324  22.640  10.551  1.00 206.51 ? 237  ARG B NE  1 
ATOM   5598 C CZ  . ARG B 1 213 ? -3.512  23.907  10.914  1.00 206.51 ? 237  ARG B CZ  1 
ATOM   5599 N NH1 . ARG B 1 213 ? -4.348  24.680  10.238  1.00 206.51 ? 237  ARG B NH1 1 
ATOM   5600 N NH2 . ARG B 1 213 ? -2.873  24.397  11.966  1.00 206.51 ? 237  ARG B NH2 1 
ATOM   5601 N N   . ASN B 1 214 ? -8.214  17.598  8.987   1.00 193.29 ? 238  ASN B N   1 
ATOM   5602 C CA  . ASN B 1 214 ? -8.803  16.524  8.199   1.00 193.29 ? 238  ASN B CA  1 
ATOM   5603 C C   . ASN B 1 214 ? -7.880  16.030  7.093   1.00 193.29 ? 238  ASN B C   1 
ATOM   5604 O O   . ASN B 1 214 ? -8.193  16.148  5.910   1.00 193.29 ? 238  ASN B O   1 
ATOM   5605 C CB  . ASN B 1 214 ? -10.140 16.970  7.597   1.00 178.87 ? 238  ASN B CB  1 
ATOM   5606 C CG  . ASN B 1 214 ? -11.208 17.190  8.647   1.00 178.87 ? 238  ASN B CG  1 
ATOM   5607 O OD1 . ASN B 1 214 ? -11.475 16.311  9.468   1.00 178.87 ? 238  ASN B OD1 1 
ATOM   5608 N ND2 . ASN B 1 214 ? -11.833 18.364  8.622   1.00 178.87 ? 238  ASN B ND2 1 
ATOM   5609 N N   . ILE B 1 215 ? -6.736  15.485  7.489   1.00 161.52 ? 239  ILE B N   1 
ATOM   5610 C CA  . ILE B 1 215 ? -5.772  14.944  6.537   1.00 161.52 ? 239  ILE B CA  1 
ATOM   5611 C C   . ILE B 1 215 ? -5.402  13.529  6.997   1.00 161.52 ? 239  ILE B C   1 
ATOM   5612 O O   . ILE B 1 215 ? -4.828  13.343  8.073   1.00 161.52 ? 239  ILE B O   1 
ATOM   5613 C CB  . ILE B 1 215 ? -4.497  15.844  6.438   1.00 106.82 ? 239  ILE B CB  1 
ATOM   5614 C CG1 . ILE B 1 215 ? -4.873  17.222  5.877   1.00 106.82 ? 239  ILE B CG1 1 
ATOM   5615 C CG2 . ILE B 1 215 ? -3.460  15.204  5.519   1.00 106.82 ? 239  ILE B CG2 1 
ATOM   5616 C CD1 . ILE B 1 215 ? -3.687  18.150  5.609   1.00 106.82 ? 239  ILE B CD1 1 
ATOM   5617 N N   . CYS B 1 216 ? -5.768  12.533  6.190   1.00 162.94 ? 240  CYS B N   1 
ATOM   5618 C CA  . CYS B 1 216 ? -5.489  11.128  6.496   1.00 162.94 ? 240  CYS B CA  1 
ATOM   5619 C C   . CYS B 1 216 ? -4.110  10.751  5.987   1.00 162.94 ? 240  CYS B C   1 
ATOM   5620 O O   . CYS B 1 216 ? -3.762  11.040  4.843   1.00 162.94 ? 240  CYS B O   1 
ATOM   5621 C CB  . CYS B 1 216 ? -6.529  10.214  5.836   1.00 291.50 ? 240  CYS B CB  1 
ATOM   5622 S SG  . CYS B 1 216 ? -8.242  10.467  6.362   1.00 291.50 ? 240  CYS B SG  1 
ATOM   5623 N N   . ILE B 1 217 ? -3.326  10.102  6.838   1.00 180.06 ? 241  ILE B N   1 
ATOM   5624 C CA  . ILE B 1 217 ? -1.983  9.691   6.455   1.00 180.06 ? 241  ILE B CA  1 
ATOM   5625 C C   . ILE B 1 217 ? -1.968  8.289   5.853   1.00 180.06 ? 241  ILE B C   1 
ATOM   5626 O O   . ILE B 1 217 ? -2.215  7.293   6.541   1.00 180.06 ? 241  ILE B O   1 
ATOM   5627 C CB  . ILE B 1 217 ? -1.009  9.766   7.663   1.00 279.51 ? 241  ILE B CB  1 
ATOM   5628 C CG1 . ILE B 1 217 ? -0.641  11.232  7.925   1.00 279.51 ? 241  ILE B CG1 1 
ATOM   5629 C CG2 . ILE B 1 217 ? 0.236   8.919   7.402   1.00 279.51 ? 241  ILE B CG2 1 
ATOM   5630 C CD1 . ILE B 1 217 ? 0.384   11.442  9.023   1.00 279.51 ? 241  ILE B CD1 1 
ATOM   5631 N N   . ALA B 1 218 ? -1.677  8.238   4.556   1.00 131.65 ? 242  ALA B N   1 
ATOM   5632 C CA  . ALA B 1 218 ? -1.619  6.996   3.798   1.00 131.65 ? 242  ALA B CA  1 
ATOM   5633 C C   . ALA B 1 218 ? -0.746  5.963   4.491   1.00 131.65 ? 242  ALA B C   1 
ATOM   5634 O O   . ALA B 1 218 ? -1.222  5.169   5.305   1.00 131.65 ? 242  ALA B O   1 
ATOM   5635 C CB  . ALA B 1 218 ? -1.083  7.280   2.413   1.00 78.98  ? 242  ALA B CB  1 
ATOM   5636 N N   . THR B 1 219 ? 0.537   5.972   4.152   1.00 185.82 ? 243  THR B N   1 
ATOM   5637 C CA  . THR B 1 219 ? 1.480   5.049   4.752   1.00 185.82 ? 243  THR B CA  1 
ATOM   5638 C C   . THR B 1 219 ? 2.484   5.863   5.554   1.00 185.82 ? 243  THR B C   1 
ATOM   5639 O O   . THR B 1 219 ? 3.021   6.857   5.066   1.00 185.82 ? 243  THR B O   1 
ATOM   5640 C CB  . THR B 1 219 ? 2.214   4.224   3.676   1.00 173.27 ? 243  THR B CB  1 
ATOM   5641 O OG1 . THR B 1 219 ? 3.066   3.263   4.311   1.00 173.27 ? 243  THR B OG1 1 
ATOM   5642 C CG2 . THR B 1 219 ? 3.041   5.129   2.773   1.00 173.27 ? 243  THR B CG2 1 
ATOM   5643 N N   . ALA B 1 220 ? 2.719   5.450   6.793   1.00 173.92 ? 244  ALA B N   1 
ATOM   5644 C CA  . ALA B 1 220 ? 3.655   6.150   7.662   1.00 173.92 ? 244  ALA B CA  1 
ATOM   5645 C C   . ALA B 1 220 ? 5.040   5.517   7.582   1.00 173.92 ? 244  ALA B C   1 
ATOM   5646 O O   . ALA B 1 220 ? 5.323   4.534   8.269   1.00 173.92 ? 244  ALA B O   1 
ATOM   5647 C CB  . ALA B 1 220 ? 3.148   6.124   9.096   1.00 264.41 ? 244  ALA B CB  1 
ATOM   5648 N N   . GLU B 1 221 ? 5.899   6.091   6.744   1.00 172.86 ? 245  GLU B N   1 
ATOM   5649 C CA  . GLU B 1 221 ? 7.255   5.590   6.557   1.00 172.86 ? 245  GLU B CA  1 
ATOM   5650 C C   . GLU B 1 221 ? 8.288   6.250   7.456   1.00 172.86 ? 245  GLU B C   1 
ATOM   5651 O O   . GLU B 1 221 ? 8.114   7.392   7.876   1.00 172.86 ? 245  GLU B O   1 
ATOM   5652 C CB  . GLU B 1 221 ? 7.683   5.772   5.100   1.00 166.54 ? 245  GLU B CB  1 
ATOM   5653 C CG  . GLU B 1 221 ? 6.992   4.828   4.162   1.00 166.54 ? 245  GLU B CG  1 
ATOM   5654 C CD  . GLU B 1 221 ? 6.890   3.439   4.756   1.00 166.54 ? 245  GLU B CD  1 
ATOM   5655 O OE1 . GLU B 1 221 ? 7.932   2.895   5.188   1.00 166.54 ? 245  GLU B OE1 1 
ATOM   5656 O OE2 . GLU B 1 221 ? 5.764   2.894   4.797   1.00 166.54 ? 245  GLU B OE2 1 
ATOM   5657 N N   . LYS B 1 222 ? 9.361   5.518   7.755   1.00 165.70 ? 246  LYS B N   1 
ATOM   5658 C CA  . LYS B 1 222 ? 10.453  6.037   8.579   1.00 165.70 ? 246  LYS B CA  1 
ATOM   5659 C C   . LYS B 1 222 ? 11.745  5.243   8.347   1.00 165.70 ? 246  LYS B C   1 
ATOM   5660 O O   . LYS B 1 222 ? 11.785  4.021   8.524   1.00 165.70 ? 246  LYS B O   1 
ATOM   5661 C CB  . LYS B 1 222 ? 10.075  6.021   10.068  1.00 171.78 ? 246  LYS B CB  1 
ATOM   5662 C CG  . LYS B 1 222 ? 10.245  4.685   10.772  1.00 171.78 ? 246  LYS B CG  1 
ATOM   5663 C CD  . LYS B 1 222 ? 10.216  4.863   12.291  1.00 171.78 ? 246  LYS B CD  1 
ATOM   5664 C CE  . LYS B 1 222 ? 10.831  3.660   13.008  1.00 171.78 ? 246  LYS B CE  1 
ATOM   5665 N NZ  . LYS B 1 222 ? 10.948  3.846   14.484  1.00 171.78 ? 246  LYS B NZ  1 
ATOM   5666 N N   . VAL B 1 223 ? 12.792  5.951   7.929   1.00 201.67 ? 247  VAL B N   1 
ATOM   5667 C CA  . VAL B 1 223 ? 14.096  5.349   7.656   1.00 201.67 ? 247  VAL B CA  1 
ATOM   5668 C C   . VAL B 1 223 ? 14.878  5.224   8.961   1.00 201.67 ? 247  VAL B C   1 
ATOM   5669 O O   . VAL B 1 223 ? 14.308  5.403   10.035  1.00 201.67 ? 247  VAL B O   1 
ATOM   5670 C CB  . VAL B 1 223 ? 14.903  6.213   6.664   1.00 182.72 ? 247  VAL B CB  1 
ATOM   5671 C CG1 . VAL B 1 223 ? 14.069  6.501   5.427   1.00 182.72 ? 247  VAL B CG1 1 
ATOM   5672 C CG2 . VAL B 1 223 ? 15.321  7.515   7.325   1.00 182.72 ? 247  VAL B CG2 1 
ATOM   5673 N N   . GLY B 1 224 ? 16.176  4.928   8.882   1.00 214.96 ? 248  GLY B N   1 
ATOM   5674 C CA  . GLY B 1 224 ? 16.947  4.795   10.110  1.00 214.96 ? 248  GLY B CA  1 
ATOM   5675 C C   . GLY B 1 224 ? 18.470  4.819   10.075  1.00 214.96 ? 248  GLY B C   1 
ATOM   5676 O O   . GLY B 1 224 ? 19.093  5.462   9.225   1.00 214.96 ? 248  GLY B O   1 
ATOM   5677 N N   . ARG B 1 225 ? 19.060  4.100   11.031  1.00 271.36 ? 249  ARG B N   1 
ATOM   5678 C CA  . ARG B 1 225 ? 20.510  3.998   11.193  1.00 271.36 ? 249  ARG B CA  1 
ATOM   5679 C C   . ARG B 1 225 ? 21.129  2.893   10.341  1.00 271.36 ? 249  ARG B C   1 
ATOM   5680 O O   . ARG B 1 225 ? 20.473  1.901   10.023  1.00 271.36 ? 249  ARG B O   1 
ATOM   5681 C CB  . ARG B 1 225 ? 20.856  3.708   12.656  1.00 239.46 ? 249  ARG B CB  1 
ATOM   5682 C CG  . ARG B 1 225 ? 20.298  4.685   13.672  1.00 239.46 ? 249  ARG B CG  1 
ATOM   5683 C CD  . ARG B 1 225 ? 20.676  4.240   15.081  1.00 239.46 ? 249  ARG B CD  1 
ATOM   5684 N NE  . ARG B 1 225 ? 20.246  5.187   16.107  1.00 239.46 ? 249  ARG B NE  1 
ATOM   5685 C CZ  . ARG B 1 225 ? 20.500  5.046   17.405  1.00 239.46 ? 249  ARG B CZ  1 
ATOM   5686 N NH1 . ARG B 1 225 ? 21.182  3.995   17.837  1.00 239.46 ? 249  ARG B NH1 1 
ATOM   5687 N NH2 . ARG B 1 225 ? 20.076  5.957   18.271  1.00 239.46 ? 249  ARG B NH2 1 
ATOM   5688 N N   . SER B 1 226 ? 22.404  3.067   10.000  1.00 374.89 ? 250  SER B N   1 
ATOM   5689 C CA  . SER B 1 226 ? 23.148  2.095   9.199   1.00 374.89 ? 250  SER B CA  1 
ATOM   5690 C C   . SER B 1 226 ? 22.339  1.595   8.007   1.00 374.89 ? 250  SER B C   1 
ATOM   5691 O O   . SER B 1 226 ? 22.600  0.515   7.474   1.00 374.89 ? 250  SER B O   1 
ATOM   5692 C CB  . SER B 1 226 ? 23.568  0.907   10.074  1.00 301.06 ? 250  SER B CB  1 
ATOM   5693 O OG  . SER B 1 226 ? 24.320  -0.043  9.337   1.00 301.06 ? 250  SER B OG  1 
ATOM   5694 N N   . ASN B 1 227 ? 21.358  2.387   7.590   1.00 287.40 ? 251  ASN B N   1 
ATOM   5695 C CA  . ASN B 1 227 ? 20.513  2.020   6.464   1.00 287.40 ? 251  ASN B CA  1 
ATOM   5696 C C   . ASN B 1 227 ? 21.252  2.136   5.139   1.00 287.40 ? 251  ASN B C   1 
ATOM   5697 O O   . ASN B 1 227 ? 22.015  3.079   4.915   1.00 287.40 ? 251  ASN B O   1 
ATOM   5698 C CB  . ASN B 1 227 ? 19.254  2.893   6.435   1.00 389.59 ? 251  ASN B CB  1 
ATOM   5699 C CG  . ASN B 1 227 ? 18.222  2.463   7.463   1.00 389.59 ? 251  ASN B CG  1 
ATOM   5700 O OD1 . ASN B 1 227 ? 18.492  2.443   8.662   1.00 389.59 ? 251  ASN B OD1 1 
ATOM   5701 N ND2 . ASN B 1 227 ? 17.031  2.113   6.992   1.00 389.59 ? 251  ASN B ND2 1 
ATOM   5702 N N   . ILE B 1 228 ? 21.021  1.159   4.269   1.00 226.66 ? 252  ILE B N   1 
ATOM   5703 C CA  . ILE B 1 228 ? 21.646  1.129   2.956   1.00 226.66 ? 252  ILE B CA  1 
ATOM   5704 C C   . ILE B 1 228 ? 20.562  1.382   1.912   1.00 226.66 ? 252  ILE B C   1 
ATOM   5705 O O   . ILE B 1 228 ? 19.455  1.805   2.246   1.00 226.66 ? 252  ILE B O   1 
ATOM   5706 C CB  . ILE B 1 228 ? 22.305  -0.244  2.669   1.00 210.19 ? 252  ILE B CB  1 
ATOM   5707 C CG1 . ILE B 1 228 ? 22.999  -0.775  3.926   1.00 210.19 ? 252  ILE B CG1 1 
ATOM   5708 C CG2 . ILE B 1 228 ? 23.331  -0.106  1.551   1.00 210.19 ? 252  ILE B CG2 1 
ATOM   5709 C CD1 . ILE B 1 228 ? 22.052  -1.361  4.954   1.00 210.19 ? 252  ILE B CD1 1 
ATOM   5710 N N   . ARG B 1 229 ? 20.882  1.115   0.652   1.00 202.56 ? 253  ARG B N   1 
ATOM   5711 C CA  . ARG B 1 229 ? 19.939  1.317   -0.439  1.00 202.56 ? 253  ARG B CA  1 
ATOM   5712 C C   . ARG B 1 229 ? 18.626  0.555   -0.247  1.00 202.56 ? 253  ARG B C   1 
ATOM   5713 O O   . ARG B 1 229 ? 17.545  1.138   -0.334  1.00 202.56 ? 253  ARG B O   1 
ATOM   5714 C CB  . ARG B 1 229 ? 20.577  0.891   -1.764  1.00 351.98 ? 253  ARG B CB  1 
ATOM   5715 C CG  . ARG B 1 229 ? 21.884  1.596   -2.095  1.00 351.98 ? 253  ARG B CG  1 
ATOM   5716 C CD  . ARG B 1 229 ? 22.403  1.162   -3.460  1.00 351.98 ? 253  ARG B CD  1 
ATOM   5717 N NE  . ARG B 1 229 ? 23.632  1.857   -3.836  1.00 351.98 ? 253  ARG B NE  1 
ATOM   5718 C CZ  . ARG B 1 229 ? 24.241  1.716   -5.011  1.00 351.98 ? 253  ARG B CZ  1 
ATOM   5719 N NH1 . ARG B 1 229 ? 23.736  0.904   -5.929  1.00 351.98 ? 253  ARG B NH1 1 
ATOM   5720 N NH2 . ARG B 1 229 ? 25.357  2.387   -5.268  1.00 351.98 ? 253  ARG B NH2 1 
ATOM   5721 N N   . LYS B 1 230 ? 18.732  -0.747  0.014   1.00 396.36 ? 254  LYS B N   1 
ATOM   5722 C CA  . LYS B 1 230 ? 17.569  -1.619  0.195   1.00 396.36 ? 254  LYS B CA  1 
ATOM   5723 C C   . LYS B 1 230 ? 16.481  -1.125  1.148   1.00 396.36 ? 254  LYS B C   1 
ATOM   5724 O O   . LYS B 1 230 ? 15.296  -1.374  0.918   1.00 396.36 ? 254  LYS B O   1 
ATOM   5725 C CB  . LYS B 1 230 ? 18.020  -3.017  0.642   1.00 316.58 ? 254  LYS B CB  1 
ATOM   5726 C CG  . LYS B 1 230 ? 18.762  -3.813  -0.425  1.00 316.58 ? 254  LYS B CG  1 
ATOM   5727 C CD  . LYS B 1 230 ? 19.104  -5.213  0.067   1.00 316.58 ? 254  LYS B CD  1 
ATOM   5728 C CE  . LYS B 1 230 ? 19.840  -6.008  -0.998  1.00 316.58 ? 254  LYS B CE  1 
ATOM   5729 N NZ  . LYS B 1 230 ? 20.198  -7.372  -0.521  1.00 316.58 ? 254  LYS B NZ  1 
ATOM   5730 N N   . SER B 1 231 ? 16.870  -0.434  2.214   1.00 180.69 ? 255  SER B N   1 
ATOM   5731 C CA  . SER B 1 231 ? 15.893  0.059   3.176   1.00 180.69 ? 255  SER B CA  1 
ATOM   5732 C C   . SER B 1 231 ? 15.229  1.339   2.668   1.00 180.69 ? 255  SER B C   1 
ATOM   5733 O O   . SER B 1 231 ? 14.105  1.661   3.056   1.00 180.69 ? 255  SER B O   1 
ATOM   5734 C CB  . SER B 1 231 ? 16.567  0.296   4.530   1.00 168.90 ? 255  SER B CB  1 
ATOM   5735 O OG  . SER B 1 231 ? 15.650  0.115   5.594   1.00 168.90 ? 255  SER B OG  1 
ATOM   5736 N N   . TYR B 1 232 ? 15.925  2.066   1.800   1.00 166.52 ? 256  TYR B N   1 
ATOM   5737 C CA  . TYR B 1 232 ? 15.372  3.288   1.231   1.00 166.52 ? 256  TYR B CA  1 
ATOM   5738 C C   . TYR B 1 232 ? 14.453  2.944   0.072   1.00 166.52 ? 256  TYR B C   1 
ATOM   5739 O O   . TYR B 1 232 ? 13.381  3.531   -0.068  1.00 166.52 ? 256  TYR B O   1 
ATOM   5740 C CB  . TYR B 1 232 ? 16.482  4.226   0.763   1.00 182.49 ? 256  TYR B CB  1 
ATOM   5741 C CG  . TYR B 1 232 ? 17.081  5.008   1.898   1.00 182.49 ? 256  TYR B CG  1 
ATOM   5742 C CD1 . TYR B 1 232 ? 18.097  4.469   2.679   1.00 182.49 ? 256  TYR B CD1 1 
ATOM   5743 C CD2 . TYR B 1 232 ? 16.597  6.273   2.224   1.00 182.49 ? 256  TYR B CD2 1 
ATOM   5744 C CE1 . TYR B 1 232 ? 18.619  5.169   3.761   1.00 182.49 ? 256  TYR B CE1 1 
ATOM   5745 C CE2 . TYR B 1 232 ? 17.108  6.981   3.304   1.00 182.49 ? 256  TYR B CE2 1 
ATOM   5746 C CZ  . TYR B 1 232 ? 18.120  6.424   4.068   1.00 182.49 ? 256  TYR B CZ  1 
ATOM   5747 O OH  . TYR B 1 232 ? 18.642  7.123   5.132   1.00 182.49 ? 256  TYR B OH  1 
ATOM   5748 N N   . ASP B 1 233 ? 14.878  1.999   -0.764  1.00 164.70 ? 257  ASP B N   1 
ATOM   5749 C CA  . ASP B 1 233 ? 14.053  1.557   -1.885  1.00 164.70 ? 257  ASP B CA  1 
ATOM   5750 C C   . ASP B 1 233 ? 12.789  0.980   -1.254  1.00 164.70 ? 257  ASP B C   1 
ATOM   5751 O O   . ASP B 1 233 ? 11.674  1.255   -1.698  1.00 164.70 ? 257  ASP B O   1 
ATOM   5752 C CB  . ASP B 1 233 ? 14.762  0.461   -2.695  1.00 215.00 ? 257  ASP B CB  1 
ATOM   5753 C CG  . ASP B 1 233 ? 15.857  1.005   -3.594  1.00 215.00 ? 257  ASP B CG  1 
ATOM   5754 O OD1 . ASP B 1 233 ? 15.556  1.873   -4.437  1.00 215.00 ? 257  ASP B OD1 1 
ATOM   5755 O OD2 . ASP B 1 233 ? 17.016  0.558   -3.465  1.00 215.00 ? 257  ASP B OD2 1 
ATOM   5756 N N   . SER B 1 234 ? 12.990  0.178   -0.211  1.00 150.35 ? 258  SER B N   1 
ATOM   5757 C CA  . SER B 1 234 ? 11.904  -0.449  0.531   1.00 150.35 ? 258  SER B CA  1 
ATOM   5758 C C   . SER B 1 234 ? 10.863  0.612   0.899   1.00 150.35 ? 258  SER B C   1 
ATOM   5759 O O   . SER B 1 234 ? 9.653   0.386   0.788   1.00 150.35 ? 258  SER B O   1 
ATOM   5760 C CB  . SER B 1 234 ? 12.471  -1.101  1.797   1.00 163.40 ? 258  SER B CB  1 
ATOM   5761 O OG  . SER B 1 234 ? 11.453  -1.660  2.605   1.00 163.40 ? 258  SER B OG  1 
ATOM   5762 N N   . VAL B 1 235 ? 11.351  1.773   1.331   1.00 141.94 ? 259  VAL B N   1 
ATOM   5763 C CA  . VAL B 1 235 ? 10.490  2.889   1.710   1.00 141.94 ? 259  VAL B CA  1 
ATOM   5764 C C   . VAL B 1 235 ? 9.811   3.462   0.472   1.00 141.94 ? 259  VAL B C   1 
ATOM   5765 O O   . VAL B 1 235 ? 8.653   3.881   0.525   1.00 141.94 ? 259  VAL B O   1 
ATOM   5766 C CB  . VAL B 1 235 ? 11.300  4.007   2.402   1.00 143.99 ? 259  VAL B CB  1 
ATOM   5767 C CG1 . VAL B 1 235 ? 10.390  5.184   2.731   1.00 143.99 ? 259  VAL B CG1 1 
ATOM   5768 C CG2 . VAL B 1 235 ? 11.949  3.466   3.670   1.00 143.99 ? 259  VAL B CG2 1 
ATOM   5769 N N   . ILE B 1 236 ? 10.544  3.489   -0.638  1.00 176.98 ? 260  ILE B N   1 
ATOM   5770 C CA  . ILE B 1 236 ? 10.006  3.990   -1.897  1.00 176.98 ? 260  ILE B CA  1 
ATOM   5771 C C   . ILE B 1 236 ? 8.889   3.037   -2.314  1.00 176.98 ? 260  ILE B C   1 
ATOM   5772 O O   . ILE B 1 236 ? 7.791   3.472   -2.663  1.00 176.98 ? 260  ILE B O   1 
ATOM   5773 C CB  . ILE B 1 236 ? 11.099  4.037   -3.008  1.00 123.99 ? 260  ILE B CB  1 
ATOM   5774 C CG1 . ILE B 1 236 ? 12.183  5.043   -2.629  1.00 123.99 ? 260  ILE B CG1 1 
ATOM   5775 C CG2 . ILE B 1 236 ? 10.492  4.457   -4.340  1.00 123.99 ? 260  ILE B CG2 1 
ATOM   5776 C CD1 . ILE B 1 236 ? 11.661  6.449   -2.483  1.00 123.99 ? 260  ILE B CD1 1 
ATOM   5777 N N   . ARG B 1 237 ? 9.176   1.737   -2.258  1.00 172.34 ? 261  ARG B N   1 
ATOM   5778 C CA  . ARG B 1 237 ? 8.195   0.721   -2.617  1.00 172.34 ? 261  ARG B CA  1 
ATOM   5779 C C   . ARG B 1 237 ? 6.890   1.035   -1.910  1.00 172.34 ? 261  ARG B C   1 
ATOM   5780 O O   . ARG B 1 237 ? 5.865   1.276   -2.548  1.00 172.34 ? 261  ARG B O   1 
ATOM   5781 C CB  . ARG B 1 237 ? 8.648   -0.678  -2.180  1.00 231.40 ? 261  ARG B CB  1 
ATOM   5782 C CG  . ARG B 1 237 ? 9.981   -1.147  -2.732  1.00 231.40 ? 261  ARG B CG  1 
ATOM   5783 C CD  . ARG B 1 237 ? 10.177  -2.659  -2.546  1.00 231.40 ? 261  ARG B CD  1 
ATOM   5784 N NE  . ARG B 1 237 ? 9.979   -3.122  -1.169  1.00 231.40 ? 261  ARG B NE  1 
ATOM   5785 C CZ  . ARG B 1 237 ? 8.810   -3.503  -0.655  1.00 231.40 ? 261  ARG B CZ  1 
ATOM   5786 N NH1 . ARG B 1 237 ? 7.712   -3.481  -1.399  1.00 231.40 ? 261  ARG B NH1 1 
ATOM   5787 N NH2 . ARG B 1 237 ? 8.738   -3.917  0.604   1.00 231.40 ? 261  ARG B NH2 1 
ATOM   5788 N N   . GLU B 1 238 ? 6.947   1.035   -0.581  1.00 108.78 ? 262  GLU B N   1 
ATOM   5789 C CA  . GLU B 1 238 ? 5.772   1.298   0.239   1.00 108.78 ? 262  GLU B CA  1 
ATOM   5790 C C   . GLU B 1 238 ? 5.105   2.655   -0.001  1.00 108.78 ? 262  GLU B C   1 
ATOM   5791 O O   . GLU B 1 238 ? 3.931   2.843   0.341   1.00 108.78 ? 262  GLU B O   1 
ATOM   5792 C CB  . GLU B 1 238 ? 6.125   1.121   1.714   1.00 239.14 ? 262  GLU B CB  1 
ATOM   5793 C CG  . GLU B 1 238 ? 6.574   -0.295  2.033   1.00 239.14 ? 262  GLU B CG  1 
ATOM   5794 C CD  . GLU B 1 238 ? 6.460   -0.632  3.502   1.00 239.14 ? 262  GLU B CD  1 
ATOM   5795 O OE1 . GLU B 1 238 ? 5.341   -0.525  4.049   1.00 239.14 ? 262  GLU B OE1 1 
ATOM   5796 O OE2 . GLU B 1 238 ? 7.485   -1.009  4.110   1.00 239.14 ? 262  GLU B OE2 1 
ATOM   5797 N N   . LEU B 1 239 ? 5.845   3.598   -0.582  1.00 195.32 ? 263  LEU B N   1 
ATOM   5798 C CA  . LEU B 1 239 ? 5.286   4.914   -0.896  1.00 195.32 ? 263  LEU B CA  1 
ATOM   5799 C C   . LEU B 1 239 ? 4.500   4.755   -2.189  1.00 195.32 ? 263  LEU B C   1 
ATOM   5800 O O   . LEU B 1 239 ? 3.646   5.578   -2.530  1.00 195.32 ? 263  LEU B O   1 
ATOM   5801 C CB  . LEU B 1 239 ? 6.394   5.948   -1.111  1.00 208.36 ? 263  LEU B CB  1 
ATOM   5802 C CG  . LEU B 1 239 ? 7.022   6.604   0.117   1.00 208.36 ? 263  LEU B CG  1 
ATOM   5803 C CD1 . LEU B 1 239 ? 8.134   7.535   -0.332  1.00 208.36 ? 263  LEU B CD1 1 
ATOM   5804 C CD2 . LEU B 1 239 ? 5.962   7.375   0.890   1.00 208.36 ? 263  LEU B CD2 1 
ATOM   5805 N N   . LEU B 1 240 ? 4.811   3.673   -2.896  1.00 220.00 ? 264  LEU B N   1 
ATOM   5806 C CA  . LEU B 1 240 ? 4.180   3.342   -4.164  1.00 220.00 ? 264  LEU B CA  1 
ATOM   5807 C C   . LEU B 1 240 ? 2.971   2.432   -3.973  1.00 220.00 ? 264  LEU B C   1 
ATOM   5808 O O   . LEU B 1 240 ? 2.088   2.385   -4.825  1.00 220.00 ? 264  LEU B O   1 
ATOM   5809 C CB  . LEU B 1 240 ? 5.203   2.669   -5.081  1.00 246.72 ? 264  LEU B CB  1 
ATOM   5810 C CG  . LEU B 1 240 ? 6.371   3.552   -5.532  1.00 246.72 ? 264  LEU B CG  1 
ATOM   5811 C CD1 . LEU B 1 240 ? 7.492   2.691   -6.096  1.00 246.72 ? 264  LEU B CD1 1 
ATOM   5812 C CD2 . LEU B 1 240 ? 5.878   4.558   -6.566  1.00 246.72 ? 264  LEU B CD2 1 
ATOM   5813 N N   . GLN B 1 241 ? 2.932   1.711   -2.856  1.00 163.30 ? 265  GLN B N   1 
ATOM   5814 C CA  . GLN B 1 241 ? 1.818   0.811   -2.563  1.00 163.30 ? 265  GLN B CA  1 
ATOM   5815 C C   . GLN B 1 241 ? 0.542   1.578   -2.233  1.00 163.30 ? 265  GLN B C   1 
ATOM   5816 O O   . GLN B 1 241 ? -0.500  0.983   -1.959  1.00 163.30 ? 265  GLN B O   1 
ATOM   5817 C CB  . GLN B 1 241 ? 2.165   -0.108  -1.393  1.00 245.82 ? 265  GLN B CB  1 
ATOM   5818 C CG  . GLN B 1 241 ? 3.377   -0.987  -1.627  1.00 245.82 ? 265  GLN B CG  1 
ATOM   5819 C CD  . GLN B 1 241 ? 3.594   -1.968  -0.496  1.00 245.82 ? 265  GLN B CD  1 
ATOM   5820 O OE1 . GLN B 1 241 ? 3.639   -1.585  0.674   1.00 245.82 ? 265  GLN B OE1 1 
ATOM   5821 N NE2 . GLN B 1 241 ? 3.731   -3.243  -0.838  1.00 245.82 ? 265  GLN B NE2 1 
ATOM   5822 N N   . LYS B 1 242 ? 0.642   2.902   -2.245  1.00 264.32 ? 266  LYS B N   1 
ATOM   5823 C CA  . LYS B 1 242 ? -0.489  3.783   -1.971  1.00 264.32 ? 266  LYS B CA  1 
ATOM   5824 C C   . LYS B 1 242 ? -0.385  4.905   -2.999  1.00 264.32 ? 266  LYS B C   1 
ATOM   5825 O O   . LYS B 1 242 ? -0.365  6.085   -2.650  1.00 264.32 ? 266  LYS B O   1 
ATOM   5826 C CB  . LYS B 1 242 ? -0.378  4.356   -0.556  1.00 229.78 ? 266  LYS B CB  1 
ATOM   5827 C CG  . LYS B 1 242 ? -0.362  3.306   0.549   1.00 229.78 ? 266  LYS B CG  1 
ATOM   5828 C CD  . LYS B 1 242 ? -1.724  2.646   0.717   1.00 229.78 ? 266  LYS B CD  1 
ATOM   5829 C CE  . LYS B 1 242 ? -1.721  1.652   1.871   1.00 229.78 ? 266  LYS B CE  1 
ATOM   5830 N NZ  . LYS B 1 242 ? -3.079  1.100   2.138   1.00 229.78 ? 266  LYS B NZ  1 
ATOM   5831 N N   . PRO B 1 243 ? -0.330  4.540   -4.292  1.00 304.41 ? 267  PRO B N   1 
ATOM   5832 C CA  . PRO B 1 243 ? -0.216  5.470   -5.420  1.00 304.41 ? 267  PRO B CA  1 
ATOM   5833 C C   . PRO B 1 243 ? -1.296  6.539   -5.533  1.00 304.41 ? 267  PRO B C   1 
ATOM   5834 O O   . PRO B 1 243 ? -1.292  7.324   -6.481  1.00 304.41 ? 267  PRO B O   1 
ATOM   5835 C CB  . PRO B 1 243 ? -0.192  4.539   -6.626  1.00 235.58 ? 267  PRO B CB  1 
ATOM   5836 C CG  . PRO B 1 243 ? -1.103  3.446   -6.195  1.00 235.58 ? 267  PRO B CG  1 
ATOM   5837 C CD  . PRO B 1 243 ? -0.648  3.185   -4.779  1.00 235.58 ? 267  PRO B CD  1 
ATOM   5838 N N   . ASN B 1 244 ? -2.221  6.568   -4.579  1.00 177.58 ? 268  ASN B N   1 
ATOM   5839 C CA  . ASN B 1 244 ? -3.275  7.572   -4.602  1.00 177.58 ? 268  ASN B CA  1 
ATOM   5840 C C   . ASN B 1 244 ? -2.716  8.863   -4.020  1.00 177.58 ? 268  ASN B C   1 
ATOM   5841 O O   . ASN B 1 244 ? -3.089  9.965   -4.434  1.00 177.58 ? 268  ASN B O   1 
ATOM   5842 C CB  . ASN B 1 244 ? -4.479  7.107   -3.783  1.00 320.32 ? 268  ASN B CB  1 
ATOM   5843 C CG  . ASN B 1 244 ? -5.699  6.849   -4.644  1.00 320.32 ? 268  ASN B CG  1 
ATOM   5844 O OD1 . ASN B 1 244 ? -6.173  7.740   -5.349  1.00 320.32 ? 268  ASN B OD1 1 
ATOM   5845 N ND2 . ASN B 1 244 ? -6.212  5.626   -4.593  1.00 320.32 ? 268  ASN B ND2 1 
ATOM   5846 N N   . ALA B 1 245 ? -1.811  8.704   -3.058  1.00 225.05 ? 269  ALA B N   1 
ATOM   5847 C CA  . ALA B 1 245 ? -1.160  9.830   -2.400  1.00 225.05 ? 269  ALA B CA  1 
ATOM   5848 C C   . ALA B 1 245 ? 0.114   10.177  -3.163  1.00 225.05 ? 269  ALA B C   1 
ATOM   5849 O O   . ALA B 1 245 ? 1.140   9.506   -3.026  1.00 225.05 ? 269  ALA B O   1 
ATOM   5850 C CB  . ALA B 1 245 ? -0.829  9.469   -0.962  1.00 149.91 ? 269  ALA B CB  1 
ATOM   5851 N N   . ARG B 1 246 ? 0.040   11.228  -3.970  1.00 202.80 ? 270  ARG B N   1 
ATOM   5852 C CA  . ARG B 1 246 ? 1.175   11.663  -4.772  1.00 202.80 ? 270  ARG B CA  1 
ATOM   5853 C C   . ARG B 1 246 ? 2.036   12.649  -3.990  1.00 202.80 ? 270  ARG B C   1 
ATOM   5854 O O   . ARG B 1 246 ? 3.141   12.993  -4.405  1.00 202.80 ? 270  ARG B O   1 
ATOM   5855 C CB  . ARG B 1 246 ? 0.671   12.319  -6.062  1.00 353.93 ? 270  ARG B CB  1 
ATOM   5856 C CG  . ARG B 1 246 ? 1.745   12.558  -7.112  0.00 353.93 ? 270  ARG B CG  1 
ATOM   5857 C CD  . ARG B 1 246 ? 2.339   11.244  -7.597  0.00 353.93 ? 270  ARG B CD  1 
ATOM   5858 N NE  . ARG B 1 246 ? 3.284   11.435  -8.694  0.00 353.93 ? 270  ARG B NE  1 
ATOM   5859 C CZ  . ARG B 1 246 ? 2.958   11.921  -9.888  0.00 353.93 ? 270  ARG B CZ  1 
ATOM   5860 N NH1 . ARG B 1 246 ? 1.704   12.268  -10.147 0.00 353.93 ? 270  ARG B NH1 1 
ATOM   5861 N NH2 . ARG B 1 246 ? 3.885   12.058  -10.825 0.00 353.93 ? 270  ARG B NH2 1 
ATOM   5862 N N   . VAL B 1 247 ? 1.527   13.094  -2.849  1.00 143.32 ? 271  VAL B N   1 
ATOM   5863 C CA  . VAL B 1 247 ? 2.246   14.048  -2.020  1.00 143.32 ? 271  VAL B CA  1 
ATOM   5864 C C   . VAL B 1 247 ? 2.881   13.360  -0.814  1.00 143.32 ? 271  VAL B C   1 
ATOM   5865 O O   . VAL B 1 247 ? 2.186   12.806  0.040   1.00 143.32 ? 271  VAL B O   1 
ATOM   5866 C CB  . VAL B 1 247 ? 1.292   15.171  -1.540  1.00 170.61 ? 271  VAL B CB  1 
ATOM   5867 C CG1 . VAL B 1 247 ? 2.021   16.133  -0.630  1.00 170.61 ? 271  VAL B CG1 1 
ATOM   5868 C CG2 . VAL B 1 247 ? 0.734   15.917  -2.738  1.00 170.61 ? 271  VAL B CG2 1 
ATOM   5869 N N   . VAL B 1 248 ? 4.209   13.390  -0.753  1.00 170.82 ? 272  VAL B N   1 
ATOM   5870 C CA  . VAL B 1 248 ? 4.916   12.779  0.359   1.00 170.82 ? 272  VAL B CA  1 
ATOM   5871 C C   . VAL B 1 248 ? 5.567   13.828  1.250   1.00 170.82 ? 272  VAL B C   1 
ATOM   5872 O O   . VAL B 1 248 ? 6.350   14.666  0.788   1.00 170.82 ? 272  VAL B O   1 
ATOM   5873 C CB  . VAL B 1 248 ? 5.994   11.804  -0.124  1.00 170.16 ? 272  VAL B CB  1 
ATOM   5874 C CG1 . VAL B 1 248 ? 6.681   11.159  1.064   1.00 170.16 ? 272  VAL B CG1 1 
ATOM   5875 C CG2 . VAL B 1 248 ? 5.362   10.735  -0.976  1.00 170.16 ? 272  VAL B CG2 1 
ATOM   5876 N N   . VAL B 1 249 ? 5.215   13.767  2.533   1.00 212.32 ? 273  VAL B N   1 
ATOM   5877 C CA  . VAL B 1 249 ? 5.732   14.672  3.546   1.00 212.32 ? 273  VAL B CA  1 
ATOM   5878 C C   . VAL B 1 249 ? 7.038   14.123  4.089   1.00 212.32 ? 273  VAL B C   1 
ATOM   5879 O O   . VAL B 1 249 ? 7.134   12.950  4.454   1.00 212.32 ? 273  VAL B O   1 
ATOM   5880 C CB  . VAL B 1 249 ? 4.728   14.835  4.705   1.00 111.25 ? 273  VAL B CB  1 
ATOM   5881 C CG1 . VAL B 1 249 ? 5.425   15.358  5.948   1.00 111.25 ? 273  VAL B CG1 1 
ATOM   5882 C CG2 . VAL B 1 249 ? 3.642   15.799  4.295   1.00 111.25 ? 273  VAL B CG2 1 
ATOM   5883 N N   . LEU B 1 250 ? 8.044   14.983  4.143   1.00 244.60 ? 274  LEU B N   1 
ATOM   5884 C CA  . LEU B 1 250 ? 9.345   14.576  4.627   1.00 244.60 ? 274  LEU B CA  1 
ATOM   5885 C C   . LEU B 1 250 ? 9.823   15.370  5.831   1.00 244.60 ? 274  LEU B C   1 
ATOM   5886 O O   . LEU B 1 250 ? 9.948   16.594  5.779   1.00 244.60 ? 274  LEU B O   1 
ATOM   5887 C CB  . LEU B 1 250 ? 10.379  14.704  3.510   1.00 167.03 ? 274  LEU B CB  1 
ATOM   5888 C CG  . LEU B 1 250 ? 10.205  13.841  2.263   1.00 167.03 ? 274  LEU B CG  1 
ATOM   5889 C CD1 . LEU B 1 250 ? 11.289  14.195  1.258   1.00 167.03 ? 274  LEU B CD1 1 
ATOM   5890 C CD2 . LEU B 1 250 ? 10.288  12.375  2.633   1.00 167.03 ? 274  LEU B CD2 1 
ATOM   5891 N N   . PHE B 1 251 ? 10.072  14.660  6.922   1.00 144.14 ? 275  PHE B N   1 
ATOM   5892 C CA  . PHE B 1 251 ? 10.601  15.267  8.129   1.00 144.14 ? 275  PHE B CA  1 
ATOM   5893 C C   . PHE B 1 251 ? 11.843  14.434  8.390   1.00 144.14 ? 275  PHE B C   1 
ATOM   5894 O O   . PHE B 1 251 ? 11.890  13.621  9.316   1.00 144.14 ? 275  PHE B O   1 
ATOM   5895 C CB  . PHE B 1 251 ? 9.618   15.149  9.288   1.00 111.10 ? 275  PHE B CB  1 
ATOM   5896 C CG  . PHE B 1 251 ? 9.374   16.446  9.990   1.00 111.10 ? 275  PHE B CG  1 
ATOM   5897 C CD1 . PHE B 1 251 ? 8.153   17.099  9.869   1.00 111.10 ? 275  PHE B CD1 1 
ATOM   5898 C CD2 . PHE B 1 251 ? 10.372  17.034  10.753  1.00 111.10 ? 275  PHE B CD2 1 
ATOM   5899 C CE1 . PHE B 1 251 ? 7.929   18.331  10.503  1.00 111.10 ? 275  PHE B CE1 1 
ATOM   5900 C CE2 . PHE B 1 251 ? 10.160  18.256  11.386  1.00 111.10 ? 275  PHE B CE2 1 
ATOM   5901 C CZ  . PHE B 1 251 ? 8.932   18.907  11.260  1.00 111.10 ? 275  PHE B CZ  1 
ATOM   5902 N N   . MET B 1 252 ? 12.837  14.628  7.529   1.00 130.14 ? 276  MET B N   1 
ATOM   5903 C CA  . MET B 1 252 ? 14.085  13.888  7.616   1.00 130.14 ? 276  MET B CA  1 
ATOM   5904 C C   . MET B 1 252 ? 15.313  14.770  7.657   1.00 130.14 ? 276  MET B C   1 
ATOM   5905 O O   . MET B 1 252 ? 15.313  15.892  7.144   1.00 130.14 ? 276  MET B O   1 
ATOM   5906 C CB  . MET B 1 252 ? 14.230  12.940  6.429   1.00 116.45 ? 276  MET B CB  1 
ATOM   5907 C CG  . MET B 1 252 ? 13.178  11.863  6.319   1.00 116.45 ? 276  MET B CG  1 
ATOM   5908 S SD  . MET B 1 252 ? 13.680  10.758  5.006   1.00 116.45 ? 276  MET B SD  1 
ATOM   5909 C CE  . MET B 1 252 ? 13.485  11.864  3.589   1.00 116.45 ? 276  MET B CE  1 
ATOM   5910 N N   . ARG B 1 253 ? 16.363  14.226  8.264   1.00 125.82 ? 277  ARG B N   1 
ATOM   5911 C CA  . ARG B 1 253 ? 17.642  14.903  8.390   1.00 125.82 ? 277  ARG B CA  1 
ATOM   5912 C C   . ARG B 1 253 ? 18.163  15.192  6.996   1.00 125.82 ? 277  ARG B C   1 
ATOM   5913 O O   . ARG B 1 253 ? 17.714  14.587  6.029   1.00 125.82 ? 277  ARG B O   1 
ATOM   5914 C CB  . ARG B 1 253 ? 18.649  14.000  9.102   1.00 133.61 ? 277  ARG B CB  1 
ATOM   5915 C CG  . ARG B 1 253 ? 18.412  13.805  10.582  1.00 133.61 ? 277  ARG B CG  1 
ATOM   5916 C CD  . ARG B 1 253 ? 19.175  12.586  11.074  1.00 133.61 ? 277  ARG B CD  1 
ATOM   5917 N NE  . ARG B 1 253 ? 20.595  12.645  10.753  1.00 133.61 ? 277  ARG B NE  1 
ATOM   5918 C CZ  . ARG B 1 253 ? 21.549  12.900  11.641  1.00 133.61 ? 277  ARG B CZ  1 
ATOM   5919 N NH1 . ARG B 1 253 ? 21.240  13.121  12.910  1.00 133.61 ? 277  ARG B NH1 1 
ATOM   5920 N NH2 . ARG B 1 253 ? 22.816  12.925  11.262  1.00 133.61 ? 277  ARG B NH2 1 
ATOM   5921 N N   . SER B 1 254 ? 19.118  16.110  6.895   1.00 133.82 ? 278  SER B N   1 
ATOM   5922 C CA  . SER B 1 254 ? 19.710  16.446  5.610   1.00 133.82 ? 278  SER B CA  1 
ATOM   5923 C C   . SER B 1 254 ? 20.193  15.174  4.914   1.00 133.82 ? 278  SER B C   1 
ATOM   5924 O O   . SER B 1 254 ? 19.899  14.966  3.741   1.00 133.82 ? 278  SER B O   1 
ATOM   5925 C CB  . SER B 1 254 ? 20.888  17.404  5.801   1.00 103.91 ? 278  SER B CB  1 
ATOM   5926 O OG  . SER B 1 254 ? 21.509  17.710  4.563   1.00 103.91 ? 278  SER B OG  1 
ATOM   5927 N N   . ASP B 1 255 ? 20.918  14.321  5.639   1.00 132.67 ? 279  ASP B N   1 
ATOM   5928 C CA  . ASP B 1 255 ? 21.429  13.082  5.062   1.00 132.67 ? 279  ASP B CA  1 
ATOM   5929 C C   . ASP B 1 255 ? 20.334  12.083  4.678   1.00 132.67 ? 279  ASP B C   1 
ATOM   5930 O O   . ASP B 1 255 ? 20.260  11.684  3.520   1.00 132.67 ? 279  ASP B O   1 
ATOM   5931 C CB  . ASP B 1 255 ? 22.462  12.422  5.994   1.00 143.60 ? 279  ASP B CB  1 
ATOM   5932 C CG  . ASP B 1 255 ? 21.887  12.026  7.348   1.00 143.60 ? 279  ASP B CG  1 
ATOM   5933 O OD1 . ASP B 1 255 ? 20.984  11.167  7.400   1.00 143.60 ? 279  ASP B OD1 1 
ATOM   5934 O OD2 . ASP B 1 255 ? 22.353  12.567  8.371   1.00 143.60 ? 279  ASP B OD2 1 
ATOM   5935 N N   . ASP B 1 256 ? 19.477  11.683  5.616   1.00 110.47 ? 280  ASP B N   1 
ATOM   5936 C CA  . ASP B 1 256 ? 18.415  10.726  5.287   1.00 110.47 ? 280  ASP B CA  1 
ATOM   5937 C C   . ASP B 1 256 ? 17.508  11.231  4.167   1.00 110.47 ? 280  ASP B C   1 
ATOM   5938 O O   . ASP B 1 256 ? 16.859  10.442  3.477   1.00 110.47 ? 280  ASP B O   1 
ATOM   5939 C CB  . ASP B 1 256 ? 17.538  10.422  6.502   1.00 141.36 ? 280  ASP B CB  1 
ATOM   5940 C CG  . ASP B 1 256 ? 18.305  9.798   7.637   1.00 141.36 ? 280  ASP B CG  1 
ATOM   5941 O OD1 . ASP B 1 256 ? 19.314  9.103   7.379   1.00 141.36 ? 280  ASP B OD1 1 
ATOM   5942 O OD2 . ASP B 1 256 ? 17.880  9.993   8.794   1.00 141.36 ? 280  ASP B OD2 1 
ATOM   5943 N N   . SER B 1 257 ? 17.456  12.549  4.004   1.00 180.38 ? 281  SER B N   1 
ATOM   5944 C CA  . SER B 1 257 ? 16.626  13.160  2.977   1.00 180.38 ? 281  SER B CA  1 
ATOM   5945 C C   . SER B 1 257 ? 17.236  13.000  1.590   1.00 180.38 ? 281  SER B C   1 
ATOM   5946 O O   . SER B 1 257 ? 16.528  13.074  0.587   1.00 180.38 ? 281  SER B O   1 
ATOM   5947 C CB  . SER B 1 257 ? 16.411  14.643  3.284   1.00 208.05 ? 281  SER B CB  1 
ATOM   5948 O OG  . SER B 1 257 ? 15.679  14.808  4.487   1.00 208.05 ? 281  SER B OG  1 
ATOM   5949 N N   . ARG B 1 258 ? 18.549  12.784  1.534   1.00 152.35 ? 282  ARG B N   1 
ATOM   5950 C CA  . ARG B 1 258 ? 19.244  12.592  0.260   1.00 152.35 ? 282  ARG B CA  1 
ATOM   5951 C C   . ARG B 1 258 ? 19.148  11.123  -0.146  1.00 152.35 ? 282  ARG B C   1 
ATOM   5952 O O   . ARG B 1 258 ? 18.784  10.811  -1.278  1.00 152.35 ? 282  ARG B O   1 
ATOM   5953 C CB  . ARG B 1 258 ? 20.717  12.999  0.375   1.00 166.24 ? 282  ARG B CB  1 
ATOM   5954 C CG  . ARG B 1 258 ? 21.522  12.794  -0.894  0.00 166.24 ? 282  ARG B CG  1 
ATOM   5955 C CD  . ARG B 1 258 ? 22.980  13.153  -0.675  0.00 166.24 ? 282  ARG B CD  1 
ATOM   5956 N NE  . ARG B 1 258 ? 23.777  12.956  -1.882  0.00 166.24 ? 282  ARG B NE  1 
ATOM   5957 C CZ  . ARG B 1 258 ? 25.085  13.176  -1.958  0.00 166.24 ? 282  ARG B CZ  1 
ATOM   5958 N NH1 . ARG B 1 258 ? 25.752  13.602  -0.893  0.00 166.24 ? 282  ARG B NH1 1 
ATOM   5959 N NH2 . ARG B 1 258 ? 25.728  12.970  -3.099  0.00 166.24 ? 282  ARG B NH2 1 
ATOM   5960 N N   . GLU B 1 259 ? 19.472  10.230  0.787   1.00 139.71 ? 283  GLU B N   1 
ATOM   5961 C CA  . GLU B 1 259 ? 19.413  8.792   0.541   1.00 139.71 ? 283  GLU B CA  1 
ATOM   5962 C C   . GLU B 1 259 ? 18.037  8.373   0.030   1.00 139.71 ? 283  GLU B C   1 
ATOM   5963 O O   . GLU B 1 259 ? 17.926  7.471   -0.805  1.00 139.71 ? 283  GLU B O   1 
ATOM   5964 C CB  . GLU B 1 259 ? 19.729  8.019   1.824   1.00 200.01 ? 283  GLU B CB  1 
ATOM   5965 C CG  . GLU B 1 259 ? 21.194  8.002   2.223   1.00 200.01 ? 283  GLU B CG  1 
ATOM   5966 C CD  . GLU B 1 259 ? 22.036  7.127   1.316   1.00 200.01 ? 283  GLU B CD  1 
ATOM   5967 O OE1 . GLU B 1 259 ? 22.073  7.394   0.097   1.00 200.01 ? 283  GLU B OE1 1 
ATOM   5968 O OE2 . GLU B 1 259 ? 22.663  6.171   1.823   1.00 200.01 ? 283  GLU B OE2 1 
ATOM   5969 N N   . LEU B 1 260 ? 16.995  9.027   0.540   1.00 179.00 ? 284  LEU B N   1 
ATOM   5970 C CA  . LEU B 1 260 ? 15.619  8.738   0.137   1.00 179.00 ? 284  LEU B CA  1 
ATOM   5971 C C   . LEU B 1 260 ? 15.422  9.103   -1.327  1.00 179.00 ? 284  LEU B C   1 
ATOM   5972 O O   . LEU B 1 260 ? 14.962  8.284   -2.122  1.00 179.00 ? 284  LEU B O   1 
ATOM   5973 C CB  . LEU B 1 260 ? 14.639  9.529   1.009   1.00 174.89 ? 284  LEU B CB  1 
ATOM   5974 C CG  . LEU B 1 260 ? 13.131  9.355   0.807   1.00 174.89 ? 284  LEU B CG  1 
ATOM   5975 C CD1 . LEU B 1 260 ? 12.684  10.047  -0.469  1.00 174.89 ? 284  LEU B CD1 1 
ATOM   5976 C CD2 . LEU B 1 260 ? 12.797  7.870   0.792   1.00 174.89 ? 284  LEU B CD2 1 
ATOM   5977 N N   . ILE B 1 261 ? 15.768  10.337  -1.677  1.00 138.65 ? 285  ILE B N   1 
ATOM   5978 C CA  . ILE B 1 261 ? 15.642  10.804  -3.053  1.00 138.65 ? 285  ILE B CA  1 
ATOM   5979 C C   . ILE B 1 261 ? 16.528  9.984   -3.992  1.00 138.65 ? 285  ILE B C   1 
ATOM   5980 O O   . ILE B 1 261 ? 16.154  9.709   -5.136  1.00 138.65 ? 285  ILE B O   1 
ATOM   5981 C CB  . ILE B 1 261 ? 16.019  12.298  -3.164  1.00 161.48 ? 285  ILE B CB  1 
ATOM   5982 C CG1 . ILE B 1 261 ? 14.977  13.142  -2.423  1.00 161.48 ? 285  ILE B CG1 1 
ATOM   5983 C CG2 . ILE B 1 261 ? 16.128  12.715  -4.624  1.00 161.48 ? 285  ILE B CG2 1 
ATOM   5984 C CD1 . ILE B 1 261 ? 13.555  12.923  -2.895  1.00 161.48 ? 285  ILE B CD1 1 
ATOM   5985 N N   . ALA B 1 262 ? 17.703  9.597   -3.506  1.00 176.45 ? 286  ALA B N   1 
ATOM   5986 C CA  . ALA B 1 262 ? 18.620  8.792   -4.301  1.00 176.45 ? 286  ALA B CA  1 
ATOM   5987 C C   . ALA B 1 262 ? 17.902  7.501   -4.666  1.00 176.45 ? 286  ALA B C   1 
ATOM   5988 O O   . ALA B 1 262 ? 17.867  7.108   -5.829  1.00 176.45 ? 286  ALA B O   1 
ATOM   5989 C CB  . ALA B 1 262 ? 19.877  8.483   -3.506  1.00 213.65 ? 286  ALA B CB  1 
ATOM   5990 N N   . ALA B 1 263 ? 17.325  6.850   -3.660  1.00 219.12 ? 287  ALA B N   1 
ATOM   5991 C CA  . ALA B 1 263 ? 16.593  5.608   -3.870  1.00 219.12 ? 287  ALA B CA  1 
ATOM   5992 C C   . ALA B 1 263 ? 15.440  5.861   -4.834  1.00 219.12 ? 287  ALA B C   1 
ATOM   5993 O O   . ALA B 1 263 ? 15.346  5.232   -5.885  1.00 219.12 ? 287  ALA B O   1 
ATOM   5994 C CB  . ALA B 1 263 ? 16.062  5.074   -2.537  1.00 72.37  ? 287  ALA B CB  1 
ATOM   5995 N N   . ALA B 1 264 ? 14.571  6.797   -4.473  1.00 147.11 ? 288  ALA B N   1 
ATOM   5996 C CA  . ALA B 1 264 ? 13.420  7.148   -5.292  1.00 147.11 ? 288  ALA B CA  1 
ATOM   5997 C C   . ALA B 1 264 ? 13.777  7.421   -6.752  1.00 147.11 ? 288  ALA B C   1 
ATOM   5998 O O   . ALA B 1 264 ? 12.906  7.392   -7.620  1.00 147.11 ? 288  ALA B O   1 
ATOM   5999 C CB  . ALA B 1 264 ? 12.728  8.360   -4.703  1.00 88.57  ? 288  ALA B CB  1 
ATOM   6000 N N   . ASN B 1 265 ? 15.049  7.693   -7.024  1.00 212.03 ? 289  ASN B N   1 
ATOM   6001 C CA  . ASN B 1 265 ? 15.486  7.966   -8.389  1.00 212.03 ? 289  ASN B CA  1 
ATOM   6002 C C   . ASN B 1 265 ? 15.901  6.715   -9.162  1.00 212.03 ? 289  ASN B C   1 
ATOM   6003 O O   . ASN B 1 265 ? 15.550  6.562   -10.333 1.00 212.03 ? 289  ASN B O   1 
ATOM   6004 C CB  . ASN B 1 265 ? 16.647  8.959   -8.389  1.00 186.97 ? 289  ASN B CB  1 
ATOM   6005 C CG  . ASN B 1 265 ? 17.343  9.038   -9.733  1.00 186.97 ? 289  ASN B CG  1 
ATOM   6006 O OD1 . ASN B 1 265 ? 16.730  9.373   -10.747 1.00 186.97 ? 289  ASN B OD1 1 
ATOM   6007 N ND2 . ASN B 1 265 ? 18.633  8.721   -9.749  1.00 186.97 ? 289  ASN B ND2 1 
ATOM   6008 N N   . ARG B 1 266 ? 16.652  5.827   -8.517  1.00 200.77 ? 290  ARG B N   1 
ATOM   6009 C CA  . ARG B 1 266 ? 17.103  4.604   -9.173  1.00 200.77 ? 290  ARG B CA  1 
ATOM   6010 C C   . ARG B 1 266 ? 15.922  3.902   -9.833  1.00 200.77 ? 290  ARG B C   1 
ATOM   6011 O O   . ARG B 1 266 ? 16.076  3.261   -10.872 1.00 200.77 ? 290  ARG B O   1 
ATOM   6012 C CB  . ARG B 1 266 ? 17.761  3.657   -8.166  1.00 267.43 ? 290  ARG B CB  1 
ATOM   6013 C CG  . ARG B 1 266 ? 18.772  4.325   -7.254  1.00 267.43 ? 290  ARG B CG  1 
ATOM   6014 C CD  . ARG B 1 266 ? 19.667  3.302   -6.577  1.00 267.43 ? 290  ARG B CD  1 
ATOM   6015 N NE  . ARG B 1 266 ? 20.049  3.725   -5.234  1.00 267.43 ? 290  ARG B NE  1 
ATOM   6016 C CZ  . ARG B 1 266 ? 19.251  3.639   -4.174  1.00 267.43 ? 290  ARG B CZ  1 
ATOM   6017 N NH1 . ARG B 1 266 ? 18.030  3.139   -4.301  1.00 267.43 ? 290  ARG B NH1 1 
ATOM   6018 N NH2 . ARG B 1 266 ? 19.670  4.055   -2.987  1.00 267.43 ? 290  ARG B NH2 1 
ATOM   6019 N N   . VAL B 1 267 ? 14.743  4.030   -9.225  1.00 153.59 ? 291  VAL B N   1 
ATOM   6020 C CA  . VAL B 1 267 ? 13.531  3.412   -9.755  1.00 153.59 ? 291  VAL B CA  1 
ATOM   6021 C C   . VAL B 1 267 ? 12.507  4.445   -10.218 1.00 153.59 ? 291  VAL B C   1 
ATOM   6022 O O   . VAL B 1 267 ? 11.322  4.348   -9.893  1.00 153.59 ? 291  VAL B O   1 
ATOM   6023 C CB  . VAL B 1 267 ? 12.854  2.489   -8.713  1.00 139.77 ? 291  VAL B CB  1 
ATOM   6024 C CG1 . VAL B 1 267 ? 13.733  1.273   -8.439  1.00 139.77 ? 291  VAL B CG1 1 
ATOM   6025 C CG2 . VAL B 1 267 ? 12.565  3.269   -7.437  1.00 139.77 ? 291  VAL B CG2 1 
ATOM   6026 N N   . ASN B 1 268 ? 12.983  5.427   -10.981 1.00 179.60 ? 292  ASN B N   1 
ATOM   6027 C CA  . ASN B 1 268 ? 12.156  6.500   -11.542 1.00 179.60 ? 292  ASN B CA  1 
ATOM   6028 C C   . ASN B 1 268 ? 10.825  6.764   -10.838 1.00 179.60 ? 292  ASN B C   1 
ATOM   6029 O O   . ASN B 1 268 ? 9.814   7.019   -11.493 1.00 179.60 ? 292  ASN B O   1 
ATOM   6030 C CB  . ASN B 1 268 ? 11.891  6.229   -13.030 1.00 249.64 ? 292  ASN B CB  1 
ATOM   6031 C CG  . ASN B 1 268 ? 13.119  6.457   -13.901 1.00 249.64 ? 292  ASN B CG  1 
ATOM   6032 O OD1 . ASN B 1 268 ? 13.114  6.141   -15.092 1.00 249.64 ? 292  ASN B OD1 1 
ATOM   6033 N ND2 . ASN B 1 268 ? 14.171  7.016   -13.312 1.00 249.64 ? 292  ASN B ND2 1 
ATOM   6034 N N   . ALA B 1 269 ? 10.828  6.708   -9.510  1.00 193.05 ? 293  ALA B N   1 
ATOM   6035 C CA  . ALA B 1 269 ? 9.619   6.959   -8.737  1.00 193.05 ? 293  ALA B CA  1 
ATOM   6036 C C   . ALA B 1 269 ? 9.430   8.471   -8.652  1.00 193.05 ? 293  ALA B C   1 
ATOM   6037 O O   . ALA B 1 269 ? 10.405  9.210   -8.508  1.00 193.05 ? 293  ALA B O   1 
ATOM   6038 C CB  . ALA B 1 269 ? 9.760   6.364   -7.348  1.00 157.02 ? 293  ALA B CB  1 
ATOM   6039 N N   . SER B 1 270 ? 8.185   8.933   -8.743  1.00 266.82 ? 294  SER B N   1 
ATOM   6040 C CA  . SER B 1 270 ? 7.912   10.368  -8.693  1.00 266.82 ? 294  SER B CA  1 
ATOM   6041 C C   . SER B 1 270 ? 6.804   10.774  -7.736  1.00 266.82 ? 294  SER B C   1 
ATOM   6042 O O   . SER B 1 270 ? 5.744   10.149  -7.691  1.00 266.82 ? 294  SER B O   1 
ATOM   6043 C CB  . SER B 1 270 ? 7.559   10.892  -10.086 1.00 200.52 ? 294  SER B CB  1 
ATOM   6044 O OG  . SER B 1 270 ? 7.211   12.267  -10.031 1.00 200.52 ? 294  SER B OG  1 
ATOM   6045 N N   . PHE B 1 271 ? 7.061   11.833  -6.977  1.00 160.26 ? 295  PHE B N   1 
ATOM   6046 C CA  . PHE B 1 271 ? 6.088   12.359  -6.027  1.00 160.26 ? 295  PHE B CA  1 
ATOM   6047 C C   . PHE B 1 271 ? 6.267   13.871  -5.904  1.00 160.26 ? 295  PHE B C   1 
ATOM   6048 O O   . PHE B 1 271 ? 7.161   14.456  -6.526  1.00 160.26 ? 295  PHE B O   1 
ATOM   6049 C CB  . PHE B 1 271 ? 6.280   11.757  -4.630  1.00 163.45 ? 295  PHE B CB  1 
ATOM   6050 C CG  . PHE B 1 271 ? 6.277   10.256  -4.588  1.00 163.45 ? 295  PHE B CG  1 
ATOM   6051 C CD1 . PHE B 1 271 ? 7.391   9.531   -5.000  1.00 163.45 ? 295  PHE B CD1 1 
ATOM   6052 C CD2 . PHE B 1 271 ? 5.182   9.567   -4.069  1.00 163.45 ? 295  PHE B CD2 1 
ATOM   6053 C CE1 . PHE B 1 271 ? 7.419   8.140   -4.889  1.00 163.45 ? 295  PHE B CE1 1 
ATOM   6054 C CE2 . PHE B 1 271 ? 5.196   8.176   -3.952  1.00 163.45 ? 295  PHE B CE2 1 
ATOM   6055 C CZ  . PHE B 1 271 ? 6.319   7.461   -4.362  1.00 163.45 ? 295  PHE B CZ  1 
ATOM   6056 N N   . THR B 1 272 ? 5.403   14.494  -5.104  1.00 269.27 ? 296  THR B N   1 
ATOM   6057 C CA  . THR B 1 272 ? 5.480   15.927  -4.840  1.00 269.27 ? 296  THR B CA  1 
ATOM   6058 C C   . THR B 1 272 ? 6.062   15.977  -3.438  1.00 269.27 ? 296  THR B C   1 
ATOM   6059 O O   . THR B 1 272 ? 5.360   15.775  -2.447  1.00 269.27 ? 296  THR B O   1 
ATOM   6060 C CB  . THR B 1 272 ? 4.100   16.612  -4.813  1.00 175.03 ? 296  THR B CB  1 
ATOM   6061 O OG1 . THR B 1 272 ? 3.250   16.034  -5.808  1.00 175.03 ? 296  THR B OG1 1 
ATOM   6062 C CG2 . THR B 1 272 ? 4.249   18.099  -5.114  1.00 175.03 ? 296  THR B CG2 1 
ATOM   6063 N N   . TRP B 1 273 ? 7.359   16.229  -3.368  1.00 142.51 ? 297  TRP B N   1 
ATOM   6064 C CA  . TRP B 1 273 ? 8.060   16.272  -2.103  1.00 142.51 ? 297  TRP B CA  1 
ATOM   6065 C C   . TRP B 1 273 ? 7.805   17.516  -1.268  1.00 142.51 ? 297  TRP B C   1 
ATOM   6066 O O   . TRP B 1 273 ? 8.059   18.640  -1.701  1.00 142.51 ? 297  TRP B O   1 
ATOM   6067 C CB  . TRP B 1 273 ? 9.557   16.140  -2.356  1.00 126.48 ? 297  TRP B CB  1 
ATOM   6068 C CG  . TRP B 1 273 ? 9.948   14.886  -3.066  1.00 126.48 ? 297  TRP B CG  1 
ATOM   6069 C CD1 . TRP B 1 273 ? 10.650  14.789  -4.232  1.00 126.48 ? 297  TRP B CD1 1 
ATOM   6070 C CD2 . TRP B 1 273 ? 9.718   13.549  -2.624  1.00 126.48 ? 297  TRP B CD2 1 
ATOM   6071 N NE1 . TRP B 1 273 ? 10.879  13.472  -4.540  1.00 126.48 ? 297  TRP B NE1 1 
ATOM   6072 C CE2 . TRP B 1 273 ? 10.318  12.688  -3.569  1.00 126.48 ? 297  TRP B CE2 1 
ATOM   6073 C CE3 . TRP B 1 273 ? 9.067   12.992  -1.519  1.00 126.48 ? 297  TRP B CE3 1 
ATOM   6074 C CZ2 . TRP B 1 273 ? 10.287  11.299  -3.443  1.00 126.48 ? 297  TRP B CZ2 1 
ATOM   6075 C CZ3 . TRP B 1 273 ? 9.037   11.606  -1.394  1.00 126.48 ? 297  TRP B CZ3 1 
ATOM   6076 C CH2 . TRP B 1 273 ? 9.645   10.776  -2.353  1.00 126.48 ? 297  TRP B CH2 1 
ATOM   6077 N N   . VAL B 1 274 ? 7.296   17.293  -0.063  1.00 172.11 ? 298  VAL B N   1 
ATOM   6078 C CA  . VAL B 1 274 ? 7.040   18.359  0.894   1.00 172.11 ? 298  VAL B CA  1 
ATOM   6079 C C   . VAL B 1 274 ? 7.991   18.015  2.030   1.00 172.11 ? 298  VAL B C   1 
ATOM   6080 O O   . VAL B 1 274 ? 7.742   17.083  2.794   1.00 172.11 ? 298  VAL B O   1 
ATOM   6081 C CB  . VAL B 1 274 ? 5.570   18.340  1.378   1.00 137.43 ? 298  VAL B CB  1 
ATOM   6082 C CG1 . VAL B 1 274 ? 5.488   18.625  2.866   1.00 137.43 ? 298  VAL B CG1 1 
ATOM   6083 C CG2 . VAL B 1 274 ? 4.770   19.384  0.615   1.00 137.43 ? 298  VAL B CG2 1 
ATOM   6084 N N   . ALA B 1 275 ? 9.089   18.755  2.130   1.00 176.00 ? 299  ALA B N   1 
ATOM   6085 C CA  . ALA B 1 275 ? 10.080  18.462  3.150   1.00 176.00 ? 299  ALA B CA  1 
ATOM   6086 C C   . ALA B 1 275 ? 10.367  19.559  4.170   1.00 176.00 ? 299  ALA B C   1 
ATOM   6087 O O   . ALA B 1 275 ? 10.260  20.755  3.886   1.00 176.00 ? 299  ALA B O   1 
ATOM   6088 C CB  . ALA B 1 275 ? 11.377  18.025  2.472   1.00 126.89 ? 299  ALA B CB  1 
ATOM   6089 N N   . SER B 1 276 ? 10.738  19.112  5.367   1.00 194.77 ? 300  SER B N   1 
ATOM   6090 C CA  . SER B 1 276 ? 11.081  19.981  6.482   1.00 194.77 ? 300  SER B CA  1 
ATOM   6091 C C   . SER B 1 276 ? 12.420  20.638  6.178   1.00 194.77 ? 300  SER B C   1 
ATOM   6092 O O   . SER B 1 276 ? 13.097  20.265  5.225   1.00 194.77 ? 300  SER B O   1 
ATOM   6093 C CB  . SER B 1 276 ? 11.195  19.152  7.766   1.00 112.16 ? 300  SER B CB  1 
ATOM   6094 O OG  . SER B 1 276 ? 12.091  18.059  7.593   1.00 112.16 ? 300  SER B OG  1 
ATOM   6095 N N   . ASP B 1 277 ? 12.803  21.614  6.991   1.00 112.75 ? 301  ASP B N   1 
ATOM   6096 C CA  . ASP B 1 277 ? 14.070  22.295  6.791   1.00 112.75 ? 301  ASP B CA  1 
ATOM   6097 C C   . ASP B 1 277 ? 15.175  21.264  6.647   1.00 112.75 ? 301  ASP B C   1 
ATOM   6098 O O   . ASP B 1 277 ? 16.162  21.514  5.961   1.00 112.75 ? 301  ASP B O   1 
ATOM   6099 C CB  . ASP B 1 277 ? 14.390  23.198  7.977   1.00 142.51 ? 301  ASP B CB  1 
ATOM   6100 C CG  . ASP B 1 277 ? 14.715  22.414  9.230   1.00 142.51 ? 301  ASP B CG  1 
ATOM   6101 O OD1 . ASP B 1 277 ? 13.869  21.598  9.652   1.00 142.51 ? 301  ASP B OD1 1 
ATOM   6102 O OD2 . ASP B 1 277 ? 15.815  22.615  9.791   1.00 142.51 ? 301  ASP B OD2 1 
ATOM   6103 N N   . GLY B 1 278 ? 15.009  20.114  7.301   1.00 115.54 ? 302  GLY B N   1 
ATOM   6104 C CA  . GLY B 1 278 ? 16.007  19.055  7.222   1.00 115.54 ? 302  GLY B CA  1 
ATOM   6105 C C   . GLY B 1 278 ? 16.614  18.959  5.831   1.00 115.54 ? 302  GLY B C   1 
ATOM   6106 O O   . GLY B 1 278 ? 17.823  18.763  5.659   1.00 115.54 ? 302  GLY B O   1 
ATOM   6107 N N   . TRP B 1 279 ? 15.743  19.093  4.835   1.00 141.29 ? 303  TRP B N   1 
ATOM   6108 C CA  . TRP B 1 279 ? 16.111  19.079  3.422   1.00 141.29 ? 303  TRP B CA  1 
ATOM   6109 C C   . TRP B 1 279 ? 16.375  20.551  3.119   1.00 141.29 ? 303  TRP B C   1 
ATOM   6110 O O   . TRP B 1 279 ? 17.398  20.925  2.543   1.00 141.29 ? 303  TRP B O   1 
ATOM   6111 C CB  . TRP B 1 279 ? 14.916  18.565  2.611   1.00 159.31 ? 303  TRP B CB  1 
ATOM   6112 C CG  . TRP B 1 279 ? 14.970  18.761  1.132   1.00 159.31 ? 303  TRP B CG  1 
ATOM   6113 C CD1 . TRP B 1 279 ? 15.439  19.851  0.459   1.00 159.31 ? 303  TRP B CD1 1 
ATOM   6114 C CD2 . TRP B 1 279 ? 14.436  17.881  0.143   1.00 159.31 ? 303  TRP B CD2 1 
ATOM   6115 N NE1 . TRP B 1 279 ? 15.229  19.707  -0.887  1.00 159.31 ? 303  TRP B NE1 1 
ATOM   6116 C CE2 . TRP B 1 279 ? 14.615  18.502  -1.110  1.00 159.31 ? 303  TRP B CE2 1 
ATOM   6117 C CE3 . TRP B 1 279 ? 13.825  16.622  0.194   1.00 159.31 ? 303  TRP B CE3 1 
ATOM   6118 C CZ2 . TRP B 1 279 ? 14.200  17.914  -2.304  1.00 159.31 ? 303  TRP B CZ2 1 
ATOM   6119 C CZ3 . TRP B 1 279 ? 13.412  16.036  -0.991  1.00 159.31 ? 303  TRP B CZ3 1 
ATOM   6120 C CH2 . TRP B 1 279 ? 13.604  16.682  -2.226  1.00 159.31 ? 303  TRP B CH2 1 
ATOM   6121 N N   . GLY B 1 280 ? 15.425  21.379  3.538   1.00 163.20 ? 304  GLY B N   1 
ATOM   6122 C CA  . GLY B 1 280 ? 15.535  22.807  3.347   1.00 163.20 ? 304  GLY B CA  1 
ATOM   6123 C C   . GLY B 1 280 ? 15.697  23.200  1.900   1.00 163.20 ? 304  GLY B C   1 
ATOM   6124 O O   . GLY B 1 280 ? 15.032  22.658  1.019   1.00 163.20 ? 304  GLY B O   1 
ATOM   6125 N N   . ALA B 1 281 ? 16.587  24.153  1.659   1.00 159.37 ? 305  ALA B N   1 
ATOM   6126 C CA  . ALA B 1 281 ? 16.840  24.638  0.313   1.00 159.37 ? 305  ALA B CA  1 
ATOM   6127 C C   . ALA B 1 281 ? 18.226  24.219  -0.162  1.00 159.37 ? 305  ALA B C   1 
ATOM   6128 O O   . ALA B 1 281 ? 18.844  24.894  -0.992  1.00 159.37 ? 305  ALA B O   1 
ATOM   6129 C CB  . ALA B 1 281 ? 16.706  26.153  0.275   1.00 254.08 ? 305  ALA B CB  1 
ATOM   6130 N N   . GLN B 1 282 ? 18.708  23.100  0.366   1.00 181.02 ? 306  GLN B N   1 
ATOM   6131 C CA  . GLN B 1 282 ? 20.021  22.596  -0.007  1.00 181.02 ? 306  GLN B CA  1 
ATOM   6132 C C   . GLN B 1 282 ? 20.009  22.065  -1.438  1.00 181.02 ? 306  GLN B C   1 
ATOM   6133 O O   . GLN B 1 282 ? 19.246  21.157  -1.772  1.00 181.02 ? 306  GLN B O   1 
ATOM   6134 C CB  . GLN B 1 282 ? 20.458  21.490  0.958   1.00 186.20 ? 306  GLN B CB  1 
ATOM   6135 C CG  . GLN B 1 282 ? 20.494  21.909  2.424   1.00 186.20 ? 306  GLN B CG  1 
ATOM   6136 C CD  . GLN B 1 282 ? 21.131  20.856  3.312   1.00 186.20 ? 306  GLN B CD  1 
ATOM   6137 O OE1 . GLN B 1 282 ? 22.338  20.622  3.253   1.00 186.20 ? 306  GLN B OE1 1 
ATOM   6138 N NE2 . GLN B 1 282 ? 20.318  20.206  4.134   1.00 186.20 ? 306  GLN B NE2 1 
ATOM   6139 N N   . GLU B 1 283 ? 20.856  22.643  -2.281  1.00 239.88 ? 307  GLU B N   1 
ATOM   6140 C CA  . GLU B 1 283 ? 20.943  22.224  -3.670  1.00 239.88 ? 307  GLU B CA  1 
ATOM   6141 C C   . GLU B 1 283 ? 21.852  21.008  -3.763  1.00 239.88 ? 307  GLU B C   1 
ATOM   6142 O O   . GLU B 1 283 ? 22.010  20.417  -4.831  1.00 239.88 ? 307  GLU B O   1 
ATOM   6143 C CB  . GLU B 1 283 ? 21.496  23.360  -4.530  1.00 246.94 ? 307  GLU B CB  1 
ATOM   6144 C CG  . GLU B 1 283 ? 20.796  24.691  -4.302  1.00 246.94 ? 307  GLU B CG  1 
ATOM   6145 C CD  . GLU B 1 283 ? 21.050  25.684  -5.418  1.00 246.94 ? 307  GLU B CD  1 
ATOM   6146 O OE1 . GLU B 1 283 ? 22.228  25.891  -5.772  1.00 246.94 ? 307  GLU B OE1 1 
ATOM   6147 O OE2 . GLU B 1 283 ? 20.069  26.262  -5.937  1.00 246.94 ? 307  GLU B OE2 1 
ATOM   6148 N N   . SER B 1 284 ? 22.442  20.636  -2.631  1.00 148.74 ? 308  SER B N   1 
ATOM   6149 C CA  . SER B 1 284 ? 23.341  19.486  -2.569  1.00 148.74 ? 308  SER B CA  1 
ATOM   6150 C C   . SER B 1 284 ? 22.587  18.189  -2.266  1.00 148.74 ? 308  SER B C   1 
ATOM   6151 O O   . SER B 1 284 ? 23.188  17.113  -2.186  1.00 148.74 ? 308  SER B O   1 
ATOM   6152 C CB  . SER B 1 284 ? 24.413  19.701  -1.497  1.00 233.59 ? 308  SER B CB  1 
ATOM   6153 O OG  . SER B 1 284 ? 23.897  19.455  -0.199  1.00 233.59 ? 308  SER B OG  1 
ATOM   6154 N N   . ILE B 1 285 ? 21.273  18.296  -2.090  1.00 198.72 ? 309  ILE B N   1 
ATOM   6155 C CA  . ILE B 1 285 ? 20.440  17.133  -1.799  1.00 198.72 ? 309  ILE B CA  1 
ATOM   6156 C C   . ILE B 1 285 ? 19.895  16.553  -3.093  1.00 198.72 ? 309  ILE B C   1 
ATOM   6157 O O   . ILE B 1 285 ? 19.849  15.336  -3.281  1.00 198.72 ? 309  ILE B O   1 
ATOM   6158 C CB  . ILE B 1 285 ? 19.239  17.513  -0.913  1.00 158.44 ? 309  ILE B CB  1 
ATOM   6159 C CG1 . ILE B 1 285 ? 19.728  18.030  0.435   1.00 158.44 ? 309  ILE B CG1 1 
ATOM   6160 C CG2 . ILE B 1 285 ? 18.334  16.305  -0.718  1.00 158.44 ? 309  ILE B CG2 1 
ATOM   6161 C CD1 . ILE B 1 285 ? 18.614  18.495  1.343   1.00 158.44 ? 309  ILE B CD1 1 
ATOM   6162 N N   . VAL B 1 286 ? 19.484  17.450  -3.982  1.00 291.93 ? 310  VAL B N   1 
ATOM   6163 C CA  . VAL B 1 286 ? 18.919  17.072  -5.265  1.00 291.93 ? 310  VAL B CA  1 
ATOM   6164 C C   . VAL B 1 286 ? 20.001  16.700  -6.282  1.00 291.93 ? 310  VAL B C   1 
ATOM   6165 O O   . VAL B 1 286 ? 19.693  16.186  -7.357  1.00 291.93 ? 310  VAL B O   1 
ATOM   6166 C CB  . VAL B 1 286 ? 18.062  18.227  -5.832  1.00 266.23 ? 310  VAL B CB  1 
ATOM   6167 C CG1 . VAL B 1 286 ? 17.183  17.722  -6.960  1.00 266.23 ? 310  VAL B CG1 1 
ATOM   6168 C CG2 . VAL B 1 286 ? 17.220  18.839  -4.723  1.00 266.23 ? 310  VAL B CG2 1 
ATOM   6169 N N   . LYS B 1 287 ? 21.263  16.951  -5.944  1.00 293.47 ? 311  LYS B N   1 
ATOM   6170 C CA  . LYS B 1 287 ? 22.371  16.636  -6.847  1.00 293.47 ? 311  LYS B CA  1 
ATOM   6171 C C   . LYS B 1 287 ? 22.438  15.145  -7.174  1.00 293.47 ? 311  LYS B C   1 
ATOM   6172 O O   . LYS B 1 287 ? 22.680  14.314  -6.297  1.00 293.47 ? 311  LYS B O   1 
ATOM   6173 C CB  . LYS B 1 287 ? 23.705  17.092  -6.243  1.00 216.25 ? 311  LYS B CB  1 
ATOM   6174 C CG  . LYS B 1 287 ? 24.933  16.729  -7.079  1.00 216.25 ? 311  LYS B CG  1 
ATOM   6175 C CD  . LYS B 1 287 ? 26.234  17.123  -6.374  1.00 216.25 ? 311  LYS B CD  1 
ATOM   6176 C CE  . LYS B 1 287 ? 27.466  16.590  -7.108  1.00 216.25 ? 311  LYS B CE  1 
ATOM   6177 N NZ  . LYS B 1 287 ? 28.746  16.887  -6.393  1.00 216.25 ? 311  LYS B NZ  1 
ATOM   6178 N N   . GLY B 1 288 ? 22.231  14.817  -8.445  1.00 238.89 ? 312  GLY B N   1 
ATOM   6179 C CA  . GLY B 1 288 ? 22.258  13.431  -8.873  1.00 238.89 ? 312  GLY B CA  1 
ATOM   6180 C C   . GLY B 1 288 ? 20.849  12.903  -9.063  1.00 238.89 ? 312  GLY B C   1 
ATOM   6181 O O   . GLY B 1 288 ? 20.649  11.721  -9.343  1.00 238.89 ? 312  GLY B O   1 
ATOM   6182 N N   . SER B 1 289 ? 19.872  13.793  -8.911  1.00 150.45 ? 313  SER B N   1 
ATOM   6183 C CA  . SER B 1 289 ? 18.458  13.448  -9.053  1.00 150.45 ? 313  SER B CA  1 
ATOM   6184 C C   . SER B 1 289 ? 17.649  14.727  -9.288  1.00 150.45 ? 313  SER B C   1 
ATOM   6185 O O   . SER B 1 289 ? 16.472  14.817  -8.930  1.00 150.45 ? 313  SER B O   1 
ATOM   6186 C CB  . SER B 1 289 ? 17.957  12.744  -7.785  1.00 198.91 ? 313  SER B CB  1 
ATOM   6187 O OG  . SER B 1 289 ? 18.740  11.600  -7.479  1.00 198.91 ? 313  SER B OG  1 
ATOM   6188 N N   . GLU B 1 290 ? 18.304  15.709  -9.896  1.00 147.22 ? 314  GLU B N   1 
ATOM   6189 C CA  . GLU B 1 290 ? 17.712  17.007  -10.202 1.00 147.22 ? 314  GLU B CA  1 
ATOM   6190 C C   . GLU B 1 290 ? 16.241  16.983  -10.634 1.00 147.22 ? 314  GLU B C   1 
ATOM   6191 O O   . GLU B 1 290 ? 15.523  17.975  -10.468 1.00 147.22 ? 314  GLU B O   1 
ATOM   6192 C CB  . GLU B 1 290 ? 18.539  17.696  -11.291 1.00 172.61 ? 314  GLU B CB  1 
ATOM   6193 C CG  . GLU B 1 290 ? 19.973  18.072  -10.904 1.00 172.61 ? 314  GLU B CG  1 
ATOM   6194 C CD  . GLU B 1 290 ? 20.810  16.914  -10.369 1.00 172.61 ? 314  GLU B CD  1 
ATOM   6195 O OE1 . GLU B 1 290 ? 20.649  15.768  -10.840 1.00 172.61 ? 314  GLU B OE1 1 
ATOM   6196 O OE2 . GLU B 1 290 ? 21.652  17.166  -9.484  1.00 172.61 ? 314  GLU B OE2 1 
ATOM   6197 N N   . HIS B 1 291 ? 15.795  15.862  -11.193 1.00 181.35 ? 315  HIS B N   1 
ATOM   6198 C CA  . HIS B 1 291 ? 14.415  15.748  -11.647 1.00 181.35 ? 315  HIS B CA  1 
ATOM   6199 C C   . HIS B 1 291 ? 13.489  14.944  -10.729 1.00 181.35 ? 315  HIS B C   1 
ATOM   6200 O O   . HIS B 1 291 ? 12.357  15.361  -10.483 1.00 181.35 ? 315  HIS B O   1 
ATOM   6201 C CB  . HIS B 1 291 ? 14.377  15.186  -13.078 1.00 281.95 ? 315  HIS B CB  1 
ATOM   6202 C CG  . HIS B 1 291 ? 15.280  14.012  -13.301 1.00 281.95 ? 315  HIS B CG  1 
ATOM   6203 N ND1 . HIS B 1 291 ? 15.092  12.796  -12.681 1.00 281.95 ? 315  HIS B ND1 1 
ATOM   6204 C CD2 . HIS B 1 291 ? 16.375  13.867  -14.086 1.00 281.95 ? 315  HIS B CD2 1 
ATOM   6205 C CE1 . HIS B 1 291 ? 16.031  11.953  -13.073 1.00 281.95 ? 315  HIS B CE1 1 
ATOM   6206 N NE2 . HIS B 1 291 ? 16.822  12.578  -13.926 1.00 281.95 ? 315  HIS B NE2 1 
ATOM   6207 N N   . VAL B 1 292 ? 13.958  13.806  -10.219 1.00 335.52 ? 316  VAL B N   1 
ATOM   6208 C CA  . VAL B 1 292 ? 13.137  12.975  -9.329  1.00 335.52 ? 316  VAL B CA  1 
ATOM   6209 C C   . VAL B 1 292 ? 12.684  13.800  -8.128  1.00 335.52 ? 316  VAL B C   1 
ATOM   6210 O O   . VAL B 1 292 ? 11.770  13.415  -7.397  1.00 335.52 ? 316  VAL B O   1 
ATOM   6211 C CB  . VAL B 1 292 ? 13.916  11.724  -8.819  1.00 163.57 ? 316  VAL B CB  1 
ATOM   6212 C CG1 . VAL B 1 292 ? 13.030  10.879  -7.899  1.00 163.57 ? 316  VAL B CG1 1 
ATOM   6213 C CG2 . VAL B 1 292 ? 14.377  10.885  -9.997  1.00 163.57 ? 316  VAL B CG2 1 
ATOM   6214 N N   . ALA B 1 293 ? 13.330  14.945  -7.940  1.00 161.21 ? 317  ALA B N   1 
ATOM   6215 C CA  . ALA B 1 293 ? 13.005  15.832  -6.838  1.00 161.21 ? 317  ALA B CA  1 
ATOM   6216 C C   . ALA B 1 293 ? 12.352  17.108  -7.353  1.00 161.21 ? 317  ALA B C   1 
ATOM   6217 O O   . ALA B 1 293 ? 11.862  17.915  -6.566  1.00 161.21 ? 317  ALA B O   1 
ATOM   6218 C CB  . ALA B 1 293 ? 14.264  16.168  -6.053  1.00 210.13 ? 317  ALA B CB  1 
ATOM   6219 N N   . TYR B 1 294 ? 12.344  17.287  -8.672  1.00 182.25 ? 318  TYR B N   1 
ATOM   6220 C CA  . TYR B 1 294 ? 11.747  18.472  -9.289  1.00 182.25 ? 318  TYR B CA  1 
ATOM   6221 C C   . TYR B 1 294 ? 10.345  18.763  -8.737  1.00 182.25 ? 318  TYR B C   1 
ATOM   6222 O O   . TYR B 1 294 ? 9.682   17.884  -8.174  1.00 182.25 ? 318  TYR B O   1 
ATOM   6223 C CB  . TYR B 1 294 ? 11.664  18.292  -10.818 1.00 231.18 ? 318  TYR B CB  1 
ATOM   6224 C CG  . TYR B 1 294 ? 11.004  19.447  -11.563 1.00 231.18 ? 318  TYR B CG  1 
ATOM   6225 C CD1 . TYR B 1 294 ? 11.680  20.651  -11.769 1.00 231.18 ? 318  TYR B CD1 1 
ATOM   6226 C CD2 . TYR B 1 294 ? 9.683   19.351  -12.017 1.00 231.18 ? 318  TYR B CD2 1 
ATOM   6227 C CE1 . TYR B 1 294 ? 11.055  21.733  -12.405 1.00 231.18 ? 318  TYR B CE1 1 
ATOM   6228 C CE2 . TYR B 1 294 ? 9.050   20.428  -12.651 1.00 231.18 ? 318  TYR B CE2 1 
ATOM   6229 C CZ  . TYR B 1 294 ? 9.741   21.614  -12.838 1.00 231.18 ? 318  TYR B CZ  1 
ATOM   6230 O OH  . TYR B 1 294 ? 9.113   22.688  -13.430 1.00 231.18 ? 318  TYR B OH  1 
ATOM   6231 N N   . GLY B 1 295 ? 9.918   20.014  -8.899  1.00 146.17 ? 319  GLY B N   1 
ATOM   6232 C CA  . GLY B 1 295 ? 8.602   20.445  -8.462  1.00 146.17 ? 319  GLY B CA  1 
ATOM   6233 C C   . GLY B 1 295 ? 8.222   20.049  -7.058  1.00 146.17 ? 319  GLY B C   1 
ATOM   6234 O O   . GLY B 1 295 ? 7.071   19.694  -6.803  1.00 146.17 ? 319  GLY B O   1 
ATOM   6235 N N   . ALA B 1 296 ? 9.191   20.103  -6.151  1.00 175.74 ? 320  ALA B N   1 
ATOM   6236 C CA  . ALA B 1 296 ? 8.941   19.762  -4.760  1.00 175.74 ? 320  ALA B CA  1 
ATOM   6237 C C   . ALA B 1 296 ? 8.829   21.038  -3.943  1.00 175.74 ? 320  ALA B C   1 
ATOM   6238 O O   . ALA B 1 296 ? 9.178   22.127  -4.409  1.00 175.74 ? 320  ALA B O   1 
ATOM   6239 C CB  . ALA B 1 296 ? 10.061  18.880  -4.209  1.00 97.17  ? 320  ALA B CB  1 
ATOM   6240 N N   . ILE B 1 297 ? 8.329   20.885  -2.722  1.00 198.50 ? 321  ILE B N   1 
ATOM   6241 C CA  . ILE B 1 297 ? 8.150   21.996  -1.801  1.00 198.50 ? 321  ILE B CA  1 
ATOM   6242 C C   . ILE B 1 297 ? 8.833   21.692  -0.473  1.00 198.50 ? 321  ILE B C   1 
ATOM   6243 O O   . ILE B 1 297 ? 8.506   20.717  0.204   1.00 198.50 ? 321  ILE B O   1 
ATOM   6244 C CB  . ILE B 1 297 ? 6.645   22.283  -1.564  1.00 171.35 ? 321  ILE B CB  1 
ATOM   6245 C CG1 . ILE B 1 297 ? 6.073   23.032  -2.772  1.00 171.35 ? 321  ILE B CG1 1 
ATOM   6246 C CG2 . ILE B 1 297 ? 6.449   23.094  -0.285  1.00 171.35 ? 321  ILE B CG2 1 
ATOM   6247 C CD1 . ILE B 1 297 ? 4.606   23.379  -2.647  1.00 171.35 ? 321  ILE B CD1 1 
ATOM   6248 N N   . THR B 1 298 ? 9.792   22.538  -0.115  1.00 196.50 ? 322  THR B N   1 
ATOM   6249 C CA  . THR B 1 298 ? 10.545  22.375  1.117   1.00 196.50 ? 322  THR B CA  1 
ATOM   6250 C C   . THR B 1 298 ? 10.555  23.668  1.921   1.00 196.50 ? 322  THR B C   1 
ATOM   6251 O O   . THR B 1 298 ? 10.608  24.762  1.359   1.00 196.50 ? 322  THR B O   1 
ATOM   6252 C CB  . THR B 1 298 ? 12.004  21.953  0.816   1.00 117.21 ? 322  THR B CB  1 
ATOM   6253 O OG1 . THR B 1 298 ? 12.586  22.862  -0.132  1.00 117.21 ? 322  THR B OG1 1 
ATOM   6254 C CG2 . THR B 1 298 ? 12.045  20.540  0.246   1.00 117.21 ? 322  THR B CG2 1 
ATOM   6255 N N   . LEU B 1 299 ? 10.501  23.533  3.240   1.00 150.90 ? 323  LEU B N   1 
ATOM   6256 C CA  . LEU B 1 299 ? 10.508  24.689  4.127   1.00 150.90 ? 323  LEU B CA  1 
ATOM   6257 C C   . LEU B 1 299 ? 11.892  24.940  4.731   1.00 150.90 ? 323  LEU B C   1 
ATOM   6258 O O   . LEU B 1 299 ? 12.722  24.033  4.817   1.00 150.90 ? 323  LEU B O   1 
ATOM   6259 C CB  . LEU B 1 299 ? 9.496   24.486  5.263   1.00 116.68 ? 323  LEU B CB  1 
ATOM   6260 C CG  . LEU B 1 299 ? 7.996   24.543  4.964   1.00 116.68 ? 323  LEU B CG  1 
ATOM   6261 C CD1 . LEU B 1 299 ? 7.193   24.243  6.229   1.00 116.68 ? 323  LEU B CD1 1 
ATOM   6262 C CD2 . LEU B 1 299 ? 7.650   25.921  4.428   1.00 116.68 ? 323  LEU B CD2 1 
ATOM   6263 N N   . GLU B 1 300 ? 12.127  26.184  5.140   1.00 172.89 ? 324  GLU B N   1 
ATOM   6264 C CA  . GLU B 1 300 ? 13.380  26.579  5.773   1.00 172.89 ? 324  GLU B CA  1 
ATOM   6265 C C   . GLU B 1 300 ? 13.055  27.682  6.774   1.00 172.89 ? 324  GLU B C   1 
ATOM   6266 O O   . GLU B 1 300 ? 11.949  28.224  6.767   1.00 172.89 ? 324  GLU B O   1 
ATOM   6267 C CB  . GLU B 1 300 ? 14.384  27.097  4.739   1.00 137.88 ? 324  GLU B CB  1 
ATOM   6268 C CG  . GLU B 1 300 ? 15.721  27.512  5.349   1.00 137.88 ? 324  GLU B CG  1 
ATOM   6269 C CD  . GLU B 1 300 ? 16.446  26.360  6.034   1.00 137.88 ? 324  GLU B CD  1 
ATOM   6270 O OE1 . GLU B 1 300 ? 17.156  25.589  5.345   1.00 137.88 ? 324  GLU B OE1 1 
ATOM   6271 O OE2 . GLU B 1 300 ? 16.296  26.227  7.267   1.00 137.88 ? 324  GLU B OE2 1 
ATOM   6272 N N   . LEU B 1 301 ? 14.002  28.011  7.642   1.00 130.20 ? 325  LEU B N   1 
ATOM   6273 C CA  . LEU B 1 301 ? 13.756  29.058  8.622   1.00 130.20 ? 325  LEU B CA  1 
ATOM   6274 C C   . LEU B 1 301 ? 13.948  30.436  7.996   1.00 130.20 ? 325  LEU B C   1 
ATOM   6275 O O   . LEU B 1 301 ? 14.734  30.594  7.055   1.00 130.20 ? 325  LEU B O   1 
ATOM   6276 C CB  . LEU B 1 301 ? 14.691  28.891  9.822   1.00 172.05 ? 325  LEU B CB  1 
ATOM   6277 C CG  . LEU B 1 301 ? 14.544  27.581  10.600  1.00 172.05 ? 325  LEU B CG  1 
ATOM   6278 C CD1 . LEU B 1 301 ? 15.365  27.641  11.871  1.00 172.05 ? 325  LEU B CD1 1 
ATOM   6279 C CD2 . LEU B 1 301 ? 13.090  27.358  10.943  1.00 172.05 ? 325  LEU B CD2 1 
ATOM   6280 N N   . ALA B 1 302 ? 13.225  31.427  8.523   1.00 129.96 ? 326  ALA B N   1 
ATOM   6281 C CA  . ALA B 1 302 ? 13.302  32.804  8.031   1.00 129.96 ? 326  ALA B CA  1 
ATOM   6282 C C   . ALA B 1 302 ? 14.591  33.474  8.468   1.00 129.96 ? 326  ALA B C   1 
ATOM   6283 O O   . ALA B 1 302 ? 14.756  33.798  9.643   1.00 129.96 ? 326  ALA B O   1 
ATOM   6284 C CB  . ALA B 1 302 ? 12.124  33.605  8.539   1.00 93.83  ? 326  ALA B CB  1 
ATOM   6285 N N   . SER B 1 303 ? 15.497  33.694  7.524   1.00 139.47 ? 327  SER B N   1 
ATOM   6286 C CA  . SER B 1 303 ? 16.770  34.319  7.843   1.00 139.47 ? 327  SER B CA  1 
ATOM   6287 C C   . SER B 1 303 ? 17.279  35.167  6.691   1.00 139.47 ? 327  SER B C   1 
ATOM   6288 O O   . SER B 1 303 ? 17.062  34.842  5.531   1.00 139.47 ? 327  SER B O   1 
ATOM   6289 C CB  . SER B 1 303 ? 17.811  33.248  8.173   1.00 117.56 ? 327  SER B CB  1 
ATOM   6290 O OG  . SER B 1 303 ? 18.096  32.452  7.036   1.00 117.56 ? 327  SER B OG  1 
ATOM   6291 N N   . HIS B 1 304 ? 17.961  36.256  7.025   1.00 131.62 ? 328  HIS B N   1 
ATOM   6292 C CA  . HIS B 1 304 ? 18.523  37.161  6.029   1.00 131.62 ? 328  HIS B CA  1 
ATOM   6293 C C   . HIS B 1 304 ? 20.046  37.059  6.097   1.00 131.62 ? 328  HIS B C   1 
ATOM   6294 O O   . HIS B 1 304 ? 20.651  37.410  7.113   1.00 131.62 ? 328  HIS B O   1 
ATOM   6295 C CB  . HIS B 1 304 ? 18.096  38.598  6.327   1.00 264.52 ? 328  HIS B CB  1 
ATOM   6296 C CG  . HIS B 1 304 ? 16.625  38.758  6.554   1.00 264.52 ? 328  HIS B CG  1 
ATOM   6297 N ND1 . HIS B 1 304 ? 16.057  39.960  6.918   1.00 264.52 ? 328  HIS B ND1 1 
ATOM   6298 C CD2 . HIS B 1 304 ? 15.605  37.869  6.476   1.00 264.52 ? 328  HIS B CD2 1 
ATOM   6299 C CE1 . HIS B 1 304 ? 14.752  39.805  7.056   1.00 264.52 ? 328  HIS B CE1 1 
ATOM   6300 N NE2 . HIS B 1 304 ? 14.452  38.545  6.793   1.00 264.52 ? 328  HIS B NE2 1 
ATOM   6301 N N   . PRO B 1 305 ? 20.686  36.588  5.012   1.00 140.17 ? 329  PRO B N   1 
ATOM   6302 C CA  . PRO B 1 305 ? 22.146  36.426  4.922   1.00 140.17 ? 329  PRO B CA  1 
ATOM   6303 C C   . PRO B 1 305 ? 22.998  37.511  5.596   1.00 140.17 ? 329  PRO B C   1 
ATOM   6304 O O   . PRO B 1 305 ? 22.680  38.703  5.545   1.00 140.17 ? 329  PRO B O   1 
ATOM   6305 C CB  . PRO B 1 305 ? 22.395  36.333  3.411   1.00 240.28 ? 329  PRO B CB  1 
ATOM   6306 C CG  . PRO B 1 305 ? 21.160  36.959  2.798   1.00 240.28 ? 329  PRO B CG  1 
ATOM   6307 C CD  . PRO B 1 305 ? 20.073  36.436  3.684   1.00 240.28 ? 329  PRO B CD  1 
ATOM   6308 N N   . VAL B 1 306 ? 24.084  37.082  6.230   1.00 144.19 ? 330  VAL B N   1 
ATOM   6309 C CA  . VAL B 1 306 ? 24.983  37.998  6.920   1.00 144.19 ? 330  VAL B CA  1 
ATOM   6310 C C   . VAL B 1 306 ? 26.039  38.513  5.963   1.00 144.19 ? 330  VAL B C   1 
ATOM   6311 O O   . VAL B 1 306 ? 27.042  37.845  5.711   1.00 144.19 ? 330  VAL B O   1 
ATOM   6312 C CB  . VAL B 1 306 ? 25.689  37.310  8.100   1.00 206.50 ? 330  VAL B CB  1 
ATOM   6313 C CG1 . VAL B 1 306 ? 26.722  38.246  8.705   1.00 206.50 ? 330  VAL B CG1 1 
ATOM   6314 C CG2 . VAL B 1 306 ? 24.666  36.905  9.147   1.00 206.50 ? 330  VAL B CG2 1 
ATOM   6315 N N   . ARG B 1 307 ? 25.806  39.712  5.444   1.00 158.65 ? 331  ARG B N   1 
ATOM   6316 C CA  . ARG B 1 307 ? 26.715  40.333  4.495   1.00 158.65 ? 331  ARG B CA  1 
ATOM   6317 C C   . ARG B 1 307 ? 28.213  40.116  4.751   1.00 158.65 ? 331  ARG B C   1 
ATOM   6318 O O   . ARG B 1 307 ? 28.916  39.510  3.930   1.00 158.65 ? 331  ARG B O   1 
ATOM   6319 C CB  . ARG B 1 307 ? 26.416  41.835  4.406   1.00 240.32 ? 331  ARG B CB  1 
ATOM   6320 C CG  . ARG B 1 307 ? 25.406  42.210  3.324   1.00 240.32 ? 331  ARG B CG  1 
ATOM   6321 C CD  . ARG B 1 307 ? 26.011  42.025  1.932   1.00 240.32 ? 331  ARG B CD  1 
ATOM   6322 N NE  . ARG B 1 307 ? 25.102  42.424  0.858   1.00 240.32 ? 331  ARG B NE  1 
ATOM   6323 C CZ  . ARG B 1 307 ? 25.434  42.462  -0.432  1.00 240.32 ? 331  ARG B CZ  1 
ATOM   6324 N NH1 . ARG B 1 307 ? 26.658  42.126  -0.816  1.00 240.32 ? 331  ARG B NH1 1 
ATOM   6325 N NH2 . ARG B 1 307 ? 24.541  42.836  -1.341  1.00 240.32 ? 331  ARG B NH2 1 
ATOM   6326 N N   . GLN B 1 308 ? 28.699  40.603  5.886   1.00 118.88 ? 332  GLN B N   1 
ATOM   6327 C CA  . GLN B 1 308 ? 30.116  40.491  6.210   1.00 118.88 ? 332  GLN B CA  1 
ATOM   6328 C C   . GLN B 1 308 ? 30.670  39.068  6.124   1.00 118.88 ? 332  GLN B C   1 
ATOM   6329 O O   . GLN B 1 308 ? 31.755  38.846  5.578   1.00 118.88 ? 332  GLN B O   1 
ATOM   6330 C CB  . GLN B 1 308 ? 30.382  41.102  7.597   1.00 133.05 ? 332  GLN B CB  1 
ATOM   6331 C CG  . GLN B 1 308 ? 30.114  42.622  7.668   1.00 133.05 ? 332  GLN B CG  1 
ATOM   6332 C CD  . GLN B 1 308 ? 28.625  42.997  7.797   1.00 133.05 ? 332  GLN B CD  1 
ATOM   6333 O OE1 . GLN B 1 308 ? 27.741  42.336  7.240   1.00 133.05 ? 332  GLN B OE1 1 
ATOM   6334 N NE2 . GLN B 1 308 ? 28.353  44.081  8.526   1.00 133.05 ? 332  GLN B NE2 1 
ATOM   6335 N N   . PHE B 1 309 ? 29.926  38.103  6.652   1.00 175.82 ? 333  PHE B N   1 
ATOM   6336 C CA  . PHE B 1 309 ? 30.376  36.720  6.613   1.00 175.82 ? 333  PHE B CA  1 
ATOM   6337 C C   . PHE B 1 309 ? 30.736  36.349  5.186   1.00 175.82 ? 333  PHE B C   1 
ATOM   6338 O O   . PHE B 1 309 ? 31.740  35.685  4.943   1.00 175.82 ? 333  PHE B O   1 
ATOM   6339 C CB  . PHE B 1 309 ? 29.286  35.769  7.120   1.00 117.24 ? 333  PHE B CB  1 
ATOM   6340 C CG  . PHE B 1 309 ? 29.700  34.318  7.109   1.00 117.24 ? 333  PHE B CG  1 
ATOM   6341 C CD1 . PHE B 1 309 ? 30.635  33.835  8.024   1.00 117.24 ? 333  PHE B CD1 1 
ATOM   6342 C CD2 . PHE B 1 309 ? 29.203  33.450  6.140   1.00 117.24 ? 333  PHE B CD2 1 
ATOM   6343 C CE1 . PHE B 1 309 ? 31.068  32.514  7.967   1.00 117.24 ? 333  PHE B CE1 1 
ATOM   6344 C CE2 . PHE B 1 309 ? 29.632  32.128  6.076   1.00 117.24 ? 333  PHE B CE2 1 
ATOM   6345 C CZ  . PHE B 1 309 ? 30.565  31.659  6.987   1.00 117.24 ? 333  PHE B CZ  1 
ATOM   6346 N N   . ASP B 1 310 ? 29.910  36.784  4.241   1.00 134.10 ? 334  ASP B N   1 
ATOM   6347 C CA  . ASP B 1 310 ? 30.157  36.478  2.843   1.00 134.10 ? 334  ASP B CA  1 
ATOM   6348 C C   . ASP B 1 310 ? 31.576  36.841  2.453   1.00 134.10 ? 334  ASP B C   1 
ATOM   6349 O O   . ASP B 1 310 ? 32.369  35.974  2.064   1.00 134.10 ? 334  ASP B O   1 
ATOM   6350 C CB  . ASP B 1 310 ? 29.171  37.224  1.942   1.00 190.37 ? 334  ASP B CB  1 
ATOM   6351 C CG  . ASP B 1 310 ? 27.919  36.419  1.658   1.00 190.37 ? 334  ASP B CG  1 
ATOM   6352 O OD1 . ASP B 1 310 ? 28.050  35.252  1.234   1.00 190.37 ? 334  ASP B OD1 1 
ATOM   6353 O OD2 . ASP B 1 310 ? 26.806  36.950  1.847   1.00 190.37 ? 334  ASP B OD2 1 
ATOM   6354 N N   . ARG B 1 311 ? 31.900  38.124  2.567   1.00 153.23 ? 335  ARG B N   1 
ATOM   6355 C CA  . ARG B 1 311 ? 33.232  38.588  2.208   1.00 153.23 ? 335  ARG B CA  1 
ATOM   6356 C C   . ARG B 1 311 ? 34.272  37.790  2.987   1.00 153.23 ? 335  ARG B C   1 
ATOM   6357 O O   . ARG B 1 311 ? 35.310  37.394  2.449   1.00 153.23 ? 335  ARG B O   1 
ATOM   6358 C CB  . ARG B 1 311 ? 33.374  40.084  2.512   1.00 231.86 ? 335  ARG B CB  1 
ATOM   6359 C CG  . ARG B 1 311 ? 34.507  40.760  1.752   1.00 231.86 ? 335  ARG B CG  1 
ATOM   6360 C CD  . ARG B 1 311 ? 35.536  41.366  2.690   1.00 231.86 ? 335  ARG B CD  1 
ATOM   6361 N NE  . ARG B 1 311 ? 34.960  42.392  3.556   1.00 231.86 ? 335  ARG B NE  1 
ATOM   6362 C CZ  . ARG B 1 311 ? 35.657  43.102  4.438   1.00 231.86 ? 335  ARG B CZ  1 
ATOM   6363 N NH1 . ARG B 1 311 ? 36.963  42.901  4.574   1.00 231.86 ? 335  ARG B NH1 1 
ATOM   6364 N NH2 . ARG B 1 311 ? 35.049  44.013  5.184   1.00 231.86 ? 335  ARG B NH2 1 
ATOM   6365 N N   . TYR B 1 312 ? 33.967  37.540  4.254   1.00 197.04 ? 336  TYR B N   1 
ATOM   6366 C CA  . TYR B 1 312 ? 34.864  36.799  5.126   1.00 197.04 ? 336  TYR B CA  1 
ATOM   6367 C C   . TYR B 1 312 ? 35.178  35.389  4.635   1.00 197.04 ? 336  TYR B C   1 
ATOM   6368 O O   . TYR B 1 312 ? 36.341  35.027  4.456   1.00 197.04 ? 336  TYR B O   1 
ATOM   6369 C CB  . TYR B 1 312 ? 34.280  36.724  6.543   1.00 150.38 ? 336  TYR B CB  1 
ATOM   6370 C CG  . TYR B 1 312 ? 34.999  35.727  7.424   1.00 150.38 ? 336  TYR B CG  1 
ATOM   6371 C CD1 . TYR B 1 312 ? 36.380  35.805  7.618   1.00 150.38 ? 336  TYR B CD1 1 
ATOM   6372 C CD2 . TYR B 1 312 ? 34.310  34.676  8.021   1.00 150.38 ? 336  TYR B CD2 1 
ATOM   6373 C CE1 . TYR B 1 312 ? 37.054  34.857  8.379   1.00 150.38 ? 336  TYR B CE1 1 
ATOM   6374 C CE2 . TYR B 1 312 ? 34.975  33.721  8.784   1.00 150.38 ? 336  TYR B CE2 1 
ATOM   6375 C CZ  . TYR B 1 312 ? 36.346  33.816  8.958   1.00 150.38 ? 336  TYR B CZ  1 
ATOM   6376 O OH  . TYR B 1 312 ? 37.004  32.861  9.698   1.00 150.38 ? 336  TYR B OH  1 
ATOM   6377 N N   . PHE B 1 313 ? 34.140  34.592  4.426   1.00 171.24 ? 337  PHE B N   1 
ATOM   6378 C CA  . PHE B 1 313 ? 34.329  33.220  3.983   1.00 171.24 ? 337  PHE B CA  1 
ATOM   6379 C C   . PHE B 1 313 ? 35.030  33.187  2.646   1.00 171.24 ? 337  PHE B C   1 
ATOM   6380 O O   . PHE B 1 313 ? 36.013  32.471  2.482   1.00 171.24 ? 337  PHE B O   1 
ATOM   6381 C CB  . PHE B 1 313 ? 32.981  32.501  3.881   1.00 135.34 ? 337  PHE B CB  1 
ATOM   6382 C CG  . PHE B 1 313 ? 33.092  31.017  3.640   1.00 135.34 ? 337  PHE B CG  1 
ATOM   6383 C CD1 . PHE B 1 313 ? 33.828  30.210  4.492   1.00 135.34 ? 337  PHE B CD1 1 
ATOM   6384 C CD2 . PHE B 1 313 ? 32.430  30.424  2.577   1.00 135.34 ? 337  PHE B CD2 1 
ATOM   6385 C CE1 . PHE B 1 313 ? 33.902  28.833  4.289   1.00 135.34 ? 337  PHE B CE1 1 
ATOM   6386 C CE2 . PHE B 1 313 ? 32.499  29.047  2.369   1.00 135.34 ? 337  PHE B CE2 1 
ATOM   6387 C CZ  . PHE B 1 313 ? 33.236  28.253  3.226   1.00 135.34 ? 337  PHE B CZ  1 
ATOM   6388 N N   . GLN B 1 314 ? 34.531  33.970  1.694   1.00 211.39 ? 338  GLN B N   1 
ATOM   6389 C CA  . GLN B 1 314 ? 35.120  34.007  0.363   1.00 211.39 ? 338  GLN B CA  1 
ATOM   6390 C C   . GLN B 1 314 ? 36.581  34.430  0.381   1.00 211.39 ? 338  GLN B C   1 
ATOM   6391 O O   . GLN B 1 314 ? 37.292  34.251  -0.607  1.00 211.39 ? 338  GLN B O   1 
ATOM   6392 C CB  . GLN B 1 314 ? 34.335  34.948  -0.548  1.00 288.69 ? 338  GLN B CB  1 
ATOM   6393 C CG  . GLN B 1 314 ? 32.884  34.568  -0.726  1.00 288.69 ? 338  GLN B CG  1 
ATOM   6394 C CD  . GLN B 1 314 ? 32.219  35.340  -1.846  1.00 288.69 ? 338  GLN B CD  1 
ATOM   6395 O OE1 . GLN B 1 314 ? 32.559  35.174  -3.017  1.00 288.69 ? 338  GLN B OE1 1 
ATOM   6396 N NE2 . GLN B 1 314 ? 31.268  36.196  -1.492  1.00 288.69 ? 338  GLN B NE2 1 
ATOM   6397 N N   . SER B 1 315 ? 37.030  34.996  1.497   1.00 118.30 ? 339  SER B N   1 
ATOM   6398 C CA  . SER B 1 315 ? 38.417  35.429  1.613   1.00 118.30 ? 339  SER B CA  1 
ATOM   6399 C C   . SER B 1 315 ? 39.324  34.299  2.115   1.00 118.30 ? 339  SER B C   1 
ATOM   6400 O O   . SER B 1 315 ? 40.538  34.475  2.240   1.00 118.30 ? 339  SER B O   1 
ATOM   6401 C CB  . SER B 1 315 ? 38.527  36.608  2.577   1.00 161.50 ? 339  SER B CB  1 
ATOM   6402 O OG  . SER B 1 315 ? 38.535  36.154  3.919   1.00 161.50 ? 339  SER B OG  1 
ATOM   6403 N N   . LEU B 1 316 ? 38.739  33.142  2.402   1.00 120.84 ? 340  LEU B N   1 
ATOM   6404 C CA  . LEU B 1 316 ? 39.500  32.007  2.910   1.00 120.84 ? 340  LEU B CA  1 
ATOM   6405 C C   . LEU B 1 316 ? 40.153  31.163  1.823   1.00 120.84 ? 340  LEU B C   1 
ATOM   6406 O O   . LEU B 1 316 ? 39.682  31.113  0.686   1.00 120.84 ? 340  LEU B O   1 
ATOM   6407 C CB  . LEU B 1 316 ? 38.589  31.118  3.762   1.00 237.78 ? 340  LEU B CB  1 
ATOM   6408 C CG  . LEU B 1 316 ? 38.016  31.742  5.036   1.00 237.78 ? 340  LEU B CG  1 
ATOM   6409 C CD1 . LEU B 1 316 ? 36.913  30.865  5.599   1.00 237.78 ? 340  LEU B CD1 1 
ATOM   6410 C CD2 . LEU B 1 316 ? 39.131  31.921  6.049   1.00 237.78 ? 340  LEU B CD2 1 
ATOM   6411 N N   . ASN B 1 317 ? 41.245  30.504  2.203   1.00 102.74 ? 341  ASN B N   1 
ATOM   6412 C CA  . ASN B 1 317 ? 42.014  29.609  1.331   1.00 102.74 ? 341  ASN B CA  1 
ATOM   6413 C C   . ASN B 1 317 ? 43.065  28.893  2.180   1.00 102.74 ? 341  ASN B C   1 
ATOM   6414 O O   . ASN B 1 317 ? 43.563  29.451  3.154   1.00 102.74 ? 341  ASN B O   1 
ATOM   6415 C CB  . ASN B 1 317 ? 42.706  30.385  0.214   1.00 154.29 ? 341  ASN B CB  1 
ATOM   6416 C CG  . ASN B 1 317 ? 43.735  31.358  0.735   1.00 154.29 ? 341  ASN B CG  1 
ATOM   6417 O OD1 . ASN B 1 317 ? 43.598  32.565  0.552   1.00 154.29 ? 341  ASN B OD1 1 
ATOM   6418 N ND2 . ASN B 1 317 ? 44.773  30.842  1.386   1.00 154.29 ? 341  ASN B ND2 1 
ATOM   6419 N N   . PRO B 1 318 ? 43.440  27.662  1.799   1.00 131.99 ? 342  PRO B N   1 
ATOM   6420 C CA  . PRO B 1 318 ? 44.427  26.831  2.506   1.00 131.99 ? 342  PRO B CA  1 
ATOM   6421 C C   . PRO B 1 318 ? 45.770  27.471  2.837   1.00 131.99 ? 342  PRO B C   1 
ATOM   6422 O O   . PRO B 1 318 ? 46.555  26.905  3.599   1.00 131.99 ? 342  PRO B O   1 
ATOM   6423 C CB  . PRO B 1 318 ? 44.578  25.616  1.594   1.00 113.32 ? 342  PRO B CB  1 
ATOM   6424 C CG  . PRO B 1 318 ? 44.316  26.186  0.237   1.00 113.32 ? 342  PRO B CG  1 
ATOM   6425 C CD  . PRO B 1 318 ? 43.142  27.101  0.472   1.00 113.32 ? 342  PRO B CD  1 
ATOM   6426 N N   . TYR B 1 319 ? 46.033  28.646  2.274   1.00 165.55 ? 343  TYR B N   1 
ATOM   6427 C CA  . TYR B 1 319 ? 47.293  29.326  2.533   1.00 165.55 ? 343  TYR B CA  1 
ATOM   6428 C C   . TYR B 1 319 ? 47.165  30.350  3.654   1.00 165.55 ? 343  TYR B C   1 
ATOM   6429 O O   . TYR B 1 319 ? 48.176  30.799  4.192   1.00 165.55 ? 343  TYR B O   1 
ATOM   6430 C CB  . TYR B 1 319 ? 47.809  30.021  1.267   1.00 350.22 ? 343  TYR B CB  1 
ATOM   6431 C CG  . TYR B 1 319 ? 47.844  29.147  0.030   1.00 350.22 ? 343  TYR B CG  1 
ATOM   6432 C CD1 . TYR B 1 319 ? 46.814  29.199  -0.910  1.00 350.22 ? 343  TYR B CD1 1 
ATOM   6433 C CD2 . TYR B 1 319 ? 48.904  28.270  -0.204  1.00 350.22 ? 343  TYR B CD2 1 
ATOM   6434 C CE1 . TYR B 1 319 ? 46.838  28.402  -2.054  1.00 350.22 ? 343  TYR B CE1 1 
ATOM   6435 C CE2 . TYR B 1 319 ? 48.936  27.465  -1.346  1.00 350.22 ? 343  TYR B CE2 1 
ATOM   6436 C CZ  . TYR B 1 319 ? 47.900  27.538  -2.266  1.00 350.22 ? 343  TYR B CZ  1 
ATOM   6437 O OH  . TYR B 1 319 ? 47.924  26.750  -3.394  1.00 350.22 ? 343  TYR B OH  1 
ATOM   6438 N N   . ASN B 1 320 ? 45.932  30.722  4.003   1.00 161.41 ? 344  ASN B N   1 
ATOM   6439 C CA  . ASN B 1 320 ? 45.709  31.696  5.074   1.00 161.41 ? 344  ASN B CA  1 
ATOM   6440 C C   . ASN B 1 320 ? 44.793  31.220  6.209   1.00 161.41 ? 344  ASN B C   1 
ATOM   6441 O O   . ASN B 1 320 ? 44.660  31.904  7.224   1.00 161.41 ? 344  ASN B O   1 
ATOM   6442 C CB  . ASN B 1 320 ? 45.165  33.018  4.512   1.00 152.40 ? 344  ASN B CB  1 
ATOM   6443 C CG  . ASN B 1 320 ? 43.769  32.887  3.940   1.00 152.40 ? 344  ASN B CG  1 
ATOM   6444 O OD1 . ASN B 1 320 ? 42.927  32.172  4.476   1.00 152.40 ? 344  ASN B OD1 1 
ATOM   6445 N ND2 . ASN B 1 320 ? 43.511  33.600  2.856   1.00 152.40 ? 344  ASN B ND2 1 
ATOM   6446 N N   . ASN B 1 321 ? 44.159  30.061  6.036   1.00 138.64 ? 345  ASN B N   1 
ATOM   6447 C CA  . ASN B 1 321 ? 43.268  29.493  7.057   1.00 138.64 ? 345  ASN B CA  1 
ATOM   6448 C C   . ASN B 1 321 ? 44.004  28.314  7.693   1.00 138.64 ? 345  ASN B C   1 
ATOM   6449 O O   . ASN B 1 321 ? 43.811  27.161  7.297   1.00 138.64 ? 345  ASN B O   1 
ATOM   6450 C CB  . ASN B 1 321 ? 41.967  28.990  6.420   1.00 205.12 ? 345  ASN B CB  1 
ATOM   6451 C CG  . ASN B 1 321 ? 40.833  28.856  7.422   1.00 205.12 ? 345  ASN B CG  1 
ATOM   6452 O OD1 . ASN B 1 321 ? 41.055  28.612  8.608   1.00 205.12 ? 345  ASN B OD1 1 
ATOM   6453 N ND2 . ASN B 1 321 ? 39.604  29.005  6.942   1.00 205.12 ? 345  ASN B ND2 1 
ATOM   6454 N N   . HIS B 1 322 ? 44.847  28.610  8.678   1.00 178.68 ? 346  HIS B N   1 
ATOM   6455 C CA  . HIS B 1 322 ? 45.630  27.575  9.347   1.00 178.68 ? 346  HIS B CA  1 
ATOM   6456 C C   . HIS B 1 322 ? 45.031  27.061  10.657  1.00 178.68 ? 346  HIS B C   1 
ATOM   6457 O O   . HIS B 1 322 ? 45.352  25.957  11.104  1.00 178.68 ? 346  HIS B O   1 
ATOM   6458 C CB  . HIS B 1 322 ? 47.057  28.089  9.591   1.00 257.23 ? 346  HIS B CB  1 
ATOM   6459 C CG  . HIS B 1 322 ? 47.911  28.120  8.358   1.00 257.23 ? 346  HIS B CG  1 
ATOM   6460 N ND1 . HIS B 1 322 ? 48.335  26.974  7.719   1.00 257.23 ? 346  HIS B ND1 1 
ATOM   6461 C CD2 . HIS B 1 322 ? 48.411  29.155  7.642   1.00 257.23 ? 346  HIS B CD2 1 
ATOM   6462 C CE1 . HIS B 1 322 ? 49.060  27.302  6.664   1.00 257.23 ? 346  HIS B CE1 1 
ATOM   6463 N NE2 . HIS B 1 322 ? 49.121  28.619  6.595   1.00 257.23 ? 346  HIS B NE2 1 
ATOM   6464 N N   . ARG B 1 323 ? 44.155  27.855  11.261  1.00 211.47 ? 347  ARG B N   1 
ATOM   6465 C CA  . ARG B 1 323 ? 43.526  27.488  12.525  1.00 211.47 ? 347  ARG B CA  1 
ATOM   6466 C C   . ARG B 1 323 ? 42.393  26.469  12.366  1.00 211.47 ? 347  ARG B C   1 
ATOM   6467 O O   . ARG B 1 323 ? 41.962  25.859  13.343  1.00 211.47 ? 347  ARG B O   1 
ATOM   6468 C CB  . ARG B 1 323 ? 42.993  28.748  13.205  1.00 115.44 ? 347  ARG B CB  1 
ATOM   6469 C CG  . ARG B 1 323 ? 41.929  29.455  12.386  1.00 115.44 ? 347  ARG B CG  1 
ATOM   6470 C CD  . ARG B 1 323 ? 41.492  30.751  13.023  1.00 115.44 ? 347  ARG B CD  1 
ATOM   6471 N NE  . ARG B 1 323 ? 40.305  31.280  12.361  1.00 115.44 ? 347  ARG B NE  1 
ATOM   6472 C CZ  . ARG B 1 323 ? 39.761  32.462  12.632  1.00 115.44 ? 347  ARG B CZ  1 
ATOM   6473 N NH1 . ARG B 1 323 ? 40.301  33.249  13.554  1.00 115.44 ? 347  ARG B NH1 1 
ATOM   6474 N NH2 . ARG B 1 323 ? 38.670  32.852  11.987  1.00 115.44 ? 347  ARG B NH2 1 
ATOM   6475 N N   . ASN B 1 324 ? 41.911  26.297  11.139  1.00 102.84 ? 348  ASN B N   1 
ATOM   6476 C CA  . ASN B 1 324 ? 40.834  25.349  10.854  1.00 102.84 ? 348  ASN B CA  1 
ATOM   6477 C C   . ASN B 1 324 ? 41.414  24.060  10.267  1.00 102.84 ? 348  ASN B C   1 
ATOM   6478 O O   . ASN B 1 324 ? 41.512  23.902  9.050   1.00 102.84 ? 348  ASN B O   1 
ATOM   6479 C CB  . ASN B 1 324 ? 39.842  25.955  9.863   1.00 87.68  ? 348  ASN B CB  1 
ATOM   6480 C CG  . ASN B 1 324 ? 38.741  24.991  9.482   1.00 87.68  ? 348  ASN B CG  1 
ATOM   6481 O OD1 . ASN B 1 324 ? 38.871  23.778  9.663   1.00 87.68  ? 348  ASN B OD1 1 
ATOM   6482 N ND2 . ASN B 1 324 ? 37.652  25.524  8.938   1.00 87.68  ? 348  ASN B ND2 1 
ATOM   6483 N N   . PRO B 1 325 ? 41.776  23.107  11.134  1.00 116.31 ? 349  PRO B N   1 
ATOM   6484 C CA  . PRO B 1 325 ? 42.354  21.822  10.735  1.00 116.31 ? 349  PRO B CA  1 
ATOM   6485 C C   . PRO B 1 325 ? 41.584  21.067  9.654   1.00 116.31 ? 349  PRO B C   1 
ATOM   6486 O O   . PRO B 1 325 ? 42.157  20.251  8.937   1.00 116.31 ? 349  PRO B O   1 
ATOM   6487 C CB  . PRO B 1 325 ? 42.406  21.053  12.053  1.00 166.04 ? 349  PRO B CB  1 
ATOM   6488 C CG  . PRO B 1 325 ? 41.226  21.596  12.797  1.00 166.04 ? 349  PRO B CG  1 
ATOM   6489 C CD  . PRO B 1 325 ? 41.362  23.072  12.547  1.00 166.04 ? 349  PRO B CD  1 
ATOM   6490 N N   . TRP B 1 326 ? 40.291  21.344  9.535   1.00 118.46 ? 350  TRP B N   1 
ATOM   6491 C CA  . TRP B 1 326 ? 39.455  20.664  8.554   1.00 118.46 ? 350  TRP B CA  1 
ATOM   6492 C C   . TRP B 1 326 ? 39.452  21.342  7.196   1.00 118.46 ? 350  TRP B C   1 
ATOM   6493 O O   . TRP B 1 326 ? 39.071  20.726  6.202   1.00 118.46 ? 350  TRP B O   1 
ATOM   6494 C CB  . TRP B 1 326 ? 38.013  20.581  9.058   1.00 114.75 ? 350  TRP B CB  1 
ATOM   6495 C CG  . TRP B 1 326 ? 37.871  19.839  10.342  1.00 114.75 ? 350  TRP B CG  1 
ATOM   6496 C CD1 . TRP B 1 326 ? 37.902  18.487  10.518  1.00 114.75 ? 350  TRP B CD1 1 
ATOM   6497 C CD2 . TRP B 1 326 ? 37.735  20.409  11.643  1.00 114.75 ? 350  TRP B CD2 1 
ATOM   6498 N NE1 . TRP B 1 326 ? 37.795  18.178  11.852  1.00 114.75 ? 350  TRP B NE1 1 
ATOM   6499 C CE2 . TRP B 1 326 ? 37.691  19.343  12.567  1.00 114.75 ? 350  TRP B CE2 1 
ATOM   6500 C CE3 . TRP B 1 326 ? 37.649  21.724  12.124  1.00 114.75 ? 350  TRP B CE3 1 
ATOM   6501 C CZ2 . TRP B 1 326 ? 37.568  19.546  13.939  1.00 114.75 ? 350  TRP B CZ2 1 
ATOM   6502 C CZ3 . TRP B 1 326 ? 37.529  21.926  13.489  1.00 114.75 ? 350  TRP B CZ3 1 
ATOM   6503 C CH2 . TRP B 1 326 ? 37.488  20.843  14.380  1.00 114.75 ? 350  TRP B CH2 1 
ATOM   6504 N N   . PHE B 1 327 ? 39.891  22.598  7.148   1.00 132.04 ? 351  PHE B N   1 
ATOM   6505 C CA  . PHE B 1 327 ? 39.883  23.366  5.903   1.00 132.04 ? 351  PHE B CA  1 
ATOM   6506 C C   . PHE B 1 327 ? 40.512  22.710  4.679   1.00 132.04 ? 351  PHE B C   1 
ATOM   6507 O O   . PHE B 1 327 ? 39.940  22.750  3.585   1.00 132.04 ? 351  PHE B O   1 
ATOM   6508 C CB  . PHE B 1 327 ? 40.534  24.728  6.106   1.00 140.14 ? 351  PHE B CB  1 
ATOM   6509 C CG  . PHE B 1 327 ? 39.991  25.772  5.193   1.00 140.14 ? 351  PHE B CG  1 
ATOM   6510 C CD1 . PHE B 1 327 ? 38.699  26.245  5.366   1.00 140.14 ? 351  PHE B CD1 1 
ATOM   6511 C CD2 . PHE B 1 327 ? 40.734  26.240  4.126   1.00 140.14 ? 351  PHE B CD2 1 
ATOM   6512 C CE1 . PHE B 1 327 ? 38.153  27.168  4.489   1.00 140.14 ? 351  PHE B CE1 1 
ATOM   6513 C CE2 . PHE B 1 327 ? 40.193  27.165  3.241   1.00 140.14 ? 351  PHE B CE2 1 
ATOM   6514 C CZ  . PHE B 1 327 ? 38.901  27.628  3.424   1.00 140.14 ? 351  PHE B CZ  1 
ATOM   6515 N N   . ARG B 1 328 ? 41.691  22.125  4.862   1.00 139.27 ? 352  ARG B N   1 
ATOM   6516 C CA  . ARG B 1 328 ? 42.387  21.464  3.768   1.00 139.27 ? 352  ARG B CA  1 
ATOM   6517 C C   . ARG B 1 328 ? 41.486  20.402  3.164   1.00 139.27 ? 352  ARG B C   1 
ATOM   6518 O O   . ARG B 1 328 ? 41.162  20.458  1.977   1.00 139.27 ? 352  ARG B O   1 
ATOM   6519 C CB  . ARG B 1 328 ? 43.684  20.827  4.270   1.00 221.20 ? 352  ARG B CB  1 
ATOM   6520 C CG  . ARG B 1 328 ? 44.621  21.816  4.955   1.00 221.20 ? 352  ARG B CG  1 
ATOM   6521 C CD  . ARG B 1 328 ? 45.945  21.171  5.332   1.00 221.20 ? 352  ARG B CD  1 
ATOM   6522 N NE  . ARG B 1 328 ? 46.757  20.840  4.164   1.00 221.20 ? 352  ARG B NE  1 
ATOM   6523 C CZ  . ARG B 1 328 ? 47.326  21.738  3.365   1.00 221.20 ? 352  ARG B CZ  1 
ATOM   6524 N NH1 . ARG B 1 328 ? 47.179  23.036  3.598   1.00 221.20 ? 352  ARG B NH1 1 
ATOM   6525 N NH2 . ARG B 1 328 ? 48.049  21.334  2.331   1.00 221.20 ? 352  ARG B NH2 1 
ATOM   6526 N N   . ASP B 1 329 ? 41.082  19.441  3.991   1.00 114.05 ? 353  ASP B N   1 
ATOM   6527 C CA  . ASP B 1 329 ? 40.202  18.364  3.550   1.00 114.05 ? 353  ASP B CA  1 
ATOM   6528 C C   . ASP B 1 329 ? 38.954  18.918  2.860   1.00 114.05 ? 353  ASP B C   1 
ATOM   6529 O O   . ASP B 1 329 ? 38.425  18.318  1.923   1.00 114.05 ? 353  ASP B O   1 
ATOM   6530 C CB  . ASP B 1 329 ? 39.813  17.502  4.746   1.00 202.30 ? 353  ASP B CB  1 
ATOM   6531 C CG  . ASP B 1 329 ? 40.995  16.757  5.321   1.00 202.30 ? 353  ASP B CG  1 
ATOM   6532 O OD1 . ASP B 1 329 ? 41.269  15.626  4.866   1.00 202.30 ? 353  ASP B OD1 1 
ATOM   6533 O OD2 . ASP B 1 329 ? 41.666  17.312  6.213   1.00 202.30 ? 353  ASP B OD2 1 
ATOM   6534 N N   . PHE B 1 330 ? 38.486  20.065  3.332   1.00 161.25 ? 354  PHE B N   1 
ATOM   6535 C CA  . PHE B 1 330 ? 37.325  20.713  2.744   1.00 161.25 ? 354  PHE B CA  1 
ATOM   6536 C C   . PHE B 1 330 ? 37.726  21.239  1.385   1.00 161.25 ? 354  PHE B C   1 
ATOM   6537 O O   . PHE B 1 330 ? 36.996  21.089  0.406   1.00 161.25 ? 354  PHE B O   1 
ATOM   6538 C CB  . PHE B 1 330 ? 36.895  21.883  3.604   1.00 107.82 ? 354  PHE B CB  1 
ATOM   6539 C CG  . PHE B 1 330 ? 36.132  22.938  2.862   1.00 107.82 ? 354  PHE B CG  1 
ATOM   6540 C CD1 . PHE B 1 330 ? 34.888  22.660  2.311   1.00 107.82 ? 354  PHE B CD1 1 
ATOM   6541 C CD2 . PHE B 1 330 ? 36.633  24.232  2.770   1.00 107.82 ? 354  PHE B CD2 1 
ATOM   6542 C CE1 . PHE B 1 330 ? 34.148  23.664  1.685   1.00 107.82 ? 354  PHE B CE1 1 
ATOM   6543 C CE2 . PHE B 1 330 ? 35.898  25.242  2.145   1.00 107.82 ? 354  PHE B CE2 1 
ATOM   6544 C CZ  . PHE B 1 330 ? 34.654  24.961  1.604   1.00 107.82 ? 354  PHE B CZ  1 
ATOM   6545 N N   . TRP B 1 331 ? 38.892  21.873  1.342   1.00 146.37 ? 355  TRP B N   1 
ATOM   6546 C CA  . TRP B 1 331 ? 39.407  22.438  0.104   1.00 146.37 ? 355  TRP B CA  1 
ATOM   6547 C C   . TRP B 1 331 ? 39.593  21.348  -0.950  1.00 146.37 ? 355  TRP B C   1 
ATOM   6548 O O   . TRP B 1 331 ? 39.036  21.437  -2.043  1.00 146.37 ? 355  TRP B O   1 
ATOM   6549 C CB  . TRP B 1 331 ? 40.728  23.166  0.371   1.00 159.06 ? 355  TRP B CB  1 
ATOM   6550 C CG  . TRP B 1 331 ? 41.134  24.105  -0.730  1.00 159.06 ? 355  TRP B CG  1 
ATOM   6551 C CD1 . TRP B 1 331 ? 41.912  23.811  -1.806  1.00 159.06 ? 355  TRP B CD1 1 
ATOM   6552 C CD2 . TRP B 1 331 ? 40.779  25.491  -0.859  1.00 159.06 ? 355  TRP B CD2 1 
ATOM   6553 N NE1 . TRP B 1 331 ? 42.070  24.924  -2.596  1.00 159.06 ? 355  TRP B NE1 1 
ATOM   6554 C CE2 . TRP B 1 331 ? 41.383  25.971  -2.036  1.00 159.06 ? 355  TRP B CE2 1 
ATOM   6555 C CE3 . TRP B 1 331 ? 40.007  26.376  -0.091  1.00 159.06 ? 355  TRP B CE3 1 
ATOM   6556 C CZ2 . TRP B 1 331 ? 41.245  27.296  -2.467  1.00 159.06 ? 355  TRP B CZ2 1 
ATOM   6557 C CZ3 . TRP B 1 331 ? 39.870  27.696  -0.520  1.00 159.06 ? 355  TRP B CZ3 1 
ATOM   6558 C CH2 . TRP B 1 331 ? 40.486  28.139  -1.695  1.00 159.06 ? 355  TRP B CH2 1 
ATOM   6559 N N   . GLU B 1 332 ? 40.363  20.316  -0.618  1.00 134.78 ? 356  GLU B N   1 
ATOM   6560 C CA  . GLU B 1 332 ? 40.594  19.213  -1.546  1.00 134.78 ? 356  GLU B CA  1 
ATOM   6561 C C   . GLU B 1 332 ? 39.302  18.562  -2.026  1.00 134.78 ? 356  GLU B C   1 
ATOM   6562 O O   . GLU B 1 332 ? 39.211  18.110  -3.162  1.00 134.78 ? 356  GLU B O   1 
ATOM   6563 C CB  . GLU B 1 332 ? 41.458  18.135  -0.898  1.00 146.58 ? 356  GLU B CB  1 
ATOM   6564 C CG  . GLU B 1 332 ? 42.924  18.478  -0.799  1.00 146.58 ? 356  GLU B CG  1 
ATOM   6565 C CD  . GLU B 1 332 ? 43.701  17.436  -0.027  1.00 146.58 ? 356  GLU B CD  1 
ATOM   6566 O OE1 . GLU B 1 332 ? 44.945  17.545  0.042   1.00 146.58 ? 356  GLU B OE1 1 
ATOM   6567 O OE2 . GLU B 1 332 ? 43.062  16.509  0.515   1.00 146.58 ? 356  GLU B OE2 1 
ATOM   6568 N N   . GLN B 1 333 ? 38.304  18.500  -1.155  1.00 153.85 ? 357  GLN B N   1 
ATOM   6569 C CA  . GLN B 1 333 ? 37.037  17.881  -1.515  1.00 153.85 ? 357  GLN B CA  1 
ATOM   6570 C C   . GLN B 1 333 ? 36.160  18.782  -2.384  1.00 153.85 ? 357  GLN B C   1 
ATOM   6571 O O   . GLN B 1 333 ? 35.534  18.313  -3.336  1.00 153.85 ? 357  GLN B O   1 
ATOM   6572 C CB  . GLN B 1 333 ? 36.275  17.481  -0.247  1.00 186.39 ? 357  GLN B CB  1 
ATOM   6573 C CG  . GLN B 1 333 ? 34.909  16.869  -0.507  1.00 186.39 ? 357  GLN B CG  1 
ATOM   6574 C CD  . GLN B 1 333 ? 34.181  16.514  0.770   1.00 186.39 ? 357  GLN B CD  1 
ATOM   6575 O OE1 . GLN B 1 333 ? 34.636  15.670  1.543   1.00 186.39 ? 357  GLN B OE1 1 
ATOM   6576 N NE2 . GLN B 1 333 ? 33.041  17.161  1.002   1.00 186.39 ? 357  GLN B NE2 1 
ATOM   6577 N N   . LYS B 1 334 ? 36.118  20.071  -2.059  1.00 157.07 ? 358  LYS B N   1 
ATOM   6578 C CA  . LYS B 1 334 ? 35.301  21.015  -2.809  1.00 157.07 ? 358  LYS B CA  1 
ATOM   6579 C C   . LYS B 1 334 ? 35.808  21.227  -4.229  1.00 157.07 ? 358  LYS B C   1 
ATOM   6580 O O   . LYS B 1 334 ? 35.024  21.297  -5.174  1.00 157.07 ? 358  LYS B O   1 
ATOM   6581 C CB  . LYS B 1 334 ? 35.262  22.369  -2.102  1.00 104.11 ? 358  LYS B CB  1 
ATOM   6582 C CG  . LYS B 1 334 ? 34.329  23.366  -2.771  1.00 104.11 ? 358  LYS B CG  1 
ATOM   6583 C CD  . LYS B 1 334 ? 34.574  24.779  -2.270  1.00 104.11 ? 358  LYS B CD  1 
ATOM   6584 C CE  . LYS B 1 334 ? 33.498  25.761  -2.755  1.00 104.11 ? 358  LYS B CE  1 
ATOM   6585 N NZ  . LYS B 1 334 ? 32.204  25.670  -1.999  1.00 104.11 ? 358  LYS B NZ  1 
ATOM   6586 N N   . PHE B 1 335 ? 37.124  21.324  -4.374  1.00 202.83 ? 359  PHE B N   1 
ATOM   6587 C CA  . PHE B 1 335 ? 37.732  21.570  -5.675  1.00 202.83 ? 359  PHE B CA  1 
ATOM   6588 C C   . PHE B 1 335 ? 38.235  20.335  -6.415  1.00 202.83 ? 359  PHE B C   1 
ATOM   6589 O O   . PHE B 1 335 ? 38.786  20.451  -7.510  1.00 202.83 ? 359  PHE B O   1 
ATOM   6590 C CB  . PHE B 1 335 ? 38.874  22.574  -5.506  1.00 214.77 ? 359  PHE B CB  1 
ATOM   6591 C CG  . PHE B 1 335 ? 38.428  23.903  -4.961  1.00 214.77 ? 359  PHE B CG  1 
ATOM   6592 C CD1 . PHE B 1 335 ? 39.021  24.442  -3.825  1.00 214.77 ? 359  PHE B CD1 1 
ATOM   6593 C CD2 . PHE B 1 335 ? 37.404  24.613  -5.585  1.00 214.77 ? 359  PHE B CD2 1 
ATOM   6594 C CE1 . PHE B 1 335 ? 38.597  25.670  -3.319  1.00 214.77 ? 359  PHE B CE1 1 
ATOM   6595 C CE2 . PHE B 1 335 ? 36.976  25.842  -5.085  1.00 214.77 ? 359  PHE B CE2 1 
ATOM   6596 C CZ  . PHE B 1 335 ? 37.576  26.370  -3.949  1.00 214.77 ? 359  PHE B CZ  1 
ATOM   6597 N N   . GLN B 1 336 ? 38.040  19.159  -5.827  1.00 187.30 ? 360  GLN B N   1 
ATOM   6598 C CA  . GLN B 1 336 ? 38.489  17.915  -6.444  1.00 187.30 ? 360  GLN B CA  1 
ATOM   6599 C C   . GLN B 1 336 ? 40.015  17.898  -6.462  1.00 187.30 ? 360  GLN B C   1 
ATOM   6600 O O   . GLN B 1 336 ? 40.637  17.104  -7.166  1.00 187.30 ? 360  GLN B O   1 
ATOM   6601 C CB  . GLN B 1 336 ? 37.940  17.807  -7.870  1.00 277.51 ? 360  GLN B CB  1 
ATOM   6602 C CG  . GLN B 1 336 ? 36.420  17.905  -7.960  1.00 277.51 ? 360  GLN B CG  1 
ATOM   6603 C CD  . GLN B 1 336 ? 35.716  16.644  -7.493  1.00 277.51 ? 360  GLN B CD  1 
ATOM   6604 O OE1 . GLN B 1 336 ? 35.932  16.171  -6.376  1.00 277.51 ? 360  GLN B OE1 1 
ATOM   6605 N NE2 . GLN B 1 336 ? 34.862  16.095  -8.350  1.00 277.51 ? 360  GLN B NE2 1 
ATOM   6606 N N   . CYS B 1 337 ? 40.595  18.797  -5.673  1.00 159.14 ? 361  CYS B N   1 
ATOM   6607 C CA  . CYS B 1 337 ? 42.038  18.954  -5.520  1.00 159.14 ? 361  CYS B CA  1 
ATOM   6608 C C   . CYS B 1 337 ? 42.777  17.672  -5.210  1.00 159.14 ? 361  CYS B C   1 
ATOM   6609 O O   . CYS B 1 337 ? 42.333  16.566  -5.519  1.00 159.14 ? 361  CYS B O   1 
ATOM   6610 C CB  . CYS B 1 337 ? 42.345  19.915  -4.374  1.00 260.43 ? 361  CYS B CB  1 
ATOM   6611 S SG  . CYS B 1 337 ? 42.185  21.673  -4.764  1.00 260.43 ? 361  CYS B SG  1 
ATOM   6612 N N   . SER B 1 338 ? 43.918  17.873  -4.562  1.00 176.47 ? 362  SER B N   1 
ATOM   6613 C CA  . SER B 1 338 ? 44.820  16.824  -4.116  1.00 176.47 ? 362  SER B CA  1 
ATOM   6614 C C   . SER B 1 338 ? 46.058  17.581  -3.676  1.00 176.47 ? 362  SER B C   1 
ATOM   6615 O O   . SER B 1 338 ? 46.373  18.631  -4.238  1.00 176.47 ? 362  SER B O   1 
ATOM   6616 C CB  . SER B 1 338 ? 45.174  15.863  -5.254  1.00 234.79 ? 362  SER B CB  1 
ATOM   6617 O OG  . SER B 1 338 ? 45.903  14.750  -4.761  1.00 234.79 ? 362  SER B OG  1 
ATOM   6618 N N   . LEU B 1 339 ? 46.741  17.069  -2.659  1.00 274.37 ? 363  LEU B N   1 
ATOM   6619 C CA  . LEU B 1 339 ? 47.951  17.703  -2.151  1.00 274.37 ? 363  LEU B CA  1 
ATOM   6620 C C   . LEU B 1 339 ? 48.868  16.655  -1.526  1.00 274.37 ? 363  LEU B C   1 
ATOM   6621 O O   . LEU B 1 339 ? 48.563  15.460  -1.547  1.00 274.37 ? 363  LEU B O   1 
ATOM   6622 C CB  . LEU B 1 339 ? 47.606  18.782  -1.111  1.00 231.52 ? 363  LEU B CB  1 
ATOM   6623 C CG  . LEU B 1 339 ? 47.257  20.221  -1.537  1.00 231.52 ? 363  LEU B CG  1 
ATOM   6624 C CD1 . LEU B 1 339 ? 48.269  20.691  -2.574  1.00 231.52 ? 363  LEU B CD1 1 
ATOM   6625 C CD2 . LEU B 1 339 ? 45.842  20.310  -2.088  1.00 231.52 ? 363  LEU B CD2 1 
ATOM   6626 N N   . GLN B 1 340 ? 49.994  17.103  -0.977  1.00 383.08 ? 364  GLN B N   1 
ATOM   6627 C CA  . GLN B 1 340 ? 50.941  16.192  -0.347  1.00 383.08 ? 364  GLN B CA  1 
ATOM   6628 C C   . GLN B 1 340 ? 50.419  15.734  1.014   1.00 383.08 ? 364  GLN B C   1 
ATOM   6629 O O   . GLN B 1 340 ? 50.732  14.631  1.468   1.00 383.08 ? 364  GLN B O   1 
ATOM   6630 C CB  . GLN B 1 340 ? 52.311  16.863  -0.205  1.00 360.71 ? 364  GLN B CB  1 
ATOM   6631 C CG  . GLN B 1 340 ? 52.953  17.236  -1.539  1.00 360.71 ? 364  GLN B CG  1 
ATOM   6632 C CD  . GLN B 1 340 ? 53.016  16.065  -2.509  1.00 360.71 ? 364  GLN B CD  1 
ATOM   6633 O OE1 . GLN B 1 340 ? 53.613  15.030  -2.213  1.00 360.71 ? 364  GLN B OE1 1 
ATOM   6634 N NE2 . GLN B 1 340 ? 52.398  16.226  -3.674  1.00 360.71 ? 364  GLN B NE2 1 
ATOM   6635 N N   . ASN B 1 341 ? 49.625  16.585  1.660   1.00 331.87 ? 365  ASN B N   1 
ATOM   6636 C CA  . ASN B 1 341 ? 49.031  16.251  2.953   1.00 331.87 ? 365  ASN B CA  1 
ATOM   6637 C C   . ASN B 1 341 ? 47.746  15.471  2.683   1.00 331.87 ? 365  ASN B C   1 
ATOM   6638 O O   . ASN B 1 341 ? 46.728  15.670  3.350   1.00 331.87 ? 365  ASN B O   1 
ATOM   6639 C CB  . ASN B 1 341 ? 48.704  17.520  3.759   1.00 246.47 ? 365  ASN B CB  1 
ATOM   6640 C CG  . ASN B 1 341 ? 49.924  18.117  4.456   1.00 246.47 ? 365  ASN B CG  1 
ATOM   6641 O OD1 . ASN B 1 341 ? 49.796  19.018  5.289   1.00 246.47 ? 365  ASN B OD1 1 
ATOM   6642 N ND2 . ASN B 1 341 ? 51.109  17.620  4.119   1.00 246.47 ? 365  ASN B ND2 1 
ATOM   6643 N N   . LYS B 1 342 ? 47.805  14.584  1.693   1.00 303.37 ? 366  LYS B N   1 
ATOM   6644 C CA  . LYS B 1 342 ? 46.659  13.770  1.303   1.00 303.37 ? 366  LYS B CA  1 
ATOM   6645 C C   . LYS B 1 342 ? 47.079  12.301  1.227   1.00 303.37 ? 366  LYS B C   1 
ATOM   6646 O O   . LYS B 1 342 ? 48.135  11.922  1.736   1.00 303.37 ? 366  LYS B O   1 
ATOM   6647 C CB  . LYS B 1 342 ? 46.138  14.238  -0.063  1.00 277.62 ? 366  LYS B CB  1 
ATOM   6648 C CG  . LYS B 1 342 ? 44.736  13.757  -0.424  1.00 277.62 ? 366  LYS B CG  1 
ATOM   6649 C CD  . LYS B 1 342 ? 44.350  14.191  -1.835  1.00 277.62 ? 366  LYS B CD  1 
ATOM   6650 C CE  . LYS B 1 342 ? 42.891  13.880  -2.136  1.00 277.62 ? 366  LYS B CE  1 
ATOM   6651 N NZ  . LYS B 1 342 ? 42.523  14.198  -3.544  1.00 277.62 ? 366  LYS B NZ  1 
ATOM   6652 N N   . ARG B 1 343 ? 46.245  11.480  0.596   1.00 343.35 ? 367  ARG B N   1 
ATOM   6653 C CA  . ARG B 1 343 ? 46.529  10.056  0.441   1.00 343.35 ? 367  ARG B CA  1 
ATOM   6654 C C   . ARG B 1 343 ? 47.327  9.844   -0.846  1.00 343.35 ? 367  ARG B C   1 
ATOM   6655 O O   . ARG B 1 343 ? 48.549  9.995   -0.862  1.00 343.35 ? 367  ARG B O   1 
ATOM   6656 C CB  . ARG B 1 343 ? 45.222  9.259   0.371   1.00 252.65 ? 367  ARG B CB  1 
ATOM   6657 C CG  . ARG B 1 343 ? 44.275  9.476   1.542   1.00 252.65 ? 367  ARG B CG  1 
ATOM   6658 C CD  . ARG B 1 343 ? 44.786  8.841   2.824   1.00 252.65 ? 367  ARG B CD  1 
ATOM   6659 N NE  . ARG B 1 343 ? 43.842  9.031   3.922   1.00 252.65 ? 367  ARG B NE  1 
ATOM   6660 C CZ  . ARG B 1 343 ? 43.990  8.518   5.139   1.00 252.65 ? 367  ARG B CZ  1 
ATOM   6661 N NH1 . ARG B 1 343 ? 45.049  7.775   5.423   1.00 252.65 ? 367  ARG B NH1 1 
ATOM   6662 N NH2 . ARG B 1 343 ? 43.079  8.749   6.074   1.00 252.65 ? 367  ARG B NH2 1 
ATOM   6663 N N   . ASN B 1 344 ? 46.623  9.498   -1.922  1.00 320.26 ? 368  ASN B N   1 
ATOM   6664 C CA  . ASN B 1 344 ? 47.233  9.264   -3.231  1.00 320.26 ? 368  ASN B CA  1 
ATOM   6665 C C   . ASN B 1 344 ? 46.158  9.381   -4.312  1.00 320.26 ? 368  ASN B C   1 
ATOM   6666 O O   . ASN B 1 344 ? 45.415  8.429   -4.554  1.00 320.26 ? 368  ASN B O   1 
ATOM   6667 C CB  . ASN B 1 344 ? 47.861  7.866   -3.288  1.00 238.14 ? 368  ASN B CB  1 
ATOM   6668 C CG  . ASN B 1 344 ? 48.998  7.693   -2.300  0.00 238.14 ? 368  ASN B CG  1 
ATOM   6669 O OD1 . ASN B 1 344 ? 50.014  8.384   -2.377  0.00 238.14 ? 368  ASN B OD1 1 
ATOM   6670 N ND2 . ASN B 1 344 ? 48.832  6.764   -1.365  0.00 238.14 ? 368  ASN B ND2 1 
ATOM   6671 N N   . HIS B 1 345 ? 46.074  10.540  -4.963  1.00 381.93 ? 369  HIS B N   1 
ATOM   6672 C CA  . HIS B 1 345 ? 45.062  10.743  -5.998  1.00 381.93 ? 369  HIS B CA  1 
ATOM   6673 C C   . HIS B 1 345 ? 45.525  11.456  -7.268  1.00 381.93 ? 369  HIS B C   1 
ATOM   6674 O O   . HIS B 1 345 ? 46.724  11.618  -7.506  1.00 381.93 ? 369  HIS B O   1 
ATOM   6675 C CB  . HIS B 1 345 ? 43.860  11.480  -5.403  1.00 296.81 ? 369  HIS B CB  1 
ATOM   6676 C CG  . HIS B 1 345 ? 43.072  10.656  -4.434  1.00 296.81 ? 369  HIS B CG  1 
ATOM   6677 N ND1 . HIS B 1 345 ? 42.409  9.507   -4.806  1.00 296.81 ? 369  HIS B ND1 1 
ATOM   6678 C CD2 . HIS B 1 345 ? 42.855  10.802  -3.106  1.00 296.81 ? 369  HIS B CD2 1 
ATOM   6679 C CE1 . HIS B 1 345 ? 41.816  8.981   -3.748  1.00 296.81 ? 369  HIS B CE1 1 
ATOM   6680 N NE2 . HIS B 1 345 ? 42.071  9.748   -2.704  1.00 296.81 ? 369  HIS B NE2 1 
ATOM   6681 N N   . ARG B 1 346 ? 44.554  11.878  -8.075  1.00 373.86 ? 370  ARG B N   1 
ATOM   6682 C CA  . ARG B 1 346 ? 44.818  12.549  -9.346  1.00 373.86 ? 370  ARG B CA  1 
ATOM   6683 C C   . ARG B 1 346 ? 44.533  14.055  -9.344  1.00 373.86 ? 370  ARG B C   1 
ATOM   6684 O O   . ARG B 1 346 ? 43.834  14.571  -8.472  1.00 373.86 ? 370  ARG B O   1 
ATOM   6685 C CB  . ARG B 1 346 ? 43.994  11.883  -10.453 1.00 259.48 ? 370  ARG B CB  1 
ATOM   6686 C CG  . ARG B 1 346 ? 44.229  10.379  -10.610 1.00 259.48 ? 370  ARG B CG  1 
ATOM   6687 C CD  . ARG B 1 346 ? 45.635  10.066  -11.122 1.00 259.48 ? 370  ARG B CD  1 
ATOM   6688 N NE  . ARG B 1 346 ? 45.828  8.637   -11.364 1.00 259.48 ? 370  ARG B NE  1 
ATOM   6689 C CZ  . ARG B 1 346 ? 46.929  8.105   -11.886 1.00 259.48 ? 370  ARG B CZ  1 
ATOM   6690 N NH1 . ARG B 1 346 ? 47.949  8.883   -12.226 1.00 259.48 ? 370  ARG B NH1 1 
ATOM   6691 N NH2 . ARG B 1 346 ? 47.010  6.793   -12.072 1.00 259.48 ? 370  ARG B NH2 1 
ATOM   6692 N N   . GLN B 1 347 ? 45.085  14.737  -10.346 1.00 269.26 ? 371  GLN B N   1 
ATOM   6693 C CA  . GLN B 1 347 ? 44.939  16.180  -10.543 1.00 269.26 ? 371  GLN B CA  1 
ATOM   6694 C C   . GLN B 1 347 ? 45.391  17.013  -9.346  1.00 269.26 ? 371  GLN B C   1 
ATOM   6695 O O   . GLN B 1 347 ? 44.720  17.043  -8.316  1.00 269.26 ? 371  GLN B O   1 
ATOM   6696 C CB  . GLN B 1 347 ? 43.483  16.535  -10.890 1.00 194.16 ? 371  GLN B CB  1 
ATOM   6697 C CG  . GLN B 1 347 ? 43.325  17.899  -11.584 1.00 194.16 ? 371  GLN B CG  1 
ATOM   6698 C CD  . GLN B 1 347 ? 41.869  18.314  -11.783 1.00 194.16 ? 371  GLN B CD  1 
ATOM   6699 O OE1 . GLN B 1 347 ? 41.051  17.535  -12.271 1.00 194.16 ? 371  GLN B OE1 1 
ATOM   6700 N NE2 . GLN B 1 347 ? 41.548  19.552  -11.414 1.00 194.16 ? 371  GLN B NE2 1 
ATOM   6701 N N   . VAL B 1 348 ? 46.532  17.685  -9.487  1.00 161.78 ? 372  VAL B N   1 
ATOM   6702 C CA  . VAL B 1 348 ? 47.056  18.543  -8.425  1.00 161.78 ? 372  VAL B CA  1 
ATOM   6703 C C   . VAL B 1 348 ? 46.192  19.809  -8.409  1.00 161.78 ? 372  VAL B C   1 
ATOM   6704 O O   . VAL B 1 348 ? 45.281  19.942  -9.229  1.00 161.78 ? 372  VAL B O   1 
ATOM   6705 C CB  . VAL B 1 348 ? 48.537  18.927  -8.685  1.00 221.48 ? 372  VAL B CB  1 
ATOM   6706 C CG1 . VAL B 1 348 ? 48.632  19.910  -9.844  1.00 221.48 ? 372  VAL B CG1 1 
ATOM   6707 C CG2 . VAL B 1 348 ? 49.156  19.510  -7.424  1.00 221.48 ? 372  VAL B CG2 1 
ATOM   6708 N N   . CYS B 1 349 ? 46.464  20.747  -7.507  1.00 213.14 ? 373  CYS B N   1 
ATOM   6709 C CA  . CYS B 1 349 ? 45.626  21.936  -7.467  1.00 213.14 ? 373  CYS B CA  1 
ATOM   6710 C C   . CYS B 1 349 ? 46.217  23.311  -7.676  1.00 213.14 ? 373  CYS B C   1 
ATOM   6711 O O   . CYS B 1 349 ? 47.172  23.716  -7.014  1.00 213.14 ? 373  CYS B O   1 
ATOM   6712 C CB  . CYS B 1 349 ? 44.807  21.955  -6.191  1.00 237.07 ? 373  CYS B CB  1 
ATOM   6713 S SG  . CYS B 1 349 ? 43.050  21.754  -6.587  1.00 237.07 ? 373  CYS B SG  1 
ATOM   6714 N N   . ASP B 1 350 ? 45.584  24.032  -8.595  1.00 221.74 ? 374  ASP B N   1 
ATOM   6715 C CA  . ASP B 1 350 ? 45.976  25.382  -8.960  1.00 221.74 ? 374  ASP B CA  1 
ATOM   6716 C C   . ASP B 1 350 ? 45.964  26.331  -7.771  1.00 221.74 ? 374  ASP B C   1 
ATOM   6717 O O   . ASP B 1 350 ? 45.041  26.325  -6.955  1.00 221.74 ? 374  ASP B O   1 
ATOM   6718 C CB  . ASP B 1 350 ? 45.039  25.917  -10.043 1.00 265.57 ? 374  ASP B CB  1 
ATOM   6719 C CG  . ASP B 1 350 ? 45.395  27.323  -10.473 1.00 265.57 ? 374  ASP B CG  1 
ATOM   6720 O OD1 . ASP B 1 350 ? 46.479  27.507  -11.066 1.00 265.57 ? 374  ASP B OD1 1 
ATOM   6721 O OD2 . ASP B 1 350 ? 44.592  28.244  -10.214 1.00 265.57 ? 374  ASP B OD2 1 
ATOM   6722 N N   . LYS B 1 351 ? 47.001  27.156  -7.695  1.00 254.98 ? 375  LYS B N   1 
ATOM   6723 C CA  . LYS B 1 351 ? 47.147  28.128  -6.624  1.00 254.98 ? 375  LYS B CA  1 
ATOM   6724 C C   . LYS B 1 351 ? 46.032  29.175  -6.694  1.00 254.98 ? 375  LYS B C   1 
ATOM   6725 O O   . LYS B 1 351 ? 45.469  29.568  -5.668  1.00 254.98 ? 375  LYS B O   1 
ATOM   6726 C CB  . LYS B 1 351 ? 48.515  28.806  -6.745  1.00 206.37 ? 375  LYS B CB  1 
ATOM   6727 C CG  . LYS B 1 351 ? 49.664  27.829  -6.970  1.00 206.37 ? 375  LYS B CG  1 
ATOM   6728 C CD  . LYS B 1 351 ? 50.956  28.548  -7.330  1.00 206.37 ? 375  LYS B CD  1 
ATOM   6729 C CE  . LYS B 1 351 ? 52.045  27.558  -7.712  1.00 206.37 ? 375  LYS B CE  1 
ATOM   6730 N NZ  . LYS B 1 351 ? 53.301  28.232  -8.145  1.00 206.37 ? 375  LYS B NZ  1 
ATOM   6731 N N   . HIS B 1 352 ? 45.712  29.607  -7.912  1.00 277.01 ? 376  HIS B N   1 
ATOM   6732 C CA  . HIS B 1 352 ? 44.682  30.620  -8.148  1.00 277.01 ? 376  HIS B CA  1 
ATOM   6733 C C   . HIS B 1 352 ? 43.265  30.103  -7.969  1.00 277.01 ? 376  HIS B C   1 
ATOM   6734 O O   . HIS B 1 352 ? 42.315  30.624  -8.559  1.00 277.01 ? 376  HIS B O   1 
ATOM   6735 C CB  . HIS B 1 352 ? 44.842  31.204  -9.550  1.00 276.86 ? 376  HIS B CB  1 
ATOM   6736 C CG  . HIS B 1 352 ? 46.178  31.835  -9.782  1.00 276.86 ? 376  HIS B CG  1 
ATOM   6737 N ND1 . HIS B 1 352 ? 46.623  32.921  -9.058  1.00 276.86 ? 376  HIS B ND1 1 
ATOM   6738 C CD2 . HIS B 1 352 ? 47.181  31.513  -10.632 1.00 276.86 ? 376  HIS B CD2 1 
ATOM   6739 C CE1 . HIS B 1 352 ? 47.844  33.238  -9.450  1.00 276.86 ? 376  HIS B CE1 1 
ATOM   6740 N NE2 . HIS B 1 352 ? 48.206  32.399  -10.404 1.00 276.86 ? 376  HIS B NE2 1 
ATOM   6741 N N   . LEU B 1 353 ? 43.134  29.071  -7.149  1.00 197.80 ? 377  LEU B N   1 
ATOM   6742 C CA  . LEU B 1 353 ? 41.844  28.479  -6.857  1.00 197.80 ? 377  LEU B CA  1 
ATOM   6743 C C   . LEU B 1 353 ? 41.325  29.289  -5.668  1.00 197.80 ? 377  LEU B C   1 
ATOM   6744 O O   . LEU B 1 353 ? 42.103  29.649  -4.781  1.00 197.80 ? 377  LEU B O   1 
ATOM   6745 C CB  . LEU B 1 353 ? 42.045  27.013  -6.469  1.00 181.25 ? 377  LEU B CB  1 
ATOM   6746 C CG  . LEU B 1 353 ? 41.058  25.936  -6.926  1.00 181.25 ? 377  LEU B CG  1 
ATOM   6747 C CD1 . LEU B 1 353 ? 41.060  25.813  -8.444  1.00 181.25 ? 377  LEU B CD1 1 
ATOM   6748 C CD2 . LEU B 1 353 ? 41.461  24.612  -6.295  1.00 181.25 ? 377  LEU B CD2 1 
ATOM   6749 N N   . ALA B 1 354 ? 40.029  29.593  -5.649  1.00 268.81 ? 378  ALA B N   1 
ATOM   6750 C CA  . ALA B 1 354 ? 39.467  30.369  -4.546  1.00 268.81 ? 378  ALA B CA  1 
ATOM   6751 C C   . ALA B 1 354 ? 37.950  30.241  -4.407  1.00 268.81 ? 378  ALA B C   1 
ATOM   6752 O O   . ALA B 1 354 ? 37.263  29.806  -5.334  1.00 268.81 ? 378  ALA B O   1 
ATOM   6753 C CB  . ALA B 1 354 ? 39.851  31.841  -4.700  1.00 149.19 ? 378  ALA B CB  1 
ATOM   6754 N N   . ILE B 1 355 ? 37.444  30.618  -3.234  1.00 308.33 ? 379  ILE B N   1 
ATOM   6755 C CA  . ILE B 1 355 ? 36.012  30.574  -2.948  1.00 308.33 ? 379  ILE B CA  1 
ATOM   6756 C C   . ILE B 1 355 ? 35.402  31.899  -3.381  1.00 308.33 ? 379  ILE B C   1 
ATOM   6757 O O   . ILE B 1 355 ? 35.588  32.919  -2.716  1.00 308.33 ? 379  ILE B O   1 
ATOM   6758 C CB  . ILE B 1 355 ? 35.732  30.397  -1.437  1.00 196.56 ? 379  ILE B CB  1 
ATOM   6759 C CG1 . ILE B 1 355 ? 36.357  29.096  -0.928  1.00 196.56 ? 379  ILE B CG1 1 
ATOM   6760 C CG2 . ILE B 1 355 ? 34.231  30.400  -1.188  1.00 196.56 ? 379  ILE B CG2 1 
ATOM   6761 C CD1 . ILE B 1 355 ? 36.122  28.844  0.547   1.00 196.56 ? 379  ILE B CD1 1 
ATOM   6762 N N   . ASP B 1 356 ? 34.674  31.891  -4.491  1.00 194.57 ? 380  ASP B N   1 
ATOM   6763 C CA  . ASP B 1 356 ? 34.065  33.121  -4.980  1.00 194.57 ? 380  ASP B CA  1 
ATOM   6764 C C   . ASP B 1 356 ? 32.554  33.001  -5.141  1.00 194.57 ? 380  ASP B C   1 
ATOM   6765 O O   . ASP B 1 356 ? 31.949  32.031  -4.686  1.00 194.57 ? 380  ASP B O   1 
ATOM   6766 C CB  . ASP B 1 356 ? 34.696  33.537  -6.315  1.00 338.94 ? 380  ASP B CB  1 
ATOM   6767 C CG  . ASP B 1 356 ? 34.351  32.591  -7.448  1.00 338.94 ? 380  ASP B CG  1 
ATOM   6768 O OD1 . ASP B 1 356 ? 34.862  31.452  -7.457  1.00 338.94 ? 380  ASP B OD1 1 
ATOM   6769 O OD2 . ASP B 1 356 ? 33.563  32.992  -8.330  1.00 338.94 ? 380  ASP B OD2 1 
ATOM   6770 N N   . SER B 1 357 ? 31.956  33.998  -5.794  1.00 157.71 ? 381  SER B N   1 
ATOM   6771 C CA  . SER B 1 357 ? 30.511  34.045  -6.023  1.00 157.71 ? 381  SER B CA  1 
ATOM   6772 C C   . SER B 1 357 ? 30.028  33.033  -7.059  1.00 157.71 ? 381  SER B C   1 
ATOM   6773 O O   . SER B 1 357 ? 28.838  32.980  -7.373  1.00 157.71 ? 381  SER B O   1 
ATOM   6774 C CB  . SER B 1 357 ? 30.091  35.456  -6.460  1.00 176.82 ? 381  SER B CB  1 
ATOM   6775 O OG  . SER B 1 357 ? 30.711  35.830  -7.680  1.00 176.82 ? 381  SER B OG  1 
ATOM   6776 N N   . SER B 1 358 ? 30.949  32.230  -7.586  1.00 235.36 ? 382  SER B N   1 
ATOM   6777 C CA  . SER B 1 358 ? 30.590  31.233  -8.586  1.00 235.36 ? 382  SER B CA  1 
ATOM   6778 C C   . SER B 1 358 ? 30.509  29.835  -7.991  1.00 235.36 ? 382  SER B C   1 
ATOM   6779 O O   . SER B 1 358 ? 29.861  28.957  -8.557  1.00 235.36 ? 382  SER B O   1 
ATOM   6780 C CB  . SER B 1 358 ? 31.603  31.233  -9.737  1.00 200.72 ? 382  SER B CB  1 
ATOM   6781 O OG  . SER B 1 358 ? 32.874  30.772  -9.308  1.00 200.72 ? 382  SER B OG  1 
ATOM   6782 N N   . ASN B 1 359 ? 31.159  29.627  -6.851  1.00 223.75 ? 383  ASN B N   1 
ATOM   6783 C CA  . ASN B 1 359 ? 31.153  28.313  -6.216  1.00 223.75 ? 383  ASN B CA  1 
ATOM   6784 C C   . ASN B 1 359 ? 30.649  28.302  -4.776  1.00 223.75 ? 383  ASN B C   1 
ATOM   6785 O O   . ASN B 1 359 ? 30.754  27.283  -4.090  1.00 223.75 ? 383  ASN B O   1 
ATOM   6786 C CB  . ASN B 1 359 ? 32.563  27.709  -6.250  1.00 227.48 ? 383  ASN B CB  1 
ATOM   6787 C CG  . ASN B 1 359 ? 33.624  28.653  -5.697  1.00 227.48 ? 383  ASN B CG  1 
ATOM   6788 O OD1 . ASN B 1 359 ? 33.380  29.398  -4.747  1.00 227.48 ? 383  ASN B OD1 1 
ATOM   6789 N ND2 . ASN B 1 359 ? 34.815  28.609  -6.282  1.00 227.48 ? 383  ASN B ND2 1 
ATOM   6790 N N   . TYR B 1 360 ? 30.085  29.414  -4.320  1.00 219.20 ? 384  TYR B N   1 
ATOM   6791 C CA  . TYR B 1 360 ? 29.624  29.483  -2.940  1.00 219.20 ? 384  TYR B CA  1 
ATOM   6792 C C   . TYR B 1 360 ? 28.388  30.333  -2.666  1.00 219.20 ? 384  TYR B C   1 
ATOM   6793 O O   . TYR B 1 360 ? 28.311  31.498  -3.055  1.00 219.20 ? 384  TYR B O   1 
ATOM   6794 C CB  . TYR B 1 360 ? 30.778  29.973  -2.055  1.00 194.43 ? 384  TYR B CB  1 
ATOM   6795 C CG  . TYR B 1 360 ? 30.335  30.797  -0.871  1.00 194.43 ? 384  TYR B CG  1 
ATOM   6796 C CD1 . TYR B 1 360 ? 29.621  30.221  0.175   1.00 194.43 ? 384  TYR B CD1 1 
ATOM   6797 C CD2 . TYR B 1 360 ? 30.576  32.168  -0.825  1.00 194.43 ? 384  TYR B CD2 1 
ATOM   6798 C CE1 . TYR B 1 360 ? 29.149  30.989  1.236   1.00 194.43 ? 384  TYR B CE1 1 
ATOM   6799 C CE2 . TYR B 1 360 ? 30.108  32.948  0.232   1.00 194.43 ? 384  TYR B CE2 1 
ATOM   6800 C CZ  . TYR B 1 360 ? 29.393  32.351  1.257   1.00 194.43 ? 384  TYR B CZ  1 
ATOM   6801 O OH  . TYR B 1 360 ? 28.904  33.115  2.291   1.00 194.43 ? 384  TYR B OH  1 
ATOM   6802 N N   . GLU B 1 361 ? 27.429  29.732  -1.970  1.00 193.86 ? 385  GLU B N   1 
ATOM   6803 C CA  . GLU B 1 361 ? 26.203  30.414  -1.578  1.00 193.86 ? 385  GLU B CA  1 
ATOM   6804 C C   . GLU B 1 361 ? 26.069  30.235  -0.065  1.00 193.86 ? 385  GLU B C   1 
ATOM   6805 O O   . GLU B 1 361 ? 26.062  29.109  0.432   1.00 193.86 ? 385  GLU B O   1 
ATOM   6806 C CB  . GLU B 1 361 ? 24.987  29.808  -2.294  1.00 205.88 ? 385  GLU B CB  1 
ATOM   6807 C CG  . GLU B 1 361 ? 23.653  30.465  -1.925  1.00 205.88 ? 385  GLU B CG  1 
ATOM   6808 C CD  . GLU B 1 361 ? 22.484  29.958  -2.756  1.00 205.88 ? 385  GLU B CD  1 
ATOM   6809 O OE1 . GLU B 1 361 ? 22.481  30.192  -3.983  1.00 205.88 ? 385  GLU B OE1 1 
ATOM   6810 O OE2 . GLU B 1 361 ? 21.570  29.327  -2.183  1.00 205.88 ? 385  GLU B OE2 1 
ATOM   6811 N N   . GLN B 1 362 ? 25.980  31.344  0.663   1.00 197.28 ? 386  GLN B N   1 
ATOM   6812 C CA  . GLN B 1 362 ? 25.863  31.295  2.117   1.00 197.28 ? 386  GLN B CA  1 
ATOM   6813 C C   . GLN B 1 362 ? 24.685  30.468  2.622   1.00 197.28 ? 386  GLN B C   1 
ATOM   6814 O O   . GLN B 1 362 ? 23.533  30.707  2.256   1.00 197.28 ? 386  GLN B O   1 
ATOM   6815 C CB  . GLN B 1 362 ? 25.776  32.711  2.688   1.00 152.28 ? 386  GLN B CB  1 
ATOM   6816 C CG  . GLN B 1 362 ? 25.311  32.764  4.131   1.00 152.28 ? 386  GLN B CG  1 
ATOM   6817 C CD  . GLN B 1 362 ? 25.680  34.064  4.816   1.00 152.28 ? 386  GLN B CD  1 
ATOM   6818 O OE1 . GLN B 1 362 ? 25.105  34.422  5.840   1.00 152.28 ? 386  GLN B OE1 1 
ATOM   6819 N NE2 . GLN B 1 362 ? 26.656  34.770  4.262   1.00 152.28 ? 386  GLN B NE2 1 
ATOM   6820 N N   . GLU B 1 363 ? 25.002  29.498  3.476   1.00 132.42 ? 387  GLU B N   1 
ATOM   6821 C CA  . GLU B 1 363 ? 24.030  28.591  4.083   1.00 132.42 ? 387  GLU B CA  1 
ATOM   6822 C C   . GLU B 1 363 ? 22.925  29.401  4.792   1.00 132.42 ? 387  GLU B C   1 
ATOM   6823 O O   . GLU B 1 363 ? 23.179  30.469  5.357   1.00 132.42 ? 387  GLU B O   1 
ATOM   6824 C CB  . GLU B 1 363 ? 24.779  27.666  5.058   1.00 117.31 ? 387  GLU B CB  1 
ATOM   6825 C CG  . GLU B 1 363 ? 24.064  26.394  5.472   1.00 117.31 ? 387  GLU B CG  1 
ATOM   6826 C CD  . GLU B 1 363 ? 23.113  26.602  6.632   1.00 117.31 ? 387  GLU B CD  1 
ATOM   6827 O OE1 . GLU B 1 363 ? 23.567  27.029  7.715   1.00 117.31 ? 387  GLU B OE1 1 
ATOM   6828 O OE2 . GLU B 1 363 ? 21.907  26.333  6.461   1.00 117.31 ? 387  GLU B OE2 1 
ATOM   6829 N N   . SER B 1 364 ? 21.698  28.890  4.747   1.00 163.24 ? 388  SER B N   1 
ATOM   6830 C CA  . SER B 1 364 ? 20.550  29.567  5.345   1.00 163.24 ? 388  SER B CA  1 
ATOM   6831 C C   . SER B 1 364 ? 20.636  29.899  6.829   1.00 163.24 ? 388  SER B C   1 
ATOM   6832 O O   . SER B 1 364 ? 20.248  30.987  7.244   1.00 163.24 ? 388  SER B O   1 
ATOM   6833 C CB  . SER B 1 364 ? 19.283  28.748  5.108   1.00 131.07 ? 388  SER B CB  1 
ATOM   6834 O OG  . SER B 1 364 ? 18.204  29.277  5.860   1.00 131.07 ? 388  SER B OG  1 
ATOM   6835 N N   . LYS B 1 365 ? 21.139  28.964  7.626   1.00 138.77 ? 389  LYS B N   1 
ATOM   6836 C CA  . LYS B 1 365 ? 21.223  29.160  9.067   1.00 138.77 ? 389  LYS B CA  1 
ATOM   6837 C C   . LYS B 1 365 ? 22.406  29.951  9.611   1.00 138.77 ? 389  LYS B C   1 
ATOM   6838 O O   . LYS B 1 365 ? 22.403  30.330  10.785  1.00 138.77 ? 389  LYS B O   1 
ATOM   6839 C CB  . LYS B 1 365 ? 21.164  27.803  9.767   1.00 109.30 ? 389  LYS B CB  1 
ATOM   6840 C CG  . LYS B 1 365 ? 19.832  27.108  9.613   1.00 109.30 ? 389  LYS B CG  1 
ATOM   6841 C CD  . LYS B 1 365 ? 19.693  25.949  10.574  1.00 109.30 ? 389  LYS B CD  1 
ATOM   6842 C CE  . LYS B 1 365 ? 18.308  25.328  10.494  1.00 109.30 ? 389  LYS B CE  1 
ATOM   6843 N NZ  . LYS B 1 365 ? 18.031  24.748  9.154   1.00 109.30 ? 389  LYS B NZ  1 
ATOM   6844 N N   . ILE B 1 366 ? 23.408  30.209  8.775   1.00 95.34  ? 390  ILE B N   1 
ATOM   6845 C CA  . ILE B 1 366 ? 24.585  30.941  9.226   1.00 95.34  ? 390  ILE B CA  1 
ATOM   6846 C C   . ILE B 1 366 ? 24.199  32.099  10.120  1.00 95.34  ? 390  ILE B C   1 
ATOM   6847 O O   . ILE B 1 366 ? 24.926  32.446  11.048  1.00 95.34  ? 390  ILE B O   1 
ATOM   6848 C CB  . ILE B 1 366 ? 25.427  31.469  8.049   1.00 85.43  ? 390  ILE B CB  1 
ATOM   6849 C CG1 . ILE B 1 366 ? 26.111  30.297  7.329   1.00 85.43  ? 390  ILE B CG1 1 
ATOM   6850 C CG2 . ILE B 1 366 ? 26.474  32.463  8.556   1.00 85.43  ? 390  ILE B CG2 1 
ATOM   6851 C CD1 . ILE B 1 366 ? 27.057  29.468  8.191   1.00 85.43  ? 390  ILE B CD1 1 
ATOM   6852 N N   . MET B 1 367 ? 23.047  32.691  9.848   1.00 91.92  ? 391  MET B N   1 
ATOM   6853 C CA  . MET B 1 367 ? 22.584  33.798  10.662  1.00 91.92  ? 391  MET B CA  1 
ATOM   6854 C C   . MET B 1 367 ? 22.434  33.341  12.114  1.00 91.92  ? 391  MET B C   1 
ATOM   6855 O O   . MET B 1 367 ? 22.956  33.979  13.037  1.00 91.92  ? 391  MET B O   1 
ATOM   6856 C CB  . MET B 1 367 ? 21.246  34.316  10.137  1.00 178.08 ? 391  MET B CB  1 
ATOM   6857 C CG  . MET B 1 367 ? 20.683  35.470  10.941  1.00 178.08 ? 391  MET B CG  1 
ATOM   6858 S SD  . MET B 1 367 ? 19.072  35.987  10.363  1.00 178.08 ? 391  MET B SD  1 
ATOM   6859 C CE  . MET B 1 367 ? 17.995  34.824  11.211  1.00 178.08 ? 391  MET B CE  1 
ATOM   6860 N N   . PHE B 1 368 ? 21.733  32.227  12.309  1.00 104.20 ? 392  PHE B N   1 
ATOM   6861 C CA  . PHE B 1 368 ? 21.509  31.696  13.646  1.00 104.20 ? 392  PHE B CA  1 
ATOM   6862 C C   . PHE B 1 368 ? 22.791  31.385  14.390  1.00 104.20 ? 392  PHE B C   1 
ATOM   6863 O O   . PHE B 1 368 ? 22.871  31.541  15.614  1.00 104.20 ? 392  PHE B O   1 
ATOM   6864 C CB  . PHE B 1 368 ? 20.651  30.454  13.564  1.00 118.77 ? 392  PHE B CB  1 
ATOM   6865 C CG  . PHE B 1 368 ? 19.372  30.685  12.871  1.00 118.77 ? 392  PHE B CG  1 
ATOM   6866 C CD1 . PHE B 1 368 ? 19.285  30.542  11.498  1.00 118.77 ? 392  PHE B CD1 1 
ATOM   6867 C CD2 . PHE B 1 368 ? 18.260  31.110  13.581  1.00 118.77 ? 392  PHE B CD2 1 
ATOM   6868 C CE1 . PHE B 1 368 ? 18.103  30.823  10.835  1.00 118.77 ? 392  PHE B CE1 1 
ATOM   6869 C CE2 . PHE B 1 368 ? 17.073  31.395  12.936  1.00 118.77 ? 392  PHE B CE2 1 
ATOM   6870 C CZ  . PHE B 1 368 ? 16.989  31.253  11.558  1.00 118.77 ? 392  PHE B CZ  1 
ATOM   6871 N N   . VAL B 1 369 ? 23.790  30.923  13.654  1.00 81.29  ? 393  VAL B N   1 
ATOM   6872 C CA  . VAL B 1 369 ? 25.067  30.634  14.267  1.00 81.29  ? 393  VAL B CA  1 
ATOM   6873 C C   . VAL B 1 369 ? 25.559  31.921  14.907  1.00 81.29  ? 393  VAL B C   1 
ATOM   6874 O O   . VAL B 1 369 ? 25.744  31.991  16.116  1.00 81.29  ? 393  VAL B O   1 
ATOM   6875 C CB  . VAL B 1 369 ? 26.086  30.186  13.233  1.00 63.93  ? 393  VAL B CB  1 
ATOM   6876 C CG1 . VAL B 1 369 ? 27.453  30.121  13.854  1.00 63.93  ? 393  VAL B CG1 1 
ATOM   6877 C CG2 . VAL B 1 369 ? 25.691  28.839  12.690  1.00 63.93  ? 393  VAL B CG2 1 
ATOM   6878 N N   . VAL B 1 370 ? 25.742  32.949  14.089  1.00 92.13  ? 394  VAL B N   1 
ATOM   6879 C CA  . VAL B 1 370 ? 26.230  34.236  14.573  1.00 92.13  ? 394  VAL B CA  1 
ATOM   6880 C C   . VAL B 1 370 ? 25.445  34.818  15.751  1.00 92.13  ? 394  VAL B C   1 
ATOM   6881 O O   . VAL B 1 370 ? 26.035  35.326  16.705  1.00 92.13  ? 394  VAL B O   1 
ATOM   6882 C CB  . VAL B 1 370 ? 26.276  35.262  13.424  1.00 108.05 ? 394  VAL B CB  1 
ATOM   6883 C CG1 . VAL B 1 370 ? 26.862  36.576  13.910  1.00 108.05 ? 394  VAL B CG1 1 
ATOM   6884 C CG2 . VAL B 1 370 ? 27.116  34.711  12.296  1.00 108.05 ? 394  VAL B CG2 1 
ATOM   6885 N N   . ASN B 1 371 ? 24.124  34.750  15.691  1.00 111.45 ? 395  ASN B N   1 
ATOM   6886 C CA  . ASN B 1 371 ? 23.313  35.266  16.784  1.00 111.45 ? 395  ASN B CA  1 
ATOM   6887 C C   . ASN B 1 371 ? 23.514  34.427  18.037  1.00 111.45 ? 395  ASN B C   1 
ATOM   6888 O O   . ASN B 1 371 ? 23.599  34.954  19.149  1.00 111.45 ? 395  ASN B O   1 
ATOM   6889 C CB  . ASN B 1 371 ? 21.843  35.262  16.387  1.00 139.07 ? 395  ASN B CB  1 
ATOM   6890 C CG  . ASN B 1 371 ? 21.518  36.350  15.397  1.00 139.07 ? 395  ASN B CG  1 
ATOM   6891 O OD1 . ASN B 1 371 ? 22.401  36.843  14.688  1.00 139.07 ? 395  ASN B OD1 1 
ATOM   6892 N ND2 . ASN B 1 371 ? 20.248  36.730  15.334  1.00 139.07 ? 395  ASN B ND2 1 
ATOM   6893 N N   . ALA B 1 372 ? 23.581  33.115  17.851  1.00 94.28  ? 396  ALA B N   1 
ATOM   6894 C CA  . ALA B 1 372 ? 23.793  32.211  18.967  1.00 94.28  ? 396  ALA B CA  1 
ATOM   6895 C C   . ALA B 1 372 ? 25.001  32.700  19.765  1.00 94.28  ? 396  ALA B C   1 
ATOM   6896 O O   . ALA B 1 372 ? 24.933  32.888  20.980  1.00 94.28  ? 396  ALA B O   1 
ATOM   6897 C CB  . ALA B 1 372 ? 24.039  30.798  18.449  1.00 65.99  ? 396  ALA B CB  1 
ATOM   6898 N N   . VAL B 1 373 ? 26.100  32.926  19.058  1.00 59.10  ? 397  VAL B N   1 
ATOM   6899 C CA  . VAL B 1 373 ? 27.325  33.383  19.676  1.00 59.10  ? 397  VAL B CA  1 
ATOM   6900 C C   . VAL B 1 373 ? 27.201  34.754  20.314  1.00 59.10  ? 397  VAL B C   1 
ATOM   6901 O O   . VAL B 1 373 ? 27.616  34.955  21.455  1.00 59.10  ? 397  VAL B O   1 
ATOM   6902 C CB  . VAL B 1 373 ? 28.458  33.422  18.666  1.00 55.16  ? 397  VAL B CB  1 
ATOM   6903 C CG1 . VAL B 1 373 ? 29.726  33.911  19.333  1.00 55.16  ? 397  VAL B CG1 1 
ATOM   6904 C CG2 . VAL B 1 373 ? 28.676  32.036  18.107  1.00 55.16  ? 397  VAL B CG2 1 
ATOM   6905 N N   . TYR B 1 374 ? 26.655  35.712  19.585  1.00 96.77  ? 398  TYR B N   1 
ATOM   6906 C CA  . TYR B 1 374 ? 26.520  37.029  20.169  1.00 96.77  ? 398  TYR B CA  1 
ATOM   6907 C C   . TYR B 1 374 ? 25.707  36.948  21.439  1.00 96.77  ? 398  TYR B C   1 
ATOM   6908 O O   . TYR B 1 374 ? 25.989  37.648  22.409  1.00 96.77  ? 398  TYR B O   1 
ATOM   6909 C CB  . TYR B 1 374 ? 25.895  38.021  19.185  1.00 124.41 ? 398  TYR B CB  1 
ATOM   6910 C CG  . TYR B 1 374 ? 26.951  38.727  18.376  1.00 124.41 ? 398  TYR B CG  1 
ATOM   6911 C CD1 . TYR B 1 374 ? 27.620  38.067  17.348  1.00 124.41 ? 398  TYR B CD1 1 
ATOM   6912 C CD2 . TYR B 1 374 ? 27.370  40.012  18.715  1.00 124.41 ? 398  TYR B CD2 1 
ATOM   6913 C CE1 . TYR B 1 374 ? 28.683  38.663  16.686  1.00 124.41 ? 398  TYR B CE1 1 
ATOM   6914 C CE2 . TYR B 1 374 ? 28.435  40.616  18.060  1.00 124.41 ? 398  TYR B CE2 1 
ATOM   6915 C CZ  . TYR B 1 374 ? 29.089  39.935  17.051  1.00 124.41 ? 398  TYR B CZ  1 
ATOM   6916 O OH  . TYR B 1 374 ? 30.171  40.512  16.430  1.00 124.41 ? 398  TYR B OH  1 
ATOM   6917 N N   . ALA B 1 375 ? 24.708  36.079  21.450  1.00 81.78  ? 399  ALA B N   1 
ATOM   6918 C CA  . ALA B 1 375 ? 23.888  35.932  22.648  1.00 81.78  ? 399  ALA B CA  1 
ATOM   6919 C C   . ALA B 1 375 ? 24.835  35.624  23.805  1.00 81.78  ? 399  ALA B C   1 
ATOM   6920 O O   . ALA B 1 375 ? 25.039  36.439  24.707  1.00 81.78  ? 399  ALA B O   1 
ATOM   6921 C CB  . ALA B 1 375 ? 22.892  34.801  22.465  1.00 135.62 ? 399  ALA B CB  1 
ATOM   6922 N N   . MET B 1 376 ? 25.430  34.443  23.745  1.00 74.59  ? 400  MET B N   1 
ATOM   6923 C CA  . MET B 1 376 ? 26.367  33.996  24.753  1.00 74.59  ? 400  MET B CA  1 
ATOM   6924 C C   . MET B 1 376 ? 27.225  35.169  25.212  1.00 74.59  ? 400  MET B C   1 
ATOM   6925 O O   . MET B 1 376 ? 27.397  35.402  26.409  1.00 74.59  ? 400  MET B O   1 
ATOM   6926 C CB  . MET B 1 376 ? 27.262  32.914  24.153  1.00 67.83  ? 400  MET B CB  1 
ATOM   6927 C CG  . MET B 1 376 ? 27.982  32.057  25.159  1.00 67.83  ? 400  MET B CG  1 
ATOM   6928 S SD  . MET B 1 376 ? 26.858  31.006  26.068  1.00 67.83  ? 400  MET B SD  1 
ATOM   6929 C CE  . MET B 1 376 ? 26.355  32.132  27.277  1.00 67.83  ? 400  MET B CE  1 
ATOM   6930 N N   . ALA B 1 377 ? 27.755  35.909  24.242  1.00 77.08  ? 401  ALA B N   1 
ATOM   6931 C CA  . ALA B 1 377 ? 28.628  37.045  24.511  1.00 77.08  ? 401  ALA B CA  1 
ATOM   6932 C C   . ALA B 1 377 ? 27.924  38.185  25.221  1.00 77.08  ? 401  ALA B C   1 
ATOM   6933 O O   . ALA B 1 377 ? 28.401  38.668  26.242  1.00 77.08  ? 401  ALA B O   1 
ATOM   6934 C CB  . ALA B 1 377 ? 29.244  37.529  23.215  1.00 55.66  ? 401  ALA B CB  1 
ATOM   6935 N N   . HIS B 1 378 ? 26.800  38.631  24.680  1.00 87.54  ? 402  HIS B N   1 
ATOM   6936 C CA  . HIS B 1 378 ? 26.073  39.701  25.329  1.00 87.54  ? 402  HIS B CA  1 
ATOM   6937 C C   . HIS B 1 378 ? 25.777  39.228  26.736  1.00 87.54  ? 402  HIS B C   1 
ATOM   6938 O O   . HIS B 1 378 ? 25.855  40.000  27.685  1.00 87.54  ? 402  HIS B O   1 
ATOM   6939 C CB  . HIS B 1 378 ? 24.778  40.013  24.584  1.00 158.27 ? 402  HIS B CB  1 
ATOM   6940 C CG  . HIS B 1 378 ? 24.951  41.004  23.479  1.00 158.27 ? 402  HIS B CG  1 
ATOM   6941 N ND1 . HIS B 1 378 ? 25.066  42.357  23.709  1.00 158.27 ? 402  HIS B ND1 1 
ATOM   6942 C CD2 . HIS B 1 378 ? 25.076  40.837  22.141  1.00 158.27 ? 402  HIS B CD2 1 
ATOM   6943 C CE1 . HIS B 1 378 ? 25.255  42.981  22.560  1.00 158.27 ? 402  HIS B CE1 1 
ATOM   6944 N NE2 . HIS B 1 378 ? 25.265  42.081  21.592  1.00 158.27 ? 402  HIS B NE2 1 
ATOM   6945 N N   . ALA B 1 379 ? 25.465  37.943  26.874  1.00 83.56  ? 403  ALA B N   1 
ATOM   6946 C CA  . ALA B 1 379 ? 25.169  37.381  28.192  1.00 83.56  ? 403  ALA B CA  1 
ATOM   6947 C C   . ALA B 1 379 ? 26.374  37.604  29.080  1.00 83.56  ? 403  ALA B C   1 
ATOM   6948 O O   . ALA B 1 379 ? 26.280  38.271  30.100  1.00 83.56  ? 403  ALA B O   1 
ATOM   6949 C CB  . ALA B 1 379 ? 24.869  35.905  28.086  1.00 134.76 ? 403  ALA B CB  1 
ATOM   6950 N N   . LEU B 1 380 ? 27.511  37.048  28.694  1.00 76.46  ? 404  LEU B N   1 
ATOM   6951 C CA  . LEU B 1 380 ? 28.707  37.251  29.484  1.00 76.46  ? 404  LEU B CA  1 
ATOM   6952 C C   . LEU B 1 380 ? 28.912  38.754  29.712  1.00 76.46  ? 404  LEU B C   1 
ATOM   6953 O O   . LEU B 1 380 ? 29.103  39.205  30.846  1.00 76.46  ? 404  LEU B O   1 
ATOM   6954 C CB  . LEU B 1 380 ? 29.906  36.661  28.755  1.00 75.52  ? 404  LEU B CB  1 
ATOM   6955 C CG  . LEU B 1 380 ? 29.807  35.165  28.506  1.00 75.52  ? 404  LEU B CG  1 
ATOM   6956 C CD1 . LEU B 1 380 ? 31.088  34.658  27.846  1.00 75.52  ? 404  LEU B CD1 1 
ATOM   6957 C CD2 . LEU B 1 380 ? 29.572  34.478  29.838  1.00 75.52  ? 404  LEU B CD2 1 
ATOM   6958 N N   . HIS B 1 381 ? 28.845  39.528  28.634  1.00 83.91  ? 405  HIS B N   1 
ATOM   6959 C CA  . HIS B 1 381 ? 29.038  40.958  28.738  1.00 83.91  ? 405  HIS B CA  1 
ATOM   6960 C C   . HIS B 1 381 ? 28.233  41.591  29.854  1.00 83.91  ? 405  HIS B C   1 
ATOM   6961 O O   . HIS B 1 381 ? 28.713  42.499  30.508  1.00 83.91  ? 405  HIS B O   1 
ATOM   6962 C CB  . HIS B 1 381 ? 28.714  41.645  27.419  1.00 116.53 ? 405  HIS B CB  1 
ATOM   6963 C CG  . HIS B 1 381 ? 29.005  43.115  27.419  1.00 116.53 ? 405  HIS B CG  1 
ATOM   6964 N ND1 . HIS B 1 381 ? 30.212  43.634  27.839  1.00 116.53 ? 405  HIS B ND1 1 
ATOM   6965 C CD2 . HIS B 1 381 ? 28.259  44.174  27.017  1.00 116.53 ? 405  HIS B CD2 1 
ATOM   6966 C CE1 . HIS B 1 381 ? 30.197  44.947  27.693  1.00 116.53 ? 405  HIS B CE1 1 
ATOM   6967 N NE2 . HIS B 1 381 ? 29.024  45.301  27.196  1.00 116.53 ? 405  HIS B NE2 1 
ATOM   6968 N N   . LYS B 1 382 ? 27.010  41.144  30.091  1.00 77.51  ? 406  LYS B N   1 
ATOM   6969 C CA  . LYS B 1 382 ? 26.258  41.753  31.181  1.00 77.51  ? 406  LYS B CA  1 
ATOM   6970 C C   . LYS B 1 382 ? 26.912  41.292  32.476  1.00 77.51  ? 406  LYS B C   1 
ATOM   6971 O O   . LYS B 1 382 ? 27.241  42.106  33.334  1.00 77.51  ? 406  LYS B O   1 
ATOM   6972 C CB  . LYS B 1 382 ? 24.773  41.351  31.150  1.00 61.24  ? 406  LYS B CB  1 
ATOM   6973 C CG  . LYS B 1 382 ? 23.950  41.932  32.288  0.00 61.24  ? 406  LYS B CG  1 
ATOM   6974 C CD  . LYS B 1 382 ? 22.549  41.343  32.317  0.00 61.24  ? 406  LYS B CD  1 
ATOM   6975 C CE  . LYS B 1 382 ? 21.789  41.641  31.035  0.00 61.24  ? 406  LYS B CE  1 
ATOM   6976 N NZ  . LYS B 1 382 ? 20.427  41.042  31.051  0.00 61.24  ? 406  LYS B NZ  1 
ATOM   6977 N N   . MET B 1 383 ? 27.137  39.988  32.600  1.00 103.77 ? 407  MET B N   1 
ATOM   6978 C CA  . MET B 1 383 ? 27.748  39.458  33.806  1.00 103.77 ? 407  MET B CA  1 
ATOM   6979 C C   . MET B 1 383 ? 28.999  40.239  34.126  1.00 103.77 ? 407  MET B C   1 
ATOM   6980 O O   . MET B 1 383 ? 29.293  40.497  35.293  1.00 103.77 ? 407  MET B O   1 
ATOM   6981 C CB  . MET B 1 383 ? 28.096  37.982  33.651  1.00 97.86  ? 407  MET B CB  1 
ATOM   6982 C CG  . MET B 1 383 ? 28.482  37.338  34.972  1.00 97.86  ? 407  MET B CG  1 
ATOM   6983 S SD  . MET B 1 383 ? 28.509  35.522  34.966  1.00 97.86  ? 407  MET B SD  1 
ATOM   6984 C CE  . MET B 1 383 ? 26.780  35.149  35.018  1.00 97.86  ? 407  MET B CE  1 
ATOM   6985 N N   . GLN B 1 384 ? 29.738  40.616  33.087  1.00 88.50  ? 408  GLN B N   1 
ATOM   6986 C CA  . GLN B 1 384 ? 30.955  41.399  33.268  1.00 88.50  ? 408  GLN B CA  1 
ATOM   6987 C C   . GLN B 1 384 ? 30.615  42.700  34.003  1.00 88.50  ? 408  GLN B C   1 
ATOM   6988 O O   . GLN B 1 384 ? 30.925  42.849  35.189  1.00 88.50  ? 408  GLN B O   1 
ATOM   6989 C CB  . GLN B 1 384 ? 31.617  41.667  31.896  1.00 123.79 ? 408  GLN B CB  1 
ATOM   6990 C CG  . GLN B 1 384 ? 32.436  42.956  31.735  1.00 123.79 ? 408  GLN B CG  1 
ATOM   6991 C CD  . GLN B 1 384 ? 33.391  43.213  32.881  1.00 123.79 ? 408  GLN B CD  1 
ATOM   6992 O OE1 . GLN B 1 384 ? 34.118  42.320  33.323  1.00 123.79 ? 408  GLN B OE1 1 
ATOM   6993 N NE2 . GLN B 1 384 ? 33.400  44.449  33.366  1.00 123.79 ? 408  GLN B NE2 1 
ATOM   6994 N N   . ARG B 1 385 ? 29.947  43.619  33.313  1.00 89.39  ? 409  ARG B N   1 
ATOM   6995 C CA  . ARG B 1 385 ? 29.597  44.891  33.915  1.00 89.39  ? 409  ARG B CA  1 
ATOM   6996 C C   . ARG B 1 385 ? 28.825  44.777  35.225  1.00 89.39  ? 409  ARG B C   1 
ATOM   6997 O O   . ARG B 1 385 ? 28.960  45.636  36.104  1.00 89.39  ? 409  ARG B O   1 
ATOM   6998 C CB  . ARG B 1 385 ? 28.821  45.763  32.917  1.00 191.49 ? 409  ARG B CB  1 
ATOM   6999 C CG  . ARG B 1 385 ? 29.652  46.932  32.408  1.00 191.49 ? 409  ARG B CG  1 
ATOM   7000 C CD  . ARG B 1 385 ? 29.045  47.649  31.210  1.00 191.49 ? 409  ARG B CD  1 
ATOM   7001 N NE  . ARG B 1 385 ? 30.015  48.581  30.629  1.00 191.49 ? 409  ARG B NE  1 
ATOM   7002 C CZ  . ARG B 1 385 ? 29.895  49.155  29.435  1.00 191.49 ? 409  ARG B CZ  1 
ATOM   7003 N NH1 . ARG B 1 385 ? 28.837  48.900  28.676  1.00 191.49 ? 409  ARG B NH1 1 
ATOM   7004 N NH2 . ARG B 1 385 ? 30.842  49.975  28.992  1.00 191.49 ? 409  ARG B NH2 1 
ATOM   7005 N N   . THR B 1 386 ? 28.027  43.729  35.382  1.00 94.93  ? 410  THR B N   1 
ATOM   7006 C CA  . THR B 1 386 ? 27.271  43.617  36.620  1.00 94.93  ? 410  THR B CA  1 
ATOM   7007 C C   . THR B 1 386 ? 28.158  43.179  37.769  1.00 94.93  ? 410  THR B C   1 
ATOM   7008 O O   . THR B 1 386 ? 28.186  43.825  38.820  1.00 94.93  ? 410  THR B O   1 
ATOM   7009 C CB  . THR B 1 386 ? 26.081  42.643  36.487  1.00 120.37 ? 410  THR B CB  1 
ATOM   7010 O OG1 . THR B 1 386 ? 25.183  43.129  35.485  1.00 120.37 ? 410  THR B OG1 1 
ATOM   7011 C CG2 . THR B 1 386 ? 25.312  42.542  37.802  1.00 120.37 ? 410  THR B CG2 1 
ATOM   7012 N N   . LEU B 1 387 ? 28.895  42.095  37.571  1.00 103.47 ? 411  LEU B N   1 
ATOM   7013 C CA  . LEU B 1 387 ? 29.765  41.589  38.622  1.00 103.47 ? 411  LEU B CA  1 
ATOM   7014 C C   . LEU B 1 387 ? 31.029  42.410  38.846  1.00 103.47 ? 411  LEU B C   1 
ATOM   7015 O O   . LEU B 1 387 ? 31.625  42.356  39.928  1.00 103.47 ? 411  LEU B O   1 
ATOM   7016 C CB  . LEU B 1 387 ? 30.178  40.142  38.323  1.00 86.55  ? 411  LEU B CB  1 
ATOM   7017 C CG  . LEU B 1 387 ? 29.255  38.990  38.712  1.00 86.55  ? 411  LEU B CG  1 
ATOM   7018 C CD1 . LEU B 1 387 ? 29.974  37.652  38.497  1.00 86.55  ? 411  LEU B CD1 1 
ATOM   7019 C CD2 . LEU B 1 387 ? 28.860  39.150  40.174  1.00 86.55  ? 411  LEU B CD2 1 
ATOM   7020 N N   . CYS B 1 388 ? 31.438  43.180  37.843  1.00 88.06  ? 412  CYS B N   1 
ATOM   7021 C CA  . CYS B 1 388 ? 32.680  43.928  37.969  1.00 88.06  ? 412  CYS B CA  1 
ATOM   7022 C C   . CYS B 1 388 ? 32.750  45.338  37.444  1.00 88.06  ? 412  CYS B C   1 
ATOM   7023 O O   . CYS B 1 388 ? 33.386  45.613  36.422  1.00 88.06  ? 412  CYS B O   1 
ATOM   7024 C CB  . CYS B 1 388 ? 33.744  43.104  37.330  1.00 107.16 ? 412  CYS B CB  1 
ATOM   7025 S SG  . CYS B 1 388 ? 33.721  41.549  38.230  1.00 107.16 ? 412  CYS B SG  1 
ATOM   7026 N N   . PRO B 1 389 ? 32.135  46.262  38.176  1.00 127.59 ? 413  PRO B N   1 
ATOM   7027 C CA  . PRO B 1 389 ? 32.021  47.698  37.922  1.00 127.59 ? 413  PRO B CA  1 
ATOM   7028 C C   . PRO B 1 389 ? 33.313  48.456  37.631  1.00 127.59 ? 413  PRO B C   1 
ATOM   7029 O O   . PRO B 1 389 ? 33.384  49.268  36.704  1.00 127.59 ? 413  PRO B O   1 
ATOM   7030 C CB  . PRO B 1 389 ? 31.319  48.194  39.178  1.00 65.75  ? 413  PRO B CB  1 
ATOM   7031 C CG  . PRO B 1 389 ? 31.779  47.223  40.221  1.00 65.75  ? 413  PRO B CG  1 
ATOM   7032 C CD  . PRO B 1 389 ? 31.670  45.927  39.532  1.00 65.75  ? 413  PRO B CD  1 
ATOM   7033 N N   . GLN B 1 390 ? 34.332  48.175  38.423  1.00 127.57 ? 414  GLN B N   1 
ATOM   7034 C CA  . GLN B 1 390 ? 35.611  48.846  38.282  1.00 127.57 ? 414  GLN B CA  1 
ATOM   7035 C C   . GLN B 1 390 ? 36.279  48.734  36.908  1.00 127.57 ? 414  GLN B C   1 
ATOM   7036 O O   . GLN B 1 390 ? 36.319  49.709  36.155  1.00 127.57 ? 414  GLN B O   1 
ATOM   7037 C CB  . GLN B 1 390 ? 36.564  48.350  39.378  1.00 346.10 ? 414  GLN B CB  1 
ATOM   7038 C CG  . GLN B 1 390 ? 36.111  48.708  40.797  1.00 346.10 ? 414  GLN B CG  1 
ATOM   7039 C CD  . GLN B 1 390 ? 36.081  50.212  41.047  1.00 346.10 ? 414  GLN B CD  1 
ATOM   7040 O OE1 . GLN B 1 390 ? 37.117  50.877  41.025  1.00 346.10 ? 414  GLN B OE1 1 
ATOM   7041 N NE2 . GLN B 1 390 ? 34.889  50.754  41.283  1.00 346.10 ? 414  GLN B NE2 1 
ATOM   7042 N N   . THR B 1 391 ? 36.795  47.549  36.586  1.00 105.76 ? 415  THR B N   1 
ATOM   7043 C CA  . THR B 1 391 ? 37.491  47.319  35.320  1.00 105.76 ? 415  THR B CA  1 
ATOM   7044 C C   . THR B 1 391 ? 36.617  46.869  34.152  1.00 105.76 ? 415  THR B C   1 
ATOM   7045 O O   . THR B 1 391 ? 35.387  46.839  34.251  1.00 105.76 ? 415  THR B O   1 
ATOM   7046 C CB  . THR B 1 391 ? 38.612  46.271  35.497  1.00 143.99 ? 415  THR B CB  1 
ATOM   7047 O OG1 . THR B 1 391 ? 38.065  45.093  36.100  1.00 143.99 ? 415  THR B OG1 1 
ATOM   7048 C CG2 . THR B 1 391 ? 39.737  46.819  36.374  1.00 143.99 ? 415  THR B CG2 1 
ATOM   7049 N N   . THR B 1 392 ? 37.281  46.542  33.042  1.00 110.54 ? 416  THR B N   1 
ATOM   7050 C CA  . THR B 1 392 ? 36.639  46.055  31.821  1.00 110.54 ? 416  THR B CA  1 
ATOM   7051 C C   . THR B 1 392 ? 37.124  44.628  31.614  1.00 110.54 ? 416  THR B C   1 
ATOM   7052 O O   . THR B 1 392 ? 36.662  43.925  30.708  1.00 110.54 ? 416  THR B O   1 
ATOM   7053 C CB  . THR B 1 392 ? 37.052  46.875  30.573  1.00 150.11 ? 416  THR B CB  1 
ATOM   7054 O OG1 . THR B 1 392 ? 38.479  46.990  30.520  1.00 150.11 ? 416  THR B OG1 1 
ATOM   7055 C CG2 . THR B 1 392 ? 36.444  48.254  30.612  1.00 150.11 ? 416  THR B CG2 1 
ATOM   7056 N N   . LYS B 1 393 ? 38.066  44.222  32.469  1.00 126.31 ? 417  LYS B N   1 
ATOM   7057 C CA  . LYS B 1 393 ? 38.671  42.893  32.422  1.00 126.31 ? 417  LYS B CA  1 
ATOM   7058 C C   . LYS B 1 393 ? 37.950  41.887  33.320  1.00 126.31 ? 417  LYS B C   1 
ATOM   7059 O O   . LYS B 1 393 ? 37.054  42.249  34.088  1.00 126.31 ? 417  LYS B O   1 
ATOM   7060 C CB  . LYS B 1 393 ? 40.155  42.981  32.810  1.00 123.15 ? 417  LYS B CB  1 
ATOM   7061 C CG  . LYS B 1 393 ? 40.984  43.855  31.878  0.00 123.15 ? 417  LYS B CG  1 
ATOM   7062 C CD  . LYS B 1 393 ? 42.450  43.883  32.285  0.00 123.15 ? 417  LYS B CD  1 
ATOM   7063 C CE  . LYS B 1 393 ? 43.261  44.759  31.342  0.00 123.15 ? 417  LYS B CE  1 
ATOM   7064 N NZ  . LYS B 1 393 ? 44.702  44.805  31.714  0.00 123.15 ? 417  LYS B NZ  1 
ATOM   7065 N N   . LEU B 1 394 ? 38.341  40.620  33.205  1.00 107.75 ? 418  LEU B N   1 
ATOM   7066 C CA  . LEU B 1 394 ? 37.741  39.545  33.995  1.00 107.75 ? 418  LEU B CA  1 
ATOM   7067 C C   . LEU B 1 394 ? 38.283  39.590  35.420  1.00 107.75 ? 418  LEU B C   1 
ATOM   7068 O O   . LEU B 1 394 ? 39.402  39.163  35.691  1.00 107.75 ? 418  LEU B O   1 
ATOM   7069 C CB  . LEU B 1 394 ? 38.055  38.183  33.363  1.00 91.22  ? 418  LEU B CB  1 
ATOM   7070 C CG  . LEU B 1 394 ? 36.963  37.109  33.424  1.00 91.22  ? 418  LEU B CG  1 
ATOM   7071 C CD1 . LEU B 1 394 ? 36.502  36.910  34.842  1.00 91.22  ? 418  LEU B CD1 1 
ATOM   7072 C CD2 . LEU B 1 394 ? 35.795  37.532  32.572  1.00 91.22  ? 418  LEU B CD2 1 
ATOM   7073 N N   . CYS B 1 395 ? 37.458  40.113  36.315  1.00 102.46 ? 419  CYS B N   1 
ATOM   7074 C CA  . CYS B 1 395 ? 37.748  40.283  37.742  1.00 102.46 ? 419  CYS B CA  1 
ATOM   7075 C C   . CYS B 1 395 ? 37.718  38.982  38.506  1.00 102.46 ? 419  CYS B C   1 
ATOM   7076 O O   . CYS B 1 395 ? 37.630  37.909  37.925  1.00 102.46 ? 419  CYS B O   1 
ATOM   7077 C CB  . CYS B 1 395 ? 36.678  41.147  38.303  1.00 141.49 ? 419  CYS B CB  1 
ATOM   7078 S SG  . CYS B 1 395 ? 35.249  40.583  37.358  1.00 141.49 ? 419  CYS B SG  1 
ATOM   7079 N N   . ASP B 1 396 ? 37.760  39.093  39.827  1.00 99.16  ? 420  ASP B N   1 
ATOM   7080 C CA  . ASP B 1 396 ? 37.740  37.921  40.692  1.00 99.16  ? 420  ASP B CA  1 
ATOM   7081 C C   . ASP B 1 396 ? 36.329  37.372  40.819  1.00 99.16  ? 420  ASP B C   1 
ATOM   7082 O O   . ASP B 1 396 ? 36.125  36.170  40.984  1.00 99.16  ? 420  ASP B O   1 
ATOM   7083 C CB  . ASP B 1 396 ? 38.281  38.282  42.077  1.00 110.30 ? 420  ASP B CB  1 
ATOM   7084 C CG  . ASP B 1 396 ? 39.759  37.967  42.231  1.00 110.30 ? 420  ASP B CG  1 
ATOM   7085 O OD1 . ASP B 1 396 ? 40.509  38.107  41.237  1.00 110.30 ? 420  ASP B OD1 1 
ATOM   7086 O OD2 . ASP B 1 396 ? 40.167  37.594  43.356  1.00 110.30 ? 420  ASP B OD2 1 
ATOM   7087 N N   . ALA B 1 397 ? 35.348  38.257  40.740  1.00 85.58  ? 421  ALA B N   1 
ATOM   7088 C CA  . ALA B 1 397 ? 33.965  37.827  40.853  1.00 85.58  ? 421  ALA B CA  1 
ATOM   7089 C C   . ALA B 1 397 ? 33.666  36.739  39.825  1.00 85.58  ? 421  ALA B C   1 
ATOM   7090 O O   . ALA B 1 397 ? 33.113  35.696  40.151  1.00 85.58  ? 421  ALA B O   1 
ATOM   7091 C CB  . ALA B 1 397 ? 33.032  39.022  40.655  1.00 261.57 ? 421  ALA B CB  1 
ATOM   7092 N N   . MET B 1 398 ? 34.068  36.986  38.587  1.00 61.10  ? 422  MET B N   1 
ATOM   7093 C CA  . MET B 1 398 ? 33.831  36.065  37.489  1.00 61.10  ? 422  MET B CA  1 
ATOM   7094 C C   . MET B 1 398 ? 34.954  35.086  37.234  1.00 61.10  ? 422  MET B C   1 
ATOM   7095 O O   . MET B 1 398 ? 34.912  34.369  36.238  1.00 61.10  ? 422  MET B O   1 
ATOM   7096 C CB  . MET B 1 398 ? 33.597  36.825  36.187  1.00 77.76  ? 422  MET B CB  1 
ATOM   7097 C CG  . MET B 1 398 ? 32.222  37.375  35.995  1.00 77.76  ? 422  MET B CG  1 
ATOM   7098 S SD  . MET B 1 398 ? 31.858  37.303  34.234  1.00 77.76  ? 422  MET B SD  1 
ATOM   7099 C CE  . MET B 1 398 ? 32.820  38.688  33.676  1.00 77.76  ? 422  MET B CE  1 
ATOM   7100 N N   . LYS B 1 399 ? 35.968  35.048  38.089  1.00 98.35  ? 423  LYS B N   1 
ATOM   7101 C CA  . LYS B 1 399 ? 37.066  34.119  37.840  1.00 98.35  ? 423  LYS B CA  1 
ATOM   7102 C C   . LYS B 1 399 ? 36.409  32.776  37.544  1.00 98.35  ? 423  LYS B C   1 
ATOM   7103 O O   . LYS B 1 399 ? 36.722  32.121  36.544  1.00 98.35  ? 423  LYS B O   1 
ATOM   7104 C CB  . LYS B 1 399 ? 37.980  34.020  39.065  1.00 160.95 ? 423  LYS B CB  1 
ATOM   7105 C CG  . LYS B 1 399 ? 39.478  33.982  38.733  1.00 160.95 ? 423  LYS B CG  1 
ATOM   7106 C CD  . LYS B 1 399 ? 39.968  35.303  38.125  1.00 160.95 ? 423  LYS B CD  1 
ATOM   7107 C CE  . LYS B 1 399 ? 41.488  35.334  37.985  1.00 160.95 ? 423  LYS B CE  1 
ATOM   7108 N NZ  . LYS B 1 399 ? 41.977  36.645  37.472  1.00 160.95 ? 423  LYS B NZ  1 
ATOM   7109 N N   . ILE B 1 400 ? 35.469  32.398  38.412  1.00 94.18  ? 424  ILE B N   1 
ATOM   7110 C CA  . ILE B 1 400 ? 34.718  31.151  38.276  1.00 94.18  ? 424  ILE B CA  1 
ATOM   7111 C C   . ILE B 1 400 ? 33.237  31.479  38.104  1.00 94.18  ? 424  ILE B C   1 
ATOM   7112 O O   . ILE B 1 400 ? 32.562  31.899  39.046  1.00 94.18  ? 424  ILE B O   1 
ATOM   7113 C CB  . ILE B 1 400 ? 34.892  30.242  39.514  1.00 109.15 ? 424  ILE B CB  1 
ATOM   7114 C CG1 . ILE B 1 400 ? 34.582  31.025  40.788  1.00 109.15 ? 424  ILE B CG1 1 
ATOM   7115 C CG2 . ILE B 1 400 ? 36.306  29.691  39.564  1.00 109.15 ? 424  ILE B CG2 1 
ATOM   7116 C CD1 . ILE B 1 400 ? 34.533  30.159  42.019  1.00 109.15 ? 424  ILE B CD1 1 
ATOM   7117 N N   . LEU B 1 401 ? 32.736  31.283  36.892  1.00 116.54 ? 425  LEU B N   1 
ATOM   7118 C CA  . LEU B 1 401 ? 31.346  31.593  36.580  1.00 116.54 ? 425  LEU B CA  1 
ATOM   7119 C C   . LEU B 1 401 ? 30.318  30.748  37.320  1.00 116.54 ? 425  LEU B C   1 
ATOM   7120 O O   . LEU B 1 401 ? 30.604  29.634  37.768  1.00 116.54 ? 425  LEU B O   1 
ATOM   7121 C CB  . LEU B 1 401 ? 31.101  31.456  35.073  1.00 95.06  ? 425  LEU B CB  1 
ATOM   7122 C CG  . LEU B 1 401 ? 31.965  32.283  34.123  1.00 95.06  ? 425  LEU B CG  1 
ATOM   7123 C CD1 . LEU B 1 401 ? 31.828  31.753  32.712  1.00 95.06  ? 425  LEU B CD1 1 
ATOM   7124 C CD2 . LEU B 1 401 ? 31.550  33.736  34.202  1.00 95.06  ? 425  LEU B CD2 1 
ATOM   7125 N N   . ASP B 1 402 ? 29.113  31.302  37.429  1.00 81.35  ? 426  ASP B N   1 
ATOM   7126 C CA  . ASP B 1 402 ? 27.983  30.645  38.077  1.00 81.35  ? 426  ASP B CA  1 
ATOM   7127 C C   . ASP B 1 402 ? 27.048  30.248  36.945  1.00 81.35  ? 426  ASP B C   1 
ATOM   7128 O O   . ASP B 1 402 ? 26.161  31.010  36.571  1.00 81.35  ? 426  ASP B O   1 
ATOM   7129 C CB  . ASP B 1 402 ? 27.261  31.624  39.009  1.00 106.43 ? 426  ASP B CB  1 
ATOM   7130 C CG  . ASP B 1 402 ? 26.131  30.976  39.777  1.00 106.43 ? 426  ASP B CG  1 
ATOM   7131 O OD1 . ASP B 1 402 ? 25.579  29.971  39.282  1.00 106.43 ? 426  ASP B OD1 1 
ATOM   7132 O OD2 . ASP B 1 402 ? 25.787  31.480  40.868  1.00 106.43 ? 426  ASP B OD2 1 
ATOM   7133 N N   . GLY B 1 403 ? 27.257  29.062  36.388  1.00 94.31  ? 427  GLY B N   1 
ATOM   7134 C CA  . GLY B 1 403 ? 26.412  28.614  35.296  1.00 94.31  ? 427  GLY B CA  1 
ATOM   7135 C C   . GLY B 1 403 ? 24.963  29.035  35.439  1.00 94.31  ? 427  GLY B C   1 
ATOM   7136 O O   . GLY B 1 403 ? 24.474  29.865  34.678  1.00 94.31  ? 427  GLY B O   1 
ATOM   7137 N N   . LYS B 1 404 ? 24.289  28.456  36.429  1.00 71.29  ? 428  LYS B N   1 
ATOM   7138 C CA  . LYS B 1 404 ? 22.884  28.723  36.725  1.00 71.29  ? 428  LYS B CA  1 
ATOM   7139 C C   . LYS B 1 404 ? 22.580  30.202  36.540  1.00 71.29  ? 428  LYS B C   1 
ATOM   7140 O O   . LYS B 1 404 ? 21.630  30.565  35.843  1.00 71.29  ? 428  LYS B O   1 
ATOM   7141 C CB  . LYS B 1 404 ? 22.585  28.294  38.163  1.00 114.74 ? 428  LYS B CB  1 
ATOM   7142 C CG  . LYS B 1 404 ? 21.132  28.022  38.488  1.00 114.74 ? 428  LYS B CG  1 
ATOM   7143 C CD  . LYS B 1 404 ? 21.037  27.298  39.834  1.00 114.74 ? 428  LYS B CD  1 
ATOM   7144 C CE  . LYS B 1 404 ? 19.635  26.743  40.088  1.00 114.74 ? 428  LYS B CE  1 
ATOM   7145 N NZ  . LYS B 1 404 ? 19.556  25.843  41.286  1.00 114.74 ? 428  LYS B NZ  1 
ATOM   7146 N N   . LYS B 1 405 ? 23.409  31.044  37.156  1.00 71.61  ? 429  LYS B N   1 
ATOM   7147 C CA  . LYS B 1 405 ? 23.268  32.498  37.086  1.00 71.61  ? 429  LYS B CA  1 
ATOM   7148 C C   . LYS B 1 405 ? 23.334  32.966  35.628  1.00 71.61  ? 429  LYS B C   1 
ATOM   7149 O O   . LYS B 1 405 ? 22.380  33.547  35.120  1.00 71.61  ? 429  LYS B O   1 
ATOM   7150 C CB  . LYS B 1 405 ? 24.389  33.164  37.892  1.00 181.01 ? 429  LYS B CB  1 
ATOM   7151 C CG  . LYS B 1 405 ? 23.938  34.125  38.987  1.00 181.01 ? 429  LYS B CG  1 
ATOM   7152 C CD  . LYS B 1 405 ? 23.160  33.422  40.091  1.00 181.01 ? 429  LYS B CD  1 
ATOM   7153 C CE  . LYS B 1 405 ? 23.154  34.255  41.371  1.00 181.01 ? 429  LYS B CE  1 
ATOM   7154 N NZ  . LYS B 1 405 ? 22.729  35.666  41.142  1.00 181.01 ? 429  LYS B NZ  1 
ATOM   7155 N N   . LEU B 1 406 ? 24.462  32.706  34.967  1.00 77.24  ? 430  LEU B N   1 
ATOM   7156 C CA  . LEU B 1 406 ? 24.655  33.097  33.576  1.00 77.24  ? 430  LEU B CA  1 
ATOM   7157 C C   . LEU B 1 406 ? 23.471  32.675  32.724  1.00 77.24  ? 430  LEU B C   1 
ATOM   7158 O O   . LEU B 1 406 ? 23.087  33.394  31.816  1.00 77.24  ? 430  LEU B O   1 
ATOM   7159 C CB  . LEU B 1 406 ? 25.938  32.472  33.013  1.00 60.67  ? 430  LEU B CB  1 
ATOM   7160 C CG  . LEU B 1 406 ? 26.287  32.725  31.535  1.00 60.67  ? 430  LEU B CG  1 
ATOM   7161 C CD1 . LEU B 1 406 ? 26.498  34.217  31.283  1.00 60.67  ? 430  LEU B CD1 1 
ATOM   7162 C CD2 . LEU B 1 406 ? 27.545  31.962  31.161  1.00 60.67  ? 430  LEU B CD2 1 
ATOM   7163 N N   . TYR B 1 407 ? 22.886  31.518  33.024  1.00 80.37  ? 431  TYR B N   1 
ATOM   7164 C CA  . TYR B 1 407 ? 21.749  31.022  32.258  1.00 80.37  ? 431  TYR B CA  1 
ATOM   7165 C C   . TYR B 1 407 ? 20.437  31.726  32.545  1.00 80.37  ? 431  TYR B C   1 
ATOM   7166 O O   . TYR B 1 407 ? 19.543  31.693  31.717  1.00 80.37  ? 431  TYR B O   1 
ATOM   7167 C CB  . TYR B 1 407 ? 21.549  29.536  32.483  1.00 77.32  ? 431  TYR B CB  1 
ATOM   7168 C CG  . TYR B 1 407 ? 20.480  28.952  31.591  1.00 77.32  ? 431  TYR B CG  1 
ATOM   7169 C CD1 . TYR B 1 407 ? 20.711  28.744  30.232  1.00 77.32  ? 431  TYR B CD1 1 
ATOM   7170 C CD2 . TYR B 1 407 ? 19.230  28.623  32.104  1.00 77.32  ? 431  TYR B CD2 1 
ATOM   7171 C CE1 . TYR B 1 407 ? 19.721  28.223  29.413  1.00 77.32  ? 431  TYR B CE1 1 
ATOM   7172 C CE2 . TYR B 1 407 ? 18.234  28.105  31.286  1.00 77.32  ? 431  TYR B CE2 1 
ATOM   7173 C CZ  . TYR B 1 407 ? 18.488  27.914  29.951  1.00 77.32  ? 431  TYR B CZ  1 
ATOM   7174 O OH  . TYR B 1 407 ? 17.480  27.456  29.162  1.00 77.32  ? 431  TYR B OH  1 
ATOM   7175 N N   . LYS B 1 408 ? 20.317  32.342  33.719  1.00 93.28  ? 432  LYS B N   1 
ATOM   7176 C CA  . LYS B 1 408 ? 19.114  33.106  34.097  1.00 93.28  ? 432  LYS B CA  1 
ATOM   7177 C C   . LYS B 1 408 ? 19.514  34.603  34.218  1.00 93.28  ? 432  LYS B C   1 
ATOM   7178 O O   . LYS B 1 408 ? 19.100  35.337  35.122  1.00 93.28  ? 432  LYS B O   1 
ATOM   7179 C CB  . LYS B 1 408 ? 18.562  32.607  35.430  1.00 136.04 ? 432  LYS B CB  1 
ATOM   7180 C CG  . LYS B 1 408 ? 18.588  31.096  35.612  1.00 136.04 ? 432  LYS B CG  1 
ATOM   7181 C CD  . LYS B 1 408 ? 17.571  30.387  34.752  1.00 136.04 ? 432  LYS B CD  1 
ATOM   7182 C CE  . LYS B 1 408 ? 17.474  28.911  35.136  1.00 136.04 ? 432  LYS B CE  1 
ATOM   7183 N NZ  . LYS B 1 408 ? 17.001  28.705  36.540  1.00 136.04 ? 432  LYS B NZ  1 
ATOM   7184 N N   . GLU B 1 409 ? 20.360  35.005  33.280  1.00 137.91 ? 433  GLU B N   1 
ATOM   7185 C CA  . GLU B 1 409 ? 20.908  36.345  33.125  1.00 137.91 ? 433  GLU B CA  1 
ATOM   7186 C C   . GLU B 1 409 ? 21.226  36.310  31.630  1.00 137.91 ? 433  GLU B C   1 
ATOM   7187 O O   . GLU B 1 409 ? 21.754  37.251  31.051  1.00 137.91 ? 433  GLU B O   1 
ATOM   7188 C CB  . GLU B 1 409 ? 22.174  36.494  34.001  1.00 107.69 ? 433  GLU B CB  1 
ATOM   7189 C CG  . GLU B 1 409 ? 23.391  37.255  33.407  1.00 107.69 ? 433  GLU B CG  1 
ATOM   7190 C CD  . GLU B 1 409 ? 24.104  38.194  34.419  1.00 107.69 ? 433  GLU B CD  1 
ATOM   7191 O OE1 . GLU B 1 409 ? 24.235  37.857  35.618  1.00 107.69 ? 433  GLU B OE1 1 
ATOM   7192 O OE2 . GLU B 1 409 ? 24.554  39.283  34.006  1.00 107.69 ? 433  GLU B OE2 1 
ATOM   7193 N N   . TYR B 1 410 ? 20.853  35.186  31.020  1.00 121.37 ? 434  TYR B N   1 
ATOM   7194 C CA  . TYR B 1 410 ? 21.046  34.909  29.602  1.00 121.37 ? 434  TYR B CA  1 
ATOM   7195 C C   . TYR B 1 410 ? 19.707  34.849  28.882  1.00 121.37 ? 434  TYR B C   1 
ATOM   7196 O O   . TYR B 1 410 ? 19.495  35.531  27.882  1.00 121.37 ? 434  TYR B O   1 
ATOM   7197 C CB  . TYR B 1 410 ? 21.758  33.577  29.426  1.00 134.58 ? 434  TYR B CB  1 
ATOM   7198 C CG  . TYR B 1 410 ? 21.922  33.189  27.990  1.00 134.58 ? 434  TYR B CG  1 
ATOM   7199 C CD1 . TYR B 1 410 ? 22.241  34.147  27.034  1.00 134.58 ? 434  TYR B CD1 1 
ATOM   7200 C CD2 . TYR B 1 410 ? 21.795  31.867  27.584  1.00 134.58 ? 434  TYR B CD2 1 
ATOM   7201 C CE1 . TYR B 1 410 ? 22.432  33.805  25.705  1.00 134.58 ? 434  TYR B CE1 1 
ATOM   7202 C CE2 . TYR B 1 410 ? 21.986  31.505  26.254  1.00 134.58 ? 434  TYR B CE2 1 
ATOM   7203 C CZ  . TYR B 1 410 ? 22.304  32.482  25.315  1.00 134.58 ? 434  TYR B CZ  1 
ATOM   7204 O OH  . TYR B 1 410 ? 22.477  32.149  23.985  1.00 134.58 ? 434  TYR B OH  1 
ATOM   7205 N N   . LEU B 1 411 ? 18.808  34.010  29.376  1.00 103.84 ? 435  LEU B N   1 
ATOM   7206 C CA  . LEU B 1 411 ? 17.495  33.916  28.767  1.00 103.84 ? 435  LEU B CA  1 
ATOM   7207 C C   . LEU B 1 411 ? 16.938  35.326  28.672  1.00 103.84 ? 435  LEU B C   1 
ATOM   7208 O O   . LEU B 1 411 ? 16.463  35.759  27.620  1.00 103.84 ? 435  LEU B O   1 
ATOM   7209 C CB  . LEU B 1 411 ? 16.563  33.059  29.621  1.00 88.93  ? 435  LEU B CB  1 
ATOM   7210 C CG  . LEU B 1 411 ? 16.867  31.558  29.621  1.00 88.93  ? 435  LEU B CG  1 
ATOM   7211 C CD1 . LEU B 1 411 ? 15.748  30.817  30.335  1.00 88.93  ? 435  LEU B CD1 1 
ATOM   7212 C CD2 . LEU B 1 411 ? 16.994  31.032  28.190  1.00 88.93  ? 435  LEU B CD2 1 
ATOM   7213 N N   . LEU B 1 412 ? 17.028  36.043  29.787  1.00 123.18 ? 436  LEU B N   1 
ATOM   7214 C CA  . LEU B 1 412 ? 16.540  37.414  29.895  1.00 123.18 ? 436  LEU B CA  1 
ATOM   7215 C C   . LEU B 1 412 ? 17.241  38.369  28.931  1.00 123.18 ? 436  LEU B C   1 
ATOM   7216 O O   . LEU B 1 412 ? 17.206  39.580  29.124  1.00 123.18 ? 436  LEU B O   1 
ATOM   7217 C CB  . LEU B 1 412 ? 16.719  37.905  31.340  1.00 131.17 ? 436  LEU B CB  1 
ATOM   7218 C CG  . LEU B 1 412 ? 15.874  37.243  32.442  1.00 131.17 ? 436  LEU B CG  1 
ATOM   7219 C CD1 . LEU B 1 412 ? 16.556  37.354  33.806  1.00 131.17 ? 436  LEU B CD1 1 
ATOM   7220 C CD2 . LEU B 1 412 ? 14.496  37.894  32.469  1.00 131.17 ? 436  LEU B CD2 1 
ATOM   7221 N N   . LYS B 1 413 ? 17.858  37.834  27.884  1.00 138.42 ? 437  LYS B N   1 
ATOM   7222 C CA  . LYS B 1 413 ? 18.563  38.676  26.930  1.00 138.42 ? 437  LYS B CA  1 
ATOM   7223 C C   . LYS B 1 413 ? 17.707  39.216  25.789  1.00 138.42 ? 437  LYS B C   1 
ATOM   7224 O O   . LYS B 1 413 ? 16.744  38.573  25.367  1.00 138.42 ? 437  LYS B O   1 
ATOM   7225 C CB  . LYS B 1 413 ? 19.752  37.923  26.344  1.00 160.88 ? 437  LYS B CB  1 
ATOM   7226 C CG  . LYS B 1 413 ? 20.756  38.827  25.665  1.00 160.88 ? 437  LYS B CG  1 
ATOM   7227 C CD  . LYS B 1 413 ? 21.396  39.817  26.658  1.00 160.88 ? 437  LYS B CD  1 
ATOM   7228 C CE  . LYS B 1 413 ? 20.460  40.972  27.062  1.00 160.88 ? 437  LYS B CE  1 
ATOM   7229 N NZ  . LYS B 1 413 ? 21.056  41.934  28.046  1.00 160.88 ? 437  LYS B NZ  1 
ATOM   7230 N N   . ILE B 1 414 ? 18.072  40.406  25.306  1.00 117.47 ? 438  ILE B N   1 
ATOM   7231 C CA  . ILE B 1 414 ? 17.398  41.095  24.194  1.00 117.47 ? 438  ILE B CA  1 
ATOM   7232 C C   . ILE B 1 414 ? 18.419  42.046  23.558  1.00 117.47 ? 438  ILE B C   1 
ATOM   7233 O O   . ILE B 1 414 ? 18.957  42.918  24.236  1.00 117.47 ? 438  ILE B O   1 
ATOM   7234 C CB  . ILE B 1 414 ? 16.172  41.953  24.669  1.00 204.17 ? 438  ILE B CB  1 
ATOM   7235 C CG1 . ILE B 1 414 ? 15.037  41.053  25.180  1.00 204.17 ? 438  ILE B CG1 1 
ATOM   7236 C CG2 . ILE B 1 414 ? 15.666  42.821  23.519  1.00 204.17 ? 438  ILE B CG2 1 
ATOM   7237 C CD1 . ILE B 1 414 ? 13.772  41.811  25.596  1.00 204.17 ? 438  ILE B CD1 1 
ATOM   7238 N N   . GLN B 1 415 ? 18.692  41.884  22.268  1.00 112.17 ? 439  GLN B N   1 
ATOM   7239 C CA  . GLN B 1 415 ? 19.661  42.750  21.600  1.00 112.17 ? 439  GLN B CA  1 
ATOM   7240 C C   . GLN B 1 415 ? 19.408  42.828  20.092  1.00 112.17 ? 439  GLN B C   1 
ATOM   7241 O O   . GLN B 1 415 ? 18.781  41.934  19.510  1.00 112.17 ? 439  GLN B O   1 
ATOM   7242 C CB  . GLN B 1 415 ? 21.096  42.247  21.882  1.00 98.62  ? 439  GLN B CB  1 
ATOM   7243 C CG  . GLN B 1 415 ? 21.841  41.553  20.703  1.00 98.62  ? 439  GLN B CG  1 
ATOM   7244 C CD  . GLN B 1 415 ? 22.055  40.038  20.889  1.00 98.62  ? 439  GLN B CD  1 
ATOM   7245 O OE1 . GLN B 1 415 ? 21.945  39.516  21.994  1.00 98.62  ? 439  GLN B OE1 1 
ATOM   7246 N NE2 . GLN B 1 415 ? 22.375  39.342  19.803  1.00 98.62  ? 439  GLN B NE2 1 
ATOM   7247 N N   . PHE B 1 416 ? 19.876  43.908  19.467  1.00 121.24 ? 440  PHE B N   1 
ATOM   7248 C CA  . PHE B 1 416 ? 19.725  44.080  18.025  1.00 121.24 ? 440  PHE B CA  1 
ATOM   7249 C C   . PHE B 1 416 ? 20.739  43.159  17.371  1.00 121.24 ? 440  PHE B C   1 
ATOM   7250 O O   . PHE B 1 416 ? 21.938  43.288  17.615  1.00 121.24 ? 440  PHE B O   1 
ATOM   7251 C CB  . PHE B 1 416 ? 19.993  45.531  17.628  1.00 309.62 ? 440  PHE B CB  1 
ATOM   7252 C CG  . PHE B 1 416 ? 18.744  46.327  17.356  1.00 309.62 ? 440  PHE B CG  1 
ATOM   7253 C CD1 . PHE B 1 416 ? 18.732  47.707  17.537  1.00 309.62 ? 440  PHE B CD1 1 
ATOM   7254 C CD2 . PHE B 1 416 ? 17.585  45.702  16.898  1.00 309.62 ? 440  PHE B CD2 1 
ATOM   7255 C CE1 . PHE B 1 416 ? 17.584  48.457  17.265  1.00 309.62 ? 440  PHE B CE1 1 
ATOM   7256 C CE2 . PHE B 1 416 ? 16.430  46.442  16.622  1.00 309.62 ? 440  PHE B CE2 1 
ATOM   7257 C CZ  . PHE B 1 416 ? 16.431  47.822  16.807  1.00 309.62 ? 440  PHE B CZ  1 
ATOM   7258 N N   . THR B 1 417 ? 20.251  42.221  16.560  1.00 110.93 ? 441  THR B N   1 
ATOM   7259 C CA  . THR B 1 417 ? 21.114  41.251  15.886  1.00 110.93 ? 441  THR B CA  1 
ATOM   7260 C C   . THR B 1 417 ? 22.441  41.878  15.534  1.00 110.93 ? 441  THR B C   1 
ATOM   7261 O O   . THR B 1 417 ? 22.499  43.064  15.219  1.00 110.93 ? 441  THR B O   1 
ATOM   7262 C CB  . THR B 1 417 ? 20.491  40.725  14.580  1.00 279.26 ? 441  THR B CB  1 
ATOM   7263 O OG1 . THR B 1 417 ? 20.289  41.816  13.676  1.00 279.26 ? 441  THR B OG1 1 
ATOM   7264 C CG2 . THR B 1 417 ? 19.167  40.033  14.856  1.00 279.26 ? 441  THR B CG2 1 
ATOM   7265 N N   . ALA B 1 418 ? 23.506  41.087  15.599  1.00 132.28 ? 442  ALA B N   1 
ATOM   7266 C CA  . ALA B 1 418 ? 24.830  41.595  15.276  1.00 132.28 ? 442  ALA B CA  1 
ATOM   7267 C C   . ALA B 1 418 ? 24.690  42.516  14.063  1.00 132.28 ? 442  ALA B C   1 
ATOM   7268 O O   . ALA B 1 418 ? 24.309  42.055  12.979  1.00 132.28 ? 442  ALA B O   1 
ATOM   7269 C CB  . ALA B 1 418 ? 25.775  40.440  14.970  1.00 132.50 ? 442  ALA B CB  1 
ATOM   7270 N N   . PRO B 1 419 ? 24.995  43.827  14.241  1.00 381.36 ? 443  PRO B N   1 
ATOM   7271 C CA  . PRO B 1 419 ? 24.949  44.940  13.276  1.00 381.36 ? 443  PRO B CA  1 
ATOM   7272 C C   . PRO B 1 419 ? 25.219  44.543  11.834  1.00 381.36 ? 443  PRO B C   1 
ATOM   7273 O O   . PRO B 1 419 ? 25.154  45.358  10.910  1.00 381.36 ? 443  PRO B O   1 
ATOM   7274 C CB  . PRO B 1 419 ? 25.984  45.933  13.827  1.00 230.04 ? 443  PRO B CB  1 
ATOM   7275 C CG  . PRO B 1 419 ? 26.828  45.105  14.770  1.00 230.04 ? 443  PRO B CG  1 
ATOM   7276 C CD  . PRO B 1 419 ? 25.796  44.228  15.409  1.00 230.04 ? 443  PRO B CD  1 
ATOM   7277 N N   . PHE B 1 420 ? 25.525  43.266  11.671  1.00 248.21 ? 444  PHE B N   1 
ATOM   7278 C CA  . PHE B 1 420 ? 25.786  42.644  10.394  1.00 248.21 ? 444  PHE B CA  1 
ATOM   7279 C C   . PHE B 1 420 ? 24.467  42.614  9.627   1.00 248.21 ? 444  PHE B C   1 
ATOM   7280 O O   . PHE B 1 420 ? 24.403  42.165  8.482   1.00 248.21 ? 444  PHE B O   1 
ATOM   7281 C CB  . PHE B 1 420 ? 26.291  41.233  10.662  1.00 149.67 ? 444  PHE B CB  1 
ATOM   7282 C CG  . PHE B 1 420 ? 27.508  41.192  11.540  1.00 149.67 ? 444  PHE B CG  1 
ATOM   7283 C CD1 . PHE B 1 420 ? 27.727  40.124  12.395  1.00 149.67 ? 444  PHE B CD1 1 
ATOM   7284 C CD2 . PHE B 1 420 ? 28.456  42.215  11.488  1.00 149.67 ? 444  PHE B CD2 1 
ATOM   7285 C CE1 . PHE B 1 420 ? 28.874  40.075  13.184  1.00 149.67 ? 444  PHE B CE1 1 
ATOM   7286 C CE2 . PHE B 1 420 ? 29.606  42.176  12.271  1.00 149.67 ? 444  PHE B CE2 1 
ATOM   7287 C CZ  . PHE B 1 420 ? 29.818  41.107  13.119  1.00 149.67 ? 444  PHE B CZ  1 
ATOM   7288 N N   . ASN B 1 421 ? 23.417  43.096  10.288  1.00 141.76 ? 445  ASN B N   1 
ATOM   7289 C CA  . ASN B 1 421 ? 22.078  43.161  9.716   1.00 141.76 ? 445  ASN B CA  1 
ATOM   7290 C C   . ASN B 1 421 ? 21.717  44.603  9.348   1.00 141.76 ? 445  ASN B C   1 
ATOM   7291 O O   . ASN B 1 421 ? 21.852  45.521  10.165  1.00 141.76 ? 445  ASN B O   1 
ATOM   7292 C CB  . ASN B 1 421 ? 21.061  42.609  10.714  1.00 226.31 ? 445  ASN B CB  1 
ATOM   7293 C CG  . ASN B 1 421 ? 19.685  43.222  10.543  1.00 226.31 ? 445  ASN B CG  1 
ATOM   7294 O OD1 . ASN B 1 421 ? 19.090  43.153  9.467   1.00 226.31 ? 445  ASN B OD1 1 
ATOM   7295 N ND2 . ASN B 1 421 ? 19.172  43.829  11.610  1.00 226.31 ? 445  ASN B ND2 1 
ATOM   7296 N N   . PRO B 1 422 ? 21.244  44.817  8.107   1.00 360.93 ? 446  PRO B N   1 
ATOM   7297 C CA  . PRO B 1 422 ? 20.862  46.147  7.620   1.00 360.93 ? 446  PRO B CA  1 
ATOM   7298 C C   . PRO B 1 422 ? 19.695  46.789  8.369   1.00 360.93 ? 446  PRO B C   1 
ATOM   7299 O O   . PRO B 1 422 ? 19.876  47.776  9.084   1.00 360.93 ? 446  PRO B O   1 
ATOM   7300 C CB  . PRO B 1 422 ? 20.545  45.895  6.146   1.00 271.18 ? 446  PRO B CB  1 
ATOM   7301 C CG  . PRO B 1 422 ? 20.028  44.487  6.153   1.00 271.18 ? 446  PRO B CG  1 
ATOM   7302 C CD  . PRO B 1 422 ? 21.007  43.793  7.072   1.00 271.18 ? 446  PRO B CD  1 
ATOM   7303 N N   . ASN B 1 423 ? 18.502  46.225  8.206   1.00 319.44 ? 447  ASN B N   1 
ATOM   7304 C CA  . ASN B 1 423 ? 17.312  46.761  8.858   1.00 319.44 ? 447  ASN B CA  1 
ATOM   7305 C C   . ASN B 1 423 ? 17.319  46.558  10.372  1.00 319.44 ? 447  ASN B C   1 
ATOM   7306 O O   . ASN B 1 423 ? 18.277  46.036  10.939  1.00 319.44 ? 447  ASN B O   1 
ATOM   7307 C CB  . ASN B 1 423 ? 16.041  46.138  8.248   1.00 179.16 ? 447  ASN B CB  1 
ATOM   7308 C CG  . ASN B 1 423 ? 15.874  44.664  8.593   1.00 179.16 ? 447  ASN B CG  1 
ATOM   7309 O OD1 . ASN B 1 423 ? 15.696  44.303  9.756   1.00 179.16 ? 447  ASN B OD1 1 
ATOM   7310 N ND2 . ASN B 1 423 ? 15.922  43.809  7.576   1.00 179.16 ? 447  ASN B ND2 1 
ATOM   7311 N N   . LYS B 1 424 ? 16.244  46.997  11.016  1.00 189.49 ? 448  LYS B N   1 
ATOM   7312 C CA  . LYS B 1 424 ? 16.077  46.874  12.459  1.00 189.49 ? 448  LYS B CA  1 
ATOM   7313 C C   . LYS B 1 424 ? 14.597  46.610  12.702  1.00 189.49 ? 448  LYS B C   1 
ATOM   7314 O O   . LYS B 1 424 ? 14.206  45.997  13.700  1.00 189.49 ? 448  LYS B O   1 
ATOM   7315 C CB  . LYS B 1 424 ? 16.488  48.172  13.163  1.00 249.52 ? 448  LYS B CB  1 
ATOM   7316 C CG  . LYS B 1 424 ? 17.952  48.568  12.991  1.00 249.52 ? 448  LYS B CG  1 
ATOM   7317 C CD  . LYS B 1 424 ? 18.295  49.781  13.860  1.00 249.52 ? 448  LYS B CD  1 
ATOM   7318 C CE  . LYS B 1 424 ? 19.780  50.137  13.796  1.00 249.52 ? 448  LYS B CE  1 
ATOM   7319 N NZ  . LYS B 1 424 ? 20.141  51.241  14.737  1.00 249.52 ? 448  LYS B NZ  1 
ATOM   7320 N N   . GLY B 1 425 ? 13.784  47.085  11.762  1.00 210.16 ? 449  GLY B N   1 
ATOM   7321 C CA  . GLY B 1 425 ? 12.346  46.919  11.846  1.00 210.16 ? 449  GLY B CA  1 
ATOM   7322 C C   . GLY B 1 425 ? 11.854  45.659  11.164  1.00 210.16 ? 449  GLY B C   1 
ATOM   7323 O O   . GLY B 1 425 ? 11.305  45.699  10.061  1.00 210.16 ? 449  GLY B O   1 
ATOM   7324 N N   . ALA B 1 426 ? 12.059  44.533  11.837  1.00 309.38 ? 450  ALA B N   1 
ATOM   7325 C CA  . ALA B 1 426 ? 11.646  43.228  11.342  1.00 309.38 ? 450  ALA B CA  1 
ATOM   7326 C C   . ALA B 1 426 ? 11.789  42.270  12.515  1.00 309.38 ? 450  ALA B C   1 
ATOM   7327 O O   . ALA B 1 426 ? 11.930  41.058  12.339  1.00 309.38 ? 450  ALA B O   1 
ATOM   7328 C CB  . ALA B 1 426 ? 12.543  42.792  10.188  1.00 259.26 ? 450  ALA B CB  1 
ATOM   7329 N N   . ASP B 1 427 ? 11.749  42.840  13.717  1.00 273.04 ? 451  ASP B N   1 
ATOM   7330 C CA  . ASP B 1 427 ? 11.889  42.075  14.946  1.00 273.04 ? 451  ASP B CA  1 
ATOM   7331 C C   . ASP B 1 427 ? 13.207  41.316  14.855  1.00 273.04 ? 451  ASP B C   1 
ATOM   7332 O O   . ASP B 1 427 ? 13.344  40.204  15.366  1.00 273.04 ? 451  ASP B O   1 
ATOM   7333 C CB  . ASP B 1 427 ? 10.712  41.106  15.109  1.00 247.27 ? 451  ASP B CB  1 
ATOM   7334 C CG  . ASP B 1 427 ? 10.570  40.588  16.531  1.00 247.27 ? 451  ASP B CG  1 
ATOM   7335 O OD1 . ASP B 1 427 ? 11.469  39.855  16.994  1.00 247.27 ? 451  ASP B OD1 1 
ATOM   7336 O OD2 . ASP B 1 427 ? 9.559   40.917  17.187  1.00 247.27 ? 451  ASP B OD2 1 
ATOM   7337 N N   . SER B 1 428 ? 14.173  41.934  14.181  1.00 204.85 ? 452  SER B N   1 
ATOM   7338 C CA  . SER B 1 428 ? 15.494  41.345  14.011  1.00 204.85 ? 452  SER B CA  1 
ATOM   7339 C C   . SER B 1 428 ? 16.287  41.554  15.291  1.00 204.85 ? 452  SER B C   1 
ATOM   7340 O O   . SER B 1 428 ? 17.384  42.109  15.273  1.00 204.85 ? 452  SER B O   1 
ATOM   7341 C CB  . SER B 1 428 ? 16.230  42.000  12.839  1.00 143.20 ? 452  SER B CB  1 
ATOM   7342 O OG  . SER B 1 428 ? 16.477  43.373  13.089  1.00 143.20 ? 452  SER B OG  1 
ATOM   7343 N N   . ILE B 1 429 ? 15.710  41.133  16.409  1.00 203.79 ? 453  ILE B N   1 
ATOM   7344 C CA  . ILE B 1 429 ? 16.375  41.254  17.697  1.00 203.79 ? 453  ILE B CA  1 
ATOM   7345 C C   . ILE B 1 429 ? 16.384  39.860  18.302  1.00 203.79 ? 453  ILE B C   1 
ATOM   7346 O O   . ILE B 1 429 ? 15.370  39.157  18.284  1.00 203.79 ? 453  ILE B O   1 
ATOM   7347 C CB  . ILE B 1 429 ? 15.636  42.231  18.646  1.00 163.58 ? 453  ILE B CB  1 
ATOM   7348 C CG1 . ILE B 1 429 ? 14.408  41.556  19.261  1.00 163.58 ? 453  ILE B CG1 1 
ATOM   7349 C CG2 . ILE B 1 429 ? 15.197  43.465  17.876  1.00 163.58 ? 453  ILE B CG2 1 
ATOM   7350 C CD1 . ILE B 1 429 ? 13.837  42.297  20.457  1.00 163.58 ? 453  ILE B CD1 1 
ATOM   7351 N N   . VAL B 1 430 ? 17.531  39.449  18.824  1.00 127.38 ? 454  VAL B N   1 
ATOM   7352 C CA  . VAL B 1 430 ? 17.628  38.122  19.399  1.00 127.38 ? 454  VAL B CA  1 
ATOM   7353 C C   . VAL B 1 430 ? 17.131  38.147  20.832  1.00 127.38 ? 454  VAL B C   1 
ATOM   7354 O O   . VAL B 1 430 ? 17.388  39.096  21.570  1.00 127.38 ? 454  VAL B O   1 
ATOM   7355 C CB  . VAL B 1 430 ? 19.087  37.600  19.340  1.00 103.34 ? 454  VAL B CB  1 
ATOM   7356 C CG1 . VAL B 1 430 ? 19.813  38.253  18.183  1.00 103.34 ? 454  VAL B CG1 1 
ATOM   7357 C CG2 . VAL B 1 430 ? 19.814  37.878  20.630  1.00 103.34 ? 454  VAL B CG2 1 
ATOM   7358 N N   . LYS B 1 431 ? 16.388  37.114  21.206  1.00 91.95  ? 455  LYS B N   1 
ATOM   7359 C CA  . LYS B 1 431 ? 15.858  36.970  22.557  1.00 91.95  ? 455  LYS B CA  1 
ATOM   7360 C C   . LYS B 1 431 ? 15.359  35.541  22.658  1.00 91.95  ? 455  LYS B C   1 
ATOM   7361 O O   . LYS B 1 431 ? 15.425  34.800  21.676  1.00 91.95  ? 455  LYS B O   1 
ATOM   7362 C CB  . LYS B 1 431 ? 14.726  37.964  22.815  1.00 193.23 ? 455  LYS B CB  1 
ATOM   7363 C CG  . LYS B 1 431 ? 13.554  37.857  21.867  1.00 193.23 ? 455  LYS B CG  1 
ATOM   7364 C CD  . LYS B 1 431 ? 12.471  38.857  22.252  1.00 193.23 ? 455  LYS B CD  1 
ATOM   7365 C CE  . LYS B 1 431 ? 11.242  38.746  21.357  1.00 193.23 ? 455  LYS B CE  1 
ATOM   7366 N NZ  . LYS B 1 431 ? 10.191  39.746  21.710  1.00 193.23 ? 455  LYS B NZ  1 
ATOM   7367 N N   . PHE B 1 432 ? 14.876  35.137  23.829  1.00 100.61 ? 456  PHE B N   1 
ATOM   7368 C CA  . PHE B 1 432 ? 14.390  33.766  23.991  1.00 100.61 ? 456  PHE B CA  1 
ATOM   7369 C C   . PHE B 1 432 ? 13.021  33.721  24.667  1.00 100.61 ? 456  PHE B C   1 
ATOM   7370 O O   . PHE B 1 432 ? 12.676  34.609  25.438  1.00 100.61 ? 456  PHE B O   1 
ATOM   7371 C CB  . PHE B 1 432 ? 15.382  32.922  24.823  1.00 79.04  ? 456  PHE B CB  1 
ATOM   7372 C CG  . PHE B 1 432 ? 16.822  32.974  24.334  1.00 79.04  ? 456  PHE B CG  1 
ATOM   7373 C CD1 . PHE B 1 432 ? 17.713  33.896  24.862  1.00 79.04  ? 456  PHE B CD1 1 
ATOM   7374 C CD2 . PHE B 1 432 ? 17.286  32.090  23.361  1.00 79.04  ? 456  PHE B CD2 1 
ATOM   7375 C CE1 . PHE B 1 432 ? 19.032  33.934  24.431  1.00 79.04  ? 456  PHE B CE1 1 
ATOM   7376 C CE2 . PHE B 1 432 ? 18.608  32.124  22.926  1.00 79.04  ? 456  PHE B CE2 1 
ATOM   7377 C CZ  . PHE B 1 432 ? 19.477  33.041  23.457  1.00 79.04  ? 456  PHE B CZ  1 
ATOM   7378 N N   . ASP B 1 433 ? 12.244  32.683  24.374  1.00 132.96 ? 457  ASP B N   1 
ATOM   7379 C CA  . ASP B 1 433 ? 10.931  32.518  24.988  1.00 132.96 ? 457  ASP B CA  1 
ATOM   7380 C C   . ASP B 1 433 ? 11.121  32.038  26.416  1.00 132.96 ? 457  ASP B C   1 
ATOM   7381 O O   . ASP B 1 433 ? 12.244  31.948  26.906  1.00 132.96 ? 457  ASP B O   1 
ATOM   7382 C CB  . ASP B 1 433 ? 10.105  31.460  24.257  1.00 180.43 ? 457  ASP B CB  1 
ATOM   7383 C CG  . ASP B 1 433 ? 9.724   31.878  22.864  1.00 180.43 ? 457  ASP B CG  1 
ATOM   7384 O OD1 . ASP B 1 433 ? 9.682   33.095  22.602  1.00 180.43 ? 457  ASP B OD1 1 
ATOM   7385 O OD2 . ASP B 1 433 ? 9.447   30.987  22.034  1.00 180.43 ? 457  ASP B OD2 1 
ATOM   7386 N N   . THR B 1 434 ? 10.013  31.722  27.076  1.00 123.55 ? 458  THR B N   1 
ATOM   7387 C CA  . THR B 1 434 ? 10.059  31.207  28.441  1.00 123.55 ? 458  THR B CA  1 
ATOM   7388 C C   . THR B 1 434 ? 10.592  29.781  28.378  1.00 123.55 ? 458  THR B C   1 
ATOM   7389 O O   . THR B 1 434 ? 10.742  29.119  29.409  1.00 123.55 ? 458  THR B O   1 
ATOM   7390 C CB  . THR B 1 434 ? 8.657   31.172  29.089  1.00 191.39 ? 458  THR B CB  1 
ATOM   7391 O OG1 . THR B 1 434 ? 7.674   30.859  28.094  1.00 191.39 ? 458  THR B OG1 1 
ATOM   7392 C CG2 . THR B 1 434 ? 8.334   32.498  29.737  1.00 191.39 ? 458  THR B CG2 1 
ATOM   7393 N N   . PHE B 1 435 ? 10.865  29.318  27.154  1.00 117.91 ? 459  PHE B N   1 
ATOM   7394 C CA  . PHE B 1 435 ? 11.381  27.967  26.917  1.00 117.91 ? 459  PHE B CA  1 
ATOM   7395 C C   . PHE B 1 435 ? 12.812  28.015  26.392  1.00 117.91 ? 459  PHE B C   1 
ATOM   7396 O O   . PHE B 1 435 ? 13.492  26.994  26.315  1.00 117.91 ? 459  PHE B O   1 
ATOM   7397 C CB  . PHE B 1 435 ? 10.517  27.215  25.895  1.00 189.92 ? 459  PHE B CB  1 
ATOM   7398 C CG  . PHE B 1 435 ? 9.048   27.236  26.194  1.00 189.92 ? 459  PHE B CG  1 
ATOM   7399 C CD1 . PHE B 1 435 ? 8.225   28.201  25.621  1.00 189.92 ? 459  PHE B CD1 1 
ATOM   7400 C CD2 . PHE B 1 435 ? 8.485   26.289  27.043  1.00 189.92 ? 459  PHE B CD2 1 
ATOM   7401 C CE1 . PHE B 1 435 ? 6.861   28.224  25.886  1.00 189.92 ? 459  PHE B CE1 1 
ATOM   7402 C CE2 . PHE B 1 435 ? 7.123   26.300  27.317  1.00 189.92 ? 459  PHE B CE2 1 
ATOM   7403 C CZ  . PHE B 1 435 ? 6.307   27.271  26.736  1.00 189.92 ? 459  PHE B CZ  1 
ATOM   7404 N N   . GLY B 1 436 ? 13.257  29.203  26.005  1.00 118.84 ? 460  GLY B N   1 
ATOM   7405 C CA  . GLY B 1 436 ? 14.608  29.330  25.504  1.00 118.84 ? 460  GLY B CA  1 
ATOM   7406 C C   . GLY B 1 436 ? 14.726  29.029  24.027  1.00 118.84 ? 460  GLY B C   1 
ATOM   7407 O O   . GLY B 1 436 ? 15.808  28.712  23.533  1.00 118.84 ? 460  GLY B O   1 
ATOM   7408 N N   . ASP B 1 437 ? 13.610  29.117  23.318  1.00 113.30 ? 461  ASP B N   1 
ATOM   7409 C CA  . ASP B 1 437 ? 13.623  28.878  21.884  1.00 113.30 ? 461  ASP B CA  1 
ATOM   7410 C C   . ASP B 1 437 ? 13.403  30.196  21.148  1.00 113.30 ? 461  ASP B C   1 
ATOM   7411 O O   . ASP B 1 437 ? 13.305  31.249  21.782  1.00 113.30 ? 461  ASP B O   1 
ATOM   7412 C CB  . ASP B 1 437 ? 12.564  27.843  21.505  1.00 135.57 ? 461  ASP B CB  1 
ATOM   7413 C CG  . ASP B 1 437 ? 11.393  27.833  22.457  1.00 135.57 ? 461  ASP B CG  1 
ATOM   7414 O OD1 . ASP B 1 437 ? 10.613  26.855  22.402  1.00 135.57 ? 461  ASP B OD1 1 
ATOM   7415 O OD2 . ASP B 1 437 ? 11.249  28.793  23.252  1.00 135.57 ? 461  ASP B OD2 1 
ATOM   7416 N N   . GLY B 1 438 ? 13.336  30.148  19.820  1.00 124.93 ? 462  GLY B N   1 
ATOM   7417 C CA  . GLY B 1 438 ? 13.161  31.371  19.052  1.00 124.93 ? 462  GLY B CA  1 
ATOM   7418 C C   . GLY B 1 438 ? 11.810  31.585  18.386  1.00 124.93 ? 462  GLY B C   1 
ATOM   7419 O O   . GLY B 1 438 ? 10.829  30.887  18.678  1.00 124.93 ? 462  GLY B O   1 
ATOM   7420 N N   . MET B 1 439 ? 11.774  32.560  17.476  1.00 160.23 ? 463  MET B N   1 
ATOM   7421 C CA  . MET B 1 439 ? 10.562  32.921  16.741  1.00 160.23 ? 463  MET B CA  1 
ATOM   7422 C C   . MET B 1 439 ? 10.272  32.003  15.547  1.00 160.23 ? 463  MET B C   1 
ATOM   7423 O O   . MET B 1 439 ? 11.141  31.781  14.698  1.00 160.23 ? 463  MET B O   1 
ATOM   7424 C CB  . MET B 1 439 ? 10.666  34.374  16.257  1.00 225.17 ? 463  MET B CB  1 
ATOM   7425 C CG  . MET B 1 439 ? 10.809  35.400  17.375  1.00 225.17 ? 463  MET B CG  1 
ATOM   7426 S SD  . MET B 1 439 ? 9.388   35.420  18.497  1.00 225.17 ? 463  MET B SD  1 
ATOM   7427 C CE  . MET B 1 439 ? 8.362   36.682  17.752  1.00 225.17 ? 463  MET B CE  1 
ATOM   7428 N N   . GLY B 1 440 ? 9.038   31.498  15.480  1.00 156.72 ? 464  GLY B N   1 
ATOM   7429 C CA  . GLY B 1 440 ? 8.639   30.607  14.401  1.00 156.72 ? 464  GLY B CA  1 
ATOM   7430 C C   . GLY B 1 440 ? 8.321   31.245  13.054  1.00 156.72 ? 464  GLY B C   1 
ATOM   7431 O O   . GLY B 1 440 ? 7.157   31.363  12.677  1.00 156.72 ? 464  GLY B O   1 
ATOM   7432 N N   . ARG B 1 441 ? 9.357   31.651  12.324  1.00 127.64 ? 465  ARG B N   1 
ATOM   7433 C CA  . ARG B 1 441 ? 9.198   32.258  11.003  1.00 127.64 ? 465  ARG B CA  1 
ATOM   7434 C C   . ARG B 1 441 ? 9.846   31.354  9.949   1.00 127.64 ? 465  ARG B C   1 
ATOM   7435 O O   . ARG B 1 441 ? 11.066  31.190  9.932   1.00 127.64 ? 465  ARG B O   1 
ATOM   7436 C CB  . ARG B 1 441 ? 9.876   33.632  10.962  1.00 287.29 ? 465  ARG B CB  1 
ATOM   7437 C CG  . ARG B 1 441 ? 9.205   34.719  11.788  1.00 287.29 ? 465  ARG B CG  1 
ATOM   7438 C CD  . ARG B 1 441 ? 7.847   35.097  11.216  1.00 287.29 ? 465  ARG B CD  1 
ATOM   7439 N NE  . ARG B 1 441 ? 7.358   36.365  11.754  1.00 287.29 ? 465  ARG B NE  1 
ATOM   7440 C CZ  . ARG B 1 441 ? 7.959   37.537  11.567  1.00 287.29 ? 465  ARG B CZ  1 
ATOM   7441 N NH1 . ARG B 1 441 ? 9.076   37.608  10.855  1.00 287.29 ? 465  ARG B NH1 1 
ATOM   7442 N NH2 . ARG B 1 441 ? 7.441   38.640  12.091  1.00 287.29 ? 465  ARG B NH2 1 
ATOM   7443 N N   . TYR B 1 442 ? 9.044   30.769  9.066   1.00 157.86 ? 466  TYR B N   1 
ATOM   7444 C CA  . TYR B 1 442 ? 9.604   29.892  8.048   1.00 157.86 ? 466  TYR B CA  1 
ATOM   7445 C C   . TYR B 1 442 ? 9.318   30.376  6.644   1.00 157.86 ? 466  TYR B C   1 
ATOM   7446 O O   . TYR B 1 442 ? 8.362   31.113  6.413   1.00 157.86 ? 466  TYR B O   1 
ATOM   7447 C CB  . TYR B 1 442 ? 9.046   28.483  8.187   1.00 151.66 ? 466  TYR B CB  1 
ATOM   7448 C CG  . TYR B 1 442 ? 9.077   27.948  9.586   1.00 151.66 ? 466  TYR B CG  1 
ATOM   7449 C CD1 . TYR B 1 442 ? 8.157   28.384  10.536  1.00 151.66 ? 466  TYR B CD1 1 
ATOM   7450 C CD2 . TYR B 1 442 ? 10.011  26.992  9.959   1.00 151.66 ? 466  TYR B CD2 1 
ATOM   7451 C CE1 . TYR B 1 442 ? 8.162   27.876  11.824  1.00 151.66 ? 466  TYR B CE1 1 
ATOM   7452 C CE2 . TYR B 1 442 ? 10.028  26.477  11.244  1.00 151.66 ? 466  TYR B CE2 1 
ATOM   7453 C CZ  . TYR B 1 442 ? 9.098   26.922  12.172  1.00 151.66 ? 466  TYR B CZ  1 
ATOM   7454 O OH  . TYR B 1 442 ? 9.095   26.401  13.443  1.00 151.66 ? 466  TYR B OH  1 
ATOM   7455 N N   . ASN B 1 443 ? 10.156  29.950  5.707   1.00 158.24 ? 467  ASN B N   1 
ATOM   7456 C CA  . ASN B 1 443 ? 9.983   30.312  4.308   1.00 158.24 ? 467  ASN B CA  1 
ATOM   7457 C C   . ASN B 1 443 ? 9.617   29.082  3.494   1.00 158.24 ? 467  ASN B C   1 
ATOM   7458 O O   . ASN B 1 443 ? 10.227  28.022  3.644   1.00 158.24 ? 467  ASN B O   1 
ATOM   7459 C CB  . ASN B 1 443 ? 11.258  30.932  3.741   1.00 203.66 ? 467  ASN B CB  1 
ATOM   7460 C CG  . ASN B 1 443 ? 11.507  32.325  4.268   1.00 203.66 ? 467  ASN B CG  1 
ATOM   7461 O OD1 . ASN B 1 443 ? 10.570  33.096  4.476   1.00 203.66 ? 467  ASN B OD1 1 
ATOM   7462 N ND2 . ASN B 1 443 ? 12.775  32.666  4.471   1.00 203.66 ? 467  ASN B ND2 1 
ATOM   7463 N N   . VAL B 1 444 ? 8.614   29.225  2.634   1.00 104.79 ? 468  VAL B N   1 
ATOM   7464 C CA  . VAL B 1 444 ? 8.175   28.122  1.799   1.00 104.79 ? 468  VAL B CA  1 
ATOM   7465 C C   . VAL B 1 444 ? 8.950   28.153  0.486   1.00 104.79 ? 468  VAL B C   1 
ATOM   7466 O O   . VAL B 1 444 ? 9.093   29.205  -0.144  1.00 104.79 ? 468  VAL B O   1 
ATOM   7467 C CB  . VAL B 1 444 ? 6.668   28.213  1.507   1.00 176.84 ? 468  VAL B CB  1 
ATOM   7468 C CG1 . VAL B 1 444 ? 6.192   26.928  0.837   1.00 176.84 ? 468  VAL B CG1 1 
ATOM   7469 C CG2 . VAL B 1 444 ? 5.906   28.469  2.800   1.00 176.84 ? 468  VAL B CG2 1 
ATOM   7470 N N   . PHE B 1 445 ? 9.455   26.995  0.078   1.00 179.91 ? 469  PHE B N   1 
ATOM   7471 C CA  . PHE B 1 445 ? 10.233  26.908  -1.146  1.00 179.91 ? 469  PHE B CA  1 
ATOM   7472 C C   . PHE B 1 445 ? 9.688   25.939  -2.178  1.00 179.91 ? 469  PHE B C   1 
ATOM   7473 O O   . PHE B 1 445 ? 8.936   25.017  -1.866  1.00 179.91 ? 469  PHE B O   1 
ATOM   7474 C CB  . PHE B 1 445 ? 11.683  26.532  -0.819  1.00 173.65 ? 469  PHE B CB  1 
ATOM   7475 C CG  . PHE B 1 445 ? 12.510  27.681  -0.318  1.00 173.65 ? 469  PHE B CG  1 
ATOM   7476 C CD1 . PHE B 1 445 ? 12.045  28.498  0.709   1.00 173.65 ? 469  PHE B CD1 1 
ATOM   7477 C CD2 . PHE B 1 445 ? 13.749  27.960  -0.884  1.00 173.65 ? 469  PHE B CD2 1 
ATOM   7478 C CE1 . PHE B 1 445 ? 12.800  29.579  1.163   1.00 173.65 ? 469  PHE B CE1 1 
ATOM   7479 C CE2 . PHE B 1 445 ? 14.513  29.039  -0.437  1.00 173.65 ? 469  PHE B CE2 1 
ATOM   7480 C CZ  . PHE B 1 445 ? 14.037  29.851  0.589   1.00 173.65 ? 469  PHE B CZ  1 
ATOM   7481 N N   . ASN B 1 446 ? 10.091  26.175  -3.418  1.00 116.84 ? 470  ASN B N   1 
ATOM   7482 C CA  . ASN B 1 446 ? 9.706   25.349  -4.551  1.00 116.84 ? 470  ASN B CA  1 
ATOM   7483 C C   . ASN B 1 446 ? 10.975  25.015  -5.339  1.00 116.84 ? 470  ASN B C   1 
ATOM   7484 O O   . ASN B 1 446 ? 11.716  25.910  -5.761  1.00 116.84 ? 470  ASN B O   1 
ATOM   7485 C CB  . ASN B 1 446 ? 8.729   26.109  -5.453  1.00 163.67 ? 470  ASN B CB  1 
ATOM   7486 C CG  . ASN B 1 446 ? 8.373   25.336  -6.707  1.00 163.67 ? 470  ASN B CG  1 
ATOM   7487 O OD1 . ASN B 1 446 ? 7.860   25.906  -7.674  1.00 163.67 ? 470  ASN B OD1 1 
ATOM   7488 N ND2 . ASN B 1 446 ? 8.636   24.030  -6.696  1.00 163.67 ? 470  ASN B ND2 1 
ATOM   7489 N N   . LEU B 1 447 ? 11.234  23.729  -5.527  1.00 161.64 ? 471  LEU B N   1 
ATOM   7490 C CA  . LEU B 1 447 ? 12.414  23.322  -6.271  1.00 161.64 ? 471  LEU B CA  1 
ATOM   7491 C C   . LEU B 1 447 ? 12.123  23.344  -7.762  1.00 161.64 ? 471  LEU B C   1 
ATOM   7492 O O   . LEU B 1 447 ? 11.385  22.493  -8.253  1.00 161.64 ? 471  LEU B O   1 
ATOM   7493 C CB  . LEU B 1 447 ? 12.841  21.913  -5.867  1.00 116.08 ? 471  LEU B CB  1 
ATOM   7494 C CG  . LEU B 1 447 ? 13.891  21.316  -6.812  1.00 116.08 ? 471  LEU B CG  1 
ATOM   7495 C CD1 . LEU B 1 447 ? 15.101  22.254  -6.872  1.00 116.08 ? 471  LEU B CD1 1 
ATOM   7496 C CD2 . LEU B 1 447 ? 14.293  19.922  -6.352  1.00 116.08 ? 471  LEU B CD2 1 
ATOM   7497 N N   . GLN B 1 448 ? 12.711  24.298  -8.482  1.00 338.22 ? 472  GLN B N   1 
ATOM   7498 C CA  . GLN B 1 448 ? 12.484  24.409  -9.921  1.00 338.22 ? 472  GLN B CA  1 
ATOM   7499 C C   . GLN B 1 448 ? 13.725  24.655  -10.775 1.00 338.22 ? 472  GLN B C   1 
ATOM   7500 O O   . GLN B 1 448 ? 14.739  25.168  -10.302 1.00 338.22 ? 472  GLN B O   1 
ATOM   7501 C CB  . GLN B 1 448 ? 11.465  25.512  -10.201 1.00 193.26 ? 472  GLN B CB  1 
ATOM   7502 C CG  . GLN B 1 448 ? 11.691  26.775  -9.397  1.00 193.26 ? 472  GLN B CG  1 
ATOM   7503 C CD  . GLN B 1 448 ? 10.818  27.916  -9.870  1.00 193.26 ? 472  GLN B CD  1 
ATOM   7504 O OE1 . GLN B 1 448 ? 11.113  28.559  -10.877 1.00 193.26 ? 472  GLN B OE1 1 
ATOM   7505 N NE2 . GLN B 1 448 ? 9.726   28.165  -9.154  1.00 193.26 ? 472  GLN B NE2 1 
ATOM   7506 N N   . GLN B 1 449 ? 13.615  24.285  -12.047 1.00 207.62 ? 473  GLN B N   1 
ATOM   7507 C CA  . GLN B 1 449 ? 14.686  24.444  -13.023 1.00 207.62 ? 473  GLN B CA  1 
ATOM   7508 C C   . GLN B 1 449 ? 14.108  25.129  -14.262 1.00 207.62 ? 473  GLN B C   1 
ATOM   7509 O O   . GLN B 1 449 ? 13.041  24.750  -14.748 1.00 207.62 ? 473  GLN B O   1 
ATOM   7510 C CB  . GLN B 1 449 ? 15.261  23.068  -13.387 1.00 254.34 ? 473  GLN B CB  1 
ATOM   7511 C CG  . GLN B 1 449 ? 16.228  23.048  -14.569 1.00 254.34 ? 473  GLN B CG  1 
ATOM   7512 C CD  . GLN B 1 449 ? 15.525  23.119  -15.919 1.00 254.34 ? 473  GLN B CD  1 
ATOM   7513 O OE1 . GLN B 1 449 ? 14.660  22.300  -16.224 1.00 254.34 ? 473  GLN B OE1 1 
ATOM   7514 N NE2 . GLN B 1 449 ? 15.901  24.097  -16.734 1.00 254.34 ? 473  GLN B NE2 1 
ATOM   7515 N N   . THR B 1 450 ? 14.809  26.143  -14.764 1.00 267.71 ? 474  THR B N   1 
ATOM   7516 C CA  . THR B 1 450 ? 14.353  26.871  -15.943 1.00 267.71 ? 474  THR B CA  1 
ATOM   7517 C C   . THR B 1 450 ? 15.371  26.829  -17.084 1.00 267.71 ? 474  THR B C   1 
ATOM   7518 O O   . THR B 1 450 ? 15.006  26.649  -18.247 1.00 267.71 ? 474  THR B O   1 
ATOM   7519 C CB  . THR B 1 450 ? 14.041  28.348  -15.601 1.00 162.25 ? 474  THR B CB  1 
ATOM   7520 O OG1 . THR B 1 450 ? 15.166  28.933  -14.932 1.00 162.25 ? 474  THR B OG1 1 
ATOM   7521 C CG2 . THR B 1 450 ? 12.804  28.445  -14.709 1.00 162.25 ? 474  THR B CG2 1 
ATOM   7522 N N   . GLY B 1 451 ? 16.648  26.986  -16.750 1.00 300.15 ? 475  GLY B N   1 
ATOM   7523 C CA  . GLY B 1 451 ? 17.680  26.961  -17.772 1.00 300.15 ? 475  GLY B CA  1 
ATOM   7524 C C   . GLY B 1 451 ? 18.720  25.875  -17.571 1.00 300.15 ? 475  GLY B C   1 
ATOM   7525 O O   . GLY B 1 451 ? 19.883  26.169  -17.298 1.00 300.15 ? 475  GLY B O   1 
ATOM   7526 N N   . GLY B 1 452 ? 18.304  24.618  -17.706 1.00 269.00 ? 476  GLY B N   1 
ATOM   7527 C CA  . GLY B 1 452 ? 19.225  23.506  -17.537 1.00 269.00 ? 476  GLY B CA  1 
ATOM   7528 C C   . GLY B 1 452 ? 19.845  23.402  -16.153 1.00 269.00 ? 476  GLY B C   1 
ATOM   7529 O O   . GLY B 1 452 ? 20.626  22.484  -15.887 1.00 269.00 ? 476  GLY B O   1 
ATOM   7530 N N   . LYS B 1 453 ? 19.501  24.338  -15.270 1.00 319.86 ? 477  LYS B N   1 
ATOM   7531 C CA  . LYS B 1 453 ? 20.032  24.342  -13.908 1.00 319.86 ? 477  LYS B CA  1 
ATOM   7532 C C   . LYS B 1 453 ? 18.935  24.387  -12.842 1.00 319.86 ? 477  LYS B C   1 
ATOM   7533 O O   . LYS B 1 453 ? 17.980  25.161  -12.935 1.00 319.86 ? 477  LYS B O   1 
ATOM   7534 C CB  . LYS B 1 453 ? 20.988  25.522  -13.706 1.00 242.08 ? 477  LYS B CB  1 
ATOM   7535 C CG  . LYS B 1 453 ? 21.664  25.520  -12.344 1.00 242.08 ? 477  LYS B CG  1 
ATOM   7536 C CD  . LYS B 1 453 ? 22.669  26.649  -12.205 1.00 242.08 ? 477  LYS B CD  1 
ATOM   7537 C CE  . LYS B 1 453 ? 23.358  26.597  -10.849 1.00 242.08 ? 477  LYS B CE  1 
ATOM   7538 N NZ  . LYS B 1 453 ? 24.361  27.684  -10.684 1.00 242.08 ? 477  LYS B NZ  1 
ATOM   7539 N N   . TYR B 1 454 ? 19.100  23.548  -11.824 1.00 255.26 ? 478  TYR B N   1 
ATOM   7540 C CA  . TYR B 1 454 ? 18.155  23.441  -10.719 1.00 255.26 ? 478  TYR B CA  1 
ATOM   7541 C C   . TYR B 1 454 ? 18.433  24.468  -9.622  1.00 255.26 ? 478  TYR B C   1 
ATOM   7542 O O   . TYR B 1 454 ? 19.581  24.677  -9.228  1.00 255.26 ? 478  TYR B O   1 
ATOM   7543 C CB  . TYR B 1 454 ? 18.218  22.024  -10.137 1.00 295.32 ? 478  TYR B CB  1 
ATOM   7544 C CG  . TYR B 1 454 ? 19.592  21.619  -9.628  1.00 295.32 ? 478  TYR B CG  1 
ATOM   7545 C CD1 . TYR B 1 454 ? 19.912  21.706  -8.272  1.00 295.32 ? 478  TYR B CD1 1 
ATOM   7546 C CD2 . TYR B 1 454 ? 20.571  21.145  -10.503 1.00 295.32 ? 478  TYR B CD2 1 
ATOM   7547 C CE1 . TYR B 1 454 ? 21.173  21.327  -7.800  1.00 295.32 ? 478  TYR B CE1 1 
ATOM   7548 C CE2 . TYR B 1 454 ? 21.834  20.765  -10.041 1.00 295.32 ? 478  TYR B CE2 1 
ATOM   7549 C CZ  . TYR B 1 454 ? 22.126  20.857  -8.690  1.00 295.32 ? 478  TYR B CZ  1 
ATOM   7550 O OH  . TYR B 1 454 ? 23.366  20.474  -8.231  1.00 295.32 ? 478  TYR B OH  1 
ATOM   7551 N N   . SER B 1 455 ? 17.374  25.105  -9.130  1.00 241.83 ? 479  SER B N   1 
ATOM   7552 C CA  . SER B 1 455 ? 17.501  26.107  -8.076  1.00 241.83 ? 479  SER B CA  1 
ATOM   7553 C C   . SER B 1 455 ? 16.250  26.162  -7.201  1.00 241.83 ? 479  SER B C   1 
ATOM   7554 O O   . SER B 1 455 ? 15.197  25.635  -7.566  1.00 241.83 ? 479  SER B O   1 
ATOM   7555 C CB  . SER B 1 455 ? 17.763  27.483  -8.693  1.00 266.58 ? 479  SER B CB  1 
ATOM   7556 O OG  . SER B 1 455 ? 16.780  27.797  -9.663  1.00 266.58 ? 479  SER B OG  1 
ATOM   7557 N N   . TYR B 1 456 ? 16.372  26.795  -6.039  1.00 167.33 ? 480  TYR B N   1 
ATOM   7558 C CA  . TYR B 1 456 ? 15.244  26.913  -5.131  1.00 167.33 ? 480  TYR B CA  1 
ATOM   7559 C C   . TYR B 1 456 ? 14.677  28.321  -5.188  1.00 167.33 ? 480  TYR B C   1 
ATOM   7560 O O   . TYR B 1 456 ? 15.409  29.294  -5.023  1.00 167.33 ? 480  TYR B O   1 
ATOM   7561 C CB  . TYR B 1 456 ? 15.669  26.603  -3.690  1.00 134.84 ? 480  TYR B CB  1 
ATOM   7562 C CG  . TYR B 1 456 ? 16.002  25.147  -3.410  1.00 134.84 ? 480  TYR B CG  1 
ATOM   7563 C CD1 . TYR B 1 456 ? 17.187  24.571  -3.881  1.00 134.84 ? 480  TYR B CD1 1 
ATOM   7564 C CD2 . TYR B 1 456 ? 15.132  24.344  -2.659  1.00 134.84 ? 480  TYR B CD2 1 
ATOM   7565 C CE1 . TYR B 1 456 ? 17.503  23.229  -3.608  1.00 134.84 ? 480  TYR B CE1 1 
ATOM   7566 C CE2 . TYR B 1 456 ? 15.437  23.001  -2.383  1.00 134.84 ? 480  TYR B CE2 1 
ATOM   7567 C CZ  . TYR B 1 456 ? 16.625  22.453  -2.860  1.00 134.84 ? 480  TYR B CZ  1 
ATOM   7568 O OH  . TYR B 1 456 ? 16.937  21.139  -2.586  1.00 134.84 ? 480  TYR B OH  1 
ATOM   7569 N N   . LEU B 1 457 ? 13.375  28.432  -5.426  1.00 124.27 ? 481  LEU B N   1 
ATOM   7570 C CA  . LEU B 1 457 ? 12.734  29.740  -5.473  1.00 124.27 ? 481  LEU B CA  1 
ATOM   7571 C C   . LEU B 1 457 ? 11.783  29.953  -4.295  1.00 124.27 ? 481  LEU B C   1 
ATOM   7572 O O   . LEU B 1 457 ? 10.902  29.128  -4.023  1.00 124.27 ? 481  LEU B O   1 
ATOM   7573 C CB  . LEU B 1 457 ? 11.954  29.919  -6.777  1.00 253.16 ? 481  LEU B CB  1 
ATOM   7574 C CG  . LEU B 1 457 ? 11.287  31.293  -6.900  1.00 253.16 ? 481  LEU B CG  1 
ATOM   7575 C CD1 . LEU B 1 457 ? 12.361  32.375  -6.940  1.00 253.16 ? 481  LEU B CD1 1 
ATOM   7576 C CD2 . LEU B 1 457 ? 10.419  31.343  -8.149  1.00 253.16 ? 481  LEU B CD2 1 
ATOM   7577 N N   . LYS B 1 458 ? 11.967  31.065  -3.592  1.00 166.87 ? 482  LYS B N   1 
ATOM   7578 C CA  . LYS B 1 458 ? 11.103  31.379  -2.464  1.00 166.87 ? 482  LYS B CA  1 
ATOM   7579 C C   . LYS B 1 458 ? 9.707   31.662  -3.010  1.00 166.87 ? 482  LYS B C   1 
ATOM   7580 O O   . LYS B 1 458 ? 9.540   32.489  -3.906  1.00 166.87 ? 482  LYS B O   1 
ATOM   7581 C CB  . LYS B 1 458 ? 11.625  32.608  -1.714  1.00 263.68 ? 482  LYS B CB  1 
ATOM   7582 C CG  . LYS B 1 458 ? 10.699  33.075  -0.599  1.00 263.68 ? 482  LYS B CG  1 
ATOM   7583 C CD  . LYS B 1 458 ? 11.246  34.289  0.137   1.00 263.68 ? 482  LYS B CD  1 
ATOM   7584 C CE  . LYS B 1 458 ? 10.271  34.759  1.212   1.00 263.68 ? 482  LYS B CE  1 
ATOM   7585 N NZ  . LYS B 1 458 ? 10.775  35.942  1.970   1.00 263.68 ? 482  LYS B NZ  1 
ATOM   7586 N N   . VAL B 1 459 ? 8.705   30.974  -2.478  1.00 183.80 ? 483  VAL B N   1 
ATOM   7587 C CA  . VAL B 1 459 ? 7.338   31.174  -2.938  1.00 183.80 ? 483  VAL B CA  1 
ATOM   7588 C C   . VAL B 1 459 ? 6.353   31.243  -1.782  1.00 183.80 ? 483  VAL B C   1 
ATOM   7589 O O   . VAL B 1 459 ? 5.420   30.445  -1.694  1.00 183.80 ? 483  VAL B O   1 
ATOM   7590 C CB  . VAL B 1 459 ? 6.917   30.053  -3.900  1.00 127.87 ? 483  VAL B CB  1 
ATOM   7591 C CG1 . VAL B 1 459 ? 7.717   30.165  -5.177  1.00 127.87 ? 483  VAL B CG1 1 
ATOM   7592 C CG2 . VAL B 1 459 ? 7.149   28.687  -3.257  1.00 127.87 ? 483  VAL B CG2 1 
ATOM   7593 N N   . GLY B 1 460 ? 6.562   32.215  -0.901  1.00 174.99 ? 484  GLY B N   1 
ATOM   7594 C CA  . GLY B 1 460 ? 5.691   32.367  0.244   1.00 174.99 ? 484  GLY B CA  1 
ATOM   7595 C C   . GLY B 1 460 ? 6.410   32.009  1.529   1.00 174.99 ? 484  GLY B C   1 
ATOM   7596 O O   . GLY B 1 460 ? 7.539   31.516  1.504   1.00 174.99 ? 484  GLY B O   1 
ATOM   7597 N N   . HIS B 1 461 ? 5.748   32.254  2.654   1.00 194.26 ? 485  HIS B N   1 
ATOM   7598 C CA  . HIS B 1 461 ? 6.315   31.976  3.971   1.00 194.26 ? 485  HIS B CA  1 
ATOM   7599 C C   . HIS B 1 461 ? 5.198   31.673  4.967   1.00 194.26 ? 485  HIS B C   1 
ATOM   7600 O O   . HIS B 1 461 ? 4.020   31.616  4.610   1.00 194.26 ? 485  HIS B O   1 
ATOM   7601 C CB  . HIS B 1 461 ? 7.072   33.195  4.484   1.00 243.13 ? 485  HIS B CB  1 
ATOM   7602 C CG  . HIS B 1 461 ? 6.177   34.358  4.770   1.00 243.13 ? 485  HIS B CG  1 
ATOM   7603 N ND1 . HIS B 1 461 ? 5.601   35.113  3.770   1.00 243.13 ? 485  HIS B ND1 1 
ATOM   7604 C CD2 . HIS B 1 461 ? 5.677   34.833  5.937   1.00 243.13 ? 485  HIS B CD2 1 
ATOM   7605 C CE1 . HIS B 1 461 ? 4.783   36.001  4.307   1.00 243.13 ? 485  HIS B CE1 1 
ATOM   7606 N NE2 . HIS B 1 461 ? 4.810   35.852  5.620   1.00 243.13 ? 485  HIS B NE2 1 
ATOM   7607 N N   . TRP B 1 462 ? 5.581   31.520  6.230   1.00 177.00 ? 486  TRP B N   1 
ATOM   7608 C CA  . TRP B 1 462 ? 4.626   31.231  7.285   1.00 177.00 ? 486  TRP B CA  1 
ATOM   7609 C C   . TRP B 1 462 ? 4.936   32.059  8.532   1.00 177.00 ? 486  TRP B C   1 
ATOM   7610 O O   . TRP B 1 462 ? 5.974   31.865  9.168   1.00 177.00 ? 486  TRP B O   1 
ATOM   7611 C CB  . TRP B 1 462 ? 4.677   29.744  7.620   1.00 149.09 ? 486  TRP B CB  1 
ATOM   7612 C CG  . TRP B 1 462 ? 3.609   29.311  8.551   1.00 149.09 ? 486  TRP B CG  1 
ATOM   7613 C CD1 . TRP B 1 462 ? 2.432   28.709  8.223   1.00 149.09 ? 486  TRP B CD1 1 
ATOM   7614 C CD2 . TRP B 1 462 ? 3.612   29.440  9.974   1.00 149.09 ? 486  TRP B CD2 1 
ATOM   7615 N NE1 . TRP B 1 462 ? 1.699   28.449  9.354   1.00 149.09 ? 486  TRP B NE1 1 
ATOM   7616 C CE2 . TRP B 1 462 ? 2.400   28.888  10.445  1.00 149.09 ? 486  TRP B CE2 1 
ATOM   7617 C CE3 . TRP B 1 462 ? 4.522   29.966  10.899  1.00 149.09 ? 486  TRP B CE3 1 
ATOM   7618 C CZ2 . TRP B 1 462 ? 2.073   28.847  11.805  1.00 149.09 ? 486  TRP B CZ2 1 
ATOM   7619 C CZ3 . TRP B 1 462 ? 4.198   29.926  12.251  1.00 149.09 ? 486  TRP B CZ3 1 
ATOM   7620 C CH2 . TRP B 1 462 ? 2.982   29.369  12.690  1.00 149.09 ? 486  TRP B CH2 1 
ATOM   7621 N N   . ALA B 1 463 ? 4.031   32.977  8.873   1.00 181.46 ? 487  ALA B N   1 
ATOM   7622 C CA  . ALA B 1 463 ? 4.195   33.844  10.042  1.00 181.46 ? 487  ALA B CA  1 
ATOM   7623 C C   . ALA B 1 463 ? 3.436   33.284  11.245  1.00 181.46 ? 487  ALA B C   1 
ATOM   7624 O O   . ALA B 1 463 ? 3.931   33.280  12.372  1.00 181.46 ? 487  ALA B O   1 
ATOM   7625 C CB  . ALA B 1 463 ? 3.700   35.251  9.720   1.00 129.80 ? 487  ALA B CB  1 
ATOM   7626 N N   . GLU B 1 464 ? 2.223   32.823  10.991  1.00 149.16 ? 488  GLU B N   1 
ATOM   7627 C CA  . GLU B 1 464 ? 1.376   32.238  12.018  1.00 149.16 ? 488  GLU B CA  1 
ATOM   7628 C C   . GLU B 1 464 ? 0.188   31.792  11.199  1.00 149.16 ? 488  GLU B C   1 
ATOM   7629 O O   . GLU B 1 464 ? -0.769  31.195  11.697  1.00 149.16 ? 488  GLU B O   1 
ATOM   7630 C CB  . GLU B 1 464 ? 0.959   33.286  13.052  1.00 171.49 ? 488  GLU B CB  1 
ATOM   7631 C CG  . GLU B 1 464 ? 0.452   32.687  14.361  1.00 171.49 ? 488  GLU B CG  1 
ATOM   7632 C CD  . GLU B 1 464 ? 0.003   33.742  15.363  1.00 171.49 ? 488  GLU B CD  1 
ATOM   7633 O OE1 . GLU B 1 464 ? 0.699   34.774  15.492  1.00 171.49 ? 488  GLU B OE1 1 
ATOM   7634 O OE2 . GLU B 1 464 ? -1.038  33.534  16.031  1.00 171.49 ? 488  GLU B OE2 1 
ATOM   7635 N N   . THR B 1 465 ? 0.293   32.112  9.914   1.00 203.35 ? 489  THR B N   1 
ATOM   7636 C CA  . THR B 1 465 ? -0.699  31.794  8.898   1.00 203.35 ? 489  THR B CA  1 
ATOM   7637 C C   . THR B 1 465 ? 0.092   31.664  7.609   1.00 203.35 ? 489  THR B C   1 
ATOM   7638 O O   . THR B 1 465 ? 1.067   32.400  7.397   1.00 203.35 ? 489  THR B O   1 
ATOM   7639 C CB  . THR B 1 465 ? -1.718  32.931  8.722   1.00 190.61 ? 489  THR B CB  1 
ATOM   7640 O OG1 . THR B 1 465 ? -1.017  34.176  8.579   1.00 190.61 ? 489  THR B OG1 1 
ATOM   7641 C CG2 . THR B 1 465 ? -2.677  32.991  9.919   1.00 190.61 ? 489  THR B CG2 1 
ATOM   7642 N N   . LEU B 1 466 ? -0.322  30.735  6.754   1.00 147.33 ? 490  LEU B N   1 
ATOM   7643 C CA  . LEU B 1 466 ? 0.381   30.520  5.500   1.00 147.33 ? 490  LEU B CA  1 
ATOM   7644 C C   . LEU B 1 466 ? 0.315   31.738  4.592   1.00 147.33 ? 490  LEU B C   1 
ATOM   7645 O O   . LEU B 1 466 ? -0.375  32.720  4.878   1.00 147.33 ? 490  LEU B O   1 
ATOM   7646 C CB  . LEU B 1 466 ? -0.168  29.280  4.779   1.00 136.50 ? 490  LEU B CB  1 
ATOM   7647 C CG  . LEU B 1 466 ? 0.542   28.835  3.494   1.00 136.50 ? 490  LEU B CG  1 
ATOM   7648 C CD1 . LEU B 1 466 ? 2.048   28.794  3.699   1.00 136.50 ? 490  LEU B CD1 1 
ATOM   7649 C CD2 . LEU B 1 466 ? 0.030   27.473  3.085   1.00 136.50 ? 490  LEU B CD2 1 
ATOM   7650 N N   . SER B 1 467 ? 1.060   31.658  3.500   1.00 202.56 ? 491  SER B N   1 
ATOM   7651 C CA  . SER B 1 467 ? 1.148   32.719  2.512   1.00 202.56 ? 491  SER B CA  1 
ATOM   7652 C C   . SER B 1 467 ? 2.019   32.132  1.405   1.00 202.56 ? 491  SER B C   1 
ATOM   7653 O O   . SER B 1 467 ? 2.953   31.378  1.689   1.00 202.56 ? 491  SER B O   1 
ATOM   7654 C CB  . SER B 1 467 ? 1.822   33.957  3.127   1.00 147.14 ? 491  SER B CB  1 
ATOM   7655 O OG  . SER B 1 467 ? 1.974   35.009  2.184   1.00 147.14 ? 491  SER B OG  1 
ATOM   7656 N N   . LEU B 1 468 ? 1.700   32.453  0.153   1.00 243.16 ? 492  LEU B N   1 
ATOM   7657 C CA  . LEU B 1 468 ? 2.458   31.956  -1.003  1.00 243.16 ? 492  LEU B CA  1 
ATOM   7658 C C   . LEU B 1 468 ? 1.760   32.378  -2.304  1.00 243.16 ? 492  LEU B C   1 
ATOM   7659 O O   . LEU B 1 468 ? 0.541   32.211  -2.436  1.00 243.16 ? 492  LEU B O   1 
ATOM   7660 C CB  . LEU B 1 468 ? 2.601   30.421  -0.931  1.00 161.15 ? 492  LEU B CB  1 
ATOM   7661 C CG  . LEU B 1 468 ? 1.396   29.474  -0.911  1.00 161.15 ? 492  LEU B CG  1 
ATOM   7662 C CD1 . LEU B 1 468 ? 1.907   28.089  -0.516  1.00 161.15 ? 492  LEU B CD1 1 
ATOM   7663 C CD2 . LEU B 1 468 ? 0.320   29.946  0.072   1.00 161.15 ? 492  LEU B CD2 1 
ATOM   7664 N N   . ASP B 1 469 ? 2.512   32.928  -3.261  1.00 194.23 ? 493  ASP B N   1 
ATOM   7665 C CA  . ASP B 1 469 ? 1.890   33.370  -4.513  1.00 194.23 ? 493  ASP B CA  1 
ATOM   7666 C C   . ASP B 1 469 ? 1.519   32.265  -5.516  1.00 194.23 ? 493  ASP B C   1 
ATOM   7667 O O   . ASP B 1 469 ? 1.578   32.468  -6.728  1.00 194.23 ? 493  ASP B O   1 
ATOM   7668 C CB  . ASP B 1 469 ? 2.726   34.486  -5.193  1.00 231.78 ? 493  ASP B CB  1 
ATOM   7669 C CG  . ASP B 1 469 ? 4.183   34.091  -5.462  1.00 231.78 ? 493  ASP B CG  1 
ATOM   7670 O OD1 . ASP B 1 469 ? 4.906   33.750  -4.497  1.00 231.78 ? 493  ASP B OD1 1 
ATOM   7671 O OD2 . ASP B 1 469 ? 4.610   34.145  -6.643  1.00 231.78 ? 493  ASP B OD2 1 
ATOM   7672 N N   . VAL B 1 470 ? 1.120   31.114  -4.972  1.00 159.45 ? 494  VAL B N   1 
ATOM   7673 C CA  . VAL B 1 470 ? 0.666   29.930  -5.713  1.00 159.45 ? 494  VAL B CA  1 
ATOM   7674 C C   . VAL B 1 470 ? 1.076   29.814  -7.179  1.00 159.45 ? 494  VAL B C   1 
ATOM   7675 O O   . VAL B 1 470 ? 1.797   28.886  -7.565  1.00 159.45 ? 494  VAL B O   1 
ATOM   7676 C CB  . VAL B 1 470 ? -0.877  29.830  -5.648  1.00 170.76 ? 494  VAL B CB  1 
ATOM   7677 C CG1 . VAL B 1 470 ? -1.365  28.646  -6.473  1.00 170.76 ? 494  VAL B CG1 1 
ATOM   7678 C CG2 . VAL B 1 470 ? -1.336  29.709  -4.199  1.00 170.76 ? 494  VAL B CG2 1 
ATOM   7679 N N   . ASP B 1 471 ? 0.568   30.736  -7.993  1.00 241.08 ? 495  ASP B N   1 
ATOM   7680 C CA  . ASP B 1 471 ? 0.868   30.784  -9.427  1.00 241.08 ? 495  ASP B CA  1 
ATOM   7681 C C   . ASP B 1 471 ? 2.362   31.084  -9.642  1.00 241.08 ? 495  ASP B C   1 
ATOM   7682 O O   . ASP B 1 471 ? 2.778   31.632  -10.673 1.00 241.08 ? 495  ASP B O   1 
ATOM   7683 C CB  . ASP B 1 471 ? -0.009  31.852  -10.108 1.00 232.53 ? 495  ASP B CB  1 
ATOM   7684 C CG  . ASP B 1 471 ? -1.450  31.377  -10.338 1.00 232.53 ? 495  ASP B CG  1 
ATOM   7685 O OD1 . ASP B 1 471 ? -1.670  30.565  -11.270 1.00 232.53 ? 495  ASP B OD1 1 
ATOM   7686 O OD2 . ASP B 1 471 ? -2.355  31.814  -9.586  1.00 232.53 ? 495  ASP B OD2 1 
ATOM   7687 N N   . SER B 1 472 ? 3.147   30.708  -8.635  1.00 177.78 ? 496  SER B N   1 
ATOM   7688 C CA  . SER B 1 472 ? 4.596   30.876  -8.608  1.00 177.78 ? 496  SER B CA  1 
ATOM   7689 C C   . SER B 1 472 ? 5.226   29.484  -8.664  1.00 177.78 ? 496  SER B C   1 
ATOM   7690 O O   . SER B 1 472 ? 6.346   29.300  -9.150  1.00 177.78 ? 496  SER B O   1 
ATOM   7691 C CB  . SER B 1 472 ? 5.004   31.552  -7.302  1.00 142.67 ? 496  SER B CB  1 
ATOM   7692 O OG  . SER B 1 472 ? 4.473   30.845  -6.193  1.00 142.67 ? 496  SER B OG  1 
ATOM   7693 N N   . ILE B 1 473 ? 4.470   28.512  -8.161  1.00 175.48 ? 497  ILE B N   1 
ATOM   7694 C CA  . ILE B 1 473 ? 4.888   27.119  -8.090  1.00 175.48 ? 497  ILE B CA  1 
ATOM   7695 C C   . ILE B 1 473 ? 4.880   26.359  -9.420  1.00 175.48 ? 497  ILE B C   1 
ATOM   7696 O O   . ILE B 1 473 ? 3.903   26.402  -10.173 1.00 175.48 ? 497  ILE B O   1 
ATOM   7697 C CB  . ILE B 1 473 ? 3.983   26.339  -7.102  1.00 181.84 ? 497  ILE B CB  1 
ATOM   7698 C CG1 . ILE B 1 473 ? 3.796   27.151  -5.813  1.00 181.84 ? 497  ILE B CG1 1 
ATOM   7699 C CG2 . ILE B 1 473 ? 4.602   24.981  -6.800  1.00 181.84 ? 497  ILE B CG2 1 
ATOM   7700 C CD1 . ILE B 1 473 ? 2.714   26.624  -4.882  1.00 181.84 ? 497  ILE B CD1 1 
ATOM   7701 N N   . HIS B 1 474 ? 5.985   25.668  -9.691  1.00 184.99 ? 498  HIS B N   1 
ATOM   7702 C CA  . HIS B 1 474 ? 6.144   24.824  -10.881 1.00 184.99 ? 498  HIS B CA  1 
ATOM   7703 C C   . HIS B 1 474 ? 6.033   23.412  -10.317 1.00 184.99 ? 498  HIS B C   1 
ATOM   7704 O O   . HIS B 1 474 ? 6.927   22.963  -9.604  1.00 184.99 ? 498  HIS B O   1 
ATOM   7705 C CB  . HIS B 1 474 ? 7.542   24.969  -11.492 1.00 227.22 ? 498  HIS B CB  1 
ATOM   7706 C CG  . HIS B 1 474 ? 7.740   26.211  -12.300 1.00 227.22 ? 498  HIS B CG  1 
ATOM   7707 N ND1 . HIS B 1 474 ? 7.013   27.365  -12.090 1.00 227.22 ? 498  HIS B ND1 1 
ATOM   7708 C CD2 . HIS B 1 474 ? 8.628   26.499  -13.284 1.00 227.22 ? 498  HIS B CD2 1 
ATOM   7709 C CE1 . HIS B 1 474 ? 7.446   28.310  -12.907 1.00 227.22 ? 498  HIS B CE1 1 
ATOM   7710 N NE2 . HIS B 1 474 ? 8.426   27.810  -13.641 1.00 227.22 ? 498  HIS B NE2 1 
ATOM   7711 N N   . TRP B 1 475 ? 4.964   22.696  -10.622 1.00 177.22 ? 499  TRP B N   1 
ATOM   7712 C CA  . TRP B 1 475 ? 4.836   21.357  -10.066 1.00 177.22 ? 499  TRP B CA  1 
ATOM   7713 C C   . TRP B 1 475 ? 5.429   20.296  -10.972 1.00 177.22 ? 499  TRP B C   1 
ATOM   7714 O O   . TRP B 1 475 ? 5.889   20.597  -12.080 1.00 177.22 ? 499  TRP B O   1 
ATOM   7715 C CB  . TRP B 1 475 ? 3.368   21.050  -9.788  1.00 188.19 ? 499  TRP B CB  1 
ATOM   7716 C CG  . TRP B 1 475 ? 2.668   22.197  -9.115  1.00 188.19 ? 499  TRP B CG  1 
ATOM   7717 C CD1 . TRP B 1 475 ? 2.107   23.290  -9.721  1.00 188.19 ? 499  TRP B CD1 1 
ATOM   7718 C CD2 . TRP B 1 475 ? 2.477   22.379  -7.710  1.00 188.19 ? 499  TRP B CD2 1 
ATOM   7719 N NE1 . TRP B 1 475 ? 1.577   24.139  -8.777  1.00 188.19 ? 499  TRP B NE1 1 
ATOM   7720 C CE2 . TRP B 1 475 ? 1.789   23.604  -7.535  1.00 188.19 ? 499  TRP B CE2 1 
ATOM   7721 C CE3 . TRP B 1 475 ? 2.820   21.627  -6.578  1.00 188.19 ? 499  TRP B CE3 1 
ATOM   7722 C CZ2 . TRP B 1 475 ? 1.435   24.091  -6.273  1.00 188.19 ? 499  TRP B CZ2 1 
ATOM   7723 C CZ3 . TRP B 1 475 ? 2.466   22.115  -5.319  1.00 188.19 ? 499  TRP B CZ3 1 
ATOM   7724 C CH2 . TRP B 1 475 ? 1.781   23.336  -5.180  1.00 188.19 ? 499  TRP B CH2 1 
ATOM   7725 N N   . SER B 1 476 ? 5.450   19.058  -10.478 1.00 226.41 ? 500  SER B N   1 
ATOM   7726 C CA  . SER B 1 476 ? 5.953   17.927  -11.261 1.00 226.41 ? 500  SER B CA  1 
ATOM   7727 C C   . SER B 1 476 ? 4.785   17.607  -12.189 1.00 226.41 ? 500  SER B C   1 
ATOM   7728 O O   . SER B 1 476 ? 3.620   17.629  -11.754 1.00 226.41 ? 500  SER B O   1 
ATOM   7729 C CB  . SER B 1 476 ? 6.262   16.722  -10.360 1.00 178.34 ? 500  SER B CB  1 
ATOM   7730 O OG  . SER B 1 476 ? 6.755   15.625  -11.115 1.00 178.34 ? 500  SER B OG  1 
ATOM   7731 N N   . ARG B 1 477 ? 5.087   17.310  -13.454 1.00 189.50 ? 501  ARG B N   1 
ATOM   7732 C CA  . ARG B 1 477 ? 4.040   17.050  -14.443 1.00 189.50 ? 501  ARG B CA  1 
ATOM   7733 C C   . ARG B 1 477 ? 3.339   18.402  -14.632 1.00 189.50 ? 501  ARG B C   1 
ATOM   7734 O O   . ARG B 1 477 ? 2.147   18.464  -14.950 1.00 189.50 ? 501  ARG B O   1 
ATOM   7735 C CB  . ARG B 1 477 ? 3.048   15.994  -13.926 1.00 133.27 ? 501  ARG B CB  1 
ATOM   7736 N N   . ASN B 1 478 ? 4.121   19.468  -14.411 1.00 240.50 ? 502  ASN B N   1 
ATOM   7737 C CA  . ASN B 1 478 ? 3.712   20.880  -14.510 1.00 240.50 ? 502  ASN B CA  1 
ATOM   7738 C C   . ASN B 1 478 ? 2.212   21.111  -14.287 1.00 240.50 ? 502  ASN B C   1 
ATOM   7739 O O   . ASN B 1 478 ? 1.551   21.835  -15.041 1.00 240.50 ? 502  ASN B O   1 
ATOM   7740 C CB  . ASN B 1 478 ? 4.139   21.465  -15.870 1.00 208.77 ? 502  ASN B CB  1 
ATOM   7741 C CG  . ASN B 1 478 ? 5.030   20.514  -16.673 1.00 208.77 ? 502  ASN B CG  1 
ATOM   7742 O OD1 . ASN B 1 478 ? 6.183   20.260  -16.310 1.00 208.77 ? 502  ASN B OD1 1 
ATOM   7743 N ND2 . ASN B 1 478 ? 4.487   19.981  -17.770 1.00 208.77 ? 502  ASN B ND2 1 
ATOM   7744 N N   . SER B 1 479 ? 1.689   20.491  -13.235 1.00 240.17 ? 503  SER B N   1 
ATOM   7745 C CA  . SER B 1 479 ? 0.275   20.597  -12.898 1.00 240.17 ? 503  SER B CA  1 
ATOM   7746 C C   . SER B 1 479 ? 0.094   20.570  -11.388 1.00 240.17 ? 503  SER B C   1 
ATOM   7747 O O   . SER B 1 479 ? 0.717   19.743  -10.704 1.00 240.17 ? 503  SER B O   1 
ATOM   7748 C CB  . SER B 1 479 ? -0.495  19.425  -13.518 1.00 213.71 ? 503  SER B CB  1 
ATOM   7749 O OG  . SER B 1 479 ? -1.833  19.376  -13.044 1.00 213.71 ? 503  SER B OG  1 
ATOM   7750 N N   . VAL B 1 480 ? -0.741  21.473  -10.871 1.00 257.99 ? 504  VAL B N   1 
ATOM   7751 C CA  . VAL B 1 480 ? -1.013  21.510  -9.434  1.00 257.99 ? 504  VAL B CA  1 
ATOM   7752 C C   . VAL B 1 480 ? -1.521  20.112  -9.051  1.00 257.99 ? 504  VAL B C   1 
ATOM   7753 O O   . VAL B 1 480 ? -2.638  19.716  -9.407  1.00 257.99 ? 504  VAL B O   1 
ATOM   7754 C CB  . VAL B 1 480 ? -2.069  22.610  -9.070  1.00 152.42 ? 504  VAL B CB  1 
ATOM   7755 C CG1 . VAL B 1 480 ? -3.221  22.594  -10.070 1.00 152.42 ? 504  VAL B CG1 1 
ATOM   7756 C CG2 . VAL B 1 480 ? -2.591  22.392  -7.648  1.00 152.42 ? 504  VAL B CG2 1 
ATOM   7757 N N   . PRO B 1 481 ? -0.685  19.337  -8.335  1.00 207.83 ? 505  PRO B N   1 
ATOM   7758 C CA  . PRO B 1 481 ? -0.986  17.974  -7.885  1.00 207.83 ? 505  PRO B CA  1 
ATOM   7759 C C   . PRO B 1 481 ? -2.293  17.811  -7.120  1.00 207.83 ? 505  PRO B C   1 
ATOM   7760 O O   . PRO B 1 481 ? -2.984  18.792  -6.800  1.00 207.83 ? 505  PRO B O   1 
ATOM   7761 C CB  . PRO B 1 481 ? 0.233   17.614  -7.036  1.00 225.54 ? 505  PRO B CB  1 
ATOM   7762 C CG  . PRO B 1 481 ? 1.335   18.391  -7.704  1.00 225.54 ? 505  PRO B CG  1 
ATOM   7763 C CD  . PRO B 1 481 ? 0.666   19.731  -7.903  1.00 225.54 ? 505  PRO B CD  1 
ATOM   7764 N N   . THR B 1 482 ? -2.620  16.551  -6.840  1.00 191.14 ? 506  THR B N   1 
ATOM   7765 C CA  . THR B 1 482 ? -3.832  16.195  -6.111  1.00 191.14 ? 506  THR B CA  1 
ATOM   7766 C C   . THR B 1 482 ? -3.578  14.910  -5.322  1.00 191.14 ? 506  THR B C   1 
ATOM   7767 O O   . THR B 1 482 ? -3.196  13.879  -5.889  1.00 191.14 ? 506  THR B O   1 
ATOM   7768 C CB  . THR B 1 482 ? -5.022  15.966  -7.072  1.00 172.74 ? 506  THR B CB  1 
ATOM   7769 O OG1 . THR B 1 482 ? -5.187  17.113  -7.923  1.00 172.74 ? 506  THR B OG1 1 
ATOM   7770 C CG2 . THR B 1 482 ? -6.304  15.742  -6.277  1.00 172.74 ? 506  THR B CG2 1 
ATOM   7771 N N   . SER B 1 483 ? -3.789  14.978  -4.013  1.00 236.54 ? 507  SER B N   1 
ATOM   7772 C CA  . SER B 1 483 ? -3.565  13.823  -3.161  1.00 236.54 ? 507  SER B CA  1 
ATOM   7773 C C   . SER B 1 483 ? -4.751  13.586  -2.235  1.00 236.54 ? 507  SER B C   1 
ATOM   7774 O O   . SER B 1 483 ? -4.832  14.168  -1.152  1.00 236.54 ? 507  SER B O   1 
ATOM   7775 C CB  . SER B 1 483 ? -2.290  14.026  -2.342  1.00 220.37 ? 507  SER B CB  1 
ATOM   7776 O OG  . SER B 1 483 ? -1.741  12.787  -1.937  1.00 220.37 ? 507  SER B OG  1 
ATOM   7777 N N   . GLN B 1 484 ? -5.668  12.729  -2.680  1.00 328.17 ? 508  GLN B N   1 
ATOM   7778 C CA  . GLN B 1 484 ? -6.862  12.381  -1.914  1.00 328.17 ? 508  GLN B CA  1 
ATOM   7779 C C   . GLN B 1 484 ? -7.063  10.869  -1.876  1.00 328.17 ? 508  GLN B C   1 
ATOM   7780 O O   . GLN B 1 484 ? -6.310  10.153  -2.567  1.00 328.17 ? 508  GLN B O   1 
ATOM   7781 C CB  . GLN B 1 484 ? -8.100  13.033  -2.531  1.00 242.54 ? 508  GLN B CB  1 
ATOM   7782 C CG  . GLN B 1 484 ? -8.130  14.542  -2.403  1.00 242.54 ? 508  GLN B CG  1 
ATOM   7783 C CD  . GLN B 1 484 ? -9.345  15.150  -3.062  1.00 242.54 ? 508  GLN B CD  1 
ATOM   7784 O OE1 . GLN B 1 484 ? -9.523  15.040  -4.275  1.00 242.54 ? 508  GLN B OE1 1 
ATOM   7785 N NE2 . GLN B 1 484 ? -10.193 15.794  -2.268  1.00 242.54 ? 508  GLN B NE2 1 
HETATM 7786 C C1  . NAG C 2 .   ? -4.965  7.280   71.250  1.00 210.47 ? 801  NAG A C1  1 
HETATM 7787 C C2  . NAG C 2 .   ? -6.252  6.579   70.744  1.00 210.47 ? 801  NAG A C2  1 
HETATM 7788 C C3  . NAG C 2 .   ? -6.793  5.642   71.849  1.00 210.47 ? 801  NAG A C3  1 
HETATM 7789 C C4  . NAG C 2 .   ? -5.689  4.700   72.362  1.00 210.47 ? 801  NAG A C4  1 
HETATM 7790 C C5  . NAG C 2 .   ? -4.465  5.512   72.792  1.00 210.47 ? 801  NAG A C5  1 
HETATM 7791 C C6  . NAG C 2 .   ? -3.309  4.637   73.233  1.00 210.47 ? 801  NAG A C6  1 
HETATM 7792 C C7  . NAG C 2 .   ? -8.090  7.397   69.362  1.00 210.47 ? 801  NAG A C7  1 
HETATM 7793 C C8  . NAG C 2 .   ? -9.523  7.005   69.689  1.00 210.47 ? 801  NAG A C8  1 
HETATM 7794 N N2  . NAG C 2 .   ? -7.255  7.579   70.389  1.00 210.47 ? 801  NAG A N2  1 
HETATM 7795 O O3  . NAG C 2 .   ? -7.881  4.871   71.351  1.00 210.47 ? 801  NAG A O3  1 
HETATM 7796 O O4  . NAG C 2 .   ? -6.170  3.940   73.463  1.00 210.47 ? 801  NAG A O4  1 
HETATM 7797 O O5  . NAG C 2 .   ? -3.996  6.311   71.688  1.00 210.47 ? 801  NAG A O5  1 
HETATM 7798 O O6  . NAG C 2 .   ? -3.396  4.332   74.615  1.00 210.47 ? 801  NAG A O6  1 
HETATM 7799 O O7  . NAG C 2 .   ? -7.755  7.547   68.184  1.00 210.47 ? 801  NAG A O7  1 
HETATM 7800 N N   . 52A D 3 .   ? 19.784  6.951   53.351  1.00 64.91  ? 1001 52A A N   1 
HETATM 7801 C CA  . 52A D 3 .   ? 21.006  7.733   53.179  1.00 64.91  ? 1001 52A A CA  1 
HETATM 7802 C C   . 52A D 3 .   ? 20.925  8.422   51.813  1.00 64.91  ? 1001 52A A C   1 
HETATM 7803 O O   . 52A D 3 .   ? 21.218  9.623   51.708  1.00 64.91  ? 1001 52A A O   1 
HETATM 7804 O OXT . 52A D 3 .   ? 20.564  7.773   50.813  1.00 64.91  ? 1001 52A A OXT 1 
HETATM 7805 C CB1 . 52A D 3 .   ? 22.238  6.838   53.258  1.00 64.91  ? 1001 52A A CB1 1 
HETATM 7806 C CB2 . 52A D 3 .   ? 21.197  8.761   54.310  1.00 64.91  ? 1001 52A A CB2 1 
HETATM 7807 C CG1 . 52A D 3 .   ? 23.260  7.774   53.869  1.00 64.91  ? 1001 52A A CG1 1 
HETATM 7808 N NG2 . 52A D 3 .   ? 22.548  8.570   54.848  1.00 64.91  ? 1001 52A A NG2 1 
HETATM 7809 C CD  . 52A D 3 .   ? 24.333  6.971   54.549  1.00 64.91  ? 1001 52A A CD  1 
HETATM 7810 O OE1 . 52A D 3 .   ? 25.370  7.540   54.916  1.00 64.91  ? 1001 52A A OE1 1 
HETATM 7811 O OE2 . 52A D 3 .   ? 24.152  5.753   54.740  1.00 64.91  ? 1001 52A A OE2 1 
HETATM 7812 N N   . 52A E 3 .   ? 16.106  20.778  11.483  1.00 94.34  ? 2001 52A B N   1 
HETATM 7813 C CA  . 52A E 3 .   ? 17.482  20.334  11.665  1.00 94.34  ? 2001 52A B CA  1 
HETATM 7814 C C   . 52A E 3 .   ? 17.604  19.797  13.084  1.00 94.34  ? 2001 52A B C   1 
HETATM 7815 O O   . 52A E 3 .   ? 18.310  18.788  13.308  1.00 94.34  ? 2001 52A B O   1 
HETATM 7816 O OXT . 52A E 3 .   ? 16.993  20.366  14.009  1.00 94.34  ? 2001 52A B OXT 1 
HETATM 7817 C CB1 . 52A E 3 .   ? 18.458  21.484  11.435  1.00 94.34  ? 2001 52A B CB1 1 
HETATM 7818 C CB2 . 52A E 3 .   ? 17.891  19.268  10.637  1.00 94.34  ? 2001 52A B CB2 1 
HETATM 7819 C CG1 . 52A E 3 .   ? 19.698  20.745  10.948  1.00 94.34  ? 2001 52A B CG1 1 
HETATM 7820 N NG2 . 52A E 3 .   ? 19.227  19.632  10.132  1.00 94.34  ? 2001 52A B NG2 1 
HETATM 7821 C CD  . 52A E 3 .   ? 20.563  21.679  10.109  1.00 94.34  ? 2001 52A B CD  1 
HETATM 7822 O OE1 . 52A E 3 .   ? 21.695  21.291  9.732   1.00 94.34  ? 2001 52A B OE1 1 
HETATM 7823 O OE2 . 52A E 3 .   ? 20.126  22.819  9.809   1.00 94.34  ? 2001 52A B OE2 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   25  ?   ?   ?   A . n 
A 1 2   HIS 2   26  ?   ?   ?   A . n 
A 1 3   ASN 3   27  ?   ?   ?   A . n 
A 1 4   PHE 4   28  ?   ?   ?   A . n 
A 1 5   MET 5   29  ?   ?   ?   A . n 
A 1 6   ARG 6   30  30  ARG ARG A . n 
A 1 7   ARG 7   31  31  ARG ARG A . n 
A 1 8   GLU 8   32  32  GLU GLU A . n 
A 1 9   ILE 9   33  33  ILE ILE A . n 
A 1 10  LYS 10  34  34  LYS LYS A . n 
A 1 11  ILE 11  35  35  ILE ILE A . n 
A 1 12  GLU 12  36  36  GLU GLU A . n 
A 1 13  GLY 13  37  37  GLY GLY A . n 
A 1 14  ASP 14  38  38  ASP ASP A . n 
A 1 15  LEU 15  39  39  LEU LEU A . n 
A 1 16  VAL 16  40  40  VAL VAL A . n 
A 1 17  LEU 17  41  41  LEU LEU A . n 
A 1 18  GLY 18  42  42  GLY GLY A . n 
A 1 19  GLY 19  43  43  GLY GLY A . n 
A 1 20  LEU 20  44  44  LEU LEU A . n 
A 1 21  PHE 21  45  45  PHE PHE A . n 
A 1 22  PRO 22  46  46  PRO PRO A . n 
A 1 23  ILE 23  47  47  ILE ILE A . n 
A 1 24  ASN 24  48  48  ASN ASN A . n 
A 1 25  GLU 25  49  49  GLU GLU A . n 
A 1 26  LYS 26  50  50  LYS LYS A . n 
A 1 27  GLY 27  51  51  GLY GLY A . n 
A 1 28  THR 28  52  52  THR THR A . n 
A 1 29  GLY 29  53  53  GLY GLY A . n 
A 1 30  THR 30  54  54  THR THR A . n 
A 1 31  GLU 31  55  55  GLU GLU A . n 
A 1 32  GLU 32  56  56  GLU GLU A . n 
A 1 33  CYS 33  57  57  CYS CYS A . n 
A 1 34  GLY 34  58  58  GLY GLY A . n 
A 1 35  ARG 35  59  59  ARG ARG A . n 
A 1 36  ILE 36  60  60  ILE ILE A . n 
A 1 37  ASN 37  61  61  ASN ASN A . n 
A 1 38  GLU 38  62  62  GLU GLU A . n 
A 1 39  ASP 39  63  63  ASP ASP A . n 
A 1 40  ARG 40  64  64  ARG ARG A . n 
A 1 41  GLY 41  65  65  GLY GLY A . n 
A 1 42  ILE 42  66  66  ILE ILE A . n 
A 1 43  GLN 43  67  67  GLN GLN A . n 
A 1 44  ARG 44  68  68  ARG ARG A . n 
A 1 45  LEU 45  69  69  LEU LEU A . n 
A 1 46  GLU 46  70  70  GLU GLU A . n 
A 1 47  ALA 47  71  71  ALA ALA A . n 
A 1 48  MET 48  72  72  MET MET A . n 
A 1 49  LEU 49  73  73  LEU LEU A . n 
A 1 50  PHE 50  74  74  PHE PHE A . n 
A 1 51  ALA 51  75  75  ALA ALA A . n 
A 1 52  ILE 52  76  76  ILE ILE A . n 
A 1 53  ASP 53  77  77  ASP ASP A . n 
A 1 54  GLU 54  78  78  GLU GLU A . n 
A 1 55  ILE 55  79  79  ILE ILE A . n 
A 1 56  ASN 56  80  80  ASN ASN A . n 
A 1 57  LYS 57  81  81  LYS LYS A . n 
A 1 58  ASP 58  82  82  ASP ASP A . n 
A 1 59  ASN 59  83  83  ASN ASN A . n 
A 1 60  TYR 60  84  84  TYR TYR A . n 
A 1 61  LEU 61  85  85  LEU LEU A . n 
A 1 62  LEU 62  86  86  LEU LEU A . n 
A 1 63  PRO 63  87  87  PRO PRO A . n 
A 1 64  GLY 64  88  88  GLY GLY A . n 
A 1 65  VAL 65  89  89  VAL VAL A . n 
A 1 66  LYS 66  90  90  LYS LYS A . n 
A 1 67  LEU 67  91  91  LEU LEU A . n 
A 1 68  GLY 68  92  92  GLY GLY A . n 
A 1 69  VAL 69  93  93  VAL VAL A . n 
A 1 70  HIS 70  94  94  HIS HIS A . n 
A 1 71  ILE 71  95  95  ILE ILE A . n 
A 1 72  LEU 72  96  96  LEU LEU A . n 
A 1 73  ASP 73  97  97  ASP ASP A . n 
A 1 74  THR 74  98  98  THR THR A . n 
A 1 75  CYS 75  99  99  CYS CYS A . n 
A 1 76  SER 76  100 100 SER SER A . n 
A 1 77  ARG 77  101 101 ARG ARG A . n 
A 1 78  ASP 78  102 102 ASP ASP A . n 
A 1 79  THR 79  103 103 THR THR A . n 
A 1 80  TYR 80  104 104 TYR TYR A . n 
A 1 81  ALA 81  105 105 ALA ALA A . n 
A 1 82  LEU 82  106 106 LEU LEU A . n 
A 1 83  GLU 83  107 107 GLU GLU A . n 
A 1 84  GLN 84  108 108 GLN GLN A . n 
A 1 85  SER 85  109 109 SER SER A . n 
A 1 86  LEU 86  110 110 LEU LEU A . n 
A 1 87  GLU 87  111 111 GLU GLU A . n 
A 1 88  PHE 88  112 112 PHE PHE A . n 
A 1 89  VAL 89  113 113 VAL VAL A . n 
A 1 90  ARG 90  114 114 ARG ARG A . n 
A 1 91  ALA 91  115 115 ALA ALA A . n 
A 1 92  SER 92  116 116 SER SER A . n 
A 1 93  LEU 93  117 117 LEU LEU A . n 
A 1 94  THR 94  118 ?   ?   ?   A . n 
A 1 95  LYS 95  119 ?   ?   ?   A . n 
A 1 96  VAL 96  120 ?   ?   ?   A . n 
A 1 97  ASP 97  121 ?   ?   ?   A . n 
A 1 98  GLU 98  122 ?   ?   ?   A . n 
A 1 99  ALA 99  123 ?   ?   ?   A . n 
A 1 100 GLU 100 124 ?   ?   ?   A . n 
A 1 101 TYR 101 125 ?   ?   ?   A . n 
A 1 102 MET 102 126 ?   ?   ?   A . n 
A 1 103 CYS 103 127 ?   ?   ?   A . n 
A 1 104 PRO 104 128 ?   ?   ?   A . n 
A 1 105 ASP 105 129 ?   ?   ?   A . n 
A 1 106 GLY 106 130 ?   ?   ?   A . n 
A 1 107 SER 107 131 ?   ?   ?   A . n 
A 1 108 TYR 108 132 ?   ?   ?   A . n 
A 1 109 ALA 109 133 ?   ?   ?   A . n 
A 1 110 ILE 110 134 ?   ?   ?   A . n 
A 1 111 GLN 111 135 ?   ?   ?   A . n 
A 1 112 GLU 112 136 ?   ?   ?   A . n 
A 1 113 ASN 113 137 ?   ?   ?   A . n 
A 1 114 ILE 114 138 138 ILE ILE A . n 
A 1 115 PRO 115 139 139 PRO PRO A . n 
A 1 116 LEU 116 140 140 LEU LEU A . n 
A 1 117 LEU 117 141 141 LEU LEU A . n 
A 1 118 ILE 118 142 142 ILE ILE A . n 
A 1 119 ALA 119 143 143 ALA ALA A . n 
A 1 120 GLY 120 144 144 GLY GLY A . n 
A 1 121 VAL 121 145 145 VAL VAL A . n 
A 1 122 ILE 122 146 146 ILE ILE A . n 
A 1 123 GLY 123 147 147 GLY GLY A . n 
A 1 124 GLY 124 148 148 GLY GLY A . n 
A 1 125 SER 125 149 149 SER SER A . n 
A 1 126 TYR 126 150 150 TYR TYR A . n 
A 1 127 SER 127 151 151 SER SER A . n 
A 1 128 SER 128 152 152 SER SER A . n 
A 1 129 VAL 129 153 153 VAL VAL A . n 
A 1 130 SER 130 154 154 SER SER A . n 
A 1 131 ILE 131 155 155 ILE ILE A . n 
A 1 132 GLN 132 156 156 GLN GLN A . n 
A 1 133 VAL 133 157 157 VAL VAL A . n 
A 1 134 ALA 134 158 158 ALA ALA A . n 
A 1 135 ASN 135 159 159 ASN ASN A . n 
A 1 136 LEU 136 160 160 LEU LEU A . n 
A 1 137 LEU 137 161 161 LEU LEU A . n 
A 1 138 ARG 138 162 162 ARG ARG A . n 
A 1 139 LEU 139 163 163 LEU LEU A . n 
A 1 140 PHE 140 164 164 PHE PHE A . n 
A 1 141 GLN 141 165 165 GLN GLN A . n 
A 1 142 ILE 142 166 166 ILE ILE A . n 
A 1 143 PRO 143 167 167 PRO PRO A . n 
A 1 144 GLN 144 168 168 GLN GLN A . n 
A 1 145 ILE 145 169 169 ILE ILE A . n 
A 1 146 SER 146 170 170 SER SER A . n 
A 1 147 TYR 147 171 171 TYR TYR A . n 
A 1 148 ALA 148 172 172 ALA ALA A . n 
A 1 149 SER 149 173 173 SER SER A . n 
A 1 150 THR 150 174 174 THR THR A . n 
A 1 151 SER 151 175 175 SER SER A . n 
A 1 152 ALA 152 176 176 ALA ALA A . n 
A 1 153 LYS 153 177 177 LYS LYS A . n 
A 1 154 LEU 154 178 178 LEU LEU A . n 
A 1 155 SER 155 179 179 SER SER A . n 
A 1 156 ASP 156 180 180 ASP ASP A . n 
A 1 157 LYS 157 181 181 LYS LYS A . n 
A 1 158 SER 158 182 182 SER SER A . n 
A 1 159 ARG 159 183 183 ARG ARG A . n 
A 1 160 TYR 160 184 184 TYR TYR A . n 
A 1 161 ASP 161 185 185 ASP ASP A . n 
A 1 162 TYR 162 186 186 TYR TYR A . n 
A 1 163 PHE 163 187 187 PHE PHE A . n 
A 1 164 ALA 164 188 188 ALA ALA A . n 
A 1 165 ARG 165 189 189 ARG ARG A . n 
A 1 166 THR 166 190 190 THR THR A . n 
A 1 167 VAL 167 191 191 VAL VAL A . n 
A 1 168 PRO 168 192 192 PRO PRO A . n 
A 1 169 PRO 169 193 193 PRO PRO A . n 
A 1 170 ASP 170 194 194 ASP ASP A . n 
A 1 171 PHE 171 195 195 PHE PHE A . n 
A 1 172 TYR 172 196 196 TYR TYR A . n 
A 1 173 GLN 173 197 197 GLN GLN A . n 
A 1 174 ALA 174 198 198 ALA ALA A . n 
A 1 175 LYS 175 199 199 LYS LYS A . n 
A 1 176 ALA 176 200 200 ALA ALA A . n 
A 1 177 MET 177 201 201 MET MET A . n 
A 1 178 ALA 178 202 202 ALA ALA A . n 
A 1 179 GLU 179 203 203 GLU GLU A . n 
A 1 180 ILE 180 204 204 ILE ILE A . n 
A 1 181 LEU 181 205 205 LEU LEU A . n 
A 1 182 ARG 182 206 206 ARG ARG A . n 
A 1 183 PHE 183 207 207 PHE PHE A . n 
A 1 184 PHE 184 208 208 PHE PHE A . n 
A 1 185 ASN 185 209 209 ASN ASN A . n 
A 1 186 TRP 186 210 210 TRP TRP A . n 
A 1 187 THR 187 211 211 THR THR A . n 
A 1 188 TYR 188 212 212 TYR TYR A . n 
A 1 189 VAL 189 213 213 VAL VAL A . n 
A 1 190 SER 190 214 214 SER SER A . n 
A 1 191 THR 191 215 215 THR THR A . n 
A 1 192 VAL 192 216 216 VAL VAL A . n 
A 1 193 ALA 193 217 217 ALA ALA A . n 
A 1 194 SER 194 218 218 SER SER A . n 
A 1 195 GLU 195 219 219 GLU GLU A . n 
A 1 196 GLY 196 220 220 GLY GLY A . n 
A 1 197 ASP 197 221 221 ASP ASP A . n 
A 1 198 TYR 198 222 222 TYR TYR A . n 
A 1 199 GLY 199 223 223 GLY GLY A . n 
A 1 200 GLU 200 224 224 GLU GLU A . n 
A 1 201 THR 201 225 225 THR THR A . n 
A 1 202 GLY 202 226 226 GLY GLY A . n 
A 1 203 ILE 203 227 227 ILE ILE A . n 
A 1 204 GLU 204 228 228 GLU GLU A . n 
A 1 205 ALA 205 229 229 ALA ALA A . n 
A 1 206 PHE 206 230 230 PHE PHE A . n 
A 1 207 GLU 207 231 231 GLU GLU A . n 
A 1 208 GLN 208 232 232 GLN GLN A . n 
A 1 209 GLU 209 233 233 GLU GLU A . n 
A 1 210 ALA 210 234 234 ALA ALA A . n 
A 1 211 ARG 211 235 235 ARG ARG A . n 
A 1 212 LEU 212 236 236 LEU LEU A . n 
A 1 213 ARG 213 237 237 ARG ARG A . n 
A 1 214 ASN 214 238 238 ASN ASN A . n 
A 1 215 ILE 215 239 239 ILE ILE A . n 
A 1 216 CYS 216 240 240 CYS CYS A . n 
A 1 217 ILE 217 241 241 ILE ILE A . n 
A 1 218 ALA 218 242 242 ALA ALA A . n 
A 1 219 THR 219 243 243 THR THR A . n 
A 1 220 ALA 220 244 244 ALA ALA A . n 
A 1 221 GLU 221 245 245 GLU GLU A . n 
A 1 222 LYS 222 246 246 LYS LYS A . n 
A 1 223 VAL 223 247 247 VAL VAL A . n 
A 1 224 GLY 224 248 248 GLY GLY A . n 
A 1 225 ARG 225 249 249 ARG ARG A . n 
A 1 226 SER 226 250 250 SER SER A . n 
A 1 227 ASN 227 251 251 ASN ASN A . n 
A 1 228 ILE 228 252 252 ILE ILE A . n 
A 1 229 ARG 229 253 253 ARG ARG A . n 
A 1 230 LYS 230 254 254 LYS LYS A . n 
A 1 231 SER 231 255 255 SER SER A . n 
A 1 232 TYR 232 256 256 TYR TYR A . n 
A 1 233 ASP 233 257 257 ASP ASP A . n 
A 1 234 SER 234 258 258 SER SER A . n 
A 1 235 VAL 235 259 259 VAL VAL A . n 
A 1 236 ILE 236 260 260 ILE ILE A . n 
A 1 237 ARG 237 261 261 ARG ARG A . n 
A 1 238 GLU 238 262 262 GLU GLU A . n 
A 1 239 LEU 239 263 263 LEU LEU A . n 
A 1 240 LEU 240 264 264 LEU LEU A . n 
A 1 241 GLN 241 265 265 GLN GLN A . n 
A 1 242 LYS 242 266 266 LYS LYS A . n 
A 1 243 PRO 243 267 267 PRO PRO A . n 
A 1 244 ASN 244 268 268 ASN ASN A . n 
A 1 245 ALA 245 269 269 ALA ALA A . n 
A 1 246 ARG 246 270 270 ARG ARG A . n 
A 1 247 VAL 247 271 271 VAL VAL A . n 
A 1 248 VAL 248 272 272 VAL VAL A . n 
A 1 249 VAL 249 273 273 VAL VAL A . n 
A 1 250 LEU 250 274 274 LEU LEU A . n 
A 1 251 PHE 251 275 275 PHE PHE A . n 
A 1 252 MET 252 276 276 MET MET A . n 
A 1 253 ARG 253 277 277 ARG ARG A . n 
A 1 254 SER 254 278 278 SER SER A . n 
A 1 255 ASP 255 279 279 ASP ASP A . n 
A 1 256 ASP 256 280 280 ASP ASP A . n 
A 1 257 SER 257 281 281 SER SER A . n 
A 1 258 ARG 258 282 282 ARG ARG A . n 
A 1 259 GLU 259 283 283 GLU GLU A . n 
A 1 260 LEU 260 284 284 LEU LEU A . n 
A 1 261 ILE 261 285 285 ILE ILE A . n 
A 1 262 ALA 262 286 286 ALA ALA A . n 
A 1 263 ALA 263 287 287 ALA ALA A . n 
A 1 264 ALA 264 288 288 ALA ALA A . n 
A 1 265 ASN 265 289 289 ASN ASN A . n 
A 1 266 ARG 266 290 290 ARG ARG A . n 
A 1 267 VAL 267 291 291 VAL VAL A . n 
A 1 268 ASN 268 292 292 ASN ASN A . n 
A 1 269 ALA 269 293 293 ALA ALA A . n 
A 1 270 SER 270 294 294 SER SER A . n 
A 1 271 PHE 271 295 295 PHE PHE A . n 
A 1 272 THR 272 296 296 THR THR A . n 
A 1 273 TRP 273 297 297 TRP TRP A . n 
A 1 274 VAL 274 298 298 VAL VAL A . n 
A 1 275 ALA 275 299 299 ALA ALA A . n 
A 1 276 SER 276 300 300 SER SER A . n 
A 1 277 ASP 277 301 301 ASP ASP A . n 
A 1 278 GLY 278 302 302 GLY GLY A . n 
A 1 279 TRP 279 303 303 TRP TRP A . n 
A 1 280 GLY 280 304 304 GLY GLY A . n 
A 1 281 ALA 281 305 305 ALA ALA A . n 
A 1 282 GLN 282 306 306 GLN GLN A . n 
A 1 283 GLU 283 307 307 GLU GLU A . n 
A 1 284 SER 284 308 308 SER SER A . n 
A 1 285 ILE 285 309 309 ILE ILE A . n 
A 1 286 VAL 286 310 310 VAL VAL A . n 
A 1 287 LYS 287 311 311 LYS LYS A . n 
A 1 288 GLY 288 312 312 GLY GLY A . n 
A 1 289 SER 289 313 313 SER SER A . n 
A 1 290 GLU 290 314 314 GLU GLU A . n 
A 1 291 HIS 291 315 315 HIS HIS A . n 
A 1 292 VAL 292 316 316 VAL VAL A . n 
A 1 293 ALA 293 317 317 ALA ALA A . n 
A 1 294 TYR 294 318 318 TYR TYR A . n 
A 1 295 GLY 295 319 319 GLY GLY A . n 
A 1 296 ALA 296 320 320 ALA ALA A . n 
A 1 297 ILE 297 321 321 ILE ILE A . n 
A 1 298 THR 298 322 322 THR THR A . n 
A 1 299 LEU 299 323 323 LEU LEU A . n 
A 1 300 GLU 300 324 324 GLU GLU A . n 
A 1 301 LEU 301 325 325 LEU LEU A . n 
A 1 302 ALA 302 326 326 ALA ALA A . n 
A 1 303 SER 303 327 327 SER SER A . n 
A 1 304 HIS 304 328 328 HIS HIS A . n 
A 1 305 PRO 305 329 329 PRO PRO A . n 
A 1 306 VAL 306 330 330 VAL VAL A . n 
A 1 307 ARG 307 331 331 ARG ARG A . n 
A 1 308 GLN 308 332 332 GLN GLN A . n 
A 1 309 PHE 309 333 333 PHE PHE A . n 
A 1 310 ASP 310 334 334 ASP ASP A . n 
A 1 311 ARG 311 335 335 ARG ARG A . n 
A 1 312 TYR 312 336 336 TYR TYR A . n 
A 1 313 PHE 313 337 337 PHE PHE A . n 
A 1 314 GLN 314 338 338 GLN GLN A . n 
A 1 315 SER 315 339 339 SER SER A . n 
A 1 316 LEU 316 340 340 LEU LEU A . n 
A 1 317 ASN 317 341 341 ASN ASN A . n 
A 1 318 PRO 318 342 342 PRO PRO A . n 
A 1 319 TYR 319 343 343 TYR TYR A . n 
A 1 320 ASN 320 344 344 ASN ASN A . n 
A 1 321 ASN 321 345 345 ASN ASN A . n 
A 1 322 HIS 322 346 346 HIS HIS A . n 
A 1 323 ARG 323 347 347 ARG ARG A . n 
A 1 324 ASN 324 348 348 ASN ASN A . n 
A 1 325 PRO 325 349 349 PRO PRO A . n 
A 1 326 TRP 326 350 350 TRP TRP A . n 
A 1 327 PHE 327 351 351 PHE PHE A . n 
A 1 328 ARG 328 352 352 ARG ARG A . n 
A 1 329 ASP 329 353 353 ASP ASP A . n 
A 1 330 PHE 330 354 354 PHE PHE A . n 
A 1 331 TRP 331 355 355 TRP TRP A . n 
A 1 332 GLU 332 356 356 GLU GLU A . n 
A 1 333 GLN 333 357 357 GLN GLN A . n 
A 1 334 LYS 334 358 358 LYS LYS A . n 
A 1 335 PHE 335 359 359 PHE PHE A . n 
A 1 336 GLN 336 360 360 GLN GLN A . n 
A 1 337 CYS 337 361 361 CYS CYS A . n 
A 1 338 SER 338 362 362 SER SER A . n 
A 1 339 LEU 339 363 363 LEU LEU A . n 
A 1 340 GLN 340 364 364 GLN GLN A . n 
A 1 341 ASN 341 365 365 ASN ASN A . n 
A 1 342 LYS 342 366 366 LYS LYS A . n 
A 1 343 ARG 343 367 367 ARG ARG A . n 
A 1 344 ASN 344 368 368 ASN ASN A . n 
A 1 345 HIS 345 369 369 HIS HIS A . n 
A 1 346 ARG 346 370 370 ARG ARG A . n 
A 1 347 GLN 347 371 371 GLN GLN A . n 
A 1 348 VAL 348 372 372 VAL VAL A . n 
A 1 349 CYS 349 373 373 CYS CYS A . n 
A 1 350 ASP 350 374 374 ASP ASP A . n 
A 1 351 LYS 351 375 375 LYS LYS A . n 
A 1 352 HIS 352 376 376 HIS HIS A . n 
A 1 353 LEU 353 377 377 LEU LEU A . n 
A 1 354 ALA 354 378 378 ALA ALA A . n 
A 1 355 ILE 355 379 379 ILE ILE A . n 
A 1 356 ASP 356 380 380 ASP ASP A . n 
A 1 357 SER 357 381 381 SER SER A . n 
A 1 358 SER 358 382 382 SER SER A . n 
A 1 359 ASN 359 383 383 ASN ASN A . n 
A 1 360 TYR 360 384 384 TYR TYR A . n 
A 1 361 GLU 361 385 385 GLU GLU A . n 
A 1 362 GLN 362 386 386 GLN GLN A . n 
A 1 363 GLU 363 387 387 GLU GLU A . n 
A 1 364 SER 364 388 388 SER SER A . n 
A 1 365 LYS 365 389 389 LYS LYS A . n 
A 1 366 ILE 366 390 390 ILE ILE A . n 
A 1 367 MET 367 391 391 MET MET A . n 
A 1 368 PHE 368 392 392 PHE PHE A . n 
A 1 369 VAL 369 393 393 VAL VAL A . n 
A 1 370 VAL 370 394 394 VAL VAL A . n 
A 1 371 ASN 371 395 395 ASN ASN A . n 
A 1 372 ALA 372 396 396 ALA ALA A . n 
A 1 373 VAL 373 397 397 VAL VAL A . n 
A 1 374 TYR 374 398 398 TYR TYR A . n 
A 1 375 ALA 375 399 399 ALA ALA A . n 
A 1 376 MET 376 400 400 MET MET A . n 
A 1 377 ALA 377 401 401 ALA ALA A . n 
A 1 378 HIS 378 402 402 HIS HIS A . n 
A 1 379 ALA 379 403 403 ALA ALA A . n 
A 1 380 LEU 380 404 404 LEU LEU A . n 
A 1 381 HIS 381 405 405 HIS HIS A . n 
A 1 382 LYS 382 406 406 LYS LYS A . n 
A 1 383 MET 383 407 407 MET MET A . n 
A 1 384 GLN 384 408 408 GLN GLN A . n 
A 1 385 ARG 385 409 409 ARG ARG A . n 
A 1 386 THR 386 410 410 THR THR A . n 
A 1 387 LEU 387 411 411 LEU LEU A . n 
A 1 388 CYS 388 412 412 CYS CYS A . n 
A 1 389 PRO 389 413 413 PRO PRO A . n 
A 1 390 GLN 390 414 414 GLN GLN A . n 
A 1 391 THR 391 415 415 THR THR A . n 
A 1 392 THR 392 416 416 THR THR A . n 
A 1 393 LYS 393 417 417 LYS LYS A . n 
A 1 394 LEU 394 418 418 LEU LEU A . n 
A 1 395 CYS 395 419 419 CYS CYS A . n 
A 1 396 ASP 396 420 420 ASP ASP A . n 
A 1 397 ALA 397 421 421 ALA ALA A . n 
A 1 398 MET 398 422 422 MET MET A . n 
A 1 399 LYS 399 423 423 LYS LYS A . n 
A 1 400 ILE 400 424 424 ILE ILE A . n 
A 1 401 LEU 401 425 425 LEU LEU A . n 
A 1 402 ASP 402 426 426 ASP ASP A . n 
A 1 403 GLY 403 427 427 GLY GLY A . n 
A 1 404 LYS 404 428 428 LYS LYS A . n 
A 1 405 LYS 405 429 429 LYS LYS A . n 
A 1 406 LEU 406 430 430 LEU LEU A . n 
A 1 407 TYR 407 431 431 TYR TYR A . n 
A 1 408 LYS 408 432 432 LYS LYS A . n 
A 1 409 GLU 409 433 433 GLU GLU A . n 
A 1 410 TYR 410 434 434 TYR TYR A . n 
A 1 411 LEU 411 435 435 LEU LEU A . n 
A 1 412 LEU 412 436 436 LEU LEU A . n 
A 1 413 LYS 413 437 437 LYS LYS A . n 
A 1 414 ILE 414 438 438 ILE ILE A . n 
A 1 415 GLN 415 439 439 GLN GLN A . n 
A 1 416 PHE 416 440 440 PHE PHE A . n 
A 1 417 THR 417 441 441 THR THR A . n 
A 1 418 ALA 418 442 442 ALA ALA A . n 
A 1 419 PRO 419 443 443 PRO PRO A . n 
A 1 420 PHE 420 444 444 PHE PHE A . n 
A 1 421 ASN 421 445 445 ASN ASN A . n 
A 1 422 PRO 422 446 446 PRO PRO A . n 
A 1 423 ASN 423 447 447 ASN ASN A . n 
A 1 424 LYS 424 448 448 LYS LYS A . n 
A 1 425 GLY 425 449 449 GLY GLY A . n 
A 1 426 ALA 426 450 450 ALA ALA A . n 
A 1 427 ASP 427 451 451 ASP ASP A . n 
A 1 428 SER 428 452 452 SER SER A . n 
A 1 429 ILE 429 453 453 ILE ILE A . n 
A 1 430 VAL 430 454 454 VAL VAL A . n 
A 1 431 LYS 431 455 455 LYS LYS A . n 
A 1 432 PHE 432 456 456 PHE PHE A . n 
A 1 433 ASP 433 457 457 ASP ASP A . n 
A 1 434 THR 434 458 458 THR THR A . n 
A 1 435 PHE 435 459 459 PHE PHE A . n 
A 1 436 GLY 436 460 460 GLY GLY A . n 
A 1 437 ASP 437 461 461 ASP ASP A . n 
A 1 438 GLY 438 462 462 GLY GLY A . n 
A 1 439 MET 439 463 463 MET MET A . n 
A 1 440 GLY 440 464 464 GLY GLY A . n 
A 1 441 ARG 441 465 465 ARG ARG A . n 
A 1 442 TYR 442 466 466 TYR TYR A . n 
A 1 443 ASN 443 467 467 ASN ASN A . n 
A 1 444 VAL 444 468 468 VAL VAL A . n 
A 1 445 PHE 445 469 469 PHE PHE A . n 
A 1 446 ASN 446 470 470 ASN ASN A . n 
A 1 447 LEU 447 471 471 LEU LEU A . n 
A 1 448 GLN 448 472 472 GLN GLN A . n 
A 1 449 GLN 449 473 473 GLN GLN A . n 
A 1 450 THR 450 474 474 THR THR A . n 
A 1 451 GLY 451 475 475 GLY GLY A . n 
A 1 452 GLY 452 476 476 GLY GLY A . n 
A 1 453 LYS 453 477 477 LYS LYS A . n 
A 1 454 TYR 454 478 478 TYR TYR A . n 
A 1 455 SER 455 479 479 SER SER A . n 
A 1 456 TYR 456 480 480 TYR TYR A . n 
A 1 457 LEU 457 481 481 LEU LEU A . n 
A 1 458 LYS 458 482 482 LYS LYS A . n 
A 1 459 VAL 459 483 483 VAL VAL A . n 
A 1 460 GLY 460 484 484 GLY GLY A . n 
A 1 461 HIS 461 485 485 HIS HIS A . n 
A 1 462 TRP 462 486 486 TRP TRP A . n 
A 1 463 ALA 463 487 487 ALA ALA A . n 
A 1 464 GLU 464 488 488 GLU GLU A . n 
A 1 465 THR 465 489 489 THR THR A . n 
A 1 466 LEU 466 490 490 LEU LEU A . n 
A 1 467 SER 467 491 491 SER SER A . n 
A 1 468 LEU 468 492 492 LEU LEU A . n 
A 1 469 ASP 469 493 493 ASP ASP A . n 
A 1 470 VAL 470 494 494 VAL VAL A . n 
A 1 471 ASP 471 495 495 ASP ASP A . n 
A 1 472 SER 472 496 496 SER SER A . n 
A 1 473 ILE 473 497 497 ILE ILE A . n 
A 1 474 HIS 474 498 498 HIS HIS A . n 
A 1 475 TRP 475 499 499 TRP TRP A . n 
A 1 476 SER 476 500 500 SER SER A . n 
A 1 477 ARG 477 501 501 ARG ALA A . n 
A 1 478 ASN 478 502 502 ASN ASN A . n 
A 1 479 SER 479 503 503 SER SER A . n 
A 1 480 VAL 480 504 504 VAL VAL A . n 
A 1 481 PRO 481 505 505 PRO PRO A . n 
A 1 482 THR 482 506 506 THR THR A . n 
A 1 483 SER 483 507 507 SER SER A . n 
A 1 484 GLN 484 508 508 GLN GLN A . n 
A 1 485 CYS 485 509 509 CYS CYS A . n 
A 1 486 SER 486 510 510 SER SER A . n 
A 1 487 ASP 487 511 511 ASP ASP A . n 
A 1 488 PRO 488 512 512 PRO PRO A . n 
A 1 489 CYS 489 513 513 CYS CYS A . n 
A 1 490 ALA 490 514 514 ALA ALA A . n 
A 1 491 PRO 491 515 515 PRO PRO A . n 
A 1 492 ASN 492 516 516 ASN ASN A . n 
A 1 493 GLU 493 517 517 GLU GLU A . n 
A 1 494 MET 494 518 518 MET MET A . n 
A 1 495 LYS 495 519 519 LYS LYS A . n 
A 1 496 ASN 496 520 520 ASN ASN A . n 
A 1 497 MET 497 521 521 MET MET A . n 
A 1 498 GLN 498 522 522 GLN GLN A . n 
A 1 499 PRO 499 523 523 PRO PRO A . n 
A 1 500 GLY 500 524 524 GLY GLY A . n 
A 1 501 ASP 501 525 525 ASP ASP A . n 
A 1 502 VAL 502 526 526 VAL VAL A . n 
A 1 503 CYS 503 527 527 CYS CYS A . n 
A 1 504 CYS 504 528 528 CYS CYS A . n 
A 1 505 TRP 505 529 529 TRP TRP A . n 
A 1 506 ILE 506 530 530 ILE ILE A . n 
A 1 507 CYS 507 531 531 CYS CYS A . n 
A 1 508 ILE 508 532 532 ILE ILE A . n 
A 1 509 PRO 509 533 533 PRO PRO A . n 
A 1 510 CYS 510 534 534 CYS CYS A . n 
A 1 511 GLU 511 535 535 GLU GLU A . n 
A 1 512 PRO 512 536 536 PRO PRO A . n 
A 1 513 TYR 513 537 537 TYR TYR A . n 
A 1 514 GLU 514 538 538 GLU GLU A . n 
A 1 515 TYR 515 539 539 TYR TYR A . n 
A 1 516 LEU 516 540 540 LEU LEU A . n 
A 1 517 VAL 517 541 541 VAL VAL A . n 
A 1 518 ASP 518 542 542 ASP ASP A . n 
A 1 519 GLU 519 543 543 GLU GLU A . n 
A 1 520 PHE 520 544 544 PHE PHE A . n 
A 1 521 THR 521 545 545 THR THR A . n 
A 1 522 CYS 522 546 546 CYS CYS A . n 
A 1 523 MET 523 547 547 MET MET A . n 
A 1 524 ASP 524 548 548 ASP ASP A . n 
A 1 525 CYS 525 549 549 CYS CYS A . n 
A 1 526 GLY 526 550 550 GLY GLY A . n 
A 1 527 PRO 527 551 551 PRO PRO A . n 
A 1 528 GLY 528 552 552 GLY GLY A . n 
A 1 529 GLN 529 553 553 GLN GLN A . n 
A 1 530 TRP 530 554 554 TRP TRP A . n 
A 1 531 PRO 531 555 555 PRO PRO A . n 
A 1 532 THR 532 556 556 THR THR A . n 
A 1 533 ALA 533 557 557 ALA ALA A . n 
A 1 534 ASP 534 558 558 ASP ASP A . n 
A 1 535 LEU 535 559 559 LEU LEU A . n 
A 1 536 SER 536 560 560 SER SER A . n 
A 1 537 GLY 537 561 561 GLY GLY A . n 
A 1 538 CYS 538 562 562 CYS CYS A . n 
A 1 539 TYR 539 563 563 TYR TYR A . n 
A 1 540 ASN 540 564 564 ASN ASN A . n 
A 1 541 LEU 541 565 565 LEU LEU A . n 
A 1 542 PRO 542 566 566 PRO PRO A . n 
A 1 543 GLU 543 567 567 GLU GLU A . n 
A 1 544 ASP 544 568 ?   ?   ?   A . n 
A 1 545 TYR 545 569 ?   ?   ?   A . n 
A 1 546 ILE 546 570 ?   ?   ?   A . n 
A 1 547 LYS 547 571 ?   ?   ?   A . n 
A 1 548 TRP 548 572 ?   ?   ?   A . n 
A 1 549 GLU 549 573 ?   ?   ?   A . n 
A 1 550 ASP 550 574 ?   ?   ?   A . n 
A 1 551 ALA 551 575 ?   ?   ?   A . n 
A 1 552 LEU 552 576 ?   ?   ?   A . n 
A 1 553 VAL 553 577 ?   ?   ?   A . n 
A 1 554 PRO 554 578 ?   ?   ?   A . n 
A 1 555 ARG 555 579 ?   ?   ?   A . n 
B 1 1   ASP 1   25  ?   ?   ?   B . n 
B 1 2   HIS 2   26  ?   ?   ?   B . n 
B 1 3   ASN 3   27  ?   ?   ?   B . n 
B 1 4   PHE 4   28  ?   ?   ?   B . n 
B 1 5   MET 5   29  ?   ?   ?   B . n 
B 1 6   ARG 6   30  30  ARG ARG B . n 
B 1 7   ARG 7   31  31  ARG ARG B . n 
B 1 8   GLU 8   32  32  GLU GLU B . n 
B 1 9   ILE 9   33  33  ILE ILE B . n 
B 1 10  LYS 10  34  34  LYS LYS B . n 
B 1 11  ILE 11  35  35  ILE ILE B . n 
B 1 12  GLU 12  36  36  GLU GLU B . n 
B 1 13  GLY 13  37  37  GLY GLY B . n 
B 1 14  ASP 14  38  38  ASP ASP B . n 
B 1 15  LEU 15  39  39  LEU LEU B . n 
B 1 16  VAL 16  40  40  VAL VAL B . n 
B 1 17  LEU 17  41  41  LEU LEU B . n 
B 1 18  GLY 18  42  42  GLY GLY B . n 
B 1 19  GLY 19  43  43  GLY GLY B . n 
B 1 20  LEU 20  44  44  LEU LEU B . n 
B 1 21  PHE 21  45  45  PHE PHE B . n 
B 1 22  PRO 22  46  46  PRO PRO B . n 
B 1 23  ILE 23  47  47  ILE ILE B . n 
B 1 24  ASN 24  48  48  ASN ASN B . n 
B 1 25  GLU 25  49  49  GLU GLU B . n 
B 1 26  LYS 26  50  50  LYS LYS B . n 
B 1 27  GLY 27  51  51  GLY GLY B . n 
B 1 28  THR 28  52  52  THR THR B . n 
B 1 29  GLY 29  53  53  GLY GLY B . n 
B 1 30  THR 30  54  54  THR THR B . n 
B 1 31  GLU 31  55  55  GLU GLU B . n 
B 1 32  GLU 32  56  56  GLU GLU B . n 
B 1 33  CYS 33  57  57  CYS CYS B . n 
B 1 34  GLY 34  58  58  GLY GLY B . n 
B 1 35  ARG 35  59  59  ARG ARG B . n 
B 1 36  ILE 36  60  60  ILE ILE B . n 
B 1 37  ASN 37  61  61  ASN ASN B . n 
B 1 38  GLU 38  62  62  GLU GLU B . n 
B 1 39  ASP 39  63  63  ASP ASP B . n 
B 1 40  ARG 40  64  64  ARG ARG B . n 
B 1 41  GLY 41  65  65  GLY GLY B . n 
B 1 42  ILE 42  66  66  ILE ILE B . n 
B 1 43  GLN 43  67  67  GLN GLN B . n 
B 1 44  ARG 44  68  68  ARG ARG B . n 
B 1 45  LEU 45  69  69  LEU LEU B . n 
B 1 46  GLU 46  70  70  GLU GLU B . n 
B 1 47  ALA 47  71  71  ALA ALA B . n 
B 1 48  MET 48  72  72  MET MET B . n 
B 1 49  LEU 49  73  73  LEU LEU B . n 
B 1 50  PHE 50  74  74  PHE PHE B . n 
B 1 51  ALA 51  75  75  ALA ALA B . n 
B 1 52  ILE 52  76  76  ILE ILE B . n 
B 1 53  ASP 53  77  77  ASP ASP B . n 
B 1 54  GLU 54  78  78  GLU GLU B . n 
B 1 55  ILE 55  79  79  ILE ILE B . n 
B 1 56  ASN 56  80  80  ASN ASN B . n 
B 1 57  LYS 57  81  81  LYS LYS B . n 
B 1 58  ASP 58  82  82  ASP ASP B . n 
B 1 59  ASN 59  83  83  ASN ASN B . n 
B 1 60  TYR 60  84  84  TYR TYR B . n 
B 1 61  LEU 61  85  85  LEU LEU B . n 
B 1 62  LEU 62  86  86  LEU LEU B . n 
B 1 63  PRO 63  87  87  PRO PRO B . n 
B 1 64  GLY 64  88  88  GLY GLY B . n 
B 1 65  VAL 65  89  89  VAL VAL B . n 
B 1 66  LYS 66  90  90  LYS LYS B . n 
B 1 67  LEU 67  91  91  LEU LEU B . n 
B 1 68  GLY 68  92  92  GLY GLY B . n 
B 1 69  VAL 69  93  93  VAL VAL B . n 
B 1 70  HIS 70  94  94  HIS HIS B . n 
B 1 71  ILE 71  95  95  ILE ILE B . n 
B 1 72  LEU 72  96  96  LEU LEU B . n 
B 1 73  ASP 73  97  97  ASP ASP B . n 
B 1 74  THR 74  98  98  THR THR B . n 
B 1 75  CYS 75  99  99  CYS CYS B . n 
B 1 76  SER 76  100 100 SER SER B . n 
B 1 77  ARG 77  101 101 ARG ARG B . n 
B 1 78  ASP 78  102 102 ASP ASP B . n 
B 1 79  THR 79  103 103 THR THR B . n 
B 1 80  TYR 80  104 104 TYR TYR B . n 
B 1 81  ALA 81  105 105 ALA ALA B . n 
B 1 82  LEU 82  106 106 LEU LEU B . n 
B 1 83  GLU 83  107 107 GLU GLU B . n 
B 1 84  GLN 84  108 108 GLN GLN B . n 
B 1 85  SER 85  109 109 SER SER B . n 
B 1 86  LEU 86  110 110 LEU LEU B . n 
B 1 87  GLU 87  111 111 GLU GLU B . n 
B 1 88  PHE 88  112 112 PHE PHE B . n 
B 1 89  VAL 89  113 113 VAL VAL B . n 
B 1 90  ARG 90  114 114 ARG ARG B . n 
B 1 91  ALA 91  115 115 ALA ALA B . n 
B 1 92  SER 92  116 116 SER SER B . n 
B 1 93  LEU 93  117 117 LEU LEU B . n 
B 1 94  THR 94  118 ?   ?   ?   B . n 
B 1 95  LYS 95  119 ?   ?   ?   B . n 
B 1 96  VAL 96  120 ?   ?   ?   B . n 
B 1 97  ASP 97  121 ?   ?   ?   B . n 
B 1 98  GLU 98  122 ?   ?   ?   B . n 
B 1 99  ALA 99  123 ?   ?   ?   B . n 
B 1 100 GLU 100 124 ?   ?   ?   B . n 
B 1 101 TYR 101 125 ?   ?   ?   B . n 
B 1 102 MET 102 126 ?   ?   ?   B . n 
B 1 103 CYS 103 127 ?   ?   ?   B . n 
B 1 104 PRO 104 128 ?   ?   ?   B . n 
B 1 105 ASP 105 129 ?   ?   ?   B . n 
B 1 106 GLY 106 130 ?   ?   ?   B . n 
B 1 107 SER 107 131 ?   ?   ?   B . n 
B 1 108 TYR 108 132 ?   ?   ?   B . n 
B 1 109 ALA 109 133 ?   ?   ?   B . n 
B 1 110 ILE 110 134 ?   ?   ?   B . n 
B 1 111 GLN 111 135 ?   ?   ?   B . n 
B 1 112 GLU 112 136 ?   ?   ?   B . n 
B 1 113 ASN 113 137 ?   ?   ?   B . n 
B 1 114 ILE 114 138 138 ILE ILE B . n 
B 1 115 PRO 115 139 139 PRO PRO B . n 
B 1 116 LEU 116 140 140 LEU LEU B . n 
B 1 117 LEU 117 141 141 LEU LEU B . n 
B 1 118 ILE 118 142 142 ILE ILE B . n 
B 1 119 ALA 119 143 143 ALA ALA B . n 
B 1 120 GLY 120 144 144 GLY GLY B . n 
B 1 121 VAL 121 145 145 VAL VAL B . n 
B 1 122 ILE 122 146 146 ILE ILE B . n 
B 1 123 GLY 123 147 147 GLY GLY B . n 
B 1 124 GLY 124 148 148 GLY GLY B . n 
B 1 125 SER 125 149 149 SER SER B . n 
B 1 126 TYR 126 150 150 TYR TYR B . n 
B 1 127 SER 127 151 151 SER SER B . n 
B 1 128 SER 128 152 152 SER SER B . n 
B 1 129 VAL 129 153 153 VAL VAL B . n 
B 1 130 SER 130 154 154 SER SER B . n 
B 1 131 ILE 131 155 155 ILE ILE B . n 
B 1 132 GLN 132 156 156 GLN GLN B . n 
B 1 133 VAL 133 157 157 VAL VAL B . n 
B 1 134 ALA 134 158 158 ALA ALA B . n 
B 1 135 ASN 135 159 159 ASN ASN B . n 
B 1 136 LEU 136 160 160 LEU LEU B . n 
B 1 137 LEU 137 161 161 LEU LEU B . n 
B 1 138 ARG 138 162 162 ARG ARG B . n 
B 1 139 LEU 139 163 163 LEU LEU B . n 
B 1 140 PHE 140 164 164 PHE PHE B . n 
B 1 141 GLN 141 165 165 GLN GLN B . n 
B 1 142 ILE 142 166 166 ILE ILE B . n 
B 1 143 PRO 143 167 167 PRO PRO B . n 
B 1 144 GLN 144 168 168 GLN GLN B . n 
B 1 145 ILE 145 169 169 ILE ILE B . n 
B 1 146 SER 146 170 170 SER SER B . n 
B 1 147 TYR 147 171 171 TYR TYR B . n 
B 1 148 ALA 148 172 172 ALA ALA B . n 
B 1 149 SER 149 173 173 SER SER B . n 
B 1 150 THR 150 174 174 THR THR B . n 
B 1 151 SER 151 175 175 SER SER B . n 
B 1 152 ALA 152 176 176 ALA ALA B . n 
B 1 153 LYS 153 177 177 LYS LYS B . n 
B 1 154 LEU 154 178 178 LEU LEU B . n 
B 1 155 SER 155 179 179 SER SER B . n 
B 1 156 ASP 156 180 180 ASP ASP B . n 
B 1 157 LYS 157 181 181 LYS LYS B . n 
B 1 158 SER 158 182 182 SER SER B . n 
B 1 159 ARG 159 183 183 ARG ARG B . n 
B 1 160 TYR 160 184 184 TYR TYR B . n 
B 1 161 ASP 161 185 185 ASP ASP B . n 
B 1 162 TYR 162 186 186 TYR TYR B . n 
B 1 163 PHE 163 187 187 PHE PHE B . n 
B 1 164 ALA 164 188 188 ALA ALA B . n 
B 1 165 ARG 165 189 189 ARG ARG B . n 
B 1 166 THR 166 190 190 THR THR B . n 
B 1 167 VAL 167 191 191 VAL VAL B . n 
B 1 168 PRO 168 192 192 PRO PRO B . n 
B 1 169 PRO 169 193 193 PRO PRO B . n 
B 1 170 ASP 170 194 194 ASP ASP B . n 
B 1 171 PHE 171 195 195 PHE PHE B . n 
B 1 172 TYR 172 196 196 TYR TYR B . n 
B 1 173 GLN 173 197 197 GLN GLN B . n 
B 1 174 ALA 174 198 198 ALA ALA B . n 
B 1 175 LYS 175 199 199 LYS LYS B . n 
B 1 176 ALA 176 200 200 ALA ALA B . n 
B 1 177 MET 177 201 201 MET MET B . n 
B 1 178 ALA 178 202 202 ALA ALA B . n 
B 1 179 GLU 179 203 203 GLU GLU B . n 
B 1 180 ILE 180 204 204 ILE ILE B . n 
B 1 181 LEU 181 205 205 LEU LEU B . n 
B 1 182 ARG 182 206 206 ARG ARG B . n 
B 1 183 PHE 183 207 207 PHE PHE B . n 
B 1 184 PHE 184 208 208 PHE PHE B . n 
B 1 185 ASN 185 209 209 ASN ASN B . n 
B 1 186 TRP 186 210 210 TRP TRP B . n 
B 1 187 THR 187 211 211 THR THR B . n 
B 1 188 TYR 188 212 212 TYR TYR B . n 
B 1 189 VAL 189 213 213 VAL VAL B . n 
B 1 190 SER 190 214 214 SER SER B . n 
B 1 191 THR 191 215 215 THR THR B . n 
B 1 192 VAL 192 216 216 VAL VAL B . n 
B 1 193 ALA 193 217 217 ALA ALA B . n 
B 1 194 SER 194 218 218 SER SER B . n 
B 1 195 GLU 195 219 219 GLU GLU B . n 
B 1 196 GLY 196 220 220 GLY GLY B . n 
B 1 197 ASP 197 221 221 ASP ASP B . n 
B 1 198 TYR 198 222 222 TYR TYR B . n 
B 1 199 GLY 199 223 223 GLY GLY B . n 
B 1 200 GLU 200 224 224 GLU GLU B . n 
B 1 201 THR 201 225 225 THR THR B . n 
B 1 202 GLY 202 226 226 GLY GLY B . n 
B 1 203 ILE 203 227 227 ILE ILE B . n 
B 1 204 GLU 204 228 228 GLU GLU B . n 
B 1 205 ALA 205 229 229 ALA ALA B . n 
B 1 206 PHE 206 230 230 PHE PHE B . n 
B 1 207 GLU 207 231 231 GLU GLU B . n 
B 1 208 GLN 208 232 232 GLN GLN B . n 
B 1 209 GLU 209 233 233 GLU GLU B . n 
B 1 210 ALA 210 234 234 ALA ALA B . n 
B 1 211 ARG 211 235 235 ARG ARG B . n 
B 1 212 LEU 212 236 236 LEU LEU B . n 
B 1 213 ARG 213 237 237 ARG ARG B . n 
B 1 214 ASN 214 238 238 ASN ASN B . n 
B 1 215 ILE 215 239 239 ILE ILE B . n 
B 1 216 CYS 216 240 240 CYS CYS B . n 
B 1 217 ILE 217 241 241 ILE ILE B . n 
B 1 218 ALA 218 242 242 ALA ALA B . n 
B 1 219 THR 219 243 243 THR THR B . n 
B 1 220 ALA 220 244 244 ALA ALA B . n 
B 1 221 GLU 221 245 245 GLU GLU B . n 
B 1 222 LYS 222 246 246 LYS LYS B . n 
B 1 223 VAL 223 247 247 VAL VAL B . n 
B 1 224 GLY 224 248 248 GLY GLY B . n 
B 1 225 ARG 225 249 249 ARG ARG B . n 
B 1 226 SER 226 250 250 SER SER B . n 
B 1 227 ASN 227 251 251 ASN ASN B . n 
B 1 228 ILE 228 252 252 ILE ILE B . n 
B 1 229 ARG 229 253 253 ARG ARG B . n 
B 1 230 LYS 230 254 254 LYS LYS B . n 
B 1 231 SER 231 255 255 SER SER B . n 
B 1 232 TYR 232 256 256 TYR TYR B . n 
B 1 233 ASP 233 257 257 ASP ASP B . n 
B 1 234 SER 234 258 258 SER SER B . n 
B 1 235 VAL 235 259 259 VAL VAL B . n 
B 1 236 ILE 236 260 260 ILE ILE B . n 
B 1 237 ARG 237 261 261 ARG ARG B . n 
B 1 238 GLU 238 262 262 GLU GLU B . n 
B 1 239 LEU 239 263 263 LEU LEU B . n 
B 1 240 LEU 240 264 264 LEU LEU B . n 
B 1 241 GLN 241 265 265 GLN GLN B . n 
B 1 242 LYS 242 266 266 LYS LYS B . n 
B 1 243 PRO 243 267 267 PRO PRO B . n 
B 1 244 ASN 244 268 268 ASN ASN B . n 
B 1 245 ALA 245 269 269 ALA ALA B . n 
B 1 246 ARG 246 270 270 ARG ARG B . n 
B 1 247 VAL 247 271 271 VAL VAL B . n 
B 1 248 VAL 248 272 272 VAL VAL B . n 
B 1 249 VAL 249 273 273 VAL VAL B . n 
B 1 250 LEU 250 274 274 LEU LEU B . n 
B 1 251 PHE 251 275 275 PHE PHE B . n 
B 1 252 MET 252 276 276 MET MET B . n 
B 1 253 ARG 253 277 277 ARG ARG B . n 
B 1 254 SER 254 278 278 SER SER B . n 
B 1 255 ASP 255 279 279 ASP ASP B . n 
B 1 256 ASP 256 280 280 ASP ASP B . n 
B 1 257 SER 257 281 281 SER SER B . n 
B 1 258 ARG 258 282 282 ARG ARG B . n 
B 1 259 GLU 259 283 283 GLU GLU B . n 
B 1 260 LEU 260 284 284 LEU LEU B . n 
B 1 261 ILE 261 285 285 ILE ILE B . n 
B 1 262 ALA 262 286 286 ALA ALA B . n 
B 1 263 ALA 263 287 287 ALA ALA B . n 
B 1 264 ALA 264 288 288 ALA ALA B . n 
B 1 265 ASN 265 289 289 ASN ASN B . n 
B 1 266 ARG 266 290 290 ARG ARG B . n 
B 1 267 VAL 267 291 291 VAL VAL B . n 
B 1 268 ASN 268 292 292 ASN ASN B . n 
B 1 269 ALA 269 293 293 ALA ALA B . n 
B 1 270 SER 270 294 294 SER SER B . n 
B 1 271 PHE 271 295 295 PHE PHE B . n 
B 1 272 THR 272 296 296 THR THR B . n 
B 1 273 TRP 273 297 297 TRP TRP B . n 
B 1 274 VAL 274 298 298 VAL VAL B . n 
B 1 275 ALA 275 299 299 ALA ALA B . n 
B 1 276 SER 276 300 300 SER SER B . n 
B 1 277 ASP 277 301 301 ASP ASP B . n 
B 1 278 GLY 278 302 302 GLY GLY B . n 
B 1 279 TRP 279 303 303 TRP TRP B . n 
B 1 280 GLY 280 304 304 GLY GLY B . n 
B 1 281 ALA 281 305 305 ALA ALA B . n 
B 1 282 GLN 282 306 306 GLN GLN B . n 
B 1 283 GLU 283 307 307 GLU GLU B . n 
B 1 284 SER 284 308 308 SER SER B . n 
B 1 285 ILE 285 309 309 ILE ILE B . n 
B 1 286 VAL 286 310 310 VAL VAL B . n 
B 1 287 LYS 287 311 311 LYS LYS B . n 
B 1 288 GLY 288 312 312 GLY GLY B . n 
B 1 289 SER 289 313 313 SER SER B . n 
B 1 290 GLU 290 314 314 GLU GLU B . n 
B 1 291 HIS 291 315 315 HIS HIS B . n 
B 1 292 VAL 292 316 316 VAL VAL B . n 
B 1 293 ALA 293 317 317 ALA ALA B . n 
B 1 294 TYR 294 318 318 TYR TYR B . n 
B 1 295 GLY 295 319 319 GLY GLY B . n 
B 1 296 ALA 296 320 320 ALA ALA B . n 
B 1 297 ILE 297 321 321 ILE ILE B . n 
B 1 298 THR 298 322 322 THR THR B . n 
B 1 299 LEU 299 323 323 LEU LEU B . n 
B 1 300 GLU 300 324 324 GLU GLU B . n 
B 1 301 LEU 301 325 325 LEU LEU B . n 
B 1 302 ALA 302 326 326 ALA ALA B . n 
B 1 303 SER 303 327 327 SER SER B . n 
B 1 304 HIS 304 328 328 HIS HIS B . n 
B 1 305 PRO 305 329 329 PRO PRO B . n 
B 1 306 VAL 306 330 330 VAL VAL B . n 
B 1 307 ARG 307 331 331 ARG ARG B . n 
B 1 308 GLN 308 332 332 GLN GLN B . n 
B 1 309 PHE 309 333 333 PHE PHE B . n 
B 1 310 ASP 310 334 334 ASP ASP B . n 
B 1 311 ARG 311 335 335 ARG ARG B . n 
B 1 312 TYR 312 336 336 TYR TYR B . n 
B 1 313 PHE 313 337 337 PHE PHE B . n 
B 1 314 GLN 314 338 338 GLN GLN B . n 
B 1 315 SER 315 339 339 SER SER B . n 
B 1 316 LEU 316 340 340 LEU LEU B . n 
B 1 317 ASN 317 341 341 ASN ASN B . n 
B 1 318 PRO 318 342 342 PRO PRO B . n 
B 1 319 TYR 319 343 343 TYR TYR B . n 
B 1 320 ASN 320 344 344 ASN ASN B . n 
B 1 321 ASN 321 345 345 ASN ASN B . n 
B 1 322 HIS 322 346 346 HIS HIS B . n 
B 1 323 ARG 323 347 347 ARG ARG B . n 
B 1 324 ASN 324 348 348 ASN ASN B . n 
B 1 325 PRO 325 349 349 PRO PRO B . n 
B 1 326 TRP 326 350 350 TRP TRP B . n 
B 1 327 PHE 327 351 351 PHE PHE B . n 
B 1 328 ARG 328 352 352 ARG ARG B . n 
B 1 329 ASP 329 353 353 ASP ASP B . n 
B 1 330 PHE 330 354 354 PHE PHE B . n 
B 1 331 TRP 331 355 355 TRP TRP B . n 
B 1 332 GLU 332 356 356 GLU GLU B . n 
B 1 333 GLN 333 357 357 GLN GLN B . n 
B 1 334 LYS 334 358 358 LYS LYS B . n 
B 1 335 PHE 335 359 359 PHE PHE B . n 
B 1 336 GLN 336 360 360 GLN GLN B . n 
B 1 337 CYS 337 361 361 CYS CYS B . n 
B 1 338 SER 338 362 362 SER SER B . n 
B 1 339 LEU 339 363 363 LEU LEU B . n 
B 1 340 GLN 340 364 364 GLN GLN B . n 
B 1 341 ASN 341 365 365 ASN ASN B . n 
B 1 342 LYS 342 366 366 LYS LYS B . n 
B 1 343 ARG 343 367 367 ARG ARG B . n 
B 1 344 ASN 344 368 368 ASN ASN B . n 
B 1 345 HIS 345 369 369 HIS HIS B . n 
B 1 346 ARG 346 370 370 ARG ARG B . n 
B 1 347 GLN 347 371 371 GLN GLN B . n 
B 1 348 VAL 348 372 372 VAL VAL B . n 
B 1 349 CYS 349 373 373 CYS CYS B . n 
B 1 350 ASP 350 374 374 ASP ASP B . n 
B 1 351 LYS 351 375 375 LYS LYS B . n 
B 1 352 HIS 352 376 376 HIS HIS B . n 
B 1 353 LEU 353 377 377 LEU LEU B . n 
B 1 354 ALA 354 378 378 ALA ALA B . n 
B 1 355 ILE 355 379 379 ILE ILE B . n 
B 1 356 ASP 356 380 380 ASP ASP B . n 
B 1 357 SER 357 381 381 SER SER B . n 
B 1 358 SER 358 382 382 SER SER B . n 
B 1 359 ASN 359 383 383 ASN ASN B . n 
B 1 360 TYR 360 384 384 TYR TYR B . n 
B 1 361 GLU 361 385 385 GLU GLU B . n 
B 1 362 GLN 362 386 386 GLN GLN B . n 
B 1 363 GLU 363 387 387 GLU GLU B . n 
B 1 364 SER 364 388 388 SER SER B . n 
B 1 365 LYS 365 389 389 LYS LYS B . n 
B 1 366 ILE 366 390 390 ILE ILE B . n 
B 1 367 MET 367 391 391 MET MET B . n 
B 1 368 PHE 368 392 392 PHE PHE B . n 
B 1 369 VAL 369 393 393 VAL VAL B . n 
B 1 370 VAL 370 394 394 VAL VAL B . n 
B 1 371 ASN 371 395 395 ASN ASN B . n 
B 1 372 ALA 372 396 396 ALA ALA B . n 
B 1 373 VAL 373 397 397 VAL VAL B . n 
B 1 374 TYR 374 398 398 TYR TYR B . n 
B 1 375 ALA 375 399 399 ALA ALA B . n 
B 1 376 MET 376 400 400 MET MET B . n 
B 1 377 ALA 377 401 401 ALA ALA B . n 
B 1 378 HIS 378 402 402 HIS HIS B . n 
B 1 379 ALA 379 403 403 ALA ALA B . n 
B 1 380 LEU 380 404 404 LEU LEU B . n 
B 1 381 HIS 381 405 405 HIS HIS B . n 
B 1 382 LYS 382 406 406 LYS LYS B . n 
B 1 383 MET 383 407 407 MET MET B . n 
B 1 384 GLN 384 408 408 GLN GLN B . n 
B 1 385 ARG 385 409 409 ARG ARG B . n 
B 1 386 THR 386 410 410 THR THR B . n 
B 1 387 LEU 387 411 411 LEU LEU B . n 
B 1 388 CYS 388 412 412 CYS CYS B . n 
B 1 389 PRO 389 413 413 PRO PRO B . n 
B 1 390 GLN 390 414 414 GLN GLN B . n 
B 1 391 THR 391 415 415 THR THR B . n 
B 1 392 THR 392 416 416 THR THR B . n 
B 1 393 LYS 393 417 417 LYS LYS B . n 
B 1 394 LEU 394 418 418 LEU LEU B . n 
B 1 395 CYS 395 419 419 CYS CYS B . n 
B 1 396 ASP 396 420 420 ASP ASP B . n 
B 1 397 ALA 397 421 421 ALA ALA B . n 
B 1 398 MET 398 422 422 MET MET B . n 
B 1 399 LYS 399 423 423 LYS LYS B . n 
B 1 400 ILE 400 424 424 ILE ILE B . n 
B 1 401 LEU 401 425 425 LEU LEU B . n 
B 1 402 ASP 402 426 426 ASP ASP B . n 
B 1 403 GLY 403 427 427 GLY GLY B . n 
B 1 404 LYS 404 428 428 LYS LYS B . n 
B 1 405 LYS 405 429 429 LYS LYS B . n 
B 1 406 LEU 406 430 430 LEU LEU B . n 
B 1 407 TYR 407 431 431 TYR TYR B . n 
B 1 408 LYS 408 432 432 LYS LYS B . n 
B 1 409 GLU 409 433 433 GLU GLU B . n 
B 1 410 TYR 410 434 434 TYR TYR B . n 
B 1 411 LEU 411 435 435 LEU LEU B . n 
B 1 412 LEU 412 436 436 LEU LEU B . n 
B 1 413 LYS 413 437 437 LYS LYS B . n 
B 1 414 ILE 414 438 438 ILE ILE B . n 
B 1 415 GLN 415 439 439 GLN GLN B . n 
B 1 416 PHE 416 440 440 PHE PHE B . n 
B 1 417 THR 417 441 441 THR THR B . n 
B 1 418 ALA 418 442 442 ALA ALA B . n 
B 1 419 PRO 419 443 443 PRO PRO B . n 
B 1 420 PHE 420 444 444 PHE PHE B . n 
B 1 421 ASN 421 445 445 ASN ASN B . n 
B 1 422 PRO 422 446 446 PRO PRO B . n 
B 1 423 ASN 423 447 447 ASN ASN B . n 
B 1 424 LYS 424 448 448 LYS LYS B . n 
B 1 425 GLY 425 449 449 GLY GLY B . n 
B 1 426 ALA 426 450 450 ALA ALA B . n 
B 1 427 ASP 427 451 451 ASP ASP B . n 
B 1 428 SER 428 452 452 SER SER B . n 
B 1 429 ILE 429 453 453 ILE ILE B . n 
B 1 430 VAL 430 454 454 VAL VAL B . n 
B 1 431 LYS 431 455 455 LYS LYS B . n 
B 1 432 PHE 432 456 456 PHE PHE B . n 
B 1 433 ASP 433 457 457 ASP ASP B . n 
B 1 434 THR 434 458 458 THR THR B . n 
B 1 435 PHE 435 459 459 PHE PHE B . n 
B 1 436 GLY 436 460 460 GLY GLY B . n 
B 1 437 ASP 437 461 461 ASP ASP B . n 
B 1 438 GLY 438 462 462 GLY GLY B . n 
B 1 439 MET 439 463 463 MET MET B . n 
B 1 440 GLY 440 464 464 GLY GLY B . n 
B 1 441 ARG 441 465 465 ARG ARG B . n 
B 1 442 TYR 442 466 466 TYR TYR B . n 
B 1 443 ASN 443 467 467 ASN ASN B . n 
B 1 444 VAL 444 468 468 VAL VAL B . n 
B 1 445 PHE 445 469 469 PHE PHE B . n 
B 1 446 ASN 446 470 470 ASN ASN B . n 
B 1 447 LEU 447 471 471 LEU LEU B . n 
B 1 448 GLN 448 472 472 GLN GLN B . n 
B 1 449 GLN 449 473 473 GLN GLN B . n 
B 1 450 THR 450 474 474 THR THR B . n 
B 1 451 GLY 451 475 475 GLY GLY B . n 
B 1 452 GLY 452 476 476 GLY GLY B . n 
B 1 453 LYS 453 477 477 LYS LYS B . n 
B 1 454 TYR 454 478 478 TYR TYR B . n 
B 1 455 SER 455 479 479 SER SER B . n 
B 1 456 TYR 456 480 480 TYR TYR B . n 
B 1 457 LEU 457 481 481 LEU LEU B . n 
B 1 458 LYS 458 482 482 LYS LYS B . n 
B 1 459 VAL 459 483 483 VAL VAL B . n 
B 1 460 GLY 460 484 484 GLY GLY B . n 
B 1 461 HIS 461 485 485 HIS HIS B . n 
B 1 462 TRP 462 486 486 TRP TRP B . n 
B 1 463 ALA 463 487 487 ALA ALA B . n 
B 1 464 GLU 464 488 488 GLU GLU B . n 
B 1 465 THR 465 489 489 THR THR B . n 
B 1 466 LEU 466 490 490 LEU LEU B . n 
B 1 467 SER 467 491 491 SER SER B . n 
B 1 468 LEU 468 492 492 LEU LEU B . n 
B 1 469 ASP 469 493 493 ASP ASP B . n 
B 1 470 VAL 470 494 494 VAL VAL B . n 
B 1 471 ASP 471 495 495 ASP ASP B . n 
B 1 472 SER 472 496 496 SER SER B . n 
B 1 473 ILE 473 497 497 ILE ILE B . n 
B 1 474 HIS 474 498 498 HIS HIS B . n 
B 1 475 TRP 475 499 499 TRP TRP B . n 
B 1 476 SER 476 500 500 SER SER B . n 
B 1 477 ARG 477 501 501 ARG ALA B . n 
B 1 478 ASN 478 502 502 ASN ASN B . n 
B 1 479 SER 479 503 503 SER SER B . n 
B 1 480 VAL 480 504 504 VAL VAL B . n 
B 1 481 PRO 481 505 505 PRO PRO B . n 
B 1 482 THR 482 506 506 THR THR B . n 
B 1 483 SER 483 507 507 SER SER B . n 
B 1 484 GLN 484 508 508 GLN GLN B . n 
B 1 485 CYS 485 509 ?   ?   ?   B . n 
B 1 486 SER 486 510 ?   ?   ?   B . n 
B 1 487 ASP 487 511 ?   ?   ?   B . n 
B 1 488 PRO 488 512 ?   ?   ?   B . n 
B 1 489 CYS 489 513 ?   ?   ?   B . n 
B 1 490 ALA 490 514 ?   ?   ?   B . n 
B 1 491 PRO 491 515 ?   ?   ?   B . n 
B 1 492 ASN 492 516 ?   ?   ?   B . n 
B 1 493 GLU 493 517 ?   ?   ?   B . n 
B 1 494 MET 494 518 ?   ?   ?   B . n 
B 1 495 LYS 495 519 ?   ?   ?   B . n 
B 1 496 ASN 496 520 ?   ?   ?   B . n 
B 1 497 MET 497 521 ?   ?   ?   B . n 
B 1 498 GLN 498 522 ?   ?   ?   B . n 
B 1 499 PRO 499 523 ?   ?   ?   B . n 
B 1 500 GLY 500 524 ?   ?   ?   B . n 
B 1 501 ASP 501 525 ?   ?   ?   B . n 
B 1 502 VAL 502 526 ?   ?   ?   B . n 
B 1 503 CYS 503 527 ?   ?   ?   B . n 
B 1 504 CYS 504 528 ?   ?   ?   B . n 
B 1 505 TRP 505 529 ?   ?   ?   B . n 
B 1 506 ILE 506 530 ?   ?   ?   B . n 
B 1 507 CYS 507 531 ?   ?   ?   B . n 
B 1 508 ILE 508 532 ?   ?   ?   B . n 
B 1 509 PRO 509 533 ?   ?   ?   B . n 
B 1 510 CYS 510 534 ?   ?   ?   B . n 
B 1 511 GLU 511 535 ?   ?   ?   B . n 
B 1 512 PRO 512 536 ?   ?   ?   B . n 
B 1 513 TYR 513 537 ?   ?   ?   B . n 
B 1 514 GLU 514 538 ?   ?   ?   B . n 
B 1 515 TYR 515 539 ?   ?   ?   B . n 
B 1 516 LEU 516 540 ?   ?   ?   B . n 
B 1 517 VAL 517 541 ?   ?   ?   B . n 
B 1 518 ASP 518 542 ?   ?   ?   B . n 
B 1 519 GLU 519 543 ?   ?   ?   B . n 
B 1 520 PHE 520 544 ?   ?   ?   B . n 
B 1 521 THR 521 545 ?   ?   ?   B . n 
B 1 522 CYS 522 546 ?   ?   ?   B . n 
B 1 523 MET 523 547 ?   ?   ?   B . n 
B 1 524 ASP 524 548 ?   ?   ?   B . n 
B 1 525 CYS 525 549 ?   ?   ?   B . n 
B 1 526 GLY 526 550 ?   ?   ?   B . n 
B 1 527 PRO 527 551 ?   ?   ?   B . n 
B 1 528 GLY 528 552 ?   ?   ?   B . n 
B 1 529 GLN 529 553 ?   ?   ?   B . n 
B 1 530 TRP 530 554 ?   ?   ?   B . n 
B 1 531 PRO 531 555 ?   ?   ?   B . n 
B 1 532 THR 532 556 ?   ?   ?   B . n 
B 1 533 ALA 533 557 ?   ?   ?   B . n 
B 1 534 ASP 534 558 ?   ?   ?   B . n 
B 1 535 LEU 535 559 ?   ?   ?   B . n 
B 1 536 SER 536 560 ?   ?   ?   B . n 
B 1 537 GLY 537 561 ?   ?   ?   B . n 
B 1 538 CYS 538 562 ?   ?   ?   B . n 
B 1 539 TYR 539 563 ?   ?   ?   B . n 
B 1 540 ASN 540 564 ?   ?   ?   B . n 
B 1 541 LEU 541 565 ?   ?   ?   B . n 
B 1 542 PRO 542 566 ?   ?   ?   B . n 
B 1 543 GLU 543 567 ?   ?   ?   B . n 
B 1 544 ASP 544 568 ?   ?   ?   B . n 
B 1 545 TYR 545 569 ?   ?   ?   B . n 
B 1 546 ILE 546 570 ?   ?   ?   B . n 
B 1 547 LYS 547 571 ?   ?   ?   B . n 
B 1 548 TRP 548 572 ?   ?   ?   B . n 
B 1 549 GLU 549 573 ?   ?   ?   B . n 
B 1 550 ASP 550 574 ?   ?   ?   B . n 
B 1 551 ALA 551 575 ?   ?   ?   B . n 
B 1 552 LEU 552 576 ?   ?   ?   B . n 
B 1 553 VAL 553 577 ?   ?   ?   B . n 
B 1 554 PRO 554 578 ?   ?   ?   B . n 
B 1 555 ARG 555 579 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAG 1 801  801 NAG NAG A . 
D 3 52A 1 1001 1   52A APD A . 
E 3 52A 1 2001 1   52A APD B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    ASN 
_pdbx_struct_mod_residue.label_seq_id     185 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     ASN 
_pdbx_struct_mod_residue.auth_seq_id      209 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   ASN 
_pdbx_struct_mod_residue.details          'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-02-27 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-07-29 
5 'Structure model' 1 4 2021-11-10 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Non-polymer description'   
3  3 'Structure model' 'Version format compliance' 
4  4 'Structure model' Advisory                    
5  4 'Structure model' 'Data collection'           
6  4 'Structure model' 'Database references'       
7  4 'Structure model' 'Derived calculations'      
8  4 'Structure model' 'Structure summary'         
9  5 'Structure model' Advisory                    
10 5 'Structure model' 'Database references'       
11 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' chem_comp                    
2  4 'Structure model' entity                       
3  4 'Structure model' pdbx_chem_comp_identifier    
4  4 'Structure model' pdbx_entity_nonpoly          
5  4 'Structure model' pdbx_unobs_or_zero_occ_atoms 
6  4 'Structure model' struct_conn                  
7  4 'Structure model' struct_ref_seq_dif           
8  4 'Structure model' struct_site                  
9  4 'Structure model' struct_site_gen              
10 5 'Structure model' chem_comp                    
11 5 'Structure model' database_2                   
12 5 'Structure model' pdbx_unobs_or_zero_occ_atoms 
13 5 'Structure model' struct_ref_seq_dif           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_chem_comp.name'                     
2  4 'Structure model' '_chem_comp.type'                     
3  4 'Structure model' '_entity.pdbx_description'            
4  4 'Structure model' '_pdbx_entity_nonpoly.name'           
5  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6  4 'Structure model' '_struct_conn.pdbx_role'              
7  4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
8  4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
9  4 'Structure model' '_struct_conn.ptnr1_label_asym_id'    
10 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'    
11 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
12 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
13 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
14 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
15 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'    
16 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'    
17 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
18 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'     
19 4 'Structure model' '_struct_ref_seq_dif.details'         
20 5 'Structure model' '_chem_comp.pdbx_synonyms'            
21 5 'Structure model' '_database_2.pdbx_DOI'                
22 5 'Structure model' '_database_2.pdbx_database_accession' 
23 5 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC   'data collection' Quantum   ? 1 
AMoRE  phasing           .         ? 2 
CNS    refinement        .         ? 3 
MOSFLM 'data reduction'  .         ? 4 
CCP4   'data scaling'    '(SCALA)' ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A ALA 442 ? ? N A PHE 444 ? ? 2.08 
2 1 O B ALA 442 ? ? N B PHE 444 ? ? 2.16 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A CYS 419 ? ? CB A CYS 419 ? ? SG A CYS 419 ? ? 101.25 114.00 -12.75 1.80 N 
2 1 C  A ALA 442 ? ? N  A PRO 443 ? ? CA A PRO 443 ? ? 130.22 119.30 10.92  1.50 Y 
3 1 CA A CYS 546 ? ? CB A CYS 546 ? ? SG A CYS 546 ? ? 101.30 114.00 -12.70 1.80 N 
4 1 C  B CYS 412 ? ? N  B PRO 413 ? ? CA B PRO 413 ? ? 128.51 119.30 9.21   1.50 Y 
5 1 CA B CYS 419 ? ? CB B CYS 419 ? ? SG B CYS 419 ? ? 101.01 114.00 -12.99 1.80 N 
6 1 C  B ALA 442 ? ? N  B PRO 443 ? ? CA B PRO 443 ? ? 129.52 119.30 10.22  1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 86  ? ? 38.82   86.84   
2  1 SER A 100 ? ? 53.26   1.93    
3  1 LEU A 141 ? ? -64.95  97.66   
4  1 ALA A 172 ? ? -165.14 -20.11  
5  1 ASP A 180 ? ? -61.85  90.75   
6  1 ASN A 209 ? ? 35.56   28.53   
7  1 ASP A 221 ? ? -36.35  -28.91  
8  1 GLU A 224 ? ? -53.82  -70.82  
9  1 ALA A 242 ? ? -51.66  -89.84  
10 1 SER A 250 ? ? 43.50   23.25   
11 1 ILE A 252 ? ? -111.38 -165.76 
12 1 PRO A 267 ? ? -57.06  3.49    
13 1 ASN A 292 ? ? 25.01   38.60   
14 1 SER A 313 ? ? -161.67 30.65   
15 1 TYR A 318 ? ? -48.49  159.44  
16 1 PRO A 329 ? ? -36.62  141.78  
17 1 CYS A 361 ? ? -50.42  -152.30 
18 1 SER A 362 ? ? 170.95  147.48  
19 1 ASN A 365 ? ? -85.74  40.02   
20 1 ARG A 367 ? ? -88.83  -95.66  
21 1 ASN A 368 ? ? -160.39 98.54   
22 1 GLN A 371 ? ? 55.23   107.79  
23 1 HIS A 376 ? ? -75.18  26.23   
24 1 ASP A 380 ? ? -125.37 -167.58 
25 1 GLU A 433 ? ? -154.14 0.53    
26 1 LEU A 436 ? ? -60.74  20.05   
27 1 THR A 441 ? ? -37.64  142.24  
28 1 PRO A 443 ? ? -26.52  -4.44   
29 1 LYS A 448 ? ? -143.65 -26.34  
30 1 ALA A 450 ? ? -168.85 23.72   
31 1 GLU A 488 ? ? -173.75 -1.91   
32 1 SER A 491 ? ? -179.89 145.10  
33 1 LEU A 492 ? ? 173.71  132.83  
34 1 ASP A 493 ? ? -80.90  34.87   
35 1 VAL A 494 ? ? 20.22   -65.93  
36 1 ASP A 495 ? ? -62.72  21.71   
37 1 ASN A 502 ? ? 26.03   50.55   
38 1 VAL A 504 ? ? -57.45  109.78  
39 1 PRO A 505 ? ? -53.68  170.50  
40 1 ASN A 516 ? ? -27.07  -38.08  
41 1 GLU A 517 ? ? -134.94 -91.81  
42 1 MET A 518 ? ? -22.89  158.66  
43 1 PRO A 523 ? ? -78.54  -72.93  
44 1 ASP A 525 ? ? -75.63  -155.69 
45 1 PRO A 536 ? ? -38.93  -14.11  
46 1 TYR A 539 ? ? -96.15  -159.07 
47 1 LEU A 559 ? ? 73.49   48.03   
48 1 PRO A 566 ? ? -80.93  -113.30 
49 1 LEU B 86  ? ? 42.44   85.21   
50 1 CYS B 99  ? ? 37.70   42.00   
51 1 SER B 100 ? ? 50.21   0.75    
52 1 LEU B 141 ? ? -63.25  98.38   
53 1 ALA B 172 ? ? -161.21 -30.54  
54 1 ASP B 180 ? ? -63.03  89.15   
55 1 LYS B 181 ? ? -69.22  15.45   
56 1 ASN B 209 ? ? 35.79   27.26   
57 1 ASP B 221 ? ? -34.75  -27.20  
58 1 GLU B 224 ? ? -50.40  -70.91  
59 1 ALA B 242 ? ? -50.65  -90.48  
60 1 SER B 250 ? ? 44.71   22.82   
61 1 ILE B 252 ? ? -110.75 -166.26 
62 1 PRO B 267 ? ? -56.72  2.23    
63 1 ASN B 292 ? ? 21.41   40.03   
64 1 SER B 313 ? ? -161.07 28.92   
65 1 GLU B 314 ? ? -37.32  -25.81  
66 1 TYR B 318 ? ? -48.27  159.02  
67 1 PRO B 329 ? ? -37.64  140.65  
68 1 CYS B 361 ? ? -50.96  -154.36 
69 1 SER B 362 ? ? 170.03  146.83  
70 1 ASN B 365 ? ? -85.10  40.24   
71 1 LYS B 366 ? ? -129.91 -165.07 
72 1 ARG B 367 ? ? -88.91  -96.28  
73 1 ASN B 368 ? ? -160.02 98.38   
74 1 GLN B 371 ? ? 56.65   107.52  
75 1 HIS B 376 ? ? -74.06  26.09   
76 1 ASP B 380 ? ? -123.40 -169.01 
77 1 GLN B 408 ? ? -57.90  -71.97  
78 1 GLN B 414 ? ? -57.21  -72.32  
79 1 CYS B 419 ? ? -73.62  -169.66 
80 1 GLU B 433 ? ? -155.47 3.34    
81 1 LEU B 436 ? ? -61.13  19.93   
82 1 THR B 441 ? ? -33.89  145.28  
83 1 PRO B 443 ? ? -30.62  -3.38   
84 1 ASN B 447 ? ? -69.69  -178.40 
85 1 LYS B 448 ? ? -144.21 -26.59  
86 1 ALA B 450 ? ? -168.20 23.33   
87 1 GLU B 488 ? ? -175.84 -2.31   
88 1 SER B 491 ? ? -175.64 142.94  
89 1 LEU B 492 ? ? 174.05  132.01  
90 1 ASP B 493 ? ? -76.28  34.31   
91 1 VAL B 494 ? ? 20.36   -65.47  
92 1 ASP B 495 ? ? -64.83  26.05   
93 1 ASN B 502 ? ? 25.61   46.72   
94 1 VAL B 504 ? ? -56.16  108.00  
95 1 PRO B 505 ? ? -52.69  173.34  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A ARG 270 ? CG  ? A ARG 246 CG  
2  1 Y 0 A ARG 270 ? CD  ? A ARG 246 CD  
3  1 Y 0 A ARG 270 ? NE  ? A ARG 246 NE  
4  1 Y 0 A ARG 270 ? CZ  ? A ARG 246 CZ  
5  1 Y 0 A ARG 270 ? NH1 ? A ARG 246 NH1 
6  1 Y 0 A ARG 270 ? NH2 ? A ARG 246 NH2 
7  1 Y 0 A ARG 282 ? CG  ? A ARG 258 CG  
8  1 Y 0 A ARG 282 ? CD  ? A ARG 258 CD  
9  1 Y 0 A ARG 282 ? NE  ? A ARG 258 NE  
10 1 Y 0 A ARG 282 ? CZ  ? A ARG 258 CZ  
11 1 Y 0 A ARG 282 ? NH1 ? A ARG 258 NH1 
12 1 Y 0 A ARG 282 ? NH2 ? A ARG 258 NH2 
13 1 Y 0 A ASN 368 ? CG  ? A ASN 344 CG  
14 1 Y 0 A ASN 368 ? OD1 ? A ASN 344 OD1 
15 1 Y 0 A ASN 368 ? ND2 ? A ASN 344 ND2 
16 1 Y 0 A LYS 406 ? CG  ? A LYS 382 CG  
17 1 Y 0 A LYS 406 ? CD  ? A LYS 382 CD  
18 1 Y 0 A LYS 406 ? CE  ? A LYS 382 CE  
19 1 Y 0 A LYS 406 ? NZ  ? A LYS 382 NZ  
20 1 Y 0 A LYS 417 ? CG  ? A LYS 393 CG  
21 1 Y 0 A LYS 417 ? CD  ? A LYS 393 CD  
22 1 Y 0 A LYS 417 ? CE  ? A LYS 393 CE  
23 1 Y 0 A LYS 417 ? NZ  ? A LYS 393 NZ  
24 1 Y 1 A ARG 501 ? CG  ? A ARG 477 CG  
25 1 Y 1 A ARG 501 ? CD  ? A ARG 477 CD  
26 1 Y 1 A ARG 501 ? NE  ? A ARG 477 NE  
27 1 Y 1 A ARG 501 ? CZ  ? A ARG 477 CZ  
28 1 Y 1 A ARG 501 ? NH1 ? A ARG 477 NH1 
29 1 Y 1 A ARG 501 ? NH2 ? A ARG 477 NH2 
30 1 Y 0 B ARG 270 ? CG  ? B ARG 246 CG  
31 1 Y 0 B ARG 270 ? CD  ? B ARG 246 CD  
32 1 Y 0 B ARG 270 ? NE  ? B ARG 246 NE  
33 1 Y 0 B ARG 270 ? CZ  ? B ARG 246 CZ  
34 1 Y 0 B ARG 270 ? NH1 ? B ARG 246 NH1 
35 1 Y 0 B ARG 270 ? NH2 ? B ARG 246 NH2 
36 1 Y 0 B ARG 282 ? CG  ? B ARG 258 CG  
37 1 Y 0 B ARG 282 ? CD  ? B ARG 258 CD  
38 1 Y 0 B ARG 282 ? NE  ? B ARG 258 NE  
39 1 Y 0 B ARG 282 ? CZ  ? B ARG 258 CZ  
40 1 Y 0 B ARG 282 ? NH1 ? B ARG 258 NH1 
41 1 Y 0 B ARG 282 ? NH2 ? B ARG 258 NH2 
42 1 Y 0 B ASN 368 ? CG  ? B ASN 344 CG  
43 1 Y 0 B ASN 368 ? OD1 ? B ASN 344 OD1 
44 1 Y 0 B ASN 368 ? ND2 ? B ASN 344 ND2 
45 1 Y 0 B LYS 406 ? CG  ? B LYS 382 CG  
46 1 Y 0 B LYS 406 ? CD  ? B LYS 382 CD  
47 1 Y 0 B LYS 406 ? CE  ? B LYS 382 CE  
48 1 Y 0 B LYS 406 ? NZ  ? B LYS 382 NZ  
49 1 Y 0 B LYS 417 ? CG  ? B LYS 393 CG  
50 1 Y 0 B LYS 417 ? CD  ? B LYS 393 CD  
51 1 Y 0 B LYS 417 ? CE  ? B LYS 393 CE  
52 1 Y 0 B LYS 417 ? NZ  ? B LYS 393 NZ  
53 1 Y 1 B ARG 501 ? CG  ? B ARG 477 CG  
54 1 Y 1 B ARG 501 ? CD  ? B ARG 477 CD  
55 1 Y 1 B ARG 501 ? NE  ? B ARG 477 NE  
56 1 Y 1 B ARG 501 ? CZ  ? B ARG 477 CZ  
57 1 Y 1 B ARG 501 ? NH1 ? B ARG 477 NH1 
58 1 Y 1 B ARG 501 ? NH2 ? B ARG 477 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A ASP 25  ? A ASP 1   
2   1 Y 1 A HIS 26  ? A HIS 2   
3   1 Y 1 A ASN 27  ? A ASN 3   
4   1 Y 1 A PHE 28  ? A PHE 4   
5   1 Y 1 A MET 29  ? A MET 5   
6   1 Y 1 A THR 118 ? A THR 94  
7   1 Y 1 A LYS 119 ? A LYS 95  
8   1 Y 1 A VAL 120 ? A VAL 96  
9   1 Y 1 A ASP 121 ? A ASP 97  
10  1 Y 1 A GLU 122 ? A GLU 98  
11  1 Y 1 A ALA 123 ? A ALA 99  
12  1 Y 1 A GLU 124 ? A GLU 100 
13  1 Y 1 A TYR 125 ? A TYR 101 
14  1 Y 1 A MET 126 ? A MET 102 
15  1 Y 1 A CYS 127 ? A CYS 103 
16  1 Y 1 A PRO 128 ? A PRO 104 
17  1 Y 1 A ASP 129 ? A ASP 105 
18  1 Y 1 A GLY 130 ? A GLY 106 
19  1 Y 1 A SER 131 ? A SER 107 
20  1 Y 1 A TYR 132 ? A TYR 108 
21  1 Y 1 A ALA 133 ? A ALA 109 
22  1 Y 1 A ILE 134 ? A ILE 110 
23  1 Y 1 A GLN 135 ? A GLN 111 
24  1 Y 1 A GLU 136 ? A GLU 112 
25  1 Y 1 A ASN 137 ? A ASN 113 
26  1 Y 1 A ASP 568 ? A ASP 544 
27  1 Y 1 A TYR 569 ? A TYR 545 
28  1 Y 1 A ILE 570 ? A ILE 546 
29  1 Y 1 A LYS 571 ? A LYS 547 
30  1 Y 1 A TRP 572 ? A TRP 548 
31  1 Y 1 A GLU 573 ? A GLU 549 
32  1 Y 1 A ASP 574 ? A ASP 550 
33  1 Y 1 A ALA 575 ? A ALA 551 
34  1 Y 1 A LEU 576 ? A LEU 552 
35  1 Y 1 A VAL 577 ? A VAL 553 
36  1 Y 1 A PRO 578 ? A PRO 554 
37  1 Y 1 A ARG 579 ? A ARG 555 
38  1 Y 1 B ASP 25  ? B ASP 1   
39  1 Y 1 B HIS 26  ? B HIS 2   
40  1 Y 1 B ASN 27  ? B ASN 3   
41  1 Y 1 B PHE 28  ? B PHE 4   
42  1 Y 1 B MET 29  ? B MET 5   
43  1 Y 1 B THR 118 ? B THR 94  
44  1 Y 1 B LYS 119 ? B LYS 95  
45  1 Y 1 B VAL 120 ? B VAL 96  
46  1 Y 1 B ASP 121 ? B ASP 97  
47  1 Y 1 B GLU 122 ? B GLU 98  
48  1 Y 1 B ALA 123 ? B ALA 99  
49  1 Y 1 B GLU 124 ? B GLU 100 
50  1 Y 1 B TYR 125 ? B TYR 101 
51  1 Y 1 B MET 126 ? B MET 102 
52  1 Y 1 B CYS 127 ? B CYS 103 
53  1 Y 1 B PRO 128 ? B PRO 104 
54  1 Y 1 B ASP 129 ? B ASP 105 
55  1 Y 1 B GLY 130 ? B GLY 106 
56  1 Y 1 B SER 131 ? B SER 107 
57  1 Y 1 B TYR 132 ? B TYR 108 
58  1 Y 1 B ALA 133 ? B ALA 109 
59  1 Y 1 B ILE 134 ? B ILE 110 
60  1 Y 1 B GLN 135 ? B GLN 111 
61  1 Y 1 B GLU 136 ? B GLU 112 
62  1 Y 1 B ASN 137 ? B ASN 113 
63  1 Y 1 B CYS 509 ? B CYS 485 
64  1 Y 1 B SER 510 ? B SER 486 
65  1 Y 1 B ASP 511 ? B ASP 487 
66  1 Y 1 B PRO 512 ? B PRO 488 
67  1 Y 1 B CYS 513 ? B CYS 489 
68  1 Y 1 B ALA 514 ? B ALA 490 
69  1 Y 1 B PRO 515 ? B PRO 491 
70  1 Y 1 B ASN 516 ? B ASN 492 
71  1 Y 1 B GLU 517 ? B GLU 493 
72  1 Y 1 B MET 518 ? B MET 494 
73  1 Y 1 B LYS 519 ? B LYS 495 
74  1 Y 1 B ASN 520 ? B ASN 496 
75  1 Y 1 B MET 521 ? B MET 497 
76  1 Y 1 B GLN 522 ? B GLN 498 
77  1 Y 1 B PRO 523 ? B PRO 499 
78  1 Y 1 B GLY 524 ? B GLY 500 
79  1 Y 1 B ASP 525 ? B ASP 501 
80  1 Y 1 B VAL 526 ? B VAL 502 
81  1 Y 1 B CYS 527 ? B CYS 503 
82  1 Y 1 B CYS 528 ? B CYS 504 
83  1 Y 1 B TRP 529 ? B TRP 505 
84  1 Y 1 B ILE 530 ? B ILE 506 
85  1 Y 1 B CYS 531 ? B CYS 507 
86  1 Y 1 B ILE 532 ? B ILE 508 
87  1 Y 1 B PRO 533 ? B PRO 509 
88  1 Y 1 B CYS 534 ? B CYS 510 
89  1 Y 1 B GLU 535 ? B GLU 511 
90  1 Y 1 B PRO 536 ? B PRO 512 
91  1 Y 1 B TYR 537 ? B TYR 513 
92  1 Y 1 B GLU 538 ? B GLU 514 
93  1 Y 1 B TYR 539 ? B TYR 515 
94  1 Y 1 B LEU 540 ? B LEU 516 
95  1 Y 1 B VAL 541 ? B VAL 517 
96  1 Y 1 B ASP 542 ? B ASP 518 
97  1 Y 1 B GLU 543 ? B GLU 519 
98  1 Y 1 B PHE 544 ? B PHE 520 
99  1 Y 1 B THR 545 ? B THR 521 
100 1 Y 1 B CYS 546 ? B CYS 522 
101 1 Y 1 B MET 547 ? B MET 523 
102 1 Y 1 B ASP 548 ? B ASP 524 
103 1 Y 1 B CYS 549 ? B CYS 525 
104 1 Y 1 B GLY 550 ? B GLY 526 
105 1 Y 1 B PRO 551 ? B PRO 527 
106 1 Y 1 B GLY 552 ? B GLY 528 
107 1 Y 1 B GLN 553 ? B GLN 529 
108 1 Y 1 B TRP 554 ? B TRP 530 
109 1 Y 1 B PRO 555 ? B PRO 531 
110 1 Y 1 B THR 556 ? B THR 532 
111 1 Y 1 B ALA 557 ? B ALA 533 
112 1 Y 1 B ASP 558 ? B ASP 534 
113 1 Y 1 B LEU 559 ? B LEU 535 
114 1 Y 1 B SER 560 ? B SER 536 
115 1 Y 1 B GLY 561 ? B GLY 537 
116 1 Y 1 B CYS 562 ? B CYS 538 
117 1 Y 1 B TYR 563 ? B TYR 539 
118 1 Y 1 B ASN 564 ? B ASN 540 
119 1 Y 1 B LEU 565 ? B LEU 541 
120 1 Y 1 B PRO 566 ? B PRO 542 
121 1 Y 1 B GLU 567 ? B GLU 543 
122 1 Y 1 B ASP 568 ? B ASP 544 
123 1 Y 1 B TYR 569 ? B TYR 545 
124 1 Y 1 B ILE 570 ? B ILE 546 
125 1 Y 1 B LYS 571 ? B LYS 547 
126 1 Y 1 B TRP 572 ? B TRP 548 
127 1 Y 1 B GLU 573 ? B GLU 549 
128 1 Y 1 B ASP 574 ? B ASP 550 
129 1 Y 1 B ALA 575 ? B ALA 551 
130 1 Y 1 B LEU 576 ? B LEU 552 
131 1 Y 1 B VAL 577 ? B VAL 553 
132 1 Y 1 B PRO 578 ? B PRO 554 
133 1 Y 1 B ARG 579 ? B ARG 555 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose           NAG 
3 '(2R,4R)-4-aminopyrrolidine-2,4-dicarboxylic acid' 52A 
#