data_2EBT
# 
_entry.id   2EBT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2EBT         pdb_00002ebt 10.2210/pdb2ebt/pdb 
RCSB  RCSB026475   ?            ?                   
WWPDB D_1000026475 ?            ?                   
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hso003006302.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2EBT 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-09 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nagashima, T.'                                          1 
'Hayashi, F.'                                            2 
'Yokoyama, S.'                                           3 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of three tandem repeats of zf-C2H2 domains from human Kruppel-like factor 5' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Nagashima, T.' 1 ? 
primary 'Hayashi, F.'   2 ? 
primary 'Yokoyama, S.'  3 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Krueppel-like factor 5' 11650.169 1 ? ? zf-C2H2 ? 
2 non-polymer syn 'ZINC ION'               65.409    3 ? ? ?       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Intestinal-enriched krueppel-like factor, Colon krueppel-like factor, Transcription factor BTEB2, Basic transcription element-binding protein 2, BTE-binding protein 2, GC box-binding protein 2
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGV
CNRSFSRSDHLALHMKRHQN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGV
CNRSFSRSDHLALHMKRHQN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hso003006302.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   PRO n 
1 9   ASP n 
1 10  LEU n 
1 11  GLU n 
1 12  LYS n 
1 13  ARG n 
1 14  ARG n 
1 15  ILE n 
1 16  HIS n 
1 17  TYR n 
1 18  CYS n 
1 19  ASP n 
1 20  TYR n 
1 21  PRO n 
1 22  GLY n 
1 23  CYS n 
1 24  THR n 
1 25  LYS n 
1 26  VAL n 
1 27  TYR n 
1 28  THR n 
1 29  LYS n 
1 30  SER n 
1 31  SER n 
1 32  HIS n 
1 33  LEU n 
1 34  LYS n 
1 35  ALA n 
1 36  HIS n 
1 37  LEU n 
1 38  ARG n 
1 39  THR n 
1 40  HIS n 
1 41  THR n 
1 42  GLY n 
1 43  GLU n 
1 44  LYS n 
1 45  PRO n 
1 46  TYR n 
1 47  LYS n 
1 48  CYS n 
1 49  THR n 
1 50  TRP n 
1 51  GLU n 
1 52  GLY n 
1 53  CYS n 
1 54  ASP n 
1 55  TRP n 
1 56  ARG n 
1 57  PHE n 
1 58  ALA n 
1 59  ARG n 
1 60  SER n 
1 61  ASP n 
1 62  GLU n 
1 63  LEU n 
1 64  THR n 
1 65  ARG n 
1 66  HIS n 
1 67  TYR n 
1 68  ARG n 
1 69  LYS n 
1 70  HIS n 
1 71  THR n 
1 72  GLY n 
1 73  ALA n 
1 74  LYS n 
1 75  PRO n 
1 76  PHE n 
1 77  GLN n 
1 78  CYS n 
1 79  GLY n 
1 80  VAL n 
1 81  CYS n 
1 82  ASN n 
1 83  ARG n 
1 84  SER n 
1 85  PHE n 
1 86  SER n 
1 87  ARG n 
1 88  SER n 
1 89  ASP n 
1 90  HIS n 
1 91  LEU n 
1 92  ALA n 
1 93  LEU n 
1 94  HIS n 
1 95  MET n 
1 96  LYS n 
1 97  ARG n 
1 98  HIS n 
1 99  GLN n 
1 100 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P060116-02 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KLF5_HUMAN 
_struct_ref.pdbx_db_accession          Q13887 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGVCNRSFSR
SDHLALHMKRHQN
;
_struct_ref.pdbx_align_begin           365 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2EBT 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 100 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q13887 
_struct_ref_seq.db_align_beg                  365 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  457 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       365 
_struct_ref_seq.pdbx_auth_seq_align_end       457 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2EBT GLY A 1 ? UNP Q13887 ? ? 'expression tag' 358 1 
1 2EBT SER A 2 ? UNP Q13887 ? ? 'expression tag' 359 2 
1 2EBT SER A 3 ? UNP Q13887 ? ? 'expression tag' 360 3 
1 2EBT GLY A 4 ? UNP Q13887 ? ? 'expression tag' 361 4 
1 2EBT SER A 5 ? UNP Q13887 ? ? 'expression tag' 362 5 
1 2EBT SER A 6 ? UNP Q13887 ? ? 'expression tag' 363 6 
1 2EBT GLY A 7 ? UNP Q13887 ? ? 'expression tag' 364 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_13C-separated_NOESY 1 
2 1 3D_15N-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'0.59mM uniformly 13C/15N-labelled protein, 20mM TrisHCl, 100mM NaCl, 1mM DTT, 0.02% NaN3, 50uM ZnCl2, 1mM IDA, 10% D2O, 90% H2O' 
_pdbx_nmr_sample_details.solvent_system   '10% D2O, 90% H2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 INOVA Varian 900 ? 
2 INOVA Varian 800 ? 
# 
_pdbx_nmr_refine.entry_id           2EBT 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2EBT 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2EBT 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1C     Varian          1 
processing           NMRPipe 20020425 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      KUJIRA  0.9822   'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.entry_id          2EBT 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2EBT 
_struct.title                     'Solution structure of three tandem repeats of zf-C2H2 domains from human Kruppel-like factor 5' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2EBT 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
;C2H2-type zinc-finger, metal bind, transcription factor, kruppel-like factor, GC-box promoter elements, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 29 ? THR A 41 ? LYS A 386 THR A 398 1 ? 13 
HELX_P HELX_P2 2 ARG A 59 ? THR A 71 ? ARG A 416 THR A 428 1 ? 13 
HELX_P HELX_P3 3 ARG A 87 ? GLN A 99 ? ARG A 444 GLN A 456 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 18 SG  ? ? A ZN 100 A CYS 375 1_555 ? ? ? ? ? ? ? 2.294 ? ? 
metalc2  metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 23 SG  ? ? A ZN 100 A CYS 380 1_555 ? ? ? ? ? ? ? 2.254 ? ? 
metalc3  metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 36 NE2 ? ? A ZN 100 A HIS 393 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
metalc4  metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 40 NE2 ? ? A ZN 100 A HIS 397 1_555 ? ? ? ? ? ? ? 2.004 ? ? 
metalc5  metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 48 SG  ? ? A ZN 200 A CYS 405 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc6  metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 53 SG  ? ? A ZN 200 A CYS 410 1_555 ? ? ? ? ? ? ? 2.348 ? ? 
metalc7  metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 66 NE2 ? ? A ZN 200 A HIS 423 1_555 ? ? ? ? ? ? ? 2.048 ? ? 
metalc8  metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 70 NE2 ? ? A ZN 200 A HIS 427 1_555 ? ? ? ? ? ? ? 2.051 ? ? 
metalc9  metalc ? ? D ZN . ZN ? ? ? 1_555 A CYS 78 SG  ? ? A ZN 300 A CYS 435 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc10 metalc ? ? D ZN . ZN ? ? ? 1_555 A CYS 81 SG  ? ? A ZN 300 A CYS 438 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc11 metalc ? ? D ZN . ZN ? ? ? 1_555 A HIS 94 NE2 ? ? A ZN 300 A HIS 451 1_555 ? ? ? ? ? ? ? 2.007 ? ? 
metalc12 metalc ? ? D ZN . ZN ? ? ? 1_555 A HIS 98 NE2 ? ? A ZN 300 A HIS 455 1_555 ? ? ? ? ? ? ? 2.050 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS A 16 ? TYR A 17 ? HIS A 373 TYR A 374 
A 2 VAL A 26 ? TYR A 27 ? VAL A 383 TYR A 384 
B 1 TYR A 46 ? LYS A 47 ? TYR A 403 LYS A 404 
B 2 ARG A 56 ? PHE A 57 ? ARG A 413 PHE A 414 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N HIS A 16 ? N HIS A 373 O TYR A 27 ? O TYR A 384 
B 1 2 N TYR A 46 ? N TYR A 403 O PHE A 57 ? O PHE A 414 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 100 ? 4 'BINDING SITE FOR RESIDUE ZN A 100' 
AC2 Software A ZN 200 ? 4 'BINDING SITE FOR RESIDUE ZN A 200' 
AC3 Software A ZN 300 ? 4 'BINDING SITE FOR RESIDUE ZN A 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 18 ? CYS A 375 . ? 1_555 ? 
2  AC1 4 CYS A 23 ? CYS A 380 . ? 1_555 ? 
3  AC1 4 HIS A 36 ? HIS A 393 . ? 1_555 ? 
4  AC1 4 HIS A 40 ? HIS A 397 . ? 1_555 ? 
5  AC2 4 CYS A 48 ? CYS A 405 . ? 1_555 ? 
6  AC2 4 CYS A 53 ? CYS A 410 . ? 1_555 ? 
7  AC2 4 HIS A 66 ? HIS A 423 . ? 1_555 ? 
8  AC2 4 HIS A 70 ? HIS A 427 . ? 1_555 ? 
9  AC3 4 CYS A 78 ? CYS A 435 . ? 1_555 ? 
10 AC3 4 CYS A 81 ? CYS A 438 . ? 1_555 ? 
11 AC3 4 HIS A 94 ? HIS A 451 . ? 1_555 ? 
12 AC3 4 HIS A 98 ? HIS A 455 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2EBT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2EBT 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1   ? 1.112   3.012   46.236  1.00 0.00 ? 358 GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1   ? 1.854   3.013   44.989  1.00 0.00 ? 358 GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1   ? 1.402   4.111   44.047  1.00 0.00 ? 358 GLY A C    1  
ATOM   4     O  O    . GLY A 1 1   ? 0.552   3.889   43.185  1.00 0.00 ? 358 GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1   ? 1.593   3.011   47.090  1.00 0.00 ? 358 GLY A H1   1  
ATOM   6     H  HA2  . GLY A 1 1   ? 2.903   3.148   45.206  1.00 0.00 ? 358 GLY A HA2  1  
ATOM   7     H  HA3  . GLY A 1 1   ? 1.717   2.058   44.501  1.00 0.00 ? 358 GLY A HA3  1  
ATOM   8     N  N    . SER A 1 2   ? 1.972   5.301   44.211  1.00 0.00 ? 359 SER A N    1  
ATOM   9     C  CA   . SER A 1 2   ? 1.619   6.440   43.372  1.00 0.00 ? 359 SER A CA   1  
ATOM   10    C  C    . SER A 1 2   ? 2.868   7.089   42.784  1.00 0.00 ? 359 SER A C    1  
ATOM   11    O  O    . SER A 1 2   ? 2.888   7.479   41.617  1.00 0.00 ? 359 SER A O    1  
ATOM   12    C  CB   . SER A 1 2   ? 0.827   7.470   44.180  1.00 0.00 ? 359 SER A CB   1  
ATOM   13    O  OG   . SER A 1 2   ? 1.610   8.001   45.235  1.00 0.00 ? 359 SER A OG   1  
ATOM   14    H  H    . SER A 1 2   ? 2.644   5.415   44.916  1.00 0.00 ? 359 SER A H    1  
ATOM   15    H  HA   . SER A 1 2   ? 1.002   6.077   42.564  1.00 0.00 ? 359 SER A HA   1  
ATOM   16    H  HB2  . SER A 1 2   ? 0.524   8.277   43.531  1.00 0.00 ? 359 SER A HB2  1  
ATOM   17    H  HB3  . SER A 1 2   ? -0.049  6.997   44.600  1.00 0.00 ? 359 SER A HB3  1  
ATOM   18    H  HG   . SER A 1 2   ? 1.836   8.913   45.038  1.00 0.00 ? 359 SER A HG   1  
ATOM   19    N  N    . SER A 1 3   ? 3.910   7.202   43.603  1.00 0.00 ? 360 SER A N    1  
ATOM   20    C  CA   . SER A 1 3   ? 5.162   7.807   43.166  1.00 0.00 ? 360 SER A CA   1  
ATOM   21    C  C    . SER A 1 3   ? 5.826   6.963   42.082  1.00 0.00 ? 360 SER A C    1  
ATOM   22    O  O    . SER A 1 3   ? 5.338   5.890   41.731  1.00 0.00 ? 360 SER A O    1  
ATOM   23    C  CB   . SER A 1 3   ? 6.114   7.973   44.353  1.00 0.00 ? 360 SER A CB   1  
ATOM   24    O  OG   . SER A 1 3   ? 5.508   8.724   45.391  1.00 0.00 ? 360 SER A OG   1  
ATOM   25    H  H    . SER A 1 3   ? 3.832   6.872   44.522  1.00 0.00 ? 360 SER A H    1  
ATOM   26    H  HA   . SER A 1 3   ? 4.936   8.781   42.759  1.00 0.00 ? 360 SER A HA   1  
ATOM   27    H  HB2  . SER A 1 3   ? 6.379   7.000   44.737  1.00 0.00 ? 360 SER A HB2  1  
ATOM   28    H  HB3  . SER A 1 3   ? 7.006   8.487   44.026  1.00 0.00 ? 360 SER A HB3  1  
ATOM   29    H  HG   . SER A 1 3   ? 5.860   8.441   46.238  1.00 0.00 ? 360 SER A HG   1  
ATOM   30    N  N    . GLY A 1 4   ? 6.942   7.457   41.556  1.00 0.00 ? 361 GLY A N    1  
ATOM   31    C  CA   . GLY A 1 4   ? 7.655   6.736   40.518  1.00 0.00 ? 361 GLY A CA   1  
ATOM   32    C  C    . GLY A 1 4   ? 9.092   7.197   40.374  1.00 0.00 ? 361 GLY A C    1  
ATOM   33    O  O    . GLY A 1 4   ? 9.495   8.192   40.975  1.00 0.00 ? 361 GLY A O    1  
ATOM   34    H  H    . GLY A 1 4   ? 7.285   8.318   41.876  1.00 0.00 ? 361 GLY A H    1  
ATOM   35    H  HA2  . GLY A 1 4   ? 7.647   5.683   40.755  1.00 0.00 ? 361 GLY A HA2  1  
ATOM   36    H  HA3  . GLY A 1 4   ? 7.146   6.886   39.577  1.00 0.00 ? 361 GLY A HA3  1  
ATOM   37    N  N    . SER A 1 5   ? 9.868   6.469   39.577  1.00 0.00 ? 362 SER A N    1  
ATOM   38    C  CA   . SER A 1 5   ? 11.270  6.806   39.361  1.00 0.00 ? 362 SER A CA   1  
ATOM   39    C  C    . SER A 1 5   ? 11.888  5.903   38.297  1.00 0.00 ? 362 SER A C    1  
ATOM   40    O  O    . SER A 1 5   ? 11.775  4.679   38.364  1.00 0.00 ? 362 SER A O    1  
ATOM   41    C  CB   . SER A 1 5   ? 12.054  6.681   40.669  1.00 0.00 ? 362 SER A CB   1  
ATOM   42    O  OG   . SER A 1 5   ? 13.220  7.486   40.643  1.00 0.00 ? 362 SER A OG   1  
ATOM   43    H  H    . SER A 1 5   ? 9.488   5.687   39.125  1.00 0.00 ? 362 SER A H    1  
ATOM   44    H  HA   . SER A 1 5   ? 11.317  7.829   39.019  1.00 0.00 ? 362 SER A HA   1  
ATOM   45    H  HB2  . SER A 1 5   ? 11.431  6.998   41.491  1.00 0.00 ? 362 SER A HB2  1  
ATOM   46    H  HB3  . SER A 1 5   ? 12.345  5.651   40.814  1.00 0.00 ? 362 SER A HB3  1  
ATOM   47    H  HG   . SER A 1 5   ? 13.635  7.421   39.780  1.00 0.00 ? 362 SER A HG   1  
ATOM   48    N  N    . SER A 1 6   ? 12.540  6.517   37.315  1.00 0.00 ? 363 SER A N    1  
ATOM   49    C  CA   . SER A 1 6   ? 13.172  5.771   36.233  1.00 0.00 ? 363 SER A CA   1  
ATOM   50    C  C    . SER A 1 6   ? 14.618  6.217   36.038  1.00 0.00 ? 363 SER A C    1  
ATOM   51    O  O    . SER A 1 6   ? 15.070  7.182   36.654  1.00 0.00 ? 363 SER A O    1  
ATOM   52    C  CB   . SER A 1 6   ? 12.389  5.956   34.932  1.00 0.00 ? 363 SER A CB   1  
ATOM   53    O  OG   . SER A 1 6   ? 12.537  7.273   34.430  1.00 0.00 ? 363 SER A OG   1  
ATOM   54    H  H    . SER A 1 6   ? 12.595  7.496   37.316  1.00 0.00 ? 363 SER A H    1  
ATOM   55    H  HA   . SER A 1 6   ? 13.164  4.725   36.503  1.00 0.00 ? 363 SER A HA   1  
ATOM   56    H  HB2  . SER A 1 6   ? 12.755  5.259   34.193  1.00 0.00 ? 363 SER A HB2  1  
ATOM   57    H  HB3  . SER A 1 6   ? 11.341  5.769   35.116  1.00 0.00 ? 363 SER A HB3  1  
ATOM   58    H  HG   . SER A 1 6   ? 11.729  7.539   33.986  1.00 0.00 ? 363 SER A HG   1  
ATOM   59    N  N    . GLY A 1 7   ? 15.339  5.507   35.176  1.00 0.00 ? 364 GLY A N    1  
ATOM   60    C  CA   . GLY A 1 7   ? 16.726  5.844   34.914  1.00 0.00 ? 364 GLY A CA   1  
ATOM   61    C  C    . GLY A 1 7   ? 17.328  5.002   33.807  1.00 0.00 ? 364 GLY A C    1  
ATOM   62    O  O    . GLY A 1 7   ? 16.980  3.835   33.626  1.00 0.00 ? 364 GLY A O    1  
ATOM   63    H  H    . GLY A 1 7   ? 14.926  4.748   34.714  1.00 0.00 ? 364 GLY A H    1  
ATOM   64    H  HA2  . GLY A 1 7   ? 16.785  6.885   34.633  1.00 0.00 ? 364 GLY A HA2  1  
ATOM   65    H  HA3  . GLY A 1 7   ? 17.298  5.692   35.818  1.00 0.00 ? 364 GLY A HA3  1  
ATOM   66    N  N    . PRO A 1 8   ? 18.254  5.598   33.042  1.00 0.00 ? 365 PRO A N    1  
ATOM   67    C  CA   . PRO A 1 8   ? 18.925  4.914   31.932  1.00 0.00 ? 365 PRO A CA   1  
ATOM   68    C  C    . PRO A 1 8   ? 19.881  3.828   32.414  1.00 0.00 ? 365 PRO A C    1  
ATOM   69    O  O    . PRO A 1 8   ? 19.897  3.481   33.596  1.00 0.00 ? 365 PRO A O    1  
ATOM   70    C  CB   . PRO A 1 8   ? 19.698  6.037   31.238  1.00 0.00 ? 365 PRO A CB   1  
ATOM   71    C  CG   . PRO A 1 8   ? 19.921  7.057   32.300  1.00 0.00 ? 365 PRO A CG   1  
ATOM   72    C  CD   . PRO A 1 8   ? 18.719  6.987   33.200  1.00 0.00 ? 365 PRO A CD   1  
ATOM   73    H  HA   . PRO A 1 8   ? 18.213  4.484   31.243  1.00 0.00 ? 365 PRO A HA   1  
ATOM   74    H  HB2  . PRO A 1 8   ? 20.634  5.652   30.857  1.00 0.00 ? 365 PRO A HB2  1  
ATOM   75    H  HB3  . PRO A 1 8   ? 19.109  6.436   30.425  1.00 0.00 ? 365 PRO A HB3  1  
ATOM   76    H  HG2  . PRO A 1 8   ? 20.818  6.822   32.853  1.00 0.00 ? 365 PRO A HG2  1  
ATOM   77    H  HG3  . PRO A 1 8   ? 19.999  8.039   31.856  1.00 0.00 ? 365 PRO A HG3  1  
ATOM   78    H  HD2  . PRO A 1 8   ? 19.001  7.184   34.224  1.00 0.00 ? 365 PRO A HD2  1  
ATOM   79    H  HD3  . PRO A 1 8   ? 17.962  7.685   32.875  1.00 0.00 ? 365 PRO A HD3  1  
ATOM   80    N  N    . ASP A 1 9   ? 20.678  3.296   31.494  1.00 0.00 ? 366 ASP A N    1  
ATOM   81    C  CA   . ASP A 1 9   ? 21.639  2.251   31.826  1.00 0.00 ? 366 ASP A CA   1  
ATOM   82    C  C    . ASP A 1 9   ? 22.854  2.317   30.905  1.00 0.00 ? 366 ASP A C    1  
ATOM   83    O  O    . ASP A 1 9   ? 22.884  3.101   29.955  1.00 0.00 ? 366 ASP A O    1  
ATOM   84    C  CB   . ASP A 1 9   ? 20.981  0.873   31.724  1.00 0.00 ? 366 ASP A CB   1  
ATOM   85    C  CG   . ASP A 1 9   ? 20.085  0.748   30.508  1.00 0.00 ? 366 ASP A CG   1  
ATOM   86    O  OD1  . ASP A 1 9   ? 18.974  1.317   30.530  1.00 0.00 ? 366 ASP A OD1  1  
ATOM   87    O  OD2  . ASP A 1 9   ? 20.494  0.080   29.535  1.00 0.00 ? 366 ASP A OD2  1  
ATOM   88    H  H    . ASP A 1 9   ? 20.619  3.615   30.569  1.00 0.00 ? 366 ASP A H    1  
ATOM   89    H  HA   . ASP A 1 9   ? 21.964  2.410   32.843  1.00 0.00 ? 366 ASP A HA   1  
ATOM   90    H  HB2  . ASP A 1 9   ? 21.751  0.118   31.660  1.00 0.00 ? 366 ASP A HB2  1  
ATOM   91    H  HB3  . ASP A 1 9   ? 20.385  0.700   32.608  1.00 0.00 ? 366 ASP A HB3  1  
ATOM   92    N  N    . LEU A 1 10  ? 23.853  1.491   31.194  1.00 0.00 ? 367 LEU A N    1  
ATOM   93    C  CA   . LEU A 1 10  ? 25.072  1.457   30.392  1.00 0.00 ? 367 LEU A CA   1  
ATOM   94    C  C    . LEU A 1 10  ? 25.701  0.067   30.418  1.00 0.00 ? 367 LEU A C    1  
ATOM   95    O  O    . LEU A 1 10  ? 25.539  -0.680  31.382  1.00 0.00 ? 367 LEU A O    1  
ATOM   96    C  CB   . LEU A 1 10  ? 26.074  2.492   30.907  1.00 0.00 ? 367 LEU A CB   1  
ATOM   97    C  CG   . LEU A 1 10  ? 26.685  2.209   32.280  1.00 0.00 ? 367 LEU A CG   1  
ATOM   98    C  CD1  . LEU A 1 10  ? 27.966  3.008   32.469  1.00 0.00 ? 367 LEU A CD1  1  
ATOM   99    C  CD2  . LEU A 1 10  ? 25.687  2.530   33.384  1.00 0.00 ? 367 LEU A CD2  1  
ATOM   100   H  H    . LEU A 1 10  ? 23.771  0.890   31.963  1.00 0.00 ? 367 LEU A H    1  
ATOM   101   H  HA   . LEU A 1 10  ? 24.806  1.700   29.375  1.00 0.00 ? 367 LEU A HA   1  
ATOM   102   H  HB2  . LEU A 1 10  ? 26.880  2.555   30.193  1.00 0.00 ? 367 LEU A HB2  1  
ATOM   103   H  HB3  . LEU A 1 10  ? 25.566  3.444   30.959  1.00 0.00 ? 367 LEU A HB3  1  
ATOM   104   H  HG   . LEU A 1 10  ? 26.934  1.159   32.347  1.00 0.00 ? 367 LEU A HG   1  
ATOM   105   H  HD11 . LEU A 1 10  ? 28.201  3.532   31.555  1.00 0.00 ? 367 LEU A HD11 1  
ATOM   106   H  HD12 . LEU A 1 10  ? 28.775  2.337   32.717  1.00 0.00 ? 367 LEU A HD12 1  
ATOM   107   H  HD13 . LEU A 1 10  ? 27.831  3.720   33.269  1.00 0.00 ? 367 LEU A HD13 1  
ATOM   108   H  HD21 . LEU A 1 10  ? 26.220  2.749   34.297  1.00 0.00 ? 367 LEU A HD21 1  
ATOM   109   H  HD22 . LEU A 1 10  ? 25.039  1.680   33.540  1.00 0.00 ? 367 LEU A HD22 1  
ATOM   110   H  HD23 . LEU A 1 10  ? 25.095  3.386   33.096  1.00 0.00 ? 367 LEU A HD23 1  
ATOM   111   N  N    . GLU A 1 11  ? 26.420  -0.271  29.352  1.00 0.00 ? 368 GLU A N    1  
ATOM   112   C  CA   . GLU A 1 11  ? 27.074  -1.571  29.253  1.00 0.00 ? 368 GLU A CA   1  
ATOM   113   C  C    . GLU A 1 11  ? 28.107  -1.576  28.131  1.00 0.00 ? 368 GLU A C    1  
ATOM   114   O  O    . GLU A 1 11  ? 28.107  -0.699  27.267  1.00 0.00 ? 368 GLU A O    1  
ATOM   115   C  CB   . GLU A 1 11  ? 26.038  -2.671  29.013  1.00 0.00 ? 368 GLU A CB   1  
ATOM   116   C  CG   . GLU A 1 11  ? 25.365  -2.587  27.653  1.00 0.00 ? 368 GLU A CG   1  
ATOM   117   C  CD   . GLU A 1 11  ? 24.131  -1.706  27.667  1.00 0.00 ? 368 GLU A CD   1  
ATOM   118   O  OE1  . GLU A 1 11  ? 23.491  -1.597  28.734  1.00 0.00 ? 368 GLU A OE1  1  
ATOM   119   O  OE2  . GLU A 1 11  ? 23.805  -1.127  26.610  1.00 0.00 ? 368 GLU A OE2  1  
ATOM   120   H  H    . GLU A 1 11  ? 26.512  0.368   28.614  1.00 0.00 ? 368 GLU A H    1  
ATOM   121   H  HA   . GLU A 1 11  ? 27.576  -1.761  30.190  1.00 0.00 ? 368 GLU A HA   1  
ATOM   122   H  HB2  . GLU A 1 11  ? 26.526  -3.631  29.092  1.00 0.00 ? 368 GLU A HB2  1  
ATOM   123   H  HB3  . GLU A 1 11  ? 25.275  -2.602  29.774  1.00 0.00 ? 368 GLU A HB3  1  
ATOM   124   H  HG2  . GLU A 1 11  ? 26.069  -2.182  26.942  1.00 0.00 ? 368 GLU A HG2  1  
ATOM   125   H  HG3  . GLU A 1 11  ? 25.077  -3.582  27.347  1.00 0.00 ? 368 GLU A HG3  1  
ATOM   126   N  N    . LYS A 1 12  ? 28.988  -2.570  28.150  1.00 0.00 ? 369 LYS A N    1  
ATOM   127   C  CA   . LYS A 1 12  ? 30.028  -2.692  27.135  1.00 0.00 ? 369 LYS A CA   1  
ATOM   128   C  C    . LYS A 1 12  ? 29.487  -2.330  25.756  1.00 0.00 ? 369 LYS A C    1  
ATOM   129   O  O    . LYS A 1 12  ? 28.277  -2.348  25.529  1.00 0.00 ? 369 LYS A O    1  
ATOM   130   C  CB   . LYS A 1 12  ? 30.587  -4.117  27.117  1.00 0.00 ? 369 LYS A CB   1  
ATOM   131   C  CG   . LYS A 1 12  ? 31.769  -4.318  28.049  1.00 0.00 ? 369 LYS A CG   1  
ATOM   132   C  CD   . LYS A 1 12  ? 31.320  -4.749  29.435  1.00 0.00 ? 369 LYS A CD   1  
ATOM   133   C  CE   . LYS A 1 12  ? 31.236  -6.264  29.548  1.00 0.00 ? 369 LYS A CE   1  
ATOM   134   N  NZ   . LYS A 1 12  ? 29.888  -6.774  29.175  1.00 0.00 ? 369 LYS A NZ   1  
ATOM   135   H  H    . LYS A 1 12  ? 28.938  -3.240  28.865  1.00 0.00 ? 369 LYS A H    1  
ATOM   136   H  HA   . LYS A 1 12  ? 30.822  -2.006  27.389  1.00 0.00 ? 369 LYS A HA   1  
ATOM   137   H  HB2  . LYS A 1 12  ? 29.805  -4.802  27.409  1.00 0.00 ? 369 LYS A HB2  1  
ATOM   138   H  HB3  . LYS A 1 12  ? 30.904  -4.353  26.112  1.00 0.00 ? 369 LYS A HB3  1  
ATOM   139   H  HG2  . LYS A 1 12  ? 32.415  -5.080  27.638  1.00 0.00 ? 369 LYS A HG2  1  
ATOM   140   H  HG3  . LYS A 1 12  ? 32.314  -3.388  28.130  1.00 0.00 ? 369 LYS A HG3  1  
ATOM   141   H  HD2  . LYS A 1 12  ? 32.028  -4.384  30.164  1.00 0.00 ? 369 LYS A HD2  1  
ATOM   142   H  HD3  . LYS A 1 12  ? 30.345  -4.328  29.635  1.00 0.00 ? 369 LYS A HD3  1  
ATOM   143   H  HE2  . LYS A 1 12  ? 31.972  -6.702  28.891  1.00 0.00 ? 369 LYS A HE2  1  
ATOM   144   H  HE3  . LYS A 1 12  ? 31.450  -6.548  30.567  1.00 0.00 ? 369 LYS A HE3  1  
ATOM   145   H  HZ1  . LYS A 1 12  ? 29.464  -7.283  29.976  1.00 0.00 ? 369 LYS A HZ1  1  
ATOM   146   H  HZ2  . LYS A 1 12  ? 29.964  -7.424  28.366  1.00 0.00 ? 369 LYS A HZ2  1  
ATOM   147   H  HZ3  . LYS A 1 12  ? 29.267  -5.983  28.911  1.00 0.00 ? 369 LYS A HZ3  1  
ATOM   148   N  N    . ARG A 1 13  ? 30.390  -2.002  24.838  1.00 0.00 ? 370 ARG A N    1  
ATOM   149   C  CA   . ARG A 1 13  ? 30.003  -1.636  23.481  1.00 0.00 ? 370 ARG A CA   1  
ATOM   150   C  C    . ARG A 1 13  ? 29.703  -2.878  22.647  1.00 0.00 ? 370 ARG A C    1  
ATOM   151   O  O    . ARG A 1 13  ? 30.615  -3.587  22.221  1.00 0.00 ? 370 ARG A O    1  
ATOM   152   C  CB   . ARG A 1 13  ? 31.110  -0.817  22.815  1.00 0.00 ? 370 ARG A CB   1  
ATOM   153   C  CG   . ARG A 1 13  ? 32.434  -1.557  22.708  1.00 0.00 ? 370 ARG A CG   1  
ATOM   154   C  CD   . ARG A 1 13  ? 33.589  -0.599  22.461  1.00 0.00 ? 370 ARG A CD   1  
ATOM   155   N  NE   . ARG A 1 13  ? 33.727  0.380   23.536  1.00 0.00 ? 370 ARG A NE   1  
ATOM   156   C  CZ   . ARG A 1 13  ? 34.813  1.123   23.718  1.00 0.00 ? 370 ARG A CZ   1  
ATOM   157   N  NH1  . ARG A 1 13  ? 35.849  1.000   22.900  1.00 0.00 ? 370 ARG A NH1  1  
ATOM   158   N  NH2  . ARG A 1 13  ? 34.864  1.992   24.719  1.00 0.00 ? 370 ARG A NH2  1  
ATOM   159   H  H    . ARG A 1 13  ? 31.340  -2.006  25.079  1.00 0.00 ? 370 ARG A H    1  
ATOM   160   H  HA   . ARG A 1 13  ? 29.109  -1.033  23.543  1.00 0.00 ? 370 ARG A HA   1  
ATOM   161   H  HB2  . ARG A 1 13  ? 30.793  -0.546  21.819  1.00 0.00 ? 370 ARG A HB2  1  
ATOM   162   H  HB3  . ARG A 1 13  ? 31.271  0.082   23.390  1.00 0.00 ? 370 ARG A HB3  1  
ATOM   163   H  HG2  . ARG A 1 13  ? 32.614  -2.090  23.629  1.00 0.00 ? 370 ARG A HG2  1  
ATOM   164   H  HG3  . ARG A 1 13  ? 32.378  -2.258  21.889  1.00 0.00 ? 370 ARG A HG3  1  
ATOM   165   H  HD2  . ARG A 1 13  ? 34.503  -1.169  22.387  1.00 0.00 ? 370 ARG A HD2  1  
ATOM   166   H  HD3  . ARG A 1 13  ? 33.414  -0.077  21.532  1.00 0.00 ? 370 ARG A HD3  1  
ATOM   167   H  HE   . ARG A 1 13  ? 32.974  0.487   24.152  1.00 0.00 ? 370 ARG A HE   1  
ATOM   168   H  HH11 . ARG A 1 13  ? 35.814  0.347   22.144  1.00 0.00 ? 370 ARG A HH11 1  
ATOM   169   H  HH12 . ARG A 1 13  ? 36.665  1.562   23.038  1.00 0.00 ? 370 ARG A HH12 1  
ATOM   170   H  HH21 . ARG A 1 13  ? 34.085  2.088   25.338  1.00 0.00 ? 370 ARG A HH21 1  
ATOM   171   H  HH22 . ARG A 1 13  ? 35.681  2.551   24.855  1.00 0.00 ? 370 ARG A HH22 1  
ATOM   172   N  N    . ARG A 1 14  ? 28.419  -3.136  22.420  1.00 0.00 ? 371 ARG A N    1  
ATOM   173   C  CA   . ARG A 1 14  ? 27.999  -4.293  21.639  1.00 0.00 ? 371 ARG A CA   1  
ATOM   174   C  C    . ARG A 1 14  ? 27.254  -3.858  20.380  1.00 0.00 ? 371 ARG A C    1  
ATOM   175   O  O    . ARG A 1 14  ? 26.922  -2.683  20.218  1.00 0.00 ? 371 ARG A O    1  
ATOM   176   C  CB   . ARG A 1 14  ? 27.107  -5.207  22.482  1.00 0.00 ? 371 ARG A CB   1  
ATOM   177   C  CG   . ARG A 1 14  ? 25.697  -4.674  22.674  1.00 0.00 ? 371 ARG A CG   1  
ATOM   178   C  CD   . ARG A 1 14  ? 25.623  -3.703  23.843  1.00 0.00 ? 371 ARG A CD   1  
ATOM   179   N  NE   . ARG A 1 14  ? 24.257  -3.539  24.332  1.00 0.00 ? 371 ARG A NE   1  
ATOM   180   C  CZ   . ARG A 1 14  ? 23.622  -4.450  25.061  1.00 0.00 ? 371 ARG A CZ   1  
ATOM   181   N  NH1  . ARG A 1 14  ? 24.228  -5.584  25.385  1.00 0.00 ? 371 ARG A NH1  1  
ATOM   182   N  NH2  . ARG A 1 14  ? 22.379  -4.226  25.469  1.00 0.00 ? 371 ARG A NH2  1  
ATOM   183   H  H    . ARG A 1 14  ? 27.738  -2.533  22.786  1.00 0.00 ? 371 ARG A H    1  
ATOM   184   H  HA   . ARG A 1 14  ? 28.885  -4.837  21.349  1.00 0.00 ? 371 ARG A HA   1  
ATOM   185   H  HB2  . ARG A 1 14  ? 27.041  -6.171  21.999  1.00 0.00 ? 371 ARG A HB2  1  
ATOM   186   H  HB3  . ARG A 1 14  ? 27.558  -5.331  23.455  1.00 0.00 ? 371 ARG A HB3  1  
ATOM   187   H  HG2  . ARG A 1 14  ? 25.390  -4.160  21.775  1.00 0.00 ? 371 ARG A HG2  1  
ATOM   188   H  HG3  . ARG A 1 14  ? 25.032  -5.503  22.863  1.00 0.00 ? 371 ARG A HG3  1  
ATOM   189   H  HD2  . ARG A 1 14  ? 26.239  -4.080  24.646  1.00 0.00 ? 371 ARG A HD2  1  
ATOM   190   H  HD3  . ARG A 1 14  ? 25.999  -2.744  23.521  1.00 0.00 ? 371 ARG A HD3  1  
ATOM   191   H  HE   . ARG A 1 14  ? 23.791  -2.708  24.104  1.00 0.00 ? 371 ARG A HE   1  
ATOM   192   H  HH11 . ARG A 1 14  ? 25.165  -5.754  25.080  1.00 0.00 ? 371 ARG A HH11 1  
ATOM   193   H  HH12 . ARG A 1 14  ? 23.748  -6.268  25.935  1.00 0.00 ? 371 ARG A HH12 1  
ATOM   194   H  HH21 . ARG A 1 14  ? 21.920  -3.372  25.227  1.00 0.00 ? 371 ARG A HH21 1  
ATOM   195   H  HH22 . ARG A 1 14  ? 21.903  -4.913  26.017  1.00 0.00 ? 371 ARG A HH22 1  
ATOM   196   N  N    . ILE A 1 15  ? 26.994  -4.812  19.493  1.00 0.00 ? 372 ILE A N    1  
ATOM   197   C  CA   . ILE A 1 15  ? 26.288  -4.527  18.250  1.00 0.00 ? 372 ILE A CA   1  
ATOM   198   C  C    . ILE A 1 15  ? 24.778  -4.614  18.443  1.00 0.00 ? 372 ILE A C    1  
ATOM   199   O  O    . ILE A 1 15  ? 24.252  -5.649  18.852  1.00 0.00 ? 372 ILE A O    1  
ATOM   200   C  CB   . ILE A 1 15  ? 26.707  -5.498  17.130  1.00 0.00 ? 372 ILE A CB   1  
ATOM   201   C  CG1  . ILE A 1 15  ? 28.232  -5.544  17.009  1.00 0.00 ? 372 ILE A CG1  1  
ATOM   202   C  CG2  . ILE A 1 15  ? 26.078  -5.084  15.808  1.00 0.00 ? 372 ILE A CG2  1  
ATOM   203   C  CD1  . ILE A 1 15  ? 28.740  -6.724  16.210  1.00 0.00 ? 372 ILE A CD1  1  
ATOM   204   H  H    . ILE A 1 15  ? 27.284  -5.729  19.679  1.00 0.00 ? 372 ILE A H    1  
ATOM   205   H  HA   . ILE A 1 15  ? 26.545  -3.523  17.944  1.00 0.00 ? 372 ILE A HA   1  
ATOM   206   H  HB   . ILE A 1 15  ? 26.343  -6.482  17.382  1.00 0.00 ? 372 ILE A HB   1  
ATOM   207   H  HG12 . ILE A 1 15  ? 28.576  -4.644  16.524  1.00 0.00 ? 372 ILE A HG12 1  
ATOM   208   H  HG13 . ILE A 1 15  ? 28.662  -5.602  17.998  1.00 0.00 ? 372 ILE A HG13 1  
ATOM   209   H  HG21 . ILE A 1 15  ? 25.282  -4.378  15.994  1.00 0.00 ? 372 ILE A HG21 1  
ATOM   210   H  HG22 . ILE A 1 15  ? 26.827  -4.624  15.181  1.00 0.00 ? 372 ILE A HG22 1  
ATOM   211   H  HG23 . ILE A 1 15  ? 25.678  -5.955  15.311  1.00 0.00 ? 372 ILE A HG23 1  
ATOM   212   H  HD11 . ILE A 1 15  ? 29.185  -7.446  16.879  1.00 0.00 ? 372 ILE A HD11 1  
ATOM   213   H  HD12 . ILE A 1 15  ? 27.916  -7.183  15.683  1.00 0.00 ? 372 ILE A HD12 1  
ATOM   214   H  HD13 . ILE A 1 15  ? 29.480  -6.387  15.500  1.00 0.00 ? 372 ILE A HD13 1  
ATOM   215   N  N    . HIS A 1 16  ? 24.086  -3.519  18.144  1.00 0.00 ? 373 HIS A N    1  
ATOM   216   C  CA   . HIS A 1 16  ? 22.634  -3.471  18.283  1.00 0.00 ? 373 HIS A CA   1  
ATOM   217   C  C    . HIS A 1 16  ? 21.951  -3.815  16.963  1.00 0.00 ? 373 HIS A C    1  
ATOM   218   O  O    . HIS A 1 16  ? 22.293  -3.267  15.914  1.00 0.00 ? 373 HIS A O    1  
ATOM   219   C  CB   . HIS A 1 16  ? 22.191  -2.086  18.754  1.00 0.00 ? 373 HIS A CB   1  
ATOM   220   C  CG   . HIS A 1 16  ? 22.865  -1.638  20.015  1.00 0.00 ? 373 HIS A CG   1  
ATOM   221   N  ND1  . HIS A 1 16  ? 22.220  -1.575  21.232  1.00 0.00 ? 373 HIS A ND1  1  
ATOM   222   C  CD2  . HIS A 1 16  ? 24.136  -1.232  20.243  1.00 0.00 ? 373 HIS A CD2  1  
ATOM   223   C  CE1  . HIS A 1 16  ? 23.064  -1.148  22.154  1.00 0.00 ? 373 HIS A CE1  1  
ATOM   224   N  NE2  . HIS A 1 16  ? 24.234  -0.933  21.579  1.00 0.00 ? 373 HIS A NE2  1  
ATOM   225   H  H    . HIS A 1 16  ? 24.562  -2.725  17.823  1.00 0.00 ? 373 HIS A H    1  
ATOM   226   H  HA   . HIS A 1 16  ? 22.348  -4.203  19.023  1.00 0.00 ? 373 HIS A HA   1  
ATOM   227   H  HB2  . HIS A 1 16  ? 22.415  -1.362  17.984  1.00 0.00 ? 373 HIS A HB2  1  
ATOM   228   H  HB3  . HIS A 1 16  ? 21.126  -2.097  18.933  1.00 0.00 ? 373 HIS A HB3  1  
ATOM   229   H  HD1  . HIS A 1 16  ? 21.282  -1.807  21.395  1.00 0.00 ? 373 HIS A HD1  1  
ATOM   230   H  HD2  . HIS A 1 16  ? 24.927  -1.157  19.510  1.00 0.00 ? 373 HIS A HD2  1  
ATOM   231   H  HE1  . HIS A 1 16  ? 22.838  -0.999  23.199  1.00 0.00 ? 373 HIS A HE1  1  
ATOM   232   N  N    . TYR A 1 17  ? 20.985  -4.725  17.021  1.00 0.00 ? 374 TYR A N    1  
ATOM   233   C  CA   . TYR A 1 17  ? 20.256  -5.144  15.830  1.00 0.00 ? 374 TYR A CA   1  
ATOM   234   C  C    . TYR A 1 17  ? 18.828  -4.609  15.849  1.00 0.00 ? 374 TYR A C    1  
ATOM   235   O  O    . TYR A 1 17  ? 18.073  -4.852  16.791  1.00 0.00 ? 374 TYR A O    1  
ATOM   236   C  CB   . TYR A 1 17  ? 20.240  -6.670  15.727  1.00 0.00 ? 374 TYR A CB   1  
ATOM   237   C  CG   . TYR A 1 17  ? 21.577  -7.311  16.024  1.00 0.00 ? 374 TYR A CG   1  
ATOM   238   C  CD1  . TYR A 1 17  ? 22.502  -7.535  15.011  1.00 0.00 ? 374 TYR A CD1  1  
ATOM   239   C  CD2  . TYR A 1 17  ? 21.914  -7.694  17.316  1.00 0.00 ? 374 TYR A CD2  1  
ATOM   240   C  CE1  . TYR A 1 17  ? 23.724  -8.122  15.277  1.00 0.00 ? 374 TYR A CE1  1  
ATOM   241   C  CE2  . TYR A 1 17  ? 23.135  -8.280  17.591  1.00 0.00 ? 374 TYR A CE2  1  
ATOM   242   C  CZ   . TYR A 1 17  ? 24.036  -8.492  16.569  1.00 0.00 ? 374 TYR A CZ   1  
ATOM   243   O  OH   . TYR A 1 17  ? 25.252  -9.076  16.839  1.00 0.00 ? 374 TYR A OH   1  
ATOM   244   H  H    . TYR A 1 17  ? 20.758  -5.126  17.886  1.00 0.00 ? 374 TYR A H    1  
ATOM   245   H  HA   . TYR A 1 17  ? 20.769  -4.740  14.969  1.00 0.00 ? 374 TYR A HA   1  
ATOM   246   H  HB2  . TYR A 1 17  ? 19.521  -7.063  16.429  1.00 0.00 ? 374 TYR A HB2  1  
ATOM   247   H  HB3  . TYR A 1 17  ? 19.951  -6.953  14.725  1.00 0.00 ? 374 TYR A HB3  1  
ATOM   248   H  HD1  . TYR A 1 17  ? 22.254  -7.244  14.000  1.00 0.00 ? 374 TYR A HD1  1  
ATOM   249   H  HD2  . TYR A 1 17  ? 21.206  -7.527  18.114  1.00 0.00 ? 374 TYR A HD2  1  
ATOM   250   H  HE1  . TYR A 1 17  ? 24.430  -8.287  14.477  1.00 0.00 ? 374 TYR A HE1  1  
ATOM   251   H  HE2  . TYR A 1 17  ? 23.379  -8.570  18.602  1.00 0.00 ? 374 TYR A HE2  1  
ATOM   252   H  HH   . TYR A 1 17  ? 25.806  -9.039  16.055  1.00 0.00 ? 374 TYR A HH   1  
ATOM   253   N  N    . CYS A 1 18  ? 18.463  -3.878  14.801  1.00 0.00 ? 375 CYS A N    1  
ATOM   254   C  CA   . CYS A 1 18  ? 17.126  -3.307  14.694  1.00 0.00 ? 375 CYS A CA   1  
ATOM   255   C  C    . CYS A 1 18  ? 16.059  -4.372  14.936  1.00 0.00 ? 375 CYS A C    1  
ATOM   256   O  O    . CYS A 1 18  ? 16.049  -5.415  14.282  1.00 0.00 ? 375 CYS A O    1  
ATOM   257   C  CB   . CYS A 1 18  ? 16.927  -2.674  13.316  1.00 0.00 ? 375 CYS A CB   1  
ATOM   258   S  SG   . CYS A 1 18  ? 15.307  -1.871  13.093  1.00 0.00 ? 375 CYS A SG   1  
ATOM   259   H  H    . CYS A 1 18  ? 19.109  -3.719  14.080  1.00 0.00 ? 375 CYS A H    1  
ATOM   260   H  HA   . CYS A 1 18  ? 17.030  -2.542  15.449  1.00 0.00 ? 375 CYS A HA   1  
ATOM   261   H  HB2  . CYS A 1 18  ? 17.689  -1.924  13.160  1.00 0.00 ? 375 CYS A HB2  1  
ATOM   262   H  HB3  . CYS A 1 18  ? 17.022  -3.439  12.559  1.00 0.00 ? 375 CYS A HB3  1  
ATOM   263   N  N    . ASP A 1 19  ? 15.163  -4.100  15.878  1.00 0.00 ? 376 ASP A N    1  
ATOM   264   C  CA   . ASP A 1 19  ? 14.091  -5.033  16.205  1.00 0.00 ? 376 ASP A CA   1  
ATOM   265   C  C    . ASP A 1 19  ? 12.932  -4.896  15.222  1.00 0.00 ? 376 ASP A C    1  
ATOM   266   O  O    . ASP A 1 19  ? 11.765  -4.927  15.614  1.00 0.00 ? 376 ASP A O    1  
ATOM   267   C  CB   . ASP A 1 19  ? 13.596  -4.794  17.633  1.00 0.00 ? 376 ASP A CB   1  
ATOM   268   C  CG   . ASP A 1 19  ? 12.791  -5.961  18.169  1.00 0.00 ? 376 ASP A CG   1  
ATOM   269   O  OD1  . ASP A 1 19  ? 13.028  -7.103  17.720  1.00 0.00 ? 376 ASP A OD1  1  
ATOM   270   O  OD2  . ASP A 1 19  ? 11.925  -5.734  19.039  1.00 0.00 ? 376 ASP A OD2  1  
ATOM   271   H  H    . ASP A 1 19  ? 15.223  -3.251  16.364  1.00 0.00 ? 376 ASP A H    1  
ATOM   272   H  HA   . ASP A 1 19  ? 14.489  -6.034  16.135  1.00 0.00 ? 376 ASP A HA   1  
ATOM   273   H  HB2  . ASP A 1 19  ? 14.447  -4.640  18.280  1.00 0.00 ? 376 ASP A HB2  1  
ATOM   274   H  HB3  . ASP A 1 19  ? 12.973  -3.912  17.648  1.00 0.00 ? 376 ASP A HB3  1  
ATOM   275   N  N    . TYR A 1 20  ? 13.262  -4.743  13.945  1.00 0.00 ? 377 TYR A N    1  
ATOM   276   C  CA   . TYR A 1 20  ? 12.249  -4.597  12.906  1.00 0.00 ? 377 TYR A CA   1  
ATOM   277   C  C    . TYR A 1 20  ? 12.347  -5.728  11.887  1.00 0.00 ? 377 TYR A C    1  
ATOM   278   O  O    . TYR A 1 20  ? 13.434  -6.153  11.496  1.00 0.00 ? 377 TYR A O    1  
ATOM   279   C  CB   . TYR A 1 20  ? 12.400  -3.247  12.203  1.00 0.00 ? 377 TYR A CB   1  
ATOM   280   C  CG   . TYR A 1 20  ? 11.108  -2.719  11.621  1.00 0.00 ? 377 TYR A CG   1  
ATOM   281   C  CD1  . TYR A 1 20  ? 10.167  -2.089  12.427  1.00 0.00 ? 377 TYR A CD1  1  
ATOM   282   C  CD2  . TYR A 1 20  ? 10.827  -2.852  10.267  1.00 0.00 ? 377 TYR A CD2  1  
ATOM   283   C  CE1  . TYR A 1 20  ? 8.985   -1.606  11.900  1.00 0.00 ? 377 TYR A CE1  1  
ATOM   284   C  CE2  . TYR A 1 20  ? 9.648   -2.370  9.732   1.00 0.00 ? 377 TYR A CE2  1  
ATOM   285   C  CZ   . TYR A 1 20  ? 8.730   -1.748  10.552  1.00 0.00 ? 377 TYR A CZ   1  
ATOM   286   O  OH   . TYR A 1 20  ? 7.554   -1.269  10.023  1.00 0.00 ? 377 TYR A OH   1  
ATOM   287   H  H    . TYR A 1 20  ? 14.209  -4.726  13.694  1.00 0.00 ? 377 TYR A H    1  
ATOM   288   H  HA   . TYR A 1 20  ? 11.279  -4.638  13.380  1.00 0.00 ? 377 TYR A HA   1  
ATOM   289   H  HB2  . TYR A 1 20  ? 12.766  -2.519  12.910  1.00 0.00 ? 377 TYR A HB2  1  
ATOM   290   H  HB3  . TYR A 1 20  ? 13.111  -3.347  11.396  1.00 0.00 ? 377 TYR A HB3  1  
ATOM   291   H  HD1  . TYR A 1 20  ? 10.369  -1.979  13.482  1.00 0.00 ? 377 TYR A HD1  1  
ATOM   292   H  HD2  . TYR A 1 20  ? 11.548  -3.340  9.627   1.00 0.00 ? 377 TYR A HD2  1  
ATOM   293   H  HE1  . TYR A 1 20  ? 8.266   -1.119  12.542  1.00 0.00 ? 377 TYR A HE1  1  
ATOM   294   H  HE2  . TYR A 1 20  ? 9.449   -2.482  8.676   1.00 0.00 ? 377 TYR A HE2  1  
ATOM   295   H  HH   . TYR A 1 20  ? 6.820   -1.798  10.343  1.00 0.00 ? 377 TYR A HH   1  
ATOM   296   N  N    . PRO A 1 21  ? 11.183  -6.227  11.445  1.00 0.00 ? 378 PRO A N    1  
ATOM   297   C  CA   . PRO A 1 21  ? 11.110  -7.315  10.465  1.00 0.00 ? 378 PRO A CA   1  
ATOM   298   C  C    . PRO A 1 21  ? 11.560  -6.874  9.076   1.00 0.00 ? 378 PRO A C    1  
ATOM   299   O  O    . PRO A 1 21  ? 11.111  -5.851  8.562   1.00 0.00 ? 378 PRO A O    1  
ATOM   300   C  CB   . PRO A 1 21  ? 9.624   -7.682  10.453  1.00 0.00 ? 378 PRO A CB   1  
ATOM   301   C  CG   . PRO A 1 21  ? 8.924   -6.443  10.894  1.00 0.00 ? 378 PRO A CG   1  
ATOM   302   C  CD   . PRO A 1 21  ? 9.849   -5.769  11.868  1.00 0.00 ? 378 PRO A CD   1  
ATOM   303   H  HA   . PRO A 1 21  ? 11.691  -8.170  10.776  1.00 0.00 ? 378 PRO A HA   1  
ATOM   304   H  HB2  . PRO A 1 21  ? 9.329   -7.969  9.453   1.00 0.00 ? 378 PRO A HB2  1  
ATOM   305   H  HB3  . PRO A 1 21  ? 9.446   -8.500  11.135  1.00 0.00 ? 378 PRO A HB3  1  
ATOM   306   H  HG2  . PRO A 1 21  ? 8.742   -5.802  10.044  1.00 0.00 ? 378 PRO A HG2  1  
ATOM   307   H  HG3  . PRO A 1 21  ? 7.993   -6.700  11.378  1.00 0.00 ? 378 PRO A HG3  1  
ATOM   308   H  HD2  . PRO A 1 21  ? 9.767   -4.695  11.786  1.00 0.00 ? 378 PRO A HD2  1  
ATOM   309   H  HD3  . PRO A 1 21  ? 9.634   -6.090  12.877  1.00 0.00 ? 378 PRO A HD3  1  
ATOM   310   N  N    . GLY A 1 22  ? 12.451  -7.655  8.472   1.00 0.00 ? 379 GLY A N    1  
ATOM   311   C  CA   . GLY A 1 22  ? 12.948  -7.329  7.148   1.00 0.00 ? 379 GLY A CA   1  
ATOM   312   C  C    . GLY A 1 22  ? 14.160  -6.420  7.191   1.00 0.00 ? 379 GLY A C    1  
ATOM   313   O  O    . GLY A 1 22  ? 15.150  -6.661  6.500   1.00 0.00 ? 379 GLY A O    1  
ATOM   314   H  H    . GLY A 1 22  ? 12.775  -8.460  8.930   1.00 0.00 ? 379 GLY A H    1  
ATOM   315   H  HA2  . GLY A 1 22  ? 13.214  -8.244  6.640   1.00 0.00 ? 379 GLY A HA2  1  
ATOM   316   H  HA3  . GLY A 1 22  ? 12.162  -6.837  6.593   1.00 0.00 ? 379 GLY A HA3  1  
ATOM   317   N  N    . CYS A 1 23  ? 14.082  -5.371  8.003   1.00 0.00 ? 380 CYS A N    1  
ATOM   318   C  CA   . CYS A 1 23  ? 15.180  -4.420  8.132   1.00 0.00 ? 380 CYS A CA   1  
ATOM   319   C  C    . CYS A 1 23  ? 16.496  -5.143  8.401   1.00 0.00 ? 380 CYS A C    1  
ATOM   320   O  O    . CYS A 1 23  ? 16.546  -6.100  9.176   1.00 0.00 ? 380 CYS A O    1  
ATOM   321   C  CB   . CYS A 1 23  ? 14.891  -3.426  9.258   1.00 0.00 ? 380 CYS A CB   1  
ATOM   322   S  SG   . CYS A 1 23  ? 16.248  -2.253  9.581   1.00 0.00 ? 380 CYS A SG   1  
ATOM   323   H  H    . CYS A 1 23  ? 13.265  -5.232  8.528   1.00 0.00 ? 380 CYS A H    1  
ATOM   324   H  HA   . CYS A 1 23  ? 15.264  -3.881  7.200   1.00 0.00 ? 380 CYS A HA   1  
ATOM   325   H  HB2  . CYS A 1 23  ? 14.014  -2.850  9.003   1.00 0.00 ? 380 CYS A HB2  1  
ATOM   326   H  HB3  . CYS A 1 23  ? 14.704  -3.972  10.171  1.00 0.00 ? 380 CYS A HB3  1  
ATOM   327   N  N    . THR A 1 24  ? 17.563  -4.679  7.757   1.00 0.00 ? 381 THR A N    1  
ATOM   328   C  CA   . THR A 1 24  ? 18.879  -5.281  7.926   1.00 0.00 ? 381 THR A CA   1  
ATOM   329   C  C    . THR A 1 24  ? 19.921  -4.230  8.292   1.00 0.00 ? 381 THR A C    1  
ATOM   330   O  O    . THR A 1 24  ? 21.078  -4.317  7.878   1.00 0.00 ? 381 THR A O    1  
ATOM   331   C  CB   . THR A 1 24  ? 19.331  -6.012  6.647   1.00 0.00 ? 381 THR A CB   1  
ATOM   332   O  OG1  . THR A 1 24  ? 19.263  -5.124  5.526   1.00 0.00 ? 381 THR A OG1  1  
ATOM   333   C  CG2  . THR A 1 24  ? 18.463  -7.233  6.387   1.00 0.00 ? 381 THR A CG2  1  
ATOM   334   H  H    . THR A 1 24  ? 17.460  -3.914  7.153   1.00 0.00 ? 381 THR A H    1  
ATOM   335   H  HA   . THR A 1 24  ? 18.815  -6.005  8.725   1.00 0.00 ? 381 THR A HA   1  
ATOM   336   H  HB   . THR A 1 24  ? 20.353  -6.336  6.778   1.00 0.00 ? 381 THR A HB   1  
ATOM   337   H  HG1  . THR A 1 24  ? 20.147  -4.824  5.301   1.00 0.00 ? 381 THR A HG1  1  
ATOM   338   H  HG21 . THR A 1 24  ? 18.854  -8.076  6.936   1.00 0.00 ? 381 THR A HG21 1  
ATOM   339   H  HG22 . THR A 1 24  ? 18.467  -7.460  5.331   1.00 0.00 ? 381 THR A HG22 1  
ATOM   340   H  HG23 . THR A 1 24  ? 17.452  -7.031  6.707   1.00 0.00 ? 381 THR A HG23 1  
ATOM   341   N  N    . LYS A 1 25  ? 19.505  -3.238  9.071   1.00 0.00 ? 382 LYS A N    1  
ATOM   342   C  CA   . LYS A 1 25  ? 20.403  -2.170  9.496   1.00 0.00 ? 382 LYS A CA   1  
ATOM   343   C  C    . LYS A 1 25  ? 20.799  -2.342  10.959  1.00 0.00 ? 382 LYS A C    1  
ATOM   344   O  O    . LYS A 1 25  ? 19.960  -2.639  11.809  1.00 0.00 ? 382 LYS A O    1  
ATOM   345   C  CB   . LYS A 1 25  ? 19.738  -0.807  9.294   1.00 0.00 ? 382 LYS A CB   1  
ATOM   346   C  CG   . LYS A 1 25  ? 19.661  -0.377  7.839   1.00 0.00 ? 382 LYS A CG   1  
ATOM   347   C  CD   . LYS A 1 25  ? 20.995  0.154   7.343   1.00 0.00 ? 382 LYS A CD   1  
ATOM   348   C  CE   . LYS A 1 25  ? 20.839  0.922   6.039   1.00 0.00 ? 382 LYS A CE   1  
ATOM   349   N  NZ   . LYS A 1 25  ? 20.794  0.013   4.861   1.00 0.00 ? 382 LYS A NZ   1  
ATOM   350   H  H    . LYS A 1 25  ? 18.571  -3.224  9.369   1.00 0.00 ? 382 LYS A H    1  
ATOM   351   H  HA   . LYS A 1 25  ? 21.292  -2.222  8.886   1.00 0.00 ? 382 LYS A HA   1  
ATOM   352   H  HB2  . LYS A 1 25  ? 18.734  -0.847  9.689   1.00 0.00 ? 382 LYS A HB2  1  
ATOM   353   H  HB3  . LYS A 1 25  ? 20.300  -0.061  9.838   1.00 0.00 ? 382 LYS A HB3  1  
ATOM   354   H  HG2  . LYS A 1 25  ? 19.378  -1.228  7.236   1.00 0.00 ? 382 LYS A HG2  1  
ATOM   355   H  HG3  . LYS A 1 25  ? 18.916  0.399   7.741   1.00 0.00 ? 382 LYS A HG3  1  
ATOM   356   H  HD2  . LYS A 1 25  ? 21.410  0.814   8.089   1.00 0.00 ? 382 LYS A HD2  1  
ATOM   357   H  HD3  . LYS A 1 25  ? 21.667  -0.678  7.182   1.00 0.00 ? 382 LYS A HD3  1  
ATOM   358   H  HE2  . LYS A 1 25  ? 19.923  1.491   6.080   1.00 0.00 ? 382 LYS A HE2  1  
ATOM   359   H  HE3  . LYS A 1 25  ? 21.677  1.596   5.932   1.00 0.00 ? 382 LYS A HE3  1  
ATOM   360   H  HZ1  . LYS A 1 25  ? 20.956  0.552   3.987   1.00 0.00 ? 382 LYS A HZ1  1  
ATOM   361   H  HZ2  . LYS A 1 25  ? 19.865  -0.450  4.803   1.00 0.00 ? 382 LYS A HZ2  1  
ATOM   362   H  HZ3  . LYS A 1 25  ? 21.528  -0.718  4.946   1.00 0.00 ? 382 LYS A HZ3  1  
ATOM   363   N  N    . VAL A 1 26  ? 22.083  -2.152  11.246  1.00 0.00 ? 383 VAL A N    1  
ATOM   364   C  CA   . VAL A 1 26  ? 22.590  -2.284  12.606  1.00 0.00 ? 383 VAL A CA   1  
ATOM   365   C  C    . VAL A 1 26  ? 23.512  -1.123  12.964  1.00 0.00 ? 383 VAL A C    1  
ATOM   366   O  O    . VAL A 1 26  ? 24.015  -0.422  12.085  1.00 0.00 ? 383 VAL A O    1  
ATOM   367   C  CB   . VAL A 1 26  ? 23.354  -3.608  12.795  1.00 0.00 ? 383 VAL A CB   1  
ATOM   368   C  CG1  . VAL A 1 26  ? 22.437  -4.794  12.540  1.00 0.00 ? 383 VAL A CG1  1  
ATOM   369   C  CG2  . VAL A 1 26  ? 24.569  -3.657  11.881  1.00 0.00 ? 383 VAL A CG2  1  
ATOM   370   H  H    . VAL A 1 26  ? 22.704  -1.917  10.525  1.00 0.00 ? 383 VAL A H    1  
ATOM   371   H  HA   . VAL A 1 26  ? 21.745  -2.281  13.279  1.00 0.00 ? 383 VAL A HA   1  
ATOM   372   H  HB   . VAL A 1 26  ? 23.697  -3.660  13.818  1.00 0.00 ? 383 VAL A HB   1  
ATOM   373   H  HG11 . VAL A 1 26  ? 21.582  -4.471  11.965  1.00 0.00 ? 383 VAL A HG11 1  
ATOM   374   H  HG12 . VAL A 1 26  ? 22.974  -5.554  11.991  1.00 0.00 ? 383 VAL A HG12 1  
ATOM   375   H  HG13 . VAL A 1 26  ? 22.103  -5.200  13.484  1.00 0.00 ? 383 VAL A HG13 1  
ATOM   376   H  HG21 . VAL A 1 26  ? 24.702  -4.663  11.512  1.00 0.00 ? 383 VAL A HG21 1  
ATOM   377   H  HG22 . VAL A 1 26  ? 24.420  -2.984  11.049  1.00 0.00 ? 383 VAL A HG22 1  
ATOM   378   H  HG23 . VAL A 1 26  ? 25.448  -3.357  12.433  1.00 0.00 ? 383 VAL A HG23 1  
ATOM   379   N  N    . TYR A 1 27  ? 23.729  -0.926  14.259  1.00 0.00 ? 384 TYR A N    1  
ATOM   380   C  CA   . TYR A 1 27  ? 24.589  0.152   14.734  1.00 0.00 ? 384 TYR A CA   1  
ATOM   381   C  C    . TYR A 1 27  ? 25.101  -0.140  16.142  1.00 0.00 ? 384 TYR A C    1  
ATOM   382   O  O    . TYR A 1 27  ? 24.363  -0.634  16.995  1.00 0.00 ? 384 TYR A O    1  
ATOM   383   C  CB   . TYR A 1 27  ? 23.832  1.481   14.720  1.00 0.00 ? 384 TYR A CB   1  
ATOM   384   C  CG   . TYR A 1 27  ? 23.140  1.769   13.408  1.00 0.00 ? 384 TYR A CG   1  
ATOM   385   C  CD1  . TYR A 1 27  ? 21.875  1.259   13.140  1.00 0.00 ? 384 TYR A CD1  1  
ATOM   386   C  CD2  . TYR A 1 27  ? 23.750  2.551   12.434  1.00 0.00 ? 384 TYR A CD2  1  
ATOM   387   C  CE1  . TYR A 1 27  ? 21.239  1.519   11.942  1.00 0.00 ? 384 TYR A CE1  1  
ATOM   388   C  CE2  . TYR A 1 27  ? 23.120  2.818   11.234  1.00 0.00 ? 384 TYR A CE2  1  
ATOM   389   C  CZ   . TYR A 1 27  ? 21.865  2.299   10.992  1.00 0.00 ? 384 TYR A CZ   1  
ATOM   390   O  OH   . TYR A 1 27  ? 21.235  2.561   9.797   1.00 0.00 ? 384 TYR A OH   1  
ATOM   391   H  H    . TYR A 1 27  ? 23.301  -1.517  14.912  1.00 0.00 ? 384 TYR A H    1  
ATOM   392   H  HA   . TYR A 1 27  ? 25.433  0.223   14.064  1.00 0.00 ? 384 TYR A HA   1  
ATOM   393   H  HB2  . TYR A 1 27  ? 23.081  1.468   15.495  1.00 0.00 ? 384 TYR A HB2  1  
ATOM   394   H  HB3  . TYR A 1 27  ? 24.527  2.285   14.913  1.00 0.00 ? 384 TYR A HB3  1  
ATOM   395   H  HD1  . TYR A 1 27  ? 21.387  0.648   13.886  1.00 0.00 ? 384 TYR A HD1  1  
ATOM   396   H  HD2  . TYR A 1 27  ? 24.733  2.955   12.627  1.00 0.00 ? 384 TYR A HD2  1  
ATOM   397   H  HE1  . TYR A 1 27  ? 20.256  1.114   11.752  1.00 0.00 ? 384 TYR A HE1  1  
ATOM   398   H  HE2  . TYR A 1 27  ? 23.611  3.428   10.490  1.00 0.00 ? 384 TYR A HE2  1  
ATOM   399   H  HH   . TYR A 1 27  ? 21.746  3.205   9.301   1.00 0.00 ? 384 TYR A HH   1  
ATOM   400   N  N    . THR A 1 28  ? 26.372  0.170   16.378  1.00 0.00 ? 385 THR A N    1  
ATOM   401   C  CA   . THR A 1 28  ? 26.985  -0.058  17.681  1.00 0.00 ? 385 THR A CA   1  
ATOM   402   C  C    . THR A 1 28  ? 26.729  1.114   18.622  1.00 0.00 ? 385 THR A C    1  
ATOM   403   O  O    . THR A 1 28  ? 27.579  1.463   19.441  1.00 0.00 ? 385 THR A O    1  
ATOM   404   C  CB   . THR A 1 28  ? 28.504  -0.279  17.556  1.00 0.00 ? 385 THR A CB   1  
ATOM   405   O  OG1  . THR A 1 28  ? 29.083  0.747   16.742  1.00 0.00 ? 385 THR A OG1  1  
ATOM   406   C  CG2  . THR A 1 28  ? 28.805  -1.642  16.952  1.00 0.00 ? 385 THR A CG2  1  
ATOM   407   H  H    . THR A 1 28  ? 26.910  0.561   15.658  1.00 0.00 ? 385 THR A H    1  
ATOM   408   H  HA   . THR A 1 28  ? 26.546  -0.950  18.104  1.00 0.00 ? 385 THR A HA   1  
ATOM   409   H  HB   . THR A 1 28  ? 28.942  -0.234  18.543  1.00 0.00 ? 385 THR A HB   1  
ATOM   410   H  HG1  . THR A 1 28  ? 29.097  0.459   15.826  1.00 0.00 ? 385 THR A HG1  1  
ATOM   411   H  HG21 . THR A 1 28  ? 28.974  -2.357  17.744  1.00 0.00 ? 385 THR A HG21 1  
ATOM   412   H  HG22 . THR A 1 28  ? 29.687  -1.576  16.333  1.00 0.00 ? 385 THR A HG22 1  
ATOM   413   H  HG23 . THR A 1 28  ? 27.967  -1.963  16.351  1.00 0.00 ? 385 THR A HG23 1  
ATOM   414   N  N    . LYS A 1 29  ? 25.552  1.717   18.501  1.00 0.00 ? 386 LYS A N    1  
ATOM   415   C  CA   . LYS A 1 29  ? 25.182  2.850   19.342  1.00 0.00 ? 386 LYS A CA   1  
ATOM   416   C  C    . LYS A 1 29  ? 23.699  2.803   19.695  1.00 0.00 ? 386 LYS A C    1  
ATOM   417   O  O    . LYS A 1 29  ? 22.866  2.425   18.871  1.00 0.00 ? 386 LYS A O    1  
ATOM   418   C  CB   . LYS A 1 29  ? 25.506  4.166   18.632  1.00 0.00 ? 386 LYS A CB   1  
ATOM   419   C  CG   . LYS A 1 29  ? 26.938  4.630   18.838  1.00 0.00 ? 386 LYS A CG   1  
ATOM   420   C  CD   . LYS A 1 29  ? 27.145  6.045   18.323  1.00 0.00 ? 386 LYS A CD   1  
ATOM   421   C  CE   . LYS A 1 29  ? 28.230  6.769   19.104  1.00 0.00 ? 386 LYS A CE   1  
ATOM   422   N  NZ   . LYS A 1 29  ? 27.684  7.456   20.307  1.00 0.00 ? 386 LYS A NZ   1  
ATOM   423   H  H    . LYS A 1 29  ? 24.915  1.393   17.829  1.00 0.00 ? 386 LYS A H    1  
ATOM   424   H  HA   . LYS A 1 29  ? 25.758  2.789   20.252  1.00 0.00 ? 386 LYS A HA   1  
ATOM   425   H  HB2  . LYS A 1 29  ? 25.339  4.041   17.573  1.00 0.00 ? 386 LYS A HB2  1  
ATOM   426   H  HB3  . LYS A 1 29  ? 24.844  4.935   19.005  1.00 0.00 ? 386 LYS A HB3  1  
ATOM   427   H  HG2  . LYS A 1 29  ? 27.167  4.606   19.893  1.00 0.00 ? 386 LYS A HG2  1  
ATOM   428   H  HG3  . LYS A 1 29  ? 27.603  3.963   18.307  1.00 0.00 ? 386 LYS A HG3  1  
ATOM   429   H  HD2  . LYS A 1 29  ? 27.433  6.002   17.283  1.00 0.00 ? 386 LYS A HD2  1  
ATOM   430   H  HD3  . LYS A 1 29  ? 26.218  6.593   18.419  1.00 0.00 ? 386 LYS A HD3  1  
ATOM   431   H  HE2  . LYS A 1 29  ? 28.972  6.050   19.416  1.00 0.00 ? 386 LYS A HE2  1  
ATOM   432   H  HE3  . LYS A 1 29  ? 28.690  7.503   18.459  1.00 0.00 ? 386 LYS A HE3  1  
ATOM   433   H  HZ1  . LYS A 1 29  ? 26.709  7.770   20.128  1.00 0.00 ? 386 LYS A HZ1  1  
ATOM   434   H  HZ2  . LYS A 1 29  ? 28.267  8.285   20.540  1.00 0.00 ? 386 LYS A HZ2  1  
ATOM   435   H  HZ3  . LYS A 1 29  ? 27.684  6.807   21.120  1.00 0.00 ? 386 LYS A HZ3  1  
ATOM   436   N  N    . SER A 1 30  ? 23.375  3.191   20.925  1.00 0.00 ? 387 SER A N    1  
ATOM   437   C  CA   . SER A 1 30  ? 21.993  3.191   21.388  1.00 0.00 ? 387 SER A CA   1  
ATOM   438   C  C    . SER A 1 30  ? 21.284  4.480   20.982  1.00 0.00 ? 387 SER A C    1  
ATOM   439   O  O    . SER A 1 30  ? 20.056  4.530   20.910  1.00 0.00 ? 387 SER A O    1  
ATOM   440   C  CB   . SER A 1 30  ? 21.941  3.024   22.908  1.00 0.00 ? 387 SER A CB   1  
ATOM   441   O  OG   . SER A 1 30  ? 22.776  3.970   23.553  1.00 0.00 ? 387 SER A OG   1  
ATOM   442   H  H    . SER A 1 30  ? 24.085  3.482   21.536  1.00 0.00 ? 387 SER A H    1  
ATOM   443   H  HA   . SER A 1 30  ? 21.488  2.356   20.925  1.00 0.00 ? 387 SER A HA   1  
ATOM   444   H  HB2  . SER A 1 30  ? 20.927  3.165   23.249  1.00 0.00 ? 387 SER A HB2  1  
ATOM   445   H  HB3  . SER A 1 30  ? 22.275  2.030   23.169  1.00 0.00 ? 387 SER A HB3  1  
ATOM   446   H  HG   . SER A 1 30  ? 22.873  4.745   22.995  1.00 0.00 ? 387 SER A HG   1  
ATOM   447   N  N    . SER A 1 31  ? 22.068  5.521   20.719  1.00 0.00 ? 388 SER A N    1  
ATOM   448   C  CA   . SER A 1 31  ? 21.516  6.812   20.324  1.00 0.00 ? 388 SER A CA   1  
ATOM   449   C  C    . SER A 1 31  ? 21.240  6.849   18.824  1.00 0.00 ? 388 SER A C    1  
ATOM   450   O  O    . SER A 1 31  ? 20.202  7.346   18.385  1.00 0.00 ? 388 SER A O    1  
ATOM   451   C  CB   . SER A 1 31  ? 22.479  7.939   20.705  1.00 0.00 ? 388 SER A CB   1  
ATOM   452   O  OG   . SER A 1 31  ? 23.750  7.746   20.109  1.00 0.00 ? 388 SER A OG   1  
ATOM   453   H  H    . SER A 1 31  ? 23.040  5.418   20.794  1.00 0.00 ? 388 SER A H    1  
ATOM   454   H  HA   . SER A 1 31  ? 20.586  6.951   20.854  1.00 0.00 ? 388 SER A HA   1  
ATOM   455   H  HB2  . SER A 1 31  ? 22.076  8.882   20.368  1.00 0.00 ? 388 SER A HB2  1  
ATOM   456   H  HB3  . SER A 1 31  ? 22.597  7.960   21.778  1.00 0.00 ? 388 SER A HB3  1  
ATOM   457   H  HG   . SER A 1 31  ? 24.053  8.573   19.726  1.00 0.00 ? 388 SER A HG   1  
ATOM   458   N  N    . HIS A 1 32  ? 22.175  6.319   18.043  1.00 0.00 ? 389 HIS A N    1  
ATOM   459   C  CA   . HIS A 1 32  ? 22.033  6.290   16.592  1.00 0.00 ? 389 HIS A CA   1  
ATOM   460   C  C    . HIS A 1 32  ? 20.861  5.406   16.178  1.00 0.00 ? 389 HIS A C    1  
ATOM   461   O  O    . HIS A 1 32  ? 20.107  5.743   15.264  1.00 0.00 ? 389 HIS A O    1  
ATOM   462   C  CB   . HIS A 1 32  ? 23.322  5.785   15.942  1.00 0.00 ? 389 HIS A CB   1  
ATOM   463   C  CG   . HIS A 1 32  ? 24.354  6.853   15.751  1.00 0.00 ? 389 HIS A CG   1  
ATOM   464   N  ND1  . HIS A 1 32  ? 25.678  6.580   15.478  1.00 0.00 ? 389 HIS A ND1  1  
ATOM   465   C  CD2  . HIS A 1 32  ? 24.251  8.202   15.792  1.00 0.00 ? 389 HIS A CD2  1  
ATOM   466   C  CE1  . HIS A 1 32  ? 26.345  7.714   15.363  1.00 0.00 ? 389 HIS A CE1  1  
ATOM   467   N  NE2  . HIS A 1 32  ? 25.502  8.714   15.548  1.00 0.00 ? 389 HIS A NE2  1  
ATOM   468   H  H    . HIS A 1 32  ? 22.980  5.938   18.452  1.00 0.00 ? 389 HIS A H    1  
ATOM   469   H  HA   . HIS A 1 32  ? 21.843  7.298   16.257  1.00 0.00 ? 389 HIS A HA   1  
ATOM   470   H  HB2  . HIS A 1 32  ? 23.753  5.015   16.564  1.00 0.00 ? 389 HIS A HB2  1  
ATOM   471   H  HB3  . HIS A 1 32  ? 23.089  5.370   14.972  1.00 0.00 ? 389 HIS A HB3  1  
ATOM   472   H  HD1  . HIS A 1 32  ? 26.071  5.687   15.386  1.00 0.00 ? 389 HIS A HD1  1  
ATOM   473   H  HD2  . HIS A 1 32  ? 23.352  8.771   15.983  1.00 0.00 ? 389 HIS A HD2  1  
ATOM   474   H  HE1  . HIS A 1 32  ? 27.400  7.809   15.152  1.00 0.00 ? 389 HIS A HE1  1  
ATOM   475   N  N    . LEU A 1 33  ? 20.712  4.273   16.856  1.00 0.00 ? 390 LEU A N    1  
ATOM   476   C  CA   . LEU A 1 33  ? 19.632  3.339   16.559  1.00 0.00 ? 390 LEU A CA   1  
ATOM   477   C  C    . LEU A 1 33  ? 18.272  4.010   16.725  1.00 0.00 ? 390 LEU A C    1  
ATOM   478   O  O    . LEU A 1 33  ? 17.462  4.034   15.798  1.00 0.00 ? 390 LEU A O    1  
ATOM   479   C  CB   . LEU A 1 33  ? 19.724  2.115   17.471  1.00 0.00 ? 390 LEU A CB   1  
ATOM   480   C  CG   . LEU A 1 33  ? 18.499  1.200   17.492  1.00 0.00 ? 390 LEU A CG   1  
ATOM   481   C  CD1  . LEU A 1 33  ? 18.332  0.500   16.152  1.00 0.00 ? 390 LEU A CD1  1  
ATOM   482   C  CD2  . LEU A 1 33  ? 18.613  0.181   18.617  1.00 0.00 ? 390 LEU A CD2  1  
ATOM   483   H  H    . LEU A 1 33  ? 21.344  4.059   17.574  1.00 0.00 ? 390 LEU A H    1  
ATOM   484   H  HA   . LEU A 1 33  ? 19.740  3.023   15.532  1.00 0.00 ? 390 LEU A HA   1  
ATOM   485   H  HB2  . LEU A 1 33  ? 20.570  1.527   17.150  1.00 0.00 ? 390 LEU A HB2  1  
ATOM   486   H  HB3  . LEU A 1 33  ? 19.893  2.466   18.479  1.00 0.00 ? 390 LEU A HB3  1  
ATOM   487   H  HG   . LEU A 1 33  ? 17.615  1.797   17.669  1.00 0.00 ? 390 LEU A HG   1  
ATOM   488   H  HD11 . LEU A 1 33  ? 18.193  1.237   15.376  1.00 0.00 ? 390 LEU A HD11 1  
ATOM   489   H  HD12 . LEU A 1 33  ? 17.470  -0.150  16.190  1.00 0.00 ? 390 LEU A HD12 1  
ATOM   490   H  HD13 . LEU A 1 33  ? 19.215  -0.086  15.940  1.00 0.00 ? 390 LEU A HD13 1  
ATOM   491   H  HD21 . LEU A 1 33  ? 19.277  -0.615  18.316  1.00 0.00 ? 390 LEU A HD21 1  
ATOM   492   H  HD22 . LEU A 1 33  ? 17.637  -0.225  18.834  1.00 0.00 ? 390 LEU A HD22 1  
ATOM   493   H  HD23 . LEU A 1 33  ? 19.007  0.664   19.501  1.00 0.00 ? 390 LEU A HD23 1  
ATOM   494   N  N    . LYS A 1 34  ? 18.028  4.555   17.912  1.00 0.00 ? 391 LYS A N    1  
ATOM   495   C  CA   . LYS A 1 34  ? 16.767  5.230   18.200  1.00 0.00 ? 391 LYS A CA   1  
ATOM   496   C  C    . LYS A 1 34  ? 16.386  6.177   17.067  1.00 0.00 ? 391 LYS A C    1  
ATOM   497   O  O    . LYS A 1 34  ? 15.221  6.257   16.678  1.00 0.00 ? 391 LYS A O    1  
ATOM   498   C  CB   . LYS A 1 34  ? 16.870  6.006   19.515  1.00 0.00 ? 391 LYS A CB   1  
ATOM   499   C  CG   . LYS A 1 34  ? 16.722  5.133   20.749  1.00 0.00 ? 391 LYS A CG   1  
ATOM   500   C  CD   . LYS A 1 34  ? 17.228  5.840   21.995  1.00 0.00 ? 391 LYS A CD   1  
ATOM   501   C  CE   . LYS A 1 34  ? 17.027  4.988   23.240  1.00 0.00 ? 391 LYS A CE   1  
ATOM   502   N  NZ   . LYS A 1 34  ? 16.992  5.815   24.478  1.00 0.00 ? 391 LYS A NZ   1  
ATOM   503   H  H    . LYS A 1 34  ? 18.713  4.503   18.611  1.00 0.00 ? 391 LYS A H    1  
ATOM   504   H  HA   . LYS A 1 34  ? 16.001  4.475   18.296  1.00 0.00 ? 391 LYS A HA   1  
ATOM   505   H  HB2  . LYS A 1 34  ? 17.832  6.493   19.557  1.00 0.00 ? 391 LYS A HB2  1  
ATOM   506   H  HB3  . LYS A 1 34  ? 16.094  6.758   19.536  1.00 0.00 ? 391 LYS A HB3  1  
ATOM   507   H  HG2  . LYS A 1 34  ? 15.679  4.890   20.885  1.00 0.00 ? 391 LYS A HG2  1  
ATOM   508   H  HG3  . LYS A 1 34  ? 17.289  4.224   20.606  1.00 0.00 ? 391 LYS A HG3  1  
ATOM   509   H  HD2  . LYS A 1 34  ? 18.282  6.045   21.880  1.00 0.00 ? 391 LYS A HD2  1  
ATOM   510   H  HD3  . LYS A 1 34  ? 16.690  6.770   22.115  1.00 0.00 ? 391 LYS A HD3  1  
ATOM   511   H  HE2  . LYS A 1 34  ? 16.094  4.454   23.147  1.00 0.00 ? 391 LYS A HE2  1  
ATOM   512   H  HE3  . LYS A 1 34  ? 17.840  4.282   23.312  1.00 0.00 ? 391 LYS A HE3  1  
ATOM   513   H  HZ1  . LYS A 1 34  ? 16.042  6.216   24.613  1.00 0.00 ? 391 LYS A HZ1  1  
ATOM   514   H  HZ2  . LYS A 1 34  ? 17.678  6.593   24.407  1.00 0.00 ? 391 LYS A HZ2  1  
ATOM   515   H  HZ3  . LYS A 1 34  ? 17.231  5.231   25.304  1.00 0.00 ? 391 LYS A HZ3  1  
ATOM   516   N  N    . ALA A 1 35  ? 17.375  6.891   16.540  1.00 0.00 ? 392 ALA A N    1  
ATOM   517   C  CA   . ALA A 1 35  ? 17.143  7.829   15.449  1.00 0.00 ? 392 ALA A CA   1  
ATOM   518   C  C    . ALA A 1 35  ? 16.690  7.103   14.187  1.00 0.00 ? 392 ALA A C    1  
ATOM   519   O  O    . ALA A 1 35  ? 15.845  7.601   13.442  1.00 0.00 ? 392 ALA A O    1  
ATOM   520   C  CB   . ALA A 1 35  ? 18.402  8.638   15.171  1.00 0.00 ? 392 ALA A CB   1  
ATOM   521   H  H    . ALA A 1 35  ? 18.283  6.783   16.892  1.00 0.00 ? 392 ALA A H    1  
ATOM   522   H  HA   . ALA A 1 35  ? 16.366  8.514   15.757  1.00 0.00 ? 392 ALA A HA   1  
ATOM   523   H  HB1  . ALA A 1 35  ? 19.086  8.534   16.000  1.00 0.00 ? 392 ALA A HB1  1  
ATOM   524   H  HB2  . ALA A 1 35  ? 18.871  8.273   14.269  1.00 0.00 ? 392 ALA A HB2  1  
ATOM   525   H  HB3  . ALA A 1 35  ? 18.142  9.678   15.047  1.00 0.00 ? 392 ALA A HB3  1  
ATOM   526   N  N    . HIS A 1 36  ? 17.255  5.923   13.953  1.00 0.00 ? 393 HIS A N    1  
ATOM   527   C  CA   . HIS A 1 36  ? 16.909  5.128   12.780  1.00 0.00 ? 393 HIS A CA   1  
ATOM   528   C  C    . HIS A 1 36  ? 15.473  4.619   12.874  1.00 0.00 ? 393 HIS A C    1  
ATOM   529   O  O    . HIS A 1 36  ? 14.693  4.753   11.931  1.00 0.00 ? 393 HIS A O    1  
ATOM   530   C  CB   . HIS A 1 36  ? 17.872  3.950   12.634  1.00 0.00 ? 393 HIS A CB   1  
ATOM   531   C  CG   . HIS A 1 36  ? 17.294  2.796   11.874  1.00 0.00 ? 393 HIS A CG   1  
ATOM   532   N  ND1  . HIS A 1 36  ? 17.130  2.802   10.505  1.00 0.00 ? 393 HIS A ND1  1  
ATOM   533   C  CD2  . HIS A 1 36  ? 16.843  1.593   12.299  1.00 0.00 ? 393 HIS A CD2  1  
ATOM   534   C  CE1  . HIS A 1 36  ? 16.602  1.654   10.121  1.00 0.00 ? 393 HIS A CE1  1  
ATOM   535   N  NE2  . HIS A 1 36  ? 16.418  0.902   11.191  1.00 0.00 ? 393 HIS A NE2  1  
ATOM   536   H  H    . HIS A 1 36  ? 17.921  5.579   14.584  1.00 0.00 ? 393 HIS A H    1  
ATOM   537   H  HA   . HIS A 1 36  ? 16.996  5.763   11.912  1.00 0.00 ? 393 HIS A HA   1  
ATOM   538   H  HB2  . HIS A 1 36  ? 18.758  4.280   12.112  1.00 0.00 ? 393 HIS A HB2  1  
ATOM   539   H  HB3  . HIS A 1 36  ? 18.150  3.596   13.616  1.00 0.00 ? 393 HIS A HB3  1  
ATOM   540   H  HD1  . HIS A 1 36  ? 17.365  3.540   9.904   1.00 0.00 ? 393 HIS A HD1  1  
ATOM   541   H  HD2  . HIS A 1 36  ? 16.821  1.240   13.321  1.00 0.00 ? 393 HIS A HD2  1  
ATOM   542   H  HE1  . HIS A 1 36  ? 16.361  1.377   9.106   1.00 0.00 ? 393 HIS A HE1  1  
ATOM   543   N  N    . LEU A 1 37  ? 15.132  4.034   14.017  1.00 0.00 ? 394 LEU A N    1  
ATOM   544   C  CA   . LEU A 1 37  ? 13.791  3.504   14.234  1.00 0.00 ? 394 LEU A CA   1  
ATOM   545   C  C    . LEU A 1 37  ? 12.730  4.526   13.837  1.00 0.00 ? 394 LEU A C    1  
ATOM   546   O  O    . LEU A 1 37  ? 11.674  4.168   13.316  1.00 0.00 ? 394 LEU A O    1  
ATOM   547   C  CB   . LEU A 1 37  ? 13.609  3.108   15.701  1.00 0.00 ? 394 LEU A CB   1  
ATOM   548   C  CG   . LEU A 1 37  ? 14.115  1.718   16.088  1.00 0.00 ? 394 LEU A CG   1  
ATOM   549   C  CD1  . LEU A 1 37  ? 14.486  1.676   17.562  1.00 0.00 ? 394 LEU A CD1  1  
ATOM   550   C  CD2  . LEU A 1 37  ? 13.067  0.661   15.770  1.00 0.00 ? 394 LEU A CD2  1  
ATOM   551   H  H    . LEU A 1 37  ? 15.797  3.957   14.732  1.00 0.00 ? 394 LEU A H    1  
ATOM   552   H  HA   . LEU A 1 37  ? 13.677  2.626   13.616  1.00 0.00 ? 394 LEU A HA   1  
ATOM   553   H  HB2  . LEU A 1 37  ? 14.133  3.831   16.306  1.00 0.00 ? 394 LEU A HB2  1  
ATOM   554   H  HB3  . LEU A 1 37  ? 12.552  3.151   15.925  1.00 0.00 ? 394 LEU A HB3  1  
ATOM   555   H  HG   . LEU A 1 37  ? 15.003  1.492   15.514  1.00 0.00 ? 394 LEU A HG   1  
ATOM   556   H  HD11 . LEU A 1 37  ? 15.278  0.959   17.714  1.00 0.00 ? 394 LEU A HD11 1  
ATOM   557   H  HD12 . LEU A 1 37  ? 13.622  1.387   18.142  1.00 0.00 ? 394 LEU A HD12 1  
ATOM   558   H  HD13 . LEU A 1 37  ? 14.819  2.654   17.877  1.00 0.00 ? 394 LEU A HD13 1  
ATOM   559   H  HD21 . LEU A 1 37  ? 12.270  1.106   15.193  1.00 0.00 ? 394 LEU A HD21 1  
ATOM   560   H  HD22 . LEU A 1 37  ? 12.666  0.263   16.691  1.00 0.00 ? 394 LEU A HD22 1  
ATOM   561   H  HD23 . LEU A 1 37  ? 13.522  -0.137  15.201  1.00 0.00 ? 394 LEU A HD23 1  
ATOM   562   N  N    . ARG A 1 38  ? 13.020  5.799   14.084  1.00 0.00 ? 395 ARG A N    1  
ATOM   563   C  CA   . ARG A 1 38  ? 12.092  6.873   13.751  1.00 0.00 ? 395 ARG A CA   1  
ATOM   564   C  C    . ARG A 1 38  ? 11.498  6.666   12.361  1.00 0.00 ? 395 ARG A C    1  
ATOM   565   O  O    . ARG A 1 38  ? 10.353  7.039   12.101  1.00 0.00 ? 395 ARG A O    1  
ATOM   566   C  CB   . ARG A 1 38  ? 12.800  8.227   13.819  1.00 0.00 ? 395 ARG A CB   1  
ATOM   567   C  CG   . ARG A 1 38  ? 13.207  8.632   15.226  1.00 0.00 ? 395 ARG A CG   1  
ATOM   568   C  CD   . ARG A 1 38  ? 13.895  9.988   15.238  1.00 0.00 ? 395 ARG A CD   1  
ATOM   569   N  NE   . ARG A 1 38  ? 14.370  10.349  16.572  1.00 0.00 ? 395 ARG A NE   1  
ATOM   570   C  CZ   . ARG A 1 38  ? 14.755  11.575  16.908  1.00 0.00 ? 395 ARG A CZ   1  
ATOM   571   N  NH1  . ARG A 1 38  ? 14.721  12.552  16.013  1.00 0.00 ? 395 ARG A NH1  1  
ATOM   572   N  NH2  . ARG A 1 38  ? 15.175  11.825  18.142  1.00 0.00 ? 395 ARG A NH2  1  
ATOM   573   H  H    . ARG A 1 38  ? 13.879  6.022   14.502  1.00 0.00 ? 395 ARG A H    1  
ATOM   574   H  HA   . ARG A 1 38  ? 11.293  6.858   14.477  1.00 0.00 ? 395 ARG A HA   1  
ATOM   575   H  HB2  . ARG A 1 38  ? 13.690  8.186   13.208  1.00 0.00 ? 395 ARG A HB2  1  
ATOM   576   H  HB3  . ARG A 1 38  ? 12.139  8.985   13.426  1.00 0.00 ? 395 ARG A HB3  1  
ATOM   577   H  HG2  . ARG A 1 38  ? 12.324  8.684   15.845  1.00 0.00 ? 395 ARG A HG2  1  
ATOM   578   H  HG3  . ARG A 1 38  ? 13.884  7.890   15.622  1.00 0.00 ? 395 ARG A HG3  1  
ATOM   579   H  HD2  . ARG A 1 38  ? 14.738  9.955   14.564  1.00 0.00 ? 395 ARG A HD2  1  
ATOM   580   H  HD3  . ARG A 1 38  ? 13.193  10.736  14.902  1.00 0.00 ? 395 ARG A HD3  1  
ATOM   581   H  HE   . ARG A 1 38  ? 14.403  9.641   17.249  1.00 0.00 ? 395 ARG A HE   1  
ATOM   582   H  HH11 . ARG A 1 38  ? 14.405  12.367  15.083  1.00 0.00 ? 395 ARG A HH11 1  
ATOM   583   H  HH12 . ARG A 1 38  ? 15.011  13.475  16.269  1.00 0.00 ? 395 ARG A HH12 1  
ATOM   584   H  HH21 . ARG A 1 38  ? 15.201  11.090  18.819  1.00 0.00 ? 395 ARG A HH21 1  
ATOM   585   H  HH22 . ARG A 1 38  ? 15.464  12.747  18.394  1.00 0.00 ? 395 ARG A HH22 1  
ATOM   586   N  N    . THR A 1 39  ? 12.284  6.070   11.470  1.00 0.00 ? 396 THR A N    1  
ATOM   587   C  CA   . THR A 1 39  ? 11.837  5.815   10.106  1.00 0.00 ? 396 THR A CA   1  
ATOM   588   C  C    . THR A 1 39  ? 10.749  4.749   10.074  1.00 0.00 ? 396 THR A C    1  
ATOM   589   O  O    . THR A 1 39  ? 9.773   4.865   9.332   1.00 0.00 ? 396 THR A O    1  
ATOM   590   C  CB   . THR A 1 39  ? 13.005  5.368   9.207   1.00 0.00 ? 396 THR A CB   1  
ATOM   591   O  OG1  . THR A 1 39  ? 13.584  4.163   9.719   1.00 0.00 ? 396 THR A OG1  1  
ATOM   592   C  CG2  . THR A 1 39  ? 14.069  6.452   9.122   1.00 0.00 ? 396 THR A CG2  1  
ATOM   593   H  H    . THR A 1 39  ? 13.186  5.796   11.737  1.00 0.00 ? 396 THR A H    1  
ATOM   594   H  HA   . THR A 1 39  ? 11.437  6.737   9.708   1.00 0.00 ? 396 THR A HA   1  
ATOM   595   H  HB   . THR A 1 39  ? 12.623  5.180   8.213   1.00 0.00 ? 396 THR A HB   1  
ATOM   596   H  HG1  . THR A 1 39  ? 13.242  3.410   9.231   1.00 0.00 ? 396 THR A HG1  1  
ATOM   597   H  HG21 . THR A 1 39  ? 13.593  7.418   9.059   1.00 0.00 ? 396 THR A HG21 1  
ATOM   598   H  HG22 . THR A 1 39  ? 14.676  6.292   8.243   1.00 0.00 ? 396 THR A HG22 1  
ATOM   599   H  HG23 . THR A 1 39  ? 14.692  6.414   10.002  1.00 0.00 ? 396 THR A HG23 1  
ATOM   600   N  N    . HIS A 1 40  ? 10.921  3.709   10.884  1.00 0.00 ? 397 HIS A N    1  
ATOM   601   C  CA   . HIS A 1 40  ? 9.952   2.621   10.949  1.00 0.00 ? 397 HIS A CA   1  
ATOM   602   C  C    . HIS A 1 40  ? 8.642   3.097   11.571  1.00 0.00 ? 397 HIS A C    1  
ATOM   603   O  O    . HIS A 1 40  ? 7.557   2.744   11.106  1.00 0.00 ? 397 HIS A O    1  
ATOM   604   C  CB   . HIS A 1 40  ? 10.518  1.453   11.757  1.00 0.00 ? 397 HIS A CB   1  
ATOM   605   C  CG   . HIS A 1 40  ? 11.636  0.734   11.067  1.00 0.00 ? 397 HIS A CG   1  
ATOM   606   N  ND1  . HIS A 1 40  ? 11.566  0.316   9.755   1.00 0.00 ? 397 HIS A ND1  1  
ATOM   607   C  CD2  . HIS A 1 40  ? 12.858  0.362   11.515  1.00 0.00 ? 397 HIS A CD2  1  
ATOM   608   C  CE1  . HIS A 1 40  ? 12.696  -0.285  9.426   1.00 0.00 ? 397 HIS A CE1  1  
ATOM   609   N  NE2  . HIS A 1 40  ? 13.497  -0.270  10.476  1.00 0.00 ? 397 HIS A NE2  1  
ATOM   610   H  H    . HIS A 1 40  ? 11.719  3.673   11.451  1.00 0.00 ? 397 HIS A H    1  
ATOM   611   H  HA   . HIS A 1 40  ? 9.757   2.289   9.941   1.00 0.00 ? 397 HIS A HA   1  
ATOM   612   H  HB2  . HIS A 1 40  ? 10.894  1.824   12.699  1.00 0.00 ? 397 HIS A HB2  1  
ATOM   613   H  HB3  . HIS A 1 40  ? 9.730   0.738   11.946  1.00 0.00 ? 397 HIS A HB3  1  
ATOM   614   H  HD1  . HIS A 1 40  ? 10.802  0.439   9.156   1.00 0.00 ? 397 HIS A HD1  1  
ATOM   615   H  HD2  . HIS A 1 40  ? 13.258  0.529   12.505  1.00 0.00 ? 397 HIS A HD2  1  
ATOM   616   H  HE1  . HIS A 1 40  ? 12.926  -0.715  8.463   1.00 0.00 ? 397 HIS A HE1  1  
ATOM   617   N  N    . THR A 1 41  ? 8.750   3.901   12.624  1.00 0.00 ? 398 THR A N    1  
ATOM   618   C  CA   . THR A 1 41  ? 7.576   4.423   13.310  1.00 0.00 ? 398 THR A CA   1  
ATOM   619   C  C    . THR A 1 41  ? 7.105   5.728   12.678  1.00 0.00 ? 398 THR A C    1  
ATOM   620   O  O    . THR A 1 41  ? 7.874   6.680   12.549  1.00 0.00 ? 398 THR A O    1  
ATOM   621   C  CB   . THR A 1 41  ? 7.858   4.663   14.806  1.00 0.00 ? 398 THR A CB   1  
ATOM   622   O  OG1  . THR A 1 41  ? 6.986   5.679   15.313  1.00 0.00 ? 398 THR A OG1  1  
ATOM   623   C  CG2  . THR A 1 41  ? 9.306   5.077   15.023  1.00 0.00 ? 398 THR A CG2  1  
ATOM   624   H  H    . THR A 1 41  ? 9.642   4.146   12.947  1.00 0.00 ? 398 THR A H    1  
ATOM   625   H  HA   . THR A 1 41  ? 6.787   3.690   13.228  1.00 0.00 ? 398 THR A HA   1  
ATOM   626   H  HB   . THR A 1 41  ? 7.678   3.743   15.343  1.00 0.00 ? 398 THR A HB   1  
ATOM   627   H  HG1  . THR A 1 41  ? 7.340   6.024   16.136  1.00 0.00 ? 398 THR A HG1  1  
ATOM   628   H  HG21 . THR A 1 41  ? 9.634   5.686   14.194  1.00 0.00 ? 398 THR A HG21 1  
ATOM   629   H  HG22 . THR A 1 41  ? 9.926   4.195   15.089  1.00 0.00 ? 398 THR A HG22 1  
ATOM   630   H  HG23 . THR A 1 41  ? 9.385   5.643   15.939  1.00 0.00 ? 398 THR A HG23 1  
ATOM   631   N  N    . GLY A 1 42  ? 5.835   5.767   12.286  1.00 0.00 ? 399 GLY A N    1  
ATOM   632   C  CA   . GLY A 1 42  ? 5.284   6.961   11.672  1.00 0.00 ? 399 GLY A CA   1  
ATOM   633   C  C    . GLY A 1 42  ? 3.793   6.849   11.423  1.00 0.00 ? 399 GLY A C    1  
ATOM   634   O  O    . GLY A 1 42  ? 3.036   6.460   12.312  1.00 0.00 ? 399 GLY A O    1  
ATOM   635   H  H    . GLY A 1 42  ? 5.268   4.977   12.414  1.00 0.00 ? 399 GLY A H    1  
ATOM   636   H  HA2  . GLY A 1 42  ? 5.468   7.803   12.322  1.00 0.00 ? 399 GLY A HA2  1  
ATOM   637   H  HA3  . GLY A 1 42  ? 5.783   7.130   10.730  1.00 0.00 ? 399 GLY A HA3  1  
ATOM   638   N  N    . GLU A 1 43  ? 3.370   7.191   10.210  1.00 0.00 ? 400 GLU A N    1  
ATOM   639   C  CA   . GLU A 1 43  ? 1.958   7.130   9.849   1.00 0.00 ? 400 GLU A CA   1  
ATOM   640   C  C    . GLU A 1 43  ? 1.765   7.418   8.363   1.00 0.00 ? 400 GLU A C    1  
ATOM   641   O  O    . GLU A 1 43  ? 2.358   8.348   7.816   1.00 0.00 ? 400 GLU A O    1  
ATOM   642   C  CB   . GLU A 1 43  ? 1.151   8.127   10.682  1.00 0.00 ? 400 GLU A CB   1  
ATOM   643   C  CG   . GLU A 1 43  ? -0.350  7.906   10.609  1.00 0.00 ? 400 GLU A CG   1  
ATOM   644   C  CD   . GLU A 1 43  ? -1.141  9.149   10.971  1.00 0.00 ? 400 GLU A CD   1  
ATOM   645   O  OE1  . GLU A 1 43  ? -1.348  9.999   10.080  1.00 0.00 ? 400 GLU A OE1  1  
ATOM   646   O  OE2  . GLU A 1 43  ? -1.551  9.271   12.144  1.00 0.00 ? 400 GLU A OE2  1  
ATOM   647   H  H    . GLU A 1 43  ? 4.022   7.493   9.544   1.00 0.00 ? 400 GLU A H    1  
ATOM   648   H  HA   . GLU A 1 43  ? 1.606   6.131   10.058  1.00 0.00 ? 400 GLU A HA   1  
ATOM   649   H  HB2  . GLU A 1 43  ? 1.457   8.046   11.715  1.00 0.00 ? 400 GLU A HB2  1  
ATOM   650   H  HB3  . GLU A 1 43  ? 1.364   9.126   10.331  1.00 0.00 ? 400 GLU A HB3  1  
ATOM   651   H  HG2  . GLU A 1 43  ? -0.610  7.614   9.603   1.00 0.00 ? 400 GLU A HG2  1  
ATOM   652   H  HG3  . GLU A 1 43  ? -0.619  7.115   11.294  1.00 0.00 ? 400 GLU A HG3  1  
ATOM   653   N  N    . LYS A 1 44  ? 0.930   6.612   7.714   1.00 0.00 ? 401 LYS A N    1  
ATOM   654   C  CA   . LYS A 1 44  ? 0.656   6.779   6.292   1.00 0.00 ? 401 LYS A CA   1  
ATOM   655   C  C    . LYS A 1 44  ? -0.842  6.710   6.015   1.00 0.00 ? 401 LYS A C    1  
ATOM   656   O  O    . LYS A 1 44  ? -1.376  5.678   5.609   1.00 0.00 ? 401 LYS A O    1  
ATOM   657   C  CB   . LYS A 1 44  ? 1.385   5.704   5.481   1.00 0.00 ? 401 LYS A CB   1  
ATOM   658   C  CG   . LYS A 1 44  ? 2.847   6.026   5.221   1.00 0.00 ? 401 LYS A CG   1  
ATOM   659   C  CD   . LYS A 1 44  ? 3.637   4.778   4.863   1.00 0.00 ? 401 LYS A CD   1  
ATOM   660   C  CE   . LYS A 1 44  ? 4.133   4.057   6.107   1.00 0.00 ? 401 LYS A CE   1  
ATOM   661   N  NZ   . LYS A 1 44  ? 5.149   3.019   5.778   1.00 0.00 ? 401 LYS A NZ   1  
ATOM   662   H  H    . LYS A 1 44  ? 0.487   5.888   8.204   1.00 0.00 ? 401 LYS A H    1  
ATOM   663   H  HA   . LYS A 1 44  ? 1.021   7.751   5.995   1.00 0.00 ? 401 LYS A HA   1  
ATOM   664   H  HB2  . LYS A 1 44  ? 1.334   4.769   6.018   1.00 0.00 ? 401 LYS A HB2  1  
ATOM   665   H  HB3  . LYS A 1 44  ? 0.888   5.590   4.529   1.00 0.00 ? 401 LYS A HB3  1  
ATOM   666   H  HG2  . LYS A 1 44  ? 2.911   6.727   4.402   1.00 0.00 ? 401 LYS A HG2  1  
ATOM   667   H  HG3  . LYS A 1 44  ? 3.272   6.468   6.111   1.00 0.00 ? 401 LYS A HG3  1  
ATOM   668   H  HD2  . LYS A 1 44  ? 3.002   4.109   4.302   1.00 0.00 ? 401 LYS A HD2  1  
ATOM   669   H  HD3  . LYS A 1 44  ? 4.487   5.062   4.259   1.00 0.00 ? 401 LYS A HD3  1  
ATOM   670   H  HE2  . LYS A 1 44  ? 4.574   4.781   6.775   1.00 0.00 ? 401 LYS A HE2  1  
ATOM   671   H  HE3  . LYS A 1 44  ? 3.292   3.585   6.593   1.00 0.00 ? 401 LYS A HE3  1  
ATOM   672   H  HZ1  . LYS A 1 44  ? 5.405   3.076   4.772   1.00 0.00 ? 401 LYS A HZ1  1  
ATOM   673   H  HZ2  . LYS A 1 44  ? 4.768   2.072   5.975   1.00 0.00 ? 401 LYS A HZ2  1  
ATOM   674   H  HZ3  . LYS A 1 44  ? 6.004   3.162   6.352   1.00 0.00 ? 401 LYS A HZ3  1  
ATOM   675   N  N    . PRO A 1 45  ? -1.538  7.835   6.237   1.00 0.00 ? 402 PRO A N    1  
ATOM   676   C  CA   . PRO A 1 45  ? -2.984  7.928   6.016   1.00 0.00 ? 402 PRO A CA   1  
ATOM   677   C  C    . PRO A 1 45  ? -3.349  7.878   4.536   1.00 0.00 ? 402 PRO A C    1  
ATOM   678   O  O    . PRO A 1 45  ? -4.345  7.265   4.152   1.00 0.00 ? 402 PRO A O    1  
ATOM   679   C  CB   . PRO A 1 45  ? -3.347  9.291   6.610   1.00 0.00 ? 402 PRO A CB   1  
ATOM   680   C  CG   . PRO A 1 45  ? -2.090  10.085  6.532   1.00 0.00 ? 402 PRO A CG   1  
ATOM   681   C  CD   . PRO A 1 45  ? -0.967  9.103   6.721   1.00 0.00 ? 402 PRO A CD   1  
ATOM   682   H  HA   . PRO A 1 45  ? -3.517  7.150   6.543   1.00 0.00 ? 402 PRO A HA   1  
ATOM   683   H  HB2  . PRO A 1 45  ? -4.138  9.742   6.027   1.00 0.00 ? 402 PRO A HB2  1  
ATOM   684   H  HB3  . PRO A 1 45  ? -3.673  9.167   7.632   1.00 0.00 ? 402 PRO A HB3  1  
ATOM   685   H  HG2  . PRO A 1 45  ? -2.014  10.560  5.566   1.00 0.00 ? 402 PRO A HG2  1  
ATOM   686   H  HG3  . PRO A 1 45  ? -2.074  10.826  7.318   1.00 0.00 ? 402 PRO A HG3  1  
ATOM   687   H  HD2  . PRO A 1 45  ? -0.110  9.391   6.129   1.00 0.00 ? 402 PRO A HD2  1  
ATOM   688   H  HD3  . PRO A 1 45  ? -0.699  9.031   7.765   1.00 0.00 ? 402 PRO A HD3  1  
ATOM   689   N  N    . TYR A 1 46  ? -2.536  8.527   3.709   1.00 0.00 ? 403 TYR A N    1  
ATOM   690   C  CA   . TYR A 1 46  ? -2.775  8.558   2.271   1.00 0.00 ? 403 TYR A CA   1  
ATOM   691   C  C    . TYR A 1 46  ? -2.606  7.170   1.661   1.00 0.00 ? 403 TYR A C    1  
ATOM   692   O  O    . TYR A 1 46  ? -1.530  6.575   1.727   1.00 0.00 ? 403 TYR A O    1  
ATOM   693   C  CB   . TYR A 1 46  ? -1.819  9.544   1.596   1.00 0.00 ? 403 TYR A CB   1  
ATOM   694   C  CG   . TYR A 1 46  ? -1.938  10.957  2.119   1.00 0.00 ? 403 TYR A CG   1  
ATOM   695   C  CD1  . TYR A 1 46  ? -2.967  11.790  1.697   1.00 0.00 ? 403 TYR A CD1  1  
ATOM   696   C  CD2  . TYR A 1 46  ? -1.021  11.460  3.033   1.00 0.00 ? 403 TYR A CD2  1  
ATOM   697   C  CE1  . TYR A 1 46  ? -3.080  13.083  2.172   1.00 0.00 ? 403 TYR A CE1  1  
ATOM   698   C  CE2  . TYR A 1 46  ? -1.127  12.751  3.514   1.00 0.00 ? 403 TYR A CE2  1  
ATOM   699   C  CZ   . TYR A 1 46  ? -2.158  13.558  3.080   1.00 0.00 ? 403 TYR A CZ   1  
ATOM   700   O  OH   . TYR A 1 46  ? -2.266  14.845  3.556   1.00 0.00 ? 403 TYR A OH   1  
ATOM   701   H  H    . TYR A 1 46  ? -1.758  8.997   4.075   1.00 0.00 ? 403 TYR A H    1  
ATOM   702   H  HA   . TYR A 1 46  ? -3.790  8.889   2.110   1.00 0.00 ? 403 TYR A HA   1  
ATOM   703   H  HB2  . TYR A 1 46  ? -0.803  9.216   1.755   1.00 0.00 ? 403 TYR A HB2  1  
ATOM   704   H  HB3  . TYR A 1 46  ? -2.024  9.563   0.535   1.00 0.00 ? 403 TYR A HB3  1  
ATOM   705   H  HD1  . TYR A 1 46  ? -3.688  11.415  0.985   1.00 0.00 ? 403 TYR A HD1  1  
ATOM   706   H  HD2  . TYR A 1 46  ? -0.215  10.825  3.371   1.00 0.00 ? 403 TYR A HD2  1  
ATOM   707   H  HE1  . TYR A 1 46  ? -3.887  13.716  1.832   1.00 0.00 ? 403 TYR A HE1  1  
ATOM   708   H  HE2  . TYR A 1 46  ? -0.405  13.124  4.225   1.00 0.00 ? 403 TYR A HE2  1  
ATOM   709   H  HH   . TYR A 1 46  ? -2.683  14.833  4.421   1.00 0.00 ? 403 TYR A HH   1  
ATOM   710   N  N    . LYS A 1 47  ? -3.679  6.659   1.065   1.00 0.00 ? 404 LYS A N    1  
ATOM   711   C  CA   . LYS A 1 47  ? -3.652  5.342   0.440   1.00 0.00 ? 404 LYS A CA   1  
ATOM   712   C  C    . LYS A 1 47  ? -3.998  5.437   -1.043  1.00 0.00 ? 404 LYS A C    1  
ATOM   713   O  O    . LYS A 1 47  ? -4.883  6.196   -1.437  1.00 0.00 ? 404 LYS A O    1  
ATOM   714   C  CB   . LYS A 1 47  ? -4.633  4.401   1.144   1.00 0.00 ? 404 LYS A CB   1  
ATOM   715   C  CG   . LYS A 1 47  ? -4.431  2.938   0.791   1.00 0.00 ? 404 LYS A CG   1  
ATOM   716   C  CD   . LYS A 1 47  ? -5.262  2.536   -0.417  1.00 0.00 ? 404 LYS A CD   1  
ATOM   717   C  CE   . LYS A 1 47  ? -5.536  1.040   -0.432  1.00 0.00 ? 404 LYS A CE   1  
ATOM   718   N  NZ   . LYS A 1 47  ? -5.953  0.566   -1.781  1.00 0.00 ? 404 LYS A NZ   1  
ATOM   719   H  H    . LYS A 1 47  ? -4.508  7.182   1.045   1.00 0.00 ? 404 LYS A H    1  
ATOM   720   H  HA   . LYS A 1 47  ? -2.653  4.947   0.540   1.00 0.00 ? 404 LYS A HA   1  
ATOM   721   H  HB2  . LYS A 1 47  ? -4.516  4.512   2.212   1.00 0.00 ? 404 LYS A HB2  1  
ATOM   722   H  HB3  . LYS A 1 47  ? -5.640  4.681   0.870   1.00 0.00 ? 404 LYS A HB3  1  
ATOM   723   H  HG2  . LYS A 1 47  ? -3.388  2.771   0.568   1.00 0.00 ? 404 LYS A HG2  1  
ATOM   724   H  HG3  . LYS A 1 47  ? -4.723  2.330   1.635   1.00 0.00 ? 404 LYS A HG3  1  
ATOM   725   H  HD2  . LYS A 1 47  ? -6.204  3.063   -0.386  1.00 0.00 ? 404 LYS A HD2  1  
ATOM   726   H  HD3  . LYS A 1 47  ? -4.727  2.805   -1.317  1.00 0.00 ? 404 LYS A HD3  1  
ATOM   727   H  HE2  . LYS A 1 47  ? -4.637  0.520   -0.140  1.00 0.00 ? 404 LYS A HE2  1  
ATOM   728   H  HE3  . LYS A 1 47  ? -6.323  0.824   0.275   1.00 0.00 ? 404 LYS A HE3  1  
ATOM   729   H  HZ1  . LYS A 1 47  ? -6.139  -0.456  -1.759  1.00 0.00 ? 404 LYS A HZ1  1  
ATOM   730   H  HZ2  . LYS A 1 47  ? -5.202  0.757   -2.474  1.00 0.00 ? 404 LYS A HZ2  1  
ATOM   731   H  HZ3  . LYS A 1 47  ? -6.818  1.059   -2.081  1.00 0.00 ? 404 LYS A HZ3  1  
ATOM   732   N  N    . CYS A 1 48  ? -3.295  4.660   -1.860  1.00 0.00 ? 405 CYS A N    1  
ATOM   733   C  CA   . CYS A 1 48  ? -3.527  4.655   -3.299  1.00 0.00 ? 405 CYS A CA   1  
ATOM   734   C  C    . CYS A 1 48  ? -4.851  3.974   -3.634  1.00 0.00 ? 405 CYS A C    1  
ATOM   735   O  O    . CYS A 1 48  ? -4.979  2.754   -3.531  1.00 0.00 ? 405 CYS A O    1  
ATOM   736   C  CB   . CYS A 1 48  ? -2.380  3.945   -4.020  1.00 0.00 ? 405 CYS A CB   1  
ATOM   737   S  SG   . CYS A 1 48  ? -2.550  3.908   -5.833  1.00 0.00 ? 405 CYS A SG   1  
ATOM   738   H  H    . CYS A 1 48  ? -2.602  4.075   -1.486  1.00 0.00 ? 405 CYS A H    1  
ATOM   739   H  HA   . CYS A 1 48  ? -3.570  5.681   -3.632  1.00 0.00 ? 405 CYS A HA   1  
ATOM   740   H  HB2  . CYS A 1 48  ? -1.452  4.449   -3.788  1.00 0.00 ? 405 CYS A HB2  1  
ATOM   741   H  HB3  . CYS A 1 48  ? -2.325  2.923   -3.674  1.00 0.00 ? 405 CYS A HB3  1  
ATOM   742   N  N    . THR A 1 49  ? -5.836  4.772   -4.036  1.00 0.00 ? 406 THR A N    1  
ATOM   743   C  CA   . THR A 1 49  ? -7.150  4.249   -4.385  1.00 0.00 ? 406 THR A CA   1  
ATOM   744   C  C    . THR A 1 49  ? -7.156  3.673   -5.796  1.00 0.00 ? 406 THR A C    1  
ATOM   745   O  O    . THR A 1 49  ? -8.042  3.974   -6.596  1.00 0.00 ? 406 THR A O    1  
ATOM   746   C  CB   . THR A 1 49  ? -8.234  5.338   -4.283  1.00 0.00 ? 406 THR A CB   1  
ATOM   747   O  OG1  . THR A 1 49  ? -7.923  6.423   -5.163  1.00 0.00 ? 406 THR A OG1  1  
ATOM   748   C  CG2  . THR A 1 49  ? -8.352  5.853   -2.856  1.00 0.00 ? 406 THR A CG2  1  
ATOM   749   H  H    . THR A 1 49  ? -5.673  5.737   -4.097  1.00 0.00 ? 406 THR A H    1  
ATOM   750   H  HA   . THR A 1 49  ? -7.393  3.462   -3.685  1.00 0.00 ? 406 THR A HA   1  
ATOM   751   H  HB   . THR A 1 49  ? -9.183  4.909   -4.574  1.00 0.00 ? 406 THR A HB   1  
ATOM   752   H  HG1  . THR A 1 49  ? -7.329  6.116   -5.853  1.00 0.00 ? 406 THR A HG1  1  
ATOM   753   H  HG21 . THR A 1 49  ? -9.070  6.658   -2.823  1.00 0.00 ? 406 THR A HG21 1  
ATOM   754   H  HG22 . THR A 1 49  ? -7.390  6.214   -2.524  1.00 0.00 ? 406 THR A HG22 1  
ATOM   755   H  HG23 . THR A 1 49  ? -8.679  5.052   -2.210  1.00 0.00 ? 406 THR A HG23 1  
ATOM   756   N  N    . TRP A 1 50  ? -6.162  2.844   -6.095  1.00 0.00 ? 407 TRP A N    1  
ATOM   757   C  CA   . TRP A 1 50  ? -6.054  2.225   -7.412  1.00 0.00 ? 407 TRP A CA   1  
ATOM   758   C  C    . TRP A 1 50  ? -6.427  0.748   -7.352  1.00 0.00 ? 407 TRP A C    1  
ATOM   759   O  O    . TRP A 1 50  ? -6.421  0.141   -6.281  1.00 0.00 ? 407 TRP A O    1  
ATOM   760   C  CB   . TRP A 1 50  ? -4.633  2.383   -7.956  1.00 0.00 ? 407 TRP A CB   1  
ATOM   761   C  CG   . TRP A 1 50  ? -4.498  1.974   -9.392  1.00 0.00 ? 407 TRP A CG   1  
ATOM   762   C  CD1  . TRP A 1 50  ? -4.022  0.784   -9.864  1.00 0.00 ? 407 TRP A CD1  1  
ATOM   763   C  CD2  . TRP A 1 50  ? -4.842  2.755   -10.541 1.00 0.00 ? 407 TRP A CD2  1  
ATOM   764   N  NE1  . TRP A 1 50  ? -4.049  0.779   -11.238 1.00 0.00 ? 407 TRP A NE1  1  
ATOM   765   C  CE2  . TRP A 1 50  ? -4.549  1.976   -11.678 1.00 0.00 ? 407 TRP A CE2  1  
ATOM   766   C  CE3  . TRP A 1 50  ? -5.371  4.036   -10.721 1.00 0.00 ? 407 TRP A CE3  1  
ATOM   767   C  CZ2  . TRP A 1 50  ? -4.766  2.438   -12.973 1.00 0.00 ? 407 TRP A CZ2  1  
ATOM   768   C  CZ3  . TRP A 1 50  ? -5.586  4.493   -12.008 1.00 0.00 ? 407 TRP A CZ3  1  
ATOM   769   C  CH2  . TRP A 1 50  ? -5.285  3.696   -13.120 1.00 0.00 ? 407 TRP A CH2  1  
ATOM   770   H  H    . TRP A 1 50  ? -5.486  2.642   -5.415  1.00 0.00 ? 407 TRP A H    1  
ATOM   771   H  HA   . TRP A 1 50  ? -6.741  2.732   -8.073  1.00 0.00 ? 407 TRP A HA   1  
ATOM   772   H  HB2  . TRP A 1 50  ? -4.336  3.418   -7.875  1.00 0.00 ? 407 TRP A HB2  1  
ATOM   773   H  HB3  . TRP A 1 50  ? -3.961  1.772   -7.371  1.00 0.00 ? 407 TRP A HB3  1  
ATOM   774   H  HD1  . TRP A 1 50  ? -3.676  -0.024  -9.238  1.00 0.00 ? 407 TRP A HD1  1  
ATOM   775   H  HE1  . TRP A 1 50  ? -3.759  0.037   -11.810 1.00 0.00 ? 407 TRP A HE1  1  
ATOM   776   H  HE3  . TRP A 1 50  ? -5.610  4.666   -9.877  1.00 0.00 ? 407 TRP A HE3  1  
ATOM   777   H  HZ2  . TRP A 1 50  ? -4.540  1.835   -13.840 1.00 0.00 ? 407 TRP A HZ2  1  
ATOM   778   H  HZ3  . TRP A 1 50  ? -5.994  5.481   -12.166 1.00 0.00 ? 407 TRP A HZ3  1  
ATOM   779   H  HH2  . TRP A 1 50  ? -5.469  4.094   -14.106 1.00 0.00 ? 407 TRP A HH2  1  
ATOM   780   N  N    . GLU A 1 51  ? -6.751  0.176   -8.507  1.00 0.00 ? 408 GLU A N    1  
ATOM   781   C  CA   . GLU A 1 51  ? -7.128  -1.230  -8.584  1.00 0.00 ? 408 GLU A CA   1  
ATOM   782   C  C    . GLU A 1 51  ? -5.903  -2.130  -8.449  1.00 0.00 ? 408 GLU A C    1  
ATOM   783   O  O    . GLU A 1 51  ? -5.015  -2.121  -9.301  1.00 0.00 ? 408 GLU A O    1  
ATOM   784   C  CB   . GLU A 1 51  ? -7.843  -1.519  -9.905  1.00 0.00 ? 408 GLU A CB   1  
ATOM   785   C  CG   . GLU A 1 51  ? -8.367  -2.941  -10.016 1.00 0.00 ? 408 GLU A CG   1  
ATOM   786   C  CD   . GLU A 1 51  ? -9.691  -3.132  -9.304  1.00 0.00 ? 408 GLU A CD   1  
ATOM   787   O  OE1  . GLU A 1 51  ? -10.623 -2.341  -9.559  1.00 0.00 ? 408 GLU A OE1  1  
ATOM   788   O  OE2  . GLU A 1 51  ? -9.796  -4.074  -8.490  1.00 0.00 ? 408 GLU A OE2  1  
ATOM   789   H  H    . GLU A 1 51  ? -6.737  0.713   -9.327  1.00 0.00 ? 408 GLU A H    1  
ATOM   790   H  HA   . GLU A 1 51  ? -7.803  -1.438  -7.767  1.00 0.00 ? 408 GLU A HA   1  
ATOM   791   H  HB2  . GLU A 1 51  ? -8.677  -0.840  -10.005 1.00 0.00 ? 408 GLU A HB2  1  
ATOM   792   H  HB3  . GLU A 1 51  ? -7.153  -1.347  -10.718 1.00 0.00 ? 408 GLU A HB3  1  
ATOM   793   H  HG2  . GLU A 1 51  ? -8.499  -3.181  -11.061 1.00 0.00 ? 408 GLU A HG2  1  
ATOM   794   H  HG3  . GLU A 1 51  ? -7.641  -3.613  -9.583  1.00 0.00 ? 408 GLU A HG3  1  
ATOM   795   N  N    . GLY A 1 52  ? -5.862  -2.906  -7.370  1.00 0.00 ? 409 GLY A N    1  
ATOM   796   C  CA   . GLY A 1 52  ? -4.742  -3.800  -7.142  1.00 0.00 ? 409 GLY A CA   1  
ATOM   797   C  C    . GLY A 1 52  ? -3.720  -3.217  -6.186  1.00 0.00 ? 409 GLY A C    1  
ATOM   798   O  O    . GLY A 1 52  ? -3.252  -3.899  -5.273  1.00 0.00 ? 409 GLY A O    1  
ATOM   799   H  H    . GLY A 1 52  ? -6.598  -2.871  -6.724  1.00 0.00 ? 409 GLY A H    1  
ATOM   800   H  HA2  . GLY A 1 52  ? -5.113  -4.728  -6.733  1.00 0.00 ? 409 GLY A HA2  1  
ATOM   801   H  HA3  . GLY A 1 52  ? -4.259  -4.002  -8.086  1.00 0.00 ? 409 GLY A HA3  1  
ATOM   802   N  N    . CYS A 1 53  ? -3.371  -1.952  -6.395  1.00 0.00 ? 410 CYS A N    1  
ATOM   803   C  CA   . CYS A 1 53  ? -2.396  -1.277  -5.547  1.00 0.00 ? 410 CYS A CA   1  
ATOM   804   C  C    . CYS A 1 53  ? -2.897  -1.187  -4.108  1.00 0.00 ? 410 CYS A C    1  
ATOM   805   O  O    . CYS A 1 53  ? -4.035  -0.789  -3.860  1.00 0.00 ? 410 CYS A O    1  
ATOM   806   C  CB   . CYS A 1 53  ? -2.104  0.125   -6.085  1.00 0.00 ? 410 CYS A CB   1  
ATOM   807   S  SG   . CYS A 1 53  ? -0.492  0.799   -5.569  1.00 0.00 ? 410 CYS A SG   1  
ATOM   808   H  H    . CYS A 1 53  ? -3.778  -1.460  -7.139  1.00 0.00 ? 410 CYS A H    1  
ATOM   809   H  HA   . CYS A 1 53  ? -1.485  -1.856  -5.562  1.00 0.00 ? 410 CYS A HA   1  
ATOM   810   H  HB2  . CYS A 1 53  ? -2.117  0.097   -7.165  1.00 0.00 ? 410 CYS A HB2  1  
ATOM   811   H  HB3  . CYS A 1 53  ? -2.871  0.802   -5.739  1.00 0.00 ? 410 CYS A HB3  1  
ATOM   812   N  N    . ASP A 1 54  ? -2.039  -1.559  -3.164  1.00 0.00 ? 411 ASP A N    1  
ATOM   813   C  CA   . ASP A 1 54  ? -2.393  -1.519  -1.750  1.00 0.00 ? 411 ASP A CA   1  
ATOM   814   C  C    . ASP A 1 54  ? -1.304  -0.827  -0.937  1.00 0.00 ? 411 ASP A C    1  
ATOM   815   O  O    . ASP A 1 54  ? -1.079  -1.159  0.227   1.00 0.00 ? 411 ASP A O    1  
ATOM   816   C  CB   . ASP A 1 54  ? -2.621  -2.935  -1.220  1.00 0.00 ? 411 ASP A CB   1  
ATOM   817   C  CG   . ASP A 1 54  ? -4.038  -3.419  -1.452  1.00 0.00 ? 411 ASP A CG   1  
ATOM   818   O  OD1  . ASP A 1 54  ? -4.928  -3.053  -0.656  1.00 0.00 ? 411 ASP A OD1  1  
ATOM   819   O  OD2  . ASP A 1 54  ? -4.258  -4.165  -2.429  1.00 0.00 ? 411 ASP A OD2  1  
ATOM   820   H  H    . ASP A 1 54  ? -1.145  -1.867  -3.425  1.00 0.00 ? 411 ASP A H    1  
ATOM   821   H  HA   . ASP A 1 54  ? -3.309  -0.957  -1.653  1.00 0.00 ? 411 ASP A HA   1  
ATOM   822   H  HB2  . ASP A 1 54  ? -1.943  -3.613  -1.718  1.00 0.00 ? 411 ASP A HB2  1  
ATOM   823   H  HB3  . ASP A 1 54  ? -2.423  -2.951  -0.158  1.00 0.00 ? 411 ASP A HB3  1  
ATOM   824   N  N    . TRP A 1 55  ? -0.630  0.135   -1.557  1.00 0.00 ? 412 TRP A N    1  
ATOM   825   C  CA   . TRP A 1 55  ? 0.437   0.873   -0.891  1.00 0.00 ? 412 TRP A CA   1  
ATOM   826   C  C    . TRP A 1 55  ? -0.109  2.123   -0.210  1.00 0.00 ? 412 TRP A C    1  
ATOM   827   O  O    . TRP A 1 55  ? -1.275  2.477   -0.385  1.00 0.00 ? 412 TRP A O    1  
ATOM   828   C  CB   . TRP A 1 55  ? 1.524   1.258   -1.896  1.00 0.00 ? 412 TRP A CB   1  
ATOM   829   C  CG   . TRP A 1 55  ? 2.393   0.106   -2.301  1.00 0.00 ? 412 TRP A CG   1  
ATOM   830   C  CD1  . TRP A 1 55  ? 2.326   -0.601  -3.468  1.00 0.00 ? 412 TRP A CD1  1  
ATOM   831   C  CD2  . TRP A 1 55  ? 3.458   -0.474  -1.540  1.00 0.00 ? 412 TRP A CD2  1  
ATOM   832   N  NE1  . TRP A 1 55  ? 3.285   -1.585  -3.478  1.00 0.00 ? 412 TRP A NE1  1  
ATOM   833   C  CE2  . TRP A 1 55  ? 3.993   -1.527  -2.306  1.00 0.00 ? 412 TRP A CE2  1  
ATOM   834   C  CE3  . TRP A 1 55  ? 4.012   -0.204  -0.286  1.00 0.00 ? 412 TRP A CE3  1  
ATOM   835   C  CZ2  . TRP A 1 55  ? 5.054   -2.309  -1.858  1.00 0.00 ? 412 TRP A CZ2  1  
ATOM   836   C  CZ3  . TRP A 1 55  ? 5.065   -0.981  0.158   1.00 0.00 ? 412 TRP A CZ3  1  
ATOM   837   C  CH2  . TRP A 1 55  ? 5.578   -2.023  -0.627  1.00 0.00 ? 412 TRP A CH2  1  
ATOM   838   H  H    . TRP A 1 55  ? -0.855  0.354   -2.486  1.00 0.00 ? 412 TRP A H    1  
ATOM   839   H  HA   . TRP A 1 55  ? 0.866   0.227   -0.140  1.00 0.00 ? 412 TRP A HA   1  
ATOM   840   H  HB2  . TRP A 1 55  ? 1.058   1.654   -2.786  1.00 0.00 ? 412 TRP A HB2  1  
ATOM   841   H  HB3  . TRP A 1 55  ? 2.157   2.016   -1.457  1.00 0.00 ? 412 TRP A HB3  1  
ATOM   842   H  HD1  . TRP A 1 55  ? 1.616   -0.405  -4.257  1.00 0.00 ? 412 TRP A HD1  1  
ATOM   843   H  HE1  . TRP A 1 55  ? 3.438   -2.223  -4.206  1.00 0.00 ? 412 TRP A HE1  1  
ATOM   844   H  HE3  . TRP A 1 55  ? 3.631   0.595   0.334   1.00 0.00 ? 412 TRP A HE3  1  
ATOM   845   H  HZ2  . TRP A 1 55  ? 5.461   -3.115  -2.451  1.00 0.00 ? 412 TRP A HZ2  1  
ATOM   846   H  HZ3  . TRP A 1 55  ? 5.507   -0.788  1.125   1.00 0.00 ? 412 TRP A HZ3  1  
ATOM   847   H  HH2  . TRP A 1 55  ? 6.401   -2.604  -0.240  1.00 0.00 ? 412 TRP A HH2  1  
ATOM   848   N  N    . ARG A 1 56  ? 0.740   2.788   0.566   1.00 0.00 ? 413 ARG A N    1  
ATOM   849   C  CA   . ARG A 1 56  ? 0.341   3.999   1.273   1.00 0.00 ? 413 ARG A CA   1  
ATOM   850   C  C    . ARG A 1 56  ? 1.516   4.964   1.404   1.00 0.00 ? 413 ARG A C    1  
ATOM   851   O  O    . ARG A 1 56  ? 2.676   4.555   1.370   1.00 0.00 ? 413 ARG A O    1  
ATOM   852   C  CB   . ARG A 1 56  ? -0.202  3.650   2.660   1.00 0.00 ? 413 ARG A CB   1  
ATOM   853   C  CG   . ARG A 1 56  ? -1.576  3.000   2.629   1.00 0.00 ? 413 ARG A CG   1  
ATOM   854   C  CD   . ARG A 1 56  ? -2.197  2.944   4.016   1.00 0.00 ? 413 ARG A CD   1  
ATOM   855   N  NE   . ARG A 1 56  ? -3.529  2.346   3.996   1.00 0.00 ? 413 ARG A NE   1  
ATOM   856   C  CZ   . ARG A 1 56  ? -3.750  1.049   3.813   1.00 0.00 ? 413 ARG A CZ   1  
ATOM   857   N  NH1  . ARG A 1 56  ? -2.731  0.218   3.635   1.00 0.00 ? 413 ARG A NH1  1  
ATOM   858   N  NH2  . ARG A 1 56  ? -4.991  0.580   3.807   1.00 0.00 ? 413 ARG A NH2  1  
ATOM   859   H  H    . ARG A 1 56  ? 1.657   2.457   0.666   1.00 0.00 ? 413 ARG A H    1  
ATOM   860   H  HA   . ARG A 1 56  ? -0.439  4.477   0.700   1.00 0.00 ? 413 ARG A HA   1  
ATOM   861   H  HB2  . ARG A 1 56  ? 0.483   2.968   3.141   1.00 0.00 ? 413 ARG A HB2  1  
ATOM   862   H  HB3  . ARG A 1 56  ? -0.269  4.554   3.245   1.00 0.00 ? 413 ARG A HB3  1  
ATOM   863   H  HG2  . ARG A 1 56  ? -2.222  3.575   1.981   1.00 0.00 ? 413 ARG A HG2  1  
ATOM   864   H  HG3  . ARG A 1 56  ? -1.480  1.995   2.246   1.00 0.00 ? 413 ARG A HG3  1  
ATOM   865   H  HD2  . ARG A 1 56  ? -1.559  2.355   4.658   1.00 0.00 ? 413 ARG A HD2  1  
ATOM   866   H  HD3  . ARG A 1 56  ? -2.269  3.949   4.404   1.00 0.00 ? 413 ARG A HD3  1  
ATOM   867   H  HE   . ARG A 1 56  ? -4.296  2.941   4.125   1.00 0.00 ? 413 ARG A HE   1  
ATOM   868   H  HH11 . ARG A 1 56  ? -1.795  0.569   3.640   1.00 0.00 ? 413 ARG A HH11 1  
ATOM   869   H  HH12 . ARG A 1 56  ? -2.900  -0.758  3.499   1.00 0.00 ? 413 ARG A HH12 1  
ATOM   870   H  HH21 . ARG A 1 56  ? -5.761  1.203   3.941   1.00 0.00 ? 413 ARG A HH21 1  
ATOM   871   H  HH22 . ARG A 1 56  ? -5.156  -0.396  3.669   1.00 0.00 ? 413 ARG A HH22 1  
ATOM   872   N  N    . PHE A 1 57  ? 1.206   6.248   1.554   1.00 0.00 ? 414 PHE A N    1  
ATOM   873   C  CA   . PHE A 1 57  ? 2.236   7.272   1.688   1.00 0.00 ? 414 PHE A CA   1  
ATOM   874   C  C    . PHE A 1 57  ? 1.903   8.232   2.826   1.00 0.00 ? 414 PHE A C    1  
ATOM   875   O  O    . PHE A 1 57  ? 0.796   8.213   3.365   1.00 0.00 ? 414 PHE A O    1  
ATOM   876   C  CB   . PHE A 1 57  ? 2.387   8.048   0.378   1.00 0.00 ? 414 PHE A CB   1  
ATOM   877   C  CG   . PHE A 1 57  ? 2.625   7.169   -0.816  1.00 0.00 ? 414 PHE A CG   1  
ATOM   878   C  CD1  . PHE A 1 57  ? 3.906   6.763   -1.151  1.00 0.00 ? 414 PHE A CD1  1  
ATOM   879   C  CD2  . PHE A 1 57  ? 1.566   6.748   -1.604  1.00 0.00 ? 414 PHE A CD2  1  
ATOM   880   C  CE1  . PHE A 1 57  ? 4.128   5.954   -2.249  1.00 0.00 ? 414 PHE A CE1  1  
ATOM   881   C  CE2  . PHE A 1 57  ? 1.781   5.938   -2.703  1.00 0.00 ? 414 PHE A CE2  1  
ATOM   882   C  CZ   . PHE A 1 57  ? 3.064   5.541   -3.026  1.00 0.00 ? 414 PHE A CZ   1  
ATOM   883   H  H    . PHE A 1 57  ? 0.263   6.513   1.573   1.00 0.00 ? 414 PHE A H    1  
ATOM   884   H  HA   . PHE A 1 57  ? 3.168   6.776   1.913   1.00 0.00 ? 414 PHE A HA   1  
ATOM   885   H  HB2  . PHE A 1 57  ? 1.487   8.616   0.198   1.00 0.00 ? 414 PHE A HB2  1  
ATOM   886   H  HB3  . PHE A 1 57  ? 3.223   8.726   0.465   1.00 0.00 ? 414 PHE A HB3  1  
ATOM   887   H  HD1  . PHE A 1 57  ? 4.740   7.086   -0.542  1.00 0.00 ? 414 PHE A HD1  1  
ATOM   888   H  HD2  . PHE A 1 57  ? 0.562   7.058   -1.353  1.00 0.00 ? 414 PHE A HD2  1  
ATOM   889   H  HE1  . PHE A 1 57  ? 5.133   5.645   -2.498  1.00 0.00 ? 414 PHE A HE1  1  
ATOM   890   H  HE2  . PHE A 1 57  ? 0.947   5.617   -3.310  1.00 0.00 ? 414 PHE A HE2  1  
ATOM   891   H  HZ   . PHE A 1 57  ? 3.235   4.908   -3.884  1.00 0.00 ? 414 PHE A HZ   1  
ATOM   892   N  N    . ALA A 1 58  ? 2.868   9.071   3.187   1.00 0.00 ? 415 ALA A N    1  
ATOM   893   C  CA   . ALA A 1 58  ? 2.678   10.040  4.259   1.00 0.00 ? 415 ALA A CA   1  
ATOM   894   C  C    . ALA A 1 58  ? 2.479   11.445  3.701   1.00 0.00 ? 415 ALA A C    1  
ATOM   895   O  O    . ALA A 1 58  ? 1.616   12.191  4.165   1.00 0.00 ? 415 ALA A O    1  
ATOM   896   C  CB   . ALA A 1 58  ? 3.863   10.012  5.212   1.00 0.00 ? 415 ALA A CB   1  
ATOM   897   H  H    . ALA A 1 58  ? 3.729   9.038   2.720   1.00 0.00 ? 415 ALA A H    1  
ATOM   898   H  HA   . ALA A 1 58  ? 1.795   9.755   4.813   1.00 0.00 ? 415 ALA A HA   1  
ATOM   899   H  HB1  . ALA A 1 58  ? 3.669   10.668  6.047   1.00 0.00 ? 415 ALA A HB1  1  
ATOM   900   H  HB2  . ALA A 1 58  ? 4.010   9.004   5.573   1.00 0.00 ? 415 ALA A HB2  1  
ATOM   901   H  HB3  . ALA A 1 58  ? 4.751   10.342  4.693   1.00 0.00 ? 415 ALA A HB3  1  
ATOM   902   N  N    . ARG A 1 59  ? 3.281   11.799  2.702   1.00 0.00 ? 416 ARG A N    1  
ATOM   903   C  CA   . ARG A 1 59  ? 3.194   13.115  2.082   1.00 0.00 ? 416 ARG A CA   1  
ATOM   904   C  C    . ARG A 1 59  ? 2.199   13.107  0.925   1.00 0.00 ? 416 ARG A C    1  
ATOM   905   O  O    . ARG A 1 59  ? 2.222   12.212  0.080   1.00 0.00 ? 416 ARG A O    1  
ATOM   906   C  CB   . ARG A 1 59  ? 4.570   13.560  1.582   1.00 0.00 ? 416 ARG A CB   1  
ATOM   907   C  CG   . ARG A 1 59  ? 5.393   14.287  2.632   1.00 0.00 ? 416 ARG A CG   1  
ATOM   908   C  CD   . ARG A 1 59  ? 5.089   15.777  2.645   1.00 0.00 ? 416 ARG A CD   1  
ATOM   909   N  NE   . ARG A 1 59  ? 5.901   16.493  3.625   1.00 0.00 ? 416 ARG A NE   1  
ATOM   910   C  CZ   . ARG A 1 59  ? 5.605   17.706  4.079   1.00 0.00 ? 416 ARG A CZ   1  
ATOM   911   N  NH1  . ARG A 1 59  ? 4.523   18.335  3.642   1.00 0.00 ? 416 ARG A NH1  1  
ATOM   912   N  NH2  . ARG A 1 59  ? 6.393   18.293  4.971   1.00 0.00 ? 416 ARG A NH2  1  
ATOM   913   H  H    . ARG A 1 59  ? 3.949   11.160  2.376   1.00 0.00 ? 416 ARG A H    1  
ATOM   914   H  HA   . ARG A 1 59  ? 2.850   13.813  2.831   1.00 0.00 ? 416 ARG A HA   1  
ATOM   915   H  HB2  . ARG A 1 59  ? 5.122   12.688  1.263   1.00 0.00 ? 416 ARG A HB2  1  
ATOM   916   H  HB3  . ARG A 1 59  ? 4.437   14.220  0.739   1.00 0.00 ? 416 ARG A HB3  1  
ATOM   917   H  HG2  . ARG A 1 59  ? 5.165   13.876  3.604   1.00 0.00 ? 416 ARG A HG2  1  
ATOM   918   H  HG3  . ARG A 1 59  ? 6.442   14.144  2.416   1.00 0.00 ? 416 ARG A HG3  1  
ATOM   919   H  HD2  . ARG A 1 59  ? 5.290   16.180  1.663   1.00 0.00 ? 416 ARG A HD2  1  
ATOM   920   H  HD3  . ARG A 1 59  ? 4.046   15.916  2.884   1.00 0.00 ? 416 ARG A HD3  1  
ATOM   921   H  HE   . ARG A 1 59  ? 6.705   16.047  3.962   1.00 0.00 ? 416 ARG A HE   1  
ATOM   922   H  HH11 . ARG A 1 59  ? 3.927   17.895  2.970   1.00 0.00 ? 416 ARG A HH11 1  
ATOM   923   H  HH12 . ARG A 1 59  ? 4.302   19.248  3.986   1.00 0.00 ? 416 ARG A HH12 1  
ATOM   924   H  HH21 . ARG A 1 59  ? 7.209   17.821  5.303   1.00 0.00 ? 416 ARG A HH21 1  
ATOM   925   H  HH22 . ARG A 1 59  ? 6.169   19.205  5.311   1.00 0.00 ? 416 ARG A HH22 1  
ATOM   926   N  N    . SER A 1 60  ? 1.326   14.108  0.895   1.00 0.00 ? 417 SER A N    1  
ATOM   927   C  CA   . SER A 1 60  ? 0.319   14.213  -0.155  1.00 0.00 ? 417 SER A CA   1  
ATOM   928   C  C    . SER A 1 60  ? 0.974   14.249  -1.533  1.00 0.00 ? 417 SER A C    1  
ATOM   929   O  O    . SER A 1 60  ? 0.574   13.520  -2.441  1.00 0.00 ? 417 SER A O    1  
ATOM   930   C  CB   . SER A 1 60  ? -0.533  15.467  0.049   1.00 0.00 ? 417 SER A CB   1  
ATOM   931   O  OG   . SER A 1 60  ? -1.472  15.281  1.094   1.00 0.00 ? 417 SER A OG   1  
ATOM   932   H  H    . SER A 1 60  ? 1.357   14.791  1.597   1.00 0.00 ? 417 SER A H    1  
ATOM   933   H  HA   . SER A 1 60  ? -0.316  13.343  -0.094  1.00 0.00 ? 417 SER A HA   1  
ATOM   934   H  HB2  . SER A 1 60  ? 0.108   16.298  0.303   1.00 0.00 ? 417 SER A HB2  1  
ATOM   935   H  HB3  . SER A 1 60  ? -1.066  15.690  -0.864  1.00 0.00 ? 417 SER A HB3  1  
ATOM   936   H  HG   . SER A 1 60  ? -1.032  15.373  1.941   1.00 0.00 ? 417 SER A HG   1  
ATOM   937   N  N    . ASP A 1 61  ? 1.982   15.101  -1.680  1.00 0.00 ? 418 ASP A N    1  
ATOM   938   C  CA   . ASP A 1 61  ? 2.694   15.232  -2.946  1.00 0.00 ? 418 ASP A CA   1  
ATOM   939   C  C    . ASP A 1 61  ? 3.288   13.895  -3.376  1.00 0.00 ? 418 ASP A C    1  
ATOM   940   O  O    . ASP A 1 61  ? 3.204   13.515  -4.544  1.00 0.00 ? 418 ASP A O    1  
ATOM   941   C  CB   . ASP A 1 61  ? 3.801   16.281  -2.827  1.00 0.00 ? 418 ASP A CB   1  
ATOM   942   C  CG   . ASP A 1 61  ? 4.376   16.671  -4.174  1.00 0.00 ? 418 ASP A CG   1  
ATOM   943   O  OD1  . ASP A 1 61  ? 3.586   16.997  -5.085  1.00 0.00 ? 418 ASP A OD1  1  
ATOM   944   O  OD2  . ASP A 1 61  ? 5.617   16.649  -4.319  1.00 0.00 ? 418 ASP A OD2  1  
ATOM   945   H  H    . ASP A 1 61  ? 2.255   15.655  -0.919  1.00 0.00 ? 418 ASP A H    1  
ATOM   946   H  HA   . ASP A 1 61  ? 1.985   15.554  -3.694  1.00 0.00 ? 418 ASP A HA   1  
ATOM   947   H  HB2  . ASP A 1 61  ? 3.399   17.168  -2.358  1.00 0.00 ? 418 ASP A HB2  1  
ATOM   948   H  HB3  . ASP A 1 61  ? 4.598   15.886  -2.215  1.00 0.00 ? 418 ASP A HB3  1  
ATOM   949   N  N    . GLU A 1 62  ? 3.890   13.186  -2.425  1.00 0.00 ? 419 GLU A N    1  
ATOM   950   C  CA   . GLU A 1 62  ? 4.499   11.892  -2.707  1.00 0.00 ? 419 GLU A CA   1  
ATOM   951   C  C    . GLU A 1 62  ? 3.526   10.983  -3.453  1.00 0.00 ? 419 GLU A C    1  
ATOM   952   O  O    . GLU A 1 62  ? 3.859   10.422  -4.498  1.00 0.00 ? 419 GLU A O    1  
ATOM   953   C  CB   . GLU A 1 62  ? 4.948   11.221  -1.408  1.00 0.00 ? 419 GLU A CB   1  
ATOM   954   C  CG   . GLU A 1 62  ? 6.328   11.656  -0.943  1.00 0.00 ? 419 GLU A CG   1  
ATOM   955   C  CD   . GLU A 1 62  ? 7.379   11.521  -2.028  1.00 0.00 ? 419 GLU A CD   1  
ATOM   956   O  OE1  . GLU A 1 62  ? 7.364   10.497  -2.743  1.00 0.00 ? 419 GLU A OE1  1  
ATOM   957   O  OE2  . GLU A 1 62  ? 8.215   12.438  -2.162  1.00 0.00 ? 419 GLU A OE2  1  
ATOM   958   H  H    . GLU A 1 62  ? 3.924   13.543  -1.513  1.00 0.00 ? 419 GLU A H    1  
ATOM   959   H  HA   . GLU A 1 62  ? 5.364   12.062  -3.331  1.00 0.00 ? 419 GLU A HA   1  
ATOM   960   H  HB2  . GLU A 1 62  ? 4.237   11.457  -0.630  1.00 0.00 ? 419 GLU A HB2  1  
ATOM   961   H  HB3  . GLU A 1 62  ? 4.963   10.151  -1.556  1.00 0.00 ? 419 GLU A HB3  1  
ATOM   962   H  HG2  . GLU A 1 62  ? 6.281   12.690  -0.636  1.00 0.00 ? 419 GLU A HG2  1  
ATOM   963   H  HG3  . GLU A 1 62  ? 6.620   11.045  -0.102  1.00 0.00 ? 419 GLU A HG3  1  
ATOM   964   N  N    . LEU A 1 63  ? 2.323   10.842  -2.908  1.00 0.00 ? 420 LEU A N    1  
ATOM   965   C  CA   . LEU A 1 63  ? 1.300   10.000  -3.519  1.00 0.00 ? 420 LEU A CA   1  
ATOM   966   C  C    . LEU A 1 63  ? 0.976   10.477  -4.932  1.00 0.00 ? 420 LEU A C    1  
ATOM   967   O  O    . LEU A 1 63  ? 1.102   9.724   -5.898  1.00 0.00 ? 420 LEU A O    1  
ATOM   968   C  CB   . LEU A 1 63  ? 0.032   10.003  -2.664  1.00 0.00 ? 420 LEU A CB   1  
ATOM   969   C  CG   . LEU A 1 63  ? -1.220  9.416   -3.319  1.00 0.00 ? 420 LEU A CG   1  
ATOM   970   C  CD1  . LEU A 1 63  ? -1.133  7.898   -3.370  1.00 0.00 ? 420 LEU A CD1  1  
ATOM   971   C  CD2  . LEU A 1 63  ? -2.469  9.856   -2.570  1.00 0.00 ? 420 LEU A CD2  1  
ATOM   972   H  H    . LEU A 1 63  ? 2.116   11.314  -2.074  1.00 0.00 ? 420 LEU A H    1  
ATOM   973   H  HA   . LEU A 1 63  ? 1.687   8.994   -3.572  1.00 0.00 ? 420 LEU A HA   1  
ATOM   974   H  HB2  . LEU A 1 63  ? 0.235   9.434   -1.770  1.00 0.00 ? 420 LEU A HB2  1  
ATOM   975   H  HB3  . LEU A 1 63  ? -0.183  11.027  -2.396  1.00 0.00 ? 420 LEU A HB3  1  
ATOM   976   H  HG   . LEU A 1 63  ? -1.292  9.780   -4.334  1.00 0.00 ? 420 LEU A HG   1  
ATOM   977   H  HD11 . LEU A 1 63  ? -1.560  7.483   -2.470  1.00 0.00 ? 420 LEU A HD11 1  
ATOM   978   H  HD12 . LEU A 1 63  ? -0.099  7.599   -3.450  1.00 0.00 ? 420 LEU A HD12 1  
ATOM   979   H  HD13 . LEU A 1 63  ? -1.679  7.536   -4.229  1.00 0.00 ? 420 LEU A HD13 1  
ATOM   980   H  HD21 . LEU A 1 63  ? -3.310  9.260   -2.892  1.00 0.00 ? 420 LEU A HD21 1  
ATOM   981   H  HD22 . LEU A 1 63  ? -2.665  10.897  -2.777  1.00 0.00 ? 420 LEU A HD22 1  
ATOM   982   H  HD23 . LEU A 1 63  ? -2.318  9.723   -1.508  1.00 0.00 ? 420 LEU A HD23 1  
ATOM   983   N  N    . THR A 1 64  ? 0.559   11.734  -5.045  1.00 0.00 ? 421 THR A N    1  
ATOM   984   C  CA   . THR A 1 64  ? 0.218   12.312  -6.339  1.00 0.00 ? 421 THR A CA   1  
ATOM   985   C  C    . THR A 1 64  ? 1.167   11.823  -7.427  1.00 0.00 ? 421 THR A C    1  
ATOM   986   O  O    . THR A 1 64  ? 0.733   11.306  -8.456  1.00 0.00 ? 421 THR A O    1  
ATOM   987   C  CB   . THR A 1 64  ? 0.256   13.852  -6.294  1.00 0.00 ? 421 THR A CB   1  
ATOM   988   O  OG1  . THR A 1 64  ? -0.662  14.336  -5.307  1.00 0.00 ? 421 THR A OG1  1  
ATOM   989   C  CG2  . THR A 1 64  ? -0.094  14.441  -7.652  1.00 0.00 ? 421 THR A CG2  1  
ATOM   990   H  H    . THR A 1 64  ? 0.479   12.285  -4.239  1.00 0.00 ? 421 THR A H    1  
ATOM   991   H  HA   . THR A 1 64  ? -0.787  12.005  -6.587  1.00 0.00 ? 421 THR A HA   1  
ATOM   992   H  HB   . THR A 1 64  ? 1.256   14.164  -6.029  1.00 0.00 ? 421 THR A HB   1  
ATOM   993   H  HG1  . THR A 1 64  ? -1.455  13.795  -5.315  1.00 0.00 ? 421 THR A HG1  1  
ATOM   994   H  HG21 . THR A 1 64  ? 0.744   15.013  -8.022  1.00 0.00 ? 421 THR A HG21 1  
ATOM   995   H  HG22 . THR A 1 64  ? -0.954  15.087  -7.553  1.00 0.00 ? 421 THR A HG22 1  
ATOM   996   H  HG23 . THR A 1 64  ? -0.320  13.643  -8.344  1.00 0.00 ? 421 THR A HG23 1  
ATOM   997   N  N    . ARG A 1 65  ? 2.465   11.990  -7.193  1.00 0.00 ? 422 ARG A N    1  
ATOM   998   C  CA   . ARG A 1 65  ? 3.475   11.566  -8.154  1.00 0.00 ? 422 ARG A CA   1  
ATOM   999   C  C    . ARG A 1 65  ? 3.363   10.071  -8.437  1.00 0.00 ? 422 ARG A C    1  
ATOM   1000  O  O    . ARG A 1 65  ? 3.345   9.646   -9.593  1.00 0.00 ? 422 ARG A O    1  
ATOM   1001  C  CB   . ARG A 1 65  ? 4.876   11.893  -7.632  1.00 0.00 ? 422 ARG A CB   1  
ATOM   1002  C  CG   . ARG A 1 65  ? 5.941   11.909  -8.716  1.00 0.00 ? 422 ARG A CG   1  
ATOM   1003  C  CD   . ARG A 1 65  ? 7.325   12.150  -8.132  1.00 0.00 ? 422 ARG A CD   1  
ATOM   1004  N  NE   . ARG A 1 65  ? 7.448   13.482  -7.547  1.00 0.00 ? 422 ARG A NE   1  
ATOM   1005  C  CZ   . ARG A 1 65  ? 8.604   14.124  -7.417  1.00 0.00 ? 422 ARG A CZ   1  
ATOM   1006  N  NH1  . ARG A 1 65  ? 9.730   13.559  -7.831  1.00 0.00 ? 422 ARG A NH1  1  
ATOM   1007  N  NH2  . ARG A 1 65  ? 8.634   15.334  -6.874  1.00 0.00 ? 422 ARG A NH2  1  
ATOM   1008  H  H    . ARG A 1 65  ? 2.749   12.410  -6.354  1.00 0.00 ? 422 ARG A H    1  
ATOM   1009  H  HA   . ARG A 1 65  ? 3.308   12.108  -9.073  1.00 0.00 ? 422 ARG A HA   1  
ATOM   1010  H  HB2  . ARG A 1 65  ? 4.855   12.867  -7.165  1.00 0.00 ? 422 ARG A HB2  1  
ATOM   1011  H  HB3  . ARG A 1 65  ? 5.153   11.155  -6.895  1.00 0.00 ? 422 ARG A HB3  1  
ATOM   1012  H  HG2  . ARG A 1 65  ? 5.938   10.957  -9.225  1.00 0.00 ? 422 ARG A HG2  1  
ATOM   1013  H  HG3  . ARG A 1 65  ? 5.714   12.696  -9.419  1.00 0.00 ? 422 ARG A HG3  1  
ATOM   1014  H  HD2  . ARG A 1 65  ? 7.512   11.412  -7.367  1.00 0.00 ? 422 ARG A HD2  1  
ATOM   1015  H  HD3  . ARG A 1 65  ? 8.056   12.044  -8.920  1.00 0.00 ? 422 ARG A HD3  1  
ATOM   1016  H  HE   . ARG A 1 65  ? 6.628   13.918  -7.234  1.00 0.00 ? 422 ARG A HE   1  
ATOM   1017  H  HH11 . ARG A 1 65  ? 9.709   12.648  -8.241  1.00 0.00 ? 422 ARG A HH11 1  
ATOM   1018  H  HH12 . ARG A 1 65  ? 10.598  14.046  -7.733  1.00 0.00 ? 422 ARG A HH12 1  
ATOM   1019  H  HH21 . ARG A 1 65  ? 7.787   15.763  -6.561  1.00 0.00 ? 422 ARG A HH21 1  
ATOM   1020  H  HH22 . ARG A 1 65  ? 9.504   15.817  -6.777  1.00 0.00 ? 422 ARG A HH22 1  
ATOM   1021  N  N    . HIS A 1 66  ? 3.288   9.277   -7.373  1.00 0.00 ? 423 HIS A N    1  
ATOM   1022  C  CA   . HIS A 1 66  ? 3.177   7.828   -7.507  1.00 0.00 ? 423 HIS A CA   1  
ATOM   1023  C  C    . HIS A 1 66  ? 1.982   7.453   -8.379  1.00 0.00 ? 423 HIS A C    1  
ATOM   1024  O  O    . HIS A 1 66  ? 2.094   6.615   -9.274  1.00 0.00 ? 423 HIS A O    1  
ATOM   1025  C  CB   . HIS A 1 66  ? 3.044   7.177   -6.131  1.00 0.00 ? 423 HIS A CB   1  
ATOM   1026  C  CG   . HIS A 1 66  ? 2.410   5.820   -6.169  1.00 0.00 ? 423 HIS A CG   1  
ATOM   1027  N  ND1  . HIS A 1 66  ? 3.118   4.666   -6.434  1.00 0.00 ? 423 HIS A ND1  1  
ATOM   1028  C  CD2  . HIS A 1 66  ? 1.127   5.436   -5.972  1.00 0.00 ? 423 HIS A CD2  1  
ATOM   1029  C  CE1  . HIS A 1 66  ? 2.297   3.632   -6.401  1.00 0.00 ? 423 HIS A CE1  1  
ATOM   1030  N  NE2  . HIS A 1 66  ? 1.083   4.071   -6.122  1.00 0.00 ? 423 HIS A NE2  1  
ATOM   1031  H  H    . HIS A 1 66  ? 3.307   9.674   -6.478  1.00 0.00 ? 423 HIS A H    1  
ATOM   1032  H  HA   . HIS A 1 66  ? 4.078   7.469   -7.980  1.00 0.00 ? 423 HIS A HA   1  
ATOM   1033  H  HB2  . HIS A 1 66  ? 4.025   7.072   -5.693  1.00 0.00 ? 423 HIS A HB2  1  
ATOM   1034  H  HB3  . HIS A 1 66  ? 2.438   7.809   -5.497  1.00 0.00 ? 423 HIS A HB3  1  
ATOM   1035  H  HD1  . HIS A 1 66  ? 4.078   4.614   -6.621  1.00 0.00 ? 423 HIS A HD1  1  
ATOM   1036  H  HD2  . HIS A 1 66  ? 0.292   6.082   -5.741  1.00 0.00 ? 423 HIS A HD2  1  
ATOM   1037  H  HE1  . HIS A 1 66  ? 2.571   2.601   -6.571  1.00 0.00 ? 423 HIS A HE1  1  
ATOM   1038  N  N    . TYR A 1 67  ? 0.841   8.077   -8.110  1.00 0.00 ? 424 TYR A N    1  
ATOM   1039  C  CA   . TYR A 1 67  ? -0.375  7.807   -8.868  1.00 0.00 ? 424 TYR A CA   1  
ATOM   1040  C  C    . TYR A 1 67  ? -0.130  7.963   -10.366 1.00 0.00 ? 424 TYR A C    1  
ATOM   1041  O  O    . TYR A 1 67  ? -0.674  7.213   -11.176 1.00 0.00 ? 424 TYR A O    1  
ATOM   1042  C  CB   . TYR A 1 67  ? -1.498  8.745   -8.423  1.00 0.00 ? 424 TYR A CB   1  
ATOM   1043  C  CG   . TYR A 1 67  ? -2.882  8.168   -8.617  1.00 0.00 ? 424 TYR A CG   1  
ATOM   1044  C  CD1  . TYR A 1 67  ? -3.479  7.395   -7.629  1.00 0.00 ? 424 TYR A CD1  1  
ATOM   1045  C  CD2  . TYR A 1 67  ? -3.593  8.397   -9.788  1.00 0.00 ? 424 TYR A CD2  1  
ATOM   1046  C  CE1  . TYR A 1 67  ? -4.743  6.865   -7.803  1.00 0.00 ? 424 TYR A CE1  1  
ATOM   1047  C  CE2  . TYR A 1 67  ? -4.858  7.873   -9.970  1.00 0.00 ? 424 TYR A CE2  1  
ATOM   1048  C  CZ   . TYR A 1 67  ? -5.428  7.107   -8.975  1.00 0.00 ? 424 TYR A CZ   1  
ATOM   1049  O  OH   . TYR A 1 67  ? -6.688  6.583   -9.151  1.00 0.00 ? 424 TYR A OH   1  
ATOM   1050  H  H    . TYR A 1 67  ? 0.815   8.735   -7.384  1.00 0.00 ? 424 TYR A H    1  
ATOM   1051  H  HA   . TYR A 1 67  ? -0.670  6.787   -8.667  1.00 0.00 ? 424 TYR A HA   1  
ATOM   1052  H  HB2  . TYR A 1 67  ? -1.377  8.969   -7.374  1.00 0.00 ? 424 TYR A HB2  1  
ATOM   1053  H  HB3  . TYR A 1 67  ? -1.438  9.662   -8.991  1.00 0.00 ? 424 TYR A HB3  1  
ATOM   1054  H  HD1  . TYR A 1 67  ? -2.939  7.207   -6.712  1.00 0.00 ? 424 TYR A HD1  1  
ATOM   1055  H  HD2  . TYR A 1 67  ? -3.144  8.998   -10.566 1.00 0.00 ? 424 TYR A HD2  1  
ATOM   1056  H  HE1  . TYR A 1 67  ? -5.189  6.266   -7.023  1.00 0.00 ? 424 TYR A HE1  1  
ATOM   1057  H  HE2  . TYR A 1 67  ? -5.396  8.062   -10.888 1.00 0.00 ? 424 TYR A HE2  1  
ATOM   1058  H  HH   . TYR A 1 67  ? -6.825  5.863   -8.530  1.00 0.00 ? 424 TYR A HH   1  
ATOM   1059  N  N    . ARG A 1 68  ? 0.693   8.942   -10.725 1.00 0.00 ? 425 ARG A N    1  
ATOM   1060  C  CA   . ARG A 1 68  ? 1.011   9.199   -12.124 1.00 0.00 ? 425 ARG A CA   1  
ATOM   1061  C  C    . ARG A 1 68  ? 1.382   7.905   -12.843 1.00 0.00 ? 425 ARG A C    1  
ATOM   1062  O  O    . ARG A 1 68  ? 0.962   7.669   -13.977 1.00 0.00 ? 425 ARG A O    1  
ATOM   1063  C  CB   . ARG A 1 68  ? 2.161   10.202  -12.233 1.00 0.00 ? 425 ARG A CB   1  
ATOM   1064  C  CG   . ARG A 1 68  ? 1.882   11.525  -11.539 1.00 0.00 ? 425 ARG A CG   1  
ATOM   1065  C  CD   . ARG A 1 68  ? 1.062   12.454  -12.421 1.00 0.00 ? 425 ARG A CD   1  
ATOM   1066  N  NE   . ARG A 1 68  ? 0.584   13.624  -11.688 1.00 0.00 ? 425 ARG A NE   1  
ATOM   1067  C  CZ   . ARG A 1 68  ? 0.125   14.723  -12.276 1.00 0.00 ? 425 ARG A CZ   1  
ATOM   1068  N  NH1  . ARG A 1 68  ? 0.083   14.802  -13.599 1.00 0.00 ? 425 ARG A NH1  1  
ATOM   1069  N  NH2  . ARG A 1 68  ? -0.293  15.745  -11.541 1.00 0.00 ? 425 ARG A NH2  1  
ATOM   1070  H  H    . ARG A 1 68  ? 1.096   9.507   -10.032 1.00 0.00 ? 425 ARG A H    1  
ATOM   1071  H  HA   . ARG A 1 68  ? 0.133   9.618   -12.592 1.00 0.00 ? 425 ARG A HA   1  
ATOM   1072  H  HB2  . ARG A 1 68  ? 3.045   9.768   -11.790 1.00 0.00 ? 425 ARG A HB2  1  
ATOM   1073  H  HB3  . ARG A 1 68  ? 2.351   10.401  -13.277 1.00 0.00 ? 425 ARG A HB3  1  
ATOM   1074  H  HG2  . ARG A 1 68  ? 1.333   11.335  -10.628 1.00 0.00 ? 425 ARG A HG2  1  
ATOM   1075  H  HG3  . ARG A 1 68  ? 2.821   12.002  -11.303 1.00 0.00 ? 425 ARG A HG3  1  
ATOM   1076  H  HD2  . ARG A 1 68  ? 1.678   12.785  -13.243 1.00 0.00 ? 425 ARG A HD2  1  
ATOM   1077  H  HD3  . ARG A 1 68  ? 0.213   11.909  -12.804 1.00 0.00 ? 425 ARG A HD3  1  
ATOM   1078  H  HE   . ARG A 1 68  ? 0.606   13.586  -10.709 1.00 0.00 ? 425 ARG A HE   1  
ATOM   1079  H  HH11 . ARG A 1 68  ? 0.396   14.033  -14.155 1.00 0.00 ? 425 ARG A HH11 1  
ATOM   1080  H  HH12 . ARG A 1 68  ? -0.264  15.631  -14.039 1.00 0.00 ? 425 ARG A HH12 1  
ATOM   1081  H  HH21 . ARG A 1 68  ? -0.263  15.689  -10.543 1.00 0.00 ? 425 ARG A HH21 1  
ATOM   1082  H  HH22 . ARG A 1 68  ? -0.637  16.572  -11.984 1.00 0.00 ? 425 ARG A HH22 1  
ATOM   1083  N  N    . LYS A 1 69  ? 2.171   7.069   -12.177 1.00 0.00 ? 426 LYS A N    1  
ATOM   1084  C  CA   . LYS A 1 69  ? 2.599   5.798   -12.751 1.00 0.00 ? 426 LYS A CA   1  
ATOM   1085  C  C    . LYS A 1 69  ? 1.405   5.014   -13.287 1.00 0.00 ? 426 LYS A C    1  
ATOM   1086  O  O    . LYS A 1 69  ? 1.477   4.409   -14.357 1.00 0.00 ? 426 LYS A O    1  
ATOM   1087  C  CB   . LYS A 1 69  ? 3.340   4.966   -11.703 1.00 0.00 ? 426 LYS A CB   1  
ATOM   1088  C  CG   . LYS A 1 69  ? 4.497   5.701   -11.049 1.00 0.00 ? 426 LYS A CG   1  
ATOM   1089  C  CD   . LYS A 1 69  ? 5.795   5.489   -11.812 1.00 0.00 ? 426 LYS A CD   1  
ATOM   1090  C  CE   . LYS A 1 69  ? 5.918   6.453   -12.982 1.00 0.00 ? 426 LYS A CE   1  
ATOM   1091  N  NZ   . LYS A 1 69  ? 7.339   6.773   -13.289 1.00 0.00 ? 426 LYS A NZ   1  
ATOM   1092  H  H    . LYS A 1 69  ? 2.473   7.313   -11.277 1.00 0.00 ? 426 LYS A H    1  
ATOM   1093  H  HA   . LYS A 1 69  ? 3.270   6.013   -13.569 1.00 0.00 ? 426 LYS A HA   1  
ATOM   1094  H  HB2  . LYS A 1 69  ? 2.642   4.677   -10.931 1.00 0.00 ? 426 LYS A HB2  1  
ATOM   1095  H  HB3  . LYS A 1 69  ? 3.728   4.076   -12.177 1.00 0.00 ? 426 LYS A HB3  1  
ATOM   1096  H  HG2  . LYS A 1 69  ? 4.274   6.757   -11.027 1.00 0.00 ? 426 LYS A HG2  1  
ATOM   1097  H  HG3  . LYS A 1 69  ? 4.620   5.336   -10.040 1.00 0.00 ? 426 LYS A HG3  1  
ATOM   1098  H  HD2  . LYS A 1 69  ? 6.626   5.646   -11.141 1.00 0.00 ? 426 LYS A HD2  1  
ATOM   1099  H  HD3  . LYS A 1 69  ? 5.820   4.475   -12.187 1.00 0.00 ? 426 LYS A HD3  1  
ATOM   1100  H  HE2  . LYS A 1 69  ? 5.463   6.003   -13.851 1.00 0.00 ? 426 LYS A HE2  1  
ATOM   1101  H  HE3  . LYS A 1 69  ? 5.397   7.366   -12.735 1.00 0.00 ? 426 LYS A HE3  1  
ATOM   1102  H  HZ1  . LYS A 1 69  ? 7.450   6.971   -14.304 1.00 0.00 ? 426 LYS A HZ1  1  
ATOM   1103  H  HZ2  . LYS A 1 69  ? 7.949   5.970   -13.035 1.00 0.00 ? 426 LYS A HZ2  1  
ATOM   1104  H  HZ3  . LYS A 1 69  ? 7.642   7.608   -12.749 1.00 0.00 ? 426 LYS A HZ3  1  
ATOM   1105  N  N    . HIS A 1 70  ? 0.307   5.031   -12.537 1.00 0.00 ? 427 HIS A N    1  
ATOM   1106  C  CA   . HIS A 1 70  ? -0.903  4.323   -12.939 1.00 0.00 ? 427 HIS A CA   1  
ATOM   1107  C  C    . HIS A 1 70  ? -1.600  5.045   -14.088 1.00 0.00 ? 427 HIS A C    1  
ATOM   1108  O  O    . HIS A 1 70  ? -2.081  4.416   -15.031 1.00 0.00 ? 427 HIS A O    1  
ATOM   1109  C  CB   . HIS A 1 70  ? -1.858  4.189   -11.752 1.00 0.00 ? 427 HIS A CB   1  
ATOM   1110  C  CG   . HIS A 1 70  ? -1.252  3.498   -10.570 1.00 0.00 ? 427 HIS A CG   1  
ATOM   1111  N  ND1  . HIS A 1 70  ? -0.651  2.259   -10.649 1.00 0.00 ? 427 HIS A ND1  1  
ATOM   1112  C  CD2  . HIS A 1 70  ? -1.153  3.880   -9.276  1.00 0.00 ? 427 HIS A CD2  1  
ATOM   1113  C  CE1  . HIS A 1 70  ? -0.212  1.908   -9.454  1.00 0.00 ? 427 HIS A CE1  1  
ATOM   1114  N  NE2  . HIS A 1 70  ? -0.503  2.875   -8.603  1.00 0.00 ? 427 HIS A NE2  1  
ATOM   1115  H  H    . HIS A 1 70  ? 0.311   5.531   -11.695 1.00 0.00 ? 427 HIS A H    1  
ATOM   1116  H  HA   . HIS A 1 70  ? -0.616  3.337   -13.272 1.00 0.00 ? 427 HIS A HA   1  
ATOM   1117  H  HB2  . HIS A 1 70  ? -2.170  5.174   -11.436 1.00 0.00 ? 427 HIS A HB2  1  
ATOM   1118  H  HB3  . HIS A 1 70  ? -2.726  3.623   -12.059 1.00 0.00 ? 427 HIS A HB3  1  
ATOM   1119  H  HD1  . HIS A 1 70  ? -0.563  1.717   -11.460 1.00 0.00 ? 427 HIS A HD1  1  
ATOM   1120  H  HD2  . HIS A 1 70  ? -1.518  4.804   -8.850  1.00 0.00 ? 427 HIS A HD2  1  
ATOM   1121  H  HE1  . HIS A 1 70  ? 0.300   0.988   -9.213  1.00 0.00 ? 427 HIS A HE1  1  
ATOM   1122  N  N    . THR A 1 71  ? -1.650  6.371   -14.004 1.00 0.00 ? 428 THR A N    1  
ATOM   1123  C  CA   . THR A 1 71  ? -2.289  7.179   -15.035 1.00 0.00 ? 428 THR A CA   1  
ATOM   1124  C  C    . THR A 1 71  ? -1.322  7.482   -16.173 1.00 0.00 ? 428 THR A C    1  
ATOM   1125  O  O    . THR A 1 71  ? -1.440  8.506   -16.846 1.00 0.00 ? 428 THR A O    1  
ATOM   1126  C  CB   . THR A 1 71  ? -2.819  8.506   -14.460 1.00 0.00 ? 428 THR A CB   1  
ATOM   1127  O  OG1  . THR A 1 71  ? -1.756  9.226   -13.827 1.00 0.00 ? 428 THR A OG1  1  
ATOM   1128  C  CG2  . THR A 1 71  ? -3.935  8.254   -13.457 1.00 0.00 ? 428 THR A CG2  1  
ATOM   1129  H  H    . THR A 1 71  ? -1.248  6.815   -13.228 1.00 0.00 ? 428 THR A H    1  
ATOM   1130  H  HA   . THR A 1 71  ? -3.126  6.620   -15.426 1.00 0.00 ? 428 THR A HA   1  
ATOM   1131  H  HB   . THR A 1 71  ? -3.213  9.101   -15.272 1.00 0.00 ? 428 THR A HB   1  
ATOM   1132  H  HG1  . THR A 1 71  ? -1.067  9.411   -14.471 1.00 0.00 ? 428 THR A HG1  1  
ATOM   1133  H  HG21 . THR A 1 71  ? -4.870  8.130   -13.983 1.00 0.00 ? 428 THR A HG21 1  
ATOM   1134  H  HG22 . THR A 1 71  ? -4.010  9.095   -12.783 1.00 0.00 ? 428 THR A HG22 1  
ATOM   1135  H  HG23 . THR A 1 71  ? -3.717  7.359   -12.894 1.00 0.00 ? 428 THR A HG23 1  
ATOM   1136  N  N    . GLY A 1 72  ? -0.364  6.584   -16.385 1.00 0.00 ? 429 GLY A N    1  
ATOM   1137  C  CA   . GLY A 1 72  ? 0.610   6.774   -17.444 1.00 0.00 ? 429 GLY A CA   1  
ATOM   1138  C  C    . GLY A 1 72  ? 0.974   5.476   -18.136 1.00 0.00 ? 429 GLY A C    1  
ATOM   1139  O  O    . GLY A 1 72  ? 0.208   4.962   -18.951 1.00 0.00 ? 429 GLY A O    1  
ATOM   1140  H  H    . GLY A 1 72  ? -0.318  5.787   -15.817 1.00 0.00 ? 429 GLY A H    1  
ATOM   1141  H  HA2  . GLY A 1 72  ? 0.202   7.457   -18.175 1.00 0.00 ? 429 GLY A HA2  1  
ATOM   1142  H  HA3  . GLY A 1 72  ? 1.505   7.207   -17.022 1.00 0.00 ? 429 GLY A HA3  1  
ATOM   1143  N  N    . ALA A 1 73  ? 2.149   4.944   -17.813 1.00 0.00 ? 430 ALA A N    1  
ATOM   1144  C  CA   . ALA A 1 73  ? 2.613   3.698   -18.409 1.00 0.00 ? 430 ALA A CA   1  
ATOM   1145  C  C    . ALA A 1 73  ? 2.545   2.551   -17.406 1.00 0.00 ? 430 ALA A C    1  
ATOM   1146  O  O    . ALA A 1 73  ? 2.594   2.768   -16.195 1.00 0.00 ? 430 ALA A O    1  
ATOM   1147  C  CB   . ALA A 1 73  ? 4.032   3.860   -18.933 1.00 0.00 ? 430 ALA A CB   1  
ATOM   1148  H  H    . ALA A 1 73  ? 2.715   5.401   -17.157 1.00 0.00 ? 430 ALA A H    1  
ATOM   1149  H  HA   . ALA A 1 73  ? 1.970   3.469   -19.247 1.00 0.00 ? 430 ALA A HA   1  
ATOM   1150  H  HB1  . ALA A 1 73  ? 4.416   4.826   -18.640 1.00 0.00 ? 430 ALA A HB1  1  
ATOM   1151  H  HB2  . ALA A 1 73  ? 4.659   3.083   -18.520 1.00 0.00 ? 430 ALA A HB2  1  
ATOM   1152  H  HB3  . ALA A 1 73  ? 4.029   3.786   -20.011 1.00 0.00 ? 430 ALA A HB3  1  
ATOM   1153  N  N    . LYS A 1 74  ? 2.432   1.330   -17.918 1.00 0.00 ? 431 LYS A N    1  
ATOM   1154  C  CA   . LYS A 1 74  ? 2.358   0.148   -17.068 1.00 0.00 ? 431 LYS A CA   1  
ATOM   1155  C  C    . LYS A 1 74  ? 3.378   -0.900  -17.503 1.00 0.00 ? 431 LYS A C    1  
ATOM   1156  O  O    . LYS A 1 74  ? 3.555   -1.174  -18.690 1.00 0.00 ? 431 LYS A O    1  
ATOM   1157  C  CB   . LYS A 1 74  ? 0.949   -0.448  -17.109 1.00 0.00 ? 431 LYS A CB   1  
ATOM   1158  C  CG   . LYS A 1 74  ? 0.701   -1.497  -16.039 1.00 0.00 ? 431 LYS A CG   1  
ATOM   1159  C  CD   . LYS A 1 74  ? 0.510   -0.864  -14.671 1.00 0.00 ? 431 LYS A CD   1  
ATOM   1160  C  CE   . LYS A 1 74  ? -0.950  -0.524  -14.413 1.00 0.00 ? 431 LYS A CE   1  
ATOM   1161  N  NZ   . LYS A 1 74  ? -1.111  0.364   -13.228 1.00 0.00 ? 431 LYS A NZ   1  
ATOM   1162  H  H    . LYS A 1 74  ? 2.399   1.221   -18.892 1.00 0.00 ? 431 LYS A H    1  
ATOM   1163  H  HA   . LYS A 1 74  ? 2.582   0.452   -16.056 1.00 0.00 ? 431 LYS A HA   1  
ATOM   1164  H  HB2  . LYS A 1 74  ? 0.231   0.347   -16.978 1.00 0.00 ? 431 LYS A HB2  1  
ATOM   1165  H  HB3  . LYS A 1 74  ? 0.794   -0.906  -18.076 1.00 0.00 ? 431 LYS A HB3  1  
ATOM   1166  H  HG2  . LYS A 1 74  ? -0.189  -2.054  -16.293 1.00 0.00 ? 431 LYS A HG2  1  
ATOM   1167  H  HG3  . LYS A 1 74  ? 1.548   -2.167  -16.001 1.00 0.00 ? 431 LYS A HG3  1  
ATOM   1168  H  HD2  . LYS A 1 74  ? 0.846   -1.556  -13.913 1.00 0.00 ? 431 LYS A HD2  1  
ATOM   1169  H  HD3  . LYS A 1 74  ? 1.097   0.043   -14.619 1.00 0.00 ? 431 LYS A HD3  1  
ATOM   1170  H  HE2  . LYS A 1 74  ? -1.349  -0.025  -15.283 1.00 0.00 ? 431 LYS A HE2  1  
ATOM   1171  H  HE3  . LYS A 1 74  ? -1.494  -1.441  -14.242 1.00 0.00 ? 431 LYS A HE3  1  
ATOM   1172  H  HZ1  . LYS A 1 74  ? -2.098  0.680   -13.150 1.00 0.00 ? 431 LYS A HZ1  1  
ATOM   1173  H  HZ2  . LYS A 1 74  ? -0.497  1.199   -13.321 1.00 0.00 ? 431 LYS A HZ2  1  
ATOM   1174  H  HZ3  . LYS A 1 74  ? -0.852  -0.147  -12.360 1.00 0.00 ? 431 LYS A HZ3  1  
ATOM   1175  N  N    . PRO A 1 75  ? 4.065   -1.502  -16.521 1.00 0.00 ? 432 PRO A N    1  
ATOM   1176  C  CA   . PRO A 1 75  ? 5.077   -2.531  -16.778 1.00 0.00 ? 432 PRO A CA   1  
ATOM   1177  C  C    . PRO A 1 75  ? 4.465   -3.833  -17.282 1.00 0.00 ? 432 PRO A C    1  
ATOM   1178  O  O    . PRO A 1 75  ? 5.169   -4.819  -17.498 1.00 0.00 ? 432 PRO A O    1  
ATOM   1179  C  CB   . PRO A 1 75  ? 5.727   -2.740  -15.408 1.00 0.00 ? 432 PRO A CB   1  
ATOM   1180  C  CG   . PRO A 1 75  ? 4.682   -2.334  -14.427 1.00 0.00 ? 432 PRO A CG   1  
ATOM   1181  C  CD   . PRO A 1 75  ? 3.906   -1.225  -15.083 1.00 0.00 ? 432 PRO A CD   1  
ATOM   1182  H  HA   . PRO A 1 75  ? 5.821   -2.188  -17.483 1.00 0.00 ? 432 PRO A HA   1  
ATOM   1183  H  HB2  . PRO A 1 75  ? 5.998   -3.780  -15.291 1.00 0.00 ? 432 PRO A HB2  1  
ATOM   1184  H  HB3  . PRO A 1 75  ? 6.607   -2.121  -15.325 1.00 0.00 ? 432 PRO A HB3  1  
ATOM   1185  H  HG2  . PRO A 1 75  ? 4.033   -3.171  -14.215 1.00 0.00 ? 432 PRO A HG2  1  
ATOM   1186  H  HG3  . PRO A 1 75  ? 5.148   -1.979  -13.520 1.00 0.00 ? 432 PRO A HG3  1  
ATOM   1187  H  HD2  . PRO A 1 75  ? 2.867   -1.270  -14.794 1.00 0.00 ? 432 PRO A HD2  1  
ATOM   1188  H  HD3  . PRO A 1 75  ? 4.330   -0.266  -14.827 1.00 0.00 ? 432 PRO A HD3  1  
ATOM   1189  N  N    . PHE A 1 76  ? 3.149   -3.830  -17.467 1.00 0.00 ? 433 PHE A N    1  
ATOM   1190  C  CA   . PHE A 1 76  ? 2.441   -5.013  -17.945 1.00 0.00 ? 433 PHE A CA   1  
ATOM   1191  C  C    . PHE A 1 76  ? 1.290   -4.622  -18.867 1.00 0.00 ? 433 PHE A C    1  
ATOM   1192  O  O    . PHE A 1 76  ? 0.312   -4.016  -18.432 1.00 0.00 ? 433 PHE A O    1  
ATOM   1193  C  CB   . PHE A 1 76  ? 1.909   -5.827  -16.763 1.00 0.00 ? 433 PHE A CB   1  
ATOM   1194  C  CG   . PHE A 1 76  ? 2.978   -6.244  -15.793 1.00 0.00 ? 433 PHE A CG   1  
ATOM   1195  C  CD1  . PHE A 1 76  ? 3.910   -7.209  -16.141 1.00 0.00 ? 433 PHE A CD1  1  
ATOM   1196  C  CD2  . PHE A 1 76  ? 3.050   -5.672  -14.533 1.00 0.00 ? 433 PHE A CD2  1  
ATOM   1197  C  CE1  . PHE A 1 76  ? 4.894   -7.595  -15.251 1.00 0.00 ? 433 PHE A CE1  1  
ATOM   1198  C  CE2  . PHE A 1 76  ? 4.032   -6.054  -13.639 1.00 0.00 ? 433 PHE A CE2  1  
ATOM   1199  C  CZ   . PHE A 1 76  ? 4.955   -7.017  -13.998 1.00 0.00 ? 433 PHE A CZ   1  
ATOM   1200  H  H    . PHE A 1 76  ? 2.641   -3.014  -17.276 1.00 0.00 ? 433 PHE A H    1  
ATOM   1201  H  HA   . PHE A 1 76  ? 3.143   -5.616  -18.500 1.00 0.00 ? 433 PHE A HA   1  
ATOM   1202  H  HB2  . PHE A 1 76  ? 1.185   -5.235  -16.224 1.00 0.00 ? 433 PHE A HB2  1  
ATOM   1203  H  HB3  . PHE A 1 76  ? 1.432   -6.720  -17.137 1.00 0.00 ? 433 PHE A HB3  1  
ATOM   1204  H  HD1  . PHE A 1 76  ? 3.863   -7.662  -17.122 1.00 0.00 ? 433 PHE A HD1  1  
ATOM   1205  H  HD2  . PHE A 1 76  ? 2.328   -4.920  -14.251 1.00 0.00 ? 433 PHE A HD2  1  
ATOM   1206  H  HE1  . PHE A 1 76  ? 5.614   -8.348  -15.536 1.00 0.00 ? 433 PHE A HE1  1  
ATOM   1207  H  HE2  . PHE A 1 76  ? 4.077   -5.601  -12.660 1.00 0.00 ? 433 PHE A HE2  1  
ATOM   1208  H  HZ   . PHE A 1 76  ? 5.723   -7.317  -13.302 1.00 0.00 ? 433 PHE A HZ   1  
ATOM   1209  N  N    . GLN A 1 77  ? 1.416   -4.974  -20.142 1.00 0.00 ? 434 GLN A N    1  
ATOM   1210  C  CA   . GLN A 1 77  ? 0.388   -4.659  -21.126 1.00 0.00 ? 434 GLN A CA   1  
ATOM   1211  C  C    . GLN A 1 77  ? 0.143   -5.842  -22.057 1.00 0.00 ? 434 GLN A C    1  
ATOM   1212  O  O    . GLN A 1 77  ? 1.082   -6.410  -22.616 1.00 0.00 ? 434 GLN A O    1  
ATOM   1213  C  CB   . GLN A 1 77  ? 0.791   -3.429  -21.942 1.00 0.00 ? 434 GLN A CB   1  
ATOM   1214  C  CG   . GLN A 1 77  ? -0.354  -2.824  -22.738 1.00 0.00 ? 434 GLN A CG   1  
ATOM   1215  C  CD   . GLN A 1 77  ? 0.119   -2.103  -23.985 1.00 0.00 ? 434 GLN A CD   1  
ATOM   1216  O  OE1  . GLN A 1 77  ? 0.836   -1.105  -23.904 1.00 0.00 ? 434 GLN A OE1  1  
ATOM   1217  N  NE2  . GLN A 1 77  ? -0.280  -2.606  -25.147 1.00 0.00 ? 434 GLN A NE2  1  
ATOM   1218  H  H    . GLN A 1 77  ? 2.220   -5.455  -20.428 1.00 0.00 ? 434 GLN A H    1  
ATOM   1219  H  HA   . GLN A 1 77  ? -0.526  -4.442  -20.593 1.00 0.00 ? 434 GLN A HA   1  
ATOM   1220  H  HB2  . GLN A 1 77  ? 1.171   -2.675  -21.269 1.00 0.00 ? 434 GLN A HB2  1  
ATOM   1221  H  HB3  . GLN A 1 77  ? 1.572   -3.710  -22.633 1.00 0.00 ? 434 GLN A HB3  1  
ATOM   1222  H  HG2  . GLN A 1 77  ? -1.028  -3.615  -23.033 1.00 0.00 ? 434 GLN A HG2  1  
ATOM   1223  H  HG3  . GLN A 1 77  ? -0.879  -2.120  -22.110 1.00 0.00 ? 434 GLN A HG3  1  
ATOM   1224  H  HE21 . GLN A 1 77  ? -0.851  -3.403  -25.135 1.00 0.00 ? 434 GLN A HE21 1  
ATOM   1225  H  HE22 . GLN A 1 77  ? 0.010   -2.159  -25.969 1.00 0.00 ? 434 GLN A HE22 1  
ATOM   1226  N  N    . CYS A 1 78  ? -1.123  -6.210  -22.218 1.00 0.00 ? 435 CYS A N    1  
ATOM   1227  C  CA   . CYS A 1 78  ? -1.492  -7.327  -23.080 1.00 0.00 ? 435 CYS A CA   1  
ATOM   1228  C  C    . CYS A 1 78  ? -1.256  -6.982  -24.548 1.00 0.00 ? 435 CYS A C    1  
ATOM   1229  O  O    . CYS A 1 78  ? -0.878  -5.859  -24.880 1.00 0.00 ? 435 CYS A O    1  
ATOM   1230  C  CB   . CYS A 1 78  ? -2.959  -7.703  -22.863 1.00 0.00 ? 435 CYS A CB   1  
ATOM   1231  S  SG   . CYS A 1 78  ? -3.334  -9.455  -23.193 1.00 0.00 ? 435 CYS A SG   1  
ATOM   1232  H  H    . CYS A 1 78  ? -1.828  -5.718  -21.746 1.00 0.00 ? 435 CYS A H    1  
ATOM   1233  H  HA   . CYS A 1 78  ? -0.870  -8.169  -22.816 1.00 0.00 ? 435 CYS A HA   1  
ATOM   1234  H  HB2  . CYS A 1 78  ? -3.227  -7.498  -21.836 1.00 0.00 ? 435 CYS A HB2  1  
ATOM   1235  H  HB3  . CYS A 1 78  ? -3.577  -7.105  -23.516 1.00 0.00 ? 435 CYS A HB3  1  
ATOM   1236  N  N    . GLY A 1 79  ? -1.481  -7.958  -25.423 1.00 0.00 ? 436 GLY A N    1  
ATOM   1237  C  CA   . GLY A 1 79  ? -1.288  -7.738  -26.844 1.00 0.00 ? 436 GLY A CA   1  
ATOM   1238  C  C    . GLY A 1 79  ? -2.599  -7.595  -27.592 1.00 0.00 ? 436 GLY A C    1  
ATOM   1239  O  O    . GLY A 1 79  ? -2.830  -6.593  -28.268 1.00 0.00 ? 436 GLY A O    1  
ATOM   1240  H  H    . GLY A 1 79  ? -1.781  -8.833  -25.100 1.00 0.00 ? 436 GLY A H    1  
ATOM   1241  H  HA2  . GLY A 1 79  ? -0.706  -6.839  -26.983 1.00 0.00 ? 436 GLY A HA2  1  
ATOM   1242  H  HA3  . GLY A 1 79  ? -0.743  -8.575  -27.255 1.00 0.00 ? 436 GLY A HA3  1  
ATOM   1243  N  N    . VAL A 1 80  ? -3.460  -8.601  -27.473 1.00 0.00 ? 437 VAL A N    1  
ATOM   1244  C  CA   . VAL A 1 80  ? -4.754  -8.583  -28.143 1.00 0.00 ? 437 VAL A CA   1  
ATOM   1245  C  C    . VAL A 1 80  ? -5.606  -7.414  -27.662 1.00 0.00 ? 437 VAL A C    1  
ATOM   1246  O  O    . VAL A 1 80  ? -5.876  -6.477  -28.415 1.00 0.00 ? 437 VAL A O    1  
ATOM   1247  C  CB   . VAL A 1 80  ? -5.525  -9.896  -27.910 1.00 0.00 ? 437 VAL A CB   1  
ATOM   1248  C  CG1  . VAL A 1 80  ? -6.899  -9.831  -28.559 1.00 0.00 ? 437 VAL A CG1  1  
ATOM   1249  C  CG2  . VAL A 1 80  ? -4.732  -11.081 -28.441 1.00 0.00 ? 437 VAL A CG2  1  
ATOM   1250  H  H    . VAL A 1 80  ? -3.219  -9.373  -26.920 1.00 0.00 ? 437 VAL A H    1  
ATOM   1251  H  HA   . VAL A 1 80  ? -4.579  -8.476  -29.204 1.00 0.00 ? 437 VAL A HA   1  
ATOM   1252  H  HB   . VAL A 1 80  ? -5.660  -10.027 -26.846 1.00 0.00 ? 437 VAL A HB   1  
ATOM   1253  H  HG11 . VAL A 1 80  ? -6.796  -9.925  -29.630 1.00 0.00 ? 437 VAL A HG11 1  
ATOM   1254  H  HG12 . VAL A 1 80  ? -7.514  -10.636 -28.183 1.00 0.00 ? 437 VAL A HG12 1  
ATOM   1255  H  HG13 . VAL A 1 80  ? -7.363  -8.884  -28.325 1.00 0.00 ? 437 VAL A HG13 1  
ATOM   1256  H  HG21 . VAL A 1 80  ? -5.111  -11.993 -28.004 1.00 0.00 ? 437 VAL A HG21 1  
ATOM   1257  H  HG22 . VAL A 1 80  ? -4.830  -11.127 -29.515 1.00 0.00 ? 437 VAL A HG22 1  
ATOM   1258  H  HG23 . VAL A 1 80  ? -3.690  -10.963 -28.179 1.00 0.00 ? 437 VAL A HG23 1  
ATOM   1259  N  N    . CYS A 1 81  ? -6.027  -7.474  -26.404 1.00 0.00 ? 438 CYS A N    1  
ATOM   1260  C  CA   . CYS A 1 81  ? -6.849  -6.421  -25.820 1.00 0.00 ? 438 CYS A CA   1  
ATOM   1261  C  C    . CYS A 1 81  ? -6.038  -5.143  -25.624 1.00 0.00 ? 438 CYS A C    1  
ATOM   1262  O  O    . CYS A 1 81  ? -6.591  -4.046  -25.570 1.00 0.00 ? 438 CYS A O    1  
ATOM   1263  C  CB   . CYS A 1 81  ? -7.429  -6.880  -24.481 1.00 0.00 ? 438 CYS A CB   1  
ATOM   1264  S  SG   . CYS A 1 81  ? -6.180  -7.147  -23.182 1.00 0.00 ? 438 CYS A SG   1  
ATOM   1265  H  H    . CYS A 1 81  ? -5.779  -8.247  -25.853 1.00 0.00 ? 438 CYS A H    1  
ATOM   1266  H  HA   . CYS A 1 81  ? -7.660  -6.216  -26.503 1.00 0.00 ? 438 CYS A HA   1  
ATOM   1267  H  HB2  . CYS A 1 81  ? -8.121  -6.132  -24.122 1.00 0.00 ? 438 CYS A HB2  1  
ATOM   1268  H  HB3  . CYS A 1 81  ? -7.957  -7.811  -24.627 1.00 0.00 ? 438 CYS A HB3  1  
ATOM   1269  N  N    . ASN A 1 82  ? -4.721  -5.295  -25.520 1.00 0.00 ? 439 ASN A N    1  
ATOM   1270  C  CA   . ASN A 1 82  ? -3.833  -4.155  -25.329 1.00 0.00 ? 439 ASN A CA   1  
ATOM   1271  C  C    . ASN A 1 82  ? -4.187  -3.396  -24.054 1.00 0.00 ? 439 ASN A C    1  
ATOM   1272  O  O    . ASN A 1 82  ? -4.144  -2.166  -24.019 1.00 0.00 ? 439 ASN A O    1  
ATOM   1273  C  CB   . ASN A 1 82  ? -3.911  -3.214  -26.534 1.00 0.00 ? 439 ASN A CB   1  
ATOM   1274  C  CG   . ASN A 1 82  ? -3.584  -3.916  -27.838 1.00 0.00 ? 439 ASN A CG   1  
ATOM   1275  O  OD1  . ASN A 1 82  ? -4.477  -4.252  -28.616 1.00 0.00 ? 439 ASN A OD1  1  
ATOM   1276  N  ND2  . ASN A 1 82  ? -2.298  -4.141  -28.082 1.00 0.00 ? 439 ASN A ND2  1  
ATOM   1277  H  H    . ASN A 1 82  ? -4.338  -6.196  -25.571 1.00 0.00 ? 439 ASN A H    1  
ATOM   1278  H  HA   . ASN A 1 82  ? -2.825  -4.531  -25.243 1.00 0.00 ? 439 ASN A HA   1  
ATOM   1279  H  HB2  . ASN A 1 82  ? -4.912  -2.813  -26.605 1.00 0.00 ? 439 ASN A HB2  1  
ATOM   1280  H  HB3  . ASN A 1 82  ? -3.212  -2.403  -26.396 1.00 0.00 ? 439 ASN A HB3  1  
ATOM   1281  H  HD21 . ASN A 1 82  ? -1.642  -3.846  -27.416 1.00 0.00 ? 439 ASN A HD21 1  
ATOM   1282  H  HD22 . ASN A 1 82  ? -2.058  -4.592  -28.918 1.00 0.00 ? 439 ASN A HD22 1  
ATOM   1283  N  N    . ARG A 1 83  ? -4.536  -4.138  -23.008 1.00 0.00 ? 440 ARG A N    1  
ATOM   1284  C  CA   . ARG A 1 83  ? -4.898  -3.536  -21.731 1.00 0.00 ? 440 ARG A CA   1  
ATOM   1285  C  C    . ARG A 1 83  ? -3.679  -3.421  -20.819 1.00 0.00 ? 440 ARG A C    1  
ATOM   1286  O  O    . ARG A 1 83  ? -2.578  -3.832  -21.184 1.00 0.00 ? 440 ARG A O    1  
ATOM   1287  C  CB   . ARG A 1 83  ? -5.986  -4.363  -21.043 1.00 0.00 ? 440 ARG A CB   1  
ATOM   1288  C  CG   . ARG A 1 83  ? -7.384  -4.092  -21.574 1.00 0.00 ? 440 ARG A CG   1  
ATOM   1289  C  CD   . ARG A 1 83  ? -8.374  -5.143  -21.097 1.00 0.00 ? 440 ARG A CD   1  
ATOM   1290  N  NE   . ARG A 1 83  ? -9.749  -4.800  -21.450 1.00 0.00 ? 440 ARG A NE   1  
ATOM   1291  C  CZ   . ARG A 1 83  ? -10.506 -3.971  -20.740 1.00 0.00 ? 440 ARG A CZ   1  
ATOM   1292  N  NH1  . ARG A 1 83  ? -10.023 -3.403  -19.643 1.00 0.00 ? 440 ARG A NH1  1  
ATOM   1293  N  NH2  . ARG A 1 83  ? -11.747 -3.708  -21.126 1.00 0.00 ? 440 ARG A NH2  1  
ATOM   1294  H  H    . ARG A 1 83  ? -4.551  -5.114  -23.098 1.00 0.00 ? 440 ARG A H    1  
ATOM   1295  H  HA   . ARG A 1 83  ? -5.281  -2.546  -21.927 1.00 0.00 ? 440 ARG A HA   1  
ATOM   1296  H  HB2  . ARG A 1 83  ? -5.768  -5.412  -21.184 1.00 0.00 ? 440 ARG A HB2  1  
ATOM   1297  H  HB3  . ARG A 1 83  ? -5.976  -4.141  -19.986 1.00 0.00 ? 440 ARG A HB3  1  
ATOM   1298  H  HG2  . ARG A 1 83  ? -7.709  -3.123  -21.226 1.00 0.00 ? 440 ARG A HG2  1  
ATOM   1299  H  HG3  . ARG A 1 83  ? -7.356  -4.100  -22.653 1.00 0.00 ? 440 ARG A HG3  1  
ATOM   1300  H  HD2  . ARG A 1 83  ? -8.122  -6.089  -21.551 1.00 0.00 ? 440 ARG A HD2  1  
ATOM   1301  H  HD3  . ARG A 1 83  ? -8.299  -5.228  -20.023 1.00 0.00 ? 440 ARG A HD3  1  
ATOM   1302  H  HE   . ARG A 1 83  ? -10.126 -5.208  -22.257 1.00 0.00 ? 440 ARG A HE   1  
ATOM   1303  H  HH11 . ARG A 1 83  ? -9.087  -3.599  -19.350 1.00 0.00 ? 440 ARG A HH11 1  
ATOM   1304  H  HH12 . ARG A 1 83  ? -10.594 -2.778  -19.110 1.00 0.00 ? 440 ARG A HH12 1  
ATOM   1305  H  HH21 . ARG A 1 83  ? -12.115 -4.134  -21.952 1.00 0.00 ? 440 ARG A HH21 1  
ATOM   1306  H  HH22 . ARG A 1 83  ? -12.316 -3.084  -20.590 1.00 0.00 ? 440 ARG A HH22 1  
ATOM   1307  N  N    . SER A 1 84  ? -3.885  -2.858  -19.633 1.00 0.00 ? 441 SER A N    1  
ATOM   1308  C  CA   . SER A 1 84  ? -2.803  -2.684  -18.671 1.00 0.00 ? 441 SER A CA   1  
ATOM   1309  C  C    . SER A 1 84  ? -3.115  -3.410  -17.366 1.00 0.00 ? 441 SER A C    1  
ATOM   1310  O  O    . SER A 1 84  ? -4.269  -3.481  -16.942 1.00 0.00 ? 441 SER A O    1  
ATOM   1311  C  CB   . SER A 1 84  ? -2.569  -1.197  -18.398 1.00 0.00 ? 441 SER A CB   1  
ATOM   1312  O  OG   . SER A 1 84  ? -2.444  -0.470  -19.608 1.00 0.00 ? 441 SER A OG   1  
ATOM   1313  H  H    . SER A 1 84  ? -4.786  -2.550  -19.400 1.00 0.00 ? 441 SER A H    1  
ATOM   1314  H  HA   . SER A 1 84  ? -1.907  -3.108  -19.100 1.00 0.00 ? 441 SER A HA   1  
ATOM   1315  H  HB2  . SER A 1 84  ? -3.402  -0.801  -17.838 1.00 0.00 ? 441 SER A HB2  1  
ATOM   1316  H  HB3  . SER A 1 84  ? -1.661  -1.078  -17.825 1.00 0.00 ? 441 SER A HB3  1  
ATOM   1317  H  HG   . SER A 1 84  ? -2.260  0.451   -19.410 1.00 0.00 ? 441 SER A HG   1  
ATOM   1318  N  N    . PHE A 1 85  ? -2.077  -3.947  -16.732 1.00 0.00 ? 442 PHE A N    1  
ATOM   1319  C  CA   . PHE A 1 85  ? -2.239  -4.669  -15.476 1.00 0.00 ? 442 PHE A CA   1  
ATOM   1320  C  C    . PHE A 1 85  ? -1.164  -4.260  -14.472 1.00 0.00 ? 442 PHE A C    1  
ATOM   1321  O  O    . PHE A 1 85  ? -0.107  -3.756  -14.850 1.00 0.00 ? 442 PHE A O    1  
ATOM   1322  C  CB   . PHE A 1 85  ? -2.179  -6.178  -15.718 1.00 0.00 ? 442 PHE A CB   1  
ATOM   1323  C  CG   . PHE A 1 85  ? -3.282  -6.688  -16.602 1.00 0.00 ? 442 PHE A CG   1  
ATOM   1324  C  CD1  . PHE A 1 85  ? -3.118  -6.739  -17.977 1.00 0.00 ? 442 PHE A CD1  1  
ATOM   1325  C  CD2  . PHE A 1 85  ? -4.482  -7.116  -16.057 1.00 0.00 ? 442 PHE A CD2  1  
ATOM   1326  C  CE1  . PHE A 1 85  ? -4.131  -7.206  -18.792 1.00 0.00 ? 442 PHE A CE1  1  
ATOM   1327  C  CE2  . PHE A 1 85  ? -5.499  -7.585  -16.868 1.00 0.00 ? 442 PHE A CE2  1  
ATOM   1328  C  CZ   . PHE A 1 85  ? -5.323  -7.631  -18.237 1.00 0.00 ? 442 PHE A CZ   1  
ATOM   1329  H  H    . PHE A 1 85  ? -1.182  -3.857  -17.121 1.00 0.00 ? 442 PHE A H    1  
ATOM   1330  H  HA   . PHE A 1 85  ? -3.207  -4.416  -15.071 1.00 0.00 ? 442 PHE A HA   1  
ATOM   1331  H  HB2  . PHE A 1 85  ? -1.239  -6.423  -16.188 1.00 0.00 ? 442 PHE A HB2  1  
ATOM   1332  H  HB3  . PHE A 1 85  ? -2.248  -6.691  -14.770 1.00 0.00 ? 442 PHE A HB3  1  
ATOM   1333  H  HD1  . PHE A 1 85  ? -2.187  -6.408  -18.412 1.00 0.00 ? 442 PHE A HD1  1  
ATOM   1334  H  HD2  . PHE A 1 85  ? -4.620  -7.081  -14.986 1.00 0.00 ? 442 PHE A HD2  1  
ATOM   1335  H  HE1  . PHE A 1 85  ? -3.991  -7.241  -19.862 1.00 0.00 ? 442 PHE A HE1  1  
ATOM   1336  H  HE2  . PHE A 1 85  ? -6.429  -7.917  -16.430 1.00 0.00 ? 442 PHE A HE2  1  
ATOM   1337  H  HZ   . PHE A 1 85  ? -6.116  -7.996  -18.872 1.00 0.00 ? 442 PHE A HZ   1  
ATOM   1338  N  N    . SER A 1 86  ? -1.444  -4.482  -13.192 1.00 0.00 ? 443 SER A N    1  
ATOM   1339  C  CA   . SER A 1 86  ? -0.504  -4.134  -12.133 1.00 0.00 ? 443 SER A CA   1  
ATOM   1340  C  C    . SER A 1 86  ? 0.464   -5.283  -11.865 1.00 0.00 ? 443 SER A C    1  
ATOM   1341  O  O    . SER A 1 86  ? 1.673   -5.078  -11.761 1.00 0.00 ? 443 SER A O    1  
ATOM   1342  C  CB   . SER A 1 86  ? -1.258  -3.778  -10.850 1.00 0.00 ? 443 SER A CB   1  
ATOM   1343  O  OG   . SER A 1 86  ? -0.362  -3.392  -9.822  1.00 0.00 ? 443 SER A OG   1  
ATOM   1344  H  H    . SER A 1 86  ? -2.304  -4.888  -12.954 1.00 0.00 ? 443 SER A H    1  
ATOM   1345  H  HA   . SER A 1 86  ? 0.059   -3.273  -12.459 1.00 0.00 ? 443 SER A HA   1  
ATOM   1346  H  HB2  . SER A 1 86  ? -1.934  -2.960  -11.047 1.00 0.00 ? 443 SER A HB2  1  
ATOM   1347  H  HB3  . SER A 1 86  ? -1.821  -4.638  -10.516 1.00 0.00 ? 443 SER A HB3  1  
ATOM   1348  H  HG   . SER A 1 86  ? 0.410   -2.974  -10.211 1.00 0.00 ? 443 SER A HG   1  
ATOM   1349  N  N    . ARG A 1 87  ? -0.078  -6.491  -11.756 1.00 0.00 ? 444 ARG A N    1  
ATOM   1350  C  CA   . ARG A 1 87  ? 0.736   -7.673  -11.499 1.00 0.00 ? 444 ARG A CA   1  
ATOM   1351  C  C    . ARG A 1 87  ? 1.009   -8.436  -12.793 1.00 0.00 ? 444 ARG A C    1  
ATOM   1352  O  O    . ARG A 1 87  ? 0.278   -8.297  -13.773 1.00 0.00 ? 444 ARG A O    1  
ATOM   1353  C  CB   . ARG A 1 87  ? 0.039   -8.589  -10.492 1.00 0.00 ? 444 ARG A CB   1  
ATOM   1354  C  CG   . ARG A 1 87  ? 0.077   -8.066  -9.065  1.00 0.00 ? 444 ARG A CG   1  
ATOM   1355  C  CD   . ARG A 1 87  ? -0.654  -8.997  -8.111  1.00 0.00 ? 444 ARG A CD   1  
ATOM   1356  N  NE   . ARG A 1 87  ? -0.086  -10.343 -8.117  1.00 0.00 ? 444 ARG A NE   1  
ATOM   1357  C  CZ   . ARG A 1 87  ? -0.315  -11.241 -7.165  1.00 0.00 ? 444 ARG A CZ   1  
ATOM   1358  N  NH1  . ARG A 1 87  ? -1.095  -10.938 -6.137  1.00 0.00 ? 444 ARG A NH1  1  
ATOM   1359  N  NH2  . ARG A 1 87  ? 0.238   -12.445 -7.241  1.00 0.00 ? 444 ARG A NH2  1  
ATOM   1360  H  H    . ARG A 1 87  ? -1.049  -6.590  -11.848 1.00 0.00 ? 444 ARG A H    1  
ATOM   1361  H  HA   . ARG A 1 87  ? 1.676   -7.344  -11.084 1.00 0.00 ? 444 ARG A HA   1  
ATOM   1362  H  HB2  . ARG A 1 87  ? -0.995  -8.705  -10.782 1.00 0.00 ? 444 ARG A HB2  1  
ATOM   1363  H  HB3  . ARG A 1 87  ? 0.520   -9.556  -10.510 1.00 0.00 ? 444 ARG A HB3  1  
ATOM   1364  H  HG2  . ARG A 1 87  ? 1.107   -7.981  -8.750  1.00 0.00 ? 444 ARG A HG2  1  
ATOM   1365  H  HG3  . ARG A 1 87  ? -0.392  -7.094  -9.036  1.00 0.00 ? 444 ARG A HG3  1  
ATOM   1366  H  HD2  . ARG A 1 87  ? -0.586  -8.593  -7.112  1.00 0.00 ? 444 ARG A HD2  1  
ATOM   1367  H  HD3  . ARG A 1 87  ? -1.691  -9.052  -8.406  1.00 0.00 ? 444 ARG A HD3  1  
ATOM   1368  H  HE   . ARG A 1 87  ? 0.493   -10.587 -8.868  1.00 0.00 ? 444 ARG A HE   1  
ATOM   1369  H  HH11 . ARG A 1 87  ? -1.513  -10.032 -6.077  1.00 0.00 ? 444 ARG A HH11 1  
ATOM   1370  H  HH12 . ARG A 1 87  ? -1.266  -11.617 -5.422  1.00 0.00 ? 444 ARG A HH12 1  
ATOM   1371  H  HH21 . ARG A 1 87  ? 0.826   -12.677 -8.015  1.00 0.00 ? 444 ARG A HH21 1  
ATOM   1372  H  HH22 . ARG A 1 87  ? 0.066   -13.120 -6.525  1.00 0.00 ? 444 ARG A HH22 1  
ATOM   1373  N  N    . SER A 1 88  ? 2.066   -9.241  -12.786 1.00 0.00 ? 445 SER A N    1  
ATOM   1374  C  CA   . SER A 1 88  ? 2.439   -10.023 -13.960 1.00 0.00 ? 445 SER A CA   1  
ATOM   1375  C  C    . SER A 1 88  ? 1.569   -11.270 -14.080 1.00 0.00 ? 445 SER A C    1  
ATOM   1376  O  O    . SER A 1 88  ? 0.940   -11.505 -15.112 1.00 0.00 ? 445 SER A O    1  
ATOM   1377  C  CB   . SER A 1 88  ? 3.914   -10.421 -13.886 1.00 0.00 ? 445 SER A CB   1  
ATOM   1378  O  OG   . SER A 1 88  ? 4.170   -11.222 -12.746 1.00 0.00 ? 445 SER A OG   1  
ATOM   1379  H  H    . SER A 1 88  ? 2.610   -9.309  -11.974 1.00 0.00 ? 445 SER A H    1  
ATOM   1380  H  HA   . SER A 1 88  ? 2.284   -9.405  -14.832 1.00 0.00 ? 445 SER A HA   1  
ATOM   1381  H  HB2  . SER A 1 88  ? 4.178   -10.981 -14.771 1.00 0.00 ? 445 SER A HB2  1  
ATOM   1382  H  HB3  . SER A 1 88  ? 4.522   -9.530  -13.829 1.00 0.00 ? 445 SER A HB3  1  
ATOM   1383  H  HG   . SER A 1 88  ? 4.230   -10.662 -11.968 1.00 0.00 ? 445 SER A HG   1  
ATOM   1384  N  N    . ASP A 1 89  ? 1.538   -12.067 -13.017 1.00 0.00 ? 446 ASP A N    1  
ATOM   1385  C  CA   . ASP A 1 89  ? 0.745   -13.291 -13.002 1.00 0.00 ? 446 ASP A CA   1  
ATOM   1386  C  C    . ASP A 1 89  ? -0.629  -13.056 -13.622 1.00 0.00 ? 446 ASP A C    1  
ATOM   1387  O  O    . ASP A 1 89  ? -1.112  -13.868 -14.412 1.00 0.00 ? 446 ASP A O    1  
ATOM   1388  C  CB   . ASP A 1 89  ? 0.590   -13.805 -11.570 1.00 0.00 ? 446 ASP A CB   1  
ATOM   1389  C  CG   . ASP A 1 89  ? -0.444  -14.908 -11.460 1.00 0.00 ? 446 ASP A CG   1  
ATOM   1390  O  OD1  . ASP A 1 89  ? -1.652  -14.593 -11.484 1.00 0.00 ? 446 ASP A OD1  1  
ATOM   1391  O  OD2  . ASP A 1 89  ? -0.045  -16.087 -11.348 1.00 0.00 ? 446 ASP A OD2  1  
ATOM   1392  H  H    . ASP A 1 89  ? 2.061   -11.826 -12.224 1.00 0.00 ? 446 ASP A H    1  
ATOM   1393  H  HA   . ASP A 1 89  ? 1.268   -14.032 -13.587 1.00 0.00 ? 446 ASP A HA   1  
ATOM   1394  H  HB2  . ASP A 1 89  ? 1.539   -14.192 -11.229 1.00 0.00 ? 446 ASP A HB2  1  
ATOM   1395  H  HB3  . ASP A 1 89  ? 0.288   -12.988 -10.931 1.00 0.00 ? 446 ASP A HB3  1  
ATOM   1396  N  N    . HIS A 1 90  ? -1.254  -11.940 -13.260 1.00 0.00 ? 447 HIS A N    1  
ATOM   1397  C  CA   . HIS A 1 90  ? -2.573  -11.598 -13.781 1.00 0.00 ? 447 HIS A CA   1  
ATOM   1398  C  C    . HIS A 1 90  ? -2.565  -11.576 -15.306 1.00 0.00 ? 447 HIS A C    1  
ATOM   1399  O  O    . HIS A 1 90  ? -3.450  -12.142 -15.950 1.00 0.00 ? 447 HIS A O    1  
ATOM   1400  C  CB   . HIS A 1 90  ? -3.021  -10.239 -13.242 1.00 0.00 ? 447 HIS A CB   1  
ATOM   1401  C  CG   . HIS A 1 90  ? -3.478  -10.281 -11.816 1.00 0.00 ? 447 HIS A CG   1  
ATOM   1402  N  ND1  . HIS A 1 90  ? -3.390  -9.200  -10.965 1.00 0.00 ? 447 HIS A ND1  1  
ATOM   1403  C  CD2  . HIS A 1 90  ? -4.031  -11.283 -11.093 1.00 0.00 ? 447 HIS A CD2  1  
ATOM   1404  C  CE1  . HIS A 1 90  ? -3.868  -9.535  -9.780  1.00 0.00 ? 447 HIS A CE1  1  
ATOM   1405  N  NE2  . HIS A 1 90  ? -4.264  -10.794 -9.831  1.00 0.00 ? 447 HIS A NE2  1  
ATOM   1406  H  H    . HIS A 1 90  ? -0.817  -11.332 -12.627 1.00 0.00 ? 447 HIS A H    1  
ATOM   1407  H  HA   . HIS A 1 90  ? -3.267  -12.354 -13.447 1.00 0.00 ? 447 HIS A HA   1  
ATOM   1408  H  HB2  . HIS A 1 90  ? -2.196  -9.545  -13.305 1.00 0.00 ? 447 HIS A HB2  1  
ATOM   1409  H  HB3  . HIS A 1 90  ? -3.840  -9.873  -13.843 1.00 0.00 ? 447 HIS A HB3  1  
ATOM   1410  H  HD1  . HIS A 1 90  ? -3.030  -8.318  -11.196 1.00 0.00 ? 447 HIS A HD1  1  
ATOM   1411  H  HD2  . HIS A 1 90  ? -4.249  -12.283 -11.443 1.00 0.00 ? 447 HIS A HD2  1  
ATOM   1412  H  HE1  . HIS A 1 90  ? -3.927  -8.890  -8.917  1.00 0.00 ? 447 HIS A HE1  1  
ATOM   1413  N  N    . LEU A 1 91  ? -1.562  -10.920 -15.879 1.00 0.00 ? 448 LEU A N    1  
ATOM   1414  C  CA   . LEU A 1 91  ? -1.440  -10.824 -17.329 1.00 0.00 ? 448 LEU A CA   1  
ATOM   1415  C  C    . LEU A 1 91  ? -1.297  -12.207 -17.957 1.00 0.00 ? 448 LEU A C    1  
ATOM   1416  O  O    . LEU A 1 91  ? -2.027  -12.557 -18.884 1.00 0.00 ? 448 LEU A O    1  
ATOM   1417  C  CB   . LEU A 1 91  ? -0.237  -9.956  -17.703 1.00 0.00 ? 448 LEU A CB   1  
ATOM   1418  C  CG   . LEU A 1 91  ? 0.202   -10.011 -19.167 1.00 0.00 ? 448 LEU A CG   1  
ATOM   1419  C  CD1  . LEU A 1 91  ? -0.756  -9.219  -20.042 1.00 0.00 ? 448 LEU A CD1  1  
ATOM   1420  C  CD2  . LEU A 1 91  ? 1.623   -9.487  -19.317 1.00 0.00 ? 448 LEU A CD2  1  
ATOM   1421  H  H    . LEU A 1 91  ? -0.887  -10.490 -15.314 1.00 0.00 ? 448 LEU A H    1  
ATOM   1422  H  HA   . LEU A 1 91  ? -2.339  -10.361 -17.708 1.00 0.00 ? 448 LEU A HA   1  
ATOM   1423  H  HB2  . LEU A 1 91  ? -0.485  -8.931  -17.471 1.00 0.00 ? 448 LEU A HB2  1  
ATOM   1424  H  HB3  . LEU A 1 91  ? 0.598   -10.269 -17.093 1.00 0.00 ? 448 LEU A HB3  1  
ATOM   1425  H  HG   . LEU A 1 91  ? 0.186   -11.040 -19.502 1.00 0.00 ? 448 LEU A HG   1  
ATOM   1426  H  HD11 . LEU A 1 91  ? -1.074  -8.331  -19.516 1.00 0.00 ? 448 LEU A HD11 1  
ATOM   1427  H  HD12 . LEU A 1 91  ? -1.618  -9.827  -20.275 1.00 0.00 ? 448 LEU A HD12 1  
ATOM   1428  H  HD13 . LEU A 1 91  ? -0.257  -8.936  -20.957 1.00 0.00 ? 448 LEU A HD13 1  
ATOM   1429  H  HD21 . LEU A 1 91  ? 1.743   -8.596  -18.721 1.00 0.00 ? 448 LEU A HD21 1  
ATOM   1430  H  HD22 . LEU A 1 91  ? 1.812   -9.255  -20.355 1.00 0.00 ? 448 LEU A HD22 1  
ATOM   1431  H  HD23 . LEU A 1 91  ? 2.321   -10.241 -18.984 1.00 0.00 ? 448 LEU A HD23 1  
ATOM   1432  N  N    . ALA A 1 92  ? -0.354  -12.990 -17.443 1.00 0.00 ? 449 ALA A N    1  
ATOM   1433  C  CA   . ALA A 1 92  ? -0.119  -14.336 -17.950 1.00 0.00 ? 449 ALA A CA   1  
ATOM   1434  C  C    . ALA A 1 92  ? -1.403  -15.158 -17.943 1.00 0.00 ? 449 ALA A C    1  
ATOM   1435  O  O    . ALA A 1 92  ? -1.817  -15.692 -18.972 1.00 0.00 ? 449 ALA A O    1  
ATOM   1436  C  CB   . ALA A 1 92  ? 0.958   -15.029 -17.128 1.00 0.00 ? 449 ALA A CB   1  
ATOM   1437  H  H    . ALA A 1 92  ? 0.196   -12.654 -16.705 1.00 0.00 ? 449 ALA A H    1  
ATOM   1438  H  HA   . ALA A 1 92  ? 0.237   -14.252 -18.967 1.00 0.00 ? 449 ALA A HA   1  
ATOM   1439  H  HB1  . ALA A 1 92  ? 1.205   -14.419 -16.272 1.00 0.00 ? 449 ALA A HB1  1  
ATOM   1440  H  HB2  . ALA A 1 92  ? 0.592   -15.989 -16.793 1.00 0.00 ? 449 ALA A HB2  1  
ATOM   1441  H  HB3  . ALA A 1 92  ? 1.839   -15.171 -17.736 1.00 0.00 ? 449 ALA A HB3  1  
ATOM   1442  N  N    . LEU A 1 93  ? -2.031  -15.255 -16.776 1.00 0.00 ? 450 LEU A N    1  
ATOM   1443  C  CA   . LEU A 1 93  ? -3.269  -16.013 -16.634 1.00 0.00 ? 450 LEU A CA   1  
ATOM   1444  C  C    . LEU A 1 93  ? -4.383  -15.398 -17.475 1.00 0.00 ? 450 LEU A C    1  
ATOM   1445  O  O    . LEU A 1 93  ? -5.216  -16.110 -18.038 1.00 0.00 ? 450 LEU A O    1  
ATOM   1446  C  CB   . LEU A 1 93  ? -3.693  -16.065 -15.165 1.00 0.00 ? 450 LEU A CB   1  
ATOM   1447  C  CG   . LEU A 1 93  ? -3.153  -17.243 -14.352 1.00 0.00 ? 450 LEU A CG   1  
ATOM   1448  C  CD1  . LEU A 1 93  ? -1.698  -17.010 -13.977 1.00 0.00 ? 450 LEU A CD1  1  
ATOM   1449  C  CD2  . LEU A 1 93  ? -3.999  -17.463 -13.106 1.00 0.00 ? 450 LEU A CD2  1  
ATOM   1450  H  H    . LEU A 1 93  ? -1.653  -14.808 -15.990 1.00 0.00 ? 450 LEU A H    1  
ATOM   1451  H  HA   . LEU A 1 93  ? -3.084  -17.018 -16.983 1.00 0.00 ? 450 LEU A HA   1  
ATOM   1452  H  HB2  . LEU A 1 93  ? -3.358  -15.156 -14.692 1.00 0.00 ? 450 LEU A HB2  1  
ATOM   1453  H  HB3  . LEU A 1 93  ? -4.773  -16.108 -15.135 1.00 0.00 ? 450 LEU A HB3  1  
ATOM   1454  H  HG   . LEU A 1 93  ? -3.203  -18.140 -14.954 1.00 0.00 ? 450 LEU A HG   1  
ATOM   1455  H  HD11 . LEU A 1 93  ? -1.566  -15.984 -13.668 1.00 0.00 ? 450 LEU A HD11 1  
ATOM   1456  H  HD12 . LEU A 1 93  ? -1.069  -17.212 -14.831 1.00 0.00 ? 450 LEU A HD12 1  
ATOM   1457  H  HD13 . LEU A 1 93  ? -1.426  -17.669 -13.166 1.00 0.00 ? 450 LEU A HD13 1  
ATOM   1458  H  HD21 . LEU A 1 93  ? -3.908  -16.607 -12.454 1.00 0.00 ? 450 LEU A HD21 1  
ATOM   1459  H  HD22 . LEU A 1 93  ? -3.655  -18.347 -12.590 1.00 0.00 ? 450 LEU A HD22 1  
ATOM   1460  H  HD23 . LEU A 1 93  ? -5.033  -17.592 -13.391 1.00 0.00 ? 450 LEU A HD23 1  
ATOM   1461  N  N    . HIS A 1 94  ? -4.392  -14.071 -17.558 1.00 0.00 ? 451 HIS A N    1  
ATOM   1462  C  CA   . HIS A 1 94  ? -5.402  -13.360 -18.333 1.00 0.00 ? 451 HIS A CA   1  
ATOM   1463  C  C    . HIS A 1 94  ? -5.468  -13.895 -19.760 1.00 0.00 ? 451 HIS A C    1  
ATOM   1464  O  O    . HIS A 1 94  ? -6.545  -14.203 -20.268 1.00 0.00 ? 451 HIS A O    1  
ATOM   1465  C  CB   . HIS A 1 94  ? -5.100  -11.861 -18.350 1.00 0.00 ? 451 HIS A CB   1  
ATOM   1466  C  CG   . HIS A 1 94  ? -5.769  -11.129 -19.472 1.00 0.00 ? 451 HIS A CG   1  
ATOM   1467  N  ND1  . HIS A 1 94  ? -6.966  -10.461 -19.327 1.00 0.00 ? 451 HIS A ND1  1  
ATOM   1468  C  CD2  . HIS A 1 94  ? -5.400  -10.960 -20.764 1.00 0.00 ? 451 HIS A CD2  1  
ATOM   1469  C  CE1  . HIS A 1 94  ? -7.306  -9.914  -20.480 1.00 0.00 ? 451 HIS A CE1  1  
ATOM   1470  N  NE2  . HIS A 1 94  ? -6.372  -10.202 -21.369 1.00 0.00 ? 451 HIS A NE2  1  
ATOM   1471  H  H    . HIS A 1 94  ? -3.702  -13.559 -17.086 1.00 0.00 ? 451 HIS A H    1  
ATOM   1472  H  HA   . HIS A 1 94  ? -6.358  -13.520 -17.857 1.00 0.00 ? 451 HIS A HA   1  
ATOM   1473  H  HB2  . HIS A 1 94  ? -5.434  -11.422 -17.422 1.00 0.00 ? 451 HIS A HB2  1  
ATOM   1474  H  HB3  . HIS A 1 94  ? -4.033  -11.717 -18.448 1.00 0.00 ? 451 HIS A HB3  1  
ATOM   1475  H  HD1  . HIS A 1 94  ? -7.490  -10.398 -18.501 1.00 0.00 ? 451 HIS A HD1  1  
ATOM   1476  H  HD2  . HIS A 1 94  ? -4.507  -11.349 -21.233 1.00 0.00 ? 451 HIS A HD2  1  
ATOM   1477  H  HE1  . HIS A 1 94  ? -8.196  -9.331  -20.666 1.00 0.00 ? 451 HIS A HE1  1  
ATOM   1478  N  N    . MET A 1 95  ? -4.309  -14.000 -20.401 1.00 0.00 ? 452 MET A N    1  
ATOM   1479  C  CA   . MET A 1 95  ? -4.235  -14.498 -21.770 1.00 0.00 ? 452 MET A CA   1  
ATOM   1480  C  C    . MET A 1 95  ? -5.264  -15.600 -22.003 1.00 0.00 ? 452 MET A C    1  
ATOM   1481  O  O    . MET A 1 95  ? -5.970  -15.601 -23.012 1.00 0.00 ? 452 MET A O    1  
ATOM   1482  C  CB   . MET A 1 95  ? -2.830  -15.024 -22.070 1.00 0.00 ? 452 MET A CB   1  
ATOM   1483  C  CG   . MET A 1 95  ? -1.857  -13.942 -22.507 1.00 0.00 ? 452 MET A CG   1  
ATOM   1484  S  SD   . MET A 1 95  ? -1.888  -13.657 -24.287 1.00 0.00 ? 452 MET A SD   1  
ATOM   1485  C  CE   . MET A 1 95  ? -0.967  -12.126 -24.401 1.00 0.00 ? 452 MET A CE   1  
ATOM   1486  H  H    . MET A 1 95  ? -3.482  -13.738 -19.943 1.00 0.00 ? 452 MET A H    1  
ATOM   1487  H  HA   . MET A 1 95  ? -4.451  -13.674 -22.434 1.00 0.00 ? 452 MET A HA   1  
ATOM   1488  H  HB2  . MET A 1 95  ? -2.438  -15.494 -21.180 1.00 0.00 ? 452 MET A HB2  1  
ATOM   1489  H  HB3  . MET A 1 95  ? -2.894  -15.760 -22.857 1.00 0.00 ? 452 MET A HB3  1  
ATOM   1490  H  HG2  . MET A 1 95  ? -2.113  -13.021 -22.005 1.00 0.00 ? 452 MET A HG2  1  
ATOM   1491  H  HG3  . MET A 1 95  ? -0.858  -14.239 -22.221 1.00 0.00 ? 452 MET A HG3  1  
ATOM   1492  H  HE1  . MET A 1 95  ? -0.126  -12.160 -23.723 1.00 0.00 ? 452 MET A HE1  1  
ATOM   1493  H  HE2  . MET A 1 95  ? -0.608  -11.995 -25.411 1.00 0.00 ? 452 MET A HE2  1  
ATOM   1494  H  HE3  . MET A 1 95  ? -1.609  -11.299 -24.137 1.00 0.00 ? 452 MET A HE3  1  
ATOM   1495  N  N    . LYS A 1 96  ? -5.344  -16.537 -21.065 1.00 0.00 ? 453 LYS A N    1  
ATOM   1496  C  CA   . LYS A 1 96  ? -6.287  -17.645 -21.167 1.00 0.00 ? 453 LYS A CA   1  
ATOM   1497  C  C    . LYS A 1 96  ? -7.599  -17.186 -21.795 1.00 0.00 ? 453 LYS A C    1  
ATOM   1498  O  O    . LYS A 1 96  ? -8.088  -17.794 -22.747 1.00 0.00 ? 453 LYS A O    1  
ATOM   1499  C  CB   . LYS A 1 96  ? -6.553  -18.244 -19.784 1.00 0.00 ? 453 LYS A CB   1  
ATOM   1500  C  CG   . LYS A 1 96  ? -5.319  -18.844 -19.134 1.00 0.00 ? 453 LYS A CG   1  
ATOM   1501  C  CD   . LYS A 1 96  ? -4.928  -20.160 -19.785 1.00 0.00 ? 453 LYS A CD   1  
ATOM   1502  C  CE   . LYS A 1 96  ? -4.055  -20.999 -18.866 1.00 0.00 ? 453 LYS A CE   1  
ATOM   1503  N  NZ   . LYS A 1 96  ? -3.741  -22.328 -19.460 1.00 0.00 ? 453 LYS A NZ   1  
ATOM   1504  H  H    . LYS A 1 96  ? -4.755  -16.482 -20.283 1.00 0.00 ? 453 LYS A H    1  
ATOM   1505  H  HA   . LYS A 1 96  ? -5.844  -18.400 -21.798 1.00 0.00 ? 453 LYS A HA   1  
ATOM   1506  H  HB2  . LYS A 1 96  ? -6.936  -17.469 -19.137 1.00 0.00 ? 453 LYS A HB2  1  
ATOM   1507  H  HB3  . LYS A 1 96  ? -7.298  -19.021 -19.880 1.00 0.00 ? 453 LYS A HB3  1  
ATOM   1508  H  HG2  . LYS A 1 96  ? -4.498  -18.149 -19.231 1.00 0.00 ? 453 LYS A HG2  1  
ATOM   1509  H  HG3  . LYS A 1 96  ? -5.523  -19.017 -18.087 1.00 0.00 ? 453 LYS A HG3  1  
ATOM   1510  H  HD2  . LYS A 1 96  ? -5.824  -20.716 -20.018 1.00 0.00 ? 453 LYS A HD2  1  
ATOM   1511  H  HD3  . LYS A 1 96  ? -4.384  -19.953 -20.695 1.00 0.00 ? 453 LYS A HD3  1  
ATOM   1512  H  HE2  . LYS A 1 96  ? -3.133  -20.469 -18.684 1.00 0.00 ? 453 LYS A HE2  1  
ATOM   1513  H  HE3  . LYS A 1 96  ? -4.576  -21.146 -17.931 1.00 0.00 ? 453 LYS A HE3  1  
ATOM   1514  H  HZ1  . LYS A 1 96  ? -4.230  -22.437 -20.371 1.00 0.00 ? 453 LYS A HZ1  1  
ATOM   1515  H  HZ2  . LYS A 1 96  ? -4.049  -23.088 -18.819 1.00 0.00 ? 453 LYS A HZ2  1  
ATOM   1516  H  HZ3  . LYS A 1 96  ? -2.717  -22.417 -19.616 1.00 0.00 ? 453 LYS A HZ3  1  
ATOM   1517  N  N    . ARG A 1 97  ? -8.163  -16.110 -21.257 1.00 0.00 ? 454 ARG A N    1  
ATOM   1518  C  CA   . ARG A 1 97  ? -9.418  -15.570 -21.765 1.00 0.00 ? 454 ARG A CA   1  
ATOM   1519  C  C    . ARG A 1 97  ? -9.390  -15.469 -23.287 1.00 0.00 ? 454 ARG A C    1  
ATOM   1520  O  O    . ARG A 1 97  ? -10.330 -15.886 -23.965 1.00 0.00 ? 454 ARG A O    1  
ATOM   1521  C  CB   . ARG A 1 97  ? -9.689  -14.192 -21.157 1.00 0.00 ? 454 ARG A CB   1  
ATOM   1522  C  CG   . ARG A 1 97  ? -10.976 -13.551 -21.650 1.00 0.00 ? 454 ARG A CG   1  
ATOM   1523  C  CD   . ARG A 1 97  ? -12.161 -13.939 -20.780 1.00 0.00 ? 454 ARG A CD   1  
ATOM   1524  N  NE   . ARG A 1 97  ? -13.282 -13.017 -20.938 1.00 0.00 ? 454 ARG A NE   1  
ATOM   1525  C  CZ   . ARG A 1 97  ? -14.258 -12.887 -20.046 1.00 0.00 ? 454 ARG A CZ   1  
ATOM   1526  N  NH1  . ARG A 1 97  ? -14.251 -13.617 -18.940 1.00 0.00 ? 454 ARG A NH1  1  
ATOM   1527  N  NH2  . ARG A 1 97  ? -15.244 -12.026 -20.261 1.00 0.00 ? 454 ARG A NH2  1  
ATOM   1528  H  H    . ARG A 1 97  ? -7.725  -15.668 -20.499 1.00 0.00 ? 454 ARG A H    1  
ATOM   1529  H  HA   . ARG A 1 97  ? -10.211 -16.243 -21.475 1.00 0.00 ? 454 ARG A HA   1  
ATOM   1530  H  HB2  . ARG A 1 97  ? -9.751  -14.291 -20.083 1.00 0.00 ? 454 ARG A HB2  1  
ATOM   1531  H  HB3  . ARG A 1 97  ? -8.868  -13.536 -21.404 1.00 0.00 ? 454 ARG A HB3  1  
ATOM   1532  H  HG2  . ARG A 1 97  ? -10.864 -12.477 -21.628 1.00 0.00 ? 454 ARG A HG2  1  
ATOM   1533  H  HG3  . ARG A 1 97  ? -11.163 -13.874 -22.663 1.00 0.00 ? 454 ARG A HG3  1  
ATOM   1534  H  HD2  . ARG A 1 97  ? -12.483 -14.932 -21.056 1.00 0.00 ? 454 ARG A HD2  1  
ATOM   1535  H  HD3  . ARG A 1 97  ? -11.847 -13.937 -19.747 1.00 0.00 ? 454 ARG A HD3  1  
ATOM   1536  H  HE   . ARG A 1 97  ? -13.306 -12.467 -21.748 1.00 0.00 ? 454 ARG A HE   1  
ATOM   1537  H  HH11 . ARG A 1 97  ? -13.509 -14.267 -18.775 1.00 0.00 ? 454 ARG A HH11 1  
ATOM   1538  H  HH12 . ARG A 1 97  ? -14.987 -13.517 -18.270 1.00 0.00 ? 454 ARG A HH12 1  
ATOM   1539  H  HH21 . ARG A 1 97  ? -15.253 -11.473 -21.094 1.00 0.00 ? 454 ARG A HH21 1  
ATOM   1540  H  HH22 . ARG A 1 97  ? -15.979 -11.929 -19.590 1.00 0.00 ? 454 ARG A HH22 1  
ATOM   1541  N  N    . HIS A 1 98  ? -8.306  -14.913 -23.818 1.00 0.00 ? 455 HIS A N    1  
ATOM   1542  C  CA   . HIS A 1 98  ? -8.155  -14.758 -25.261 1.00 0.00 ? 455 HIS A CA   1  
ATOM   1543  C  C    . HIS A 1 98  ? -8.199  -16.113 -25.961 1.00 0.00 ? 455 HIS A C    1  
ATOM   1544  O  O    . HIS A 1 98  ? -9.116  -16.394 -26.731 1.00 0.00 ? 455 HIS A O    1  
ATOM   1545  C  CB   . HIS A 1 98  ? -6.842  -14.045 -25.584 1.00 0.00 ? 455 HIS A CB   1  
ATOM   1546  C  CG   . HIS A 1 98  ? -6.857  -12.583 -25.259 1.00 0.00 ? 455 HIS A CG   1  
ATOM   1547  N  ND1  . HIS A 1 98  ? -7.810  -11.714 -25.748 1.00 0.00 ? 455 HIS A ND1  1  
ATOM   1548  C  CD2  . HIS A 1 98  ? -6.031  -11.839 -24.488 1.00 0.00 ? 455 HIS A CD2  1  
ATOM   1549  C  CE1  . HIS A 1 98  ? -7.567  -10.498 -25.294 1.00 0.00 ? 455 HIS A CE1  1  
ATOM   1550  N  NE2  . HIS A 1 98  ? -6.493  -10.546 -24.526 1.00 0.00 ? 455 HIS A NE2  1  
ATOM   1551  H  H    . HIS A 1 98  ? -7.591  -14.600 -23.226 1.00 0.00 ? 455 HIS A H    1  
ATOM   1552  H  HA   . HIS A 1 98  ? -8.978  -14.156 -25.617 1.00 0.00 ? 455 HIS A HA   1  
ATOM   1553  H  HB2  . HIS A 1 98  ? -6.044  -14.502 -25.017 1.00 0.00 ? 455 HIS A HB2  1  
ATOM   1554  H  HB3  . HIS A 1 98  ? -6.633  -14.150 -26.639 1.00 0.00 ? 455 HIS A HB3  1  
ATOM   1555  H  HD1  . HIS A 1 98  ? -8.551  -11.953 -26.342 1.00 0.00 ? 455 HIS A HD1  1  
ATOM   1556  H  HD2  . HIS A 1 98  ? -5.167  -12.194 -23.944 1.00 0.00 ? 455 HIS A HD2  1  
ATOM   1557  H  HE1  . HIS A 1 98  ? -8.148  -9.614  -25.511 1.00 0.00 ? 455 HIS A HE1  1  
ATOM   1558  N  N    . GLN A 1 99  ? -7.200  -16.946 -25.688 1.00 0.00 ? 456 GLN A N    1  
ATOM   1559  C  CA   . GLN A 1 99  ? -7.125  -18.271 -26.293 1.00 0.00 ? 456 GLN A CA   1  
ATOM   1560  C  C    . GLN A 1 99  ? -8.306  -19.134 -25.862 1.00 0.00 ? 456 GLN A C    1  
ATOM   1561  O  O    . GLN A 1 99  ? -9.080  -18.752 -24.986 1.00 0.00 ? 456 GLN A O    1  
ATOM   1562  C  CB   . GLN A 1 99  ? -5.811  -18.955 -25.910 1.00 0.00 ? 456 GLN A CB   1  
ATOM   1563  C  CG   . GLN A 1 99  ? -5.652  -19.175 -24.414 1.00 0.00 ? 456 GLN A CG   1  
ATOM   1564  C  CD   . GLN A 1 99  ? -4.458  -20.045 -24.076 1.00 0.00 ? 456 GLN A CD   1  
ATOM   1565  O  OE1  . GLN A 1 99  ? -4.471  -21.254 -24.309 1.00 0.00 ? 456 GLN A OE1  1  
ATOM   1566  N  NE2  . GLN A 1 99  ? -3.417  -19.433 -23.523 1.00 0.00 ? 456 GLN A NE2  1  
ATOM   1567  H  H    . GLN A 1 99  ? -6.498  -16.664 -25.065 1.00 0.00 ? 456 GLN A H    1  
ATOM   1568  H  HA   . GLN A 1 99  ? -7.157  -18.148 -27.365 1.00 0.00 ? 456 GLN A HA   1  
ATOM   1569  H  HB2  . GLN A 1 99  ? -5.763  -19.916 -26.401 1.00 0.00 ? 456 GLN A HB2  1  
ATOM   1570  H  HB3  . GLN A 1 99  ? -4.988  -18.344 -26.251 1.00 0.00 ? 456 GLN A HB3  1  
ATOM   1571  H  HG2  . GLN A 1 99  ? -5.527  -18.216 -23.934 1.00 0.00 ? 456 GLN A HG2  1  
ATOM   1572  H  HG3  . GLN A 1 99  ? -6.545  -19.651 -24.037 1.00 0.00 ? 456 GLN A HG3  1  
ATOM   1573  H  HE21 . GLN A 1 99  ? -3.479  -18.467 -23.365 1.00 0.00 ? 456 GLN A HE21 1  
ATOM   1574  H  HE22 . GLN A 1 99  ? -2.633  -19.972 -23.293 1.00 0.00 ? 456 GLN A HE22 1  
ATOM   1575  N  N    . ASN A 1 100 ? -8.437  -20.301 -26.485 1.00 0.00 ? 457 ASN A N    1  
ATOM   1576  C  CA   . ASN A 1 100 ? -9.525  -21.219 -26.166 1.00 0.00 ? 457 ASN A CA   1  
ATOM   1577  C  C    . ASN A 1 100 ? -9.528  -21.564 -24.680 1.00 0.00 ? 457 ASN A C    1  
ATOM   1578  O  O    . ASN A 1 100 ? -8.569  -22.138 -24.164 1.00 0.00 ? 457 ASN A O    1  
ATOM   1579  C  CB   . ASN A 1 100 ? -9.402  -22.497 -26.998 1.00 0.00 ? 457 ASN A CB   1  
ATOM   1580  C  CG   . ASN A 1 100 ? -7.966  -22.972 -27.120 1.00 0.00 ? 457 ASN A CG   1  
ATOM   1581  O  OD1  . ASN A 1 100 ? -7.463  -23.689 -26.256 1.00 0.00 ? 457 ASN A OD1  1  
ATOM   1582  N  ND2  . ASN A 1 100 ? -7.300  -22.571 -28.196 1.00 0.00 ? 457 ASN A ND2  1  
ATOM   1583  H  H    . ASN A 1 100 ? -7.788  -20.551 -27.175 1.00 0.00 ? 457 ASN A H    1  
ATOM   1584  H  HA   . ASN A 1 100 ? -10.455 -20.729 -26.412 1.00 0.00 ? 457 ASN A HA   1  
ATOM   1585  H  HB2  . ASN A 1 100 ? -9.981  -23.281 -26.531 1.00 0.00 ? 457 ASN A HB2  1  
ATOM   1586  H  HB3  . ASN A 1 100 ? -9.786  -22.313 -27.990 1.00 0.00 ? 457 ASN A HB3  1  
ATOM   1587  H  HD21 . ASN A 1 100 ? -7.766  -22.000 -28.843 1.00 0.00 ? 457 ASN A HD21 1  
ATOM   1588  H  HD22 . ASN A 1 100 ? -6.371  -22.863 -28.301 1.00 0.00 ? 457 ASN A HD22 1  
HETATM 1589  ZN ZN   . ZN  B 2 .   ? 15.336  -0.814  11.057  1.00 0.00 ? 100 ZN  A ZN   1  
HETATM 1590  ZN ZN   . ZN  C 2 .   ? -0.561  2.929   -6.554  1.00 0.00 ? 200 ZN  A ZN   1  
HETATM 1591  ZN ZN   . ZN  D 2 .   ? -5.647  -9.393  -23.057 1.00 0.00 ? 300 ZN  A ZN   1  
ATOM   1592  N  N    . GLY A 1 1   ? 72.080  14.036  20.582  1.00 0.00 ? 358 GLY A N    2  
ATOM   1593  C  CA   . GLY A 1 1   ? 70.716  13.887  20.108  1.00 0.00 ? 358 GLY A CA   2  
ATOM   1594  C  C    . GLY A 1 1   ? 70.056  12.625  20.628  1.00 0.00 ? 358 GLY A C    2  
ATOM   1595  O  O    . GLY A 1 1   ? 70.735  11.700  21.075  1.00 0.00 ? 358 GLY A O    2  
ATOM   1596  H  H1   . GLY A 1 1   ? 72.473  13.349  21.161  1.00 0.00 ? 358 GLY A H1   2  
ATOM   1597  H  HA2  . GLY A 1 1   ? 70.140  14.741  20.430  1.00 0.00 ? 358 GLY A HA2  2  
ATOM   1598  H  HA3  . GLY A 1 1   ? 70.724  13.856  19.029  1.00 0.00 ? 358 GLY A HA3  2  
ATOM   1599  N  N    . SER A 1 2   ? 68.729  12.588  20.572  1.00 0.00 ? 359 SER A N    2  
ATOM   1600  C  CA   . SER A 1 2   ? 67.976  11.432  21.046  1.00 0.00 ? 359 SER A CA   2  
ATOM   1601  C  C    . SER A 1 2   ? 66.607  11.364  20.377  1.00 0.00 ? 359 SER A C    2  
ATOM   1602  O  O    . SER A 1 2   ? 66.245  12.237  19.588  1.00 0.00 ? 359 SER A O    2  
ATOM   1603  C  CB   . SER A 1 2   ? 67.812  11.493  22.566  1.00 0.00 ? 359 SER A CB   2  
ATOM   1604  O  OG   . SER A 1 2   ? 69.016  11.137  23.224  1.00 0.00 ? 359 SER A OG   2  
ATOM   1605  H  H    . SER A 1 2   ? 68.244  13.356  20.205  1.00 0.00 ? 359 SER A H    2  
ATOM   1606  H  HA   . SER A 1 2   ? 68.534  10.544  20.788  1.00 0.00 ? 359 SER A HA   2  
ATOM   1607  H  HB2  . SER A 1 2   ? 67.540  12.496  22.856  1.00 0.00 ? 359 SER A HB2  2  
ATOM   1608  H  HB3  . SER A 1 2   ? 67.034  10.807  22.869  1.00 0.00 ? 359 SER A HB3  2  
ATOM   1609  H  HG   . SER A 1 2   ? 69.215  10.215  23.050  1.00 0.00 ? 359 SER A HG   2  
ATOM   1610  N  N    . SER A 1 3   ? 65.849  10.320  20.699  1.00 0.00 ? 360 SER A N    2  
ATOM   1611  C  CA   . SER A 1 3   ? 64.521  10.135  20.128  1.00 0.00 ? 360 SER A CA   2  
ATOM   1612  C  C    . SER A 1 3   ? 63.775  9.011   20.840  1.00 0.00 ? 360 SER A C    2  
ATOM   1613  O  O    . SER A 1 3   ? 64.323  8.346   21.719  1.00 0.00 ? 360 SER A O    2  
ATOM   1614  C  CB   . SER A 1 3   ? 64.624  9.826   18.633  1.00 0.00 ? 360 SER A CB   2  
ATOM   1615  O  OG   . SER A 1 3   ? 65.265  8.582   18.412  1.00 0.00 ? 360 SER A OG   2  
ATOM   1616  H  H    . SER A 1 3   ? 66.193  9.658   21.335  1.00 0.00 ? 360 SER A H    2  
ATOM   1617  H  HA   . SER A 1 3   ? 63.971  11.055  20.260  1.00 0.00 ? 360 SER A HA   2  
ATOM   1618  H  HB2  . SER A 1 3   ? 63.633  9.788   18.206  1.00 0.00 ? 360 SER A HB2  2  
ATOM   1619  H  HB3  . SER A 1 3   ? 65.196  10.604  18.147  1.00 0.00 ? 360 SER A HB3  2  
ATOM   1620  H  HG   . SER A 1 3   ? 65.144  8.019   19.180  1.00 0.00 ? 360 SER A HG   2  
ATOM   1621  N  N    . GLY A 1 4   ? 62.519  8.804   20.454  1.00 0.00 ? 361 GLY A N    2  
ATOM   1622  C  CA   . GLY A 1 4   ? 61.718  7.760   21.065  1.00 0.00 ? 361 GLY A CA   2  
ATOM   1623  C  C    . GLY A 1 4   ? 60.255  7.849   20.676  1.00 0.00 ? 361 GLY A C    2  
ATOM   1624  O  O    . GLY A 1 4   ? 59.802  8.877   20.172  1.00 0.00 ? 361 GLY A O    2  
ATOM   1625  H  H    . GLY A 1 4   ? 62.135  9.364   19.748  1.00 0.00 ? 361 GLY A H    2  
ATOM   1626  H  HA2  . GLY A 1 4   ? 62.103  6.799   20.758  1.00 0.00 ? 361 GLY A HA2  2  
ATOM   1627  H  HA3  . GLY A 1 4   ? 61.798  7.842   22.139  1.00 0.00 ? 361 GLY A HA3  2  
ATOM   1628  N  N    . SER A 1 5   ? 59.515  6.770   20.910  1.00 0.00 ? 362 SER A N    2  
ATOM   1629  C  CA   . SER A 1 5   ? 58.096  6.729   20.575  1.00 0.00 ? 362 SER A CA   2  
ATOM   1630  C  C    . SER A 1 5   ? 57.462  5.428   21.057  1.00 0.00 ? 362 SER A C    2  
ATOM   1631  O  O    . SER A 1 5   ? 58.109  4.381   21.082  1.00 0.00 ? 362 SER A O    2  
ATOM   1632  C  CB   . SER A 1 5   ? 57.902  6.876   19.065  1.00 0.00 ? 362 SER A CB   2  
ATOM   1633  O  OG   . SER A 1 5   ? 56.614  7.383   18.763  1.00 0.00 ? 362 SER A OG   2  
ATOM   1634  H  H    . SER A 1 5   ? 59.934  5.982   21.314  1.00 0.00 ? 362 SER A H    2  
ATOM   1635  H  HA   . SER A 1 5   ? 57.614  7.557   21.073  1.00 0.00 ? 362 SER A HA   2  
ATOM   1636  H  HB2  . SER A 1 5   ? 58.644  7.555   18.673  1.00 0.00 ? 362 SER A HB2  2  
ATOM   1637  H  HB3  . SER A 1 5   ? 58.015  5.909   18.595  1.00 0.00 ? 362 SER A HB3  2  
ATOM   1638  H  HG   . SER A 1 5   ? 55.947  6.832   19.180  1.00 0.00 ? 362 SER A HG   2  
ATOM   1639  N  N    . SER A 1 6   ? 56.191  5.503   21.439  1.00 0.00 ? 363 SER A N    2  
ATOM   1640  C  CA   . SER A 1 6   ? 55.469  4.333   21.924  1.00 0.00 ? 363 SER A CA   2  
ATOM   1641  C  C    . SER A 1 6   ? 53.971  4.613   22.004  1.00 0.00 ? 363 SER A C    2  
ATOM   1642  O  O    . SER A 1 6   ? 53.526  5.739   21.783  1.00 0.00 ? 363 SER A O    2  
ATOM   1643  C  CB   . SER A 1 6   ? 55.995  3.916   23.299  1.00 0.00 ? 363 SER A CB   2  
ATOM   1644  O  OG   . SER A 1 6   ? 55.792  2.532   23.525  1.00 0.00 ? 363 SER A OG   2  
ATOM   1645  H  H    . SER A 1 6   ? 55.729  6.367   21.396  1.00 0.00 ? 363 SER A H    2  
ATOM   1646  H  HA   . SER A 1 6   ? 55.635  3.527   21.225  1.00 0.00 ? 363 SER A HA   2  
ATOM   1647  H  HB2  . SER A 1 6   ? 57.052  4.126   23.356  1.00 0.00 ? 363 SER A HB2  2  
ATOM   1648  H  HB3  . SER A 1 6   ? 55.475  4.474   24.064  1.00 0.00 ? 363 SER A HB3  2  
ATOM   1649  H  HG   . SER A 1 6   ? 55.699  2.080   22.683  1.00 0.00 ? 363 SER A HG   2  
ATOM   1650  N  N    . GLY A 1 7   ? 53.198  3.579   22.322  1.00 0.00 ? 364 GLY A N    2  
ATOM   1651  C  CA   . GLY A 1 7   ? 51.758  3.734   22.425  1.00 0.00 ? 364 GLY A CA   2  
ATOM   1652  C  C    . GLY A 1 7   ? 51.044  2.408   22.596  1.00 0.00 ? 364 GLY A C    2  
ATOM   1653  O  O    . GLY A 1 7   ? 51.377  1.412   21.954  1.00 0.00 ? 364 GLY A O    2  
ATOM   1654  H  H    . GLY A 1 7   ? 53.608  2.705   22.487  1.00 0.00 ? 364 GLY A H    2  
ATOM   1655  H  HA2  . GLY A 1 7   ? 51.535  4.363   23.273  1.00 0.00 ? 364 GLY A HA2  2  
ATOM   1656  H  HA3  . GLY A 1 7   ? 51.394  4.213   21.528  1.00 0.00 ? 364 GLY A HA3  2  
ATOM   1657  N  N    . PRO A 1 8   ? 50.036  2.384   23.481  1.00 0.00 ? 365 PRO A N    2  
ATOM   1658  C  CA   . PRO A 1 8   ? 49.252  1.176   23.755  1.00 0.00 ? 365 PRO A CA   2  
ATOM   1659  C  C    . PRO A 1 8   ? 48.361  0.784   22.582  1.00 0.00 ? 365 PRO A C    2  
ATOM   1660  O  O    . PRO A 1 8   ? 48.404  1.409   21.522  1.00 0.00 ? 365 PRO A O    2  
ATOM   1661  C  CB   . PRO A 1 8   ? 48.401  1.573   24.964  1.00 0.00 ? 365 PRO A CB   2  
ATOM   1662  C  CG   . PRO A 1 8   ? 48.290  3.056   24.879  1.00 0.00 ? 365 PRO A CG   2  
ATOM   1663  C  CD   . PRO A 1 8   ? 49.584  3.535   24.281  1.00 0.00 ? 365 PRO A CD   2  
ATOM   1664  H  HA   . PRO A 1 8   ? 49.887  0.343   24.018  1.00 0.00 ? 365 PRO A HA   2  
ATOM   1665  H  HB2  . PRO A 1 8   ? 47.432  1.099   24.897  1.00 0.00 ? 365 PRO A HB2  2  
ATOM   1666  H  HB3  . PRO A 1 8   ? 48.896  1.266   25.874  1.00 0.00 ? 365 PRO A HB3  2  
ATOM   1667  H  HG2  . PRO A 1 8   ? 47.460  3.326   24.243  1.00 0.00 ? 365 PRO A HG2  2  
ATOM   1668  H  HG3  . PRO A 1 8   ? 48.158  3.471   25.867  1.00 0.00 ? 365 PRO A HG3  2  
ATOM   1669  H  HD2  . PRO A 1 8   ? 49.414  4.397   23.654  1.00 0.00 ? 365 PRO A HD2  2  
ATOM   1670  H  HD3  . PRO A 1 8   ? 50.296  3.766   25.059  1.00 0.00 ? 365 PRO A HD3  2  
ATOM   1671  N  N    . ASP A 1 9   ? 47.555  -0.253  22.778  1.00 0.00 ? 366 ASP A N    2  
ATOM   1672  C  CA   . ASP A 1 9   ? 46.652  -0.727  21.736  1.00 0.00 ? 366 ASP A CA   2  
ATOM   1673  C  C    . ASP A 1 9   ? 45.436  -1.420  22.345  1.00 0.00 ? 366 ASP A C    2  
ATOM   1674  O  O    . ASP A 1 9   ? 45.571  -2.376  23.110  1.00 0.00 ? 366 ASP A O    2  
ATOM   1675  C  CB   . ASP A 1 9   ? 47.383  -1.686  20.795  1.00 0.00 ? 366 ASP A CB   2  
ATOM   1676  C  CG   . ASP A 1 9   ? 46.598  -1.965  19.528  1.00 0.00 ? 366 ASP A CG   2  
ATOM   1677  O  OD1  . ASP A 1 9   ? 46.406  -1.024  18.730  1.00 0.00 ? 366 ASP A OD1  2  
ATOM   1678  O  OD2  . ASP A 1 9   ? 46.177  -3.124  19.335  1.00 0.00 ? 366 ASP A OD2  2  
ATOM   1679  H  H    . ASP A 1 9   ? 47.567  -0.710  23.645  1.00 0.00 ? 366 ASP A H    2  
ATOM   1680  H  HA   . ASP A 1 9   ? 46.316  0.130   21.172  1.00 0.00 ? 366 ASP A HA   2  
ATOM   1681  H  HB2  . ASP A 1 9   ? 48.334  -1.254  20.520  1.00 0.00 ? 366 ASP A HB2  2  
ATOM   1682  H  HB3  . ASP A 1 9   ? 47.552  -2.623  21.306  1.00 0.00 ? 366 ASP A HB3  2  
ATOM   1683  N  N    . LEU A 1 10  ? 44.250  -0.932  22.000  1.00 0.00 ? 367 LEU A N    2  
ATOM   1684  C  CA   . LEU A 1 10  ? 43.009  -1.504  22.513  1.00 0.00 ? 367 LEU A CA   2  
ATOM   1685  C  C    . LEU A 1 10  ? 41.797  -0.861  21.847  1.00 0.00 ? 367 LEU A C    2  
ATOM   1686  O  O    . LEU A 1 10  ? 41.869  0.269   21.365  1.00 0.00 ? 367 LEU A O    2  
ATOM   1687  C  CB   . LEU A 1 10  ? 42.929  -1.321  24.030  1.00 0.00 ? 367 LEU A CB   2  
ATOM   1688  C  CG   . LEU A 1 10  ? 42.579  0.085   24.518  1.00 0.00 ? 367 LEU A CG   2  
ATOM   1689  C  CD1  . LEU A 1 10  ? 42.168  0.055   25.982  1.00 0.00 ? 367 LEU A CD1  2  
ATOM   1690  C  CD2  . LEU A 1 10  ? 43.755  1.029   24.312  1.00 0.00 ? 367 LEU A CD2  2  
ATOM   1691  H  H    . LEU A 1 10  ? 44.205  -0.170  21.387  1.00 0.00 ? 367 LEU A H    2  
ATOM   1692  H  HA   . LEU A 1 10  ? 43.012  -2.560  22.286  1.00 0.00 ? 367 LEU A HA   2  
ATOM   1693  H  HB2  . LEU A 1 10  ? 42.177  -1.997  24.405  1.00 0.00 ? 367 LEU A HB2  2  
ATOM   1694  H  HB3  . LEU A 1 10  ? 43.890  -1.587  24.445  1.00 0.00 ? 367 LEU A HB3  2  
ATOM   1695  H  HG   . LEU A 1 10  ? 41.743  0.462   23.944  1.00 0.00 ? 367 LEU A HG   2  
ATOM   1696  H  HD11 . LEU A 1 10  ? 42.095  -0.969  26.314  1.00 0.00 ? 367 LEU A HD11 2  
ATOM   1697  H  HD12 . LEU A 1 10  ? 41.209  0.540   26.096  1.00 0.00 ? 367 LEU A HD12 2  
ATOM   1698  H  HD13 . LEU A 1 10  ? 42.906  0.575   26.574  1.00 0.00 ? 367 LEU A HD13 2  
ATOM   1699  H  HD21 . LEU A 1 10  ? 44.666  0.543   24.627  1.00 0.00 ? 367 LEU A HD21 2  
ATOM   1700  H  HD22 . LEU A 1 10  ? 43.604  1.925   24.897  1.00 0.00 ? 367 LEU A HD22 2  
ATOM   1701  H  HD23 . LEU A 1 10  ? 43.828  1.291   23.266  1.00 0.00 ? 367 LEU A HD23 2  
ATOM   1702  N  N    . GLU A 1 11  ? 40.684  -1.589  21.826  1.00 0.00 ? 368 GLU A N    2  
ATOM   1703  C  CA   . GLU A 1 11  ? 39.456  -1.088  21.219  1.00 0.00 ? 368 GLU A CA   2  
ATOM   1704  C  C    . GLU A 1 11  ? 38.245  -1.872  21.716  1.00 0.00 ? 368 GLU A C    2  
ATOM   1705  O  O    . GLU A 1 11  ? 38.367  -3.021  22.140  1.00 0.00 ? 368 GLU A O    2  
ATOM   1706  C  CB   . GLU A 1 11  ? 39.543  -1.173  19.694  1.00 0.00 ? 368 GLU A CB   2  
ATOM   1707  C  CG   . GLU A 1 11  ? 39.842  -2.571  19.179  1.00 0.00 ? 368 GLU A CG   2  
ATOM   1708  C  CD   . GLU A 1 11  ? 39.471  -2.746  17.719  1.00 0.00 ? 368 GLU A CD   2  
ATOM   1709  O  OE1  . GLU A 1 11  ? 39.881  -1.899  16.898  1.00 0.00 ? 368 GLU A OE1  2  
ATOM   1710  O  OE2  . GLU A 1 11  ? 38.772  -3.729  17.398  1.00 0.00 ? 368 GLU A OE2  2  
ATOM   1711  H  H    . GLU A 1 11  ? 40.690  -2.483  22.226  1.00 0.00 ? 368 GLU A H    2  
ATOM   1712  H  HA   . GLU A 1 11  ? 39.343  -0.053  21.507  1.00 0.00 ? 368 GLU A HA   2  
ATOM   1713  H  HB2  . GLU A 1 11  ? 38.602  -0.850  19.274  1.00 0.00 ? 368 GLU A HB2  2  
ATOM   1714  H  HB3  . GLU A 1 11  ? 40.325  -0.511  19.353  1.00 0.00 ? 368 GLU A HB3  2  
ATOM   1715  H  HG2  . GLU A 1 11  ? 40.899  -2.763  19.291  1.00 0.00 ? 368 GLU A HG2  2  
ATOM   1716  H  HG3  . GLU A 1 11  ? 39.283  -3.284  19.766  1.00 0.00 ? 368 GLU A HG3  2  
ATOM   1717  N  N    . LYS A 1 12  ? 37.077  -1.242  21.662  1.00 0.00 ? 369 LYS A N    2  
ATOM   1718  C  CA   . LYS A 1 12  ? 35.842  -1.878  22.105  1.00 0.00 ? 369 LYS A CA   2  
ATOM   1719  C  C    . LYS A 1 12  ? 34.624  -1.109  21.605  1.00 0.00 ? 369 LYS A C    2  
ATOM   1720  O  O    . LYS A 1 12  ? 34.670  0.112   21.449  1.00 0.00 ? 369 LYS A O    2  
ATOM   1721  C  CB   . LYS A 1 12  ? 35.810  -1.969  23.632  1.00 0.00 ? 369 LYS A CB   2  
ATOM   1722  C  CG   . LYS A 1 12  ? 34.870  -3.039  24.158  1.00 0.00 ? 369 LYS A CG   2  
ATOM   1723  C  CD   . LYS A 1 12  ? 35.017  -3.221  25.660  1.00 0.00 ? 369 LYS A CD   2  
ATOM   1724  C  CE   . LYS A 1 12  ? 34.655  -4.635  26.087  1.00 0.00 ? 369 LYS A CE   2  
ATOM   1725  N  NZ   . LYS A 1 12  ? 34.119  -4.674  27.476  1.00 0.00 ? 369 LYS A NZ   2  
ATOM   1726  H  H    . LYS A 1 12  ? 37.044  -0.325  21.314  1.00 0.00 ? 369 LYS A H    2  
ATOM   1727  H  HA   . LYS A 1 12  ? 35.817  -2.876  21.693  1.00 0.00 ? 369 LYS A HA   2  
ATOM   1728  H  HB2  . LYS A 1 12  ? 36.806  -2.187  23.988  1.00 0.00 ? 369 LYS A HB2  2  
ATOM   1729  H  HB3  . LYS A 1 12  ? 35.496  -1.015  24.031  1.00 0.00 ? 369 LYS A HB3  2  
ATOM   1730  H  HG2  . LYS A 1 12  ? 33.852  -2.750  23.940  1.00 0.00 ? 369 LYS A HG2  2  
ATOM   1731  H  HG3  . LYS A 1 12  ? 35.094  -3.975  23.667  1.00 0.00 ? 369 LYS A HG3  2  
ATOM   1732  H  HD2  . LYS A 1 12  ? 36.042  -3.024  25.939  1.00 0.00 ? 369 LYS A HD2  2  
ATOM   1733  H  HD3  . LYS A 1 12  ? 34.364  -2.523  26.164  1.00 0.00 ? 369 LYS A HD3  2  
ATOM   1734  H  HE2  . LYS A 1 12  ? 33.907  -5.021  25.412  1.00 0.00 ? 369 LYS A HE2  2  
ATOM   1735  H  HE3  . LYS A 1 12  ? 35.540  -5.251  26.034  1.00 0.00 ? 369 LYS A HE3  2  
ATOM   1736  H  HZ1  . LYS A 1 12  ? 34.902  -4.697  28.161  1.00 0.00 ? 369 LYS A HZ1  2  
ATOM   1737  H  HZ2  . LYS A 1 12  ? 33.532  -5.523  27.609  1.00 0.00 ? 369 LYS A HZ2  2  
ATOM   1738  H  HZ3  . LYS A 1 12  ? 33.537  -3.832  27.659  1.00 0.00 ? 369 LYS A HZ3  2  
ATOM   1739  N  N    . ARG A 1 13  ? 33.535  -1.829  21.357  1.00 0.00 ? 370 ARG A N    2  
ATOM   1740  C  CA   . ARG A 1 13  ? 32.304  -1.214  20.875  1.00 0.00 ? 370 ARG A CA   2  
ATOM   1741  C  C    . ARG A 1 13  ? 31.170  -2.233  20.825  1.00 0.00 ? 370 ARG A C    2  
ATOM   1742  O  O    . ARG A 1 13  ? 31.360  -3.367  20.383  1.00 0.00 ? 370 ARG A O    2  
ATOM   1743  C  CB   . ARG A 1 13  ? 32.522  -0.607  19.488  1.00 0.00 ? 370 ARG A CB   2  
ATOM   1744  C  CG   . ARG A 1 13  ? 31.647  0.604   19.209  1.00 0.00 ? 370 ARG A CG   2  
ATOM   1745  C  CD   . ARG A 1 13  ? 31.998  1.767   20.123  1.00 0.00 ? 370 ARG A CD   2  
ATOM   1746  N  NE   . ARG A 1 13  ? 31.711  3.058   19.503  1.00 0.00 ? 370 ARG A NE   2  
ATOM   1747  C  CZ   . ARG A 1 13  ? 32.381  3.537   18.460  1.00 0.00 ? 370 ARG A CZ   2  
ATOM   1748  N  NH1  . ARG A 1 13  ? 33.370  2.836   17.924  1.00 0.00 ? 370 ARG A NH1  2  
ATOM   1749  N  NH2  . ARG A 1 13  ? 32.060  4.720   17.951  1.00 0.00 ? 370 ARG A NH2  2  
ATOM   1750  H  H    . ARG A 1 13  ? 33.560  -2.799  21.500  1.00 0.00 ? 370 ARG A H    2  
ATOM   1751  H  HA   . ARG A 1 13  ? 32.035  -0.427  21.564  1.00 0.00 ? 370 ARG A HA   2  
ATOM   1752  H  HB2  . ARG A 1 13  ? 33.555  -0.306  19.397  1.00 0.00 ? 370 ARG A HB2  2  
ATOM   1753  H  HB3  . ARG A 1 13  ? 32.307  -1.358  18.742  1.00 0.00 ? 370 ARG A HB3  2  
ATOM   1754  H  HG2  . ARG A 1 13  ? 31.790  0.912   18.183  1.00 0.00 ? 370 ARG A HG2  2  
ATOM   1755  H  HG3  . ARG A 1 13  ? 30.613  0.334   19.365  1.00 0.00 ? 370 ARG A HG3  2  
ATOM   1756  H  HD2  . ARG A 1 13  ? 31.422  1.680   21.032  1.00 0.00 ? 370 ARG A HD2  2  
ATOM   1757  H  HD3  . ARG A 1 13  ? 33.051  1.717   20.359  1.00 0.00 ? 370 ARG A HD3  2  
ATOM   1758  H  HE   . ARG A 1 13  ? 30.984  3.592   19.883  1.00 0.00 ? 370 ARG A HE   2  
ATOM   1759  H  HH11 . ARG A 1 13  ? 33.613  1.944   18.305  1.00 0.00 ? 370 ARG A HH11 2  
ATOM   1760  H  HH12 . ARG A 1 13  ? 33.872  3.198   17.139  1.00 0.00 ? 370 ARG A HH12 2  
ATOM   1761  H  HH21 . ARG A 1 13  ? 31.315  5.251   18.353  1.00 0.00 ? 370 ARG A HH21 2  
ATOM   1762  H  HH22 . ARG A 1 13  ? 32.564  5.080   17.167  1.00 0.00 ? 370 ARG A HH22 2  
ATOM   1763  N  N    . ARG A 1 14  ? 29.991  -1.822  21.280  1.00 0.00 ? 371 ARG A N    2  
ATOM   1764  C  CA   . ARG A 1 14  ? 28.827  -2.700  21.289  1.00 0.00 ? 371 ARG A CA   2  
ATOM   1765  C  C    . ARG A 1 14  ? 28.110  -2.665  19.942  1.00 0.00 ? 371 ARG A C    2  
ATOM   1766  O  O    . ARG A 1 14  ? 28.512  -1.938  19.033  1.00 0.00 ? 371 ARG A O    2  
ATOM   1767  C  CB   . ARG A 1 14  ? 27.862  -2.291  22.403  1.00 0.00 ? 371 ARG A CB   2  
ATOM   1768  C  CG   . ARG A 1 14  ? 27.055  -3.450  22.965  1.00 0.00 ? 371 ARG A CG   2  
ATOM   1769  C  CD   . ARG A 1 14  ? 26.689  -3.220  24.422  1.00 0.00 ? 371 ARG A CD   2  
ATOM   1770  N  NE   . ARG A 1 14  ? 25.567  -2.296  24.566  1.00 0.00 ? 371 ARG A NE   2  
ATOM   1771  C  CZ   . ARG A 1 14  ? 25.064  -1.927  25.739  1.00 0.00 ? 371 ARG A CZ   2  
ATOM   1772  N  NH1  . ARG A 1 14  ? 25.580  -2.402  26.864  1.00 0.00 ? 371 ARG A NH1  2  
ATOM   1773  N  NH2  . ARG A 1 14  ? 24.042  -1.082  25.788  1.00 0.00 ? 371 ARG A NH2  2  
ATOM   1774  H  H    . ARG A 1 14  ? 29.902  -0.907  21.620  1.00 0.00 ? 371 ARG A H    2  
ATOM   1775  H  HA   . ARG A 1 14  ? 29.172  -3.706  21.474  1.00 0.00 ? 371 ARG A HA   2  
ATOM   1776  H  HB2  . ARG A 1 14  ? 28.429  -1.852  23.211  1.00 0.00 ? 371 ARG A HB2  2  
ATOM   1777  H  HB3  . ARG A 1 14  ? 27.174  -1.556  22.015  1.00 0.00 ? 371 ARG A HB3  2  
ATOM   1778  H  HG2  . ARG A 1 14  ? 26.147  -3.556  22.390  1.00 0.00 ? 371 ARG A HG2  2  
ATOM   1779  H  HG3  . ARG A 1 14  ? 27.639  -4.355  22.888  1.00 0.00 ? 371 ARG A HG3  2  
ATOM   1780  H  HD2  . ARG A 1 14  ? 26.421  -4.167  24.867  1.00 0.00 ? 371 ARG A HD2  2  
ATOM   1781  H  HD3  . ARG A 1 14  ? 27.547  -2.812  24.935  1.00 0.00 ? 371 ARG A HD3  2  
ATOM   1782  H  HE   . ARG A 1 14  ? 25.170  -1.933  23.747  1.00 0.00 ? 371 ARG A HE   2  
ATOM   1783  H  HH11 . ARG A 1 14  ? 26.351  -3.038  26.830  1.00 0.00 ? 371 ARG A HH11 2  
ATOM   1784  H  HH12 . ARG A 1 14  ? 25.200  -2.122  27.746  1.00 0.00 ? 371 ARG A HH12 2  
ATOM   1785  H  HH21 . ARG A 1 14  ? 23.651  -0.722  24.941  1.00 0.00 ? 371 ARG A HH21 2  
ATOM   1786  H  HH22 . ARG A 1 14  ? 23.664  -0.805  26.670  1.00 0.00 ? 371 ARG A HH22 2  
ATOM   1787  N  N    . ILE A 1 15  ? 27.048  -3.454  19.823  1.00 0.00 ? 372 ILE A N    2  
ATOM   1788  C  CA   . ILE A 1 15  ? 26.275  -3.512  18.588  1.00 0.00 ? 372 ILE A CA   2  
ATOM   1789  C  C    . ILE A 1 15  ? 24.788  -3.688  18.878  1.00 0.00 ? 372 ILE A C    2  
ATOM   1790  O  O    . ILE A 1 15  ? 24.406  -4.197  19.933  1.00 0.00 ? 372 ILE A O    2  
ATOM   1791  C  CB   . ILE A 1 15  ? 26.750  -4.663  17.681  1.00 0.00 ? 372 ILE A CB   2  
ATOM   1792  C  CG1  . ILE A 1 15  ? 28.206  -4.446  17.266  1.00 0.00 ? 372 ILE A CG1  2  
ATOM   1793  C  CG2  . ILE A 1 15  ? 25.855  -4.775  16.456  1.00 0.00 ? 372 ILE A CG2  2  
ATOM   1794  C  CD1  . ILE A 1 15  ? 28.877  -5.696  16.741  1.00 0.00 ? 372 ILE A CD1  2  
ATOM   1795  H  H    . ILE A 1 15  ? 26.777  -4.009  20.583  1.00 0.00 ? 372 ILE A H    2  
ATOM   1796  H  HA   . ILE A 1 15  ? 26.420  -2.581  18.060  1.00 0.00 ? 372 ILE A HA   2  
ATOM   1797  H  HB   . ILE A 1 15  ? 26.674  -5.584  18.237  1.00 0.00 ? 372 ILE A HB   2  
ATOM   1798  H  HG12 . ILE A 1 15  ? 28.245  -3.699  16.489  1.00 0.00 ? 372 ILE A HG12 2  
ATOM   1799  H  HG13 . ILE A 1 15  ? 28.769  -4.101  18.121  1.00 0.00 ? 372 ILE A HG13 2  
ATOM   1800  H  HG21 . ILE A 1 15  ? 24.926  -5.254  16.731  1.00 0.00 ? 372 ILE A HG21 2  
ATOM   1801  H  HG22 . ILE A 1 15  ? 25.649  -3.788  16.070  1.00 0.00 ? 372 ILE A HG22 2  
ATOM   1802  H  HG23 . ILE A 1 15  ? 26.352  -5.362  15.699  1.00 0.00 ? 372 ILE A HG23 2  
ATOM   1803  H  HD11 . ILE A 1 15  ? 29.242  -6.284  17.571  1.00 0.00 ? 372 ILE A HD11 2  
ATOM   1804  H  HD12 . ILE A 1 15  ? 28.164  -6.278  16.176  1.00 0.00 ? 372 ILE A HD12 2  
ATOM   1805  H  HD13 . ILE A 1 15  ? 29.704  -5.422  16.105  1.00 0.00 ? 372 ILE A HD13 2  
ATOM   1806  N  N    . HIS A 1 16  ? 23.953  -3.266  17.934  1.00 0.00 ? 373 HIS A N    2  
ATOM   1807  C  CA   . HIS A 1 16  ? 22.507  -3.379  18.087  1.00 0.00 ? 373 HIS A CA   2  
ATOM   1808  C  C    . HIS A 1 16  ? 21.828  -3.537  16.730  1.00 0.00 ? 373 HIS A C    2  
ATOM   1809  O  O    . HIS A 1 16  ? 22.100  -2.781  15.797  1.00 0.00 ? 373 HIS A O    2  
ATOM   1810  C  CB   . HIS A 1 16  ? 21.951  -2.150  18.808  1.00 0.00 ? 373 HIS A CB   2  
ATOM   1811  C  CG   . HIS A 1 16  ? 22.583  -1.903  20.144  1.00 0.00 ? 373 HIS A CG   2  
ATOM   1812  N  ND1  . HIS A 1 16  ? 21.910  -2.062  21.336  1.00 0.00 ? 373 HIS A ND1  2  
ATOM   1813  C  CD2  . HIS A 1 16  ? 23.836  -1.507  20.470  1.00 0.00 ? 373 HIS A CD2  2  
ATOM   1814  C  CE1  . HIS A 1 16  ? 22.720  -1.774  22.339  1.00 0.00 ? 373 HIS A CE1  2  
ATOM   1815  N  NE2  . HIS A 1 16  ? 23.895  -1.434  21.840  1.00 0.00 ? 373 HIS A NE2  2  
ATOM   1816  H  H    . HIS A 1 16  ? 24.318  -2.869  17.116  1.00 0.00 ? 373 HIS A H    2  
ATOM   1817  H  HA   . HIS A 1 16  ? 22.304  -4.257  18.681  1.00 0.00 ? 373 HIS A HA   2  
ATOM   1818  H  HB2  . HIS A 1 16  ? 22.117  -1.276  18.196  1.00 0.00 ? 373 HIS A HB2  2  
ATOM   1819  H  HB3  . HIS A 1 16  ? 20.890  -2.280  18.962  1.00 0.00 ? 373 HIS A HB3  2  
ATOM   1820  H  HD1  . HIS A 1 16  ? 20.976  -2.344  21.433  1.00 0.00 ? 373 HIS A HD1  2  
ATOM   1821  H  HD2  . HIS A 1 16  ? 24.640  -1.288  19.782  1.00 0.00 ? 373 HIS A HD2  2  
ATOM   1822  H  HE1  . HIS A 1 16  ? 22.466  -1.809  23.388  1.00 0.00 ? 373 HIS A HE1  2  
ATOM   1823  N  N    . TYR A 1 17  ? 20.945  -4.523  16.627  1.00 0.00 ? 374 TYR A N    2  
ATOM   1824  C  CA   . TYR A 1 17  ? 20.229  -4.782  15.383  1.00 0.00 ? 374 TYR A CA   2  
ATOM   1825  C  C    . TYR A 1 17  ? 18.790  -4.285  15.469  1.00 0.00 ? 374 TYR A C    2  
ATOM   1826  O  O    . TYR A 1 17  ? 18.085  -4.551  16.443  1.00 0.00 ? 374 TYR A O    2  
ATOM   1827  C  CB   . TYR A 1 17  ? 20.246  -6.278  15.063  1.00 0.00 ? 374 TYR A CB   2  
ATOM   1828  C  CG   . TYR A 1 17  ? 21.635  -6.835  14.843  1.00 0.00 ? 374 TYR A CG   2  
ATOM   1829  C  CD1  . TYR A 1 17  ? 22.470  -7.116  15.918  1.00 0.00 ? 374 TYR A CD1  2  
ATOM   1830  C  CD2  . TYR A 1 17  ? 22.111  -7.081  13.562  1.00 0.00 ? 374 TYR A CD2  2  
ATOM   1831  C  CE1  . TYR A 1 17  ? 23.739  -7.624  15.722  1.00 0.00 ? 374 TYR A CE1  2  
ATOM   1832  C  CE2  . TYR A 1 17  ? 23.379  -7.591  13.356  1.00 0.00 ? 374 TYR A CE2  2  
ATOM   1833  C  CZ   . TYR A 1 17  ? 24.189  -7.860  14.439  1.00 0.00 ? 374 TYR A CZ   2  
ATOM   1834  O  OH   . TYR A 1 17  ? 25.452  -8.367  14.240  1.00 0.00 ? 374 TYR A OH   2  
ATOM   1835  H  H    . TYR A 1 17  ? 20.770  -5.092  17.406  1.00 0.00 ? 374 TYR A H    2  
ATOM   1836  H  HA   . TYR A 1 17  ? 20.736  -4.249  14.592  1.00 0.00 ? 374 TYR A HA   2  
ATOM   1837  H  HB2  . TYR A 1 17  ? 19.798  -6.820  15.881  1.00 0.00 ? 374 TYR A HB2  2  
ATOM   1838  H  HB3  . TYR A 1 17  ? 19.672  -6.453  14.165  1.00 0.00 ? 374 TYR A HB3  2  
ATOM   1839  H  HD1  . TYR A 1 17  ? 22.114  -6.930  16.921  1.00 0.00 ? 374 TYR A HD1  2  
ATOM   1840  H  HD2  . TYR A 1 17  ? 21.474  -6.869  12.715  1.00 0.00 ? 374 TYR A HD2  2  
ATOM   1841  H  HE1  . TYR A 1 17  ? 24.374  -7.835  16.570  1.00 0.00 ? 374 TYR A HE1  2  
ATOM   1842  H  HE2  . TYR A 1 17  ? 23.731  -7.775  12.352  1.00 0.00 ? 374 TYR A HE2  2  
ATOM   1843  H  HH   . TYR A 1 17  ? 25.460  -8.902  13.443  1.00 0.00 ? 374 TYR A HH   2  
ATOM   1844  N  N    . CYS A 1 18  ? 18.359  -3.561  14.441  1.00 0.00 ? 375 CYS A N    2  
ATOM   1845  C  CA   . CYS A 1 18  ? 17.003  -3.026  14.398  1.00 0.00 ? 375 CYS A CA   2  
ATOM   1846  C  C    . CYS A 1 18  ? 15.983  -4.096  14.776  1.00 0.00 ? 375 CYS A C    2  
ATOM   1847  O  O    . CYS A 1 18  ? 16.057  -5.232  14.308  1.00 0.00 ? 375 CYS A O    2  
ATOM   1848  C  CB   . CYS A 1 18  ? 16.693  -2.480  13.002  1.00 0.00 ? 375 CYS A CB   2  
ATOM   1849  S  SG   . CYS A 1 18  ? 15.087  -1.628  12.877  1.00 0.00 ? 375 CYS A SG   2  
ATOM   1850  H  H    . CYS A 1 18  ? 18.967  -3.382  13.693  1.00 0.00 ? 375 CYS A H    2  
ATOM   1851  H  HA   . CYS A 1 18  ? 16.942  -2.219  15.112  1.00 0.00 ? 375 CYS A HA   2  
ATOM   1852  H  HB2  . CYS A 1 18  ? 17.461  -1.775  12.721  1.00 0.00 ? 375 CYS A HB2  2  
ATOM   1853  H  HB3  . CYS A 1 18  ? 16.687  -3.298  12.297  1.00 0.00 ? 375 CYS A HB3  2  
ATOM   1854  N  N    . ASP A 1 19  ? 15.032  -3.724  15.626  1.00 0.00 ? 376 ASP A N    2  
ATOM   1855  C  CA   . ASP A 1 19  ? 13.996  -4.650  16.067  1.00 0.00 ? 376 ASP A CA   2  
ATOM   1856  C  C    . ASP A 1 19  ? 12.814  -4.643  15.102  1.00 0.00 ? 376 ASP A C    2  
ATOM   1857  O  O    . ASP A 1 19  ? 11.657  -4.681  15.521  1.00 0.00 ? 376 ASP A O    2  
ATOM   1858  C  CB   . ASP A 1 19  ? 13.522  -4.287  17.475  1.00 0.00 ? 376 ASP A CB   2  
ATOM   1859  C  CG   . ASP A 1 19  ? 13.426  -2.788  17.685  1.00 0.00 ? 376 ASP A CG   2  
ATOM   1860  O  OD1  . ASP A 1 19  ? 14.469  -2.109  17.593  1.00 0.00 ? 376 ASP A OD1  2  
ATOM   1861  O  OD2  . ASP A 1 19  ? 12.307  -2.295  17.941  1.00 0.00 ? 376 ASP A OD2  2  
ATOM   1862  H  H    . ASP A 1 19  ? 15.026  -2.804  15.964  1.00 0.00 ? 376 ASP A H    2  
ATOM   1863  H  HA   . ASP A 1 19  ? 14.423  -5.641  16.085  1.00 0.00 ? 376 ASP A HA   2  
ATOM   1864  H  HB2  . ASP A 1 19  ? 12.546  -4.718  17.642  1.00 0.00 ? 376 ASP A HB2  2  
ATOM   1865  H  HB3  . ASP A 1 19  ? 14.218  -4.689  18.196  1.00 0.00 ? 376 ASP A HB3  2  
ATOM   1866  N  N    . TYR A 1 20  ? 13.114  -4.592  13.809  1.00 0.00 ? 377 TYR A N    2  
ATOM   1867  C  CA   . TYR A 1 20  ? 12.076  -4.576  12.784  1.00 0.00 ? 377 TYR A CA   2  
ATOM   1868  C  C    . TYR A 1 20  ? 12.210  -5.779  11.855  1.00 0.00 ? 377 TYR A C    2  
ATOM   1869  O  O    . TYR A 1 20  ? 13.306  -6.162  11.447  1.00 0.00 ? 377 TYR A O    2  
ATOM   1870  C  CB   . TYR A 1 20  ? 12.150  -3.281  11.974  1.00 0.00 ? 377 TYR A CB   2  
ATOM   1871  C  CG   . TYR A 1 20  ? 10.831  -2.878  11.354  1.00 0.00 ? 377 TYR A CG   2  
ATOM   1872  C  CD1  . TYR A 1 20  ? 9.853   -2.242  12.108  1.00 0.00 ? 377 TYR A CD1  2  
ATOM   1873  C  CD2  . TYR A 1 20  ? 10.563  -3.135  10.015  1.00 0.00 ? 377 TYR A CD2  2  
ATOM   1874  C  CE1  . TYR A 1 20  ? 8.646   -1.873  11.546  1.00 0.00 ? 377 TYR A CE1  2  
ATOM   1875  C  CE2  . TYR A 1 20  ? 9.360   -2.768  9.445   1.00 0.00 ? 377 TYR A CE2  2  
ATOM   1876  C  CZ   . TYR A 1 20  ? 8.404   -2.137  10.214  1.00 0.00 ? 377 TYR A CZ   2  
ATOM   1877  O  OH   . TYR A 1 20  ? 7.204   -1.771  9.650   1.00 0.00 ? 377 TYR A OH   2  
ATOM   1878  H  H    . TYR A 1 20  ? 14.054  -4.563  13.536  1.00 0.00 ? 377 TYR A H    2  
ATOM   1879  H  HA   . TYR A 1 20  ? 11.118  -4.624  13.281  1.00 0.00 ? 377 TYR A HA   2  
ATOM   1880  H  HB2  . TYR A 1 20  ? 12.471  -2.478  12.619  1.00 0.00 ? 377 TYR A HB2  2  
ATOM   1881  H  HB3  . TYR A 1 20  ? 12.868  -3.404  11.176  1.00 0.00 ? 377 TYR A HB3  2  
ATOM   1882  H  HD1  . TYR A 1 20  ? 10.045  -2.036  13.151  1.00 0.00 ? 377 TYR A HD1  2  
ATOM   1883  H  HD2  . TYR A 1 20  ? 11.313  -3.629  9.415   1.00 0.00 ? 377 TYR A HD2  2  
ATOM   1884  H  HE1  . TYR A 1 20  ? 7.897   -1.379  12.149  1.00 0.00 ? 377 TYR A HE1  2  
ATOM   1885  H  HE2  . TYR A 1 20  ? 9.170   -2.975  8.402   1.00 0.00 ? 377 TYR A HE2  2  
ATOM   1886  H  HH   . TYR A 1 20  ? 7.226   -0.838  9.427   1.00 0.00 ? 377 TYR A HH   2  
ATOM   1887  N  N    . PRO A 1 21  ? 11.066  -6.390  11.511  1.00 0.00 ? 378 PRO A N    2  
ATOM   1888  C  CA   . PRO A 1 21  ? 11.027  -7.557  10.626  1.00 0.00 ? 378 PRO A CA   2  
ATOM   1889  C  C    . PRO A 1 21  ? 11.386  -7.205  9.186   1.00 0.00 ? 378 PRO A C    2  
ATOM   1890  O  O    . PRO A 1 21  ? 10.616  -6.548  8.487   1.00 0.00 ? 378 PRO A O    2  
ATOM   1891  C  CB   . PRO A 1 21  ? 9.571   -8.022  10.716  1.00 0.00 ? 378 PRO A CB   2  
ATOM   1892  C  CG   . PRO A 1 21  ? 8.806   -6.800  11.089  1.00 0.00 ? 378 PRO A CG   2  
ATOM   1893  C  CD   . PRO A 1 21  ? 9.723   -5.987  11.961  1.00 0.00 ? 378 PRO A CD   2  
ATOM   1894  H  HA   . PRO A 1 21  ? 11.680  -8.343  10.976  1.00 0.00 ? 378 PRO A HA   2  
ATOM   1895  H  HB2  . PRO A 1 21  ? 9.255   -8.410  9.758   1.00 0.00 ? 378 PRO A HB2  2  
ATOM   1896  H  HB3  . PRO A 1 21  ? 9.480   -8.790  11.469  1.00 0.00 ? 378 PRO A HB3  2  
ATOM   1897  H  HG2  . PRO A 1 21  ? 8.543   -6.245  10.201  1.00 0.00 ? 378 PRO A HG2  2  
ATOM   1898  H  HG3  . PRO A 1 21  ? 7.917   -7.077  11.637  1.00 0.00 ? 378 PRO A HG3  2  
ATOM   1899  H  HD2  . PRO A 1 21  ? 9.562   -4.932  11.797  1.00 0.00 ? 378 PRO A HD2  2  
ATOM   1900  H  HD3  . PRO A 1 21  ? 9.574   -6.236  13.001  1.00 0.00 ? 378 PRO A HD3  2  
ATOM   1901  N  N    . GLY A 1 22  ? 12.561  -7.647  8.749   1.00 0.00 ? 379 GLY A N    2  
ATOM   1902  C  CA   . GLY A 1 22  ? 13.001  -7.369  7.394   1.00 0.00 ? 379 GLY A CA   2  
ATOM   1903  C  C    . GLY A 1 22  ? 14.175  -6.412  7.351   1.00 0.00 ? 379 GLY A C    2  
ATOM   1904  O  O    . GLY A 1 22  ? 15.076  -6.559  6.525   1.00 0.00 ? 379 GLY A O    2  
ATOM   1905  H  H    . GLY A 1 22  ? 13.134  -8.167  9.351   1.00 0.00 ? 379 GLY A H    2  
ATOM   1906  H  HA2  . GLY A 1 22  ? 13.289  -8.297  6.923   1.00 0.00 ? 379 GLY A HA2  2  
ATOM   1907  H  HA3  . GLY A 1 22  ? 12.179  -6.937  6.843   1.00 0.00 ? 379 GLY A HA3  2  
ATOM   1908  N  N    . CYS A 1 23  ? 14.165  -5.426  8.242   1.00 0.00 ? 380 CYS A N    2  
ATOM   1909  C  CA   . CYS A 1 23  ? 15.236  -4.438  8.302   1.00 0.00 ? 380 CYS A CA   2  
ATOM   1910  C  C    . CYS A 1 23  ? 16.554  -5.089  8.715   1.00 0.00 ? 380 CYS A C    2  
ATOM   1911  O  O    . CYS A 1 23  ? 16.613  -5.829  9.697   1.00 0.00 ? 380 CYS A O    2  
ATOM   1912  C  CB   . CYS A 1 23  ? 14.875  -3.323  9.285   1.00 0.00 ? 380 CYS A CB   2  
ATOM   1913  S  SG   . CYS A 1 23  ? 16.123  -2.000  9.399   1.00 0.00 ? 380 CYS A SG   2  
ATOM   1914  H  H    . CYS A 1 23  ? 13.419  -5.360  8.875   1.00 0.00 ? 380 CYS A H    2  
ATOM   1915  H  HA   . CYS A 1 23  ? 15.352  -4.014  7.316   1.00 0.00 ? 380 CYS A HA   2  
ATOM   1916  H  HB2  . CYS A 1 23  ? 13.944  -2.869  8.977   1.00 0.00 ? 380 CYS A HB2  2  
ATOM   1917  H  HB3  . CYS A 1 23  ? 14.754  -3.747  10.270  1.00 0.00 ? 380 CYS A HB3  2  
ATOM   1918  N  N    . THR A 1 24  ? 17.610  -4.806  7.958   1.00 0.00 ? 381 THR A N    2  
ATOM   1919  C  CA   . THR A 1 24  ? 18.926  -5.363  8.244   1.00 0.00 ? 381 THR A CA   2  
ATOM   1920  C  C    . THR A 1 24  ? 19.907  -4.272  8.654   1.00 0.00 ? 381 THR A C    2  
ATOM   1921  O  O    . THR A 1 24  ? 21.078  -4.301  8.275   1.00 0.00 ? 381 THR A O    2  
ATOM   1922  C  CB   . THR A 1 24  ? 19.493  -6.117  7.026   1.00 0.00 ? 381 THR A CB   2  
ATOM   1923  O  OG1  . THR A 1 24  ? 19.602  -5.229  5.908   1.00 0.00 ? 381 THR A OG1  2  
ATOM   1924  C  CG2  . THR A 1 24  ? 18.606  -7.297  6.658   1.00 0.00 ? 381 THR A CG2  2  
ATOM   1925  H  H    . THR A 1 24  ? 17.499  -4.209  7.189   1.00 0.00 ? 381 THR A H    2  
ATOM   1926  H  HA   . THR A 1 24  ? 18.821  -6.065  9.058   1.00 0.00 ? 381 THR A HA   2  
ATOM   1927  H  HB   . THR A 1 24  ? 20.476  -6.489  7.278   1.00 0.00 ? 381 THR A HB   2  
ATOM   1928  H  HG1  . THR A 1 24  ? 18.746  -5.146  5.480   1.00 0.00 ? 381 THR A HG1  2  
ATOM   1929  H  HG21 . THR A 1 24  ? 18.491  -7.941  7.517   1.00 0.00 ? 381 THR A HG21 2  
ATOM   1930  H  HG22 . THR A 1 24  ? 19.062  -7.852  5.852   1.00 0.00 ? 381 THR A HG22 2  
ATOM   1931  H  HG23 . THR A 1 24  ? 17.638  -6.936  6.346   1.00 0.00 ? 381 THR A HG23 2  
ATOM   1932  N  N    . LYS A 1 25  ? 19.423  -3.310  9.432   1.00 0.00 ? 382 LYS A N    2  
ATOM   1933  C  CA   . LYS A 1 25  ? 20.259  -2.208  9.897   1.00 0.00 ? 382 LYS A CA   2  
ATOM   1934  C  C    . LYS A 1 25  ? 20.865  -2.524  11.261  1.00 0.00 ? 382 LYS A C    2  
ATOM   1935  O  O    . LYS A 1 25  ? 20.317  -3.316  12.027  1.00 0.00 ? 382 LYS A O    2  
ATOM   1936  C  CB   . LYS A 1 25  ? 19.439  -0.919  9.978   1.00 0.00 ? 382 LYS A CB   2  
ATOM   1937  C  CG   . LYS A 1 25  ? 19.160  -0.289  8.624   1.00 0.00 ? 382 LYS A CG   2  
ATOM   1938  C  CD   . LYS A 1 25  ? 20.433  0.232   7.979   1.00 0.00 ? 382 LYS A CD   2  
ATOM   1939  C  CE   . LYS A 1 25  ? 20.151  0.879   6.632   1.00 0.00 ? 382 LYS A CE   2  
ATOM   1940  N  NZ   . LYS A 1 25  ? 21.293  1.715   6.168   1.00 0.00 ? 382 LYS A NZ   2  
ATOM   1941  H  H    . LYS A 1 25  ? 18.481  -3.341  9.701   1.00 0.00 ? 382 LYS A H    2  
ATOM   1942  H  HA   . LYS A 1 25  ? 21.057  -2.073  9.184   1.00 0.00 ? 382 LYS A HA   2  
ATOM   1943  H  HB2  . LYS A 1 25  ? 18.493  -1.136  10.452  1.00 0.00 ? 382 LYS A HB2  2  
ATOM   1944  H  HB3  . LYS A 1 25  ? 19.977  -0.202  10.581  1.00 0.00 ? 382 LYS A HB3  2  
ATOM   1945  H  HG2  . LYS A 1 25  ? 18.719  -1.031  7.976   1.00 0.00 ? 382 LYS A HG2  2  
ATOM   1946  H  HG3  . LYS A 1 25  ? 18.471  0.533   8.755   1.00 0.00 ? 382 LYS A HG3  2  
ATOM   1947  H  HD2  . LYS A 1 25  ? 20.883  0.967   8.631   1.00 0.00 ? 382 LYS A HD2  2  
ATOM   1948  H  HD3  . LYS A 1 25  ? 21.118  -0.592  7.837   1.00 0.00 ? 382 LYS A HD3  2  
ATOM   1949  H  HE2  . LYS A 1 25  ? 19.967  0.102   5.906   1.00 0.00 ? 382 LYS A HE2  2  
ATOM   1950  H  HE3  . LYS A 1 25  ? 19.273  1.501   6.723   1.00 0.00 ? 382 LYS A HE3  2  
ATOM   1951  H  HZ1  . LYS A 1 25  ? 20.943  2.617   5.786   1.00 0.00 ? 382 LYS A HZ1  2  
ATOM   1952  H  HZ2  . LYS A 1 25  ? 21.821  1.217   5.423   1.00 0.00 ? 382 LYS A HZ2  2  
ATOM   1953  H  HZ3  . LYS A 1 25  ? 21.936  1.912   6.960   1.00 0.00 ? 382 LYS A HZ3  2  
ATOM   1954  N  N    . VAL A 1 26  ? 22.000  -1.898  11.557  1.00 0.00 ? 383 VAL A N    2  
ATOM   1955  C  CA   . VAL A 1 26  ? 22.680  -2.111  12.829  1.00 0.00 ? 383 VAL A CA   2  
ATOM   1956  C  C    . VAL A 1 26  ? 23.591  -0.936  13.168  1.00 0.00 ? 383 VAL A C    2  
ATOM   1957  O  O    . VAL A 1 26  ? 24.285  -0.404  12.302  1.00 0.00 ? 383 VAL A O    2  
ATOM   1958  C  CB   . VAL A 1 26  ? 23.516  -3.404  12.810  1.00 0.00 ? 383 VAL A CB   2  
ATOM   1959  C  CG1  . VAL A 1 26  ? 24.509  -3.382  11.658  1.00 0.00 ? 383 VAL A CG1  2  
ATOM   1960  C  CG2  . VAL A 1 26  ? 24.232  -3.596  14.139  1.00 0.00 ? 383 VAL A CG2  2  
ATOM   1961  H  H    . VAL A 1 26  ? 22.389  -1.279  10.905  1.00 0.00 ? 383 VAL A H    2  
ATOM   1962  H  HA   . VAL A 1 26  ? 21.928  -2.204  13.599  1.00 0.00 ? 383 VAL A HA   2  
ATOM   1963  H  HB   . VAL A 1 26  ? 22.847  -4.239  12.662  1.00 0.00 ? 383 VAL A HB   2  
ATOM   1964  H  HG11 . VAL A 1 26  ? 25.043  -2.443  11.663  1.00 0.00 ? 383 VAL A HG11 2  
ATOM   1965  H  HG12 . VAL A 1 26  ? 25.210  -4.196  11.770  1.00 0.00 ? 383 VAL A HG12 2  
ATOM   1966  H  HG13 . VAL A 1 26  ? 23.979  -3.488  10.724  1.00 0.00 ? 383 VAL A HG13 2  
ATOM   1967  H  HG21 . VAL A 1 26  ? 24.454  -2.631  14.570  1.00 0.00 ? 383 VAL A HG21 2  
ATOM   1968  H  HG22 . VAL A 1 26  ? 23.598  -4.154  14.811  1.00 0.00 ? 383 VAL A HG22 2  
ATOM   1969  H  HG23 . VAL A 1 26  ? 25.152  -4.138  13.978  1.00 0.00 ? 383 VAL A HG23 2  
ATOM   1970  N  N    . TYR A 1 27  ? 23.583  -0.535  14.435  1.00 0.00 ? 384 TYR A N    2  
ATOM   1971  C  CA   . TYR A 1 27  ? 24.407  0.579   14.889  1.00 0.00 ? 384 TYR A CA   2  
ATOM   1972  C  C    . TYR A 1 27  ? 25.155  0.217   16.168  1.00 0.00 ? 384 TYR A C    2  
ATOM   1973  O  O    . TYR A 1 27  ? 24.562  -0.263  17.135  1.00 0.00 ? 384 TYR A O    2  
ATOM   1974  C  CB   . TYR A 1 27  ? 23.541  1.818   15.125  1.00 0.00 ? 384 TYR A CB   2  
ATOM   1975  C  CG   . TYR A 1 27  ? 22.789  2.274   13.896  1.00 0.00 ? 384 TYR A CG   2  
ATOM   1976  C  CD1  . TYR A 1 27  ? 23.448  2.906   12.848  1.00 0.00 ? 384 TYR A CD1  2  
ATOM   1977  C  CD2  . TYR A 1 27  ? 21.419  2.072   13.781  1.00 0.00 ? 384 TYR A CD2  2  
ATOM   1978  C  CE1  . TYR A 1 27  ? 22.764  3.325   11.724  1.00 0.00 ? 384 TYR A CE1  2  
ATOM   1979  C  CE2  . TYR A 1 27  ? 20.727  2.486   12.659  1.00 0.00 ? 384 TYR A CE2  2  
ATOM   1980  C  CZ   . TYR A 1 27  ? 21.404  3.113   11.633  1.00 0.00 ? 384 TYR A CZ   2  
ATOM   1981  O  OH   . TYR A 1 27  ? 20.720  3.528   10.514  1.00 0.00 ? 384 TYR A OH   2  
ATOM   1982  H  H    . TYR A 1 27  ? 23.008  -0.998  15.080  1.00 0.00 ? 384 TYR A H    2  
ATOM   1983  H  HA   . TYR A 1 27  ? 25.126  0.797   14.114  1.00 0.00 ? 384 TYR A HA   2  
ATOM   1984  H  HB2  . TYR A 1 27  ? 22.816  1.601   15.895  1.00 0.00 ? 384 TYR A HB2  2  
ATOM   1985  H  HB3  . TYR A 1 27  ? 24.172  2.632   15.450  1.00 0.00 ? 384 TYR A HB3  2  
ATOM   1986  H  HD1  . TYR A 1 27  ? 24.513  3.070   12.922  1.00 0.00 ? 384 TYR A HD1  2  
ATOM   1987  H  HD2  . TYR A 1 27  ? 20.891  1.581   14.586  1.00 0.00 ? 384 TYR A HD2  2  
ATOM   1988  H  HE1  . TYR A 1 27  ? 23.294  3.815   10.920  1.00 0.00 ? 384 TYR A HE1  2  
ATOM   1989  H  HE2  . TYR A 1 27  ? 19.662  2.321   12.588  1.00 0.00 ? 384 TYR A HE2  2  
ATOM   1990  H  HH   . TYR A 1 27  ? 20.859  2.898   9.802   1.00 0.00 ? 384 TYR A HH   2  
ATOM   1991  N  N    . THR A 1 28  ? 26.464  0.450   16.166  1.00 0.00 ? 385 THR A N    2  
ATOM   1992  C  CA   . THR A 1 28  ? 27.296  0.149   17.324  1.00 0.00 ? 385 THR A CA   2  
ATOM   1993  C  C    . THR A 1 28  ? 26.639  0.628   18.613  1.00 0.00 ? 385 THR A C    2  
ATOM   1994  O  O    . THR A 1 28  ? 26.500  -0.131  19.572  1.00 0.00 ? 385 THR A O    2  
ATOM   1995  C  CB   . THR A 1 28  ? 28.688  0.796   17.200  1.00 0.00 ? 385 THR A CB   2  
ATOM   1996  O  OG1  . THR A 1 28  ? 28.587  2.048   16.513  1.00 0.00 ? 385 THR A OG1  2  
ATOM   1997  C  CG2  . THR A 1 28  ? 29.646  -0.121  16.454  1.00 0.00 ? 385 THR A CG2  2  
ATOM   1998  H  H    . THR A 1 28  ? 26.879  0.833   15.365  1.00 0.00 ? 385 THR A H    2  
ATOM   1999  H  HA   . THR A 1 28  ? 27.423  -0.923  17.374  1.00 0.00 ? 385 THR A HA   2  
ATOM   2000  H  HB   . THR A 1 28  ? 29.078  0.969   18.193  1.00 0.00 ? 385 THR A HB   2  
ATOM   2001  H  HG1  . THR A 1 28  ? 28.686  1.905   15.569  1.00 0.00 ? 385 THR A HG1  2  
ATOM   2002  H  HG21 . THR A 1 28  ? 30.658  0.232   16.586  1.00 0.00 ? 385 THR A HG21 2  
ATOM   2003  H  HG22 . THR A 1 28  ? 29.400  -0.120  15.402  1.00 0.00 ? 385 THR A HG22 2  
ATOM   2004  H  HG23 . THR A 1 28  ? 29.561  -1.124  16.843  1.00 0.00 ? 385 THR A HG23 2  
ATOM   2005  N  N    . LYS A 1 29  ? 26.234  1.894   18.630  1.00 0.00 ? 386 LYS A N    2  
ATOM   2006  C  CA   . LYS A 1 29  ? 25.588  2.476   19.800  1.00 0.00 ? 386 LYS A CA   2  
ATOM   2007  C  C    . LYS A 1 29  ? 24.070  2.434   19.662  1.00 0.00 ? 386 LYS A C    2  
ATOM   2008  O  O    . LYS A 1 29  ? 23.535  2.530   18.557  1.00 0.00 ? 386 LYS A O    2  
ATOM   2009  C  CB   . LYS A 1 29  ? 26.053  3.921   19.999  1.00 0.00 ? 386 LYS A CB   2  
ATOM   2010  C  CG   . LYS A 1 29  ? 27.529  4.044   20.333  1.00 0.00 ? 386 LYS A CG   2  
ATOM   2011  C  CD   . LYS A 1 29  ? 27.775  3.928   21.828  1.00 0.00 ? 386 LYS A CD   2  
ATOM   2012  C  CE   . LYS A 1 29  ? 29.128  3.298   22.123  1.00 0.00 ? 386 LYS A CE   2  
ATOM   2013  N  NZ   . LYS A 1 29  ? 29.279  2.960   23.565  1.00 0.00 ? 386 LYS A NZ   2  
ATOM   2014  H  H    . LYS A 1 29  ? 26.372  2.450   17.834  1.00 0.00 ? 386 LYS A H    2  
ATOM   2015  H  HA   . LYS A 1 29  ? 25.876  1.893   20.662  1.00 0.00 ? 386 LYS A HA   2  
ATOM   2016  H  HB2  . LYS A 1 29  ? 25.862  4.475   19.092  1.00 0.00 ? 386 LYS A HB2  2  
ATOM   2017  H  HB3  . LYS A 1 29  ? 25.485  4.361   20.806  1.00 0.00 ? 386 LYS A HB3  2  
ATOM   2018  H  HG2  . LYS A 1 29  ? 28.070  3.258   19.828  1.00 0.00 ? 386 LYS A HG2  2  
ATOM   2019  H  HG3  . LYS A 1 29  ? 27.887  5.006   19.992  1.00 0.00 ? 386 LYS A HG3  2  
ATOM   2020  H  HD2  . LYS A 1 29  ? 27.746  4.914   22.267  1.00 0.00 ? 386 LYS A HD2  2  
ATOM   2021  H  HD3  . LYS A 1 29  ? 26.999  3.315   22.264  1.00 0.00 ? 386 LYS A HD3  2  
ATOM   2022  H  HE2  . LYS A 1 29  ? 29.226  2.397   21.538  1.00 0.00 ? 386 LYS A HE2  2  
ATOM   2023  H  HE3  . LYS A 1 29  ? 29.903  3.995   21.842  1.00 0.00 ? 386 LYS A HE3  2  
ATOM   2024  H  HZ1  . LYS A 1 29  ? 29.437  1.938   23.678  1.00 0.00 ? 386 LYS A HZ1  2  
ATOM   2025  H  HZ2  . LYS A 1 29  ? 28.419  3.226   24.086  1.00 0.00 ? 386 LYS A HZ2  2  
ATOM   2026  H  HZ3  . LYS A 1 29  ? 30.088  3.472   23.969  1.00 0.00 ? 386 LYS A HZ3  2  
ATOM   2027  N  N    . SER A 1 30  ? 23.381  2.290   20.789  1.00 0.00 ? 387 SER A N    2  
ATOM   2028  C  CA   . SER A 1 30  ? 21.924  2.232   20.793  1.00 0.00 ? 387 SER A CA   2  
ATOM   2029  C  C    . SER A 1 30  ? 21.325  3.612   20.537  1.00 0.00 ? 387 SER A C    2  
ATOM   2030  O  O    . SER A 1 30  ? 20.134  3.741   20.254  1.00 0.00 ? 387 SER A O    2  
ATOM   2031  C  CB   . SER A 1 30  ? 21.417  1.684   22.129  1.00 0.00 ? 387 SER A CB   2  
ATOM   2032  O  OG   . SER A 1 30  ? 21.816  2.514   23.205  1.00 0.00 ? 387 SER A OG   2  
ATOM   2033  H  H    . SER A 1 30  ? 23.865  2.218   21.639  1.00 0.00 ? 387 SER A H    2  
ATOM   2034  H  HA   . SER A 1 30  ? 21.616  1.567   20.000  1.00 0.00 ? 387 SER A HA   2  
ATOM   2035  H  HB2  . SER A 1 30  ? 20.339  1.634   22.109  1.00 0.00 ? 387 SER A HB2  2  
ATOM   2036  H  HB3  . SER A 1 30  ? 21.821  0.693   22.284  1.00 0.00 ? 387 SER A HB3  2  
ATOM   2037  H  HG   . SER A 1 30  ? 22.762  2.671   23.155  1.00 0.00 ? 387 SER A HG   2  
ATOM   2038  N  N    . SER A 1 31  ? 22.161  4.641   20.640  1.00 0.00 ? 388 SER A N    2  
ATOM   2039  C  CA   . SER A 1 31  ? 21.715  6.012   20.424  1.00 0.00 ? 388 SER A CA   2  
ATOM   2040  C  C    . SER A 1 31  ? 21.365  6.245   18.957  1.00 0.00 ? 388 SER A C    2  
ATOM   2041  O  O    . SER A 1 31  ? 20.324  6.821   18.639  1.00 0.00 ? 388 SER A O    2  
ATOM   2042  C  CB   . SER A 1 31  ? 22.798  6.999   20.864  1.00 0.00 ? 388 SER A CB   2  
ATOM   2043  O  OG   . SER A 1 31  ? 23.105  6.839   22.239  1.00 0.00 ? 388 SER A OG   2  
ATOM   2044  H  H    . SER A 1 31  ? 23.099  4.473   20.869  1.00 0.00 ? 388 SER A H    2  
ATOM   2045  H  HA   . SER A 1 31  ? 20.830  6.171   21.022  1.00 0.00 ? 388 SER A HA   2  
ATOM   2046  H  HB2  . SER A 1 31  ? 23.693  6.828   20.286  1.00 0.00 ? 388 SER A HB2  2  
ATOM   2047  H  HB3  . SER A 1 31  ? 22.449  8.008   20.700  1.00 0.00 ? 388 SER A HB3  2  
ATOM   2048  H  HG   . SER A 1 31  ? 24.056  6.772   22.349  1.00 0.00 ? 388 SER A HG   2  
ATOM   2049  N  N    . HIS A 1 32  ? 22.243  5.793   18.067  1.00 0.00 ? 389 HIS A N    2  
ATOM   2050  C  CA   . HIS A 1 32  ? 22.028  5.951   16.633  1.00 0.00 ? 389 HIS A CA   2  
ATOM   2051  C  C    . HIS A 1 32  ? 20.800  5.167   16.178  1.00 0.00 ? 389 HIS A C    2  
ATOM   2052  O  O    . HIS A 1 32  ? 20.044  5.621   15.319  1.00 0.00 ? 389 HIS A O    2  
ATOM   2053  C  CB   . HIS A 1 32  ? 23.260  5.487   15.857  1.00 0.00 ? 389 HIS A CB   2  
ATOM   2054  C  CG   . HIS A 1 32  ? 24.554  5.927   16.469  1.00 0.00 ? 389 HIS A CG   2  
ATOM   2055  N  ND1  . HIS A 1 32  ? 25.606  5.066   16.706  1.00 0.00 ? 389 HIS A ND1  2  
ATOM   2056  C  CD2  . HIS A 1 32  ? 24.965  7.145   16.892  1.00 0.00 ? 389 HIS A CD2  2  
ATOM   2057  C  CE1  . HIS A 1 32  ? 26.606  5.736   17.250  1.00 0.00 ? 389 HIS A CE1  2  
ATOM   2058  N  NE2  . HIS A 1 32  ? 26.243  7.000   17.373  1.00 0.00 ? 389 HIS A NE2  2  
ATOM   2059  H  H    . HIS A 1 32  ? 23.054  5.343   18.382  1.00 0.00 ? 389 HIS A H    2  
ATOM   2060  H  HA   . HIS A 1 32  ? 21.863  7.000   16.436  1.00 0.00 ? 389 HIS A HA   2  
ATOM   2061  H  HB2  . HIS A 1 32  ? 23.265  4.408   15.813  1.00 0.00 ? 389 HIS A HB2  2  
ATOM   2062  H  HB3  . HIS A 1 32  ? 23.216  5.883   14.853  1.00 0.00 ? 389 HIS A HB3  2  
ATOM   2063  H  HD1  . HIS A 1 32  ? 25.616  4.107   16.507  1.00 0.00 ? 389 HIS A HD1  2  
ATOM   2064  H  HD2  . HIS A 1 32  ? 24.393  8.062   16.859  1.00 0.00 ? 389 HIS A HD2  2  
ATOM   2065  H  HE1  . HIS A 1 32  ? 27.559  5.322   17.544  1.00 0.00 ? 389 HIS A HE1  2  
ATOM   2066  N  N    . LEU A 1 33  ? 20.609  3.988   16.760  1.00 0.00 ? 390 LEU A N    2  
ATOM   2067  C  CA   . LEU A 1 33  ? 19.473  3.140   16.414  1.00 0.00 ? 390 LEU A CA   2  
ATOM   2068  C  C    . LEU A 1 33  ? 18.157  3.885   16.613  1.00 0.00 ? 390 LEU A C    2  
ATOM   2069  O  O    . LEU A 1 33  ? 17.372  4.041   15.677  1.00 0.00 ? 390 LEU A O    2  
ATOM   2070  C  CB   . LEU A 1 33  ? 19.486  1.867   17.261  1.00 0.00 ? 390 LEU A CB   2  
ATOM   2071  C  CG   . LEU A 1 33  ? 18.179  1.073   17.299  1.00 0.00 ? 390 LEU A CG   2  
ATOM   2072  C  CD1  . LEU A 1 33  ? 17.822  0.567   15.910  1.00 0.00 ? 390 LEU A CD1  2  
ATOM   2073  C  CD2  . LEU A 1 33  ? 18.288  -0.086  18.279  1.00 0.00 ? 390 LEU A CD2  2  
ATOM   2074  H  H    . LEU A 1 33  ? 21.245  3.680   17.437  1.00 0.00 ? 390 LEU A H    2  
ATOM   2075  H  HA   . LEU A 1 33  ? 19.566  2.870   15.372  1.00 0.00 ? 390 LEU A HA   2  
ATOM   2076  H  HB2  . LEU A 1 33  ? 20.255  1.218   16.872  1.00 0.00 ? 390 LEU A HB2  2  
ATOM   2077  H  HB3  . LEU A 1 33  ? 19.732  2.148   18.275  1.00 0.00 ? 390 LEU A HB3  2  
ATOM   2078  H  HG   . LEU A 1 33  ? 17.381  1.721   17.633  1.00 0.00 ? 390 LEU A HG   2  
ATOM   2079  H  HD11 . LEU A 1 33  ? 17.394  1.372   15.333  1.00 0.00 ? 390 LEU A HD11 2  
ATOM   2080  H  HD12 . LEU A 1 33  ? 17.105  -0.237  15.993  1.00 0.00 ? 390 LEU A HD12 2  
ATOM   2081  H  HD13 . LEU A 1 33  ? 18.713  0.205   15.419  1.00 0.00 ? 390 LEU A HD13 2  
ATOM   2082  H  HD21 . LEU A 1 33  ? 17.909  0.221   19.243  1.00 0.00 ? 390 LEU A HD21 2  
ATOM   2083  H  HD22 . LEU A 1 33  ? 19.322  -0.380  18.375  1.00 0.00 ? 390 LEU A HD22 2  
ATOM   2084  H  HD23 . LEU A 1 33  ? 17.709  -0.922  17.913  1.00 0.00 ? 390 LEU A HD23 2  
ATOM   2085  N  N    . LYS A 1 34  ? 17.922  4.344   17.837  1.00 0.00 ? 391 LYS A N    2  
ATOM   2086  C  CA   . LYS A 1 34  ? 16.703  5.076   18.160  1.00 0.00 ? 391 LYS A CA   2  
ATOM   2087  C  C    . LYS A 1 34  ? 16.361  6.075   17.059  1.00 0.00 ? 391 LYS A C    2  
ATOM   2088  O  O    . LYS A 1 34  ? 15.205  6.196   16.655  1.00 0.00 ? 391 LYS A O    2  
ATOM   2089  C  CB   . LYS A 1 34  ? 16.861  5.806   19.495  1.00 0.00 ? 391 LYS A CB   2  
ATOM   2090  C  CG   . LYS A 1 34  ? 16.644  4.914   20.706  1.00 0.00 ? 391 LYS A CG   2  
ATOM   2091  C  CD   . LYS A 1 34  ? 16.911  5.659   22.003  1.00 0.00 ? 391 LYS A CD   2  
ATOM   2092  C  CE   . LYS A 1 34  ? 16.715  4.760   23.213  1.00 0.00 ? 391 LYS A CE   2  
ATOM   2093  N  NZ   . LYS A 1 34  ? 17.576  5.172   24.356  1.00 0.00 ? 391 LYS A NZ   2  
ATOM   2094  H  H    . LYS A 1 34  ? 18.587  4.188   18.541  1.00 0.00 ? 391 LYS A H    2  
ATOM   2095  H  HA   . LYS A 1 34  ? 15.899  4.360   18.243  1.00 0.00 ? 391 LYS A HA   2  
ATOM   2096  H  HB2  . LYS A 1 34  ? 17.857  6.218   19.552  1.00 0.00 ? 391 LYS A HB2  2  
ATOM   2097  H  HB3  . LYS A 1 34  ? 16.144  6.614   19.537  1.00 0.00 ? 391 LYS A HB3  2  
ATOM   2098  H  HG2  . LYS A 1 34  ? 15.621  4.567   20.707  1.00 0.00 ? 391 LYS A HG2  2  
ATOM   2099  H  HG3  . LYS A 1 34  ? 17.313  4.068   20.642  1.00 0.00 ? 391 LYS A HG3  2  
ATOM   2100  H  HD2  . LYS A 1 34  ? 17.929  6.020   21.997  1.00 0.00 ? 391 LYS A HD2  2  
ATOM   2101  H  HD3  . LYS A 1 34  ? 16.231  6.497   22.073  1.00 0.00 ? 391 LYS A HD3  2  
ATOM   2102  H  HE2  . LYS A 1 34  ? 15.681  4.807   23.517  1.00 0.00 ? 391 LYS A HE2  2  
ATOM   2103  H  HE3  . LYS A 1 34  ? 16.962  3.746   22.935  1.00 0.00 ? 391 LYS A HE3  2  
ATOM   2104  H  HZ1  . LYS A 1 34  ? 18.217  4.397   24.619  1.00 0.00 ? 391 LYS A HZ1  2  
ATOM   2105  H  HZ2  . LYS A 1 34  ? 16.986  5.414   25.178  1.00 0.00 ? 391 LYS A HZ2  2  
ATOM   2106  H  HZ3  . LYS A 1 34  ? 18.143  6.003   24.094  1.00 0.00 ? 391 LYS A HZ3  2  
ATOM   2107  N  N    . ALA A 1 35  ? 17.374  6.788   16.577  1.00 0.00 ? 392 ALA A N    2  
ATOM   2108  C  CA   . ALA A 1 35  ? 17.180  7.773   15.521  1.00 0.00 ? 392 ALA A CA   2  
ATOM   2109  C  C    . ALA A 1 35  ? 16.684  7.113   14.239  1.00 0.00 ? 392 ALA A C    2  
ATOM   2110  O  O    . ALA A 1 35  ? 15.751  7.600   13.599  1.00 0.00 ? 392 ALA A O    2  
ATOM   2111  C  CB   . ALA A 1 35  ? 18.474  8.530   15.261  1.00 0.00 ? 392 ALA A CB   2  
ATOM   2112  H  H    . ALA A 1 35  ? 18.273  6.646   16.940  1.00 0.00 ? 392 ALA A H    2  
ATOM   2113  H  HA   . ALA A 1 35  ? 16.438  8.483   15.859  1.00 0.00 ? 392 ALA A HA   2  
ATOM   2114  H  HB1  . ALA A 1 35  ? 19.092  7.963   14.582  1.00 0.00 ? 392 ALA A HB1  2  
ATOM   2115  H  HB2  . ALA A 1 35  ? 18.246  9.491   14.824  1.00 0.00 ? 392 ALA A HB2  2  
ATOM   2116  H  HB3  . ALA A 1 35  ? 19.000  8.673   16.193  1.00 0.00 ? 392 ALA A HB3  2  
ATOM   2117  N  N    . HIS A 1 36  ? 17.315  6.004   13.868  1.00 0.00 ? 393 HIS A N    2  
ATOM   2118  C  CA   . HIS A 1 36  ? 16.937  5.277   12.661  1.00 0.00 ? 393 HIS A CA   2  
ATOM   2119  C  C    . HIS A 1 36  ? 15.488  4.807   12.740  1.00 0.00 ? 393 HIS A C    2  
ATOM   2120  O  O    . HIS A 1 36  ? 14.687  5.077   11.845  1.00 0.00 ? 393 HIS A O    2  
ATOM   2121  C  CB   . HIS A 1 36  ? 17.864  4.079   12.451  1.00 0.00 ? 393 HIS A CB   2  
ATOM   2122  C  CG   . HIS A 1 36  ? 17.232  2.961   11.679  1.00 0.00 ? 393 HIS A CG   2  
ATOM   2123  N  ND1  . HIS A 1 36  ? 17.237  2.901   10.301  1.00 0.00 ? 393 HIS A ND1  2  
ATOM   2124  C  CD2  . HIS A 1 36  ? 16.574  1.856   12.100  1.00 0.00 ? 393 HIS A CD2  2  
ATOM   2125  C  CE1  . HIS A 1 36  ? 16.608  1.808   9.908   1.00 0.00 ? 393 HIS A CE1  2  
ATOM   2126  N  NE2  . HIS A 1 36  ? 16.197  1.156   10.980  1.00 0.00 ? 393 HIS A NE2  2  
ATOM   2127  H  H    . HIS A 1 36  ? 18.051  5.665   14.419  1.00 0.00 ? 393 HIS A H    2  
ATOM   2128  H  HA   . HIS A 1 36  ? 17.039  5.950   11.823  1.00 0.00 ? 393 HIS A HA   2  
ATOM   2129  H  HB2  . HIS A 1 36  ? 18.741  4.401   11.909  1.00 0.00 ? 393 HIS A HB2  2  
ATOM   2130  H  HB3  . HIS A 1 36  ? 18.163  3.690   13.413  1.00 0.00 ? 393 HIS A HB3  2  
ATOM   2131  H  HD1  . HIS A 1 36  ? 17.640  3.563   9.701   1.00 0.00 ? 393 HIS A HD1  2  
ATOM   2132  H  HD2  . HIS A 1 36  ? 16.381  1.575   13.126  1.00 0.00 ? 393 HIS A HD2  2  
ATOM   2133  H  HE1  . HIS A 1 36  ? 16.457  1.499   8.884   1.00 0.00 ? 393 HIS A HE1  2  
ATOM   2134  N  N    . LEU A 1 37  ? 15.159  4.101   13.817  1.00 0.00 ? 394 LEU A N    2  
ATOM   2135  C  CA   . LEU A 1 37  ? 13.805  3.593   14.013  1.00 0.00 ? 394 LEU A CA   2  
ATOM   2136  C  C    . LEU A 1 37  ? 12.770  4.577   13.478  1.00 0.00 ? 394 LEU A C    2  
ATOM   2137  O  O    . LEU A 1 37  ? 11.834  4.189   12.779  1.00 0.00 ? 394 LEU A O    2  
ATOM   2138  C  CB   . LEU A 1 37  ? 13.551  3.324   15.498  1.00 0.00 ? 394 LEU A CB   2  
ATOM   2139  C  CG   . LEU A 1 37  ? 13.943  1.937   16.006  1.00 0.00 ? 394 LEU A CG   2  
ATOM   2140  C  CD1  . LEU A 1 37  ? 14.004  1.923   17.526  1.00 0.00 ? 394 LEU A CD1  2  
ATOM   2141  C  CD2  . LEU A 1 37  ? 12.964  0.887   15.500  1.00 0.00 ? 394 LEU A CD2  2  
ATOM   2142  H  H    . LEU A 1 37  ? 15.840  3.918   14.496  1.00 0.00 ? 394 LEU A H    2  
ATOM   2143  H  HA   . LEU A 1 37  ? 13.718  2.665   13.468  1.00 0.00 ? 394 LEU A HA   2  
ATOM   2144  H  HB2  . LEU A 1 37  ? 14.108  4.054   16.065  1.00 0.00 ? 394 LEU A HB2  2  
ATOM   2145  H  HB3  . LEU A 1 37  ? 12.494  3.459   15.681  1.00 0.00 ? 394 LEU A HB3  2  
ATOM   2146  H  HG   . LEU A 1 37  ? 14.926  1.687   15.631  1.00 0.00 ? 394 LEU A HG   2  
ATOM   2147  H  HD11 . LEU A 1 37  ? 14.554  1.054   17.855  1.00 0.00 ? 394 LEU A HD11 2  
ATOM   2148  H  HD12 . LEU A 1 37  ? 13.002  1.888   17.926  1.00 0.00 ? 394 LEU A HD12 2  
ATOM   2149  H  HD13 . LEU A 1 37  ? 14.499  2.817   17.874  1.00 0.00 ? 394 LEU A HD13 2  
ATOM   2150  H  HD21 . LEU A 1 37  ? 11.955  1.256   15.606  1.00 0.00 ? 394 LEU A HD21 2  
ATOM   2151  H  HD22 . LEU A 1 37  ? 13.079  -0.019  16.076  1.00 0.00 ? 394 LEU A HD22 2  
ATOM   2152  H  HD23 . LEU A 1 37  ? 13.165  0.680   14.459  1.00 0.00 ? 394 LEU A HD23 2  
ATOM   2153  N  N    . ARG A 1 38  ? 12.947  5.852   13.808  1.00 0.00 ? 395 ARG A N    2  
ATOM   2154  C  CA   . ARG A 1 38  ? 12.029  6.892   13.359  1.00 0.00 ? 395 ARG A CA   2  
ATOM   2155  C  C    . ARG A 1 38  ? 11.554  6.619   11.935  1.00 0.00 ? 395 ARG A C    2  
ATOM   2156  O  O    . ARG A 1 38  ? 10.354  6.636   11.655  1.00 0.00 ? 395 ARG A O    2  
ATOM   2157  C  CB   . ARG A 1 38  ? 12.704  8.263   13.429  1.00 0.00 ? 395 ARG A CB   2  
ATOM   2158  C  CG   . ARG A 1 38  ? 12.976  8.736   14.848  1.00 0.00 ? 395 ARG A CG   2  
ATOM   2159  C  CD   . ARG A 1 38  ? 13.481  10.170  14.870  1.00 0.00 ? 395 ARG A CD   2  
ATOM   2160  N  NE   . ARG A 1 38  ? 12.424  11.127  14.554  1.00 0.00 ? 395 ARG A NE   2  
ATOM   2161  C  CZ   . ARG A 1 38  ? 12.505  12.426  14.821  1.00 0.00 ? 395 ARG A CZ   2  
ATOM   2162  N  NH1  . ARG A 1 38  ? 13.588  12.920  15.406  1.00 0.00 ? 395 ARG A NH1  2  
ATOM   2163  N  NH2  . ARG A 1 38  ? 11.501  13.233  14.504  1.00 0.00 ? 395 ARG A NH2  2  
ATOM   2164  H  H    . ARG A 1 38  ? 13.713  6.099   14.368  1.00 0.00 ? 395 ARG A H    2  
ATOM   2165  H  HA   . ARG A 1 38  ? 11.175  6.887   14.019  1.00 0.00 ? 395 ARG A HA   2  
ATOM   2166  H  HB2  . ARG A 1 38  ? 13.646  8.215   12.903  1.00 0.00 ? 395 ARG A HB2  2  
ATOM   2167  H  HB3  . ARG A 1 38  ? 12.068  8.989   12.947  1.00 0.00 ? 395 ARG A HB3  2  
ATOM   2168  H  HG2  . ARG A 1 38  ? 12.061  8.680   15.418  1.00 0.00 ? 395 ARG A HG2  2  
ATOM   2169  H  HG3  . ARG A 1 38  ? 13.721  8.094   15.295  1.00 0.00 ? 395 ARG A HG3  2  
ATOM   2170  H  HD2  . ARG A 1 38  ? 13.867  10.387  15.855  1.00 0.00 ? 395 ARG A HD2  2  
ATOM   2171  H  HD3  . ARG A 1 38  ? 14.273  10.269  14.143  1.00 0.00 ? 395 ARG A HD3  2  
ATOM   2172  H  HE   . ARG A 1 38  ? 11.615  10.784  14.122  1.00 0.00 ? 395 ARG A HE   2  
ATOM   2173  H  HH11 . ARG A 1 38  ? 14.346  12.314  15.646  1.00 0.00 ? 395 ARG A HH11 2  
ATOM   2174  H  HH12 . ARG A 1 38  ? 13.646  13.898  15.605  1.00 0.00 ? 395 ARG A HH12 2  
ATOM   2175  H  HH21 . ARG A 1 38  ? 10.684  12.865  14.063  1.00 0.00 ? 395 ARG A HH21 2  
ATOM   2176  H  HH22 . ARG A 1 38  ? 11.563  14.210  14.705  1.00 0.00 ? 395 ARG A HH22 2  
ATOM   2177  N  N    . THR A 1 39  ? 12.502  6.369   11.038  1.00 0.00 ? 396 THR A N    2  
ATOM   2178  C  CA   . THR A 1 39  ? 12.180  6.095   9.643   1.00 0.00 ? 396 THR A CA   2  
ATOM   2179  C  C    . THR A 1 39  ? 10.956  5.194   9.527   1.00 0.00 ? 396 THR A C    2  
ATOM   2180  O  O    . THR A 1 39  ? 10.025  5.487   8.776   1.00 0.00 ? 396 THR A O    2  
ATOM   2181  C  CB   . THR A 1 39  ? 13.363  5.430   8.914   1.00 0.00 ? 396 THR A CB   2  
ATOM   2182  O  OG1  . THR A 1 39  ? 13.672  4.173   9.526   1.00 0.00 ? 396 THR A OG1  2  
ATOM   2183  C  CG2  . THR A 1 39  ? 14.590  6.329   8.942   1.00 0.00 ? 396 THR A CG2  2  
ATOM   2184  H  H    . THR A 1 39  ? 13.439  6.370   11.322  1.00 0.00 ? 396 THR A H    2  
ATOM   2185  H  HA   . THR A 1 39  ? 11.969  7.037   9.158   1.00 0.00 ? 396 THR A HA   2  
ATOM   2186  H  HB   . THR A 1 39  ? 13.083  5.261   7.884   1.00 0.00 ? 396 THR A HB   2  
ATOM   2187  H  HG1  . THR A 1 39  ? 14.347  4.301   10.197  1.00 0.00 ? 396 THR A HG1  2  
ATOM   2188  H  HG21 . THR A 1 39  ? 14.417  7.194   8.321   1.00 0.00 ? 396 THR A HG21 2  
ATOM   2189  H  HG22 . THR A 1 39  ? 15.445  5.783   8.569   1.00 0.00 ? 396 THR A HG22 2  
ATOM   2190  H  HG23 . THR A 1 39  ? 14.781  6.646   9.957   1.00 0.00 ? 396 THR A HG23 2  
ATOM   2191  N  N    . HIS A 1 40  ? 10.962  4.096   10.277  1.00 0.00 ? 397 HIS A N    2  
ATOM   2192  C  CA   . HIS A 1 40  ? 9.850   3.152   10.259  1.00 0.00 ? 397 HIS A CA   2  
ATOM   2193  C  C    . HIS A 1 40  ? 8.569   3.813   10.759  1.00 0.00 ? 397 HIS A C    2  
ATOM   2194  O  O    . HIS A 1 40  ? 7.519   3.717   10.123  1.00 0.00 ? 397 HIS A O    2  
ATOM   2195  C  CB   . HIS A 1 40  ? 10.176  1.931   11.119  1.00 0.00 ? 397 HIS A CB   2  
ATOM   2196  C  CG   . HIS A 1 40  ? 11.330  1.127   10.604  1.00 0.00 ? 397 HIS A CG   2  
ATOM   2197  N  ND1  . HIS A 1 40  ? 11.362  0.582   9.338   1.00 0.00 ? 397 HIS A ND1  2  
ATOM   2198  C  CD2  . HIS A 1 40  ? 12.499  0.779   11.191  1.00 0.00 ? 397 HIS A CD2  2  
ATOM   2199  C  CE1  . HIS A 1 40  ? 12.499  -0.069  9.169   1.00 0.00 ? 397 HIS A CE1  2  
ATOM   2200  N  NE2  . HIS A 1 40  ? 13.207  0.036   10.279  1.00 0.00 ? 397 HIS A NE2  2  
ATOM   2201  H  H    . HIS A 1 40  ? 11.732  3.917   10.856  1.00 0.00 ? 397 HIS A H    2  
ATOM   2202  H  HA   . HIS A 1 40  ? 9.701   2.834   9.239   1.00 0.00 ? 397 HIS A HA   2  
ATOM   2203  H  HB2  . HIS A 1 40  ? 10.421  2.258   12.119  1.00 0.00 ? 397 HIS A HB2  2  
ATOM   2204  H  HB3  . HIS A 1 40  ? 9.311   1.284   11.158  1.00 0.00 ? 397 HIS A HB3  2  
ATOM   2205  H  HD1  . HIS A 1 40  ? 10.655  0.658   8.664   1.00 0.00 ? 397 HIS A HD1  2  
ATOM   2206  H  HD2  . HIS A 1 40  ? 12.816  1.037   12.192  1.00 0.00 ? 397 HIS A HD2  2  
ATOM   2207  H  HE1  . HIS A 1 40  ? 12.800  -0.596  8.276   1.00 0.00 ? 397 HIS A HE1  2  
ATOM   2208  N  N    . THR A 1 41  ? 8.661   4.484   11.903  1.00 0.00 ? 398 THR A N    2  
ATOM   2209  C  CA   . THR A 1 41  ? 7.510   5.158   12.489  1.00 0.00 ? 398 THR A CA   2  
ATOM   2210  C  C    . THR A 1 41  ? 7.138   6.403   11.692  1.00 0.00 ? 398 THR A C    2  
ATOM   2211  O  O    . THR A 1 41  ? 8.008   7.144   11.237  1.00 0.00 ? 398 THR A O    2  
ATOM   2212  C  CB   . THR A 1 41  ? 7.779   5.561   13.951  1.00 0.00 ? 398 THR A CB   2  
ATOM   2213  O  OG1  . THR A 1 41  ? 8.967   6.357   14.030  1.00 0.00 ? 398 THR A OG1  2  
ATOM   2214  C  CG2  . THR A 1 41  ? 7.928   4.330   14.833  1.00 0.00 ? 398 THR A CG2  2  
ATOM   2215  H  H    . THR A 1 41  ? 9.526   4.524   12.363  1.00 0.00 ? 398 THR A H    2  
ATOM   2216  H  HA   . THR A 1 41  ? 6.677   4.470   12.475  1.00 0.00 ? 398 THR A HA   2  
ATOM   2217  H  HB   . THR A 1 41  ? 6.941   6.142   14.309  1.00 0.00 ? 398 THR A HB   2  
ATOM   2218  H  HG1  . THR A 1 41  ? 9.448   6.297   13.201  1.00 0.00 ? 398 THR A HG1  2  
ATOM   2219  H  HG21 . THR A 1 41  ? 8.742   3.723   14.468  1.00 0.00 ? 398 THR A HG21 2  
ATOM   2220  H  HG22 . THR A 1 41  ? 7.013   3.757   14.809  1.00 0.00 ? 398 THR A HG22 2  
ATOM   2221  H  HG23 . THR A 1 41  ? 8.135   4.637   15.847  1.00 0.00 ? 398 THR A HG23 2  
ATOM   2222  N  N    . GLY A 1 42  ? 5.837   6.627   11.526  1.00 0.00 ? 399 GLY A N    2  
ATOM   2223  C  CA   . GLY A 1 42  ? 5.373   7.784   10.783  1.00 0.00 ? 399 GLY A CA   2  
ATOM   2224  C  C    . GLY A 1 42  ? 4.494   8.694   11.618  1.00 0.00 ? 399 GLY A C    2  
ATOM   2225  O  O    . GLY A 1 42  ? 4.977   9.655   12.216  1.00 0.00 ? 399 GLY A O    2  
ATOM   2226  H  H    . GLY A 1 42  ? 5.188   6.001   11.911  1.00 0.00 ? 399 GLY A H    2  
ATOM   2227  H  HA2  . GLY A 1 42  ? 6.229   8.344   10.438  1.00 0.00 ? 399 GLY A HA2  2  
ATOM   2228  H  HA3  . GLY A 1 42  ? 4.808   7.444   9.927   1.00 0.00 ? 399 GLY A HA3  2  
ATOM   2229  N  N    . GLU A 1 43  ? 3.200   8.392   11.657  1.00 0.00 ? 400 GLU A N    2  
ATOM   2230  C  CA   . GLU A 1 43  ? 2.253   9.193   12.423  1.00 0.00 ? 400 GLU A CA   2  
ATOM   2231  C  C    . GLU A 1 43  ? 1.291   8.301   13.203  1.00 0.00 ? 400 GLU A C    2  
ATOM   2232  O  O    . GLU A 1 43  ? 0.720   7.357   12.656  1.00 0.00 ? 400 GLU A O    2  
ATOM   2233  C  CB   . GLU A 1 43  ? 1.466   10.120  11.494  1.00 0.00 ? 400 GLU A CB   2  
ATOM   2234  C  CG   . GLU A 1 43  ? 2.311   11.221  10.875  1.00 0.00 ? 400 GLU A CG   2  
ATOM   2235  C  CD   . GLU A 1 43  ? 2.575   12.364  11.835  1.00 0.00 ? 400 GLU A CD   2  
ATOM   2236  O  OE1  . GLU A 1 43  ? 1.773   12.548  12.775  1.00 0.00 ? 400 GLU A OE1  2  
ATOM   2237  O  OE2  . GLU A 1 43  ? 3.584   13.076  11.647  1.00 0.00 ? 400 GLU A OE2  2  
ATOM   2238  H  H    . GLU A 1 43  ? 2.875   7.613   11.159  1.00 0.00 ? 400 GLU A H    2  
ATOM   2239  H  HA   . GLU A 1 43  ? 2.815   9.793   13.123  1.00 0.00 ? 400 GLU A HA   2  
ATOM   2240  H  HB2  . GLU A 1 43  ? 1.037   9.532   10.697  1.00 0.00 ? 400 GLU A HB2  2  
ATOM   2241  H  HB3  . GLU A 1 43  ? 0.669   10.582  12.058  1.00 0.00 ? 400 GLU A HB3  2  
ATOM   2242  H  HG2  . GLU A 1 43  ? 3.258   10.802  10.570  1.00 0.00 ? 400 GLU A HG2  2  
ATOM   2243  H  HG3  . GLU A 1 43  ? 1.795   11.609  10.009  1.00 0.00 ? 400 GLU A HG3  2  
ATOM   2244  N  N    . LYS A 1 44  ? 1.117   8.606   14.484  1.00 0.00 ? 401 LYS A N    2  
ATOM   2245  C  CA   . LYS A 1 44  ? 0.224   7.834   15.340  1.00 0.00 ? 401 LYS A CA   2  
ATOM   2246  C  C    . LYS A 1 44  ? -0.760  8.747   16.065  1.00 0.00 ? 401 LYS A C    2  
ATOM   2247  O  O    . LYS A 1 44  ? -0.506  9.219   17.173  1.00 0.00 ? 401 LYS A O    2  
ATOM   2248  C  CB   . LYS A 1 44  ? 1.033   7.027   16.359  1.00 0.00 ? 401 LYS A CB   2  
ATOM   2249  C  CG   . LYS A 1 44  ? 1.989   6.031   15.726  1.00 0.00 ? 401 LYS A CG   2  
ATOM   2250  C  CD   . LYS A 1 44  ? 2.853   5.346   16.771  1.00 0.00 ? 401 LYS A CD   2  
ATOM   2251  C  CE   . LYS A 1 44  ? 3.251   3.945   16.333  1.00 0.00 ? 401 LYS A CE   2  
ATOM   2252  N  NZ   . LYS A 1 44  ? 4.202   3.971   15.187  1.00 0.00 ? 401 LYS A NZ   2  
ATOM   2253  H  H    . LYS A 1 44  ? 1.600   9.371   14.863  1.00 0.00 ? 401 LYS A H    2  
ATOM   2254  H  HA   . LYS A 1 44  ? -0.330  7.152   14.713  1.00 0.00 ? 401 LYS A HA   2  
ATOM   2255  H  HB2  . LYS A 1 44  ? 1.608   7.711   16.966  1.00 0.00 ? 401 LYS A HB2  2  
ATOM   2256  H  HB3  . LYS A 1 44  ? 0.349   6.484   16.994  1.00 0.00 ? 401 LYS A HB3  2  
ATOM   2257  H  HG2  . LYS A 1 44  ? 1.417   5.282   15.199  1.00 0.00 ? 401 LYS A HG2  2  
ATOM   2258  H  HG3  . LYS A 1 44  ? 2.629   6.554   15.029  1.00 0.00 ? 401 LYS A HG3  2  
ATOM   2259  H  HD2  . LYS A 1 44  ? 3.748   5.930   16.925  1.00 0.00 ? 401 LYS A HD2  2  
ATOM   2260  H  HD3  . LYS A 1 44  ? 2.299   5.281   17.697  1.00 0.00 ? 401 LYS A HD3  2  
ATOM   2261  H  HE2  . LYS A 1 44  ? 3.717   3.440   17.165  1.00 0.00 ? 401 LYS A HE2  2  
ATOM   2262  H  HE3  . LYS A 1 44  ? 2.361   3.407   16.039  1.00 0.00 ? 401 LYS A HE3  2  
ATOM   2263  H  HZ1  . LYS A 1 44  ? 5.179   3.880   15.531  1.00 0.00 ? 401 LYS A HZ1  2  
ATOM   2264  H  HZ2  . LYS A 1 44  ? 4.110   4.867   14.667  1.00 0.00 ? 401 LYS A HZ2  2  
ATOM   2265  H  HZ3  . LYS A 1 44  ? 4.000   3.185   14.537  1.00 0.00 ? 401 LYS A HZ3  2  
ATOM   2266  N  N    . PRO A 1 45  ? -1.912  9.002   15.426  1.00 0.00 ? 402 PRO A N    2  
ATOM   2267  C  CA   . PRO A 1 45  ? -2.958  9.859   15.993  1.00 0.00 ? 402 PRO A CA   2  
ATOM   2268  C  C    . PRO A 1 45  ? -3.650  9.214   17.189  1.00 0.00 ? 402 PRO A C    2  
ATOM   2269  O  O    . PRO A 1 45  ? -4.389  9.874   17.921  1.00 0.00 ? 402 PRO A O    2  
ATOM   2270  C  CB   . PRO A 1 45  ? -3.943  10.029  14.834  1.00 0.00 ? 402 PRO A CB   2  
ATOM   2271  C  CG   . PRO A 1 45  ? -3.739  8.824   13.983  1.00 0.00 ? 402 PRO A CG   2  
ATOM   2272  C  CD   . PRO A 1 45  ? -2.282  8.473   14.103  1.00 0.00 ? 402 PRO A CD   2  
ATOM   2273  H  HA   . PRO A 1 45  ? -2.567  10.824  16.281  1.00 0.00 ? 402 PRO A HA   2  
ATOM   2274  H  HB2  . PRO A 1 45  ? -4.951  10.076  15.219  1.00 0.00 ? 402 PRO A HB2  2  
ATOM   2275  H  HB3  . PRO A 1 45  ? -3.715  10.936  14.294  1.00 0.00 ? 402 PRO A HB3  2  
ATOM   2276  H  HG2  . PRO A 1 45  ? -4.351  8.011   14.345  1.00 0.00 ? 402 PRO A HG2  2  
ATOM   2277  H  HG3  . PRO A 1 45  ? -3.986  9.053   12.957  1.00 0.00 ? 402 PRO A HG3  2  
ATOM   2278  H  HD2  . PRO A 1 45  ? -2.146  7.403   14.063  1.00 0.00 ? 402 PRO A HD2  2  
ATOM   2279  H  HD3  . PRO A 1 45  ? -1.712  8.956   13.322  1.00 0.00 ? 402 PRO A HD3  2  
ATOM   2280  N  N    . TYR A 1 46  ? -3.405  7.923   17.383  1.00 0.00 ? 403 TYR A N    2  
ATOM   2281  C  CA   . TYR A 1 46  ? -4.007  7.189   18.490  1.00 0.00 ? 403 TYR A CA   2  
ATOM   2282  C  C    . TYR A 1 46  ? -3.027  7.058   19.653  1.00 0.00 ? 403 TYR A C    2  
ATOM   2283  O  O    . TYR A 1 46  ? -1.920  6.544   19.493  1.00 0.00 ? 403 TYR A O    2  
ATOM   2284  C  CB   . TYR A 1 46  ? -4.455  5.802   18.027  1.00 0.00 ? 403 TYR A CB   2  
ATOM   2285  C  CG   . TYR A 1 46  ? -5.321  5.828   16.787  1.00 0.00 ? 403 TYR A CG   2  
ATOM   2286  C  CD1  . TYR A 1 46  ? -4.753  5.891   15.521  1.00 0.00 ? 403 TYR A CD1  2  
ATOM   2287  C  CD2  . TYR A 1 46  ? -6.706  5.790   16.883  1.00 0.00 ? 403 TYR A CD2  2  
ATOM   2288  C  CE1  . TYR A 1 46  ? -5.540  5.916   14.386  1.00 0.00 ? 403 TYR A CE1  2  
ATOM   2289  C  CE2  . TYR A 1 46  ? -7.501  5.812   15.754  1.00 0.00 ? 403 TYR A CE2  2  
ATOM   2290  C  CZ   . TYR A 1 46  ? -6.914  5.876   14.508  1.00 0.00 ? 403 TYR A CZ   2  
ATOM   2291  O  OH   . TYR A 1 46  ? -7.701  5.899   13.379  1.00 0.00 ? 403 TYR A OH   2  
ATOM   2292  H  H    . TYR A 1 46  ? -2.807  7.451   16.767  1.00 0.00 ? 403 TYR A H    2  
ATOM   2293  H  HA   . TYR A 1 46  ? -4.872  7.743   18.824  1.00 0.00 ? 403 TYR A HA   2  
ATOM   2294  H  HB2  . TYR A 1 46  ? -3.584  5.204   17.809  1.00 0.00 ? 403 TYR A HB2  2  
ATOM   2295  H  HB3  . TYR A 1 46  ? -5.021  5.332   18.817  1.00 0.00 ? 403 TYR A HB3  2  
ATOM   2296  H  HD1  . TYR A 1 46  ? -3.677  5.921   15.429  1.00 0.00 ? 403 TYR A HD1  2  
ATOM   2297  H  HD2  . TYR A 1 46  ? -7.164  5.740   17.861  1.00 0.00 ? 403 TYR A HD2  2  
ATOM   2298  H  HE1  . TYR A 1 46  ? -5.081  5.965   13.410  1.00 0.00 ? 403 TYR A HE1  2  
ATOM   2299  H  HE2  . TYR A 1 46  ? -8.577  5.782   15.848  1.00 0.00 ? 403 TYR A HE2  2  
ATOM   2300  H  HH   . TYR A 1 46  ? -8.038  6.788   13.242  1.00 0.00 ? 403 TYR A HH   2  
ATOM   2301  N  N    . LYS A 1 47  ? -3.444  7.525   20.825  1.00 0.00 ? 404 LYS A N    2  
ATOM   2302  C  CA   . LYS A 1 47  ? -2.607  7.459   22.017  1.00 0.00 ? 404 LYS A CA   2  
ATOM   2303  C  C    . LYS A 1 47  ? -3.346  6.776   23.163  1.00 0.00 ? 404 LYS A C    2  
ATOM   2304  O  O    . LYS A 1 47  ? -4.576  6.779   23.212  1.00 0.00 ? 404 LYS A O    2  
ATOM   2305  C  CB   . LYS A 1 47  ? -2.175  8.865   22.440  1.00 0.00 ? 404 LYS A CB   2  
ATOM   2306  C  CG   . LYS A 1 47  ? -3.330  9.752   22.873  1.00 0.00 ? 404 LYS A CG   2  
ATOM   2307  C  CD   . LYS A 1 47  ? -3.016  11.222  22.656  1.00 0.00 ? 404 LYS A CD   2  
ATOM   2308  C  CE   . LYS A 1 47  ? -3.304  11.648  21.224  1.00 0.00 ? 404 LYS A CE   2  
ATOM   2309  N  NZ   . LYS A 1 47  ? -3.579  13.108  21.125  1.00 0.00 ? 404 LYS A NZ   2  
ATOM   2310  H  H    . LYS A 1 47  ? -4.338  7.924   20.890  1.00 0.00 ? 404 LYS A H    2  
ATOM   2311  H  HA   . LYS A 1 47  ? -1.729  6.880   21.774  1.00 0.00 ? 404 LYS A HA   2  
ATOM   2312  H  HB2  . LYS A 1 47  ? -1.482  8.783   23.264  1.00 0.00 ? 404 LYS A HB2  2  
ATOM   2313  H  HB3  . LYS A 1 47  ? -1.676  9.341   21.608  1.00 0.00 ? 404 LYS A HB3  2  
ATOM   2314  H  HG2  . LYS A 1 47  ? -4.206  9.493   22.298  1.00 0.00 ? 404 LYS A HG2  2  
ATOM   2315  H  HG3  . LYS A 1 47  ? -3.524  9.586   23.923  1.00 0.00 ? 404 LYS A HG3  2  
ATOM   2316  H  HD2  . LYS A 1 47  ? -3.624  11.814  23.324  1.00 0.00 ? 404 LYS A HD2  2  
ATOM   2317  H  HD3  . LYS A 1 47  ? -1.970  11.394  22.870  1.00 0.00 ? 404 LYS A HD3  2  
ATOM   2318  H  HE2  . LYS A 1 47  ? -2.447  11.410  20.613  1.00 0.00 ? 404 LYS A HE2  2  
ATOM   2319  H  HE3  . LYS A 1 47  ? -4.164  11.102  20.867  1.00 0.00 ? 404 LYS A HE3  2  
ATOM   2320  H  HZ1  . LYS A 1 47  ? -2.807  13.584  20.617  1.00 0.00 ? 404 LYS A HZ1  2  
ATOM   2321  H  HZ2  . LYS A 1 47  ? -3.662  13.522  22.076  1.00 0.00 ? 404 LYS A HZ2  2  
ATOM   2322  H  HZ3  . LYS A 1 47  ? -4.469  13.269  20.611  1.00 0.00 ? 404 LYS A HZ3  2  
ATOM   2323  N  N    . CYS A 1 48  ? -2.587  6.193   24.085  1.00 0.00 ? 405 CYS A N    2  
ATOM   2324  C  CA   . CYS A 1 48  ? -3.169  5.507   25.232  1.00 0.00 ? 405 CYS A CA   2  
ATOM   2325  C  C    . CYS A 1 48  ? -3.544  6.501   26.328  1.00 0.00 ? 405 CYS A C    2  
ATOM   2326  O  O    . CYS A 1 48  ? -2.684  7.186   26.882  1.00 0.00 ? 405 CYS A O    2  
ATOM   2327  C  CB   . CYS A 1 48  ? -2.189  4.470   25.784  1.00 0.00 ? 405 CYS A CB   2  
ATOM   2328  S  SG   . CYS A 1 48  ? -2.781  3.605   27.274  1.00 0.00 ? 405 CYS A SG   2  
ATOM   2329  H  H    . CYS A 1 48  ? -1.611  6.224   23.992  1.00 0.00 ? 405 CYS A H    2  
ATOM   2330  H  HA   . CYS A 1 48  ? -4.063  5.003   24.899  1.00 0.00 ? 405 CYS A HA   2  
ATOM   2331  H  HB2  . CYS A 1 48  ? -2.001  3.724   25.025  1.00 0.00 ? 405 CYS A HB2  2  
ATOM   2332  H  HB3  . CYS A 1 48  ? -1.260  4.961   26.035  1.00 0.00 ? 405 CYS A HB3  2  
ATOM   2333  N  N    . THR A 1 49  ? -4.836  6.574   26.635  1.00 0.00 ? 406 THR A N    2  
ATOM   2334  C  CA   . THR A 1 49  ? -5.326  7.484   27.663  1.00 0.00 ? 406 THR A CA   2  
ATOM   2335  C  C    . THR A 1 49  ? -5.148  6.889   29.055  1.00 0.00 ? 406 THR A C    2  
ATOM   2336  O  O    . THR A 1 49  ? -6.044  6.971   29.895  1.00 0.00 ? 406 THR A O    2  
ATOM   2337  C  CB   . THR A 1 49  ? -6.813  7.825   27.449  1.00 0.00 ? 406 THR A CB   2  
ATOM   2338  O  OG1  . THR A 1 49  ? -7.022  8.285   26.110  1.00 0.00 ? 406 THR A OG1  2  
ATOM   2339  C  CG2  . THR A 1 49  ? -7.271  8.889   28.434  1.00 0.00 ? 406 THR A CG2  2  
ATOM   2340  H  H    . THR A 1 49  ? -5.473  6.003   26.158  1.00 0.00 ? 406 THR A H    2  
ATOM   2341  H  HA   . THR A 1 49  ? -4.755  8.400   27.598  1.00 0.00 ? 406 THR A HA   2  
ATOM   2342  H  HB   . THR A 1 49  ? -7.398  6.930   27.610  1.00 0.00 ? 406 THR A HB   2  
ATOM   2343  H  HG1  . THR A 1 49  ? -6.363  7.895   25.530  1.00 0.00 ? 406 THR A HG1  2  
ATOM   2344  H  HG21 . THR A 1 49  ? -7.946  9.571   27.939  1.00 0.00 ? 406 THR A HG21 2  
ATOM   2345  H  HG22 . THR A 1 49  ? -6.414  9.435   28.800  1.00 0.00 ? 406 THR A HG22 2  
ATOM   2346  H  HG23 . THR A 1 49  ? -7.779  8.418   29.263  1.00 0.00 ? 406 THR A HG23 2  
ATOM   2347  N  N    . TRP A 1 50  ? -3.986  6.290   29.293  1.00 0.00 ? 407 TRP A N    2  
ATOM   2348  C  CA   . TRP A 1 50  ? -3.691  5.682   30.585  1.00 0.00 ? 407 TRP A CA   2  
ATOM   2349  C  C    . TRP A 1 50  ? -2.674  6.513   31.359  1.00 0.00 ? 407 TRP A C    2  
ATOM   2350  O  O    . TRP A 1 50  ? -1.958  7.329   30.780  1.00 0.00 ? 407 TRP A O    2  
ATOM   2351  C  CB   . TRP A 1 50  ? -3.163  4.259   30.393  1.00 0.00 ? 407 TRP A CB   2  
ATOM   2352  C  CG   . TRP A 1 50  ? -3.014  3.502   31.678  1.00 0.00 ? 407 TRP A CG   2  
ATOM   2353  C  CD1  . TRP A 1 50  ? -1.886  3.395   32.440  1.00 0.00 ? 407 TRP A CD1  2  
ATOM   2354  C  CD2  . TRP A 1 50  ? -4.027  2.745   32.349  1.00 0.00 ? 407 TRP A CD2  2  
ATOM   2355  N  NE1  . TRP A 1 50  ? -2.137  2.617   33.544  1.00 0.00 ? 407 TRP A NE1  2  
ATOM   2356  C  CE2  . TRP A 1 50  ? -3.443  2.207   33.512  1.00 0.00 ? 407 TRP A CE2  2  
ATOM   2357  C  CE3  . TRP A 1 50  ? -5.371  2.471   32.081  1.00 0.00 ? 407 TRP A CE3  2  
ATOM   2358  C  CZ2  . TRP A 1 50  ? -4.158  1.411   34.404  1.00 0.00 ? 407 TRP A CZ2  2  
ATOM   2359  C  CZ3  . TRP A 1 50  ? -6.079  1.680   32.967  1.00 0.00 ? 407 TRP A CZ3  2  
ATOM   2360  C  CH2  . TRP A 1 50  ? -5.472  1.159   34.117  1.00 0.00 ? 407 TRP A CH2  2  
ATOM   2361  H  H    . TRP A 1 50  ? -3.311  6.257   28.583  1.00 0.00 ? 407 TRP A H    2  
ATOM   2362  H  HA   . TRP A 1 50  ? -4.611  5.641   31.149  1.00 0.00 ? 407 TRP A HA   2  
ATOM   2363  H  HB2  . TRP A 1 50  ? -3.846  3.711   29.760  1.00 0.00 ? 407 TRP A HB2  2  
ATOM   2364  H  HB3  . TRP A 1 50  ? -2.194  4.304   29.917  1.00 0.00 ? 407 TRP A HB3  2  
ATOM   2365  H  HD1  . TRP A 1 50  ? -0.942  3.858   32.196  1.00 0.00 ? 407 TRP A HD1  2  
ATOM   2366  H  HE1  . TRP A 1 50  ? -1.486  2.394   34.243  1.00 0.00 ? 407 TRP A HE1  2  
ATOM   2367  H  HE3  . TRP A 1 50  ? -5.857  2.864   31.200  1.00 0.00 ? 407 TRP A HE3  2  
ATOM   2368  H  HZ2  . TRP A 1 50  ? -3.704  1.002   35.295  1.00 0.00 ? 407 TRP A HZ2  2  
ATOM   2369  H  HZ3  . TRP A 1 50  ? -7.119  1.457   32.776  1.00 0.00 ? 407 TRP A HZ3  2  
ATOM   2370  H  HH2  . TRP A 1 50  ? -6.063  0.546   34.780  1.00 0.00 ? 407 TRP A HH2  2  
ATOM   2371  N  N    . GLU A 1 51  ? -2.618  6.301   32.670  1.00 0.00 ? 408 GLU A N    2  
ATOM   2372  C  CA   . GLU A 1 51  ? -1.688  7.033   33.523  1.00 0.00 ? 408 GLU A CA   2  
ATOM   2373  C  C    . GLU A 1 51  ? -0.294  6.416   33.463  1.00 0.00 ? 408 GLU A C    2  
ATOM   2374  O  O    . GLU A 1 51  ? -0.074  5.306   33.946  1.00 0.00 ? 408 GLU A O    2  
ATOM   2375  C  CB   . GLU A 1 51  ? -2.190  7.048   34.968  1.00 0.00 ? 408 GLU A CB   2  
ATOM   2376  C  CG   . GLU A 1 51  ? -3.499  7.799   35.150  1.00 0.00 ? 408 GLU A CG   2  
ATOM   2377  C  CD   . GLU A 1 51  ? -4.674  7.087   34.509  1.00 0.00 ? 408 GLU A CD   2  
ATOM   2378  O  OE1  . GLU A 1 51  ? -4.655  5.839   34.454  1.00 0.00 ? 408 GLU A OE1  2  
ATOM   2379  O  OE2  . GLU A 1 51  ? -5.613  7.778   34.061  1.00 0.00 ? 408 GLU A OE2  2  
ATOM   2380  H  H    . GLU A 1 51  ? -3.215  5.637   33.074  1.00 0.00 ? 408 GLU A H    2  
ATOM   2381  H  HA   . GLU A 1 51  ? -1.635  8.049   33.160  1.00 0.00 ? 408 GLU A HA   2  
ATOM   2382  H  HB2  . GLU A 1 51  ? -2.334  6.029   35.297  1.00 0.00 ? 408 GLU A HB2  2  
ATOM   2383  H  HB3  . GLU A 1 51  ? -1.442  7.515   35.591  1.00 0.00 ? 408 GLU A HB3  2  
ATOM   2384  H  HG2  . GLU A 1 51  ? -3.695  7.904   36.207  1.00 0.00 ? 408 GLU A HG2  2  
ATOM   2385  H  HG3  . GLU A 1 51  ? -3.403  8.778   34.704  1.00 0.00 ? 408 GLU A HG3  2  
ATOM   2386  N  N    . GLY A 1 52  ? 0.645   7.145   32.866  1.00 0.00 ? 409 GLY A N    2  
ATOM   2387  C  CA   . GLY A 1 52  ? 2.005   6.653   32.753  1.00 0.00 ? 409 GLY A CA   2  
ATOM   2388  C  C    . GLY A 1 52  ? 2.345   6.206   31.346  1.00 0.00 ? 409 GLY A C    2  
ATOM   2389  O  O    . GLY A 1 52  ? 3.445   6.462   30.853  1.00 0.00 ? 409 GLY A O    2  
ATOM   2390  H  H    . GLY A 1 52  ? 0.411   8.023   32.499  1.00 0.00 ? 409 GLY A H    2  
ATOM   2391  H  HA2  . GLY A 1 52  ? 2.686   7.439   33.045  1.00 0.00 ? 409 GLY A HA2  2  
ATOM   2392  H  HA3  . GLY A 1 52  ? 2.130   5.816   33.424  1.00 0.00 ? 409 GLY A HA3  2  
ATOM   2393  N  N    . CYS A 1 53  ? 1.401   5.534   30.695  1.00 0.00 ? 410 CYS A N    2  
ATOM   2394  C  CA   . CYS A 1 53  ? 1.606   5.048   29.336  1.00 0.00 ? 410 CYS A CA   2  
ATOM   2395  C  C    . CYS A 1 53  ? 1.621   6.204   28.341  1.00 0.00 ? 410 CYS A C    2  
ATOM   2396  O  O    . CYS A 1 53  ? 0.651   6.954   28.231  1.00 0.00 ? 410 CYS A O    2  
ATOM   2397  C  CB   . CYS A 1 53  ? 0.509   4.050   28.959  1.00 0.00 ? 410 CYS A CB   2  
ATOM   2398  S  SG   . CYS A 1 53  ? 0.986   2.883   27.644  1.00 0.00 ? 410 CYS A SG   2  
ATOM   2399  H  H    . CYS A 1 53  ? 0.544   5.361   31.141  1.00 0.00 ? 410 CYS A H    2  
ATOM   2400  H  HA   . CYS A 1 53  ? 2.562   4.548   29.303  1.00 0.00 ? 410 CYS A HA   2  
ATOM   2401  H  HB2  . CYS A 1 53  ? 0.245   3.470   29.831  1.00 0.00 ? 410 CYS A HB2  2  
ATOM   2402  H  HB3  . CYS A 1 53  ? -0.359  4.593   28.618  1.00 0.00 ? 410 CYS A HB3  2  
ATOM   2403  N  N    . ASP A 1 54  ? 2.728   6.342   27.620  1.00 0.00 ? 411 ASP A N    2  
ATOM   2404  C  CA   . ASP A 1 54  ? 2.870   7.406   26.632  1.00 0.00 ? 411 ASP A CA   2  
ATOM   2405  C  C    . ASP A 1 54  ? 3.118   6.828   25.243  1.00 0.00 ? 411 ASP A C    2  
ATOM   2406  O  O    . ASP A 1 54  ? 3.784   7.447   24.413  1.00 0.00 ? 411 ASP A O    2  
ATOM   2407  C  CB   . ASP A 1 54  ? 4.015   8.342   27.021  1.00 0.00 ? 411 ASP A CB   2  
ATOM   2408  C  CG   . ASP A 1 54  ? 3.658   9.238   28.192  1.00 0.00 ? 411 ASP A CG   2  
ATOM   2409  O  OD1  . ASP A 1 54  ? 3.129   10.343  27.953  1.00 0.00 ? 411 ASP A OD1  2  
ATOM   2410  O  OD2  . ASP A 1 54  ? 3.910   8.834   29.346  1.00 0.00 ? 411 ASP A OD2  2  
ATOM   2411  H  H    . ASP A 1 54  ? 3.467   5.712   27.754  1.00 0.00 ? 411 ASP A H    2  
ATOM   2412  H  HA   . ASP A 1 54  ? 1.948   7.968   26.615  1.00 0.00 ? 411 ASP A HA   2  
ATOM   2413  H  HB2  . ASP A 1 54  ? 4.877   7.752   27.294  1.00 0.00 ? 411 ASP A HB2  2  
ATOM   2414  H  HB3  . ASP A 1 54  ? 4.263   8.967   26.176  1.00 0.00 ? 411 ASP A HB3  2  
ATOM   2415  N  N    . TRP A 1 55  ? 2.579   5.640   24.997  1.00 0.00 ? 412 TRP A N    2  
ATOM   2416  C  CA   . TRP A 1 55  ? 2.744   4.978   23.708  1.00 0.00 ? 412 TRP A CA   2  
ATOM   2417  C  C    . TRP A 1 55  ? 1.627   5.371   22.748  1.00 0.00 ? 412 TRP A C    2  
ATOM   2418  O  O    . TRP A 1 55  ? 0.599   5.906   23.163  1.00 0.00 ? 412 TRP A O    2  
ATOM   2419  C  CB   . TRP A 1 55  ? 2.766   3.459   23.890  1.00 0.00 ? 412 TRP A CB   2  
ATOM   2420  C  CG   . TRP A 1 55  ? 4.136   2.912   24.152  1.00 0.00 ? 412 TRP A CG   2  
ATOM   2421  C  CD1  . TRP A 1 55  ? 4.601   2.392   25.326  1.00 0.00 ? 412 TRP A CD1  2  
ATOM   2422  C  CD2  . TRP A 1 55  ? 5.220   2.833   23.220  1.00 0.00 ? 412 TRP A CD2  2  
ATOM   2423  N  NE1  . TRP A 1 55  ? 5.908   1.994   25.180  1.00 0.00 ? 412 TRP A NE1  2  
ATOM   2424  C  CE2  . TRP A 1 55  ? 6.311   2.253   23.897  1.00 0.00 ? 412 TRP A CE2  2  
ATOM   2425  C  CE3  . TRP A 1 55  ? 5.375   3.194   21.878  1.00 0.00 ? 412 TRP A CE3  2  
ATOM   2426  C  CZ2  . TRP A 1 55  ? 7.537   2.028   23.277  1.00 0.00 ? 412 TRP A CZ2  2  
ATOM   2427  C  CZ3  . TRP A 1 55  ? 6.593   2.970   21.265  1.00 0.00 ? 412 TRP A CZ3  2  
ATOM   2428  C  CH2  . TRP A 1 55  ? 7.660   2.391   21.963  1.00 0.00 ? 412 TRP A CH2  2  
ATOM   2429  H  H    . TRP A 1 55  ? 2.059   5.196   25.699  1.00 0.00 ? 412 TRP A H    2  
ATOM   2430  H  HA   . TRP A 1 55  ? 3.689   5.295   23.292  1.00 0.00 ? 412 TRP A HA   2  
ATOM   2431  H  HB2  . TRP A 1 55  ? 2.136   3.194   24.726  1.00 0.00 ? 412 TRP A HB2  2  
ATOM   2432  H  HB3  . TRP A 1 55  ? 2.385   2.991   22.994  1.00 0.00 ? 412 TRP A HB3  2  
ATOM   2433  H  HD1  . TRP A 1 55  ? 4.015   2.313   26.230  1.00 0.00 ? 412 TRP A HD1  2  
ATOM   2434  H  HE1  . TRP A 1 55  ? 6.461   1.589   25.881  1.00 0.00 ? 412 TRP A HE1  2  
ATOM   2435  H  HE3  . TRP A 1 55  ? 4.563   3.641   21.323  1.00 0.00 ? 412 TRP A HE3  2  
ATOM   2436  H  HZ2  . TRP A 1 55  ? 8.369   1.583   23.802  1.00 0.00 ? 412 TRP A HZ2  2  
ATOM   2437  H  HZ3  . TRP A 1 55  ? 6.731   3.243   20.229  1.00 0.00 ? 412 TRP A HZ3  2  
ATOM   2438  H  HH2  . TRP A 1 55  ? 8.593   2.235   21.444  1.00 0.00 ? 412 TRP A HH2  2  
ATOM   2439  N  N    . ARG A 1 56  ? 1.835   5.103   21.463  1.00 0.00 ? 413 ARG A N    2  
ATOM   2440  C  CA   . ARG A 1 56  ? 0.845   5.430   20.444  1.00 0.00 ? 413 ARG A CA   2  
ATOM   2441  C  C    . ARG A 1 56  ? 0.801   4.354   19.363  1.00 0.00 ? 413 ARG A C    2  
ATOM   2442  O  O    . ARG A 1 56  ? 1.586   3.405   19.384  1.00 0.00 ? 413 ARG A O    2  
ATOM   2443  C  CB   . ARG A 1 56  ? 1.159   6.788   19.814  1.00 0.00 ? 413 ARG A CB   2  
ATOM   2444  C  CG   . ARG A 1 56  ? 1.141   7.939   20.807  1.00 0.00 ? 413 ARG A CG   2  
ATOM   2445  C  CD   . ARG A 1 56  ? 1.595   9.239   20.161  1.00 0.00 ? 413 ARG A CD   2  
ATOM   2446  N  NE   . ARG A 1 56  ? 3.043   9.410   20.234  1.00 0.00 ? 413 ARG A NE   2  
ATOM   2447  C  CZ   . ARG A 1 56  ? 3.685   9.783   21.336  1.00 0.00 ? 413 ARG A CZ   2  
ATOM   2448  N  NH1  . ARG A 1 56  ? 3.009   10.021  22.451  1.00 0.00 ? 413 ARG A NH1  2  
ATOM   2449  N  NH2  . ARG A 1 56  ? 5.005   9.917   21.323  1.00 0.00 ? 413 ARG A NH2  2  
ATOM   2450  H  H    . ARG A 1 56  ? 2.675   4.675   21.193  1.00 0.00 ? 413 ARG A H    2  
ATOM   2451  H  HA   . ARG A 1 56  ? -0.121  5.481   20.924  1.00 0.00 ? 413 ARG A HA   2  
ATOM   2452  H  HB2  . ARG A 1 56  ? 2.141   6.745   19.365  1.00 0.00 ? 413 ARG A HB2  2  
ATOM   2453  H  HB3  . ARG A 1 56  ? 0.429   6.992   19.046  1.00 0.00 ? 413 ARG A HB3  2  
ATOM   2454  H  HG2  . ARG A 1 56  ? 0.135   8.066   21.178  1.00 0.00 ? 413 ARG A HG2  2  
ATOM   2455  H  HG3  . ARG A 1 56  ? 1.803   7.704   21.627  1.00 0.00 ? 413 ARG A HG3  2  
ATOM   2456  H  HD2  . ARG A 1 56  ? 1.294   9.234   19.124  1.00 0.00 ? 413 ARG A HD2  2  
ATOM   2457  H  HD3  . ARG A 1 56  ? 1.118   10.063  20.670  1.00 0.00 ? 413 ARG A HD3  2  
ATOM   2458  H  HE   . ARG A 1 56  ? 3.562   9.239   19.421  1.00 0.00 ? 413 ARG A HE   2  
ATOM   2459  H  HH11 . ARG A 1 56  ? 2.015   9.920   22.464  1.00 0.00 ? 413 ARG A HH11 2  
ATOM   2460  H  HH12 . ARG A 1 56  ? 3.495   10.301  23.280  1.00 0.00 ? 413 ARG A HH12 2  
ATOM   2461  H  HH21 . ARG A 1 56  ? 5.517   9.737   20.484  1.00 0.00 ? 413 ARG A HH21 2  
ATOM   2462  H  HH22 . ARG A 1 56  ? 5.487   10.197  22.152  1.00 0.00 ? 413 ARG A HH22 2  
ATOM   2463  N  N    . PHE A 1 57  ? -0.122  4.507   18.419  1.00 0.00 ? 414 PHE A N    2  
ATOM   2464  C  CA   . PHE A 1 57  ? -0.270  3.548   17.331  1.00 0.00 ? 414 PHE A CA   2  
ATOM   2465  C  C    . PHE A 1 57  ? -0.795  4.231   16.072  1.00 0.00 ? 414 PHE A C    2  
ATOM   2466  O  O    . PHE A 1 57  ? -1.331  5.338   16.130  1.00 0.00 ? 414 PHE A O    2  
ATOM   2467  C  CB   . PHE A 1 57  ? -1.214  2.418   17.743  1.00 0.00 ? 414 PHE A CB   2  
ATOM   2468  C  CG   . PHE A 1 57  ? -0.752  1.663   18.957  1.00 0.00 ? 414 PHE A CG   2  
ATOM   2469  C  CD1  . PHE A 1 57  ? -1.006  2.148   20.229  1.00 0.00 ? 414 PHE A CD1  2  
ATOM   2470  C  CD2  . PHE A 1 57  ? -0.063  0.468   18.825  1.00 0.00 ? 414 PHE A CD2  2  
ATOM   2471  C  CE1  . PHE A 1 57  ? -0.581  1.456   21.348  1.00 0.00 ? 414 PHE A CE1  2  
ATOM   2472  C  CE2  . PHE A 1 57  ? 0.364   -0.229  19.940  1.00 0.00 ? 414 PHE A CE2  2  
ATOM   2473  C  CZ   . PHE A 1 57  ? 0.104   0.266   21.203  1.00 0.00 ? 414 PHE A CZ   2  
ATOM   2474  H  H    . PHE A 1 57  ? -0.719  5.284   18.456  1.00 0.00 ? 414 PHE A H    2  
ATOM   2475  H  HA   . PHE A 1 57  ? 0.704   3.134   17.121  1.00 0.00 ? 414 PHE A HA   2  
ATOM   2476  H  HB2  . PHE A 1 57  ? -2.187  2.832   17.962  1.00 0.00 ? 414 PHE A HB2  2  
ATOM   2477  H  HB3  . PHE A 1 57  ? -1.302  1.716   16.928  1.00 0.00 ? 414 PHE A HB3  2  
ATOM   2478  H  HD1  . PHE A 1 57  ? -1.543  3.079   20.345  1.00 0.00 ? 414 PHE A HD1  2  
ATOM   2479  H  HD2  . PHE A 1 57  ? 0.141   0.080   17.837  1.00 0.00 ? 414 PHE A HD2  2  
ATOM   2480  H  HE1  . PHE A 1 57  ? -0.786  1.845   22.334  1.00 0.00 ? 414 PHE A HE1  2  
ATOM   2481  H  HE2  . PHE A 1 57  ? 0.900   -1.159  19.822  1.00 0.00 ? 414 PHE A HE2  2  
ATOM   2482  H  HZ   . PHE A 1 57  ? 0.437   -0.277  22.075  1.00 0.00 ? 414 PHE A HZ   2  
ATOM   2483  N  N    . ALA A 1 58  ? -0.637  3.564   14.934  1.00 0.00 ? 415 ALA A N    2  
ATOM   2484  C  CA   . ALA A 1 58  ? -1.097  4.104   13.660  1.00 0.00 ? 415 ALA A CA   2  
ATOM   2485  C  C    . ALA A 1 58  ? -2.567  3.778   13.424  1.00 0.00 ? 415 ALA A C    2  
ATOM   2486  O  O    . ALA A 1 58  ? -3.353  4.647   13.045  1.00 0.00 ? 415 ALA A O    2  
ATOM   2487  C  CB   . ALA A 1 58  ? -0.245  3.567   12.520  1.00 0.00 ? 415 ALA A CB   2  
ATOM   2488  H  H    . ALA A 1 58  ? -0.203  2.686   14.951  1.00 0.00 ? 415 ALA A H    2  
ATOM   2489  H  HA   . ALA A 1 58  ? -0.977  5.178   13.691  1.00 0.00 ? 415 ALA A HA   2  
ATOM   2490  H  HB1  . ALA A 1 58  ? -0.773  2.768   12.022  1.00 0.00 ? 415 ALA A HB1  2  
ATOM   2491  H  HB2  . ALA A 1 58  ? -0.045  4.361   11.815  1.00 0.00 ? 415 ALA A HB2  2  
ATOM   2492  H  HB3  . ALA A 1 58  ? 0.688   3.191   12.914  1.00 0.00 ? 415 ALA A HB3  2  
ATOM   2493  N  N    . ARG A 1 59  ? -2.933  2.521   13.650  1.00 0.00 ? 416 ARG A N    2  
ATOM   2494  C  CA   . ARG A 1 59  ? -4.310  2.080   13.459  1.00 0.00 ? 416 ARG A CA   2  
ATOM   2495  C  C    . ARG A 1 59  ? -5.089  2.147   14.769  1.00 0.00 ? 416 ARG A C    2  
ATOM   2496  O  O    . ARG A 1 59  ? -4.506  2.311   15.841  1.00 0.00 ? 416 ARG A O    2  
ATOM   2497  C  CB   . ARG A 1 59  ? -4.339  0.653   12.908  1.00 0.00 ? 416 ARG A CB   2  
ATOM   2498  C  CG   . ARG A 1 59  ? -3.762  0.528   11.508  1.00 0.00 ? 416 ARG A CG   2  
ATOM   2499  C  CD   . ARG A 1 59  ? -3.406  -0.913  11.178  1.00 0.00 ? 416 ARG A CD   2  
ATOM   2500  N  NE   . ARG A 1 59  ? -4.593  -1.750  11.032  1.00 0.00 ? 416 ARG A NE   2  
ATOM   2501  C  CZ   . ARG A 1 59  ? -4.571  -3.076  11.105  1.00 0.00 ? 416 ARG A CZ   2  
ATOM   2502  N  NH1  . ARG A 1 59  ? -3.428  -3.712  11.321  1.00 0.00 ? 416 ARG A NH1  2  
ATOM   2503  N  NH2  . ARG A 1 59  ? -5.694  -3.769  10.962  1.00 0.00 ? 416 ARG A NH2  2  
ATOM   2504  H  H    . ARG A 1 59  ? -2.262  1.874   13.951  1.00 0.00 ? 416 ARG A H    2  
ATOM   2505  H  HA   . ARG A 1 59  ? -4.775  2.742   12.744  1.00 0.00 ? 416 ARG A HA   2  
ATOM   2506  H  HB2  . ARG A 1 59  ? -3.770  0.013   13.567  1.00 0.00 ? 416 ARG A HB2  2  
ATOM   2507  H  HB3  . ARG A 1 59  ? -5.363  0.310   12.884  1.00 0.00 ? 416 ARG A HB3  2  
ATOM   2508  H  HG2  . ARG A 1 59  ? -4.493  0.879   10.795  1.00 0.00 ? 416 ARG A HG2  2  
ATOM   2509  H  HG3  . ARG A 1 59  ? -2.871  1.135   11.441  1.00 0.00 ? 416 ARG A HG3  2  
ATOM   2510  H  HD2  . ARG A 1 59  ? -2.849  -0.930  10.253  1.00 0.00 ? 416 ARG A HD2  2  
ATOM   2511  H  HD3  . ARG A 1 59  ? -2.793  -1.309  11.974  1.00 0.00 ? 416 ARG A HD3  2  
ATOM   2512  H  HE   . ARG A 1 59  ? -5.449  -1.301  10.871  1.00 0.00 ? 416 ARG A HE   2  
ATOM   2513  H  HH11 . ARG A 1 59  ? -2.581  -3.193  11.431  1.00 0.00 ? 416 ARG A HH11 2  
ATOM   2514  H  HH12 . ARG A 1 59  ? -3.414  -4.711  11.377  1.00 0.00 ? 416 ARG A HH12 2  
ATOM   2515  H  HH21 . ARG A 1 59  ? -6.557  -3.293  10.799  1.00 0.00 ? 416 ARG A HH21 2  
ATOM   2516  H  HH22 . ARG A 1 59  ? -5.676  -4.767  11.016  1.00 0.00 ? 416 ARG A HH22 2  
ATOM   2517  N  N    . SER A 1 60  ? -6.408  2.019   14.675  1.00 0.00 ? 417 SER A N    2  
ATOM   2518  C  CA   . SER A 1 60  ? -7.267  2.069   15.852  1.00 0.00 ? 417 SER A CA   2  
ATOM   2519  C  C    . SER A 1 60  ? -7.288  0.722   16.568  1.00 0.00 ? 417 SER A C    2  
ATOM   2520  O  O    . SER A 1 60  ? -7.220  0.657   17.795  1.00 0.00 ? 417 SER A O    2  
ATOM   2521  C  CB   . SER A 1 60  ? -8.690  2.470   15.455  1.00 0.00 ? 417 SER A CB   2  
ATOM   2522  O  OG   . SER A 1 60  ? -8.698  3.714   14.777  1.00 0.00 ? 417 SER A OG   2  
ATOM   2523  H  H    . SER A 1 60  ? -6.814  1.890   13.792  1.00 0.00 ? 417 SER A H    2  
ATOM   2524  H  HA   . SER A 1 60  ? -6.867  2.814   16.523  1.00 0.00 ? 417 SER A HA   2  
ATOM   2525  H  HB2  . SER A 1 60  ? -9.105  1.716   14.803  1.00 0.00 ? 417 SER A HB2  2  
ATOM   2526  H  HB3  . SER A 1 60  ? -9.298  2.553   16.344  1.00 0.00 ? 417 SER A HB3  2  
ATOM   2527  H  HG   . SER A 1 60  ? -8.355  3.598   13.888  1.00 0.00 ? 417 SER A HG   2  
ATOM   2528  N  N    . ASP A 1 61  ? -7.383  -0.352  15.791  1.00 0.00 ? 418 ASP A N    2  
ATOM   2529  C  CA   . ASP A 1 61  ? -7.411  -1.699  16.349  1.00 0.00 ? 418 ASP A CA   2  
ATOM   2530  C  C    . ASP A 1 61  ? -6.174  -1.961  17.201  1.00 0.00 ? 418 ASP A C    2  
ATOM   2531  O  O    . ASP A 1 61  ? -6.274  -2.465  18.319  1.00 0.00 ? 418 ASP A O    2  
ATOM   2532  C  CB   . ASP A 1 61  ? -7.503  -2.736  15.229  1.00 0.00 ? 418 ASP A CB   2  
ATOM   2533  C  CG   . ASP A 1 61  ? -7.906  -4.106  15.739  1.00 0.00 ? 418 ASP A CG   2  
ATOM   2534  O  OD1  . ASP A 1 61  ? -7.531  -4.448  16.880  1.00 0.00 ? 418 ASP A OD1  2  
ATOM   2535  O  OD2  . ASP A 1 61  ? -8.598  -4.835  14.998  1.00 0.00 ? 418 ASP A OD2  2  
ATOM   2536  H  H    . ASP A 1 61  ? -7.434  -0.236  14.819  1.00 0.00 ? 418 ASP A H    2  
ATOM   2537  H  HA   . ASP A 1 61  ? -8.287  -1.780  16.975  1.00 0.00 ? 418 ASP A HA   2  
ATOM   2538  H  HB2  . ASP A 1 61  ? -8.237  -2.412  14.506  1.00 0.00 ? 418 ASP A HB2  2  
ATOM   2539  H  HB3  . ASP A 1 61  ? -6.541  -2.821  14.746  1.00 0.00 ? 418 ASP A HB3  2  
ATOM   2540  N  N    . GLU A 1 62  ? -5.008  -1.615  16.664  1.00 0.00 ? 419 GLU A N    2  
ATOM   2541  C  CA   . GLU A 1 62  ? -3.751  -1.814  17.376  1.00 0.00 ? 419 GLU A CA   2  
ATOM   2542  C  C    . GLU A 1 62  ? -3.861  -1.337  18.821  1.00 0.00 ? 419 GLU A C    2  
ATOM   2543  O  O    . GLU A 1 62  ? -3.574  -2.083  19.758  1.00 0.00 ? 419 GLU A O    2  
ATOM   2544  C  CB   . GLU A 1 62  ? -2.615  -1.073  16.668  1.00 0.00 ? 419 GLU A CB   2  
ATOM   2545  C  CG   . GLU A 1 62  ? -2.296  -1.623  15.288  1.00 0.00 ? 419 GLU A CG   2  
ATOM   2546  C  CD   . GLU A 1 62  ? -1.471  -2.893  15.342  1.00 0.00 ? 419 GLU A CD   2  
ATOM   2547  O  OE1  . GLU A 1 62  ? -1.524  -3.592  16.375  1.00 0.00 ? 419 GLU A OE1  2  
ATOM   2548  O  OE2  . GLU A 1 62  ? -0.771  -3.189  14.350  1.00 0.00 ? 419 GLU A OE2  2  
ATOM   2549  H  H    . GLU A 1 62  ? -4.993  -1.216  15.769  1.00 0.00 ? 419 GLU A H    2  
ATOM   2550  H  HA   . GLU A 1 62  ? -3.533  -2.872  17.375  1.00 0.00 ? 419 GLU A HA   2  
ATOM   2551  H  HB2  . GLU A 1 62  ? -2.889  -0.033  16.565  1.00 0.00 ? 419 GLU A HB2  2  
ATOM   2552  H  HB3  . GLU A 1 62  ? -1.724  -1.142  17.274  1.00 0.00 ? 419 GLU A HB3  2  
ATOM   2553  H  HG2  . GLU A 1 62  ? -3.223  -1.836  14.776  1.00 0.00 ? 419 GLU A HG2  2  
ATOM   2554  H  HG3  . GLU A 1 62  ? -1.745  -0.876  14.735  1.00 0.00 ? 419 GLU A HG3  2  
ATOM   2555  N  N    . LEU A 1 63  ? -4.280  -0.088  18.994  1.00 0.00 ? 420 LEU A N    2  
ATOM   2556  C  CA   . LEU A 1 63  ? -4.429  0.492   20.325  1.00 0.00 ? 420 LEU A CA   2  
ATOM   2557  C  C    . LEU A 1 63  ? -5.356  -0.358  21.188  1.00 0.00 ? 420 LEU A C    2  
ATOM   2558  O  O    . LEU A 1 63  ? -5.085  -0.593  22.366  1.00 0.00 ? 420 LEU A O    2  
ATOM   2559  C  CB   . LEU A 1 63  ? -4.971  1.918   20.224  1.00 0.00 ? 420 LEU A CB   2  
ATOM   2560  C  CG   . LEU A 1 63  ? -5.401  2.568   21.540  1.00 0.00 ? 420 LEU A CG   2  
ATOM   2561  C  CD1  . LEU A 1 63  ? -4.206  2.744   22.463  1.00 0.00 ? 420 LEU A CD1  2  
ATOM   2562  C  CD2  . LEU A 1 63  ? -6.078  3.905   21.278  1.00 0.00 ? 420 LEU A CD2  2  
ATOM   2563  H  H    . LEU A 1 63  ? -4.494  0.459   18.210  1.00 0.00 ? 420 LEU A H    2  
ATOM   2564  H  HA   . LEU A 1 63  ? -3.452  0.518   20.786  1.00 0.00 ? 420 LEU A HA   2  
ATOM   2565  H  HB2  . LEU A 1 63  ? -4.200  2.535   19.788  1.00 0.00 ? 420 LEU A HB2  2  
ATOM   2566  H  HB3  . LEU A 1 63  ? -5.829  1.899   19.567  1.00 0.00 ? 420 LEU A HB3  2  
ATOM   2567  H  HG   . LEU A 1 63  ? -6.114  1.923   22.036  1.00 0.00 ? 420 LEU A HG   2  
ATOM   2568  H  HD11 . LEU A 1 63  ? -3.516  3.450   22.028  1.00 0.00 ? 420 LEU A HD11 2  
ATOM   2569  H  HD12 . LEU A 1 63  ? -3.712  1.793   22.598  1.00 0.00 ? 420 LEU A HD12 2  
ATOM   2570  H  HD13 . LEU A 1 63  ? -4.543  3.113   23.421  1.00 0.00 ? 420 LEU A HD13 2  
ATOM   2571  H  HD21 . LEU A 1 63  ? -6.986  3.746   20.717  1.00 0.00 ? 420 LEU A HD21 2  
ATOM   2572  H  HD22 . LEU A 1 63  ? -5.412  4.540   20.713  1.00 0.00 ? 420 LEU A HD22 2  
ATOM   2573  H  HD23 . LEU A 1 63  ? -6.314  4.380   22.220  1.00 0.00 ? 420 LEU A HD23 2  
ATOM   2574  N  N    . THR A 1 64  ? -6.453  -0.817  20.593  1.00 0.00 ? 421 THR A N    2  
ATOM   2575  C  CA   . THR A 1 64  ? -7.421  -1.641  21.306  1.00 0.00 ? 421 THR A CA   2  
ATOM   2576  C  C    . THR A 1 64  ? -6.746  -2.843  21.957  1.00 0.00 ? 421 THR A C    2  
ATOM   2577  O  O    . THR A 1 64  ? -6.911  -3.088  23.152  1.00 0.00 ? 421 THR A O    2  
ATOM   2578  C  CB   . THR A 1 64  ? -8.536  -2.138  20.367  1.00 0.00 ? 421 THR A CB   2  
ATOM   2579  O  OG1  . THR A 1 64  ? -9.098  -1.036  19.647  1.00 0.00 ? 421 THR A OG1  2  
ATOM   2580  C  CG2  . THR A 1 64  ? -9.629  -2.848  21.152  1.00 0.00 ? 421 THR A CG2  2  
ATOM   2581  H  H    . THR A 1 64  ? -6.614  -0.595  19.653  1.00 0.00 ? 421 THR A H    2  
ATOM   2582  H  HA   . THR A 1 64  ? -7.873  -1.033  22.077  1.00 0.00 ? 421 THR A HA   2  
ATOM   2583  H  HB   . THR A 1 64  ? -8.107  -2.837  19.663  1.00 0.00 ? 421 THR A HB   2  
ATOM   2584  H  HG1  . THR A 1 64  ? -9.630  -1.367  18.920  1.00 0.00 ? 421 THR A HG1  2  
ATOM   2585  H  HG21 . THR A 1 64  ? -10.073 -3.615  20.536  1.00 0.00 ? 421 THR A HG21 2  
ATOM   2586  H  HG22 . THR A 1 64  ? -10.386 -2.135  21.440  1.00 0.00 ? 421 THR A HG22 2  
ATOM   2587  H  HG23 . THR A 1 64  ? -9.202  -3.298  22.036  1.00 0.00 ? 421 THR A HG23 2  
ATOM   2588  N  N    . ARG A 1 65  ? -5.986  -3.590  21.163  1.00 0.00 ? 422 ARG A N    2  
ATOM   2589  C  CA   . ARG A 1 65  ? -5.286  -4.768  21.663  1.00 0.00 ? 422 ARG A CA   2  
ATOM   2590  C  C    . ARG A 1 65  ? -4.257  -4.381  22.720  1.00 0.00 ? 422 ARG A C    2  
ATOM   2591  O  O    . ARG A 1 65  ? -3.991  -5.142  23.651  1.00 0.00 ? 422 ARG A O    2  
ATOM   2592  C  CB   . ARG A 1 65  ? -4.599  -5.505  20.512  1.00 0.00 ? 422 ARG A CB   2  
ATOM   2593  C  CG   . ARG A 1 65  ? -3.883  -6.775  20.943  1.00 0.00 ? 422 ARG A CG   2  
ATOM   2594  C  CD   . ARG A 1 65  ? -3.466  -7.613  19.745  1.00 0.00 ? 422 ARG A CD   2  
ATOM   2595  N  NE   . ARG A 1 65  ? -4.609  -8.250  19.098  1.00 0.00 ? 422 ARG A NE   2  
ATOM   2596  C  CZ   . ARG A 1 65  ? -5.272  -9.276  19.619  1.00 0.00 ? 422 ARG A CZ   2  
ATOM   2597  N  NH1  . ARG A 1 65  ? -4.907  -9.779  20.790  1.00 0.00 ? 422 ARG A NH1  2  
ATOM   2598  N  NH2  . ARG A 1 65  ? -6.303  -9.801  18.969  1.00 0.00 ? 422 ARG A NH2  2  
ATOM   2599  H  H    . ARG A 1 65  ? -5.894  -3.345  20.219  1.00 0.00 ? 422 ARG A H    2  
ATOM   2600  H  HA   . ARG A 1 65  ? -6.018  -5.423  22.112  1.00 0.00 ? 422 ARG A HA   2  
ATOM   2601  H  HB2  . ARG A 1 65  ? -5.342  -5.770  19.774  1.00 0.00 ? 422 ARG A HB2  2  
ATOM   2602  H  HB3  . ARG A 1 65  ? -3.874  -4.845  20.060  1.00 0.00 ? 422 ARG A HB3  2  
ATOM   2603  H  HG2  . ARG A 1 65  ? -3.001  -6.507  21.506  1.00 0.00 ? 422 ARG A HG2  2  
ATOM   2604  H  HG3  . ARG A 1 65  ? -4.547  -7.357  21.566  1.00 0.00 ? 422 ARG A HG3  2  
ATOM   2605  H  HD2  . ARG A 1 65  ? -2.970  -6.974  19.031  1.00 0.00 ? 422 ARG A HD2  2  
ATOM   2606  H  HD3  . ARG A 1 65  ? -2.781  -8.378  20.080  1.00 0.00 ? 422 ARG A HD3  2  
ATOM   2607  H  HE   . ARG A 1 65  ? -4.896  -7.894  18.231  1.00 0.00 ? 422 ARG A HE   2  
ATOM   2608  H  HH11 . ARG A 1 65  ? -4.131  -9.385  21.283  1.00 0.00 ? 422 ARG A HH11 2  
ATOM   2609  H  HH12 . ARG A 1 65  ? -5.408  -10.551 21.182  1.00 0.00 ? 422 ARG A HH12 2  
ATOM   2610  H  HH21 . ARG A 1 65  ? -6.581  -9.425  18.086  1.00 0.00 ? 422 ARG A HH21 2  
ATOM   2611  H  HH22 . ARG A 1 65  ? -6.801  -10.574 19.362  1.00 0.00 ? 422 ARG A HH22 2  
ATOM   2612  N  N    . HIS A 1 66  ? -3.681  -3.192  22.571  1.00 0.00 ? 423 HIS A N    2  
ATOM   2613  C  CA   . HIS A 1 66  ? -2.680  -2.704  23.513  1.00 0.00 ? 423 HIS A CA   2  
ATOM   2614  C  C    . HIS A 1 66  ? -3.323  -2.338  24.847  1.00 0.00 ? 423 HIS A C    2  
ATOM   2615  O  O    . HIS A 1 66  ? -2.737  -2.549  25.909  1.00 0.00 ? 423 HIS A O    2  
ATOM   2616  C  CB   . HIS A 1 66  ? -1.953  -1.490  22.934  1.00 0.00 ? 423 HIS A CB   2  
ATOM   2617  C  CG   . HIS A 1 66  ? -1.451  -0.539  23.976  1.00 0.00 ? 423 HIS A CG   2  
ATOM   2618  N  ND1  . HIS A 1 66  ? -0.183  -0.614  24.515  1.00 0.00 ? 423 HIS A ND1  2  
ATOM   2619  C  CD2  . HIS A 1 66  ? -2.052  0.513   24.578  1.00 0.00 ? 423 HIS A CD2  2  
ATOM   2620  C  CE1  . HIS A 1 66  ? -0.028  0.351   25.404  1.00 0.00 ? 423 HIS A CE1  2  
ATOM   2621  N  NE2  . HIS A 1 66  ? -1.147  1.050   25.461  1.00 0.00 ? 423 HIS A NE2  2  
ATOM   2622  H  H    . HIS A 1 66  ? -3.934  -2.631  21.809  1.00 0.00 ? 423 HIS A H    2  
ATOM   2623  H  HA   . HIS A 1 66  ? -1.965  -3.496  23.678  1.00 0.00 ? 423 HIS A HA   2  
ATOM   2624  H  HB2  . HIS A 1 66  ? -1.104  -1.828  22.358  1.00 0.00 ? 423 HIS A HB2  2  
ATOM   2625  H  HB3  . HIS A 1 66  ? -2.628  -0.949  22.287  1.00 0.00 ? 423 HIS A HB3  2  
ATOM   2626  H  HD1  . HIS A 1 66  ? 0.500   -1.276  24.281  1.00 0.00 ? 423 HIS A HD1  2  
ATOM   2627  H  HD2  . HIS A 1 66  ? -3.058  0.867   24.398  1.00 0.00 ? 423 HIS A HD2  2  
ATOM   2628  H  HE1  . HIS A 1 66  ? 0.862   0.538   25.985  1.00 0.00 ? 423 HIS A HE1  2  
ATOM   2629  N  N    . TYR A 1 67  ? -4.531  -1.787  24.785  1.00 0.00 ? 424 TYR A N    2  
ATOM   2630  C  CA   . TYR A 1 67  ? -5.252  -1.389  25.987  1.00 0.00 ? 424 TYR A CA   2  
ATOM   2631  C  C    . TYR A 1 67  ? -5.621  -2.606  26.830  1.00 0.00 ? 424 TYR A C    2  
ATOM   2632  O  O    . TYR A 1 67  ? -5.390  -2.630  28.039  1.00 0.00 ? 424 TYR A O    2  
ATOM   2633  C  CB   . TYR A 1 67  ? -6.515  -0.610  25.615  1.00 0.00 ? 424 TYR A CB   2  
ATOM   2634  C  CG   . TYR A 1 67  ? -6.923  0.414   26.651  1.00 0.00 ? 424 TYR A CG   2  
ATOM   2635  C  CD1  . TYR A 1 67  ? -6.175  1.568   26.847  1.00 0.00 ? 424 TYR A CD1  2  
ATOM   2636  C  CD2  . TYR A 1 67  ? -8.056  0.227   27.432  1.00 0.00 ? 424 TYR A CD2  2  
ATOM   2637  C  CE1  . TYR A 1 67  ? -6.543  2.505   27.792  1.00 0.00 ? 424 TYR A CE1  2  
ATOM   2638  C  CE2  . TYR A 1 67  ? -8.433  1.160   28.379  1.00 0.00 ? 424 TYR A CE2  2  
ATOM   2639  C  CZ   . TYR A 1 67  ? -7.673  2.297   28.555  1.00 0.00 ? 424 TYR A CZ   2  
ATOM   2640  O  OH   . TYR A 1 67  ? -8.043  3.230   29.497  1.00 0.00 ? 424 TYR A OH   2  
ATOM   2641  H  H    . TYR A 1 67  ? -4.946  -1.644  23.909  1.00 0.00 ? 424 TYR A H    2  
ATOM   2642  H  HA   . TYR A 1 67  ? -4.603  -0.747  26.566  1.00 0.00 ? 424 TYR A HA   2  
ATOM   2643  H  HB2  . TYR A 1 67  ? -6.349  -0.091  24.684  1.00 0.00 ? 424 TYR A HB2  2  
ATOM   2644  H  HB3  . TYR A 1 67  ? -7.334  -1.304  25.494  1.00 0.00 ? 424 TYR A HB3  2  
ATOM   2645  H  HD1  . TYR A 1 67  ? -5.290  1.728   26.247  1.00 0.00 ? 424 TYR A HD1  2  
ATOM   2646  H  HD2  . TYR A 1 67  ? -8.650  -0.665  27.292  1.00 0.00 ? 424 TYR A HD2  2  
ATOM   2647  H  HE1  . TYR A 1 67  ? -5.948  3.396   27.930  1.00 0.00 ? 424 TYR A HE1  2  
ATOM   2648  H  HE2  . TYR A 1 67  ? -9.317  0.997   28.977  1.00 0.00 ? 424 TYR A HE2  2  
ATOM   2649  H  HH   . TYR A 1 67  ? -8.999  3.227   29.591  1.00 0.00 ? 424 TYR A HH   2  
ATOM   2650  N  N    . ARG A 1 68  ? -6.195  -3.614  26.182  1.00 0.00 ? 425 ARG A N    2  
ATOM   2651  C  CA   . ARG A 1 68  ? -6.596  -4.835  26.871  1.00 0.00 ? 425 ARG A CA   2  
ATOM   2652  C  C    . ARG A 1 68  ? -5.615  -5.176  27.989  1.00 0.00 ? 425 ARG A C    2  
ATOM   2653  O  O    . ARG A 1 68  ? -6.008  -5.354  29.142  1.00 0.00 ? 425 ARG A O    2  
ATOM   2654  C  CB   . ARG A 1 68  ? -6.684  -5.998  25.882  1.00 0.00 ? 425 ARG A CB   2  
ATOM   2655  C  CG   . ARG A 1 68  ? -7.978  -6.025  25.085  1.00 0.00 ? 425 ARG A CG   2  
ATOM   2656  C  CD   . ARG A 1 68  ? -8.223  -7.391  24.464  1.00 0.00 ? 425 ARG A CD   2  
ATOM   2657  N  NE   . ARG A 1 68  ? -8.537  -8.401  25.471  1.00 0.00 ? 425 ARG A NE   2  
ATOM   2658  C  CZ   . ARG A 1 68  ? -9.696  -8.458  26.118  1.00 0.00 ? 425 ARG A CZ   2  
ATOM   2659  N  NH1  . ARG A 1 68  ? -10.645 -7.568  25.864  1.00 0.00 ? 425 ARG A NH1  2  
ATOM   2660  N  NH2  . ARG A 1 68  ? -9.907  -9.408  27.020  1.00 0.00 ? 425 ARG A NH2  2  
ATOM   2661  H  H    . ARG A 1 68  ? -6.353  -3.535  25.218  1.00 0.00 ? 425 ARG A H    2  
ATOM   2662  H  HA   . ARG A 1 68  ? -7.571  -4.667  27.303  1.00 0.00 ? 425 ARG A HA   2  
ATOM   2663  H  HB2  . ARG A 1 68  ? -5.860  -5.927  25.186  1.00 0.00 ? 425 ARG A HB2  2  
ATOM   2664  H  HB3  . ARG A 1 68  ? -6.604  -6.926  26.428  1.00 0.00 ? 425 ARG A HB3  2  
ATOM   2665  H  HG2  . ARG A 1 68  ? -8.801  -5.789  25.744  1.00 0.00 ? 425 ARG A HG2  2  
ATOM   2666  H  HG3  . ARG A 1 68  ? -7.921  -5.286  24.299  1.00 0.00 ? 425 ARG A HG3  2  
ATOM   2667  H  HD2  . ARG A 1 68  ? -9.049  -7.315  23.774  1.00 0.00 ? 425 ARG A HD2  2  
ATOM   2668  H  HD3  . ARG A 1 68  ? -7.334  -7.693  23.930  1.00 0.00 ? 425 ARG A HD3  2  
ATOM   2669  H  HE   . ARG A 1 68  ? -7.850  -9.069  25.674  1.00 0.00 ? 425 ARG A HE   2  
ATOM   2670  H  HH11 . ARG A 1 68  ? -10.489 -6.852  25.184  1.00 0.00 ? 425 ARG A HH11 2  
ATOM   2671  H  HH12 . ARG A 1 68  ? -11.517 -7.614  26.352  1.00 0.00 ? 425 ARG A HH12 2  
ATOM   2672  H  HH21 . ARG A 1 68  ? -9.194  -10.081 27.214  1.00 0.00 ? 425 ARG A HH21 2  
ATOM   2673  H  HH22 . ARG A 1 68  ? -10.779 -9.450  27.507  1.00 0.00 ? 425 ARG A HH22 2  
ATOM   2674  N  N    . LYS A 1 69  ? -4.337  -5.267  27.639  1.00 0.00 ? 426 LYS A N    2  
ATOM   2675  C  CA   . LYS A 1 69  ? -3.298  -5.587  28.612  1.00 0.00 ? 426 LYS A CA   2  
ATOM   2676  C  C    . LYS A 1 69  ? -3.487  -4.782  29.894  1.00 0.00 ? 426 LYS A C    2  
ATOM   2677  O  O    . LYS A 1 69  ? -3.433  -5.329  30.996  1.00 0.00 ? 426 LYS A O    2  
ATOM   2678  C  CB   . LYS A 1 69  ? -1.914  -5.307  28.021  1.00 0.00 ? 426 LYS A CB   2  
ATOM   2679  C  CG   . LYS A 1 69  ? -1.357  -6.461  27.205  1.00 0.00 ? 426 LYS A CG   2  
ATOM   2680  C  CD   . LYS A 1 69  ? -0.003  -6.118  26.607  1.00 0.00 ? 426 LYS A CD   2  
ATOM   2681  C  CE   . LYS A 1 69  ? -0.144  -5.232  25.379  1.00 0.00 ? 426 LYS A CE   2  
ATOM   2682  N  NZ   . LYS A 1 69  ? -0.843  -5.933  24.267  1.00 0.00 ? 426 LYS A NZ   2  
ATOM   2683  H  H    . LYS A 1 69  ? -4.085  -5.115  26.704  1.00 0.00 ? 426 LYS A H    2  
ATOM   2684  H  HA   . LYS A 1 69  ? -3.375  -6.638  28.846  1.00 0.00 ? 426 LYS A HA   2  
ATOM   2685  H  HB2  . LYS A 1 69  ? -1.978  -4.439  27.382  1.00 0.00 ? 426 LYS A HB2  2  
ATOM   2686  H  HB3  . LYS A 1 69  ? -1.227  -5.100  28.829  1.00 0.00 ? 426 LYS A HB3  2  
ATOM   2687  H  HG2  . LYS A 1 69  ? -1.247  -7.323  27.846  1.00 0.00 ? 426 LYS A HG2  2  
ATOM   2688  H  HG3  . LYS A 1 69  ? -2.046  -6.689  26.405  1.00 0.00 ? 426 LYS A HG3  2  
ATOM   2689  H  HD2  . LYS A 1 69  ? 0.586   -5.596  27.347  1.00 0.00 ? 426 LYS A HD2  2  
ATOM   2690  H  HD3  . LYS A 1 69  ? 0.499   -7.033  26.325  1.00 0.00 ? 426 LYS A HD3  2  
ATOM   2691  H  HE2  . LYS A 1 69  ? -0.707  -4.352  25.649  1.00 0.00 ? 426 LYS A HE2  2  
ATOM   2692  H  HE3  . LYS A 1 69  ? 0.841   -4.940  25.047  1.00 0.00 ? 426 LYS A HE3  2  
ATOM   2693  H  HZ1  . LYS A 1 69  ? -1.694  -5.403  23.989  1.00 0.00 ? 426 LYS A HZ1  2  
ATOM   2694  H  HZ2  . LYS A 1 69  ? -1.126  -6.888  24.569  1.00 0.00 ? 426 LYS A HZ2  2  
ATOM   2695  H  HZ3  . LYS A 1 69  ? -0.214  -6.014  23.444  1.00 0.00 ? 426 LYS A HZ3  2  
ATOM   2696  N  N    . HIS A 1 70  ? -3.711  -3.480  29.743  1.00 0.00 ? 427 HIS A N    2  
ATOM   2697  C  CA   . HIS A 1 70  ? -3.911  -2.601  30.889  1.00 0.00 ? 427 HIS A CA   2  
ATOM   2698  C  C    . HIS A 1 70  ? -5.062  -3.096  31.760  1.00 0.00 ? 427 HIS A C    2  
ATOM   2699  O  O    . HIS A 1 70  ? -4.969  -3.100  32.988  1.00 0.00 ? 427 HIS A O    2  
ATOM   2700  C  CB   . HIS A 1 70  ? -4.189  -1.172  30.421  1.00 0.00 ? 427 HIS A CB   2  
ATOM   2701  C  CG   . HIS A 1 70  ? -2.986  -0.484  29.851  1.00 0.00 ? 427 HIS A CG   2  
ATOM   2702  N  ND1  . HIS A 1 70  ? -1.748  -0.509  30.457  1.00 0.00 ? 427 HIS A ND1  2  
ATOM   2703  C  CD2  . HIS A 1 70  ? -2.838  0.249   28.724  1.00 0.00 ? 427 HIS A CD2  2  
ATOM   2704  C  CE1  . HIS A 1 70  ? -0.890  0.181   29.727  1.00 0.00 ? 427 HIS A CE1  2  
ATOM   2705  N  NE2  . HIS A 1 70  ? -1.526  0.651   28.670  1.00 0.00 ? 427 HIS A NE2  2  
ATOM   2706  H  H    . HIS A 1 70  ? -3.743  -3.103  28.839  1.00 0.00 ? 427 HIS A H    2  
ATOM   2707  H  HA   . HIS A 1 70  ? -3.004  -2.609  31.475  1.00 0.00 ? 427 HIS A HA   2  
ATOM   2708  H  HB2  . HIS A 1 70  ? -4.951  -1.193  29.656  1.00 0.00 ? 427 HIS A HB2  2  
ATOM   2709  H  HB3  . HIS A 1 70  ? -4.541  -0.588  31.258  1.00 0.00 ? 427 HIS A HB3  2  
ATOM   2710  H  HD1  . HIS A 1 70  ? -1.531  -0.964  31.297  1.00 0.00 ? 427 HIS A HD1  2  
ATOM   2711  H  HD2  . HIS A 1 70  ? -3.608  0.478   28.000  1.00 0.00 ? 427 HIS A HD2  2  
ATOM   2712  H  HE1  . HIS A 1 70  ? 0.155   0.334   29.956  1.00 0.00 ? 427 HIS A HE1  2  
ATOM   2713  N  N    . THR A 1 71  ? -6.148  -3.513  31.116  1.00 0.00 ? 428 THR A N    2  
ATOM   2714  C  CA   . THR A 1 71  ? -7.317  -4.008  31.832  1.00 0.00 ? 428 THR A CA   2  
ATOM   2715  C  C    . THR A 1 71  ? -7.165  -5.484  32.179  1.00 0.00 ? 428 THR A C    2  
ATOM   2716  O  O    . THR A 1 71  ? -8.152  -6.186  32.394  1.00 0.00 ? 428 THR A O    2  
ATOM   2717  C  CB   . THR A 1 71  ? -8.603  -3.817  31.006  1.00 0.00 ? 428 THR A CB   2  
ATOM   2718  O  OG1  . THR A 1 71  ? -8.477  -4.478  29.742  1.00 0.00 ? 428 THR A OG1  2  
ATOM   2719  C  CG2  . THR A 1 71  ? -8.889  -2.339  30.784  1.00 0.00 ? 428 THR A CG2  2  
ATOM   2720  H  H    . THR A 1 71  ? -6.162  -3.485  30.137  1.00 0.00 ? 428 THR A H    2  
ATOM   2721  H  HA   . THR A 1 71  ? -7.414  -3.441  32.746  1.00 0.00 ? 428 THR A HA   2  
ATOM   2722  H  HB   . THR A 1 71  ? -9.430  -4.250  31.550  1.00 0.00 ? 428 THR A HB   2  
ATOM   2723  H  HG1  . THR A 1 71  ? -9.033  -4.039  29.094  1.00 0.00 ? 428 THR A HG1  2  
ATOM   2724  H  HG21 . THR A 1 71  ? -8.150  -1.926  30.115  1.00 0.00 ? 428 THR A HG21 2  
ATOM   2725  H  HG22 . THR A 1 71  ? -8.849  -1.818  31.730  1.00 0.00 ? 428 THR A HG22 2  
ATOM   2726  H  HG23 . THR A 1 71  ? -9.872  -2.223  30.351  1.00 0.00 ? 428 THR A HG23 2  
ATOM   2727  N  N    . GLY A 1 72  ? -5.921  -5.950  32.232  1.00 0.00 ? 429 GLY A N    2  
ATOM   2728  C  CA   . GLY A 1 72  ? -5.662  -7.341  32.555  1.00 0.00 ? 429 GLY A CA   2  
ATOM   2729  C  C    . GLY A 1 72  ? -4.194  -7.612  32.819  1.00 0.00 ? 429 GLY A C    2  
ATOM   2730  O  O    . GLY A 1 72  ? -3.405  -7.755  31.886  1.00 0.00 ? 429 GLY A O    2  
ATOM   2731  H  H    . GLY A 1 72  ? -5.172  -5.344  32.051  1.00 0.00 ? 429 GLY A H    2  
ATOM   2732  H  HA2  . GLY A 1 72  ? -6.231  -7.607  33.433  1.00 0.00 ? 429 GLY A HA2  2  
ATOM   2733  H  HA3  . GLY A 1 72  ? -5.986  -7.956  31.729  1.00 0.00 ? 429 GLY A HA3  2  
ATOM   2734  N  N    . ALA A 1 73  ? -3.827  -7.680  34.095  1.00 0.00 ? 430 ALA A N    2  
ATOM   2735  C  CA   . ALA A 1 73  ? -2.445  -7.936  34.479  1.00 0.00 ? 430 ALA A CA   2  
ATOM   2736  C  C    . ALA A 1 73  ? -2.263  -9.375  34.951  1.00 0.00 ? 430 ALA A C    2  
ATOM   2737  O  O    . ALA A 1 73  ? -2.811  -9.777  35.977  1.00 0.00 ? 430 ALA A O    2  
ATOM   2738  C  CB   . ALA A 1 73  ? -2.011  -6.963  35.566  1.00 0.00 ? 430 ALA A CB   2  
ATOM   2739  H  H    . ALA A 1 73  ? -4.503  -7.557  34.794  1.00 0.00 ? 430 ALA A H    2  
ATOM   2740  H  HA   . ALA A 1 73  ? -1.821  -7.770  33.612  1.00 0.00 ? 430 ALA A HA   2  
ATOM   2741  H  HB1  . ALA A 1 73  ? -2.576  -7.154  36.466  1.00 0.00 ? 430 ALA A HB1  2  
ATOM   2742  H  HB2  . ALA A 1 73  ? -0.957  -7.096  35.767  1.00 0.00 ? 430 ALA A HB2  2  
ATOM   2743  H  HB3  . ALA A 1 73  ? -2.190  -5.951  35.235  1.00 0.00 ? 430 ALA A HB3  2  
ATOM   2744  N  N    . LYS A 1 74  ? -1.491  -10.147 34.194  1.00 0.00 ? 431 LYS A N    2  
ATOM   2745  C  CA   . LYS A 1 74  ? -1.236  -11.542 34.534  1.00 0.00 ? 431 LYS A CA   2  
ATOM   2746  C  C    . LYS A 1 74  ? -0.137  -11.653 35.586  1.00 0.00 ? 431 LYS A C    2  
ATOM   2747  O  O    . LYS A 1 74  ? 0.631   -10.719 35.818  1.00 0.00 ? 431 LYS A O    2  
ATOM   2748  C  CB   . LYS A 1 74  ? -0.841  -12.329 33.283  1.00 0.00 ? 431 LYS A CB   2  
ATOM   2749  C  CG   . LYS A 1 74  ? -2.014  -13.000 32.591  1.00 0.00 ? 431 LYS A CG   2  
ATOM   2750  C  CD   . LYS A 1 74  ? -2.653  -12.082 31.561  1.00 0.00 ? 431 LYS A CD   2  
ATOM   2751  C  CE   . LYS A 1 74  ? -3.927  -12.685 30.991  1.00 0.00 ? 431 LYS A CE   2  
ATOM   2752  N  NZ   . LYS A 1 74  ? -5.026  -12.712 31.996  1.00 0.00 ? 431 LYS A NZ   2  
ATOM   2753  H  H    . LYS A 1 74  ? -1.081  -9.769  33.387  1.00 0.00 ? 431 LYS A H    2  
ATOM   2754  H  HA   . LYS A 1 74  ? -2.147  -11.957 34.938  1.00 0.00 ? 431 LYS A HA   2  
ATOM   2755  H  HB2  . LYS A 1 74  ? -0.372  -11.655 32.581  1.00 0.00 ? 431 LYS A HB2  2  
ATOM   2756  H  HB3  . LYS A 1 74  ? -0.130  -13.094 33.563  1.00 0.00 ? 431 LYS A HB3  2  
ATOM   2757  H  HG2  . LYS A 1 74  ? -1.665  -13.893 32.093  1.00 0.00 ? 431 LYS A HG2  2  
ATOM   2758  H  HG3  . LYS A 1 74  ? -2.755  -13.264 33.332  1.00 0.00 ? 431 LYS A HG3  2  
ATOM   2759  H  HD2  . LYS A 1 74  ? -2.893  -11.140 32.031  1.00 0.00 ? 431 LYS A HD2  2  
ATOM   2760  H  HD3  . LYS A 1 74  ? -1.952  -11.916 30.756  1.00 0.00 ? 431 LYS A HD3  2  
ATOM   2761  H  HE2  . LYS A 1 74  ? -4.241  -12.096 30.143  1.00 0.00 ? 431 LYS A HE2  2  
ATOM   2762  H  HE3  . LYS A 1 74  ? -3.720  -13.696 30.671  1.00 0.00 ? 431 LYS A HE3  2  
ATOM   2763  H  HZ1  . LYS A 1 74  ? -5.054  -11.813 32.520  1.00 0.00 ? 431 LYS A HZ1  2  
ATOM   2764  H  HZ2  . LYS A 1 74  ? -4.875  -13.489 32.670  1.00 0.00 ? 431 LYS A HZ2  2  
ATOM   2765  H  HZ3  . LYS A 1 74  ? -5.941  -12.853 31.522  1.00 0.00 ? 431 LYS A HZ3  2  
ATOM   2766  N  N    . PRO A 1 75  ? -0.056  -12.823 36.238  1.00 0.00 ? 432 PRO A N    2  
ATOM   2767  C  CA   . PRO A 1 75  ? 0.947   -13.084 37.274  1.00 0.00 ? 432 PRO A CA   2  
ATOM   2768  C  C    . PRO A 1 75  ? 2.356   -13.194 36.702  1.00 0.00 ? 432 PRO A C    2  
ATOM   2769  O  O    . PRO A 1 75  ? 3.314   -13.459 37.429  1.00 0.00 ? 432 PRO A O    2  
ATOM   2770  C  CB   . PRO A 1 75  ? 0.504   -14.424 37.867  1.00 0.00 ? 432 PRO A CB   2  
ATOM   2771  C  CG   . PRO A 1 75  ? -0.262  -15.087 36.774  1.00 0.00 ? 432 PRO A CG   2  
ATOM   2772  C  CD   . PRO A 1 75  ? -0.938  -13.980 36.013  1.00 0.00 ? 432 PRO A CD   2  
ATOM   2773  H  HA   . PRO A 1 75  ? 0.930   -12.326 38.043  1.00 0.00 ? 432 PRO A HA   2  
ATOM   2774  H  HB2  . PRO A 1 75  ? 1.374   -15.002 38.147  1.00 0.00 ? 432 PRO A HB2  2  
ATOM   2775  H  HB3  . PRO A 1 75  ? -0.114  -14.252 38.734  1.00 0.00 ? 432 PRO A HB3  2  
ATOM   2776  H  HG2  . PRO A 1 75  ? 0.412   -15.628 36.129  1.00 0.00 ? 432 PRO A HG2  2  
ATOM   2777  H  HG3  . PRO A 1 75  ? -0.998  -15.755 37.196  1.00 0.00 ? 432 PRO A HG3  2  
ATOM   2778  H  HD2  . PRO A 1 75  ? -0.994  -14.224 34.963  1.00 0.00 ? 432 PRO A HD2  2  
ATOM   2779  H  HD3  . PRO A 1 75  ? -1.925  -13.795 36.413  1.00 0.00 ? 432 PRO A HD3  2  
ATOM   2780  N  N    . PHE A 1 76  ? 2.477   -12.989 35.395  1.00 0.00 ? 433 PHE A N    2  
ATOM   2781  C  CA   . PHE A 1 76  ? 3.770   -13.065 34.725  1.00 0.00 ? 433 PHE A CA   2  
ATOM   2782  C  C    . PHE A 1 76  ? 3.849   -12.060 33.579  1.00 0.00 ? 433 PHE A C    2  
ATOM   2783  O  O    . PHE A 1 76  ? 3.101   -12.153 32.607  1.00 0.00 ? 433 PHE A O    2  
ATOM   2784  C  CB   . PHE A 1 76  ? 4.010   -14.480 34.194  1.00 0.00 ? 433 PHE A CB   2  
ATOM   2785  C  CG   . PHE A 1 76  ? 4.071   -15.523 35.274  1.00 0.00 ? 433 PHE A CG   2  
ATOM   2786  C  CD1  . PHE A 1 76  ? 5.190   -15.638 36.082  1.00 0.00 ? 433 PHE A CD1  2  
ATOM   2787  C  CD2  . PHE A 1 76  ? 3.008   -16.388 35.480  1.00 0.00 ? 433 PHE A CD2  2  
ATOM   2788  C  CE1  . PHE A 1 76  ? 5.249   -16.596 37.076  1.00 0.00 ? 433 PHE A CE1  2  
ATOM   2789  C  CE2  . PHE A 1 76  ? 3.061   -17.348 36.473  1.00 0.00 ? 433 PHE A CE2  2  
ATOM   2790  C  CZ   . PHE A 1 76  ? 4.184   -17.453 37.271  1.00 0.00 ? 433 PHE A CZ   2  
ATOM   2791  H  H    . PHE A 1 76  ? 1.677   -12.781 34.868  1.00 0.00 ? 433 PHE A H    2  
ATOM   2792  H  HA   . PHE A 1 76  ? 4.533   -12.828 35.450  1.00 0.00 ? 433 PHE A HA   2  
ATOM   2793  H  HB2  . PHE A 1 76  ? 3.208   -14.746 33.522  1.00 0.00 ? 433 PHE A HB2  2  
ATOM   2794  H  HB3  . PHE A 1 76  ? 4.946   -14.501 33.657  1.00 0.00 ? 433 PHE A HB3  2  
ATOM   2795  H  HD1  . PHE A 1 76  ? 6.025   -14.968 35.929  1.00 0.00 ? 433 PHE A HD1  2  
ATOM   2796  H  HD2  . PHE A 1 76  ? 2.130   -16.308 34.856  1.00 0.00 ? 433 PHE A HD2  2  
ATOM   2797  H  HE1  . PHE A 1 76  ? 6.129   -16.676 37.698  1.00 0.00 ? 433 PHE A HE1  2  
ATOM   2798  H  HE2  . PHE A 1 76  ? 2.227   -18.017 36.624  1.00 0.00 ? 433 PHE A HE2  2  
ATOM   2799  H  HZ   . PHE A 1 76  ? 4.228   -18.202 38.048  1.00 0.00 ? 433 PHE A HZ   2  
ATOM   2800  N  N    . GLN A 1 77  ? 4.761   -11.101 33.704  1.00 0.00 ? 434 GLN A N    2  
ATOM   2801  C  CA   . GLN A 1 77  ? 4.938   -10.078 32.680  1.00 0.00 ? 434 GLN A CA   2  
ATOM   2802  C  C    . GLN A 1 77  ? 6.404   -9.961  32.275  1.00 0.00 ? 434 GLN A C    2  
ATOM   2803  O  O    . GLN A 1 77  ? 7.303   -10.225 33.074  1.00 0.00 ? 434 GLN A O    2  
ATOM   2804  C  CB   . GLN A 1 77  ? 4.426   -8.728  33.184  1.00 0.00 ? 434 GLN A CB   2  
ATOM   2805  C  CG   . GLN A 1 77  ? 4.473   -7.629  32.135  1.00 0.00 ? 434 GLN A CG   2  
ATOM   2806  C  CD   . GLN A 1 77  ? 3.505   -6.500  32.429  1.00 0.00 ? 434 GLN A CD   2  
ATOM   2807  O  OE1  . GLN A 1 77  ? 3.338   -6.093  33.579  1.00 0.00 ? 434 GLN A OE1  2  
ATOM   2808  N  NE2  . GLN A 1 77  ? 2.860   -5.987  31.388  1.00 0.00 ? 434 GLN A NE2  2  
ATOM   2809  H  H    . GLN A 1 77  ? 5.328   -11.081 34.502  1.00 0.00 ? 434 GLN A H    2  
ATOM   2810  H  HA   . GLN A 1 77  ? 4.361   -10.371 31.816  1.00 0.00 ? 434 GLN A HA   2  
ATOM   2811  H  HB2  . GLN A 1 77  ? 3.403   -8.843  33.509  1.00 0.00 ? 434 GLN A HB2  2  
ATOM   2812  H  HB3  . GLN A 1 77  ? 5.030   -8.419  34.025  1.00 0.00 ? 434 GLN A HB3  2  
ATOM   2813  H  HG2  . GLN A 1 77  ? 5.474   -7.224  32.101  1.00 0.00 ? 434 GLN A HG2  2  
ATOM   2814  H  HG3  . GLN A 1 77  ? 4.225   -8.056  31.175  1.00 0.00 ? 434 GLN A HG3  2  
ATOM   2815  H  HE21 . GLN A 1 77  ? 3.042   -6.362  30.501  1.00 0.00 ? 434 GLN A HE21 2  
ATOM   2816  H  HE22 . GLN A 1 77  ? 2.227   -5.257  31.549  1.00 0.00 ? 434 GLN A HE22 2  
ATOM   2817  N  N    . CYS A 1 78  ? 6.638   -9.563  31.029  1.00 0.00 ? 435 CYS A N    2  
ATOM   2818  C  CA   . CYS A 1 78  ? 7.994   -9.411  30.516  1.00 0.00 ? 435 CYS A CA   2  
ATOM   2819  C  C    . CYS A 1 78  ? 8.609   -8.097  30.987  1.00 0.00 ? 435 CYS A C    2  
ATOM   2820  O  O    . CYS A 1 78  ? 7.979   -7.329  31.713  1.00 0.00 ? 435 CYS A O    2  
ATOM   2821  C  CB   . CYS A 1 78  ? 7.993   -9.467  28.987  1.00 0.00 ? 435 CYS A CB   2  
ATOM   2822  S  SG   . CYS A 1 78  ? 9.526   -10.139 28.267  1.00 0.00 ? 435 CYS A SG   2  
ATOM   2823  H  H    . CYS A 1 78  ? 5.879   -9.367  30.438  1.00 0.00 ? 435 CYS A H    2  
ATOM   2824  H  HA   . CYS A 1 78  ? 8.587   -10.229 30.897  1.00 0.00 ? 435 CYS A HA   2  
ATOM   2825  H  HB2  . CYS A 1 78  ? 7.175   -10.092 28.658  1.00 0.00 ? 435 CYS A HB2  2  
ATOM   2826  H  HB3  . CYS A 1 78  ? 7.857   -8.469  28.598  1.00 0.00 ? 435 CYS A HB3  2  
ATOM   2827  N  N    . GLY A 1 79  ? 9.846   -7.845  30.568  1.00 0.00 ? 436 GLY A N    2  
ATOM   2828  C  CA   . GLY A 1 79  ? 10.526  -6.623  30.957  1.00 0.00 ? 436 GLY A CA   2  
ATOM   2829  C  C    . GLY A 1 79  ? 10.769  -5.696  29.783  1.00 0.00 ? 436 GLY A C    2  
ATOM   2830  O  O    . GLY A 1 79  ? 10.323  -4.548  29.786  1.00 0.00 ? 436 GLY A O    2  
ATOM   2831  H  H    . GLY A 1 79  ? 10.300  -8.493  29.991  1.00 0.00 ? 436 GLY A H    2  
ATOM   2832  H  HA2  . GLY A 1 79  ? 9.926   -6.107  31.691  1.00 0.00 ? 436 GLY A HA2  2  
ATOM   2833  H  HA3  . GLY A 1 79  ? 11.477  -6.880  31.400  1.00 0.00 ? 436 GLY A HA3  2  
ATOM   2834  N  N    . VAL A 1 80  ? 11.479  -6.193  28.775  1.00 0.00 ? 437 VAL A N    2  
ATOM   2835  C  CA   . VAL A 1 80  ? 11.781  -5.401  27.589  1.00 0.00 ? 437 VAL A CA   2  
ATOM   2836  C  C    . VAL A 1 80  ? 10.504  -4.961  26.882  1.00 0.00 ? 437 VAL A C    2  
ATOM   2837  O  O    . VAL A 1 80  ? 10.239  -3.767  26.741  1.00 0.00 ? 437 VAL A O    2  
ATOM   2838  C  CB   . VAL A 1 80  ? 12.659  -6.188  26.597  1.00 0.00 ? 437 VAL A CB   2  
ATOM   2839  C  CG1  . VAL A 1 80  ? 12.918  -5.365  25.344  1.00 0.00 ? 437 VAL A CG1  2  
ATOM   2840  C  CG2  . VAL A 1 80  ? 13.967  -6.599  27.255  1.00 0.00 ? 437 VAL A CG2  2  
ATOM   2841  H  H    . VAL A 1 80  ? 11.807  -7.115  28.830  1.00 0.00 ? 437 VAL A H    2  
ATOM   2842  H  HA   . VAL A 1 80  ? 12.327  -4.523  27.903  1.00 0.00 ? 437 VAL A HA   2  
ATOM   2843  H  HB   . VAL A 1 80  ? 12.128  -7.083  26.309  1.00 0.00 ? 437 VAL A HB   2  
ATOM   2844  H  HG11 . VAL A 1 80  ? 13.452  -5.966  24.623  1.00 0.00 ? 437 VAL A HG11 2  
ATOM   2845  H  HG12 . VAL A 1 80  ? 11.976  -5.046  24.921  1.00 0.00 ? 437 VAL A HG12 2  
ATOM   2846  H  HG13 . VAL A 1 80  ? 13.510  -4.499  25.599  1.00 0.00 ? 437 VAL A HG13 2  
ATOM   2847  H  HG21 . VAL A 1 80  ? 13.766  -7.302  28.049  1.00 0.00 ? 437 VAL A HG21 2  
ATOM   2848  H  HG22 . VAL A 1 80  ? 14.610  -7.060  26.519  1.00 0.00 ? 437 VAL A HG22 2  
ATOM   2849  H  HG23 . VAL A 1 80  ? 14.456  -5.725  27.662  1.00 0.00 ? 437 VAL A HG23 2  
ATOM   2850  N  N    . CYS A 1 81  ? 9.714   -5.934  26.439  1.00 0.00 ? 438 CYS A N    2  
ATOM   2851  C  CA   . CYS A 1 81  ? 8.464   -5.649  25.746  1.00 0.00 ? 438 CYS A CA   2  
ATOM   2852  C  C    . CYS A 1 81  ? 7.327   -5.433  26.741  1.00 0.00 ? 438 CYS A C    2  
ATOM   2853  O  O    . CYS A 1 81  ? 6.320   -4.803  26.422  1.00 0.00 ? 438 CYS A O    2  
ATOM   2854  C  CB   . CYS A 1 81  ? 8.112   -6.793  24.794  1.00 0.00 ? 438 CYS A CB   2  
ATOM   2855  S  SG   . CYS A 1 81  ? 7.606   -8.330  25.632  1.00 0.00 ? 438 CYS A SG   2  
ATOM   2856  H  H    . CYS A 1 81  ? 9.980   -6.868  26.581  1.00 0.00 ? 438 CYS A H    2  
ATOM   2857  H  HA   . CYS A 1 81  ? 8.600   -4.745  25.173  1.00 0.00 ? 438 CYS A HA   2  
ATOM   2858  H  HB2  . CYS A 1 81  ? 7.295   -6.484  24.157  1.00 0.00 ? 438 CYS A HB2  2  
ATOM   2859  H  HB3  . CYS A 1 81  ? 8.972   -7.020  24.182  1.00 0.00 ? 438 CYS A HB3  2  
ATOM   2860  N  N    . ASN A 1 82  ? 7.498   -5.961  27.949  1.00 0.00 ? 439 ASN A N    2  
ATOM   2861  C  CA   . ASN A 1 82  ? 6.487   -5.827  28.992  1.00 0.00 ? 439 ASN A CA   2  
ATOM   2862  C  C    . ASN A 1 82  ? 5.158   -6.425  28.541  1.00 0.00 ? 439 ASN A C    2  
ATOM   2863  O  O    . ASN A 1 82  ? 4.106   -5.799  28.675  1.00 0.00 ? 439 ASN A O    2  
ATOM   2864  C  CB   . ASN A 1 82  ? 6.297   -4.354  29.360  1.00 0.00 ? 439 ASN A CB   2  
ATOM   2865  C  CG   . ASN A 1 82  ? 7.579   -3.711  29.852  1.00 0.00 ? 439 ASN A CG   2  
ATOM   2866  O  OD1  . ASN A 1 82  ? 8.171   -2.876  29.167  1.00 0.00 ? 439 ASN A OD1  2  
ATOM   2867  N  ND2  . ASN A 1 82  ? 8.015   -4.098  31.045  1.00 0.00 ? 439 ASN A ND2  2  
ATOM   2868  H  H    . ASN A 1 82  ? 8.323   -6.453  28.144  1.00 0.00 ? 439 ASN A H    2  
ATOM   2869  H  HA   . ASN A 1 82  ? 6.834   -6.364  29.861  1.00 0.00 ? 439 ASN A HA   2  
ATOM   2870  H  HB2  . ASN A 1 82  ? 5.957   -3.812  28.489  1.00 0.00 ? 439 ASN A HB2  2  
ATOM   2871  H  HB3  . ASN A 1 82  ? 5.554   -4.276  30.140  1.00 0.00 ? 439 ASN A HB3  2  
ATOM   2872  H  HD21 . ASN A 1 82  ? 7.492   -4.767  31.535  1.00 0.00 ? 439 ASN A HD21 2  
ATOM   2873  H  HD22 . ASN A 1 82  ? 8.841   -3.697  31.388  1.00 0.00 ? 439 ASN A HD22 2  
ATOM   2874  N  N    . ARG A 1 83  ? 5.214   -7.641  28.008  1.00 0.00 ? 440 ARG A N    2  
ATOM   2875  C  CA   . ARG A 1 83  ? 4.015   -8.324  27.537  1.00 0.00 ? 440 ARG A CA   2  
ATOM   2876  C  C    . ARG A 1 83  ? 3.467   -9.262  28.609  1.00 0.00 ? 440 ARG A C    2  
ATOM   2877  O  O    . ARG A 1 83  ? 4.151   -9.573  29.584  1.00 0.00 ? 440 ARG A O    2  
ATOM   2878  C  CB   . ARG A 1 83  ? 4.319   -9.113  26.262  1.00 0.00 ? 440 ARG A CB   2  
ATOM   2879  C  CG   . ARG A 1 83  ? 4.109   -8.313  24.987  1.00 0.00 ? 440 ARG A CG   2  
ATOM   2880  C  CD   . ARG A 1 83  ? 4.510   -9.111  23.756  1.00 0.00 ? 440 ARG A CD   2  
ATOM   2881  N  NE   . ARG A 1 83  ? 4.069   -8.470  22.520  1.00 0.00 ? 440 ARG A NE   2  
ATOM   2882  C  CZ   . ARG A 1 83  ? 4.134   -9.051  21.327  1.00 0.00 ? 440 ARG A CZ   2  
ATOM   2883  N  NH1  . ARG A 1 83  ? 4.619   -10.279 21.209  1.00 0.00 ? 440 ARG A NH1  2  
ATOM   2884  N  NH2  . ARG A 1 83  ? 3.712   -8.403  20.248  1.00 0.00 ? 440 ARG A NH2  2  
ATOM   2885  H  H    . ARG A 1 83  ? 6.082   -8.089  27.928  1.00 0.00 ? 440 ARG A H    2  
ATOM   2886  H  HA   . ARG A 1 83  ? 3.270   -7.574  27.317  1.00 0.00 ? 440 ARG A HA   2  
ATOM   2887  H  HB2  . ARG A 1 83  ? 5.348   -9.439  26.291  1.00 0.00 ? 440 ARG A HB2  2  
ATOM   2888  H  HB3  . ARG A 1 83  ? 3.676   -9.979  26.227  1.00 0.00 ? 440 ARG A HB3  2  
ATOM   2889  H  HG2  . ARG A 1 83  ? 3.065   -8.048  24.906  1.00 0.00 ? 440 ARG A HG2  2  
ATOM   2890  H  HG3  . ARG A 1 83  ? 4.708   -7.415  25.034  1.00 0.00 ? 440 ARG A HG3  2  
ATOM   2891  H  HD2  . ARG A 1 83  ? 5.586   -9.204  23.738  1.00 0.00 ? 440 ARG A HD2  2  
ATOM   2892  H  HD3  . ARG A 1 83  ? 4.066   -10.093 23.820  1.00 0.00 ? 440 ARG A HD3  2  
ATOM   2893  H  HE   . ARG A 1 83  ? 3.707   -7.562  22.584  1.00 0.00 ? 440 ARG A HE   2  
ATOM   2894  H  HH11 . ARG A 1 83  ? 4.937   -10.770 22.020  1.00 0.00 ? 440 ARG A HH11 2  
ATOM   2895  H  HH12 . ARG A 1 83  ? 4.666   -10.714 20.310  1.00 0.00 ? 440 ARG A HH12 2  
ATOM   2896  H  HH21 . ARG A 1 83  ? 3.346   -7.477  20.333  1.00 0.00 ? 440 ARG A HH21 2  
ATOM   2897  H  HH22 . ARG A 1 83  ? 3.762   -8.840  19.351  1.00 0.00 ? 440 ARG A HH22 2  
ATOM   2898  N  N    . SER A 1 84  ? 2.229   -9.709  28.421  1.00 0.00 ? 441 SER A N    2  
ATOM   2899  C  CA   . SER A 1 84  ? 1.588   -10.607 29.374  1.00 0.00 ? 441 SER A CA   2  
ATOM   2900  C  C    . SER A 1 84  ? 1.717   -12.059 28.923  1.00 0.00 ? 441 SER A C    2  
ATOM   2901  O  O    . SER A 1 84  ? 1.795   -12.345 27.728  1.00 0.00 ? 441 SER A O    2  
ATOM   2902  C  CB   . SER A 1 84  ? 0.112   -10.241 29.538  1.00 0.00 ? 441 SER A CB   2  
ATOM   2903  O  OG   . SER A 1 84  ? -0.594  -10.410 28.320  1.00 0.00 ? 441 SER A OG   2  
ATOM   2904  H  H    . SER A 1 84  ? 1.735   -9.425  27.624  1.00 0.00 ? 441 SER A H    2  
ATOM   2905  H  HA   . SER A 1 84  ? 2.086   -10.493 30.325  1.00 0.00 ? 441 SER A HA   2  
ATOM   2906  H  HB2  . SER A 1 84  ? -0.333  -10.877 30.288  1.00 0.00 ? 441 SER A HB2  2  
ATOM   2907  H  HB3  . SER A 1 84  ? 0.032   -9.209  29.847  1.00 0.00 ? 441 SER A HB3  2  
ATOM   2908  H  HG   . SER A 1 84  ? -0.773  -11.342 28.180  1.00 0.00 ? 441 SER A HG   2  
ATOM   2909  N  N    . PHE A 1 85  ? 1.738   -12.972 29.888  1.00 0.00 ? 442 PHE A N    2  
ATOM   2910  C  CA   . PHE A 1 85  ? 1.858   -14.395 29.592  1.00 0.00 ? 442 PHE A CA   2  
ATOM   2911  C  C    . PHE A 1 85  ? 0.897   -15.212 30.450  1.00 0.00 ? 442 PHE A C    2  
ATOM   2912  O  O    . PHE A 1 85  ? 0.265   -14.686 31.366  1.00 0.00 ? 442 PHE A O    2  
ATOM   2913  C  CB   . PHE A 1 85  ? 3.295   -14.866 29.825  1.00 0.00 ? 442 PHE A CB   2  
ATOM   2914  C  CG   . PHE A 1 85  ? 4.269   -14.348 28.806  1.00 0.00 ? 442 PHE A CG   2  
ATOM   2915  C  CD1  . PHE A 1 85  ? 4.257   -14.833 27.508  1.00 0.00 ? 442 PHE A CD1  2  
ATOM   2916  C  CD2  . PHE A 1 85  ? 5.196   -13.376 29.146  1.00 0.00 ? 442 PHE A CD2  2  
ATOM   2917  C  CE1  . PHE A 1 85  ? 5.152   -14.358 26.567  1.00 0.00 ? 442 PHE A CE1  2  
ATOM   2918  C  CE2  . PHE A 1 85  ? 6.093   -12.897 28.210  1.00 0.00 ? 442 PHE A CE2  2  
ATOM   2919  C  CZ   . PHE A 1 85  ? 6.071   -13.389 26.919  1.00 0.00 ? 442 PHE A CZ   2  
ATOM   2920  H  H    . PHE A 1 85  ? 1.671   -12.682 30.822  1.00 0.00 ? 442 PHE A H    2  
ATOM   2921  H  HA   . PHE A 1 85  ? 1.605   -14.539 28.553  1.00 0.00 ? 442 PHE A HA   2  
ATOM   2922  H  HB2  . PHE A 1 85  ? 3.623   -14.531 30.797  1.00 0.00 ? 442 PHE A HB2  2  
ATOM   2923  H  HB3  . PHE A 1 85  ? 3.322   -15.945 29.793  1.00 0.00 ? 442 PHE A HB3  2  
ATOM   2924  H  HD1  . PHE A 1 85  ? 3.538   -15.591 27.232  1.00 0.00 ? 442 PHE A HD1  2  
ATOM   2925  H  HD2  . PHE A 1 85  ? 5.215   -12.991 30.155  1.00 0.00 ? 442 PHE A HD2  2  
ATOM   2926  H  HE1  . PHE A 1 85  ? 5.132   -14.745 25.559  1.00 0.00 ? 442 PHE A HE1  2  
ATOM   2927  H  HE2  . PHE A 1 85  ? 6.811   -12.140 28.487  1.00 0.00 ? 442 PHE A HE2  2  
ATOM   2928  H  HZ   . PHE A 1 85  ? 6.771   -13.016 26.186  1.00 0.00 ? 442 PHE A HZ   2  
ATOM   2929  N  N    . SER A 1 86  ? 0.792   -16.502 30.146  1.00 0.00 ? 443 SER A N    2  
ATOM   2930  C  CA   . SER A 1 86  ? -0.095  -17.392 30.886  1.00 0.00 ? 443 SER A CA   2  
ATOM   2931  C  C    . SER A 1 86  ? 0.694   -18.248 31.872  1.00 0.00 ? 443 SER A C    2  
ATOM   2932  O  O    . SER A 1 86  ? 0.246   -18.498 32.991  1.00 0.00 ? 443 SER A O    2  
ATOM   2933  C  CB   . SER A 1 86  ? -0.872  -18.290 29.921  1.00 0.00 ? 443 SER A CB   2  
ATOM   2934  O  OG   . SER A 1 86  ? -1.975  -17.601 29.359  1.00 0.00 ? 443 SER A OG   2  
ATOM   2935  H  H    . SER A 1 86  ? 1.322   -16.863 29.404  1.00 0.00 ? 443 SER A H    2  
ATOM   2936  H  HA   . SER A 1 86  ? -0.793  -16.781 31.437  1.00 0.00 ? 443 SER A HA   2  
ATOM   2937  H  HB2  . SER A 1 86  ? -0.217  -18.609 29.124  1.00 0.00 ? 443 SER A HB2  2  
ATOM   2938  H  HB3  . SER A 1 86  ? -1.237  -19.156 30.455  1.00 0.00 ? 443 SER A HB3  2  
ATOM   2939  H  HG   . SER A 1 86  ? -1.918  -17.632 28.401  1.00 0.00 ? 443 SER A HG   2  
ATOM   2940  N  N    . ARG A 1 87  ? 1.872   -18.695 31.448  1.00 0.00 ? 444 ARG A N    2  
ATOM   2941  C  CA   . ARG A 1 87  ? 2.724   -19.524 32.292  1.00 0.00 ? 444 ARG A CA   2  
ATOM   2942  C  C    . ARG A 1 87  ? 4.088   -18.872 32.495  1.00 0.00 ? 444 ARG A C    2  
ATOM   2943  O  O    . ARG A 1 87  ? 4.394   -17.848 31.885  1.00 0.00 ? 444 ARG A O    2  
ATOM   2944  C  CB   . ARG A 1 87  ? 2.897   -20.912 31.671  1.00 0.00 ? 444 ARG A CB   2  
ATOM   2945  C  CG   . ARG A 1 87  ? 1.617   -21.731 31.643  1.00 0.00 ? 444 ARG A CG   2  
ATOM   2946  C  CD   . ARG A 1 87  ? 1.401   -22.472 32.953  1.00 0.00 ? 444 ARG A CD   2  
ATOM   2947  N  NE   . ARG A 1 87  ? 0.969   -21.576 34.023  1.00 0.00 ? 444 ARG A NE   2  
ATOM   2948  C  CZ   . ARG A 1 87  ? 0.926   -21.929 35.303  1.00 0.00 ? 444 ARG A CZ   2  
ATOM   2949  N  NH1  . ARG A 1 87  ? 1.287   -23.150 35.671  1.00 0.00 ? 444 ARG A NH1  2  
ATOM   2950  N  NH2  . ARG A 1 87  ? 0.523   -21.057 36.219  1.00 0.00 ? 444 ARG A NH2  2  
ATOM   2951  H  H    . ARG A 1 87  ? 2.175   -18.462 30.545  1.00 0.00 ? 444 ARG A H    2  
ATOM   2952  H  HA   . ARG A 1 87  ? 2.240   -19.627 33.252  1.00 0.00 ? 444 ARG A HA   2  
ATOM   2953  H  HB2  . ARG A 1 87  ? 3.248   -20.798 30.656  1.00 0.00 ? 444 ARG A HB2  2  
ATOM   2954  H  HB3  . ARG A 1 87  ? 3.635   -21.457 32.239  1.00 0.00 ? 444 ARG A HB3  2  
ATOM   2955  H  HG2  . ARG A 1 87  ? 0.780   -21.069 31.474  1.00 0.00 ? 444 ARG A HG2  2  
ATOM   2956  H  HG3  . ARG A 1 87  ? 1.678   -22.449 30.839  1.00 0.00 ? 444 ARG A HG3  2  
ATOM   2957  H  HD2  . ARG A 1 87  ? 0.645   -23.228 32.803  1.00 0.00 ? 444 ARG A HD2  2  
ATOM   2958  H  HD3  . ARG A 1 87  ? 2.328   -22.943 33.242  1.00 0.00 ? 444 ARG A HD3  2  
ATOM   2959  H  HE   . ARG A 1 87  ? 0.699   -20.669 33.774  1.00 0.00 ? 444 ARG A HE   2  
ATOM   2960  H  HH11 . ARG A 1 87  ? 1.592   -23.809 34.983  1.00 0.00 ? 444 ARG A HH11 2  
ATOM   2961  H  HH12 . ARG A 1 87  ? 1.255   -23.413 36.635  1.00 0.00 ? 444 ARG A HH12 2  
ATOM   2962  H  HH21 . ARG A 1 87  ? 0.250   -20.135 35.946  1.00 0.00 ? 444 ARG A HH21 2  
ATOM   2963  H  HH22 . ARG A 1 87  ? 0.490   -21.323 37.182  1.00 0.00 ? 444 ARG A HH22 2  
ATOM   2964  N  N    . SER A 1 88  ? 4.903   -19.473 33.356  1.00 0.00 ? 445 SER A N    2  
ATOM   2965  C  CA   . SER A 1 88  ? 6.233   -18.948 33.643  1.00 0.00 ? 445 SER A CA   2  
ATOM   2966  C  C    . SER A 1 88  ? 7.260   -19.504 32.661  1.00 0.00 ? 445 SER A C    2  
ATOM   2967  O  O    . SER A 1 88  ? 8.365   -18.976 32.536  1.00 0.00 ? 445 SER A O    2  
ATOM   2968  C  CB   . SER A 1 88  ? 6.642   -19.294 35.076  1.00 0.00 ? 445 SER A CB   2  
ATOM   2969  O  OG   . SER A 1 88  ? 6.659   -20.697 35.277  1.00 0.00 ? 445 SER A OG   2  
ATOM   2970  H  H    . SER A 1 88  ? 4.601   -20.287 33.811  1.00 0.00 ? 445 SER A H    2  
ATOM   2971  H  HA   . SER A 1 88  ? 6.196   -17.874 33.537  1.00 0.00 ? 445 SER A HA   2  
ATOM   2972  H  HB2  . SER A 1 88  ? 7.630   -18.903 35.270  1.00 0.00 ? 445 SER A HB2  2  
ATOM   2973  H  HB3  . SER A 1 88  ? 5.938   -18.851 35.765  1.00 0.00 ? 445 SER A HB3  2  
ATOM   2974  H  HG   . SER A 1 88  ? 7.508   -21.050 34.999  1.00 0.00 ? 445 SER A HG   2  
ATOM   2975  N  N    . ASP A 1 89  ? 6.886   -20.572 31.966  1.00 0.00 ? 446 ASP A N    2  
ATOM   2976  C  CA   . ASP A 1 89  ? 7.773   -21.200 30.993  1.00 0.00 ? 446 ASP A CA   2  
ATOM   2977  C  C    . ASP A 1 89  ? 7.750   -20.444 29.669  1.00 0.00 ? 446 ASP A C    2  
ATOM   2978  O  O    . ASP A 1 89  ? 8.747   -20.401 28.948  1.00 0.00 ? 446 ASP A O    2  
ATOM   2979  C  CB   . ASP A 1 89  ? 7.369   -22.658 30.769  1.00 0.00 ? 446 ASP A CB   2  
ATOM   2980  C  CG   . ASP A 1 89  ? 5.888   -22.810 30.480  1.00 0.00 ? 446 ASP A CG   2  
ATOM   2981  O  OD1  . ASP A 1 89  ? 5.451   -22.396 29.385  1.00 0.00 ? 446 ASP A OD1  2  
ATOM   2982  O  OD2  . ASP A 1 89  ? 5.166   -23.345 31.347  1.00 0.00 ? 446 ASP A OD2  2  
ATOM   2983  H  H    . ASP A 1 89  ? 5.992   -20.947 32.110  1.00 0.00 ? 446 ASP A H    2  
ATOM   2984  H  HA   . ASP A 1 89  ? 8.776   -21.172 31.392  1.00 0.00 ? 446 ASP A HA   2  
ATOM   2985  H  HB2  . ASP A 1 89  ? 7.923   -23.054 29.930  1.00 0.00 ? 446 ASP A HB2  2  
ATOM   2986  H  HB3  . ASP A 1 89  ? 7.605   -23.231 31.654  1.00 0.00 ? 446 ASP A HB3  2  
ATOM   2987  N  N    . HIS A 1 90  ? 6.604   -19.848 29.353  1.00 0.00 ? 447 HIS A N    2  
ATOM   2988  C  CA   . HIS A 1 90  ? 6.450   -19.094 28.114  1.00 0.00 ? 447 HIS A CA   2  
ATOM   2989  C  C    . HIS A 1 90  ? 7.198   -17.766 28.191  1.00 0.00 ? 447 HIS A C    2  
ATOM   2990  O  O    . HIS A 1 90  ? 7.822   -17.336 27.220  1.00 0.00 ? 447 HIS A O    2  
ATOM   2991  C  CB   . HIS A 1 90  ? 4.970   -18.843 27.825  1.00 0.00 ? 447 HIS A CB   2  
ATOM   2992  C  CG   . HIS A 1 90  ? 4.166   -20.099 27.685  1.00 0.00 ? 447 HIS A CG   2  
ATOM   2993  N  ND1  . HIS A 1 90  ? 2.872   -20.219 28.147  1.00 0.00 ? 447 HIS A ND1  2  
ATOM   2994  C  CD2  . HIS A 1 90  ? 4.478   -21.292 27.128  1.00 0.00 ? 447 HIS A CD2  2  
ATOM   2995  C  CE1  . HIS A 1 90  ? 2.424   -21.434 27.882  1.00 0.00 ? 447 HIS A CE1  2  
ATOM   2996  N  NE2  . HIS A 1 90  ? 3.379   -22.105 27.264  1.00 0.00 ? 447 HIS A NE2  2  
ATOM   2997  H  H    . HIS A 1 90  ? 5.844   -19.918 29.967  1.00 0.00 ? 447 HIS A H    2  
ATOM   2998  H  HA   . HIS A 1 90  ? 6.869   -19.683 27.313  1.00 0.00 ? 447 HIS A HA   2  
ATOM   2999  H  HB2  . HIS A 1 90  ? 4.545   -18.266 28.634  1.00 0.00 ? 447 HIS A HB2  2  
ATOM   3000  H  HB3  . HIS A 1 90  ? 4.879   -18.285 26.905  1.00 0.00 ? 447 HIS A HB3  2  
ATOM   3001  H  HD1  . HIS A 1 90  ? 2.360   -19.520 28.603  1.00 0.00 ? 447 HIS A HD1  2  
ATOM   3002  H  HD2  . HIS A 1 90  ? 5.417   -21.557 26.663  1.00 0.00 ? 447 HIS A HD2  2  
ATOM   3003  H  HE1  . HIS A 1 90  ? 1.444   -21.814 28.128  1.00 0.00 ? 447 HIS A HE1  2  
ATOM   3004  N  N    . LEU A 1 91  ? 7.130   -17.121 29.350  1.00 0.00 ? 448 LEU A N    2  
ATOM   3005  C  CA   . LEU A 1 91  ? 7.800   -15.841 29.553  1.00 0.00 ? 448 LEU A CA   2  
ATOM   3006  C  C    . LEU A 1 91  ? 9.315   -16.002 29.480  1.00 0.00 ? 448 LEU A C    2  
ATOM   3007  O  O    . LEU A 1 91  ? 10.013  -15.155 28.921  1.00 0.00 ? 448 LEU A O    2  
ATOM   3008  C  CB   . LEU A 1 91  ? 7.404   -15.245 30.905  1.00 0.00 ? 448 LEU A CB   2  
ATOM   3009  C  CG   . LEU A 1 91  ? 8.311   -14.136 31.441  1.00 0.00 ? 448 LEU A CG   2  
ATOM   3010  C  CD1  . LEU A 1 91  ? 8.191   -12.887 30.581  1.00 0.00 ? 448 LEU A CD1  2  
ATOM   3011  C  CD2  . LEU A 1 91  ? 7.970   -13.822 32.891  1.00 0.00 ? 448 LEU A CD2  2  
ATOM   3012  H  H    . LEU A 1 91  ? 6.618   -17.513 30.087  1.00 0.00 ? 448 LEU A H    2  
ATOM   3013  H  HA   . LEU A 1 91  ? 7.483   -15.172 28.767  1.00 0.00 ? 448 LEU A HA   2  
ATOM   3014  H  HB2  . LEU A 1 91  ? 6.409   -14.840 30.810  1.00 0.00 ? 448 LEU A HB2  2  
ATOM   3015  H  HB3  . LEU A 1 91  ? 7.397   -16.047 31.630  1.00 0.00 ? 448 LEU A HB3  2  
ATOM   3016  H  HG   . LEU A 1 91  ? 9.338   -14.470 31.403  1.00 0.00 ? 448 LEU A HG   2  
ATOM   3017  H  HD11 . LEU A 1 91  ? 7.277   -12.367 30.826  1.00 0.00 ? 448 LEU A HD11 2  
ATOM   3018  H  HD12 . LEU A 1 91  ? 8.177   -13.168 29.539  1.00 0.00 ? 448 LEU A HD12 2  
ATOM   3019  H  HD13 . LEU A 1 91  ? 9.036   -12.240 30.768  1.00 0.00 ? 448 LEU A HD13 2  
ATOM   3020  H  HD21 . LEU A 1 91  ? 8.589   -13.009 33.238  1.00 0.00 ? 448 LEU A HD21 2  
ATOM   3021  H  HD22 . LEU A 1 91  ? 8.148   -14.696 33.499  1.00 0.00 ? 448 LEU A HD22 2  
ATOM   3022  H  HD23 . LEU A 1 91  ? 6.929   -13.540 32.962  1.00 0.00 ? 448 LEU A HD23 2  
ATOM   3023  N  N    . ALA A 1 92  ? 9.817   -17.095 30.045  1.00 0.00 ? 449 ALA A N    2  
ATOM   3024  C  CA   . ALA A 1 92  ? 11.249  -17.369 30.039  1.00 0.00 ? 449 ALA A CA   2  
ATOM   3025  C  C    . ALA A 1 92  ? 11.742  -17.682 28.631  1.00 0.00 ? 449 ALA A C    2  
ATOM   3026  O  O    . ALA A 1 92  ? 12.660  -17.035 28.125  1.00 0.00 ? 449 ALA A O    2  
ATOM   3027  C  CB   . ALA A 1 92  ? 11.570  -18.520 30.981  1.00 0.00 ? 449 ALA A CB   2  
ATOM   3028  H  H    . ALA A 1 92  ? 9.210   -17.733 30.474  1.00 0.00 ? 449 ALA A H    2  
ATOM   3029  H  HA   . ALA A 1 92  ? 11.759  -16.487 30.401  1.00 0.00 ? 449 ALA A HA   2  
ATOM   3030  H  HB1  . ALA A 1 92  ? 12.038  -18.134 31.874  1.00 0.00 ? 449 ALA A HB1  2  
ATOM   3031  H  HB2  . ALA A 1 92  ? 10.656  -19.032 31.246  1.00 0.00 ? 449 ALA A HB2  2  
ATOM   3032  H  HB3  . ALA A 1 92  ? 12.241  -19.209 30.492  1.00 0.00 ? 449 ALA A HB3  2  
ATOM   3033  N  N    . LEU A 1 93  ? 11.129  -18.679 28.002  1.00 0.00 ? 450 LEU A N    2  
ATOM   3034  C  CA   . LEU A 1 93  ? 11.506  -19.079 26.651  1.00 0.00 ? 450 LEU A CA   2  
ATOM   3035  C  C    . LEU A 1 93  ? 11.386  -17.907 25.683  1.00 0.00 ? 450 LEU A C    2  
ATOM   3036  O  O    . LEU A 1 93  ? 12.035  -17.884 24.636  1.00 0.00 ? 450 LEU A O    2  
ATOM   3037  C  CB   . LEU A 1 93  ? 10.628  -20.239 26.178  1.00 0.00 ? 450 LEU A CB   2  
ATOM   3038  C  CG   . LEU A 1 93  ? 11.187  -21.077 25.027  1.00 0.00 ? 450 LEU A CG   2  
ATOM   3039  C  CD1  . LEU A 1 93  ? 12.155  -22.126 25.552  1.00 0.00 ? 450 LEU A CD1  2  
ATOM   3040  C  CD2  . LEU A 1 93  ? 10.057  -21.734 24.248  1.00 0.00 ? 450 LEU A CD2  2  
ATOM   3041  H  H    . LEU A 1 93  ? 10.404  -19.157 28.456  1.00 0.00 ? 450 LEU A H    2  
ATOM   3042  H  HA   . LEU A 1 93  ? 12.535  -19.405 26.678  1.00 0.00 ? 450 LEU A HA   2  
ATOM   3043  H  HB2  . LEU A 1 93  ? 10.468  -20.896 27.018  1.00 0.00 ? 450 LEU A HB2  2  
ATOM   3044  H  HB3  . LEU A 1 93  ? 9.681   -19.827 25.859  1.00 0.00 ? 450 LEU A HB3  2  
ATOM   3045  H  HG   . LEU A 1 93  ? 11.730  -20.432 24.350  1.00 0.00 ? 450 LEU A HG   2  
ATOM   3046  H  HD11 . LEU A 1 93  ? 11.919  -22.350 26.581  1.00 0.00 ? 450 LEU A HD11 2  
ATOM   3047  H  HD12 . LEU A 1 93  ? 13.165  -21.748 25.488  1.00 0.00 ? 450 LEU A HD12 2  
ATOM   3048  H  HD13 . LEU A 1 93  ? 12.069  -23.024 24.958  1.00 0.00 ? 450 LEU A HD13 2  
ATOM   3049  H  HD21 . LEU A 1 93  ? 10.222  -21.597 23.190  1.00 0.00 ? 450 LEU A HD21 2  
ATOM   3050  H  HD22 . LEU A 1 93  ? 9.117   -21.281 24.528  1.00 0.00 ? 450 LEU A HD22 2  
ATOM   3051  H  HD23 . LEU A 1 93  ? 10.029  -22.790 24.475  1.00 0.00 ? 450 LEU A HD23 2  
ATOM   3052  N  N    . HIS A 1 94  ? 10.553  -16.934 26.039  1.00 0.00 ? 451 HIS A N    2  
ATOM   3053  C  CA   . HIS A 1 94  ? 10.350  -15.757 25.202  1.00 0.00 ? 451 HIS A CA   2  
ATOM   3054  C  C    . HIS A 1 94  ? 11.410  -14.697 25.489  1.00 0.00 ? 451 HIS A C    2  
ATOM   3055  O  O    . HIS A 1 94  ? 11.973  -14.104 24.569  1.00 0.00 ? 451 HIS A O    2  
ATOM   3056  C  CB   . HIS A 1 94  ? 8.956   -15.175 25.434  1.00 0.00 ? 451 HIS A CB   2  
ATOM   3057  C  CG   . HIS A 1 94  ? 8.853   -13.717 25.107  1.00 0.00 ? 451 HIS A CG   2  
ATOM   3058  N  ND1  . HIS A 1 94  ? 8.291   -13.245 23.939  1.00 0.00 ? 451 HIS A ND1  2  
ATOM   3059  C  CD2  . HIS A 1 94  ? 9.243   -12.624 25.804  1.00 0.00 ? 451 HIS A CD2  2  
ATOM   3060  C  CE1  . HIS A 1 94  ? 8.342   -11.925 23.931  1.00 0.00 ? 451 HIS A CE1  2  
ATOM   3061  N  NE2  . HIS A 1 94  ? 8.914   -11.523 25.052  1.00 0.00 ? 451 HIS A NE2  2  
ATOM   3062  H  H    . HIS A 1 94  ? 10.064  -17.010 26.884  1.00 0.00 ? 451 HIS A H    2  
ATOM   3063  H  HA   . HIS A 1 94  ? 10.436  -16.064 24.171  1.00 0.00 ? 451 HIS A HA   2  
ATOM   3064  H  HB2  . HIS A 1 94  ? 8.245   -15.704 24.815  1.00 0.00 ? 451 HIS A HB2  2  
ATOM   3065  H  HB3  . HIS A 1 94  ? 8.687   -15.303 26.472  1.00 0.00 ? 451 HIS A HB3  2  
ATOM   3066  H  HD1  . HIS A 1 94  ? 7.914   -13.796 23.222  1.00 0.00 ? 451 HIS A HD1  2  
ATOM   3067  H  HD2  . HIS A 1 94  ? 9.723   -12.618 26.772  1.00 0.00 ? 451 HIS A HD2  2  
ATOM   3068  H  HE1  . HIS A 1 94  ? 7.977   -11.283 23.144  1.00 0.00 ? 451 HIS A HE1  2  
ATOM   3069  N  N    . MET A 1 95  ? 11.676  -14.464 26.770  1.00 0.00 ? 452 MET A N    2  
ATOM   3070  C  CA   . MET A 1 95  ? 12.669  -13.477 27.177  1.00 0.00 ? 452 MET A CA   2  
ATOM   3071  C  C    . MET A 1 95  ? 13.929  -13.589 26.325  1.00 0.00 ? 452 MET A C    2  
ATOM   3072  O  O    . MET A 1 95  ? 14.360  -12.617 25.705  1.00 0.00 ? 452 MET A O    2  
ATOM   3073  C  CB   . MET A 1 95  ? 13.021  -13.655 28.655  1.00 0.00 ? 452 MET A CB   2  
ATOM   3074  C  CG   . MET A 1 95  ? 12.069  -12.936 29.598  1.00 0.00 ? 452 MET A CG   2  
ATOM   3075  S  SD   . MET A 1 95  ? 12.274  -11.145 29.559  1.00 0.00 ? 452 MET A SD   2  
ATOM   3076  C  CE   . MET A 1 95  ? 13.870  -10.970 30.352  1.00 0.00 ? 452 MET A CE   2  
ATOM   3077  H  H    . MET A 1 95  ? 11.194  -14.969 27.459  1.00 0.00 ? 452 MET A H    2  
ATOM   3078  H  HA   . MET A 1 95  ? 12.238  -12.497 27.035  1.00 0.00 ? 452 MET A HA   2  
ATOM   3079  H  HB2  . MET A 1 95  ? 13.002  -14.708 28.893  1.00 0.00 ? 452 MET A HB2  2  
ATOM   3080  H  HB3  . MET A 1 95  ? 14.017  -13.274 28.825  1.00 0.00 ? 452 MET A HB3  2  
ATOM   3081  H  HG2  . MET A 1 95  ? 11.055  -13.174 29.315  1.00 0.00 ? 452 MET A HG2  2  
ATOM   3082  H  HG3  . MET A 1 95  ? 12.251  -13.284 30.604  1.00 0.00 ? 452 MET A HG3  2  
ATOM   3083  H  HE1  . MET A 1 95  ? 14.235  -11.943 30.647  1.00 0.00 ? 452 MET A HE1  2  
ATOM   3084  H  HE2  . MET A 1 95  ? 14.568  -10.518 29.663  1.00 0.00 ? 452 MET A HE2  2  
ATOM   3085  H  HE3  . MET A 1 95  ? 13.770  -10.343 31.226  1.00 0.00 ? 452 MET A HE3  2  
ATOM   3086  N  N    . LYS A 1 96  ? 14.515  -14.781 26.298  1.00 0.00 ? 453 LYS A N    2  
ATOM   3087  C  CA   . LYS A 1 96  ? 15.725  -15.022 25.522  1.00 0.00 ? 453 LYS A CA   2  
ATOM   3088  C  C    . LYS A 1 96  ? 15.462  -14.831 24.031  1.00 0.00 ? 453 LYS A C    2  
ATOM   3089  O  O    . LYS A 1 96  ? 16.369  -14.492 23.270  1.00 0.00 ? 453 LYS A O    2  
ATOM   3090  C  CB   . LYS A 1 96  ? 16.249  -16.436 25.781  1.00 0.00 ? 453 LYS A CB   2  
ATOM   3091  C  CG   . LYS A 1 96  ? 15.302  -17.530 25.320  1.00 0.00 ? 453 LYS A CG   2  
ATOM   3092  C  CD   . LYS A 1 96  ? 15.620  -18.860 25.982  1.00 0.00 ? 453 LYS A CD   2  
ATOM   3093  C  CE   . LYS A 1 96  ? 16.821  -19.532 25.334  1.00 0.00 ? 453 LYS A CE   2  
ATOM   3094  N  NZ   . LYS A 1 96  ? 16.524  -19.979 23.945  1.00 0.00 ? 453 LYS A NZ   2  
ATOM   3095  H  H    . LYS A 1 96  ? 14.123  -15.518 26.814  1.00 0.00 ? 453 LYS A H    2  
ATOM   3096  H  HA   . LYS A 1 96  ? 16.470  -14.308 25.838  1.00 0.00 ? 453 LYS A HA   2  
ATOM   3097  H  HB2  . LYS A 1 96  ? 17.189  -16.560 25.262  1.00 0.00 ? 453 LYS A HB2  2  
ATOM   3098  H  HB3  . LYS A 1 96  ? 16.416  -16.557 26.841  1.00 0.00 ? 453 LYS A HB3  2  
ATOM   3099  H  HG2  . LYS A 1 96  ? 14.290  -17.248 25.572  1.00 0.00 ? 453 LYS A HG2  2  
ATOM   3100  H  HG3  . LYS A 1 96  ? 15.389  -17.642 24.248  1.00 0.00 ? 453 LYS A HG3  2  
ATOM   3101  H  HD2  . LYS A 1 96  ? 15.838  -18.689 27.026  1.00 0.00 ? 453 LYS A HD2  2  
ATOM   3102  H  HD3  . LYS A 1 96  ? 14.762  -19.511 25.893  1.00 0.00 ? 453 LYS A HD3  2  
ATOM   3103  H  HE2  . LYS A 1 96  ? 17.640  -18.830 25.310  1.00 0.00 ? 453 LYS A HE2  2  
ATOM   3104  H  HE3  . LYS A 1 96  ? 17.100  -20.390 25.928  1.00 0.00 ? 453 LYS A HE3  2  
ATOM   3105  H  HZ1  . LYS A 1 96  ? 17.003  -19.360 23.260  1.00 0.00 ? 453 LYS A HZ1  2  
ATOM   3106  H  HZ2  . LYS A 1 96  ? 15.499  -19.944 23.771  1.00 0.00 ? 453 LYS A HZ2  2  
ATOM   3107  H  HZ3  . LYS A 1 96  ? 16.855  -20.955 23.806  1.00 0.00 ? 453 LYS A HZ3  2  
ATOM   3108  N  N    . ARG A 1 97  ? 14.217  -15.049 23.622  1.00 0.00 ? 454 ARG A N    2  
ATOM   3109  C  CA   . ARG A 1 97  ? 13.835  -14.901 22.223  1.00 0.00 ? 454 ARG A CA   2  
ATOM   3110  C  C    . ARG A 1 97  ? 14.103  -13.480 21.734  1.00 0.00 ? 454 ARG A C    2  
ATOM   3111  O  O    . ARG A 1 97  ? 14.453  -13.268 20.573  1.00 0.00 ? 454 ARG A O    2  
ATOM   3112  C  CB   . ARG A 1 97  ? 12.357  -15.245 22.036  1.00 0.00 ? 454 ARG A CB   2  
ATOM   3113  C  CG   . ARG A 1 97  ? 11.972  -15.516 20.590  1.00 0.00 ? 454 ARG A CG   2  
ATOM   3114  C  CD   . ARG A 1 97  ? 12.579  -16.816 20.087  1.00 0.00 ? 454 ARG A CD   2  
ATOM   3115  N  NE   . ARG A 1 97  ? 12.317  -17.027 18.666  1.00 0.00 ? 454 ARG A NE   2  
ATOM   3116  C  CZ   . ARG A 1 97  ? 12.819  -18.041 17.969  1.00 0.00 ? 454 ARG A CZ   2  
ATOM   3117  N  NH1  . ARG A 1 97  ? 13.605  -18.930 18.559  1.00 0.00 ? 454 ARG A NH1  2  
ATOM   3118  N  NH2  . ARG A 1 97  ? 12.535  -18.166 16.678  1.00 0.00 ? 454 ARG A NH2  2  
ATOM   3119  H  H    . ARG A 1 97  ? 13.538  -15.317 24.276  1.00 0.00 ? 454 ARG A H    2  
ATOM   3120  H  HA   . ARG A 1 97  ? 14.432  -15.587 21.641  1.00 0.00 ? 454 ARG A HA   2  
ATOM   3121  H  HB2  . ARG A 1 97  ? 12.128  -16.127 22.617  1.00 0.00 ? 454 ARG A HB2  2  
ATOM   3122  H  HB3  . ARG A 1 97  ? 11.759  -14.421 22.396  1.00 0.00 ? 454 ARG A HB3  2  
ATOM   3123  H  HG2  . ARG A 1 97  ? 10.897  -15.582 20.520  1.00 0.00 ? 454 ARG A HG2  2  
ATOM   3124  H  HG3  . ARG A 1 97  ? 12.325  -14.701 19.976  1.00 0.00 ? 454 ARG A HG3  2  
ATOM   3125  H  HD2  . ARG A 1 97  ? 13.647  -16.784 20.245  1.00 0.00 ? 454 ARG A HD2  2  
ATOM   3126  H  HD3  . ARG A 1 97  ? 12.156  -17.636 20.647  1.00 0.00 ? 454 ARG A HD3  2  
ATOM   3127  H  HE   . ARG A 1 97  ? 11.739  -16.382 18.210  1.00 0.00 ? 454 ARG A HE   2  
ATOM   3128  H  HH11 . ARG A 1 97  ? 13.821  -18.839 19.531  1.00 0.00 ? 454 ARG A HH11 2  
ATOM   3129  H  HH12 . ARG A 1 97  ? 13.981  -19.693 18.032  1.00 0.00 ? 454 ARG A HH12 2  
ATOM   3130  H  HH21 . ARG A 1 97  ? 11.942  -17.497 16.230  1.00 0.00 ? 454 ARG A HH21 2  
ATOM   3131  H  HH22 . ARG A 1 97  ? 12.913  -18.928 16.155  1.00 0.00 ? 454 ARG A HH22 2  
ATOM   3132  N  N    . HIS A 1 98  ? 13.936  -12.511 22.628  1.00 0.00 ? 455 HIS A N    2  
ATOM   3133  C  CA   . HIS A 1 98  ? 14.160  -11.110 22.288  1.00 0.00 ? 455 HIS A CA   2  
ATOM   3134  C  C    . HIS A 1 98  ? 15.452  -10.944 21.494  1.00 0.00 ? 455 HIS A C    2  
ATOM   3135  O  O    . HIS A 1 98  ? 15.476  -10.270 20.464  1.00 0.00 ? 455 HIS A O    2  
ATOM   3136  C  CB   . HIS A 1 98  ? 14.214  -10.258 23.556  1.00 0.00 ? 455 HIS A CB   2  
ATOM   3137  C  CG   . HIS A 1 98  ? 12.868  -9.795  24.024  1.00 0.00 ? 455 HIS A CG   2  
ATOM   3138  N  ND1  . HIS A 1 98  ? 11.873  -9.383  23.164  1.00 0.00 ? 455 HIS A ND1  2  
ATOM   3139  C  CD2  . HIS A 1 98  ? 12.356  -9.683  25.272  1.00 0.00 ? 455 HIS A CD2  2  
ATOM   3140  C  CE1  . HIS A 1 98  ? 10.807  -9.035  23.862  1.00 0.00 ? 455 HIS A CE1  2  
ATOM   3141  N  NE2  . HIS A 1 98  ? 11.073  -9.209  25.144  1.00 0.00 ? 455 HIS A NE2  2  
ATOM   3142  H  H    . HIS A 1 98  ? 13.656  -12.743 23.538  1.00 0.00 ? 455 HIS A H    2  
ATOM   3143  H  HA   . HIS A 1 98  ? 13.333  -10.781 21.678  1.00 0.00 ? 455 HIS A HA   2  
ATOM   3144  H  HB2  . HIS A 1 98  ? 14.661  -10.836 24.352  1.00 0.00 ? 455 HIS A HB2  2  
ATOM   3145  H  HB3  . HIS A 1 98  ? 14.820  -9.383  23.369  1.00 0.00 ? 455 HIS A HB3  2  
ATOM   3146  H  HD1  . HIS A 1 98  ? 11.939  -9.349  22.187  1.00 0.00 ? 455 HIS A HD1  2  
ATOM   3147  H  HD2  . HIS A 1 98  ? 12.861  -9.921  26.198  1.00 0.00 ? 455 HIS A HD2  2  
ATOM   3148  H  HE1  . HIS A 1 98  ? 9.875   -8.672  23.455  1.00 0.00 ? 455 HIS A HE1  2  
ATOM   3149  N  N    . GLN A 1 99  ? 16.524  -11.561 21.981  1.00 0.00 ? 456 GLN A N    2  
ATOM   3150  C  CA   . GLN A 1 99  ? 17.819  -11.479 21.316  1.00 0.00 ? 456 GLN A CA   2  
ATOM   3151  C  C    . GLN A 1 99  ? 17.689  -11.790 19.829  1.00 0.00 ? 456 GLN A C    2  
ATOM   3152  O  O    . GLN A 1 99  ? 17.207  -12.855 19.447  1.00 0.00 ? 456 GLN A O    2  
ATOM   3153  C  CB   . GLN A 1 99  ? 18.811  -12.446 21.966  1.00 0.00 ? 456 GLN A CB   2  
ATOM   3154  C  CG   . GLN A 1 99  ? 18.690  -13.874 21.458  1.00 0.00 ? 456 GLN A CG   2  
ATOM   3155  C  CD   . GLN A 1 99  ? 19.503  -14.856 22.279  1.00 0.00 ? 456 GLN A CD   2  
ATOM   3156  O  OE1  . GLN A 1 99  ? 20.548  -15.335 21.839  1.00 0.00 ? 456 GLN A OE1  2  
ATOM   3157  N  NE2  . GLN A 1 99  ? 19.026  -15.160 23.481  1.00 0.00 ? 456 GLN A NE2  2  
ATOM   3158  H  H    . GLN A 1 99  ? 16.442  -12.083 22.805  1.00 0.00 ? 456 GLN A H    2  
ATOM   3159  H  HA   . GLN A 1 99  ? 18.187  -10.471 21.430  1.00 0.00 ? 456 GLN A HA   2  
ATOM   3160  H  HB2  . GLN A 1 99  ? 19.815  -12.100 21.769  1.00 0.00 ? 456 GLN A HB2  2  
ATOM   3161  H  HB3  . GLN A 1 99  ? 18.644  -12.451 23.033  1.00 0.00 ? 456 GLN A HB3  2  
ATOM   3162  H  HG2  . GLN A 1 99  ? 17.653  -14.169 21.496  1.00 0.00 ? 456 GLN A HG2  2  
ATOM   3163  H  HG3  . GLN A 1 99  ? 19.036  -13.909 20.436  1.00 0.00 ? 456 GLN A HG3  2  
ATOM   3164  H  HE21 . GLN A 1 99  ? 18.186  -14.741 23.765  1.00 0.00 ? 456 GLN A HE21 2  
ATOM   3165  H  HE22 . GLN A 1 99  ? 19.530  -15.793 24.032  1.00 0.00 ? 456 GLN A HE22 2  
ATOM   3166  N  N    . ASN A 1 100 ? 18.122  -10.851 18.994  1.00 0.00 ? 457 ASN A N    2  
ATOM   3167  C  CA   . ASN A 1 100 ? 18.052  -11.024 17.547  1.00 0.00 ? 457 ASN A CA   2  
ATOM   3168  C  C    . ASN A 1 100 ? 18.951  -10.017 16.835  1.00 0.00 ? 457 ASN A C    2  
ATOM   3169  O  O    . ASN A 1 100 ? 19.157  -8.904  17.317  1.00 0.00 ? 457 ASN A O    2  
ATOM   3170  C  CB   . ASN A 1 100 ? 16.609  -10.868 17.063  1.00 0.00 ? 457 ASN A CB   2  
ATOM   3171  C  CG   . ASN A 1 100 ? 15.858  -12.185 17.053  1.00 0.00 ? 457 ASN A CG   2  
ATOM   3172  O  OD1  . ASN A 1 100 ? 14.871  -12.355 17.769  1.00 0.00 ? 457 ASN A OD1  2  
ATOM   3173  N  ND2  . ASN A 1 100 ? 16.322  -13.125 16.238  1.00 0.00 ? 457 ASN A ND2  2  
ATOM   3174  H  H    . ASN A 1 100 ? 18.496  -10.022 19.358  1.00 0.00 ? 457 ASN A H    2  
ATOM   3175  H  HA   . ASN A 1 100 ? 18.395  -12.021 17.316  1.00 0.00 ? 457 ASN A HA   2  
ATOM   3176  H  HB2  . ASN A 1 100 ? 16.088  -10.184 17.716  1.00 0.00 ? 457 ASN A HB2  2  
ATOM   3177  H  HB3  . ASN A 1 100 ? 16.613  -10.469 16.060  1.00 0.00 ? 457 ASN A HB3  2  
ATOM   3178  H  HD21 . ASN A 1 100 ? 17.113  -12.920 15.697  1.00 0.00 ? 457 ASN A HD21 2  
ATOM   3179  H  HD22 . ASN A 1 100 ? 15.855  -13.986 16.211  1.00 0.00 ? 457 ASN A HD22 2  
HETATM 3180  ZN ZN   . ZN  B 2 .   ? 15.028  -0.508  10.833  1.00 0.00 ? 100 ZN  A ZN   2  
HETATM 3181  ZN ZN   . ZN  C 2 .   ? -1.116  1.946   27.236  1.00 0.00 ? 200 ZN  A ZN   2  
HETATM 3182  ZN ZN   . ZN  D 2 .   ? 9.324   -9.741  25.982  1.00 0.00 ? 300 ZN  A ZN   2  
ATOM   3183  N  N    . GLY A 1 1   ? 71.182  -2.877  15.372  1.00 0.00 ? 358 GLY A N    3  
ATOM   3184  C  CA   . GLY A 1 1   ? 70.090  -3.086  14.440  1.00 0.00 ? 358 GLY A CA   3  
ATOM   3185  C  C    . GLY A 1 1   ? 68.735  -2.824  15.067  1.00 0.00 ? 358 GLY A C    3  
ATOM   3186  O  O    . GLY A 1 1   ? 68.608  -1.983  15.957  1.00 0.00 ? 358 GLY A O    3  
ATOM   3187  H  H1   . GLY A 1 1   ? 70.991  -2.631  16.302  1.00 0.00 ? 358 GLY A H1   3  
ATOM   3188  H  HA2  . GLY A 1 1   ? 70.219  -2.425  13.597  1.00 0.00 ? 358 GLY A HA2  3  
ATOM   3189  H  HA3  . GLY A 1 1   ? 70.120  -4.108  14.091  1.00 0.00 ? 358 GLY A HA3  3  
ATOM   3190  N  N    . SER A 1 2   ? 67.719  -3.544  14.602  1.00 0.00 ? 359 SER A N    3  
ATOM   3191  C  CA   . SER A 1 2   ? 66.366  -3.381  15.119  1.00 0.00 ? 359 SER A CA   3  
ATOM   3192  C  C    . SER A 1 2   ? 65.989  -4.544  16.032  1.00 0.00 ? 359 SER A C    3  
ATOM   3193  O  O    . SER A 1 2   ? 66.584  -5.619  15.963  1.00 0.00 ? 359 SER A O    3  
ATOM   3194  C  CB   . SER A 1 2   ? 65.365  -3.278  13.966  1.00 0.00 ? 359 SER A CB   3  
ATOM   3195  O  OG   . SER A 1 2   ? 65.634  -2.146  13.157  1.00 0.00 ? 359 SER A OG   3  
ATOM   3196  H  H    . SER A 1 2   ? 67.885  -4.199  13.891  1.00 0.00 ? 359 SER A H    3  
ATOM   3197  H  HA   . SER A 1 2   ? 66.338  -2.465  15.691  1.00 0.00 ? 359 SER A HA   3  
ATOM   3198  H  HB2  . SER A 1 2   ? 65.432  -4.166  13.355  1.00 0.00 ? 359 SER A HB2  3  
ATOM   3199  H  HB3  . SER A 1 2   ? 64.366  -3.191  14.367  1.00 0.00 ? 359 SER A HB3  3  
ATOM   3200  H  HG   . SER A 1 2   ? 66.571  -1.941  13.194  1.00 0.00 ? 359 SER A HG   3  
ATOM   3201  N  N    . SER A 1 3   ? 64.997  -4.319  16.888  1.00 0.00 ? 360 SER A N    3  
ATOM   3202  C  CA   . SER A 1 3   ? 64.543  -5.345  17.818  1.00 0.00 ? 360 SER A CA   3  
ATOM   3203  C  C    . SER A 1 3   ? 63.284  -6.032  17.297  1.00 0.00 ? 360 SER A C    3  
ATOM   3204  O  O    . SER A 1 3   ? 63.267  -7.244  17.083  1.00 0.00 ? 360 SER A O    3  
ATOM   3205  C  CB   . SER A 1 3   ? 64.271  -4.733  19.193  1.00 0.00 ? 360 SER A CB   3  
ATOM   3206  O  OG   . SER A 1 3   ? 64.413  -5.700  20.219  1.00 0.00 ? 360 SER A OG   3  
ATOM   3207  H  H    . SER A 1 3   ? 64.562  -3.440  16.895  1.00 0.00 ? 360 SER A H    3  
ATOM   3208  H  HA   . SER A 1 3   ? 65.328  -6.081  17.910  1.00 0.00 ? 360 SER A HA   3  
ATOM   3209  H  HB2  . SER A 1 3   ? 64.971  -3.931  19.372  1.00 0.00 ? 360 SER A HB2  3  
ATOM   3210  H  HB3  . SER A 1 3   ? 63.263  -4.344  19.218  1.00 0.00 ? 360 SER A HB3  3  
ATOM   3211  H  HG   . SER A 1 3   ? 65.118  -5.434  20.815  1.00 0.00 ? 360 SER A HG   3  
ATOM   3212  N  N    . GLY A 1 4   ? 62.230  -5.247  17.094  1.00 0.00 ? 361 GLY A N    3  
ATOM   3213  C  CA   . GLY A 1 4   ? 60.981  -5.796  16.600  1.00 0.00 ? 361 GLY A CA   3  
ATOM   3214  C  C    . GLY A 1 4   ? 60.055  -6.231  17.719  1.00 0.00 ? 361 GLY A C    3  
ATOM   3215  O  O    . GLY A 1 4   ? 60.478  -6.909  18.655  1.00 0.00 ? 361 GLY A O    3  
ATOM   3216  H  H    . GLY A 1 4   ? 62.301  -4.288  17.281  1.00 0.00 ? 361 GLY A H    3  
ATOM   3217  H  HA2  . GLY A 1 4   ? 60.481  -5.046  16.004  1.00 0.00 ? 361 GLY A HA2  3  
ATOM   3218  H  HA3  . GLY A 1 4   ? 61.198  -6.650  15.976  1.00 0.00 ? 361 GLY A HA3  3  
ATOM   3219  N  N    . SER A 1 5   ? 58.789  -5.838  17.624  1.00 0.00 ? 362 SER A N    3  
ATOM   3220  C  CA   . SER A 1 5   ? 57.802  -6.187  18.639  1.00 0.00 ? 362 SER A CA   3  
ATOM   3221  C  C    . SER A 1 5   ? 56.385  -6.048  18.090  1.00 0.00 ? 362 SER A C    3  
ATOM   3222  O  O    . SER A 1 5   ? 56.182  -5.540  16.988  1.00 0.00 ? 362 SER A O    3  
ATOM   3223  C  CB   . SER A 1 5   ? 57.972  -5.298  19.872  1.00 0.00 ? 362 SER A CB   3  
ATOM   3224  O  OG   . SER A 1 5   ? 57.807  -3.930  19.542  1.00 0.00 ? 362 SER A OG   3  
ATOM   3225  H  H    . SER A 1 5   ? 58.513  -5.298  16.853  1.00 0.00 ? 362 SER A H    3  
ATOM   3226  H  HA   . SER A 1 5   ? 57.967  -7.216  18.922  1.00 0.00 ? 362 SER A HA   3  
ATOM   3227  H  HB2  . SER A 1 5   ? 57.235  -5.568  20.613  1.00 0.00 ? 362 SER A HB2  3  
ATOM   3228  H  HB3  . SER A 1 5   ? 58.962  -5.440  20.281  1.00 0.00 ? 362 SER A HB3  3  
ATOM   3229  H  HG   . SER A 1 5   ? 58.648  -3.564  19.259  1.00 0.00 ? 362 SER A HG   3  
ATOM   3230  N  N    . SER A 1 6   ? 55.409  -6.505  18.868  1.00 0.00 ? 363 SER A N    3  
ATOM   3231  C  CA   . SER A 1 6   ? 54.011  -6.437  18.459  1.00 0.00 ? 363 SER A CA   3  
ATOM   3232  C  C    . SER A 1 6   ? 53.087  -6.495  19.672  1.00 0.00 ? 363 SER A C    3  
ATOM   3233  O  O    . SER A 1 6   ? 53.515  -6.826  20.777  1.00 0.00 ? 363 SER A O    3  
ATOM   3234  C  CB   . SER A 1 6   ? 53.682  -7.580  17.498  1.00 0.00 ? 363 SER A CB   3  
ATOM   3235  O  OG   . SER A 1 6   ? 54.056  -8.832  18.047  1.00 0.00 ? 363 SER A OG   3  
ATOM   3236  H  H    . SER A 1 6   ? 55.635  -6.900  19.736  1.00 0.00 ? 363 SER A H    3  
ATOM   3237  H  HA   . SER A 1 6   ? 53.860  -5.496  17.951  1.00 0.00 ? 363 SER A HA   3  
ATOM   3238  H  HB2  . SER A 1 6   ? 52.621  -7.589  17.303  1.00 0.00 ? 363 SER A HB2  3  
ATOM   3239  H  HB3  . SER A 1 6   ? 54.217  -7.432  16.571  1.00 0.00 ? 363 SER A HB3  3  
ATOM   3240  H  HG   . SER A 1 6   ? 54.230  -9.454  17.337  1.00 0.00 ? 363 SER A HG   3  
ATOM   3241  N  N    . GLY A 1 7   ? 51.816  -6.170  19.456  1.00 0.00 ? 364 GLY A N    3  
ATOM   3242  C  CA   . GLY A 1 7   ? 50.850  -6.192  20.539  1.00 0.00 ? 364 GLY A CA   3  
ATOM   3243  C  C    . GLY A 1 7   ? 49.589  -5.419  20.207  1.00 0.00 ? 364 GLY A C    3  
ATOM   3244  O  O    . GLY A 1 7   ? 49.427  -4.260  20.591  1.00 0.00 ? 364 GLY A O    3  
ATOM   3245  H  H    . GLY A 1 7   ? 51.531  -5.914  18.553  1.00 0.00 ? 364 GLY A H    3  
ATOM   3246  H  HA2  . GLY A 1 7   ? 50.586  -7.217  20.751  1.00 0.00 ? 364 GLY A HA2  3  
ATOM   3247  H  HA3  . GLY A 1 7   ? 51.303  -5.758  21.418  1.00 0.00 ? 364 GLY A HA3  3  
ATOM   3248  N  N    . PRO A 1 8   ? 48.670  -6.065  19.475  1.00 0.00 ? 365 PRO A N    3  
ATOM   3249  C  CA   . PRO A 1 8   ? 47.401  -5.449  19.074  1.00 0.00 ? 365 PRO A CA   3  
ATOM   3250  C  C    . PRO A 1 8   ? 46.459  -5.242  20.255  1.00 0.00 ? 365 PRO A C    3  
ATOM   3251  O  O    . PRO A 1 8   ? 46.698  -5.754  21.349  1.00 0.00 ? 365 PRO A O    3  
ATOM   3252  C  CB   . PRO A 1 8   ? 46.811  -6.461  18.090  1.00 0.00 ? 365 PRO A CB   3  
ATOM   3253  C  CG   . PRO A 1 8   ? 47.417  -7.766  18.478  1.00 0.00 ? 365 PRO A CG   3  
ATOM   3254  C  CD   . PRO A 1 8   ? 48.797  -7.447  18.983  1.00 0.00 ? 365 PRO A CD   3  
ATOM   3255  H  HA   . PRO A 1 8   ? 47.559  -4.506  18.572  1.00 0.00 ? 365 PRO A HA   3  
ATOM   3256  H  HB2  . PRO A 1 8   ? 45.735  -6.479  18.190  1.00 0.00 ? 365 PRO A HB2  3  
ATOM   3257  H  HB3  . PRO A 1 8   ? 47.080  -6.187  17.081  1.00 0.00 ? 365 PRO A HB3  3  
ATOM   3258  H  HG2  . PRO A 1 8   ? 46.830  -8.226  19.258  1.00 0.00 ? 365 PRO A HG2  3  
ATOM   3259  H  HG3  . PRO A 1 8   ? 47.474  -8.415  17.617  1.00 0.00 ? 365 PRO A HG3  3  
ATOM   3260  H  HD2  . PRO A 1 8   ? 49.071  -8.118  19.784  1.00 0.00 ? 365 PRO A HD2  3  
ATOM   3261  H  HD3  . PRO A 1 8   ? 49.516  -7.504  18.179  1.00 0.00 ? 365 PRO A HD3  3  
ATOM   3262  N  N    . ASP A 1 9   ? 45.388  -4.491  20.026  1.00 0.00 ? 366 ASP A N    3  
ATOM   3263  C  CA   . ASP A 1 9   ? 44.408  -4.218  21.071  1.00 0.00 ? 366 ASP A CA   3  
ATOM   3264  C  C    . ASP A 1 9   ? 43.004  -4.110  20.485  1.00 0.00 ? 366 ASP A C    3  
ATOM   3265  O  O    . ASP A 1 9   ? 42.733  -3.245  19.650  1.00 0.00 ? 366 ASP A O    3  
ATOM   3266  C  CB   . ASP A 1 9   ? 44.765  -2.928  21.811  1.00 0.00 ? 366 ASP A CB   3  
ATOM   3267  C  CG   . ASP A 1 9   ? 44.244  -2.913  23.234  1.00 0.00 ? 366 ASP A CG   3  
ATOM   3268  O  OD1  . ASP A 1 9   ? 43.097  -2.464  23.441  1.00 0.00 ? 366 ASP A OD1  3  
ATOM   3269  O  OD2  . ASP A 1 9   ? 44.983  -3.350  24.142  1.00 0.00 ? 366 ASP A OD2  3  
ATOM   3270  H  H    . ASP A 1 9   ? 45.252  -4.111  19.133  1.00 0.00 ? 366 ASP A H    3  
ATOM   3271  H  HA   . ASP A 1 9   ? 44.430  -5.040  21.770  1.00 0.00 ? 366 ASP A HA   3  
ATOM   3272  H  HB2  . ASP A 1 9   ? 45.840  -2.823  21.840  1.00 0.00 ? 366 ASP A HB2  3  
ATOM   3273  H  HB3  . ASP A 1 9   ? 44.341  -2.087  21.282  1.00 0.00 ? 366 ASP A HB3  3  
ATOM   3274  N  N    . LEU A 1 10  ? 42.115  -4.993  20.925  1.00 0.00 ? 367 LEU A N    3  
ATOM   3275  C  CA   . LEU A 1 10  ? 40.738  -4.998  20.443  1.00 0.00 ? 367 LEU A CA   3  
ATOM   3276  C  C    . LEU A 1 10  ? 39.854  -4.106  21.310  1.00 0.00 ? 367 LEU A C    3  
ATOM   3277  O  O    . LEU A 1 10  ? 40.325  -3.494  22.268  1.00 0.00 ? 367 LEU A O    3  
ATOM   3278  C  CB   . LEU A 1 10  ? 40.186  -6.425  20.431  1.00 0.00 ? 367 LEU A CB   3  
ATOM   3279  C  CG   . LEU A 1 10  ? 40.398  -7.237  21.709  1.00 0.00 ? 367 LEU A CG   3  
ATOM   3280  C  CD1  . LEU A 1 10  ? 41.758  -7.918  21.690  1.00 0.00 ? 367 LEU A CD1  3  
ATOM   3281  C  CD2  . LEU A 1 10  ? 40.263  -6.346  22.936  1.00 0.00 ? 367 LEU A CD2  3  
ATOM   3282  H  H    . LEU A 1 10  ? 42.389  -5.657  21.590  1.00 0.00 ? 367 LEU A H    3  
ATOM   3283  H  HA   . LEU A 1 10  ? 40.738  -4.612  19.435  1.00 0.00 ? 367 LEU A HA   3  
ATOM   3284  H  HB2  . LEU A 1 10  ? 39.124  -6.367  20.249  1.00 0.00 ? 367 LEU A HB2  3  
ATOM   3285  H  HB3  . LEU A 1 10  ? 40.661  -6.955  19.618  1.00 0.00 ? 367 LEU A HB3  3  
ATOM   3286  H  HG   . LEU A 1 10  ? 39.641  -8.007  21.769  1.00 0.00 ? 367 LEU A HG   3  
ATOM   3287  H  HD11 . LEU A 1 10  ? 42.269  -7.726  22.621  1.00 0.00 ? 367 LEU A HD11 3  
ATOM   3288  H  HD12 . LEU A 1 10  ? 42.343  -7.528  20.871  1.00 0.00 ? 367 LEU A HD12 3  
ATOM   3289  H  HD13 . LEU A 1 10  ? 41.625  -8.982  21.563  1.00 0.00 ? 367 LEU A HD13 3  
ATOM   3290  H  HD21 . LEU A 1 10  ? 39.286  -5.886  22.941  1.00 0.00 ? 367 LEU A HD21 3  
ATOM   3291  H  HD22 . LEU A 1 10  ? 41.023  -5.579  22.909  1.00 0.00 ? 367 LEU A HD22 3  
ATOM   3292  H  HD23 . LEU A 1 10  ? 40.385  -6.942  23.829  1.00 0.00 ? 367 LEU A HD23 3  
ATOM   3293  N  N    . GLU A 1 11  ? 38.572  -4.040  20.967  1.00 0.00 ? 368 GLU A N    3  
ATOM   3294  C  CA   . GLU A 1 11  ? 37.623  -3.223  21.715  1.00 0.00 ? 368 GLU A CA   3  
ATOM   3295  C  C    . GLU A 1 11  ? 36.353  -4.012  22.025  1.00 0.00 ? 368 GLU A C    3  
ATOM   3296  O  O    . GLU A 1 11  ? 35.950  -4.888  21.260  1.00 0.00 ? 368 GLU A O    3  
ATOM   3297  C  CB   . GLU A 1 11  ? 37.271  -1.959  20.927  1.00 0.00 ? 368 GLU A CB   3  
ATOM   3298  C  CG   . GLU A 1 11  ? 38.477  -1.099  20.588  1.00 0.00 ? 368 GLU A CG   3  
ATOM   3299  C  CD   . GLU A 1 11  ? 39.154  -1.526  19.300  1.00 0.00 ? 368 GLU A CD   3  
ATOM   3300  O  OE1  . GLU A 1 11  ? 38.707  -1.084  18.221  1.00 0.00 ? 368 GLU A OE1  3  
ATOM   3301  O  OE2  . GLU A 1 11  ? 40.130  -2.302  19.370  1.00 0.00 ? 368 GLU A OE2  3  
ATOM   3302  H  H    . GLU A 1 11  ? 38.256  -4.551  20.192  1.00 0.00 ? 368 GLU A H    3  
ATOM   3303  H  HA   . GLU A 1 11  ? 38.091  -2.939  22.645  1.00 0.00 ? 368 GLU A HA   3  
ATOM   3304  H  HB2  . GLU A 1 11  ? 36.788  -2.246  20.005  1.00 0.00 ? 368 GLU A HB2  3  
ATOM   3305  H  HB3  . GLU A 1 11  ? 36.585  -1.365  21.513  1.00 0.00 ? 368 GLU A HB3  3  
ATOM   3306  H  HG2  . GLU A 1 11  ? 38.155  -0.074  20.484  1.00 0.00 ? 368 GLU A HG2  3  
ATOM   3307  H  HG3  . GLU A 1 11  ? 39.193  -1.170  21.394  1.00 0.00 ? 368 GLU A HG3  3  
ATOM   3308  N  N    . LYS A 1 12  ? 35.727  -3.694  23.153  1.00 0.00 ? 369 LYS A N    3  
ATOM   3309  C  CA   . LYS A 1 12  ? 34.503  -4.370  23.566  1.00 0.00 ? 369 LYS A CA   3  
ATOM   3310  C  C    . LYS A 1 12  ? 33.298  -3.445  23.431  1.00 0.00 ? 369 LYS A C    3  
ATOM   3311  O  O    . LYS A 1 12  ? 33.004  -2.659  24.332  1.00 0.00 ? 369 LYS A O    3  
ATOM   3312  C  CB   . LYS A 1 12  ? 34.628  -4.855  25.012  1.00 0.00 ? 369 LYS A CB   3  
ATOM   3313  C  CG   . LYS A 1 12  ? 35.548  -6.053  25.175  1.00 0.00 ? 369 LYS A CG   3  
ATOM   3314  C  CD   . LYS A 1 12  ? 35.132  -6.920  26.351  1.00 0.00 ? 369 LYS A CD   3  
ATOM   3315  C  CE   . LYS A 1 12  ? 35.701  -6.393  27.660  1.00 0.00 ? 369 LYS A CE   3  
ATOM   3316  N  NZ   . LYS A 1 12  ? 34.787  -5.413  28.309  1.00 0.00 ? 369 LYS A NZ   3  
ATOM   3317  H  H    . LYS A 1 12  ? 36.098  -2.986  23.721  1.00 0.00 ? 369 LYS A H    3  
ATOM   3318  H  HA   . LYS A 1 12  ? 34.361  -5.223  22.920  1.00 0.00 ? 369 LYS A HA   3  
ATOM   3319  H  HB2  . LYS A 1 12  ? 35.011  -4.048  25.618  1.00 0.00 ? 369 LYS A HB2  3  
ATOM   3320  H  HB3  . LYS A 1 12  ? 33.647  -5.130  25.372  1.00 0.00 ? 369 LYS A HB3  3  
ATOM   3321  H  HG2  . LYS A 1 12  ? 35.513  -6.647  24.274  1.00 0.00 ? 369 LYS A HG2  3  
ATOM   3322  H  HG3  . LYS A 1 12  ? 36.557  -5.700  25.338  1.00 0.00 ? 369 LYS A HG3  3  
ATOM   3323  H  HD2  . LYS A 1 12  ? 34.054  -6.928  26.419  1.00 0.00 ? 369 LYS A HD2  3  
ATOM   3324  H  HD3  . LYS A 1 12  ? 35.492  -7.926  26.191  1.00 0.00 ? 369 LYS A HD3  3  
ATOM   3325  H  HE2  . LYS A 1 12  ? 35.857  -7.225  28.330  1.00 0.00 ? 369 LYS A HE2  3  
ATOM   3326  H  HE3  . LYS A 1 12  ? 36.647  -5.912  27.458  1.00 0.00 ? 369 LYS A HE3  3  
ATOM   3327  H  HZ1  . LYS A 1 12  ? 35.040  -5.296  29.310  1.00 0.00 ? 369 LYS A HZ1  3  
ATOM   3328  H  HZ2  . LYS A 1 12  ? 33.804  -5.748  28.248  1.00 0.00 ? 369 LYS A HZ2  3  
ATOM   3329  H  HZ3  . LYS A 1 12  ? 34.857  -4.491  27.834  1.00 0.00 ? 369 LYS A HZ3  3  
ATOM   3330  N  N    . ARG A 1 13  ? 32.605  -3.544  22.302  1.00 0.00 ? 370 ARG A N    3  
ATOM   3331  C  CA   . ARG A 1 13  ? 31.432  -2.716  22.050  1.00 0.00 ? 370 ARG A CA   3  
ATOM   3332  C  C    . ARG A 1 13  ? 30.271  -3.561  21.533  1.00 0.00 ? 370 ARG A C    3  
ATOM   3333  O  O    . ARG A 1 13  ? 30.424  -4.331  20.585  1.00 0.00 ? 370 ARG A O    3  
ATOM   3334  C  CB   . ARG A 1 13  ? 31.765  -1.616  21.040  1.00 0.00 ? 370 ARG A CB   3  
ATOM   3335  C  CG   . ARG A 1 13  ? 32.634  -0.508  21.611  1.00 0.00 ? 370 ARG A CG   3  
ATOM   3336  C  CD   . ARG A 1 13  ? 33.445  0.180   20.524  1.00 0.00 ? 370 ARG A CD   3  
ATOM   3337  N  NE   . ARG A 1 13  ? 32.637  1.118   19.750  1.00 0.00 ? 370 ARG A NE   3  
ATOM   3338  C  CZ   . ARG A 1 13  ? 33.148  2.128   19.055  1.00 0.00 ? 370 ARG A CZ   3  
ATOM   3339  N  NH1  . ARG A 1 13  ? 34.458  2.329   19.037  1.00 0.00 ? 370 ARG A NH1  3  
ATOM   3340  N  NH2  . ARG A 1 13  ? 32.347  2.939   18.375  1.00 0.00 ? 370 ARG A NH2  3  
ATOM   3341  H  H    . ARG A 1 13  ? 32.889  -4.190  21.621  1.00 0.00 ? 370 ARG A H    3  
ATOM   3342  H  HA   . ARG A 1 13  ? 31.141  -2.259  22.984  1.00 0.00 ? 370 ARG A HA   3  
ATOM   3343  H  HB2  . ARG A 1 13  ? 32.286  -2.058  20.203  1.00 0.00 ? 370 ARG A HB2  3  
ATOM   3344  H  HB3  . ARG A 1 13  ? 30.844  -1.176  20.689  1.00 0.00 ? 370 ARG A HB3  3  
ATOM   3345  H  HG2  . ARG A 1 13  ? 32.000  0.224   22.090  1.00 0.00 ? 370 ARG A HG2  3  
ATOM   3346  H  HG3  . ARG A 1 13  ? 33.310  -0.933  22.339  1.00 0.00 ? 370 ARG A HG3  3  
ATOM   3347  H  HD2  . ARG A 1 13  ? 34.259  0.718   20.987  1.00 0.00 ? 370 ARG A HD2  3  
ATOM   3348  H  HD3  . ARG A 1 13  ? 33.843  -0.572  19.860  1.00 0.00 ? 370 ARG A HD3  3  
ATOM   3349  H  HE   . ARG A 1 13  ? 31.666  0.988   19.750  1.00 0.00 ? 370 ARG A HE   3  
ATOM   3350  H  HH11 . ARG A 1 13  ? 35.064  1.719   19.547  1.00 0.00 ? 370 ARG A HH11 3  
ATOM   3351  H  HH12 . ARG A 1 13  ? 34.840  3.090   18.511  1.00 0.00 ? 370 ARG A HH12 3  
ATOM   3352  H  HH21 . ARG A 1 13  ? 31.359  2.791   18.386  1.00 0.00 ? 370 ARG A HH21 3  
ATOM   3353  H  HH22 . ARG A 1 13  ? 32.732  3.699   17.852  1.00 0.00 ? 370 ARG A HH22 3  
ATOM   3354  N  N    . ARG A 1 14  ? 29.111  -3.412  22.165  1.00 0.00 ? 371 ARG A N    3  
ATOM   3355  C  CA   . ARG A 1 14  ? 27.924  -4.162  21.770  1.00 0.00 ? 371 ARG A CA   3  
ATOM   3356  C  C    . ARG A 1 14  ? 27.273  -3.541  20.539  1.00 0.00 ? 371 ARG A C    3  
ATOM   3357  O  O    . ARG A 1 14  ? 27.419  -2.345  20.284  1.00 0.00 ? 371 ARG A O    3  
ATOM   3358  C  CB   . ARG A 1 14  ? 26.919  -4.211  22.922  1.00 0.00 ? 371 ARG A CB   3  
ATOM   3359  C  CG   . ARG A 1 14  ? 26.400  -2.844  23.336  1.00 0.00 ? 371 ARG A CG   3  
ATOM   3360  C  CD   . ARG A 1 14  ? 25.999  -2.821  24.803  1.00 0.00 ? 371 ARG A CD   3  
ATOM   3361  N  NE   . ARG A 1 14  ? 24.652  -3.345  25.011  1.00 0.00 ? 371 ARG A NE   3  
ATOM   3362  C  CZ   . ARG A 1 14  ? 24.164  -3.665  26.204  1.00 0.00 ? 371 ARG A CZ   3  
ATOM   3363  N  NH1  . ARG A 1 14  ? 24.909  -3.515  27.290  1.00 0.00 ? 371 ARG A NH1  3  
ATOM   3364  N  NH2  . ARG A 1 14  ? 22.928  -4.136  26.312  1.00 0.00 ? 371 ARG A NH2  3  
ATOM   3365  H  H    . ARG A 1 14  ? 29.051  -2.783  22.914  1.00 0.00 ? 371 ARG A H    3  
ATOM   3366  H  HA   . ARG A 1 14  ? 28.233  -5.169  21.530  1.00 0.00 ? 371 ARG A HA   3  
ATOM   3367  H  HB2  . ARG A 1 14  ? 26.076  -4.817  22.624  1.00 0.00 ? 371 ARG A HB2  3  
ATOM   3368  H  HB3  . ARG A 1 14  ? 27.394  -4.666  23.779  1.00 0.00 ? 371 ARG A HB3  3  
ATOM   3369  H  HG2  . ARG A 1 14  ? 27.176  -2.110  23.175  1.00 0.00 ? 371 ARG A HG2  3  
ATOM   3370  H  HG3  . ARG A 1 14  ? 25.539  -2.599  22.732  1.00 0.00 ? 371 ARG A HG3  3  
ATOM   3371  H  HD2  . ARG A 1 14  ? 26.699  -3.422  25.363  1.00 0.00 ? 371 ARG A HD2  3  
ATOM   3372  H  HD3  . ARG A 1 14  ? 26.037  -1.801  25.156  1.00 0.00 ? 371 ARG A HD3  3  
ATOM   3373  H  HE   . ARG A 1 14  ? 24.084  -3.464  24.221  1.00 0.00 ? 371 ARG A HE   3  
ATOM   3374  H  HH11 . ARG A 1 14  ? 25.840  -3.159  27.212  1.00 0.00 ? 371 ARG A HH11 3  
ATOM   3375  H  HH12 . ARG A 1 14  ? 24.538  -3.755  28.188  1.00 0.00 ? 371 ARG A HH12 3  
ATOM   3376  H  HH21 . ARG A 1 14  ? 22.364  -4.251  25.495  1.00 0.00 ? 371 ARG A HH21 3  
ATOM   3377  H  HH22 . ARG A 1 14  ? 22.562  -4.377  27.210  1.00 0.00 ? 371 ARG A HH22 3  
ATOM   3378  N  N    . ILE A 1 15  ? 26.554  -4.360  19.779  1.00 0.00 ? 372 ILE A N    3  
ATOM   3379  C  CA   . ILE A 1 15  ? 25.880  -3.890  18.575  1.00 0.00 ? 372 ILE A CA   3  
ATOM   3380  C  C    . ILE A 1 15  ? 24.373  -4.107  18.668  1.00 0.00 ? 372 ILE A C    3  
ATOM   3381  O  O    . ILE A 1 15  ? 23.913  -5.171  19.086  1.00 0.00 ? 372 ILE A O    3  
ATOM   3382  C  CB   . ILE A 1 15  ? 26.413  -4.601  17.317  1.00 0.00 ? 372 ILE A CB   3  
ATOM   3383  C  CG1  . ILE A 1 15  ? 27.928  -4.421  17.206  1.00 0.00 ? 372 ILE A CG1  3  
ATOM   3384  C  CG2  . ILE A 1 15  ? 25.718  -4.069  16.073  1.00 0.00 ? 372 ILE A CG2  3  
ATOM   3385  C  CD1  . ILE A 1 15  ? 28.718  -5.482  17.939  1.00 0.00 ? 372 ILE A CD1  3  
ATOM   3386  H  H    . ILE A 1 15  ? 26.474  -5.302  20.034  1.00 0.00 ? 372 ILE A H    3  
ATOM   3387  H  HA   . ILE A 1 15  ? 26.074  -2.832  18.475  1.00 0.00 ? 372 ILE A HA   3  
ATOM   3388  H  HB   . ILE A 1 15  ? 26.188  -5.653  17.403  1.00 0.00 ? 372 ILE A HB   3  
ATOM   3389  H  HG12 . ILE A 1 15  ? 28.213  -4.455  16.167  1.00 0.00 ? 372 ILE A HG12 3  
ATOM   3390  H  HG13 . ILE A 1 15  ? 28.199  -3.460  17.618  1.00 0.00 ? 372 ILE A HG13 3  
ATOM   3391  H  HG21 . ILE A 1 15  ? 25.948  -3.021  15.953  1.00 0.00 ? 372 ILE A HG21 3  
ATOM   3392  H  HG22 . ILE A 1 15  ? 26.063  -4.614  15.207  1.00 0.00 ? 372 ILE A HG22 3  
ATOM   3393  H  HG23 . ILE A 1 15  ? 24.650  -4.193  16.175  1.00 0.00 ? 372 ILE A HG23 3  
ATOM   3394  H  HD11 . ILE A 1 15  ? 29.233  -5.033  18.777  1.00 0.00 ? 372 ILE A HD11 3  
ATOM   3395  H  HD12 . ILE A 1 15  ? 28.046  -6.247  18.300  1.00 0.00 ? 372 ILE A HD12 3  
ATOM   3396  H  HD13 . ILE A 1 15  ? 29.439  -5.923  17.268  1.00 0.00 ? 372 ILE A HD13 3  
ATOM   3397  N  N    . HIS A 1 16  ? 23.609  -3.093  18.275  1.00 0.00 ? 373 HIS A N    3  
ATOM   3398  C  CA   . HIS A 1 16  ? 22.153  -3.174  18.311  1.00 0.00 ? 373 HIS A CA   3  
ATOM   3399  C  C    . HIS A 1 16  ? 21.584  -3.362  16.908  1.00 0.00 ? 373 HIS A C    3  
ATOM   3400  O  O    . HIS A 1 16  ? 21.759  -2.509  16.037  1.00 0.00 ? 373 HIS A O    3  
ATOM   3401  C  CB   . HIS A 1 16  ? 21.567  -1.914  18.948  1.00 0.00 ? 373 HIS A CB   3  
ATOM   3402  C  CG   . HIS A 1 16  ? 22.085  -1.642  20.326  1.00 0.00 ? 373 HIS A CG   3  
ATOM   3403  N  ND1  . HIS A 1 16  ? 21.332  -1.835  21.465  1.00 0.00 ? 373 HIS A ND1  3  
ATOM   3404  C  CD2  . HIS A 1 16  ? 23.291  -1.192  20.747  1.00 0.00 ? 373 HIS A CD2  3  
ATOM   3405  C  CE1  . HIS A 1 16  ? 22.051  -1.514  22.526  1.00 0.00 ? 373 HIS A CE1  3  
ATOM   3406  N  NE2  . HIS A 1 16  ? 23.244  -1.121  22.117  1.00 0.00 ? 373 HIS A NE2  3  
ATOM   3407  H  H    . HIS A 1 16  ? 24.034  -2.272  17.952  1.00 0.00 ? 373 HIS A H    3  
ATOM   3408  H  HA   . HIS A 1 16  ? 21.883  -4.029  18.913  1.00 0.00 ? 373 HIS A HA   3  
ATOM   3409  H  HB2  . HIS A 1 16  ? 21.808  -1.061  18.330  1.00 0.00 ? 373 HIS A HB2  3  
ATOM   3410  H  HB3  . HIS A 1 16  ? 20.493  -2.015  19.010  1.00 0.00 ? 373 HIS A HB3  3  
ATOM   3411  H  HD1  . HIS A 1 16  ? 20.407  -2.158  21.492  1.00 0.00 ? 373 HIS A HD1  3  
ATOM   3412  H  HD2  . HIS A 1 16  ? 24.134  -0.936  20.120  1.00 0.00 ? 373 HIS A HD2  3  
ATOM   3413  H  HE1  . HIS A 1 16  ? 21.720  -1.564  23.552  1.00 0.00 ? 373 HIS A HE1  3  
ATOM   3414  N  N    . TYR A 1 17  ? 20.902  -4.482  16.696  1.00 0.00 ? 374 TYR A N    3  
ATOM   3415  C  CA   . TYR A 1 17  ? 20.310  -4.783  15.399  1.00 0.00 ? 374 TYR A CA   3  
ATOM   3416  C  C    . TYR A 1 17  ? 18.886  -4.243  15.311  1.00 0.00 ? 374 TYR A C    3  
ATOM   3417  O  O    . TYR A 1 17  ? 18.062  -4.485  16.194  1.00 0.00 ? 374 TYR A O    3  
ATOM   3418  C  CB   . TYR A 1 17  ? 20.311  -6.292  15.151  1.00 0.00 ? 374 TYR A CB   3  
ATOM   3419  C  CG   . TYR A 1 17  ? 21.660  -6.837  14.737  1.00 0.00 ? 374 TYR A CG   3  
ATOM   3420  C  CD1  . TYR A 1 17  ? 22.835  -6.284  15.228  1.00 0.00 ? 374 TYR A CD1  3  
ATOM   3421  C  CD2  . TYR A 1 17  ? 21.758  -7.907  13.855  1.00 0.00 ? 374 TYR A CD2  3  
ATOM   3422  C  CE1  . TYR A 1 17  ? 24.069  -6.778  14.852  1.00 0.00 ? 374 TYR A CE1  3  
ATOM   3423  C  CE2  . TYR A 1 17  ? 22.987  -8.408  13.474  1.00 0.00 ? 374 TYR A CE2  3  
ATOM   3424  C  CZ   . TYR A 1 17  ? 24.140  -7.840  13.975  1.00 0.00 ? 374 TYR A CZ   3  
ATOM   3425  O  OH   . TYR A 1 17  ? 25.367  -8.336  13.599  1.00 0.00 ? 374 TYR A OH   3  
ATOM   3426  H  H    . TYR A 1 17  ? 20.796  -5.123  17.430  1.00 0.00 ? 374 TYR A H    3  
ATOM   3427  H  HA   . TYR A 1 17  ? 20.912  -4.304  14.640  1.00 0.00 ? 374 TYR A HA   3  
ATOM   3428  H  HB2  . TYR A 1 17  ? 20.014  -6.799  16.056  1.00 0.00 ? 374 TYR A HB2  3  
ATOM   3429  H  HB3  . TYR A 1 17  ? 19.605  -6.522  14.367  1.00 0.00 ? 374 TYR A HB3  3  
ATOM   3430  H  HD1  . TYR A 1 17  ? 22.776  -5.452  15.916  1.00 0.00 ? 374 TYR A HD1  3  
ATOM   3431  H  HD2  . TYR A 1 17  ? 20.853  -8.349  13.465  1.00 0.00 ? 374 TYR A HD2  3  
ATOM   3432  H  HE1  . TYR A 1 17  ? 24.972  -6.334  15.244  1.00 0.00 ? 374 TYR A HE1  3  
ATOM   3433  H  HE2  . TYR A 1 17  ? 23.043  -9.240  12.788  1.00 0.00 ? 374 TYR A HE2  3  
ATOM   3434  H  HH   . TYR A 1 17  ? 25.276  -8.827  12.779  1.00 0.00 ? 374 TYR A HH   3  
ATOM   3435  N  N    . CYS A 1 18  ? 18.603  -3.511  14.239  1.00 0.00 ? 375 CYS A N    3  
ATOM   3436  C  CA   . CYS A 1 18  ? 17.279  -2.936  14.034  1.00 0.00 ? 375 CYS A CA   3  
ATOM   3437  C  C    . CYS A 1 18  ? 16.191  -3.878  14.542  1.00 0.00 ? 375 CYS A C    3  
ATOM   3438  O  O    . CYS A 1 18  ? 16.165  -5.058  14.193  1.00 0.00 ? 375 CYS A O    3  
ATOM   3439  C  CB   . CYS A 1 18  ? 17.055  -2.635  12.550  1.00 0.00 ? 375 CYS A CB   3  
ATOM   3440  S  SG   . CYS A 1 18  ? 15.426  -1.911  12.175  1.00 0.00 ? 375 CYS A SG   3  
ATOM   3441  H  H    . CYS A 1 18  ? 19.301  -3.353  13.569  1.00 0.00 ? 375 CYS A H    3  
ATOM   3442  H  HA   . CYS A 1 18  ? 17.228  -2.013  14.591  1.00 0.00 ? 375 CYS A HA   3  
ATOM   3443  H  HB2  . CYS A 1 18  ? 17.809  -1.937  12.215  1.00 0.00 ? 375 CYS A HB2  3  
ATOM   3444  H  HB3  . CYS A 1 18  ? 17.145  -3.552  11.987  1.00 0.00 ? 375 CYS A HB3  3  
ATOM   3445  N  N    . ASP A 1 19  ? 15.296  -3.347  15.368  1.00 0.00 ? 376 ASP A N    3  
ATOM   3446  C  CA   . ASP A 1 19  ? 14.205  -4.139  15.924  1.00 0.00 ? 376 ASP A CA   3  
ATOM   3447  C  C    . ASP A 1 19  ? 13.024  -4.190  14.960  1.00 0.00 ? 376 ASP A C    3  
ATOM   3448  O  O    . ASP A 1 19  ? 11.867  -4.181  15.379  1.00 0.00 ? 376 ASP A O    3  
ATOM   3449  C  CB   . ASP A 1 19  ? 13.759  -3.559  17.267  1.00 0.00 ? 376 ASP A CB   3  
ATOM   3450  C  CG   . ASP A 1 19  ? 14.600  -4.062  18.424  1.00 0.00 ? 376 ASP A CG   3  
ATOM   3451  O  OD1  . ASP A 1 19  ? 14.755  -5.295  18.552  1.00 0.00 ? 376 ASP A OD1  3  
ATOM   3452  O  OD2  . ASP A 1 19  ? 15.103  -3.224  19.201  1.00 0.00 ? 376 ASP A OD2  3  
ATOM   3453  H  H    . ASP A 1 19  ? 15.370  -2.400  15.609  1.00 0.00 ? 376 ASP A H    3  
ATOM   3454  H  HA   . ASP A 1 19  ? 14.570  -5.143  16.080  1.00 0.00 ? 376 ASP A HA   3  
ATOM   3455  H  HB2  . ASP A 1 19  ? 13.837  -2.483  17.231  1.00 0.00 ? 376 ASP A HB2  3  
ATOM   3456  H  HB3  . ASP A 1 19  ? 12.730  -3.835  17.447  1.00 0.00 ? 376 ASP A HB3  3  
ATOM   3457  N  N    . TYR A 1 20  ? 13.325  -4.242  13.667  1.00 0.00 ? 377 TYR A N    3  
ATOM   3458  C  CA   . TYR A 1 20  ? 12.288  -4.291  12.643  1.00 0.00 ? 377 TYR A CA   3  
ATOM   3459  C  C    . TYR A 1 20  ? 12.378  -5.583  11.837  1.00 0.00 ? 377 TYR A C    3  
ATOM   3460  O  O    . TYR A 1 20  ? 13.461  -6.054  11.489  1.00 0.00 ? 377 TYR A O    3  
ATOM   3461  C  CB   . TYR A 1 20  ? 12.407  -3.085  11.709  1.00 0.00 ? 377 TYR A CB   3  
ATOM   3462  C  CG   . TYR A 1 20  ? 11.087  -2.646  11.116  1.00 0.00 ? 377 TYR A CG   3  
ATOM   3463  C  CD1  . TYR A 1 20  ? 10.191  -1.884  11.855  1.00 0.00 ? 377 TYR A CD1  3  
ATOM   3464  C  CD2  . TYR A 1 20  ? 10.736  -2.994  9.818   1.00 0.00 ? 377 TYR A CD2  3  
ATOM   3465  C  CE1  . TYR A 1 20  ? 8.984   -1.481  11.318  1.00 0.00 ? 377 TYR A CE1  3  
ATOM   3466  C  CE2  . TYR A 1 20  ? 9.532   -2.594  9.272   1.00 0.00 ? 377 TYR A CE2  3  
ATOM   3467  C  CZ   . TYR A 1 20  ? 8.659   -1.838  10.026  1.00 0.00 ? 377 TYR A CZ   3  
ATOM   3468  O  OH   . TYR A 1 20  ? 7.458   -1.439  9.486   1.00 0.00 ? 377 TYR A OH   3  
ATOM   3469  H  H    . TYR A 1 20  ? 14.266  -4.247  13.395  1.00 0.00 ? 377 TYR A H    3  
ATOM   3470  H  HA   . TYR A 1 20  ? 11.329  -4.256  13.140  1.00 0.00 ? 377 TYR A HA   3  
ATOM   3471  H  HB2  . TYR A 1 20  ? 12.816  -2.252  12.259  1.00 0.00 ? 377 TYR A HB2  3  
ATOM   3472  H  HB3  . TYR A 1 20  ? 13.071  -3.334  10.895  1.00 0.00 ? 377 TYR A HB3  3  
ATOM   3473  H  HD1  . TYR A 1 20  ? 10.448  -1.605  12.867  1.00 0.00 ? 377 TYR A HD1  3  
ATOM   3474  H  HD2  . TYR A 1 20  ? 11.423  -3.587  9.230   1.00 0.00 ? 377 TYR A HD2  3  
ATOM   3475  H  HE1  . TYR A 1 20  ? 8.300   -0.888  11.908  1.00 0.00 ? 377 TYR A HE1  3  
ATOM   3476  H  HE2  . TYR A 1 20  ? 9.278   -2.874  8.260   1.00 0.00 ? 377 TYR A HE2  3  
ATOM   3477  H  HH   . TYR A 1 20  ? 7.261   -1.974  8.714   1.00 0.00 ? 377 TYR A HH   3  
ATOM   3478  N  N    . PRO A 1 21  ? 11.212  -6.172  11.532  1.00 0.00 ? 378 PRO A N    3  
ATOM   3479  C  CA   . PRO A 1 21  ? 11.131  -7.417  10.763  1.00 0.00 ? 378 PRO A CA   3  
ATOM   3480  C  C    . PRO A 1 21  ? 11.528  -7.223  9.303   1.00 0.00 ? 378 PRO A C    3  
ATOM   3481  O  O    . PRO A 1 21  ? 10.841  -6.534  8.550   1.00 0.00 ? 378 PRO A O    3  
ATOM   3482  C  CB   . PRO A 1 21  ? 9.654   -7.804  10.869  1.00 0.00 ? 378 PRO A CB   3  
ATOM   3483  C  CG   . PRO A 1 21  ? 8.942   -6.518  11.108  1.00 0.00 ? 378 PRO A CG   3  
ATOM   3484  C  CD   . PRO A 1 21  ? 9.883   -5.667  11.914  1.00 0.00 ? 378 PRO A CD   3  
ATOM   3485  H  HA   . PRO A 1 21  ? 11.741  -8.194  11.200  1.00 0.00 ? 378 PRO A HA   3  
ATOM   3486  H  HB2  . PRO A 1 21  ? 9.334   -8.269  9.947   1.00 0.00 ? 378 PRO A HB2  3  
ATOM   3487  H  HB3  . PRO A 1 21  ? 9.516   -8.490  11.691  1.00 0.00 ? 378 PRO A HB3  3  
ATOM   3488  H  HG2  . PRO A 1 21  ? 8.719   -6.041  10.165  1.00 0.00 ? 378 PRO A HG2  3  
ATOM   3489  H  HG3  . PRO A 1 21  ? 8.033   -6.700  11.662  1.00 0.00 ? 378 PRO A HG3  3  
ATOM   3490  H  HD2  . PRO A 1 21  ? 9.774   -4.626  11.647  1.00 0.00 ? 378 PRO A HD2  3  
ATOM   3491  H  HD3  . PRO A 1 21  ? 9.707   -5.807  12.971  1.00 0.00 ? 378 PRO A HD3  3  
ATOM   3492  N  N    . GLY A 1 22  ? 12.640  -7.837  8.910   1.00 0.00 ? 379 GLY A N    3  
ATOM   3493  C  CA   . GLY A 1 22  ? 13.108  -7.719  7.542   1.00 0.00 ? 379 GLY A CA   3  
ATOM   3494  C  C    . GLY A 1 22  ? 14.337  -6.840  7.423   1.00 0.00 ? 379 GLY A C    3  
ATOM   3495  O  O    . GLY A 1 22  ? 15.269  -7.159  6.684   1.00 0.00 ? 379 GLY A O    3  
ATOM   3496  H  H    . GLY A 1 22  ? 13.147  -8.373  9.555   1.00 0.00 ? 379 GLY A H    3  
ATOM   3497  H  HA2  . GLY A 1 22  ? 13.345  -8.704  7.168   1.00 0.00 ? 379 GLY A HA2  3  
ATOM   3498  H  HA3  . GLY A 1 22  ? 12.318  -7.297  6.938   1.00 0.00 ? 379 GLY A HA3  3  
ATOM   3499  N  N    . CYS A 1 23  ? 14.340  -5.728  8.150   1.00 0.00 ? 380 CYS A N    3  
ATOM   3500  C  CA   . CYS A 1 23  ? 15.462  -4.798  8.122   1.00 0.00 ? 380 CYS A CA   3  
ATOM   3501  C  C    . CYS A 1 23  ? 16.745  -5.478  8.591   1.00 0.00 ? 380 CYS A C    3  
ATOM   3502  O  O    . CYS A 1 23  ? 16.716  -6.353  9.458   1.00 0.00 ? 380 CYS A O    3  
ATOM   3503  C  CB   . CYS A 1 23  ? 15.166  -3.582  9.001   1.00 0.00 ? 380 CYS A CB   3  
ATOM   3504  S  SG   . CYS A 1 23  ? 16.145  -2.104  8.582   1.00 0.00 ? 380 CYS A SG   3  
ATOM   3505  H  H    . CYS A 1 23  ? 13.567  -5.527  8.720   1.00 0.00 ? 380 CYS A H    3  
ATOM   3506  H  HA   . CYS A 1 23  ? 15.596  -4.470  7.102   1.00 0.00 ? 380 CYS A HA   3  
ATOM   3507  H  HB2  . CYS A 1 23  ? 14.122  -3.321  8.903   1.00 0.00 ? 380 CYS A HB2  3  
ATOM   3508  H  HB3  . CYS A 1 23  ? 15.373  -3.833  10.031  1.00 0.00 ? 380 CYS A HB3  3  
ATOM   3509  N  N    . THR A 1 24  ? 17.870  -5.071  8.012   1.00 0.00 ? 381 THR A N    3  
ATOM   3510  C  CA   . THR A 1 24  ? 19.163  -5.641  8.370   1.00 0.00 ? 381 THR A CA   3  
ATOM   3511  C  C    . THR A 1 24  ? 20.102  -4.572  8.917   1.00 0.00 ? 381 THR A C    3  
ATOM   3512  O  O    . THR A 1 24  ? 21.167  -4.882  9.454   1.00 0.00 ? 381 THR A O    3  
ATOM   3513  C  CB   . THR A 1 24  ? 19.830  -6.323  7.160   1.00 0.00 ? 381 THR A CB   3  
ATOM   3514  O  OG1  . THR A 1 24  ? 19.981  -5.384  6.090   1.00 0.00 ? 381 THR A OG1  3  
ATOM   3515  C  CG2  . THR A 1 24  ? 19.005  -7.511  6.687   1.00 0.00 ? 381 THR A CG2  3  
ATOM   3516  H  H    . THR A 1 24  ? 17.828  -4.370  7.329   1.00 0.00 ? 381 THR A H    3  
ATOM   3517  H  HA   . THR A 1 24  ? 18.999  -6.388  9.133   1.00 0.00 ? 381 THR A HA   3  
ATOM   3518  H  HB   . THR A 1 24  ? 20.806  -6.677  7.459   1.00 0.00 ? 381 THR A HB   3  
ATOM   3519  H  HG1  . THR A 1 24  ? 20.336  -5.833  5.319   1.00 0.00 ? 381 THR A HG1  3  
ATOM   3520  H  HG21 . THR A 1 24  ? 19.477  -8.427  7.009   1.00 0.00 ? 381 THR A HG21 3  
ATOM   3521  H  HG22 . THR A 1 24  ? 18.942  -7.499  5.609   1.00 0.00 ? 381 THR A HG22 3  
ATOM   3522  H  HG23 . THR A 1 24  ? 18.012  -7.450  7.107   1.00 0.00 ? 381 THR A HG23 3  
ATOM   3523  N  N    . LYS A 1 25  ? 19.702  -3.313  8.780   1.00 0.00 ? 382 LYS A N    3  
ATOM   3524  C  CA   . LYS A 1 25  ? 20.507  -2.197  9.263   1.00 0.00 ? 382 LYS A CA   3  
ATOM   3525  C  C    . LYS A 1 25  ? 20.739  -2.303  10.767  1.00 0.00 ? 382 LYS A C    3  
ATOM   3526  O  O    . LYS A 1 25  ? 19.856  -2.729  11.512  1.00 0.00 ? 382 LYS A O    3  
ATOM   3527  C  CB   . LYS A 1 25  ? 19.823  -0.868  8.934   1.00 0.00 ? 382 LYS A CB   3  
ATOM   3528  C  CG   . LYS A 1 25  ? 19.900  -0.492  7.465   1.00 0.00 ? 382 LYS A CG   3  
ATOM   3529  C  CD   . LYS A 1 25  ? 21.172  0.278   7.152   1.00 0.00 ? 382 LYS A CD   3  
ATOM   3530  C  CE   . LYS A 1 25  ? 20.973  1.233   5.985   1.00 0.00 ? 382 LYS A CE   3  
ATOM   3531  N  NZ   . LYS A 1 25  ? 20.465  2.559   6.434   1.00 0.00 ? 382 LYS A NZ   3  
ATOM   3532  H  H    . LYS A 1 25  ? 18.844  -3.129  8.344   1.00 0.00 ? 382 LYS A H    3  
ATOM   3533  H  HA   . LYS A 1 25  ? 21.462  -2.235  8.760   1.00 0.00 ? 382 LYS A HA   3  
ATOM   3534  H  HB2  . LYS A 1 25  ? 18.782  -0.934  9.214   1.00 0.00 ? 382 LYS A HB2  3  
ATOM   3535  H  HB3  . LYS A 1 25  ? 20.293  -0.083  9.510   1.00 0.00 ? 382 LYS A HB3  3  
ATOM   3536  H  HG2  . LYS A 1 25  ? 19.881  -1.393  6.870   1.00 0.00 ? 382 LYS A HG2  3  
ATOM   3537  H  HG3  . LYS A 1 25  ? 19.047  0.124   7.215   1.00 0.00 ? 382 LYS A HG3  3  
ATOM   3538  H  HD2  . LYS A 1 25  ? 21.462  0.847   8.022   1.00 0.00 ? 382 LYS A HD2  3  
ATOM   3539  H  HD3  . LYS A 1 25  ? 21.955  -0.425  6.901   1.00 0.00 ? 382 LYS A HD3  3  
ATOM   3540  H  HE2  . LYS A 1 25  ? 21.919  1.370   5.484   1.00 0.00 ? 382 LYS A HE2  3  
ATOM   3541  H  HE3  . LYS A 1 25  ? 20.262  0.798   5.298   1.00 0.00 ? 382 LYS A HE3  3  
ATOM   3542  H  HZ1  . LYS A 1 25  ? 20.531  3.248   5.658   1.00 0.00 ? 382 LYS A HZ1  3  
ATOM   3543  H  HZ2  . LYS A 1 25  ? 21.028  2.903   7.238   1.00 0.00 ? 382 LYS A HZ2  3  
ATOM   3544  H  HZ3  . LYS A 1 25  ? 19.472  2.479   6.729   1.00 0.00 ? 382 LYS A HZ3  3  
ATOM   3545  N  N    . VAL A 1 26  ? 21.930  -1.913  11.207  1.00 0.00 ? 383 VAL A N    3  
ATOM   3546  C  CA   . VAL A 1 26  ? 22.276  -1.962  12.623  1.00 0.00 ? 383 VAL A CA   3  
ATOM   3547  C  C    . VAL A 1 26  ? 22.987  -0.686  13.059  1.00 0.00 ? 383 VAL A C    3  
ATOM   3548  O  O    . VAL A 1 26  ? 23.126  0.258   12.280  1.00 0.00 ? 383 VAL A O    3  
ATOM   3549  C  CB   . VAL A 1 26  ? 23.176  -3.171  12.939  1.00 0.00 ? 383 VAL A CB   3  
ATOM   3550  C  CG1  . VAL A 1 26  ? 22.563  -4.451  12.390  1.00 0.00 ? 383 VAL A CG1  3  
ATOM   3551  C  CG2  . VAL A 1 26  ? 24.574  -2.957  12.378  1.00 0.00 ? 383 VAL A CG2  3  
ATOM   3552  H  H    . VAL A 1 26  ? 22.593  -1.583  10.564  1.00 0.00 ? 383 VAL A H    3  
ATOM   3553  H  HA   . VAL A 1 26  ? 21.361  -2.063  13.187  1.00 0.00 ? 383 VAL A HA   3  
ATOM   3554  H  HB   . VAL A 1 26  ? 23.252  -3.267  14.012  1.00 0.00 ? 383 VAL A HB   3  
ATOM   3555  H  HG11 . VAL A 1 26  ? 21.655  -4.214  11.856  1.00 0.00 ? 383 VAL A HG11 3  
ATOM   3556  H  HG12 . VAL A 1 26  ? 23.263  -4.927  11.719  1.00 0.00 ? 383 VAL A HG12 3  
ATOM   3557  H  HG13 . VAL A 1 26  ? 22.335  -5.120  13.207  1.00 0.00 ? 383 VAL A HG13 3  
ATOM   3558  H  HG21 . VAL A 1 26  ? 24.804  -3.742  11.674  1.00 0.00 ? 383 VAL A HG21 3  
ATOM   3559  H  HG22 . VAL A 1 26  ? 24.617  -2.000  11.878  1.00 0.00 ? 383 VAL A HG22 3  
ATOM   3560  H  HG23 . VAL A 1 26  ? 25.292  -2.974  13.184  1.00 0.00 ? 383 VAL A HG23 3  
ATOM   3561  N  N    . TYR A 1 27  ? 23.436  -0.663  14.309  1.00 0.00 ? 384 TYR A N    3  
ATOM   3562  C  CA   . TYR A 1 27  ? 24.132  0.498   14.851  1.00 0.00 ? 384 TYR A CA   3  
ATOM   3563  C  C    . TYR A 1 27  ? 24.964  0.114   16.070  1.00 0.00 ? 384 TYR A C    3  
ATOM   3564  O  O    . TYR A 1 27  ? 24.429  -0.310  17.095  1.00 0.00 ? 384 TYR A O    3  
ATOM   3565  C  CB   . TYR A 1 27  ? 23.128  1.590   15.227  1.00 0.00 ? 384 TYR A CB   3  
ATOM   3566  C  CG   . TYR A 1 27  ? 22.489  2.262   14.034  1.00 0.00 ? 384 TYR A CG   3  
ATOM   3567  C  CD1  . TYR A 1 27  ? 21.340  1.742   13.452  1.00 0.00 ? 384 TYR A CD1  3  
ATOM   3568  C  CD2  . TYR A 1 27  ? 23.035  3.417   13.487  1.00 0.00 ? 384 TYR A CD2  3  
ATOM   3569  C  CE1  . TYR A 1 27  ? 20.752  2.353   12.361  1.00 0.00 ? 384 TYR A CE1  3  
ATOM   3570  C  CE2  . TYR A 1 27  ? 22.454  4.035   12.397  1.00 0.00 ? 384 TYR A CE2  3  
ATOM   3571  C  CZ   . TYR A 1 27  ? 21.313  3.499   11.837  1.00 0.00 ? 384 TYR A CZ   3  
ATOM   3572  O  OH   . TYR A 1 27  ? 20.731  4.111   10.750  1.00 0.00 ? 384 TYR A OH   3  
ATOM   3573  H  H    . TYR A 1 27  ? 23.295  -1.446  14.882  1.00 0.00 ? 384 TYR A H    3  
ATOM   3574  H  HA   . TYR A 1 27  ? 24.791  0.878   14.084  1.00 0.00 ? 384 TYR A HA   3  
ATOM   3575  H  HB2  . TYR A 1 27  ? 22.341  1.155   15.823  1.00 0.00 ? 384 TYR A HB2  3  
ATOM   3576  H  HB3  . TYR A 1 27  ? 23.634  2.349   15.805  1.00 0.00 ? 384 TYR A HB3  3  
ATOM   3577  H  HD1  . TYR A 1 27  ? 20.903  0.844   13.864  1.00 0.00 ? 384 TYR A HD1  3  
ATOM   3578  H  HD2  . TYR A 1 27  ? 23.929  3.834   13.928  1.00 0.00 ? 384 TYR A HD2  3  
ATOM   3579  H  HE1  . TYR A 1 27  ? 19.859  1.934   11.922  1.00 0.00 ? 384 TYR A HE1  3  
ATOM   3580  H  HE2  . TYR A 1 27  ? 22.893  4.933   11.987  1.00 0.00 ? 384 TYR A HE2  3  
ATOM   3581  H  HH   . TYR A 1 27  ? 19.778  4.126   10.864  1.00 0.00 ? 384 TYR A HH   3  
ATOM   3582  N  N    . THR A 1 28  ? 26.280  0.268   15.952  1.00 0.00 ? 385 THR A N    3  
ATOM   3583  C  CA   . THR A 1 28  ? 27.188  -0.062  17.043  1.00 0.00 ? 385 THR A CA   3  
ATOM   3584  C  C    . THR A 1 28  ? 26.676  0.486   18.370  1.00 0.00 ? 385 THR A C    3  
ATOM   3585  O  O    . THR A 1 28  ? 26.771  -0.175  19.405  1.00 0.00 ? 385 THR A O    3  
ATOM   3586  C  CB   . THR A 1 28  ? 28.602  0.492   16.784  1.00 0.00 ? 385 THR A CB   3  
ATOM   3587  O  OG1  . THR A 1 28  ? 29.138  -0.076  15.583  1.00 0.00 ? 385 THR A OG1  3  
ATOM   3588  C  CG2  . THR A 1 28  ? 29.526  0.185   17.952  1.00 0.00 ? 385 THR A CG2  3  
ATOM   3589  H  H    . THR A 1 28  ? 26.646  0.610   15.111  1.00 0.00 ? 385 THR A H    3  
ATOM   3590  H  HA   . THR A 1 28  ? 27.253  -1.139  17.110  1.00 0.00 ? 385 THR A HA   3  
ATOM   3591  H  HB   . THR A 1 28  ? 28.536  1.564   16.668  1.00 0.00 ? 385 THR A HB   3  
ATOM   3592  H  HG1  . THR A 1 28  ? 28.421  -0.415  15.042  1.00 0.00 ? 385 THR A HG1  3  
ATOM   3593  H  HG21 . THR A 1 28  ? 29.473  -0.868  18.186  1.00 0.00 ? 385 THR A HG21 3  
ATOM   3594  H  HG22 . THR A 1 28  ? 29.221  0.760   18.814  1.00 0.00 ? 385 THR A HG22 3  
ATOM   3595  H  HG23 . THR A 1 28  ? 30.541  0.444   17.686  1.00 0.00 ? 385 THR A HG23 3  
ATOM   3596  N  N    . LYS A 1 29  ? 26.132  1.697   18.334  1.00 0.00 ? 386 LYS A N    3  
ATOM   3597  C  CA   . LYS A 1 29  ? 25.602  2.334   19.534  1.00 0.00 ? 386 LYS A CA   3  
ATOM   3598  C  C    . LYS A 1 29  ? 24.079  2.404   19.486  1.00 0.00 ? 386 LYS A C    3  
ATOM   3599  O  O    . LYS A 1 29  ? 23.484  2.432   18.409  1.00 0.00 ? 386 LYS A O    3  
ATOM   3600  C  CB   . LYS A 1 29  ? 26.183  3.742   19.688  1.00 0.00 ? 386 LYS A CB   3  
ATOM   3601  C  CG   . LYS A 1 29  ? 27.501  3.777   20.443  1.00 0.00 ? 386 LYS A CG   3  
ATOM   3602  C  CD   . LYS A 1 29  ? 27.704  5.107   21.149  1.00 0.00 ? 386 LYS A CD   3  
ATOM   3603  C  CE   . LYS A 1 29  ? 26.826  5.220   22.386  1.00 0.00 ? 386 LYS A CE   3  
ATOM   3604  N  NZ   . LYS A 1 29  ? 27.395  4.471   23.541  1.00 0.00 ? 386 LYS A NZ   3  
ATOM   3605  H  H    . LYS A 1 29  ? 26.085  2.175   17.479  1.00 0.00 ? 386 LYS A H    3  
ATOM   3606  H  HA   . LYS A 1 29  ? 25.897  1.738   20.384  1.00 0.00 ? 386 LYS A HA   3  
ATOM   3607  H  HB2  . LYS A 1 29  ? 26.343  4.162   18.706  1.00 0.00 ? 386 LYS A HB2  3  
ATOM   3608  H  HB3  . LYS A 1 29  ? 25.471  4.356   20.221  1.00 0.00 ? 386 LYS A HB3  3  
ATOM   3609  H  HG2  . LYS A 1 29  ? 27.505  2.986   21.178  1.00 0.00 ? 386 LYS A HG2  3  
ATOM   3610  H  HG3  . LYS A 1 29  ? 28.310  3.624   19.743  1.00 0.00 ? 386 LYS A HG3  3  
ATOM   3611  H  HD2  . LYS A 1 29  ? 28.738  5.192   21.447  1.00 0.00 ? 386 LYS A HD2  3  
ATOM   3612  H  HD3  . LYS A 1 29  ? 27.456  5.908   20.468  1.00 0.00 ? 386 LYS A HD3  3  
ATOM   3613  H  HE2  . LYS A 1 29  ? 26.736  6.262   22.653  1.00 0.00 ? 386 LYS A HE2  3  
ATOM   3614  H  HE3  . LYS A 1 29  ? 25.849  4.822   22.156  1.00 0.00 ? 386 LYS A HE3  3  
ATOM   3615  H  HZ1  . LYS A 1 29  ? 26.749  3.706   23.824  1.00 0.00 ? 386 LYS A HZ1  3  
ATOM   3616  H  HZ2  . LYS A 1 29  ? 27.532  5.111   24.349  1.00 0.00 ? 386 LYS A HZ2  3  
ATOM   3617  H  HZ3  . LYS A 1 29  ? 28.312  4.057   23.281  1.00 0.00 ? 386 LYS A HZ3  3  
ATOM   3618  N  N    . SER A 1 30  ? 23.455  2.433   20.659  1.00 0.00 ? 387 SER A N    3  
ATOM   3619  C  CA   . SER A 1 30  ? 22.001  2.498   20.750  1.00 0.00 ? 387 SER A CA   3  
ATOM   3620  C  C    . SER A 1 30  ? 21.499  3.905   20.440  1.00 0.00 ? 387 SER A C    3  
ATOM   3621  O  O    . SER A 1 30  ? 20.637  4.094   19.582  1.00 0.00 ? 387 SER A O    3  
ATOM   3622  C  CB   . SER A 1 30  ? 21.537  2.074   22.144  1.00 0.00 ? 387 SER A CB   3  
ATOM   3623  O  OG   . SER A 1 30  ? 20.126  2.146   22.256  1.00 0.00 ? 387 SER A OG   3  
ATOM   3624  H  H    . SER A 1 30  ? 23.985  2.409   21.483  1.00 0.00 ? 387 SER A H    3  
ATOM   3625  H  HA   . SER A 1 30  ? 21.593  1.814   20.020  1.00 0.00 ? 387 SER A HA   3  
ATOM   3626  H  HB2  . SER A 1 30  ? 21.849  1.058   22.331  1.00 0.00 ? 387 SER A HB2  3  
ATOM   3627  H  HB3  . SER A 1 30  ? 21.979  2.728   22.882  1.00 0.00 ? 387 SER A HB3  3  
ATOM   3628  H  HG   . SER A 1 30  ? 19.891  2.529   23.105  1.00 0.00 ? 387 SER A HG   3  
ATOM   3629  N  N    . SER A 1 31  ? 22.045  4.890   21.146  1.00 0.00 ? 388 SER A N    3  
ATOM   3630  C  CA   . SER A 1 31  ? 21.651  6.280   20.951  1.00 0.00 ? 388 SER A CA   3  
ATOM   3631  C  C    . SER A 1 31  ? 21.375  6.564   19.477  1.00 0.00 ? 388 SER A C    3  
ATOM   3632  O  O    . SER A 1 31  ? 20.409  7.247   19.135  1.00 0.00 ? 388 SER A O    3  
ATOM   3633  C  CB   . SER A 1 31  ? 22.742  7.219   21.468  1.00 0.00 ? 388 SER A CB   3  
ATOM   3634  O  OG   . SER A 1 31  ? 22.236  8.528   21.667  1.00 0.00 ? 388 SER A OG   3  
ATOM   3635  H  H    . SER A 1 31  ? 22.727  4.676   21.817  1.00 0.00 ? 388 SER A H    3  
ATOM   3636  H  HA   . SER A 1 31  ? 20.745  6.450   21.514  1.00 0.00 ? 388 SER A HA   3  
ATOM   3637  H  HB2  . SER A 1 31  ? 23.120  6.845   22.407  1.00 0.00 ? 388 SER A HB2  3  
ATOM   3638  H  HB3  . SER A 1 31  ? 23.547  7.262   20.748  1.00 0.00 ? 388 SER A HB3  3  
ATOM   3639  H  HG   . SER A 1 31  ? 21.434  8.485   22.193  1.00 0.00 ? 388 SER A HG   3  
ATOM   3640  N  N    . HIS A 1 32  ? 22.231  6.036   18.609  1.00 0.00 ? 389 HIS A N    3  
ATOM   3641  C  CA   . HIS A 1 32  ? 22.081  6.232   17.171  1.00 0.00 ? 389 HIS A CA   3  
ATOM   3642  C  C    . HIS A 1 32  ? 20.933  5.388   16.625  1.00 0.00 ? 389 HIS A C    3  
ATOM   3643  O  O    . HIS A 1 32  ? 20.164  5.841   15.777  1.00 0.00 ? 389 HIS A O    3  
ATOM   3644  C  CB   . HIS A 1 32  ? 23.380  5.876   16.448  1.00 0.00 ? 389 HIS A CB   3  
ATOM   3645  C  CG   . HIS A 1 32  ? 24.595  6.508   17.054  1.00 0.00 ? 389 HIS A CG   3  
ATOM   3646  N  ND1  . HIS A 1 32  ? 25.790  5.839   17.218  1.00 0.00 ? 389 HIS A ND1  3  
ATOM   3647  C  CD2  . HIS A 1 32  ? 24.797  7.758   17.534  1.00 0.00 ? 389 HIS A CD2  3  
ATOM   3648  C  CE1  . HIS A 1 32  ? 26.673  6.649   17.775  1.00 0.00 ? 389 HIS A CE1  3  
ATOM   3649  N  NE2  . HIS A 1 32  ? 26.095  7.820   17.976  1.00 0.00 ? 389 HIS A NE2  3  
ATOM   3650  H  H    . HIS A 1 32  ? 22.981  5.501   18.943  1.00 0.00 ? 389 HIS A H    3  
ATOM   3651  H  HA   . HIS A 1 32  ? 21.858  7.274   17.000  1.00 0.00 ? 389 HIS A HA   3  
ATOM   3652  H  HB2  . HIS A 1 32  ? 23.517  4.805   16.474  1.00 0.00 ? 389 HIS A HB2  3  
ATOM   3653  H  HB3  . HIS A 1 32  ? 23.313  6.201   15.420  1.00 0.00 ? 389 HIS A HB3  3  
ATOM   3654  H  HD1  . HIS A 1 32  ? 25.963  4.908   16.966  1.00 0.00 ? 389 HIS A HD1  3  
ATOM   3655  H  HD2  . HIS A 1 32  ? 24.071  8.559   17.564  1.00 0.00 ? 389 HIS A HD2  3  
ATOM   3656  H  HE1  . HIS A 1 32  ? 27.693  6.397   18.023  1.00 0.00 ? 389 HIS A HE1  3  
ATOM   3657  N  N    . LEU A 1 33  ? 20.824  4.158   17.116  1.00 0.00 ? 390 LEU A N    3  
ATOM   3658  C  CA   . LEU A 1 33  ? 19.771  3.250   16.676  1.00 0.00 ? 390 LEU A CA   3  
ATOM   3659  C  C    . LEU A 1 33  ? 18.405  3.925   16.746  1.00 0.00 ? 390 LEU A C    3  
ATOM   3660  O  O    . LEU A 1 33  ? 17.542  3.696   15.898  1.00 0.00 ? 390 LEU A O    3  
ATOM   3661  C  CB   . LEU A 1 33  ? 19.771  1.984   17.535  1.00 0.00 ? 390 LEU A CB   3  
ATOM   3662  C  CG   . LEU A 1 33  ? 18.596  1.028   17.322  1.00 0.00 ? 390 LEU A CG   3  
ATOM   3663  C  CD1  . LEU A 1 33  ? 18.631  0.444   15.919  1.00 0.00 ? 390 LEU A CD1  3  
ATOM   3664  C  CD2  . LEU A 1 33  ? 18.615  -0.081  18.364  1.00 0.00 ? 390 LEU A CD2  3  
ATOM   3665  H  H    . LEU A 1 33  ? 21.467  3.853   17.789  1.00 0.00 ? 390 LEU A H    3  
ATOM   3666  H  HA   . LEU A 1 33  ? 19.973  2.979   15.651  1.00 0.00 ? 390 LEU A HA   3  
ATOM   3667  H  HB2  . LEU A 1 33  ? 20.680  1.441   17.324  1.00 0.00 ? 390 LEU A HB2  3  
ATOM   3668  H  HB3  . LEU A 1 33  ? 19.767  2.288   18.572  1.00 0.00 ? 390 LEU A HB3  3  
ATOM   3669  H  HG   . LEU A 1 33  ? 17.670  1.576   17.432  1.00 0.00 ? 390 LEU A HG   3  
ATOM   3670  H  HD11 . LEU A 1 33  ? 19.656  0.342   15.597  1.00 0.00 ? 390 LEU A HD11 3  
ATOM   3671  H  HD12 . LEU A 1 33  ? 18.104  1.100   15.242  1.00 0.00 ? 390 LEU A HD12 3  
ATOM   3672  H  HD13 . LEU A 1 33  ? 18.155  -0.526  15.921  1.00 0.00 ? 390 LEU A HD13 3  
ATOM   3673  H  HD21 . LEU A 1 33  ? 17.644  -0.152  18.831  1.00 0.00 ? 390 LEU A HD21 3  
ATOM   3674  H  HD22 . LEU A 1 33  ? 19.359  0.143   19.114  1.00 0.00 ? 390 LEU A HD22 3  
ATOM   3675  H  HD23 . LEU A 1 33  ? 18.856  -1.019  17.887  1.00 0.00 ? 390 LEU A HD23 3  
ATOM   3676  N  N    . LYS A 1 34  ? 18.216  4.761   17.762  1.00 0.00 ? 391 LYS A N    3  
ATOM   3677  C  CA   . LYS A 1 34  ? 16.957  5.474   17.942  1.00 0.00 ? 391 LYS A CA   3  
ATOM   3678  C  C    . LYS A 1 34  ? 16.584  6.247   16.681  1.00 0.00 ? 391 LYS A C    3  
ATOM   3679  O  O    . LYS A 1 34  ? 15.458  6.149   16.192  1.00 0.00 ? 391 LYS A O    3  
ATOM   3680  C  CB   . LYS A 1 34  ? 17.055  6.433   19.131  1.00 0.00 ? 391 LYS A CB   3  
ATOM   3681  C  CG   . LYS A 1 34  ? 16.897  5.750   20.478  1.00 0.00 ? 391 LYS A CG   3  
ATOM   3682  C  CD   . LYS A 1 34  ? 17.624  6.508   21.576  1.00 0.00 ? 391 LYS A CD   3  
ATOM   3683  C  CE   . LYS A 1 34  ? 16.787  7.664   22.103  1.00 0.00 ? 391 LYS A CE   3  
ATOM   3684  N  NZ   . LYS A 1 34  ? 17.376  8.258   23.336  1.00 0.00 ? 391 LYS A NZ   3  
ATOM   3685  H  H    . LYS A 1 34  ? 18.941  4.902   18.406  1.00 0.00 ? 391 LYS A H    3  
ATOM   3686  H  HA   . LYS A 1 34  ? 16.187  4.743   18.143  1.00 0.00 ? 391 LYS A HA   3  
ATOM   3687  H  HB2  . LYS A 1 34  ? 18.020  6.918   19.107  1.00 0.00 ? 391 LYS A HB2  3  
ATOM   3688  H  HB3  . LYS A 1 34  ? 16.283  7.182   19.038  1.00 0.00 ? 391 LYS A HB3  3  
ATOM   3689  H  HG2  . LYS A 1 34  ? 15.848  5.699   20.725  1.00 0.00 ? 391 LYS A HG2  3  
ATOM   3690  H  HG3  . LYS A 1 34  ? 17.303  4.750   20.415  1.00 0.00 ? 391 LYS A HG3  3  
ATOM   3691  H  HD2  . LYS A 1 34  ? 17.836  5.831   22.390  1.00 0.00 ? 391 LYS A HD2  3  
ATOM   3692  H  HD3  . LYS A 1 34  ? 18.551  6.898   21.180  1.00 0.00 ? 391 LYS A HD3  3  
ATOM   3693  H  HE2  . LYS A 1 34  ? 16.727  8.425   21.341  1.00 0.00 ? 391 LYS A HE2  3  
ATOM   3694  H  HE3  . LYS A 1 34  ? 15.795  7.300   22.327  1.00 0.00 ? 391 LYS A HE3  3  
ATOM   3695  H  HZ1  . LYS A 1 34  ? 18.338  7.894   23.484  1.00 0.00 ? 391 LYS A HZ1  3  
ATOM   3696  H  HZ2  . LYS A 1 34  ? 16.793  8.014   24.162  1.00 0.00 ? 391 LYS A HZ2  3  
ATOM   3697  H  HZ3  . LYS A 1 34  ? 17.417  9.293   23.248  1.00 0.00 ? 391 LYS A HZ3  3  
ATOM   3698  N  N    . ALA A 1 35  ? 17.536  7.013   16.159  1.00 0.00 ? 392 ALA A N    3  
ATOM   3699  C  CA   . ALA A 1 35  ? 17.308  7.799   14.953  1.00 0.00 ? 392 ALA A CA   3  
ATOM   3700  C  C    . ALA A 1 35  ? 16.774  6.927   13.822  1.00 0.00 ? 392 ALA A C    3  
ATOM   3701  O  O    . ALA A 1 35  ? 16.224  7.432   12.842  1.00 0.00 ? 392 ALA A O    3  
ATOM   3702  C  CB   . ALA A 1 35  ? 18.592  8.494   14.526  1.00 0.00 ? 392 ALA A CB   3  
ATOM   3703  H  H    . ALA A 1 35  ? 18.413  7.049   16.595  1.00 0.00 ? 392 ALA A H    3  
ATOM   3704  H  HA   . ALA A 1 35  ? 16.575  8.560   15.184  1.00 0.00 ? 392 ALA A HA   3  
ATOM   3705  H  HB1  . ALA A 1 35  ? 18.884  8.141   13.548  1.00 0.00 ? 392 ALA A HB1  3  
ATOM   3706  H  HB2  . ALA A 1 35  ? 18.427  9.561   14.489  1.00 0.00 ? 392 ALA A HB2  3  
ATOM   3707  H  HB3  . ALA A 1 35  ? 19.374  8.275   15.237  1.00 0.00 ? 392 ALA A HB3  3  
ATOM   3708  N  N    . HIS A 1 36  ? 16.940  5.616   13.963  1.00 0.00 ? 393 HIS A N    3  
ATOM   3709  C  CA   . HIS A 1 36  ? 16.474  4.673   12.952  1.00 0.00 ? 393 HIS A CA   3  
ATOM   3710  C  C    . HIS A 1 36  ? 15.023  4.277   13.206  1.00 0.00 ? 393 HIS A C    3  
ATOM   3711  O  O    . HIS A 1 36  ? 14.180  4.359   12.311  1.00 0.00 ? 393 HIS A O    3  
ATOM   3712  C  CB   . HIS A 1 36  ? 17.361  3.428   12.939  1.00 0.00 ? 393 HIS A CB   3  
ATOM   3713  C  CG   . HIS A 1 36  ? 17.109  2.526   11.770  1.00 0.00 ? 393 HIS A CG   3  
ATOM   3714  N  ND1  . HIS A 1 36  ? 17.392  2.883   10.469  1.00 0.00 ? 393 HIS A ND1  3  
ATOM   3715  C  CD2  . HIS A 1 36  ? 16.599  1.273   11.712  1.00 0.00 ? 393 HIS A CD2  3  
ATOM   3716  C  CE1  . HIS A 1 36  ? 17.066  1.890   9.661   1.00 0.00 ? 393 HIS A CE1  3  
ATOM   3717  N  NE2  . HIS A 1 36  ? 16.583  0.901   10.390  1.00 0.00 ? 393 HIS A NE2  3  
ATOM   3718  H  H    . HIS A 1 36  ? 17.385  5.274   14.766  1.00 0.00 ? 393 HIS A H    3  
ATOM   3719  H  HA   . HIS A 1 36  ? 16.538  5.160   11.991  1.00 0.00 ? 393 HIS A HA   3  
ATOM   3720  H  HB2  . HIS A 1 36  ? 18.397  3.732   12.906  1.00 0.00 ? 393 HIS A HB2  3  
ATOM   3721  H  HB3  . HIS A 1 36  ? 17.186  2.860   13.841  1.00 0.00 ? 393 HIS A HB3  3  
ATOM   3722  H  HD1  . HIS A 1 36  ? 17.774  3.738   10.180  1.00 0.00 ? 393 HIS A HD1  3  
ATOM   3723  H  HD2  . HIS A 1 36  ? 16.267  0.676   12.550  1.00 0.00 ? 393 HIS A HD2  3  
ATOM   3724  H  HE1  . HIS A 1 36  ? 17.176  1.887   8.587   1.00 0.00 ? 393 HIS A HE1  3  
ATOM   3725  N  N    . LEU A 1 37  ? 14.738  3.846   14.430  1.00 0.00 ? 394 LEU A N    3  
ATOM   3726  C  CA   . LEU A 1 37  ? 13.389  3.436   14.802  1.00 0.00 ? 394 LEU A CA   3  
ATOM   3727  C  C    . LEU A 1 37  ? 12.375  4.521   14.455  1.00 0.00 ? 394 LEU A C    3  
ATOM   3728  O  O    . LEU A 1 37  ? 11.251  4.227   14.048  1.00 0.00 ? 394 LEU A O    3  
ATOM   3729  C  CB   . LEU A 1 37  ? 13.324  3.120   16.297  1.00 0.00 ? 394 LEU A CB   3  
ATOM   3730  C  CG   . LEU A 1 37  ? 13.759  1.712   16.706  1.00 0.00 ? 394 LEU A CG   3  
ATOM   3731  C  CD1  . LEU A 1 37  ? 13.745  1.568   18.220  1.00 0.00 ? 394 LEU A CD1  3  
ATOM   3732  C  CD2  . LEU A 1 37  ? 12.859  0.668   16.060  1.00 0.00 ? 394 LEU A CD2  3  
ATOM   3733  H  H    . LEU A 1 37  ? 15.452  3.803   15.100  1.00 0.00 ? 394 LEU A H    3  
ATOM   3734  H  HA   . LEU A 1 37  ? 13.148  2.543   14.243  1.00 0.00 ? 394 LEU A HA   3  
ATOM   3735  H  HB2  . LEU A 1 37  ? 13.961  3.824   16.811  1.00 0.00 ? 394 LEU A HB2  3  
ATOM   3736  H  HB3  . LEU A 1 37  ? 12.302  3.259   16.620  1.00 0.00 ? 394 LEU A HB3  3  
ATOM   3737  H  HG   . LEU A 1 37  ? 14.770  1.541   16.364  1.00 0.00 ? 394 LEU A HG   3  
ATOM   3738  H  HD11 . LEU A 1 37  ? 14.108  0.588   18.491  1.00 0.00 ? 394 LEU A HD11 3  
ATOM   3739  H  HD12 . LEU A 1 37  ? 12.737  1.692   18.584  1.00 0.00 ? 394 LEU A HD12 3  
ATOM   3740  H  HD13 . LEU A 1 37  ? 14.382  2.322   18.659  1.00 0.00 ? 394 LEU A HD13 3  
ATOM   3741  H  HD21 . LEU A 1 37  ? 12.689  -0.140  16.756  1.00 0.00 ? 394 LEU A HD21 3  
ATOM   3742  H  HD22 . LEU A 1 37  ? 13.335  0.284   15.171  1.00 0.00 ? 394 LEU A HD22 3  
ATOM   3743  H  HD23 . LEU A 1 37  ? 11.915  1.122   15.795  1.00 0.00 ? 394 LEU A HD23 3  
ATOM   3744  N  N    . ARG A 1 38  ? 12.780  5.776   14.618  1.00 0.00 ? 395 ARG A N    3  
ATOM   3745  C  CA   . ARG A 1 38  ? 11.907  6.905   14.321  1.00 0.00 ? 395 ARG A CA   3  
ATOM   3746  C  C    . ARG A 1 38  ? 11.286  6.763   12.935  1.00 0.00 ? 395 ARG A C    3  
ATOM   3747  O  O    . ARG A 1 38  ? 10.136  7.146   12.715  1.00 0.00 ? 395 ARG A O    3  
ATOM   3748  C  CB   . ARG A 1 38  ? 12.688  8.218   14.409  1.00 0.00 ? 395 ARG A CB   3  
ATOM   3749  C  CG   . ARG A 1 38  ? 12.974  8.662   15.834  1.00 0.00 ? 395 ARG A CG   3  
ATOM   3750  C  CD   . ARG A 1 38  ? 13.429  10.112  15.885  1.00 0.00 ? 395 ARG A CD   3  
ATOM   3751  N  NE   . ARG A 1 38  ? 12.307  11.042  15.788  1.00 0.00 ? 395 ARG A NE   3  
ATOM   3752  C  CZ   . ARG A 1 38  ? 12.377  12.318  16.151  1.00 0.00 ? 395 ARG A CZ   3  
ATOM   3753  N  NH1  . ARG A 1 38  ? 13.509  12.813  16.632  1.00 0.00 ? 395 ARG A NH1  3  
ATOM   3754  N  NH2  . ARG A 1 38  ? 11.313  13.102  16.032  1.00 0.00 ? 395 ARG A NH2  3  
ATOM   3755  H  H    . ARG A 1 38  ? 13.688  5.947   14.946  1.00 0.00 ? 395 ARG A H    3  
ATOM   3756  H  HA   . ARG A 1 38  ? 11.117  6.917   15.057  1.00 0.00 ? 395 ARG A HA   3  
ATOM   3757  H  HB2  . ARG A 1 38  ? 13.631  8.097   13.897  1.00 0.00 ? 395 ARG A HB2  3  
ATOM   3758  H  HB3  . ARG A 1 38  ? 12.119  8.994   13.920  1.00 0.00 ? 395 ARG A HB3  3  
ATOM   3759  H  HG2  . ARG A 1 38  ? 12.073  8.559   16.421  1.00 0.00 ? 395 ARG A HG2  3  
ATOM   3760  H  HG3  . ARG A 1 38  ? 13.749  8.035   16.248  1.00 0.00 ? 395 ARG A HG3  3  
ATOM   3761  H  HD2  . ARG A 1 38  ? 13.945  10.281  16.819  1.00 0.00 ? 395 ARG A HD2  3  
ATOM   3762  H  HD3  . ARG A 1 38  ? 14.106  10.292  15.063  1.00 0.00 ? 395 ARG A HD3  3  
ATOM   3763  H  HE   . ARG A 1 38  ? 11.461  10.697  15.435  1.00 0.00 ? 395 ARG A HE   3  
ATOM   3764  H  HH11 . ARG A 1 38  ? 14.313  12.225  16.721  1.00 0.00 ? 395 ARG A HH11 3  
ATOM   3765  H  HH12 . ARG A 1 38  ? 13.559  13.775  16.903  1.00 0.00 ? 395 ARG A HH12 3  
ATOM   3766  H  HH21 . ARG A 1 38  ? 10.458  12.732  15.670  1.00 0.00 ? 395 ARG A HH21 3  
ATOM   3767  H  HH22 . ARG A 1 38  ? 11.366  14.062  16.306  1.00 0.00 ? 395 ARG A HH22 3  
ATOM   3768  N  N    . THR A 1 39  ? 12.054  6.209   12.002  1.00 0.00 ? 396 THR A N    3  
ATOM   3769  C  CA   . THR A 1 39  ? 11.580  6.017   10.637  1.00 0.00 ? 396 THR A CA   3  
ATOM   3770  C  C    . THR A 1 39  ? 10.747  4.746   10.518  1.00 0.00 ? 396 THR A C    3  
ATOM   3771  O  O    . THR A 1 39  ? 9.943   4.603   9.596   1.00 0.00 ? 396 THR A O    3  
ATOM   3772  C  CB   . THR A 1 39  ? 12.752  5.944   9.641   1.00 0.00 ? 396 THR A CB   3  
ATOM   3773  O  OG1  . THR A 1 39  ? 13.536  4.772   9.891   1.00 0.00 ? 396 THR A OG1  3  
ATOM   3774  C  CG2  . THR A 1 39  ? 13.631  7.181   9.748   1.00 0.00 ? 396 THR A CG2  3  
ATOM   3775  H  H    . THR A 1 39  ? 12.961  5.923   12.239  1.00 0.00 ? 396 THR A H    3  
ATOM   3776  H  HA   . THR A 1 39  ? 10.964  6.865   10.375  1.00 0.00 ? 396 THR A HA   3  
ATOM   3777  H  HB   . THR A 1 39  ? 12.351  5.892   8.639   1.00 0.00 ? 396 THR A HB   3  
ATOM   3778  H  HG1  . THR A 1 39  ? 12.968  4.070   10.216  1.00 0.00 ? 396 THR A HG1  3  
ATOM   3779  H  HG21 . THR A 1 39  ? 14.669  6.891   9.679   1.00 0.00 ? 396 THR A HG21 3  
ATOM   3780  H  HG22 . THR A 1 39  ? 13.456  7.666   10.696  1.00 0.00 ? 396 THR A HG22 3  
ATOM   3781  H  HG23 . THR A 1 39  ? 13.393  7.862   8.945   1.00 0.00 ? 396 THR A HG23 3  
ATOM   3782  N  N    . HIS A 1 40  ? 10.943  3.825   11.456  1.00 0.00 ? 397 HIS A N    3  
ATOM   3783  C  CA   . HIS A 1 40  ? 10.208  2.565   11.456  1.00 0.00 ? 397 HIS A CA   3  
ATOM   3784  C  C    . HIS A 1 40  ? 8.919   2.689   12.262  1.00 0.00 ? 397 HIS A C    3  
ATOM   3785  O  O    . HIS A 1 40  ? 8.172   1.720   12.413  1.00 0.00 ? 397 HIS A O    3  
ATOM   3786  C  CB   . HIS A 1 40  ? 11.076  1.444   12.029  1.00 0.00 ? 397 HIS A CB   3  
ATOM   3787  C  CG   . HIS A 1 40  ? 11.952  0.784   11.008  1.00 0.00 ? 397 HIS A CG   3  
ATOM   3788  N  ND1  . HIS A 1 40  ? 11.459  0.177   9.873   1.00 0.00 ? 397 HIS A ND1  3  
ATOM   3789  C  CD2  . HIS A 1 40  ? 13.297  0.640   10.956  1.00 0.00 ? 397 HIS A CD2  3  
ATOM   3790  C  CE1  . HIS A 1 40  ? 12.462  -0.314  9.168   1.00 0.00 ? 397 HIS A CE1  3  
ATOM   3791  N  NE2  . HIS A 1 40  ? 13.589  -0.045  9.803   1.00 0.00 ? 397 HIS A NE2  3  
ATOM   3792  H  H    . HIS A 1 40  ? 11.597  3.997   12.165  1.00 0.00 ? 397 HIS A H    3  
ATOM   3793  H  HA   . HIS A 1 40  ? 9.957   2.327   10.434  1.00 0.00 ? 397 HIS A HA   3  
ATOM   3794  H  HB2  . HIS A 1 40  ? 11.713  1.850   12.800  1.00 0.00 ? 397 HIS A HB2  3  
ATOM   3795  H  HB3  . HIS A 1 40  ? 10.437  0.686   12.458  1.00 0.00 ? 397 HIS A HB3  3  
ATOM   3796  H  HD1  . HIS A 1 40  ? 10.514  0.113   9.622   1.00 0.00 ? 397 HIS A HD1  3  
ATOM   3797  H  HD2  . HIS A 1 40  ? 14.009  0.998   11.687  1.00 0.00 ? 397 HIS A HD2  3  
ATOM   3798  H  HE1  . HIS A 1 40  ? 12.377  -0.843  8.231   1.00 0.00 ? 397 HIS A HE1  3  
ATOM   3799  N  N    . THR A 1 41  ? 8.662   3.886   12.780  1.00 0.00 ? 398 THR A N    3  
ATOM   3800  C  CA   . THR A 1 41  ? 7.465   4.136   13.572  1.00 0.00 ? 398 THR A CA   3  
ATOM   3801  C  C    . THR A 1 41  ? 6.203   3.893   12.753  1.00 0.00 ? 398 THR A C    3  
ATOM   3802  O  O    . THR A 1 41  ? 5.377   3.051   13.102  1.00 0.00 ? 398 THR A O    3  
ATOM   3803  C  CB   . THR A 1 41  ? 7.441   5.577   14.116  1.00 0.00 ? 398 THR A CB   3  
ATOM   3804  O  OG1  . THR A 1 41  ? 7.630   6.508   13.044  1.00 0.00 ? 398 THR A OG1  3  
ATOM   3805  C  CG2  . THR A 1 41  ? 8.524   5.777   15.165  1.00 0.00 ? 398 THR A CG2  3  
ATOM   3806  H  H    . THR A 1 41  ? 9.295   4.618   12.625  1.00 0.00 ? 398 THR A H    3  
ATOM   3807  H  HA   . THR A 1 41  ? 7.473   3.457   14.413  1.00 0.00 ? 398 THR A HA   3  
ATOM   3808  H  HB   . THR A 1 41  ? 6.479   5.757   14.574  1.00 0.00 ? 398 THR A HB   3  
ATOM   3809  H  HG1  . THR A 1 41  ? 7.996   7.325   13.391  1.00 0.00 ? 398 THR A HG1  3  
ATOM   3810  H  HG21 . THR A 1 41  ? 9.450   5.349   14.813  1.00 0.00 ? 398 THR A HG21 3  
ATOM   3811  H  HG22 . THR A 1 41  ? 8.230   5.291   16.084  1.00 0.00 ? 398 THR A HG22 3  
ATOM   3812  H  HG23 . THR A 1 41  ? 8.661   6.833   15.344  1.00 0.00 ? 398 THR A HG23 3  
ATOM   3813  N  N    . GLY A 1 42  ? 6.060   4.637   11.660  1.00 0.00 ? 399 GLY A N    3  
ATOM   3814  C  CA   . GLY A 1 42  ? 4.896   4.486   10.807  1.00 0.00 ? 399 GLY A CA   3  
ATOM   3815  C  C    . GLY A 1 42  ? 3.883   5.596   11.008  1.00 0.00 ? 399 GLY A C    3  
ATOM   3816  O  O    . GLY A 1 42  ? 3.881   6.263   12.042  1.00 0.00 ? 399 GLY A O    3  
ATOM   3817  H  H    . GLY A 1 42  ? 6.752   5.293   11.431  1.00 0.00 ? 399 GLY A H    3  
ATOM   3818  H  HA2  . GLY A 1 42  ? 5.216   4.488   9.776   1.00 0.00 ? 399 GLY A HA2  3  
ATOM   3819  H  HA3  . GLY A 1 42  ? 4.423   3.540   11.026  1.00 0.00 ? 399 GLY A HA3  3  
ATOM   3820  N  N    . GLU A 1 43  ? 3.020   5.794   10.017  1.00 0.00 ? 400 GLU A N    3  
ATOM   3821  C  CA   . GLU A 1 43  ? 1.999   6.833   10.090  1.00 0.00 ? 400 GLU A CA   3  
ATOM   3822  C  C    . GLU A 1 43  ? 0.672   6.259   10.577  1.00 0.00 ? 400 GLU A C    3  
ATOM   3823  O  O    . GLU A 1 43  ? 0.087   5.385   9.936   1.00 0.00 ? 400 GLU A O    3  
ATOM   3824  C  CB   . GLU A 1 43  ? 1.810   7.491   8.721   1.00 0.00 ? 400 GLU A CB   3  
ATOM   3825  C  CG   . GLU A 1 43  ? 1.301   6.538   7.653   1.00 0.00 ? 400 GLU A CG   3  
ATOM   3826  C  CD   . GLU A 1 43  ? 1.538   7.057   6.248   1.00 0.00 ? 400 GLU A CD   3  
ATOM   3827  O  OE1  . GLU A 1 43  ? 2.716   7.218   5.866   1.00 0.00 ? 400 GLU A OE1  3  
ATOM   3828  O  OE2  . GLU A 1 43  ? 0.545   7.301   5.530   1.00 0.00 ? 400 GLU A OE2  3  
ATOM   3829  H  H    . GLU A 1 43  ? 3.071   5.230   9.217   1.00 0.00 ? 400 GLU A H    3  
ATOM   3830  H  HA   . GLU A 1 43  ? 2.335   7.579   10.794  1.00 0.00 ? 400 GLU A HA   3  
ATOM   3831  H  HB2  . GLU A 1 43  ? 1.103   8.301   8.819   1.00 0.00 ? 400 GLU A HB2  3  
ATOM   3832  H  HB3  . GLU A 1 43  ? 2.759   7.891   8.394   1.00 0.00 ? 400 GLU A HB3  3  
ATOM   3833  H  HG2  . GLU A 1 43  ? 1.809   5.591   7.761   1.00 0.00 ? 400 GLU A HG2  3  
ATOM   3834  H  HG3  . GLU A 1 43  ? 0.240   6.394   7.794   1.00 0.00 ? 400 GLU A HG3  3  
ATOM   3835  N  N    . LYS A 1 44  ? 0.203   6.755   11.717  1.00 0.00 ? 401 LYS A N    3  
ATOM   3836  C  CA   . LYS A 1 44  ? -1.055  6.293   12.292  1.00 0.00 ? 401 LYS A CA   3  
ATOM   3837  C  C    . LYS A 1 44  ? -2.121  7.382   12.216  1.00 0.00 ? 401 LYS A C    3  
ATOM   3838  O  O    . LYS A 1 44  ? -2.330  8.147   13.157  1.00 0.00 ? 401 LYS A O    3  
ATOM   3839  C  CB   . LYS A 1 44  ? -0.848  5.869   13.748  1.00 0.00 ? 401 LYS A CB   3  
ATOM   3840  C  CG   . LYS A 1 44  ? 0.067   4.667   13.907  1.00 0.00 ? 401 LYS A CG   3  
ATOM   3841  C  CD   . LYS A 1 44  ? 0.117   4.192   15.350  1.00 0.00 ? 401 LYS A CD   3  
ATOM   3842  C  CE   . LYS A 1 44  ? 1.177   4.937   16.146  1.00 0.00 ? 401 LYS A CE   3  
ATOM   3843  N  NZ   . LYS A 1 44  ? 2.553   4.611   15.679  1.00 0.00 ? 401 LYS A NZ   3  
ATOM   3844  H  H    . LYS A 1 44  ? 0.715   7.450   12.182  1.00 0.00 ? 401 LYS A H    3  
ATOM   3845  H  HA   . LYS A 1 44  ? -1.388  5.440   11.721  1.00 0.00 ? 401 LYS A HA   3  
ATOM   3846  H  HB2  . LYS A 1 44  ? -0.420  6.696   14.294  1.00 0.00 ? 401 LYS A HB2  3  
ATOM   3847  H  HB3  . LYS A 1 44  ? -1.809  5.623   14.179  1.00 0.00 ? 401 LYS A HB3  3  
ATOM   3848  H  HG2  . LYS A 1 44  ? -0.299  3.862   13.287  1.00 0.00 ? 401 LYS A HG2  3  
ATOM   3849  H  HG3  . LYS A 1 44  ? 1.064   4.942   13.593  1.00 0.00 ? 401 LYS A HG3  3  
ATOM   3850  H  HD2  . LYS A 1 44  ? -0.846  4.360   15.809  1.00 0.00 ? 401 LYS A HD2  3  
ATOM   3851  H  HD3  . LYS A 1 44  ? 0.346   3.135   15.364  1.00 0.00 ? 401 LYS A HD3  3  
ATOM   3852  H  HE2  . LYS A 1 44  ? 1.012   5.998   16.036  1.00 0.00 ? 401 LYS A HE2  3  
ATOM   3853  H  HE3  . LYS A 1 44  ? 1.085   4.665   17.187  1.00 0.00 ? 401 LYS A HE3  3  
ATOM   3854  H  HZ1  . LYS A 1 44  ? 2.543   4.390   14.663  1.00 0.00 ? 401 LYS A HZ1  3  
ATOM   3855  H  HZ2  . LYS A 1 44  ? 2.920   3.788   16.198  1.00 0.00 ? 401 LYS A HZ2  3  
ATOM   3856  H  HZ3  . LYS A 1 44  ? 3.187   5.419   15.841  1.00 0.00 ? 401 LYS A HZ3  3  
ATOM   3857  N  N    . PRO A 1 45  ? -2.812  7.454   11.069  1.00 0.00 ? 402 PRO A N    3  
ATOM   3858  C  CA   . PRO A 1 45  ? -3.869  8.445   10.843  1.00 0.00 ? 402 PRO A CA   3  
ATOM   3859  C  C    . PRO A 1 45  ? -5.109  8.172   11.687  1.00 0.00 ? 402 PRO A C    3  
ATOM   3860  O  O    . PRO A 1 45  ? -5.925  9.065   11.916  1.00 0.00 ? 402 PRO A O    3  
ATOM   3861  C  CB   . PRO A 1 45  ? -4.191  8.287   9.354   1.00 0.00 ? 402 PRO A CB   3  
ATOM   3862  C  CG   . PRO A 1 45  ? -3.797  6.888   9.028   1.00 0.00 ? 402 PRO A CG   3  
ATOM   3863  C  CD   . PRO A 1 45  ? -2.616  6.575   9.904   1.00 0.00 ? 402 PRO A CD   3  
ATOM   3864  H  HA   . PRO A 1 45  ? -3.519  9.449   11.033  1.00 0.00 ? 402 PRO A HA   3  
ATOM   3865  H  HB2  . PRO A 1 45  ? -5.247  8.450   9.193   1.00 0.00 ? 402 PRO A HB2  3  
ATOM   3866  H  HB3  . PRO A 1 45  ? -3.619  9.002   8.782   1.00 0.00 ? 402 PRO A HB3  3  
ATOM   3867  H  HG2  . PRO A 1 45  ? -4.614  6.217   9.245   1.00 0.00 ? 402 PRO A HG2  3  
ATOM   3868  H  HG3  . PRO A 1 45  ? -3.520  6.819   7.986   1.00 0.00 ? 402 PRO A HG3  3  
ATOM   3869  H  HD2  . PRO A 1 45  ? -2.630  5.536   10.199  1.00 0.00 ? 402 PRO A HD2  3  
ATOM   3870  H  HD3  . PRO A 1 45  ? -1.694  6.812   9.394   1.00 0.00 ? 402 PRO A HD3  3  
ATOM   3871  N  N    . TYR A 1 46  ? -5.245  6.933   12.148  1.00 0.00 ? 403 TYR A N    3  
ATOM   3872  C  CA   . TYR A 1 46  ? -6.387  6.543   12.966  1.00 0.00 ? 403 TYR A CA   3  
ATOM   3873  C  C    . TYR A 1 46  ? -6.194  6.979   14.415  1.00 0.00 ? 403 TYR A C    3  
ATOM   3874  O  O    . TYR A 1 46  ? -5.331  6.460   15.123  1.00 0.00 ? 403 TYR A O    3  
ATOM   3875  C  CB   . TYR A 1 46  ? -6.593  5.028   12.901  1.00 0.00 ? 403 TYR A CB   3  
ATOM   3876  C  CG   . TYR A 1 46  ? -6.890  4.517   11.510  1.00 0.00 ? 403 TYR A CG   3  
ATOM   3877  C  CD1  . TYR A 1 46  ? -8.148  4.680   10.942  1.00 0.00 ? 403 TYR A CD1  3  
ATOM   3878  C  CD2  . TYR A 1 46  ? -5.914  3.869   10.763  1.00 0.00 ? 403 TYR A CD2  3  
ATOM   3879  C  CE1  . TYR A 1 46  ? -8.424  4.214   9.671   1.00 0.00 ? 403 TYR A CE1  3  
ATOM   3880  C  CE2  . TYR A 1 46  ? -6.181  3.401   9.491   1.00 0.00 ? 403 TYR A CE2  3  
ATOM   3881  C  CZ   . TYR A 1 46  ? -7.438  3.575   8.950   1.00 0.00 ? 403 TYR A CZ   3  
ATOM   3882  O  OH   . TYR A 1 46  ? -7.708  3.109   7.684   1.00 0.00 ? 403 TYR A OH   3  
ATOM   3883  H  H    . TYR A 1 46  ? -4.561  6.265   11.932  1.00 0.00 ? 403 TYR A H    3  
ATOM   3884  H  HA   . TYR A 1 46  ? -7.263  7.033   12.567  1.00 0.00 ? 403 TYR A HA   3  
ATOM   3885  H  HB2  . TYR A 1 46  ? -5.700  4.535   13.251  1.00 0.00 ? 403 TYR A HB2  3  
ATOM   3886  H  HB3  . TYR A 1 46  ? -7.422  4.757   13.539  1.00 0.00 ? 403 TYR A HB3  3  
ATOM   3887  H  HD1  . TYR A 1 46  ? -8.919  5.181   11.510  1.00 0.00 ? 403 TYR A HD1  3  
ATOM   3888  H  HD2  . TYR A 1 46  ? -4.931  3.733   11.190  1.00 0.00 ? 403 TYR A HD2  3  
ATOM   3889  H  HE1  . TYR A 1 46  ? -9.408  4.350   9.247   1.00 0.00 ? 403 TYR A HE1  3  
ATOM   3890  H  HE2  . TYR A 1 46  ? -5.409  2.900   8.926   1.00 0.00 ? 403 TYR A HE2  3  
ATOM   3891  H  HH   . TYR A 1 46  ? -6.883  2.935   7.224   1.00 0.00 ? 403 TYR A HH   3  
ATOM   3892  N  N    . LYS A 1 47  ? -7.005  7.938   14.849  1.00 0.00 ? 404 LYS A N    3  
ATOM   3893  C  CA   . LYS A 1 47  ? -6.927  8.446   16.214  1.00 0.00 ? 404 LYS A CA   3  
ATOM   3894  C  C    . LYS A 1 47  ? -8.256  8.260   16.940  1.00 0.00 ? 404 LYS A C    3  
ATOM   3895  O  O    . LYS A 1 47  ? -9.306  8.677   16.450  1.00 0.00 ? 404 LYS A O    3  
ATOM   3896  C  CB   . LYS A 1 47  ? -6.540  9.926   16.208  1.00 0.00 ? 404 LYS A CB   3  
ATOM   3897  C  CG   . LYS A 1 47  ? -6.260  10.487  17.592  1.00 0.00 ? 404 LYS A CG   3  
ATOM   3898  C  CD   . LYS A 1 47  ? -7.516  11.060  18.226  1.00 0.00 ? 404 LYS A CD   3  
ATOM   3899  C  CE   . LYS A 1 47  ? -7.193  11.858  19.480  1.00 0.00 ? 404 LYS A CE   3  
ATOM   3900  N  NZ   . LYS A 1 47  ? -6.505  11.025  20.505  1.00 0.00 ? 404 LYS A NZ   3  
ATOM   3901  H  H    . LYS A 1 47  ? -7.673  8.313   14.237  1.00 0.00 ? 404 LYS A H    3  
ATOM   3902  H  HA   . LYS A 1 47  ? -6.165  7.885   16.734  1.00 0.00 ? 404 LYS A HA   3  
ATOM   3903  H  HB2  . LYS A 1 47  ? -5.653  10.052  15.605  1.00 0.00 ? 404 LYS A HB2  3  
ATOM   3904  H  HB3  . LYS A 1 47  ? -7.347  10.495  15.769  1.00 0.00 ? 404 LYS A HB3  3  
ATOM   3905  H  HG2  . LYS A 1 47  ? -5.880  9.696   18.221  1.00 0.00 ? 404 LYS A HG2  3  
ATOM   3906  H  HG3  . LYS A 1 47  ? -5.520  11.271  17.509  1.00 0.00 ? 404 LYS A HG3  3  
ATOM   3907  H  HD2  . LYS A 1 47  ? -8.003  11.711  17.515  1.00 0.00 ? 404 LYS A HD2  3  
ATOM   3908  H  HD3  . LYS A 1 47  ? -8.180  10.248  18.487  1.00 0.00 ? 404 LYS A HD3  3  
ATOM   3909  H  HE2  . LYS A 1 47  ? -6.553  12.684  19.211  1.00 0.00 ? 404 LYS A HE2  3  
ATOM   3910  H  HE3  . LYS A 1 47  ? -8.115  12.237  19.897  1.00 0.00 ? 404 LYS A HE3  3  
ATOM   3911  H  HZ1  . LYS A 1 47  ? -6.927  11.188  21.441  1.00 0.00 ? 404 LYS A HZ1  3  
ATOM   3912  H  HZ2  . LYS A 1 47  ? -5.495  11.270  20.544  1.00 0.00 ? 404 LYS A HZ2  3  
ATOM   3913  H  HZ3  . LYS A 1 47  ? -6.596  10.017  20.266  1.00 0.00 ? 404 LYS A HZ3  3  
ATOM   3914  N  N    . CYS A 1 48  ? -8.203  7.633   18.110  1.00 0.00 ? 405 CYS A N    3  
ATOM   3915  C  CA   . CYS A 1 48  ? -9.402  7.393   18.905  1.00 0.00 ? 405 CYS A CA   3  
ATOM   3916  C  C    . CYS A 1 48  ? -10.148 8.697   19.170  1.00 0.00 ? 405 CYS A C    3  
ATOM   3917  O  O    . CYS A 1 48  ? -9.685  9.548   19.930  1.00 0.00 ? 405 CYS A O    3  
ATOM   3918  C  CB   . CYS A 1 48  ? -9.034  6.724   20.231  1.00 0.00 ? 405 CYS A CB   3  
ATOM   3919  S  SG   . CYS A 1 48  ? -10.462 6.067   21.152  1.00 0.00 ? 405 CYS A SG   3  
ATOM   3920  H  H    . CYS A 1 48  ? -7.336  7.324   18.449  1.00 0.00 ? 405 CYS A H    3  
ATOM   3921  H  HA   . CYS A 1 48  ? -10.045 6.732   18.344  1.00 0.00 ? 405 CYS A HA   3  
ATOM   3922  H  HB2  . CYS A 1 48  ? -8.363  5.900   20.035  1.00 0.00 ? 405 CYS A HB2  3  
ATOM   3923  H  HB3  . CYS A 1 48  ? -8.537  7.444   20.863  1.00 0.00 ? 405 CYS A HB3  3  
ATOM   3924  N  N    . THR A 1 49  ? -11.309 8.847   18.539  1.00 0.00 ? 406 THR A N    3  
ATOM   3925  C  CA   . THR A 1 49  ? -12.120 10.046  18.706  1.00 0.00 ? 406 THR A CA   3  
ATOM   3926  C  C    . THR A 1 49  ? -12.849 10.035  20.045  1.00 0.00 ? 406 THR A C    3  
ATOM   3927  O  O    . THR A 1 49  ? -14.051 10.293  20.109  1.00 0.00 ? 406 THR A O    3  
ATOM   3928  C  CB   . THR A 1 49  ? -13.154 10.187  17.573  1.00 0.00 ? 406 THR A CB   3  
ATOM   3929  O  OG1  . THR A 1 49  ? -13.922 8.984   17.458  1.00 0.00 ? 406 THR A OG1  3  
ATOM   3930  C  CG2  . THR A 1 49  ? -12.467 10.485  16.248  1.00 0.00 ? 406 THR A CG2  3  
ATOM   3931  H  H    . THR A 1 49  ? -11.626 8.133   17.947  1.00 0.00 ? 406 THR A H    3  
ATOM   3932  H  HA   . THR A 1 49  ? -11.462 10.902  18.673  1.00 0.00 ? 406 THR A HA   3  
ATOM   3933  H  HB   . THR A 1 49  ? -13.816 11.007  17.810  1.00 0.00 ? 406 THR A HB   3  
ATOM   3934  H  HG1  . THR A 1 49  ? -13.823 8.464   18.259  1.00 0.00 ? 406 THR A HG1  3  
ATOM   3935  H  HG21 . THR A 1 49  ? -12.205 11.531  16.206  1.00 0.00 ? 406 THR A HG21 3  
ATOM   3936  H  HG22 . THR A 1 49  ? -13.137 10.249  15.434  1.00 0.00 ? 406 THR A HG22 3  
ATOM   3937  H  HG23 . THR A 1 49  ? -11.573 9.885   16.164  1.00 0.00 ? 406 THR A HG23 3  
ATOM   3938  N  N    . TRP A 1 50  ? -12.115 9.736   21.110  1.00 0.00 ? 407 TRP A N    3  
ATOM   3939  C  CA   . TRP A 1 50  ? -12.693 9.693   22.449  1.00 0.00 ? 407 TRP A CA   3  
ATOM   3940  C  C    . TRP A 1 50  ? -12.237 10.888  23.278  1.00 0.00 ? 407 TRP A C    3  
ATOM   3941  O  O    . TRP A 1 50  ? -11.225 11.517  22.971  1.00 0.00 ? 407 TRP A O    3  
ATOM   3942  C  CB   . TRP A 1 50  ? -12.305 8.391   23.152  1.00 0.00 ? 407 TRP A CB   3  
ATOM   3943  C  CG   . TRP A 1 50  ? -13.295 7.959   24.191  1.00 0.00 ? 407 TRP A CG   3  
ATOM   3944  C  CD1  . TRP A 1 50  ? -13.183 8.111   25.543  1.00 0.00 ? 407 TRP A CD1  3  
ATOM   3945  C  CD2  . TRP A 1 50  ? -14.547 7.303   23.962  1.00 0.00 ? 407 TRP A CD2  3  
ATOM   3946  N  NE1  . TRP A 1 50  ? -14.289 7.589   26.169  1.00 0.00 ? 407 TRP A NE1  3  
ATOM   3947  C  CE2  . TRP A 1 50  ? -15.141 7.088   25.221  1.00 0.00 ? 407 TRP A CE2  3  
ATOM   3948  C  CE3  . TRP A 1 50  ? -15.224 6.878   22.816  1.00 0.00 ? 407 TRP A CE3  3  
ATOM   3949  C  CZ2  . TRP A 1 50  ? -16.379 6.466   25.363  1.00 0.00 ? 407 TRP A CZ2  3  
ATOM   3950  C  CZ3  . TRP A 1 50  ? -16.452 6.261   22.958  1.00 0.00 ? 407 TRP A CZ3  3  
ATOM   3951  C  CH2  . TRP A 1 50  ? -17.020 6.060   24.224  1.00 0.00 ? 407 TRP A CH2  3  
ATOM   3952  H  H    . TRP A 1 50  ? -11.162 9.540   20.995  1.00 0.00 ? 407 TRP A H    3  
ATOM   3953  H  HA   . TRP A 1 50  ? -13.768 9.729   22.346  1.00 0.00 ? 407 TRP A HA   3  
ATOM   3954  H  HB2  . TRP A 1 50  ? -12.226 7.602   22.419  1.00 0.00 ? 407 TRP A HB2  3  
ATOM   3955  H  HB3  . TRP A 1 50  ? -11.349 8.524   23.637  1.00 0.00 ? 407 TRP A HB3  3  
ATOM   3956  H  HD1  . TRP A 1 50  ? -12.341 8.574   26.035  1.00 0.00 ? 407 TRP A HD1  3  
ATOM   3957  H  HE1  . TRP A 1 50  ? -14.443 7.579   27.137  1.00 0.00 ? 407 TRP A HE1  3  
ATOM   3958  H  HE3  . TRP A 1 50  ? -14.804 7.024   21.832  1.00 0.00 ? 407 TRP A HE3  3  
ATOM   3959  H  HZ2  . TRP A 1 50  ? -16.830 6.305   26.331  1.00 0.00 ? 407 TRP A HZ2  3  
ATOM   3960  H  HZ3  . TRP A 1 50  ? -16.991 5.925   22.084  1.00 0.00 ? 407 TRP A HZ3  3  
ATOM   3961  H  HH2  . TRP A 1 50  ? -17.981 5.574   24.288  1.00 0.00 ? 407 TRP A HH2  3  
ATOM   3962  N  N    . GLU A 1 51  ? -12.990 11.196  24.329  1.00 0.00 ? 408 GLU A N    3  
ATOM   3963  C  CA   . GLU A 1 51  ? -12.662 12.317  25.201  1.00 0.00 ? 408 GLU A CA   3  
ATOM   3964  C  C    . GLU A 1 51  ? -11.630 11.908  26.248  1.00 0.00 ? 408 GLU A C    3  
ATOM   3965  O  O    . GLU A 1 51  ? -11.923 11.128  27.153  1.00 0.00 ? 408 GLU A O    3  
ATOM   3966  C  CB   . GLU A 1 51  ? -13.923 12.843  25.890  1.00 0.00 ? 408 GLU A CB   3  
ATOM   3967  C  CG   . GLU A 1 51  ? -13.788 14.266  26.404  1.00 0.00 ? 408 GLU A CG   3  
ATOM   3968  C  CD   . GLU A 1 51  ? -15.108 14.843  26.878  1.00 0.00 ? 408 GLU A CD   3  
ATOM   3969  O  OE1  . GLU A 1 51  ? -15.894 15.302  26.024  1.00 0.00 ? 408 GLU A OE1  3  
ATOM   3970  O  OE2  . GLU A 1 51  ? -15.354 14.836  28.102  1.00 0.00 ? 408 GLU A OE2  3  
ATOM   3971  H  H    . GLU A 1 51  ? -13.786 10.657  24.522  1.00 0.00 ? 408 GLU A H    3  
ATOM   3972  H  HA   . GLU A 1 51  ? -12.244 13.102  24.589  1.00 0.00 ? 408 GLU A HA   3  
ATOM   3973  H  HB2  . GLU A 1 51  ? -14.743 12.812  25.187  1.00 0.00 ? 408 GLU A HB2  3  
ATOM   3974  H  HB3  . GLU A 1 51  ? -14.155 12.201  26.727  1.00 0.00 ? 408 GLU A HB3  3  
ATOM   3975  H  HG2  . GLU A 1 51  ? -13.093 14.272  27.231  1.00 0.00 ? 408 GLU A HG2  3  
ATOM   3976  H  HG3  . GLU A 1 51  ? -13.405 14.888  25.609  1.00 0.00 ? 408 GLU A HG3  3  
ATOM   3977  N  N    . GLY A 1 52  ? -10.419 12.441  26.117  1.00 0.00 ? 409 GLY A N    3  
ATOM   3978  C  CA   . GLY A 1 52  ? -9.361  12.120  27.057  1.00 0.00 ? 409 GLY A CA   3  
ATOM   3979  C  C    . GLY A 1 52  ? -8.349  11.149  26.481  1.00 0.00 ? 409 GLY A C    3  
ATOM   3980  O  O    . GLY A 1 52  ? -7.154  11.246  26.763  1.00 0.00 ? 409 GLY A O    3  
ATOM   3981  H  H    . GLY A 1 52  ? -10.242 13.058  25.375  1.00 0.00 ? 409 GLY A H    3  
ATOM   3982  H  HA2  . GLY A 1 52  ? -8.853  13.031  27.335  1.00 0.00 ? 409 GLY A HA2  3  
ATOM   3983  H  HA3  . GLY A 1 52  ? -9.801  11.682  27.940  1.00 0.00 ? 409 GLY A HA3  3  
ATOM   3984  N  N    . CYS A 1 53  ? -8.827  10.208  25.674  1.00 0.00 ? 410 CYS A N    3  
ATOM   3985  C  CA   . CYS A 1 53  ? -7.957  9.214   25.059  1.00 0.00 ? 410 CYS A CA   3  
ATOM   3986  C  C    . CYS A 1 53  ? -6.987  9.870   24.081  1.00 0.00 ? 410 CYS A C    3  
ATOM   3987  O  O    . CYS A 1 53  ? -7.365  10.757  23.316  1.00 0.00 ? 410 CYS A O    3  
ATOM   3988  C  CB   . CYS A 1 53  ? -8.790  8.155   24.334  1.00 0.00 ? 410 CYS A CB   3  
ATOM   3989  S  SG   . CYS A 1 53  ? -7.822  6.742   23.714  1.00 0.00 ? 410 CYS A SG   3  
ATOM   3990  H  H    . CYS A 1 53  ? -9.790  10.182  25.487  1.00 0.00 ? 410 CYS A H    3  
ATOM   3991  H  HA   . CYS A 1 53  ? -7.390  8.737   25.844  1.00 0.00 ? 410 CYS A HA   3  
ATOM   3992  H  HB2  . CYS A 1 53  ? -9.536  7.768   25.013  1.00 0.00 ? 410 CYS A HB2  3  
ATOM   3993  H  HB3  . CYS A 1 53  ? -9.283  8.612   23.489  1.00 0.00 ? 410 CYS A HB3  3  
ATOM   3994  N  N    . ASP A 1 54  ? -5.735  9.427   24.112  1.00 0.00 ? 411 ASP A N    3  
ATOM   3995  C  CA   . ASP A 1 54  ? -4.710  9.970   23.228  1.00 0.00 ? 411 ASP A CA   3  
ATOM   3996  C  C    . ASP A 1 54  ? -3.960  8.849   22.513  1.00 0.00 ? 411 ASP A C    3  
ATOM   3997  O  O    . ASP A 1 54  ? -2.765  8.965   22.240  1.00 0.00 ? 411 ASP A O    3  
ATOM   3998  C  CB   . ASP A 1 54  ? -3.727  10.833  24.020  1.00 0.00 ? 411 ASP A CB   3  
ATOM   3999  C  CG   . ASP A 1 54  ? -2.772  11.595  23.123  1.00 0.00 ? 411 ASP A CG   3  
ATOM   4000  O  OD1  . ASP A 1 54  ? -3.133  12.705  22.678  1.00 0.00 ? 411 ASP A OD1  3  
ATOM   4001  O  OD2  . ASP A 1 54  ? -1.662  11.083  22.868  1.00 0.00 ? 411 ASP A OD2  3  
ATOM   4002  H  H    . ASP A 1 54  ? -5.494  8.717   24.744  1.00 0.00 ? 411 ASP A H    3  
ATOM   4003  H  HA   . ASP A 1 54  ? -5.200  10.585  22.489  1.00 0.00 ? 411 ASP A HA   3  
ATOM   4004  H  HB2  . ASP A 1 54  ? -4.282  11.547  24.612  1.00 0.00 ? 411 ASP A HB2  3  
ATOM   4005  H  HB3  . ASP A 1 54  ? -3.149  10.199  24.676  1.00 0.00 ? 411 ASP A HB3  3  
ATOM   4006  N  N    . TRP A 1 55  ? -4.668  7.767   22.215  1.00 0.00 ? 412 TRP A N    3  
ATOM   4007  C  CA   . TRP A 1 55  ? -4.069  6.625   21.533  1.00 0.00 ? 412 TRP A CA   3  
ATOM   4008  C  C    . TRP A 1 55  ? -4.333  6.687   20.033  1.00 0.00 ? 412 TRP A C    3  
ATOM   4009  O  O    . TRP A 1 55  ? -5.184  7.449   19.574  1.00 0.00 ? 412 TRP A O    3  
ATOM   4010  C  CB   . TRP A 1 55  ? -4.617  5.317   22.107  1.00 0.00 ? 412 TRP A CB   3  
ATOM   4011  C  CG   . TRP A 1 55  ? -3.827  4.803   23.272  1.00 0.00 ? 412 TRP A CG   3  
ATOM   4012  C  CD1  . TRP A 1 55  ? -4.173  4.872   24.592  1.00 0.00 ? 412 TRP A CD1  3  
ATOM   4013  C  CD2  . TRP A 1 55  ? -2.557  4.143   23.223  1.00 0.00 ? 412 TRP A CD2  3  
ATOM   4014  N  NE1  . TRP A 1 55  ? -3.195  4.294   25.365  1.00 0.00 ? 412 TRP A NE1  3  
ATOM   4015  C  CE2  . TRP A 1 55  ? -2.193  3.839   24.549  1.00 0.00 ? 412 TRP A CE2  3  
ATOM   4016  C  CE3  . TRP A 1 55  ? -1.693  3.778   22.187  1.00 0.00 ? 412 TRP A CE3  3  
ATOM   4017  C  CZ2  . TRP A 1 55  ? -1.003  3.189   24.864  1.00 0.00 ? 412 TRP A CZ2  3  
ATOM   4018  C  CZ3  . TRP A 1 55  ? -0.512  3.133   22.501  1.00 0.00 ? 412 TRP A CZ3  3  
ATOM   4019  C  CH2  . TRP A 1 55  ? -0.176  2.843   23.830  1.00 0.00 ? 412 TRP A CH2  3  
ATOM   4020  H  H    . TRP A 1 55  ? -5.617  7.734   22.459  1.00 0.00 ? 412 TRP A H    3  
ATOM   4021  H  HA   . TRP A 1 55  ? -3.003  6.662   21.701  1.00 0.00 ? 412 TRP A HA   3  
ATOM   4022  H  HB2  . TRP A 1 55  ? -5.633  5.474   22.436  1.00 0.00 ? 412 TRP A HB2  3  
ATOM   4023  H  HB3  . TRP A 1 55  ? -4.604  4.561   21.335  1.00 0.00 ? 412 TRP A HB3  3  
ATOM   4024  H  HD1  . TRP A 1 55  ? -5.084  5.319   24.958  1.00 0.00 ? 412 TRP A HD1  3  
ATOM   4025  H  HE1  . TRP A 1 55  ? -3.213  4.220   26.342  1.00 0.00 ? 412 TRP A HE1  3  
ATOM   4026  H  HE3  . TRP A 1 55  ? -1.934  3.993   21.156  1.00 0.00 ? 412 TRP A HE3  3  
ATOM   4027  H  HZ2  . TRP A 1 55  ? -0.730  2.958   25.883  1.00 0.00 ? 412 TRP A HZ2  3  
ATOM   4028  H  HZ3  . TRP A 1 55  ? 0.169   2.843   21.714  1.00 0.00 ? 412 TRP A HZ3  3  
ATOM   4029  H  HH2  . TRP A 1 55  ? 0.756   2.338   24.029  1.00 0.00 ? 412 TRP A HH2  3  
ATOM   4030  N  N    . ARG A 1 56  ? -3.600  5.880   19.274  1.00 0.00 ? 413 ARG A N    3  
ATOM   4031  C  CA   . ARG A 1 56  ? -3.755  5.844   17.824  1.00 0.00 ? 413 ARG A CA   3  
ATOM   4032  C  C    . ARG A 1 56  ? -3.380  4.472   17.271  1.00 0.00 ? 413 ARG A C    3  
ATOM   4033  O  O    . ARG A 1 56  ? -2.887  3.611   18.000  1.00 0.00 ? 413 ARG A O    3  
ATOM   4034  C  CB   . ARG A 1 56  ? -2.890  6.923   17.171  1.00 0.00 ? 413 ARG A CB   3  
ATOM   4035  C  CG   . ARG A 1 56  ? -3.243  8.335   17.609  1.00 0.00 ? 413 ARG A CG   3  
ATOM   4036  C  CD   . ARG A 1 56  ? -2.576  9.376   16.724  1.00 0.00 ? 413 ARG A CD   3  
ATOM   4037  N  NE   . ARG A 1 56  ? -2.849  10.737  17.178  1.00 0.00 ? 413 ARG A NE   3  
ATOM   4038  C  CZ   . ARG A 1 56  ? -2.160  11.799  16.776  1.00 0.00 ? 413 ARG A CZ   3  
ATOM   4039  N  NH1  . ARG A 1 56  ? -1.161  11.658  15.916  1.00 0.00 ? 413 ARG A NH1  3  
ATOM   4040  N  NH2  . ARG A 1 56  ? -2.469  13.005  17.235  1.00 0.00 ? 413 ARG A NH2  3  
ATOM   4041  H  H    . ARG A 1 56  ? -2.937  5.295   19.698  1.00 0.00 ? 413 ARG A H    3  
ATOM   4042  H  HA   . ARG A 1 56  ? -4.792  6.040   17.597  1.00 0.00 ? 413 ARG A HA   3  
ATOM   4043  H  HB2  . ARG A 1 56  ? -1.856  6.740   17.422  1.00 0.00 ? 413 ARG A HB2  3  
ATOM   4044  H  HB3  . ARG A 1 56  ? -3.008  6.862   16.099  1.00 0.00 ? 413 ARG A HB3  3  
ATOM   4045  H  HG2  . ARG A 1 56  ? -4.314  8.463   17.550  1.00 0.00 ? 413 ARG A HG2  3  
ATOM   4046  H  HG3  . ARG A 1 56  ? -2.917  8.478   18.628  1.00 0.00 ? 413 ARG A HG3  3  
ATOM   4047  H  HD2  . ARG A 1 56  ? -1.509  9.210   16.738  1.00 0.00 ? 413 ARG A HD2  3  
ATOM   4048  H  HD3  . ARG A 1 56  ? -2.944  9.262   15.716  1.00 0.00 ? 413 ARG A HD3  3  
ATOM   4049  H  HE   . ARG A 1 56  ? -3.583  10.864  17.815  1.00 0.00 ? 413 ARG A HE   3  
ATOM   4050  H  HH11 . ARG A 1 56  ? -0.926  10.750  15.568  1.00 0.00 ? 413 ARG A HH11 3  
ATOM   4051  H  HH12 . ARG A 1 56  ? -0.644  12.459  15.613  1.00 0.00 ? 413 ARG A HH12 3  
ATOM   4052  H  HH21 . ARG A 1 56  ? -3.222  13.115  17.883  1.00 0.00 ? 413 ARG A HH21 3  
ATOM   4053  H  HH22 . ARG A 1 56  ? -1.950  13.803  16.931  1.00 0.00 ? 413 ARG A HH22 3  
ATOM   4054  N  N    . PHE A 1 57  ? -3.618  4.276   15.978  1.00 0.00 ? 414 PHE A N    3  
ATOM   4055  C  CA   . PHE A 1 57  ? -3.307  3.009   15.327  1.00 0.00 ? 414 PHE A CA   3  
ATOM   4056  C  C    . PHE A 1 57  ? -3.022  3.216   13.843  1.00 0.00 ? 414 PHE A C    3  
ATOM   4057  O  O    . PHE A 1 57  ? -3.504  4.171   13.234  1.00 0.00 ? 414 PHE A O    3  
ATOM   4058  C  CB   . PHE A 1 57  ? -4.464  2.023   15.503  1.00 0.00 ? 414 PHE A CB   3  
ATOM   4059  C  CG   . PHE A 1 57  ? -4.751  1.685   16.938  1.00 0.00 ? 414 PHE A CG   3  
ATOM   4060  C  CD1  . PHE A 1 57  ? -5.523  2.528   17.722  1.00 0.00 ? 414 PHE A CD1  3  
ATOM   4061  C  CD2  . PHE A 1 57  ? -4.248  0.524   17.504  1.00 0.00 ? 414 PHE A CD2  3  
ATOM   4062  C  CE1  . PHE A 1 57  ? -5.787  2.219   19.043  1.00 0.00 ? 414 PHE A CE1  3  
ATOM   4063  C  CE2  . PHE A 1 57  ? -4.510  0.210   18.824  1.00 0.00 ? 414 PHE A CE2  3  
ATOM   4064  C  CZ   . PHE A 1 57  ? -5.281  1.058   19.595  1.00 0.00 ? 414 PHE A CZ   3  
ATOM   4065  H  H    . PHE A 1 57  ? -4.013  5.001   15.450  1.00 0.00 ? 414 PHE A H    3  
ATOM   4066  H  HA   . PHE A 1 57  ? -2.425  2.603   15.798  1.00 0.00 ? 414 PHE A HA   3  
ATOM   4067  H  HB2  . PHE A 1 57  ? -5.360  2.451   15.079  1.00 0.00 ? 414 PHE A HB2  3  
ATOM   4068  H  HB3  . PHE A 1 57  ? -4.228  1.106   14.985  1.00 0.00 ? 414 PHE A HB3  3  
ATOM   4069  H  HD1  . PHE A 1 57  ? -5.920  3.435   17.292  1.00 0.00 ? 414 PHE A HD1  3  
ATOM   4070  H  HD2  . PHE A 1 57  ? -3.645  -0.141  16.902  1.00 0.00 ? 414 PHE A HD2  3  
ATOM   4071  H  HE1  . PHE A 1 57  ? -6.390  2.884   19.643  1.00 0.00 ? 414 PHE A HE1  3  
ATOM   4072  H  HE2  . PHE A 1 57  ? -4.112  -0.698  19.252  1.00 0.00 ? 414 PHE A HE2  3  
ATOM   4073  H  HZ   . PHE A 1 57  ? -5.485  0.815   20.626  1.00 0.00 ? 414 PHE A HZ   3  
ATOM   4074  N  N    . ALA A 1 58  ? -2.234  2.314   13.267  1.00 0.00 ? 415 ALA A N    3  
ATOM   4075  C  CA   . ALA A 1 58  ? -1.885  2.395   11.854  1.00 0.00 ? 415 ALA A CA   3  
ATOM   4076  C  C    . ALA A 1 58  ? -3.009  1.851   10.978  1.00 0.00 ? 415 ALA A C    3  
ATOM   4077  O  O    . ALA A 1 58  ? -3.313  2.409   9.924   1.00 0.00 ? 415 ALA A O    3  
ATOM   4078  C  CB   . ALA A 1 58  ? -0.591  1.641   11.585  1.00 0.00 ? 415 ALA A CB   3  
ATOM   4079  H  H    . ALA A 1 58  ? -1.881  1.575   13.804  1.00 0.00 ? 415 ALA A H    3  
ATOM   4080  H  HA   . ALA A 1 58  ? -1.724  3.436   11.609  1.00 0.00 ? 415 ALA A HA   3  
ATOM   4081  H  HB1  . ALA A 1 58  ? -0.580  1.299   10.561  1.00 0.00 ? 415 ALA A HB1  3  
ATOM   4082  H  HB2  . ALA A 1 58  ? 0.249   2.298   11.755  1.00 0.00 ? 415 ALA A HB2  3  
ATOM   4083  H  HB3  . ALA A 1 58  ? -0.525  0.792   12.249  1.00 0.00 ? 415 ALA A HB3  3  
ATOM   4084  N  N    . ARG A 1 59  ? -3.621  0.758   11.421  1.00 0.00 ? 416 ARG A N    3  
ATOM   4085  C  CA   . ARG A 1 59  ? -4.710  0.137   10.677  1.00 0.00 ? 416 ARG A CA   3  
ATOM   4086  C  C    . ARG A 1 59  ? -6.056  0.435   11.331  1.00 0.00 ? 416 ARG A C    3  
ATOM   4087  O  O    . ARG A 1 59  ? -6.189  0.379   12.554  1.00 0.00 ? 416 ARG A O    3  
ATOM   4088  C  CB   . ARG A 1 59  ? -4.498  -1.375  10.588  1.00 0.00 ? 416 ARG A CB   3  
ATOM   4089  C  CG   . ARG A 1 59  ? -3.217  -1.770  9.871   1.00 0.00 ? 416 ARG A CG   3  
ATOM   4090  C  CD   . ARG A 1 59  ? -2.886  -3.238  10.090  1.00 0.00 ? 416 ARG A CD   3  
ATOM   4091  N  NE   . ARG A 1 59  ? -1.449  -3.490  10.025  1.00 0.00 ? 416 ARG A NE   3  
ATOM   4092  C  CZ   . ARG A 1 59  ? -0.789  -3.695  8.891   1.00 0.00 ? 416 ARG A CZ   3  
ATOM   4093  N  NH1  . ARG A 1 59  ? -1.433  -3.677  7.733   1.00 0.00 ? 416 ARG A NH1  3  
ATOM   4094  N  NH2  . ARG A 1 59  ? 0.519   -3.918  8.914   1.00 0.00 ? 416 ARG A NH2  3  
ATOM   4095  H  H    . ARG A 1 59  ? -3.334  0.359   12.269  1.00 0.00 ? 416 ARG A H    3  
ATOM   4096  H  HA   . ARG A 1 59  ? -4.708  0.551   9.680   1.00 0.00 ? 416 ARG A HA   3  
ATOM   4097  H  HB2  . ARG A 1 59  ? -4.465  -1.782  11.588  1.00 0.00 ? 416 ARG A HB2  3  
ATOM   4098  H  HB3  . ARG A 1 59  ? -5.331  -1.813  10.058  1.00 0.00 ? 416 ARG A HB3  3  
ATOM   4099  H  HG2  . ARG A 1 59  ? -3.339  -1.594  8.812   1.00 0.00 ? 416 ARG A HG2  3  
ATOM   4100  H  HG3  . ARG A 1 59  ? -2.405  -1.166  10.247  1.00 0.00 ? 416 ARG A HG3  3  
ATOM   4101  H  HD2  . ARG A 1 59  ? -3.250  -3.534  11.062  1.00 0.00 ? 416 ARG A HD2  3  
ATOM   4102  H  HD3  . ARG A 1 59  ? -3.379  -3.821  9.327   1.00 0.00 ? 416 ARG A HD3  3  
ATOM   4103  H  HE   . ARG A 1 59  ? -0.953  -3.507  10.870  1.00 0.00 ? 416 ARG A HE   3  
ATOM   4104  H  HH11 . ARG A 1 59  ? -2.418  -3.508  7.712   1.00 0.00 ? 416 ARG A HH11 3  
ATOM   4105  H  HH12 . ARG A 1 59  ? -0.933  -3.830  6.880   1.00 0.00 ? 416 ARG A HH12 3  
ATOM   4106  H  HH21 . ARG A 1 59  ? 1.008   -3.932  9.786   1.00 0.00 ? 416 ARG A HH21 3  
ATOM   4107  H  HH22 . ARG A 1 59  ? 1.015   -4.072  8.060   1.00 0.00 ? 416 ARG A HH22 3  
ATOM   4108  N  N    . SER A 1 60  ? -7.051  0.753   10.509  1.00 0.00 ? 417 SER A N    3  
ATOM   4109  C  CA   . SER A 1 60  ? -8.385  1.064   11.008  1.00 0.00 ? 417 SER A CA   3  
ATOM   4110  C  C    . SER A 1 60  ? -8.878  -0.024  11.956  1.00 0.00 ? 417 SER A C    3  
ATOM   4111  O  O    . SER A 1 60  ? -9.215  0.247   13.109  1.00 0.00 ? 417 SER A O    3  
ATOM   4112  C  CB   . SER A 1 60  ? -9.364  1.223   9.843   1.00 0.00 ? 417 SER A CB   3  
ATOM   4113  O  OG   . SER A 1 60  ? -10.396 2.139   10.165  1.00 0.00 ? 417 SER A OG   3  
ATOM   4114  H  H    . SER A 1 60  ? -6.882  0.781   9.544   1.00 0.00 ? 417 SER A H    3  
ATOM   4115  H  HA   . SER A 1 60  ? -8.327  1.997   11.548  1.00 0.00 ? 417 SER A HA   3  
ATOM   4116  H  HB2  . SER A 1 60  ? -8.833  1.588   8.977   1.00 0.00 ? 417 SER A HB2  3  
ATOM   4117  H  HB3  . SER A 1 60  ? -9.807  0.264   9.616   1.00 0.00 ? 417 SER A HB3  3  
ATOM   4118  H  HG   . SER A 1 60  ? -10.917 2.324   9.380   1.00 0.00 ? 417 SER A HG   3  
ATOM   4119  N  N    . ASP A 1 61  ? -8.918  -1.257  11.463  1.00 0.00 ? 418 ASP A N    3  
ATOM   4120  C  CA   . ASP A 1 61  ? -9.368  -2.388  12.265  1.00 0.00 ? 418 ASP A CA   3  
ATOM   4121  C  C    . ASP A 1 61  ? -8.796  -2.314  13.678  1.00 0.00 ? 418 ASP A C    3  
ATOM   4122  O  O    . ASP A 1 61  ? -9.538  -2.338  14.659  1.00 0.00 ? 418 ASP A O    3  
ATOM   4123  C  CB   . ASP A 1 61  ? -8.959  -3.705  11.604  1.00 0.00 ? 418 ASP A CB   3  
ATOM   4124  C  CG   . ASP A 1 61  ? -10.011 -4.221  10.642  1.00 0.00 ? 418 ASP A CG   3  
ATOM   4125  O  OD1  . ASP A 1 61  ? -11.187 -3.822  10.778  1.00 0.00 ? 418 ASP A OD1  3  
ATOM   4126  O  OD2  . ASP A 1 61  ? -9.659  -5.023  9.752   1.00 0.00 ? 418 ASP A OD2  3  
ATOM   4127  H  H    . ASP A 1 61  ? -8.636  -1.410  10.536  1.00 0.00 ? 418 ASP A H    3  
ATOM   4128  H  HA   . ASP A 1 61  ? -10.445 -2.345  12.324  1.00 0.00 ? 418 ASP A HA   3  
ATOM   4129  H  HB2  . ASP A 1 61  ? -8.040  -3.555  11.056  1.00 0.00 ? 418 ASP A HB2  3  
ATOM   4130  H  HB3  . ASP A 1 61  ? -8.800  -4.450  12.369  1.00 0.00 ? 418 ASP A HB3  3  
ATOM   4131  N  N    . GLU A 1 62  ? -7.473  -2.225  13.771  1.00 0.00 ? 419 GLU A N    3  
ATOM   4132  C  CA   . GLU A 1 62  ? -6.803  -2.150  15.063  1.00 0.00 ? 419 GLU A CA   3  
ATOM   4133  C  C    . GLU A 1 62  ? -7.522  -1.178  15.994  1.00 0.00 ? 419 GLU A C    3  
ATOM   4134  O  O    . GLU A 1 62  ? -7.950  -1.549  17.088  1.00 0.00 ? 419 GLU A O    3  
ATOM   4135  C  CB   . GLU A 1 62  ? -5.346  -1.717  14.883  1.00 0.00 ? 419 GLU A CB   3  
ATOM   4136  C  CG   . GLU A 1 62  ? -4.467  -2.785  14.254  1.00 0.00 ? 419 GLU A CG   3  
ATOM   4137  C  CD   . GLU A 1 62  ? -3.046  -2.309  14.022  1.00 0.00 ? 419 GLU A CD   3  
ATOM   4138  O  OE1  . GLU A 1 62  ? -2.408  -1.850  14.992  1.00 0.00 ? 419 GLU A OE1  3  
ATOM   4139  O  OE2  . GLU A 1 62  ? -2.572  -2.396  12.870  1.00 0.00 ? 419 GLU A OE2  3  
ATOM   4140  H  H    . GLU A 1 62  ? -6.936  -2.210  12.952  1.00 0.00 ? 419 GLU A H    3  
ATOM   4141  H  HA   . GLU A 1 62  ? -6.823  -3.135  15.506  1.00 0.00 ? 419 GLU A HA   3  
ATOM   4142  H  HB2  . GLU A 1 62  ? -5.319  -0.840  14.253  1.00 0.00 ? 419 GLU A HB2  3  
ATOM   4143  H  HB3  . GLU A 1 62  ? -4.935  -1.467  15.850  1.00 0.00 ? 419 GLU A HB3  3  
ATOM   4144  H  HG2  . GLU A 1 62  ? -4.440  -3.643  14.908  1.00 0.00 ? 419 GLU A HG2  3  
ATOM   4145  H  HG3  . GLU A 1 62  ? -4.895  -3.071  13.304  1.00 0.00 ? 419 GLU A HG3  3  
ATOM   4146  N  N    . LEU A 1 63  ? -7.652  0.068   15.553  1.00 0.00 ? 420 LEU A N    3  
ATOM   4147  C  CA   . LEU A 1 63  ? -8.319  1.095   16.345  1.00 0.00 ? 420 LEU A CA   3  
ATOM   4148  C  C    . LEU A 1 63  ? -9.743  0.675   16.693  1.00 0.00 ? 420 LEU A C    3  
ATOM   4149  O  O    . LEU A 1 63  ? -10.133 0.667   17.861  1.00 0.00 ? 420 LEU A O    3  
ATOM   4150  C  CB   . LEU A 1 63  ? -8.337  2.422   15.584  1.00 0.00 ? 420 LEU A CB   3  
ATOM   4151  C  CG   . LEU A 1 63  ? -9.262  3.504   16.144  1.00 0.00 ? 420 LEU A CG   3  
ATOM   4152  C  CD1  . LEU A 1 63  ? -8.651  4.141   17.382  1.00 0.00 ? 420 LEU A CD1  3  
ATOM   4153  C  CD2  . LEU A 1 63  ? -9.551  4.558   15.086  1.00 0.00 ? 420 LEU A CD2  3  
ATOM   4154  H  H    . LEU A 1 63  ? -7.291  0.304   14.673  1.00 0.00 ? 420 LEU A H    3  
ATOM   4155  H  HA   . LEU A 1 63  ? -7.760  1.222   17.261  1.00 0.00 ? 420 LEU A HA   3  
ATOM   4156  H  HB2  . LEU A 1 63  ? -7.333  2.816   15.582  1.00 0.00 ? 420 LEU A HB2  3  
ATOM   4157  H  HB3  . LEU A 1 63  ? -8.644  2.216   14.569  1.00 0.00 ? 420 LEU A HB3  3  
ATOM   4158  H  HG   . LEU A 1 63  ? -10.202 3.051   16.431  1.00 0.00 ? 420 LEU A HG   3  
ATOM   4159  H  HD11 . LEU A 1 63  ? -8.166  3.381   17.976  1.00 0.00 ? 420 LEU A HD11 3  
ATOM   4160  H  HD12 . LEU A 1 63  ? -9.428  4.612   17.965  1.00 0.00 ? 420 LEU A HD12 3  
ATOM   4161  H  HD13 . LEU A 1 63  ? -7.925  4.883   17.083  1.00 0.00 ? 420 LEU A HD13 3  
ATOM   4162  H  HD21 . LEU A 1 63  ? -8.708  5.230   15.008  1.00 0.00 ? 420 LEU A HD21 3  
ATOM   4163  H  HD22 . LEU A 1 63  ? -10.432 5.117   15.366  1.00 0.00 ? 420 LEU A HD22 3  
ATOM   4164  H  HD23 . LEU A 1 63  ? -9.718  4.076   14.133  1.00 0.00 ? 420 LEU A HD23 3  
ATOM   4165  N  N    . THR A 1 64  ? -10.517 0.324   15.670  1.00 0.00 ? 421 THR A N    3  
ATOM   4166  C  CA   . THR A 1 64  ? -11.898 -0.098  15.867  1.00 0.00 ? 421 THR A CA   3  
ATOM   4167  C  C    . THR A 1 64  ? -12.038 -0.955  17.120  1.00 0.00 ? 421 THR A C    3  
ATOM   4168  O  O    . THR A 1 64  ? -12.894 -0.699  17.967  1.00 0.00 ? 421 THR A O    3  
ATOM   4169  C  CB   . THR A 1 64  ? -12.421 -0.892  14.655  1.00 0.00 ? 421 THR A CB   3  
ATOM   4170  O  OG1  . THR A 1 64  ? -12.318 -0.099  13.468  1.00 0.00 ? 421 THR A OG1  3  
ATOM   4171  C  CG2  . THR A 1 64  ? -13.868 -1.312  14.866  1.00 0.00 ? 421 THR A CG2  3  
ATOM   4172  H  H    . THR A 1 64  ? -10.150 0.351   14.762  1.00 0.00 ? 421 THR A H    3  
ATOM   4173  H  HA   . THR A 1 64  ? -12.506 0.788   15.980  1.00 0.00 ? 421 THR A HA   3  
ATOM   4174  H  HB   . THR A 1 64  ? -11.817 -1.781  14.539  1.00 0.00 ? 421 THR A HB   3  
ATOM   4175  H  HG1  . THR A 1 64  ? -11.648 0.579   13.593  1.00 0.00 ? 421 THR A HG1  3  
ATOM   4176  H  HG21 . THR A 1 64  ? -14.225 -1.827  13.987  1.00 0.00 ? 421 THR A HG21 3  
ATOM   4177  H  HG22 . THR A 1 64  ? -14.475 -0.436  15.041  1.00 0.00 ? 421 THR A HG22 3  
ATOM   4178  H  HG23 . THR A 1 64  ? -13.931 -1.970  15.720  1.00 0.00 ? 421 THR A HG23 3  
ATOM   4179  N  N    . ARG A 1 65  ? -11.191 -1.973  17.233  1.00 0.00 ? 422 ARG A N    3  
ATOM   4180  C  CA   . ARG A 1 65  ? -11.221 -2.868  18.383  1.00 0.00 ? 422 ARG A CA   3  
ATOM   4181  C  C    . ARG A 1 65  ? -11.005 -2.094  19.680  1.00 0.00 ? 422 ARG A C    3  
ATOM   4182  O  O    . ARG A 1 65  ? -11.803 -2.192  20.613  1.00 0.00 ? 422 ARG A O    3  
ATOM   4183  C  CB   . ARG A 1 65  ? -10.151 -3.953  18.240  1.00 0.00 ? 422 ARG A CB   3  
ATOM   4184  C  CG   . ARG A 1 65  ? -10.132 -4.945  19.391  1.00 0.00 ? 422 ARG A CG   3  
ATOM   4185  C  CD   . ARG A 1 65  ? -11.131 -6.070  19.174  1.00 0.00 ? 422 ARG A CD   3  
ATOM   4186  N  NE   . ARG A 1 65  ? -12.447 -5.747  19.718  1.00 0.00 ? 422 ARG A NE   3  
ATOM   4187  C  CZ   . ARG A 1 65  ? -13.417 -6.640  19.876  1.00 0.00 ? 422 ARG A CZ   3  
ATOM   4188  N  NH1  . ARG A 1 65  ? -13.219 -7.906  19.533  1.00 0.00 ? 422 ARG A NH1  3  
ATOM   4189  N  NH2  . ARG A 1 65  ? -14.588 -6.269  20.378  1.00 0.00 ? 422 ARG A NH2  3  
ATOM   4190  H  H    . ARG A 1 65  ? -10.531 -2.127  16.525  1.00 0.00 ? 422 ARG A H    3  
ATOM   4191  H  HA   . ARG A 1 65  ? -12.193 -3.337  18.414  1.00 0.00 ? 422 ARG A HA   3  
ATOM   4192  H  HB2  . ARG A 1 65  ? -10.329 -4.499  17.326  1.00 0.00 ? 422 ARG A HB2  3  
ATOM   4193  H  HB3  . ARG A 1 65  ? -9.182  -3.480  18.185  1.00 0.00 ? 422 ARG A HB3  3  
ATOM   4194  H  HG2  . ARG A 1 65  ? -9.141  -5.368  19.473  1.00 0.00 ? 422 ARG A HG2  3  
ATOM   4195  H  HG3  . ARG A 1 65  ? -10.380 -4.426  20.305  1.00 0.00 ? 422 ARG A HG3  3  
ATOM   4196  H  HD2  . ARG A 1 65  ? -11.225 -6.250  18.113  1.00 0.00 ? 422 ARG A HD2  3  
ATOM   4197  H  HD3  . ARG A 1 65  ? -10.760 -6.961  19.658  1.00 0.00 ? 422 ARG A HD3  3  
ATOM   4198  H  HE   . ARG A 1 65  ? -12.615 -4.817  19.977  1.00 0.00 ? 422 ARG A HE   3  
ATOM   4199  H  HH11 . ARG A 1 65  ? -12.338 -8.189  19.156  1.00 0.00 ? 422 ARG A HH11 3  
ATOM   4200  H  HH12 . ARG A 1 65  ? -13.951 -8.577  19.655  1.00 0.00 ? 422 ARG A HH12 3  
ATOM   4201  H  HH21 . ARG A 1 65  ? -14.740 -5.316  20.637  1.00 0.00 ? 422 ARG A HH21 3  
ATOM   4202  H  HH22 . ARG A 1 65  ? -15.317 -6.942  20.496  1.00 0.00 ? 422 ARG A HH22 3  
ATOM   4203  N  N    . HIS A 1 66  ? -9.922  -1.326  19.732  1.00 0.00 ? 423 HIS A N    3  
ATOM   4204  C  CA   . HIS A 1 66  ? -9.602  -0.534  20.914  1.00 0.00 ? 423 HIS A CA   3  
ATOM   4205  C  C    . HIS A 1 66  ? -10.765 0.378   21.289  1.00 0.00 ? 423 HIS A C    3  
ATOM   4206  O  O    . HIS A 1 66  ? -11.058 0.575   22.469  1.00 0.00 ? 423 HIS A O    3  
ATOM   4207  C  CB   . HIS A 1 66  ? -8.343  0.299   20.671  1.00 0.00 ? 423 HIS A CB   3  
ATOM   4208  C  CG   . HIS A 1 66  ? -8.227  1.487   21.575  1.00 0.00 ? 423 HIS A CG   3  
ATOM   4209  N  ND1  . HIS A 1 66  ? -7.299  1.573   22.591  1.00 0.00 ? 423 HIS A ND1  3  
ATOM   4210  C  CD2  . HIS A 1 66  ? -8.929  2.644   21.611  1.00 0.00 ? 423 HIS A CD2  3  
ATOM   4211  C  CE1  . HIS A 1 66  ? -7.436  2.730   23.213  1.00 0.00 ? 423 HIS A CE1  3  
ATOM   4212  N  NE2  . HIS A 1 66  ? -8.418  3.399   22.638  1.00 0.00 ? 423 HIS A NE2  3  
ATOM   4213  H  H    . HIS A 1 66  ? -9.324  -1.289  18.956  1.00 0.00 ? 423 HIS A H    3  
ATOM   4214  H  HA   . HIS A 1 66  ? -9.419  -1.217  21.730  1.00 0.00 ? 423 HIS A HA   3  
ATOM   4215  H  HB2  . HIS A 1 66  ? -7.473  -0.322  20.827  1.00 0.00 ? 423 HIS A HB2  3  
ATOM   4216  H  HB3  . HIS A 1 66  ? -8.347  0.656   19.651  1.00 0.00 ? 423 HIS A HB3  3  
ATOM   4217  H  HD1  . HIS A 1 66  ? -6.639  0.886   22.822  1.00 0.00 ? 423 HIS A HD1  3  
ATOM   4218  H  HD2  . HIS A 1 66  ? -9.741  2.923   20.954  1.00 0.00 ? 423 HIS A HD2  3  
ATOM   4219  H  HE1  . HIS A 1 66  ? -6.845  3.071   24.050  1.00 0.00 ? 423 HIS A HE1  3  
ATOM   4220  N  N    . TYR A 1 67  ? -11.425 0.933   20.278  1.00 0.00 ? 424 TYR A N    3  
ATOM   4221  C  CA   . TYR A 1 67  ? -12.555 1.827   20.502  1.00 0.00 ? 424 TYR A CA   3  
ATOM   4222  C  C    . TYR A 1 67  ? -13.664 1.121   21.275  1.00 0.00 ? 424 TYR A C    3  
ATOM   4223  O  O    . TYR A 1 67  ? -14.142 1.621   22.293  1.00 0.00 ? 424 TYR A O    3  
ATOM   4224  C  CB   . TYR A 1 67  ? -13.096 2.342   19.167  1.00 0.00 ? 424 TYR A CB   3  
ATOM   4225  C  CG   . TYR A 1 67  ? -13.980 3.561   19.302  1.00 0.00 ? 424 TYR A CG   3  
ATOM   4226  C  CD1  . TYR A 1 67  ? -13.443 4.802   19.620  1.00 0.00 ? 424 TYR A CD1  3  
ATOM   4227  C  CD2  . TYR A 1 67  ? -15.354 3.472   19.111  1.00 0.00 ? 424 TYR A CD2  3  
ATOM   4228  C  CE1  . TYR A 1 67  ? -14.247 5.918   19.746  1.00 0.00 ? 424 TYR A CE1  3  
ATOM   4229  C  CE2  . TYR A 1 67  ? -16.166 4.583   19.233  1.00 0.00 ? 424 TYR A CE2  3  
ATOM   4230  C  CZ   . TYR A 1 67  ? -15.608 5.804   19.551  1.00 0.00 ? 424 TYR A CZ   3  
ATOM   4231  O  OH   . TYR A 1 67  ? -16.412 6.913   19.673  1.00 0.00 ? 424 TYR A OH   3  
ATOM   4232  H  H    . TYR A 1 67  ? -11.145 0.738   19.360  1.00 0.00 ? 424 TYR A H    3  
ATOM   4233  H  HA   . TYR A 1 67  ? -12.204 2.666   21.084  1.00 0.00 ? 424 TYR A HA   3  
ATOM   4234  H  HB2  . TYR A 1 67  ? -12.268 2.604   18.527  1.00 0.00 ? 424 TYR A HB2  3  
ATOM   4235  H  HB3  . TYR A 1 67  ? -13.676 1.562   18.696  1.00 0.00 ? 424 TYR A HB3  3  
ATOM   4236  H  HD1  . TYR A 1 67  ? -12.376 4.889   19.772  1.00 0.00 ? 424 TYR A HD1  3  
ATOM   4237  H  HD2  . TYR A 1 67  ? -15.788 2.515   18.862  1.00 0.00 ? 424 TYR A HD2  3  
ATOM   4238  H  HE1  . TYR A 1 67  ? -13.810 6.874   19.994  1.00 0.00 ? 424 TYR A HE1  3  
ATOM   4239  H  HE2  . TYR A 1 67  ? -17.231 4.494   19.080  1.00 0.00 ? 424 TYR A HE2  3  
ATOM   4240  H  HH   . TYR A 1 67  ? -15.961 7.580   20.197  1.00 0.00 ? 424 TYR A HH   3  
ATOM   4241  N  N    . ARG A 1 68  ? -14.069 -0.046  20.783  1.00 0.00 ? 425 ARG A N    3  
ATOM   4242  C  CA   . ARG A 1 68  ? -15.122 -0.822  21.426  1.00 0.00 ? 425 ARG A CA   3  
ATOM   4243  C  C    . ARG A 1 68  ? -15.005 -0.743  22.945  1.00 0.00 ? 425 ARG A C    3  
ATOM   4244  O  O    . ARG A 1 68  ? -15.984 -0.473  23.641  1.00 0.00 ? 425 ARG A O    3  
ATOM   4245  C  CB   . ARG A 1 68  ? -15.058 -2.282  20.974  1.00 0.00 ? 425 ARG A CB   3  
ATOM   4246  C  CG   . ARG A 1 68  ? -15.195 -2.461  19.470  1.00 0.00 ? 425 ARG A CG   3  
ATOM   4247  C  CD   . ARG A 1 68  ? -16.650 -2.614  19.058  1.00 0.00 ? 425 ARG A CD   3  
ATOM   4248  N  NE   . ARG A 1 68  ? -17.288 -1.324  18.810  1.00 0.00 ? 425 ARG A NE   3  
ATOM   4249  C  CZ   . ARG A 1 68  ? -18.394 -1.177  18.089  1.00 0.00 ? 425 ARG A CZ   3  
ATOM   4250  N  NH1  . ARG A 1 68  ? -18.981 -2.235  17.547  1.00 0.00 ? 425 ARG A NH1  3  
ATOM   4251  N  NH2  . ARG A 1 68  ? -18.914 0.030   17.908  1.00 0.00 ? 425 ARG A NH2  3  
ATOM   4252  H  H    . ARG A 1 68  ? -13.650 -0.392  19.967  1.00 0.00 ? 425 ARG A H    3  
ATOM   4253  H  HA   . ARG A 1 68  ? -16.072 -0.404  21.127  1.00 0.00 ? 425 ARG A HA   3  
ATOM   4254  H  HB2  . ARG A 1 68  ? -14.109 -2.700  21.278  1.00 0.00 ? 425 ARG A HB2  3  
ATOM   4255  H  HB3  . ARG A 1 68  ? -15.854 -2.830  21.453  1.00 0.00 ? 425 ARG A HB3  3  
ATOM   4256  H  HG2  . ARG A 1 68  ? -14.781 -1.594  18.975  1.00 0.00 ? 425 ARG A HG2  3  
ATOM   4257  H  HG3  . ARG A 1 68  ? -14.649 -3.343  19.171  1.00 0.00 ? 425 ARG A HG3  3  
ATOM   4258  H  HD2  . ARG A 1 68  ? -16.695 -3.206  18.156  1.00 0.00 ? 425 ARG A HD2  3  
ATOM   4259  H  HD3  . ARG A 1 68  ? -17.182 -3.123  19.848  1.00 0.00 ? 425 ARG A HD3  3  
ATOM   4260  H  HE   . ARG A 1 68  ? -16.871 -0.529  19.202  1.00 0.00 ? 425 ARG A HE   3  
ATOM   4261  H  HH11 . ARG A 1 68  ? -18.592 -3.146  17.682  1.00 0.00 ? 425 ARG A HH11 3  
ATOM   4262  H  HH12 . ARG A 1 68  ? -19.814 -2.122  17.005  1.00 0.00 ? 425 ARG A HH12 3  
ATOM   4263  H  HH21 . ARG A 1 68  ? -18.474 0.830   18.316  1.00 0.00 ? 425 ARG A HH21 3  
ATOM   4264  H  HH22 . ARG A 1 68  ? -19.746 0.140   17.365  1.00 0.00 ? 425 ARG A HH22 3  
ATOM   4265  N  N    . LYS A 1 69  ? -13.801 -0.982  23.454  1.00 0.00 ? 426 LYS A N    3  
ATOM   4266  C  CA   . LYS A 1 69  ? -13.555 -0.938  24.890  1.00 0.00 ? 426 LYS A CA   3  
ATOM   4267  C  C    . LYS A 1 69  ? -14.215 0.285   25.518  1.00 0.00 ? 426 LYS A C    3  
ATOM   4268  O  O    . LYS A 1 69  ? -14.889 0.182   26.544  1.00 0.00 ? 426 LYS A O    3  
ATOM   4269  C  CB   . LYS A 1 69  ? -12.050 -0.918  25.170  1.00 0.00 ? 426 LYS A CB   3  
ATOM   4270  C  CG   . LYS A 1 69  ? -11.341 -2.202  24.775  1.00 0.00 ? 426 LYS A CG   3  
ATOM   4271  C  CD   . LYS A 1 69  ? -10.096 -2.432  25.615  1.00 0.00 ? 426 LYS A CD   3  
ATOM   4272  C  CE   . LYS A 1 69  ? -9.227  -3.537  25.032  1.00 0.00 ? 426 LYS A CE   3  
ATOM   4273  N  NZ   . LYS A 1 69  ? -8.112  -3.906  25.948  1.00 0.00 ? 426 LYS A NZ   3  
ATOM   4274  H  H    . LYS A 1 69  ? -13.060 -1.192  22.848  1.00 0.00 ? 426 LYS A H    3  
ATOM   4275  H  HA   . LYS A 1 69  ? -13.982 -1.827  25.328  1.00 0.00 ? 426 LYS A HA   3  
ATOM   4276  H  HB2  . LYS A 1 69  ? -11.605 -0.102  24.620  1.00 0.00 ? 426 LYS A HB2  3  
ATOM   4277  H  HB3  . LYS A 1 69  ? -11.894 -0.756  26.226  1.00 0.00 ? 426 LYS A HB3  3  
ATOM   4278  H  HG2  . LYS A 1 69  ? -12.016 -3.033  24.917  1.00 0.00 ? 426 LYS A HG2  3  
ATOM   4279  H  HG3  . LYS A 1 69  ? -11.057 -2.140  23.734  1.00 0.00 ? 426 LYS A HG3  3  
ATOM   4280  H  HD2  . LYS A 1 69  ? -9.521  -1.518  25.649  1.00 0.00 ? 426 LYS A HD2  3  
ATOM   4281  H  HD3  . LYS A 1 69  ? -10.393 -2.710  26.616  1.00 0.00 ? 426 LYS A HD3  3  
ATOM   4282  H  HE2  . LYS A 1 69  ? -9.842  -4.406  24.858  1.00 0.00 ? 426 LYS A HE2  3  
ATOM   4283  H  HE3  . LYS A 1 69  ? -8.814  -3.195  24.095  1.00 0.00 ? 426 LYS A HE3  3  
ATOM   4284  H  HZ1  . LYS A 1 69  ? -8.489  -4.355  26.807  1.00 0.00 ? 426 LYS A HZ1  3  
ATOM   4285  H  HZ2  . LYS A 1 69  ? -7.577  -3.057  26.219  1.00 0.00 ? 426 LYS A HZ2  3  
ATOM   4286  H  HZ3  . LYS A 1 69  ? -7.468  -4.572  25.475  1.00 0.00 ? 426 LYS A HZ3  3  
ATOM   4287  N  N    . HIS A 1 70  ? -14.019 1.444   24.896  1.00 0.00 ? 427 HIS A N    3  
ATOM   4288  C  CA   . HIS A 1 70  ? -14.598 2.687   25.393  1.00 0.00 ? 427 HIS A CA   3  
ATOM   4289  C  C    . HIS A 1 70  ? -16.121 2.601   25.428  1.00 0.00 ? 427 HIS A C    3  
ATOM   4290  O  O    . HIS A 1 70  ? -16.753 2.993   26.409  1.00 0.00 ? 427 HIS A O    3  
ATOM   4291  C  CB   . HIS A 1 70  ? -14.161 3.863   24.520  1.00 0.00 ? 427 HIS A CB   3  
ATOM   4292  C  CG   . HIS A 1 70  ? -12.730 4.257   24.717  1.00 0.00 ? 427 HIS A CG   3  
ATOM   4293  N  ND1  . HIS A 1 70  ? -12.254 4.800   25.892  1.00 0.00 ? 427 HIS A ND1  3  
ATOM   4294  C  CD2  . HIS A 1 70  ? -11.667 4.181   23.882  1.00 0.00 ? 427 HIS A CD2  3  
ATOM   4295  C  CE1  . HIS A 1 70  ? -10.961 5.044   25.769  1.00 0.00 ? 427 HIS A CE1  3  
ATOM   4296  N  NE2  . HIS A 1 70  ? -10.580 4.677   24.559  1.00 0.00 ? 427 HIS A NE2  3  
ATOM   4297  H  H    . HIS A 1 70  ? -13.473 1.462   24.083  1.00 0.00 ? 427 HIS A H    3  
ATOM   4298  H  HA   . HIS A 1 70  ? -14.236 2.842   26.398  1.00 0.00 ? 427 HIS A HA   3  
ATOM   4299  H  HB2  . HIS A 1 70  ? -14.291 3.599   23.481  1.00 0.00 ? 427 HIS A HB2  3  
ATOM   4300  H  HB3  . HIS A 1 70  ? -14.777 4.721   24.748  1.00 0.00 ? 427 HIS A HB3  3  
ATOM   4301  H  HD1  . HIS A 1 70  ? -12.785 4.982   26.695  1.00 0.00 ? 427 HIS A HD1  3  
ATOM   4302  H  HD2  . HIS A 1 70  ? -11.673 3.802   22.869  1.00 0.00 ? 427 HIS A HD2  3  
ATOM   4303  H  HE1  . HIS A 1 70  ? -10.323 5.470   26.529  1.00 0.00 ? 427 HIS A HE1  3  
ATOM   4304  N  N    . THR A 1 71  ? -16.704 2.087   24.350  1.00 0.00 ? 428 THR A N    3  
ATOM   4305  C  CA   . THR A 1 71  ? -18.153 1.952   24.256  1.00 0.00 ? 428 THR A CA   3  
ATOM   4306  C  C    . THR A 1 71  ? -18.629 0.663   24.917  1.00 0.00 ? 428 THR A C    3  
ATOM   4307  O  O    . THR A 1 71  ? -19.630 0.078   24.509  1.00 0.00 ? 428 THR A O    3  
ATOM   4308  C  CB   . THR A 1 71  ? -18.624 1.968   22.790  1.00 0.00 ? 428 THR A CB   3  
ATOM   4309  O  OG1  . THR A 1 71  ? -18.031 0.879   22.073  1.00 0.00 ? 428 THR A OG1  3  
ATOM   4310  C  CG2  . THR A 1 71  ? -18.260 3.283   22.118  1.00 0.00 ? 428 THR A CG2  3  
ATOM   4311  H  H    . THR A 1 71  ? -16.146 1.792   23.600  1.00 0.00 ? 428 THR A H    3  
ATOM   4312  H  HA   . THR A 1 71  ? -18.600 2.793   24.765  1.00 0.00 ? 428 THR A HA   3  
ATOM   4313  H  HB   . THR A 1 71  ? -19.699 1.857   22.772  1.00 0.00 ? 428 THR A HB   3  
ATOM   4314  H  HG1  . THR A 1 71  ? -18.718 0.375   21.631  1.00 0.00 ? 428 THR A HG1  3  
ATOM   4315  H  HG21 . THR A 1 71  ? -17.255 3.562   22.396  1.00 0.00 ? 428 THR A HG21 3  
ATOM   4316  H  HG22 . THR A 1 71  ? -18.948 4.052   22.436  1.00 0.00 ? 428 THR A HG22 3  
ATOM   4317  H  HG23 . THR A 1 71  ? -18.318 3.168   21.046  1.00 0.00 ? 428 THR A HG23 3  
ATOM   4318  N  N    . GLY A 1 72  ? -17.904 0.227   25.943  1.00 0.00 ? 429 GLY A N    3  
ATOM   4319  C  CA   . GLY A 1 72  ? -18.269 -0.990  26.645  1.00 0.00 ? 429 GLY A CA   3  
ATOM   4320  C  C    . GLY A 1 72  ? -17.692 -1.046  28.046  1.00 0.00 ? 429 GLY A C    3  
ATOM   4321  O  O    . GLY A 1 72  ? -17.606 -0.027  28.730  1.00 0.00 ? 429 GLY A O    3  
ATOM   4322  H  H    . GLY A 1 72  ? -17.114 0.735   26.225  1.00 0.00 ? 429 GLY A H    3  
ATOM   4323  H  HA2  . GLY A 1 72  ? -19.345 -1.047  26.707  1.00 0.00 ? 429 GLY A HA2  3  
ATOM   4324  H  HA3  . GLY A 1 72  ? -17.905 -1.838  26.084  1.00 0.00 ? 429 GLY A HA3  3  
ATOM   4325  N  N    . ALA A 1 73  ? -17.297 -2.241  28.474  1.00 0.00 ? 430 ALA A N    3  
ATOM   4326  C  CA   . ALA A 1 73  ? -16.726 -2.426  29.802  1.00 0.00 ? 430 ALA A CA   3  
ATOM   4327  C  C    . ALA A 1 73  ? -15.536 -1.498  30.022  1.00 0.00 ? 430 ALA A C    3  
ATOM   4328  O  O    . ALA A 1 73  ? -14.952 -0.983  29.068  1.00 0.00 ? 430 ALA A O    3  
ATOM   4329  C  CB   . ALA A 1 73  ? -16.310 -3.876  30.000  1.00 0.00 ? 430 ALA A CB   3  
ATOM   4330  H  H    . ALA A 1 73  ? -17.392 -3.016  27.882  1.00 0.00 ? 430 ALA A H    3  
ATOM   4331  H  HA   . ALA A 1 73  ? -17.490 -2.194  30.529  1.00 0.00 ? 430 ALA A HA   3  
ATOM   4332  H  HB1  . ALA A 1 73  ? -16.863 -4.505  29.319  1.00 0.00 ? 430 ALA A HB1  3  
ATOM   4333  H  HB2  . ALA A 1 73  ? -15.252 -3.976  29.804  1.00 0.00 ? 430 ALA A HB2  3  
ATOM   4334  H  HB3  . ALA A 1 73  ? -16.519 -4.175  31.016  1.00 0.00 ? 430 ALA A HB3  3  
ATOM   4335  N  N    . LYS A 1 74  ? -15.182 -1.286  31.285  1.00 0.00 ? 431 LYS A N    3  
ATOM   4336  C  CA   . LYS A 1 74  ? -14.062 -0.420  31.631  1.00 0.00 ? 431 LYS A CA   3  
ATOM   4337  C  C    . LYS A 1 74  ? -13.028 -1.174  32.461  1.00 0.00 ? 431 LYS A C    3  
ATOM   4338  O  O    . LYS A 1 74  ? -13.361 -1.989  33.322  1.00 0.00 ? 431 LYS A O    3  
ATOM   4339  C  CB   . LYS A 1 74  ? -14.557 0.804   32.404  1.00 0.00 ? 431 LYS A CB   3  
ATOM   4340  C  CG   . LYS A 1 74  ? -15.285 1.817   31.538  1.00 0.00 ? 431 LYS A CG   3  
ATOM   4341  C  CD   . LYS A 1 74  ? -16.339 2.572   32.329  1.00 0.00 ? 431 LYS A CD   3  
ATOM   4342  C  CE   . LYS A 1 74  ? -17.654 1.808   32.377  1.00 0.00 ? 431 LYS A CE   3  
ATOM   4343  N  NZ   . LYS A 1 74  ? -18.792 2.687   32.763  1.00 0.00 ? 431 LYS A NZ   3  
ATOM   4344  H  H    . LYS A 1 74  ? -15.687 -1.725  32.002  1.00 0.00 ? 431 LYS A H    3  
ATOM   4345  H  HA   . LYS A 1 74  ? -13.599 -0.093  30.713  1.00 0.00 ? 431 LYS A HA   3  
ATOM   4346  H  HB2  . LYS A 1 74  ? -15.231 0.476   33.182  1.00 0.00 ? 431 LYS A HB2  3  
ATOM   4347  H  HB3  . LYS A 1 74  ? -13.709 1.295   32.859  1.00 0.00 ? 431 LYS A HB3  3  
ATOM   4348  H  HG2  . LYS A 1 74  ? -14.569 2.524   31.147  1.00 0.00 ? 431 LYS A HG2  3  
ATOM   4349  H  HG3  . LYS A 1 74  ? -15.765 1.298   30.719  1.00 0.00 ? 431 LYS A HG3  3  
ATOM   4350  H  HD2  . LYS A 1 74  ? -15.984 2.719   33.338  1.00 0.00 ? 431 LYS A HD2  3  
ATOM   4351  H  HD3  . LYS A 1 74  ? -16.508 3.533   31.862  1.00 0.00 ? 431 LYS A HD3  3  
ATOM   4352  H  HE2  . LYS A 1 74  ? -17.848 1.390   31.401  1.00 0.00 ? 431 LYS A HE2  3  
ATOM   4353  H  HE3  . LYS A 1 74  ? -17.565 1.011   33.100  1.00 0.00 ? 431 LYS A HE3  3  
ATOM   4354  H  HZ1  . LYS A 1 74  ? -19.682 2.310   32.378  1.00 0.00 ? 431 LYS A HZ1  3  
ATOM   4355  H  HZ2  . LYS A 1 74  ? -18.645 3.647   32.391  1.00 0.00 ? 431 LYS A HZ2  3  
ATOM   4356  H  HZ3  . LYS A 1 74  ? -18.870 2.738   33.799  1.00 0.00 ? 431 LYS A HZ3  3  
ATOM   4357  N  N    . PRO A 1 75  ? -11.742 -0.898  32.199  1.00 0.00 ? 432 PRO A N    3  
ATOM   4358  C  CA   . PRO A 1 75  ? -10.633 -1.538  32.913  1.00 0.00 ? 432 PRO A CA   3  
ATOM   4359  C  C    . PRO A 1 75  ? -10.537 -1.081  34.365  1.00 0.00 ? 432 PRO A C    3  
ATOM   4360  O  O    . PRO A 1 75  ? -9.972  -1.777  35.209  1.00 0.00 ? 432 PRO A O    3  
ATOM   4361  C  CB   . PRO A 1 75  ? -9.398  -1.087  32.128  1.00 0.00 ? 432 PRO A CB   3  
ATOM   4362  C  CG   . PRO A 1 75  ? -9.804  0.196   31.489  1.00 0.00 ? 432 PRO A CG   3  
ATOM   4363  C  CD   . PRO A 1 75  ? -11.271 0.063   31.187  1.00 0.00 ? 432 PRO A CD   3  
ATOM   4364  H  HA   . PRO A 1 75  ? -10.709 -2.615  32.880  1.00 0.00 ? 432 PRO A HA   3  
ATOM   4365  H  HB2  . PRO A 1 75  ? -8.569  -0.946  32.807  1.00 0.00 ? 432 PRO A HB2  3  
ATOM   4366  H  HB3  . PRO A 1 75  ? -9.144  -1.833  31.390  1.00 0.00 ? 432 PRO A HB3  3  
ATOM   4367  H  HG2  . PRO A 1 75  ? -9.634  1.016   32.170  1.00 0.00 ? 432 PRO A HG2  3  
ATOM   4368  H  HG3  . PRO A 1 75  ? -9.246  0.343   30.576  1.00 0.00 ? 432 PRO A HG3  3  
ATOM   4369  H  HD2  . PRO A 1 75  ? -11.767 1.015   31.298  1.00 0.00 ? 432 PRO A HD2  3  
ATOM   4370  H  HD3  . PRO A 1 75  ? -11.417 -0.327  30.190  1.00 0.00 ? 432 PRO A HD3  3  
ATOM   4371  N  N    . PHE A 1 76  ? -11.094 0.091   34.649  1.00 0.00 ? 433 PHE A N    3  
ATOM   4372  C  CA   . PHE A 1 76  ? -11.071 0.641   36.000  1.00 0.00 ? 433 PHE A CA   3  
ATOM   4373  C  C    . PHE A 1 76  ? -12.218 1.625   36.206  1.00 0.00 ? 433 PHE A C    3  
ATOM   4374  O  O    . PHE A 1 76  ? -12.247 2.696   35.600  1.00 0.00 ? 433 PHE A O    3  
ATOM   4375  C  CB   . PHE A 1 76  ? -9.734  1.335   36.268  1.00 0.00 ? 433 PHE A CB   3  
ATOM   4376  C  CG   . PHE A 1 76  ? -8.541  0.474   35.967  1.00 0.00 ? 433 PHE A CG   3  
ATOM   4377  C  CD1  . PHE A 1 76  ? -8.013  0.421   34.687  1.00 0.00 ? 433 PHE A CD1  3  
ATOM   4378  C  CD2  . PHE A 1 76  ? -7.945  -0.281  36.965  1.00 0.00 ? 433 PHE A CD2  3  
ATOM   4379  C  CE1  . PHE A 1 76  ? -6.916  -0.371  34.407  1.00 0.00 ? 433 PHE A CE1  3  
ATOM   4380  C  CE2  . PHE A 1 76  ? -6.847  -1.075  36.691  1.00 0.00 ? 433 PHE A CE2  3  
ATOM   4381  C  CZ   . PHE A 1 76  ? -6.331  -1.119  35.411  1.00 0.00 ? 433 PHE A CZ   3  
ATOM   4382  H  H    . PHE A 1 76  ? -11.530 0.600   33.934  1.00 0.00 ? 433 PHE A H    3  
ATOM   4383  H  HA   . PHE A 1 76  ? -11.186 -0.179  36.692  1.00 0.00 ? 433 PHE A HA   3  
ATOM   4384  H  HB2  . PHE A 1 76  ? -9.667  2.221   35.654  1.00 0.00 ? 433 PHE A HB2  3  
ATOM   4385  H  HB3  . PHE A 1 76  ? -9.686  1.619   37.309  1.00 0.00 ? 433 PHE A HB3  3  
ATOM   4386  H  HD1  . PHE A 1 76  ? -8.469  1.006   33.901  1.00 0.00 ? 433 PHE A HD1  3  
ATOM   4387  H  HD2  . PHE A 1 76  ? -8.348  -0.247  37.967  1.00 0.00 ? 433 PHE A HD2  3  
ATOM   4388  H  HE1  . PHE A 1 76  ? -6.514  -0.403  33.406  1.00 0.00 ? 433 PHE A HE1  3  
ATOM   4389  H  HE2  . PHE A 1 76  ? -6.393  -1.658  37.478  1.00 0.00 ? 433 PHE A HE2  3  
ATOM   4390  H  HZ   . PHE A 1 76  ? -5.474  -1.738  35.195  1.00 0.00 ? 433 PHE A HZ   3  
ATOM   4391  N  N    . GLN A 1 77  ? -13.162 1.253   37.066  1.00 0.00 ? 434 GLN A N    3  
ATOM   4392  C  CA   . GLN A 1 77  ? -14.312 2.103   37.351  1.00 0.00 ? 434 GLN A CA   3  
ATOM   4393  C  C    . GLN A 1 77  ? -14.299 2.567   38.803  1.00 0.00 ? 434 GLN A C    3  
ATOM   4394  O  O    . GLN A 1 77  ? -14.418 1.760   39.726  1.00 0.00 ? 434 GLN A O    3  
ATOM   4395  C  CB   . GLN A 1 77  ? -15.612 1.353   37.055  1.00 0.00 ? 434 GLN A CB   3  
ATOM   4396  C  CG   . GLN A 1 77  ? -16.860 2.098   37.501  1.00 0.00 ? 434 GLN A CG   3  
ATOM   4397  C  CD   . GLN A 1 77  ? -18.123 1.279   37.326  1.00 0.00 ? 434 GLN A CD   3  
ATOM   4398  O  OE1  . GLN A 1 77  ? -18.172 0.359   36.508  1.00 0.00 ? 434 GLN A OE1  3  
ATOM   4399  N  NE2  . GLN A 1 77  ? -19.154 1.608   38.095  1.00 0.00 ? 434 GLN A NE2  3  
ATOM   4400  H  H    . GLN A 1 77  ? -13.083 0.388   37.517  1.00 0.00 ? 434 GLN A H    3  
ATOM   4401  H  HA   . GLN A 1 77  ? -14.252 2.968   36.709  1.00 0.00 ? 434 GLN A HA   3  
ATOM   4402  H  HB2  . GLN A 1 77  ? -15.682 1.183   35.991  1.00 0.00 ? 434 GLN A HB2  3  
ATOM   4403  H  HB3  . GLN A 1 77  ? -15.588 0.400   37.563  1.00 0.00 ? 434 GLN A HB3  3  
ATOM   4404  H  HG2  . GLN A 1 77  ? -16.757 2.353   38.545  1.00 0.00 ? 434 GLN A HG2  3  
ATOM   4405  H  HG3  . GLN A 1 77  ? -16.951 3.003   36.918  1.00 0.00 ? 434 GLN A HG3  3  
ATOM   4406  H  HE21 . GLN A 1 77  ? -19.043 2.353   38.723  1.00 0.00 ? 434 GLN A HE21 3  
ATOM   4407  H  HE22 . GLN A 1 77  ? -19.983 1.096   38.002  1.00 0.00 ? 434 GLN A HE22 3  
ATOM   4408  N  N    . CYS A 1 78  ? -14.153 3.873   39.000  1.00 0.00 ? 435 CYS A N    3  
ATOM   4409  C  CA   . CYS A 1 78  ? -14.123 4.446   40.340  1.00 0.00 ? 435 CYS A CA   3  
ATOM   4410  C  C    . CYS A 1 78  ? -15.381 4.074   41.119  1.00 0.00 ? 435 CYS A C    3  
ATOM   4411  O  O    . CYS A 1 78  ? -16.301 3.463   40.578  1.00 0.00 ? 435 CYS A O    3  
ATOM   4412  C  CB   . CYS A 1 78  ? -13.988 5.969   40.264  1.00 0.00 ? 435 CYS A CB   3  
ATOM   4413  S  SG   . CYS A 1 78  ? -13.207 6.720   41.728  1.00 0.00 ? 435 CYS A SG   3  
ATOM   4414  H  H    . CYS A 1 78  ? -14.062 4.467   38.225  1.00 0.00 ? 435 CYS A H    3  
ATOM   4415  H  HA   . CYS A 1 78  ? -13.264 4.043   40.855  1.00 0.00 ? 435 CYS A HA   3  
ATOM   4416  H  HB2  . CYS A 1 78  ? -13.388 6.226   39.403  1.00 0.00 ? 435 CYS A HB2  3  
ATOM   4417  H  HB3  . CYS A 1 78  ? -14.971 6.404   40.155  1.00 0.00 ? 435 CYS A HB3  3  
ATOM   4418  N  N    . GLY A 1 79  ? -15.414 4.449   42.395  1.00 0.00 ? 436 GLY A N    3  
ATOM   4419  C  CA   . GLY A 1 79  ? -16.563 4.147   43.228  1.00 0.00 ? 436 GLY A CA   3  
ATOM   4420  C  C    . GLY A 1 79  ? -17.418 5.368   43.501  1.00 0.00 ? 436 GLY A C    3  
ATOM   4421  O  O    . GLY A 1 79  ? -18.582 5.422   43.102  1.00 0.00 ? 436 GLY A O    3  
ATOM   4422  H  H    . GLY A 1 79  ? -14.651 4.934   42.773  1.00 0.00 ? 436 GLY A H    3  
ATOM   4423  H  HA2  . GLY A 1 79  ? -17.166 3.401   42.733  1.00 0.00 ? 436 GLY A HA2  3  
ATOM   4424  H  HA3  . GLY A 1 79  ? -16.215 3.747   44.169  1.00 0.00 ? 436 GLY A HA3  3  
ATOM   4425  N  N    . VAL A 1 80  ? -16.842 6.351   44.184  1.00 0.00 ? 437 VAL A N    3  
ATOM   4426  C  CA   . VAL A 1 80  ? -17.559 7.578   44.511  1.00 0.00 ? 437 VAL A CA   3  
ATOM   4427  C  C    . VAL A 1 80  ? -18.114 8.241   43.256  1.00 0.00 ? 437 VAL A C    3  
ATOM   4428  O  O    . VAL A 1 80  ? -19.328 8.304   43.057  1.00 0.00 ? 437 VAL A O    3  
ATOM   4429  C  CB   . VAL A 1 80  ? -16.652 8.580   45.250  1.00 0.00 ? 437 VAL A CB   3  
ATOM   4430  C  CG1  . VAL A 1 80  ? -17.372 9.903   45.454  1.00 0.00 ? 437 VAL A CG1  3  
ATOM   4431  C  CG2  . VAL A 1 80  ? -16.193 8.002   46.580  1.00 0.00 ? 437 VAL A CG2  3  
ATOM   4432  H  H    . VAL A 1 80  ? -15.912 6.250   44.475  1.00 0.00 ? 437 VAL A H    3  
ATOM   4433  H  HA   . VAL A 1 80  ? -18.381 7.320   45.164  1.00 0.00 ? 437 VAL A HA   3  
ATOM   4434  H  HB   . VAL A 1 80  ? -15.779 8.760   44.640  1.00 0.00 ? 437 VAL A HB   3  
ATOM   4435  H  HG11 . VAL A 1 80  ? -18.419 9.783   45.218  1.00 0.00 ? 437 VAL A HG11 3  
ATOM   4436  H  HG12 . VAL A 1 80  ? -17.267 10.216  46.482  1.00 0.00 ? 437 VAL A HG12 3  
ATOM   4437  H  HG13 . VAL A 1 80  ? -16.941 10.651  44.804  1.00 0.00 ? 437 VAL A HG13 3  
ATOM   4438  H  HG21 . VAL A 1 80  ? -15.370 7.323   46.414  1.00 0.00 ? 437 VAL A HG21 3  
ATOM   4439  H  HG22 . VAL A 1 80  ? -15.874 8.804   47.229  1.00 0.00 ? 437 VAL A HG22 3  
ATOM   4440  H  HG23 . VAL A 1 80  ? -17.011 7.469   47.043  1.00 0.00 ? 437 VAL A HG23 3  
ATOM   4441  N  N    . CYS A 1 81  ? -17.217 8.736   42.409  1.00 0.00 ? 438 CYS A N    3  
ATOM   4442  C  CA   . CYS A 1 81  ? -17.615 9.396   41.171  1.00 0.00 ? 438 CYS A CA   3  
ATOM   4443  C  C    . CYS A 1 81  ? -18.052 8.373   40.126  1.00 0.00 ? 438 CYS A C    3  
ATOM   4444  O  O    . CYS A 1 81  ? -18.949 8.633   39.325  1.00 0.00 ? 438 CYS A O    3  
ATOM   4445  C  CB   . CYS A 1 81  ? -16.462 10.239  40.625  1.00 0.00 ? 438 CYS A CB   3  
ATOM   4446  S  SG   . CYS A 1 81  ? -15.122 9.265   39.867  1.00 0.00 ? 438 CYS A SG   3  
ATOM   4447  H  H    . CYS A 1 81  ? -16.263 8.656   42.622  1.00 0.00 ? 438 CYS A H    3  
ATOM   4448  H  HA   . CYS A 1 81  ? -18.449 10.043  41.394  1.00 0.00 ? 438 CYS A HA   3  
ATOM   4449  H  HB2  . CYS A 1 81  ? -16.844 10.913  39.871  1.00 0.00 ? 438 CYS A HB2  3  
ATOM   4450  H  HB3  . CYS A 1 81  ? -16.034 10.816  41.431  1.00 0.00 ? 438 CYS A HB3  3  
ATOM   4451  N  N    . ASN A 1 82  ? -17.410 7.209   40.141  1.00 0.00 ? 439 ASN A N    3  
ATOM   4452  C  CA   . ASN A 1 82  ? -17.732 6.147   39.195  1.00 0.00 ? 439 ASN A CA   3  
ATOM   4453  C  C    . ASN A 1 82  ? -17.263 6.510   37.789  1.00 0.00 ? 439 ASN A C    3  
ATOM   4454  O  O    . ASN A 1 82  ? -17.984 6.310   36.812  1.00 0.00 ? 439 ASN A O    3  
ATOM   4455  C  CB   . ASN A 1 82  ? -19.238 5.879   39.189  1.00 0.00 ? 439 ASN A CB   3  
ATOM   4456  C  CG   . ASN A 1 82  ? -19.818 5.806   40.588  1.00 0.00 ? 439 ASN A CG   3  
ATOM   4457  O  OD1  . ASN A 1 82  ? -20.032 6.829   41.238  1.00 0.00 ? 439 ASN A OD1  3  
ATOM   4458  N  ND2  . ASN A 1 82  ? -20.074 4.591   41.059  1.00 0.00 ? 439 ASN A ND2  3  
ATOM   4459  H  H    . ASN A 1 82  ? -16.704 7.061   40.804  1.00 0.00 ? 439 ASN A H    3  
ATOM   4460  H  HA   . ASN A 1 82  ? -17.218 5.253   39.514  1.00 0.00 ? 439 ASN A HA   3  
ATOM   4461  H  HB2  . ASN A 1 82  ? -19.737 6.676   38.656  1.00 0.00 ? 439 ASN A HB2  3  
ATOM   4462  H  HB3  . ASN A 1 82  ? -19.430 4.942   38.689  1.00 0.00 ? 439 ASN A HB3  3  
ATOM   4463  H  HD21 . ASN A 1 82  ? -19.877 3.821   40.486  1.00 0.00 ? 439 ASN A HD21 3  
ATOM   4464  H  HD22 . ASN A 1 82  ? -20.450 4.514   41.961  1.00 0.00 ? 439 ASN A HD22 3  
ATOM   4465  N  N    . ARG A 1 83  ? -16.050 7.046   37.696  1.00 0.00 ? 440 ARG A N    3  
ATOM   4466  C  CA   . ARG A 1 83  ? -15.485 7.438   36.411  1.00 0.00 ? 440 ARG A CA   3  
ATOM   4467  C  C    . ARG A 1 83  ? -14.694 6.289   35.791  1.00 0.00 ? 440 ARG A C    3  
ATOM   4468  O  O    . ARG A 1 83  ? -14.541 5.229   36.399  1.00 0.00 ? 440 ARG A O    3  
ATOM   4469  C  CB   . ARG A 1 83  ? -14.581 8.661   36.579  1.00 0.00 ? 440 ARG A CB   3  
ATOM   4470  C  CG   . ARG A 1 83  ? -15.318 9.984   36.451  1.00 0.00 ? 440 ARG A CG   3  
ATOM   4471  C  CD   . ARG A 1 83  ? -14.352 11.158  36.413  1.00 0.00 ? 440 ARG A CD   3  
ATOM   4472  N  NE   . ARG A 1 83  ? -13.939 11.483  35.050  1.00 0.00 ? 440 ARG A NE   3  
ATOM   4473  C  CZ   . ARG A 1 83  ? -14.745 12.031  34.149  1.00 0.00 ? 440 ARG A CZ   3  
ATOM   4474  N  NH1  . ARG A 1 83  ? -16.001 12.316  34.464  1.00 0.00 ? 440 ARG A NH1  3  
ATOM   4475  N  NH2  . ARG A 1 83  ? -14.296 12.297  32.929  1.00 0.00 ? 440 ARG A NH2  3  
ATOM   4476  H  H    . ARG A 1 83  ? -15.523 7.181   38.511  1.00 0.00 ? 440 ARG A H    3  
ATOM   4477  H  HA   . ARG A 1 83  ? -16.302 7.692   35.753  1.00 0.00 ? 440 ARG A HA   3  
ATOM   4478  H  HB2  . ARG A 1 83  ? -14.121 8.623   37.555  1.00 0.00 ? 440 ARG A HB2  3  
ATOM   4479  H  HB3  . ARG A 1 83  ? -13.810 8.629   35.824  1.00 0.00 ? 440 ARG A HB3  3  
ATOM   4480  H  HG2  . ARG A 1 83  ? -15.896 9.978   35.539  1.00 0.00 ? 440 ARG A HG2  3  
ATOM   4481  H  HG3  . ARG A 1 83  ? -15.979 10.100  37.297  1.00 0.00 ? 440 ARG A HG3  3  
ATOM   4482  H  HD2  . ARG A 1 83  ? -14.837 12.020  36.847  1.00 0.00 ? 440 ARG A HD2  3  
ATOM   4483  H  HD3  . ARG A 1 83  ? -13.478 10.906  36.994  1.00 0.00 ? 440 ARG A HD3  3  
ATOM   4484  H  HE   . ARG A 1 83  ? -13.015 11.281  34.796  1.00 0.00 ? 440 ARG A HE   3  
ATOM   4485  H  HH11 . ARG A 1 83  ? -16.343 12.118  35.383  1.00 0.00 ? 440 ARG A HH11 3  
ATOM   4486  H  HH12 . ARG A 1 83  ? -16.606 12.730  33.783  1.00 0.00 ? 440 ARG A HH12 3  
ATOM   4487  H  HH21 . ARG A 1 83  ? -13.349 12.084  32.688  1.00 0.00 ? 440 ARG A HH21 3  
ATOM   4488  H  HH22 . ARG A 1 83  ? -14.903 12.710  32.251  1.00 0.00 ? 440 ARG A HH22 3  
ATOM   4489  N  N    . SER A 1 84  ? -14.194 6.507   34.579  1.00 0.00 ? 441 SER A N    3  
ATOM   4490  C  CA   . SER A 1 84  ? -13.423 5.489   33.876  1.00 0.00 ? 441 SER A CA   3  
ATOM   4491  C  C    . SER A 1 84  ? -11.969 5.923   33.716  1.00 0.00 ? 441 SER A C    3  
ATOM   4492  O  O    . SER A 1 84  ? -11.668 7.115   33.657  1.00 0.00 ? 441 SER A O    3  
ATOM   4493  C  CB   . SER A 1 84  ? -14.038 5.211   32.503  1.00 0.00 ? 441 SER A CB   3  
ATOM   4494  O  OG   . SER A 1 84  ? -14.144 6.401   31.741  1.00 0.00 ? 441 SER A OG   3  
ATOM   4495  H  H    . SER A 1 84  ? -14.351 7.373   34.147  1.00 0.00 ? 441 SER A H    3  
ATOM   4496  H  HA   . SER A 1 84  ? -13.454 4.584   34.464  1.00 0.00 ? 441 SER A HA   3  
ATOM   4497  H  HB2  . SER A 1 84  ? -13.416 4.510   31.968  1.00 0.00 ? 441 SER A HB2  3  
ATOM   4498  H  HB3  . SER A 1 84  ? -15.025 4.791   32.632  1.00 0.00 ? 441 SER A HB3  3  
ATOM   4499  H  HG   . SER A 1 84  ? -13.266 6.741   31.554  1.00 0.00 ? 441 SER A HG   3  
ATOM   4500  N  N    . PHE A 1 85  ? -11.071 4.946   33.646  1.00 0.00 ? 442 PHE A N    3  
ATOM   4501  C  CA   . PHE A 1 85  ? -9.648  5.225   33.494  1.00 0.00 ? 442 PHE A CA   3  
ATOM   4502  C  C    . PHE A 1 85  ? -9.002  4.243   32.521  1.00 0.00 ? 442 PHE A C    3  
ATOM   4503  O  O    . PHE A 1 85  ? -9.622  3.262   32.109  1.00 0.00 ? 442 PHE A O    3  
ATOM   4504  C  CB   . PHE A 1 85  ? -8.945  5.153   34.851  1.00 0.00 ? 442 PHE A CB   3  
ATOM   4505  C  CG   . PHE A 1 85  ? -9.471  6.142   35.852  1.00 0.00 ? 442 PHE A CG   3  
ATOM   4506  C  CD1  . PHE A 1 85  ? -9.048  7.461   35.831  1.00 0.00 ? 442 PHE A CD1  3  
ATOM   4507  C  CD2  . PHE A 1 85  ? -10.390 5.752   36.813  1.00 0.00 ? 442 PHE A CD2  3  
ATOM   4508  C  CE1  . PHE A 1 85  ? -9.530  8.373   36.751  1.00 0.00 ? 442 PHE A CE1  3  
ATOM   4509  C  CE2  . PHE A 1 85  ? -10.876 6.659   37.735  1.00 0.00 ? 442 PHE A CE2  3  
ATOM   4510  C  CZ   . PHE A 1 85  ? -10.445 7.971   37.704  1.00 0.00 ? 442 PHE A CZ   3  
ATOM   4511  H  H    . PHE A 1 85  ? -11.373 4.014   33.698  1.00 0.00 ? 442 PHE A H    3  
ATOM   4512  H  HA   . PHE A 1 85  ? -9.547  6.224   33.098  1.00 0.00 ? 442 PHE A HA   3  
ATOM   4513  H  HB2  . PHE A 1 85  ? -9.074  4.164   35.263  1.00 0.00 ? 442 PHE A HB2  3  
ATOM   4514  H  HB3  . PHE A 1 85  ? -7.892  5.347   34.713  1.00 0.00 ? 442 PHE A HB3  3  
ATOM   4515  H  HD1  . PHE A 1 85  ? -8.331  7.776   35.086  1.00 0.00 ? 442 PHE A HD1  3  
ATOM   4516  H  HD2  . PHE A 1 85  ? -10.727 4.726   36.839  1.00 0.00 ? 442 PHE A HD2  3  
ATOM   4517  H  HE1  . PHE A 1 85  ? -9.191  9.398   36.724  1.00 0.00 ? 442 PHE A HE1  3  
ATOM   4518  H  HE2  . PHE A 1 85  ? -11.591 6.343   38.479  1.00 0.00 ? 442 PHE A HE2  3  
ATOM   4519  H  HZ   . PHE A 1 85  ? -10.824 8.683   38.423  1.00 0.00 ? 442 PHE A HZ   3  
ATOM   4520  N  N    . SER A 1 86  ? -7.753  4.514   32.157  1.00 0.00 ? 443 SER A N    3  
ATOM   4521  C  CA   . SER A 1 86  ? -7.023  3.658   31.230  1.00 0.00 ? 443 SER A CA   3  
ATOM   4522  C  C    . SER A 1 86  ? -6.003  2.799   31.971  1.00 0.00 ? 443 SER A C    3  
ATOM   4523  O  O    . SER A 1 86  ? -5.894  1.597   31.729  1.00 0.00 ? 443 SER A O    3  
ATOM   4524  C  CB   . SER A 1 86  ? -6.319  4.504   30.168  1.00 0.00 ? 443 SER A CB   3  
ATOM   4525  O  OG   . SER A 1 86  ? -5.208  5.191   30.717  1.00 0.00 ? 443 SER A OG   3  
ATOM   4526  H  H    . SER A 1 86  ? -7.312  5.311   32.520  1.00 0.00 ? 443 SER A H    3  
ATOM   4527  H  HA   . SER A 1 86  ? -7.738  3.009   30.746  1.00 0.00 ? 443 SER A HA   3  
ATOM   4528  H  HB2  . SER A 1 86  ? -5.972  3.862   29.372  1.00 0.00 ? 443 SER A HB2  3  
ATOM   4529  H  HB3  . SER A 1 86  ? -7.014  5.228   29.769  1.00 0.00 ? 443 SER A HB3  3  
ATOM   4530  H  HG   . SER A 1 86  ? -5.501  5.740   31.449  1.00 0.00 ? 443 SER A HG   3  
ATOM   4531  N  N    . ARG A 1 87  ? -5.258  3.426   32.876  1.00 0.00 ? 444 ARG A N    3  
ATOM   4532  C  CA   . ARG A 1 87  ? -4.245  2.720   33.652  1.00 0.00 ? 444 ARG A CA   3  
ATOM   4533  C  C    . ARG A 1 87  ? -4.724  2.482   35.081  1.00 0.00 ? 444 ARG A C    3  
ATOM   4534  O  O    . ARG A 1 87  ? -5.735  3.039   35.509  1.00 0.00 ? 444 ARG A O    3  
ATOM   4535  C  CB   . ARG A 1 87  ? -2.938  3.515   33.667  1.00 0.00 ? 444 ARG A CB   3  
ATOM   4536  C  CG   . ARG A 1 87  ? -2.347  3.742   32.285  1.00 0.00 ? 444 ARG A CG   3  
ATOM   4537  C  CD   . ARG A 1 87  ? -1.112  4.627   32.345  1.00 0.00 ? 444 ARG A CD   3  
ATOM   4538  N  NE   . ARG A 1 87  ? 0.110   3.849   32.526  1.00 0.00 ? 444 ARG A NE   3  
ATOM   4539  C  CZ   . ARG A 1 87  ? 0.710   3.183   31.546  1.00 0.00 ? 444 ARG A CZ   3  
ATOM   4540  N  NH1  . ARG A 1 87  ? 0.203   3.200   30.321  1.00 0.00 ? 444 ARG A NH1  3  
ATOM   4541  N  NH2  . ARG A 1 87  ? 1.820   2.498   31.790  1.00 0.00 ? 444 ARG A NH2  3  
ATOM   4542  H  H    . ARG A 1 87  ? -5.391  4.385   33.024  1.00 0.00 ? 444 ARG A H    3  
ATOM   4543  H  HA   . ARG A 1 87  ? -4.070  1.765   33.180  1.00 0.00 ? 444 ARG A HA   3  
ATOM   4544  H  HB2  . ARG A 1 87  ? -3.121  4.479   34.118  1.00 0.00 ? 444 ARG A HB2  3  
ATOM   4545  H  HB3  . ARG A 1 87  ? -2.213  2.981   34.261  1.00 0.00 ? 444 ARG A HB3  3  
ATOM   4546  H  HG2  . ARG A 1 87  ? -2.072  2.787   31.860  1.00 0.00 ? 444 ARG A HG2  3  
ATOM   4547  H  HG3  . ARG A 1 87  ? -3.090  4.215   31.660  1.00 0.00 ? 444 ARG A HG3  3  
ATOM   4548  H  HD2  . ARG A 1 87  ? -1.039  5.183   31.422  1.00 0.00 ? 444 ARG A HD2  3  
ATOM   4549  H  HD3  . ARG A 1 87  ? -1.218  5.313   33.172  1.00 0.00 ? 444 ARG A HD3  3  
ATOM   4550  H  HE   . ARG A 1 87  ? 0.502   3.822   33.424  1.00 0.00 ? 444 ARG A HE   3  
ATOM   4551  H  HH11 . ARG A 1 87  ? -0.633  3.717   30.134  1.00 0.00 ? 444 ARG A HH11 3  
ATOM   4552  H  HH12 . ARG A 1 87  ? 0.657   2.699   29.584  1.00 0.00 ? 444 ARG A HH12 3  
ATOM   4553  H  HH21 . ARG A 1 87  ? 2.205   2.482   32.712  1.00 0.00 ? 444 ARG A HH21 3  
ATOM   4554  H  HH22 . ARG A 1 87  ? 2.270   1.997   31.051  1.00 0.00 ? 444 ARG A HH22 3  
ATOM   4555  N  N    . SER A 1 88  ? -3.991  1.651   35.815  1.00 0.00 ? 445 SER A N    3  
ATOM   4556  C  CA   . SER A 1 88  ? -4.343  1.335   37.194  1.00 0.00 ? 445 SER A CA   3  
ATOM   4557  C  C    . SER A 1 88  ? -3.982  2.489   38.125  1.00 0.00 ? 445 SER A C    3  
ATOM   4558  O  O    . SER A 1 88  ? -4.840  3.034   38.819  1.00 0.00 ? 445 SER A O    3  
ATOM   4559  C  CB   . SER A 1 88  ? -3.630  0.059   37.646  1.00 0.00 ? 445 SER A CB   3  
ATOM   4560  O  OG   . SER A 1 88  ? -3.980  -1.039  36.821  1.00 0.00 ? 445 SER A OG   3  
ATOM   4561  H  H    . SER A 1 88  ? -3.195  1.238   35.418  1.00 0.00 ? 445 SER A H    3  
ATOM   4562  H  HA   . SER A 1 88  ? -5.410  1.175   37.236  1.00 0.00 ? 445 SER A HA   3  
ATOM   4563  H  HB2  . SER A 1 88  ? -2.562  0.208   37.593  1.00 0.00 ? 445 SER A HB2  3  
ATOM   4564  H  HB3  . SER A 1 88  ? -3.912  -0.166  38.664  1.00 0.00 ? 445 SER A HB3  3  
ATOM   4565  H  HG   . SER A 1 88  ? -3.696  -0.866  35.920  1.00 0.00 ? 445 SER A HG   3  
ATOM   4566  N  N    . ASP A 1 89  ? -2.705  2.857   38.133  1.00 0.00 ? 446 ASP A N    3  
ATOM   4567  C  CA   . ASP A 1 89  ? -2.228  3.946   38.977  1.00 0.00 ? 446 ASP A CA   3  
ATOM   4568  C  C    . ASP A 1 89  ? -3.153  5.156   38.876  1.00 0.00 ? 446 ASP A C    3  
ATOM   4569  O  O    . ASP A 1 89  ? -3.481  5.785   39.883  1.00 0.00 ? 446 ASP A O    3  
ATOM   4570  C  CB   . ASP A 1 89  ? -0.806  4.343   38.579  1.00 0.00 ? 446 ASP A CB   3  
ATOM   4571  C  CG   . ASP A 1 89  ? -0.508  5.801   38.869  1.00 0.00 ? 446 ASP A CG   3  
ATOM   4572  O  OD1  . ASP A 1 89  ? -0.729  6.234   40.020  1.00 0.00 ? 446 ASP A OD1  3  
ATOM   4573  O  OD2  . ASP A 1 89  ? -0.054  6.508   37.946  1.00 0.00 ? 446 ASP A OD2  3  
ATOM   4574  H  H    . ASP A 1 89  ? -2.068  2.384   37.557  1.00 0.00 ? 446 ASP A H    3  
ATOM   4575  H  HA   . ASP A 1 89  ? -2.223  3.597   39.998  1.00 0.00 ? 446 ASP A HA   3  
ATOM   4576  H  HB2  . ASP A 1 89  ? -0.102  3.735   39.130  1.00 0.00 ? 446 ASP A HB2  3  
ATOM   4577  H  HB3  . ASP A 1 89  ? -0.673  4.170   37.522  1.00 0.00 ? 446 ASP A HB3  3  
ATOM   4578  N  N    . HIS A 1 90  ? -3.569  5.476   37.655  1.00 0.00 ? 447 HIS A N    3  
ATOM   4579  C  CA   . HIS A 1 90  ? -4.456  6.611   37.423  1.00 0.00 ? 447 HIS A CA   3  
ATOM   4580  C  C    . HIS A 1 90  ? -5.621  6.600   38.408  1.00 0.00 ? 447 HIS A C    3  
ATOM   4581  O  O    . HIS A 1 90  ? -5.956  7.627   39.001  1.00 0.00 ? 447 HIS A O    3  
ATOM   4582  C  CB   . HIS A 1 90  ? -4.985  6.587   35.989  1.00 0.00 ? 447 HIS A CB   3  
ATOM   4583  C  CG   . HIS A 1 90  ? -3.997  7.079   34.977  1.00 0.00 ? 447 HIS A CG   3  
ATOM   4584  N  ND1  . HIS A 1 90  ? -4.018  6.692   33.654  1.00 0.00 ? 447 HIS A ND1  3  
ATOM   4585  C  CD2  . HIS A 1 90  ? -2.955  7.934   35.101  1.00 0.00 ? 447 HIS A CD2  3  
ATOM   4586  C  CE1  . HIS A 1 90  ? -3.030  7.286   33.008  1.00 0.00 ? 447 HIS A CE1  3  
ATOM   4587  N  NE2  . HIS A 1 90  ? -2.370  8.046   33.863  1.00 0.00 ? 447 HIS A NE2  3  
ATOM   4588  H  H    . HIS A 1 90  ? -3.273  4.937   36.893  1.00 0.00 ? 447 HIS A H    3  
ATOM   4589  H  HA   . HIS A 1 90  ? -3.884  7.515   37.571  1.00 0.00 ? 447 HIS A HA   3  
ATOM   4590  H  HB2  . HIS A 1 90  ? -5.250  5.573   35.727  1.00 0.00 ? 447 HIS A HB2  3  
ATOM   4591  H  HB3  . HIS A 1 90  ? -5.865  7.211   35.926  1.00 0.00 ? 447 HIS A HB3  3  
ATOM   4592  H  HD1  . HIS A 1 90  ? -4.660  6.072   33.249  1.00 0.00 ? 447 HIS A HD1  3  
ATOM   4593  H  HD2  . HIS A 1 90  ? -2.640  8.436   36.005  1.00 0.00 ? 447 HIS A HD2  3  
ATOM   4594  H  HE1  . HIS A 1 90  ? -2.801  7.171   31.959  1.00 0.00 ? 447 HIS A HE1  3  
ATOM   4595  N  N    . LEU A 1 91  ? -6.235  5.435   38.577  1.00 0.00 ? 448 LEU A N    3  
ATOM   4596  C  CA   . LEU A 1 91  ? -7.364  5.291   39.490  1.00 0.00 ? 448 LEU A CA   3  
ATOM   4597  C  C    . LEU A 1 91  ? -6.944  5.585   40.927  1.00 0.00 ? 448 LEU A C    3  
ATOM   4598  O  O    . LEU A 1 91  ? -7.505  6.463   41.581  1.00 0.00 ? 448 LEU A O    3  
ATOM   4599  C  CB   . LEU A 1 91  ? -7.945  3.879   39.396  1.00 0.00 ? 448 LEU A CB   3  
ATOM   4600  C  CG   . LEU A 1 91  ? -8.988  3.510   40.451  1.00 0.00 ? 448 LEU A CG   3  
ATOM   4601  C  CD1  . LEU A 1 91  ? -10.241 4.355   40.280  1.00 0.00 ? 448 LEU A CD1  3  
ATOM   4602  C  CD2  . LEU A 1 91  ? -9.327  2.028   40.371  1.00 0.00 ? 448 LEU A CD2  3  
ATOM   4603  H  H    . LEU A 1 91  ? -5.924  4.653   38.077  1.00 0.00 ? 448 LEU A H    3  
ATOM   4604  H  HA   . LEU A 1 91  ? -8.121  6.003   39.196  1.00 0.00 ? 448 LEU A HA   3  
ATOM   4605  H  HB2  . LEU A 1 91  ? -8.405  3.775   38.425  1.00 0.00 ? 448 LEU A HB2  3  
ATOM   4606  H  HB3  . LEU A 1 91  ? -7.125  3.179   39.480  1.00 0.00 ? 448 LEU A HB3  3  
ATOM   4607  H  HG   . LEU A 1 91  ? -8.583  3.709   41.433  1.00 0.00 ? 448 LEU A HG   3  
ATOM   4608  H  HD11 . LEU A 1 91  ? -11.111 3.716   40.298  1.00 0.00 ? 448 LEU A HD11 3  
ATOM   4609  H  HD12 . LEU A 1 91  ? -10.197 4.877   39.336  1.00 0.00 ? 448 LEU A HD12 3  
ATOM   4610  H  HD13 . LEU A 1 91  ? -10.303 5.072   41.085  1.00 0.00 ? 448 LEU A HD13 3  
ATOM   4611  H  HD21 . LEU A 1 91  ? -9.726  1.802   39.393  1.00 0.00 ? 448 LEU A HD21 3  
ATOM   4612  H  HD22 . LEU A 1 91  ? -10.062 1.787   41.124  1.00 0.00 ? 448 LEU A HD22 3  
ATOM   4613  H  HD23 . LEU A 1 91  ? -8.433  1.445   40.540  1.00 0.00 ? 448 LEU A HD23 3  
ATOM   4614  N  N    . ALA A 1 92  ? -5.951  4.845   41.410  1.00 0.00 ? 449 ALA A N    3  
ATOM   4615  C  CA   . ALA A 1 92  ? -5.452  5.030   42.768  1.00 0.00 ? 449 ALA A CA   3  
ATOM   4616  C  C    . ALA A 1 92  ? -5.145  6.497   43.045  1.00 0.00 ? 449 ALA A C    3  
ATOM   4617  O  O    . ALA A 1 92  ? -5.608  7.063   44.036  1.00 0.00 ? 449 ALA A O    3  
ATOM   4618  C  CB   . ALA A 1 92  ? -4.213  4.177   42.995  1.00 0.00 ? 449 ALA A CB   3  
ATOM   4619  H  H    . ALA A 1 92  ? -5.544  4.161   40.840  1.00 0.00 ? 449 ALA A H    3  
ATOM   4620  H  HA   . ALA A 1 92  ? -6.219  4.698   43.453  1.00 0.00 ? 449 ALA A HA   3  
ATOM   4621  H  HB1  . ALA A 1 92  ? -4.319  3.628   43.919  1.00 0.00 ? 449 ALA A HB1  3  
ATOM   4622  H  HB2  . ALA A 1 92  ? -4.100  3.483   42.175  1.00 0.00 ? 449 ALA A HB2  3  
ATOM   4623  H  HB3  . ALA A 1 92  ? -3.343  4.814   43.052  1.00 0.00 ? 449 ALA A HB3  3  
ATOM   4624  N  N    . LEU A 1 93  ? -4.360  7.109   42.164  1.00 0.00 ? 450 LEU A N    3  
ATOM   4625  C  CA   . LEU A 1 93  ? -3.990  8.512   42.314  1.00 0.00 ? 450 LEU A CA   3  
ATOM   4626  C  C    . LEU A 1 93  ? -5.229  9.399   42.377  1.00 0.00 ? 450 LEU A C    3  
ATOM   4627  O  O    . LEU A 1 93  ? -5.388  10.198  43.301  1.00 0.00 ? 450 LEU A O    3  
ATOM   4628  C  CB   . LEU A 1 93  ? -3.094  8.950   41.154  1.00 0.00 ? 450 LEU A CB   3  
ATOM   4629  C  CG   . LEU A 1 93  ? -2.160  10.128  41.436  1.00 0.00 ? 450 LEU A CG   3  
ATOM   4630  C  CD1  . LEU A 1 93  ? -0.863  9.644   42.065  1.00 0.00 ? 450 LEU A CD1  3  
ATOM   4631  C  CD2  . LEU A 1 93  ? -1.878  10.902  40.156  1.00 0.00 ? 450 LEU A CD2  3  
ATOM   4632  H  H    . LEU A 1 93  ? -4.022  6.606   41.394  1.00 0.00 ? 450 LEU A H    3  
ATOM   4633  H  HA   . LEU A 1 93  ? -3.443  8.613   43.240  1.00 0.00 ? 450 LEU A HA   3  
ATOM   4634  H  HB2  . LEU A 1 93  ? -2.484  8.106   40.871  1.00 0.00 ? 450 LEU A HB2  3  
ATOM   4635  H  HB3  . LEU A 1 93  ? -3.734  9.224   40.328  1.00 0.00 ? 450 LEU A HB3  3  
ATOM   4636  H  HG   . LEU A 1 93  ? -2.639  10.800  42.135  1.00 0.00 ? 450 LEU A HG   3  
ATOM   4637  H  HD11 . LEU A 1 93  ? -0.212  9.258   41.295  1.00 0.00 ? 450 LEU A HD11 3  
ATOM   4638  H  HD12 . LEU A 1 93  ? -1.079  8.863   42.778  1.00 0.00 ? 450 LEU A HD12 3  
ATOM   4639  H  HD13 . LEU A 1 93  ? -0.378  10.467  42.568  1.00 0.00 ? 450 LEU A HD13 3  
ATOM   4640  H  HD21 . LEU A 1 93  ? -1.571  10.216  39.381  1.00 0.00 ? 450 LEU A HD21 3  
ATOM   4641  H  HD22 . LEU A 1 93  ? -1.091  11.619  40.336  1.00 0.00 ? 450 LEU A HD22 3  
ATOM   4642  H  HD23 . LEU A 1 93  ? -2.773  11.421  39.844  1.00 0.00 ? 450 LEU A HD23 3  
ATOM   4643  N  N    . HIS A 1 94  ? -6.107  9.252   41.389  1.00 0.00 ? 451 HIS A N    3  
ATOM   4644  C  CA   . HIS A 1 94  ? -7.334  10.038  41.334  1.00 0.00 ? 451 HIS A CA   3  
ATOM   4645  C  C    . HIS A 1 94  ? -7.984  10.129  42.711  1.00 0.00 ? 451 HIS A C    3  
ATOM   4646  O  O    . HIS A 1 94  ? -8.495  11.179  43.098  1.00 0.00 ? 451 HIS A O    3  
ATOM   4647  C  CB   . HIS A 1 94  ? -8.314  9.422   40.335  1.00 0.00 ? 451 HIS A CB   3  
ATOM   4648  C  CG   . HIS A 1 94  ? -9.737  9.830   40.562  1.00 0.00 ? 451 HIS A CG   3  
ATOM   4649  N  ND1  . HIS A 1 94  ? -10.256 11.028  40.118  1.00 0.00 ? 451 HIS A ND1  3  
ATOM   4650  C  CD2  . HIS A 1 94  ? -10.753 9.192   41.189  1.00 0.00 ? 451 HIS A CD2  3  
ATOM   4651  C  CE1  . HIS A 1 94  ? -11.528 11.110  40.464  1.00 0.00 ? 451 HIS A CE1  3  
ATOM   4652  N  NE2  . HIS A 1 94  ? -11.855 10.008  41.115  1.00 0.00 ? 451 HIS A NE2  3  
ATOM   4653  H  H    . HIS A 1 94  ? -5.924  8.599   40.682  1.00 0.00 ? 451 HIS A H    3  
ATOM   4654  H  HA   . HIS A 1 94  ? -7.076  11.033  41.005  1.00 0.00 ? 451 HIS A HA   3  
ATOM   4655  H  HB2  . HIS A 1 94  ? -8.038  9.725   39.336  1.00 0.00 ? 451 HIS A HB2  3  
ATOM   4656  H  HB3  . HIS A 1 94  ? -8.262  8.345   40.406  1.00 0.00 ? 451 HIS A HB3  3  
ATOM   4657  H  HD1  . HIS A 1 94  ? -9.764  11.717  39.625  1.00 0.00 ? 451 HIS A HD1  3  
ATOM   4658  H  HD2  . HIS A 1 94  ? -10.705 8.220   41.662  1.00 0.00 ? 451 HIS A HD2  3  
ATOM   4659  H  HE1  . HIS A 1 94  ? -12.190 11.936  40.251  1.00 0.00 ? 451 HIS A HE1  3  
ATOM   4660  N  N    . MET A 1 95  ? -7.959  9.022   43.446  1.00 0.00 ? 452 MET A N    3  
ATOM   4661  C  CA   . MET A 1 95  ? -8.545  8.978   44.781  1.00 0.00 ? 452 MET A CA   3  
ATOM   4662  C  C    . MET A 1 95  ? -8.180  10.227  45.577  1.00 0.00 ? 452 MET A C    3  
ATOM   4663  O  O    . MET A 1 95  ? -9.003  10.769  46.315  1.00 0.00 ? 452 MET A O    3  
ATOM   4664  C  CB   . MET A 1 95  ? -8.075  7.728   45.527  1.00 0.00 ? 452 MET A CB   3  
ATOM   4665  C  CG   . MET A 1 95  ? -8.484  6.428   44.853  1.00 0.00 ? 452 MET A CG   3  
ATOM   4666  S  SD   . MET A 1 95  ? -10.255 6.342   44.526  1.00 0.00 ? 452 MET A SD   3  
ATOM   4667  C  CE   . MET A 1 95  ? -10.784 5.223   45.821  1.00 0.00 ? 452 MET A CE   3  
ATOM   4668  H  H    . MET A 1 95  ? -7.537  8.215   43.084  1.00 0.00 ? 452 MET A H    3  
ATOM   4669  H  HA   . MET A 1 95  ? -9.619  8.937   44.670  1.00 0.00 ? 452 MET A HA   3  
ATOM   4670  H  HB2  . MET A 1 95  ? -6.998  7.749   45.597  1.00 0.00 ? 452 MET A HB2  3  
ATOM   4671  H  HB3  . MET A 1 95  ? -8.493  7.738   46.523  1.00 0.00 ? 452 MET A HB3  3  
ATOM   4672  H  HG2  . MET A 1 95  ? -7.955  6.342   43.915  1.00 0.00 ? 452 MET A HG2  3  
ATOM   4673  H  HG3  . MET A 1 95  ? -8.209  5.604   45.495  1.00 0.00 ? 452 MET A HG3  3  
ATOM   4674  H  HE1  . MET A 1 95  ? -10.097 5.285   46.652  1.00 0.00 ? 452 MET A HE1  3  
ATOM   4675  H  HE2  . MET A 1 95  ? -11.775 5.497   46.151  1.00 0.00 ? 452 MET A HE2  3  
ATOM   4676  H  HE3  . MET A 1 95  ? -10.798 4.213   45.439  1.00 0.00 ? 452 MET A HE3  3  
ATOM   4677  N  N    . LYS A 1 96  ? -6.940  10.680  45.422  1.00 0.00 ? 453 LYS A N    3  
ATOM   4678  C  CA   . LYS A 1 96  ? -6.465  11.865  46.125  1.00 0.00 ? 453 LYS A CA   3  
ATOM   4679  C  C    . LYS A 1 96  ? -7.555  12.930  46.195  1.00 0.00 ? 453 LYS A C    3  
ATOM   4680  O  O    . LYS A 1 96  ? -7.824  13.487  47.259  1.00 0.00 ? 453 LYS A O    3  
ATOM   4681  C  CB   . LYS A 1 96  ? -5.226  12.434  45.429  1.00 0.00 ? 453 LYS A CB   3  
ATOM   4682  C  CG   . LYS A 1 96  ? -5.514  13.023  44.059  1.00 0.00 ? 453 LYS A CG   3  
ATOM   4683  C  CD   . LYS A 1 96  ? -4.239  13.473  43.366  1.00 0.00 ? 453 LYS A CD   3  
ATOM   4684  C  CE   . LYS A 1 96  ? -4.353  13.347  41.854  1.00 0.00 ? 453 LYS A CE   3  
ATOM   4685  N  NZ   . LYS A 1 96  ? -4.879  14.593  41.232  1.00 0.00 ? 453 LYS A NZ   3  
ATOM   4686  H  H    . LYS A 1 96  ? -6.330  10.205  44.819  1.00 0.00 ? 453 LYS A H    3  
ATOM   4687  H  HA   . LYS A 1 96  ? -6.200  11.572  47.129  1.00 0.00 ? 453 LYS A HA   3  
ATOM   4688  H  HB2  . LYS A 1 96  ? -4.803  13.209  46.050  1.00 0.00 ? 453 LYS A HB2  3  
ATOM   4689  H  HB3  . LYS A 1 96  ? -4.499  11.642  45.311  1.00 0.00 ? 453 LYS A HB3  3  
ATOM   4690  H  HG2  . LYS A 1 96  ? -5.998  12.275  43.450  1.00 0.00 ? 453 LYS A HG2  3  
ATOM   4691  H  HG3  . LYS A 1 96  ? -6.170  13.875  44.175  1.00 0.00 ? 453 LYS A HG3  3  
ATOM   4692  H  HD2  . LYS A 1 96  ? -4.048  14.505  43.616  1.00 0.00 ? 453 LYS A HD2  3  
ATOM   4693  H  HD3  . LYS A 1 96  ? -3.418  12.859  43.709  1.00 0.00 ? 453 LYS A HD3  3  
ATOM   4694  H  HE2  . LYS A 1 96  ? -3.375  13.138  41.449  1.00 0.00 ? 453 LYS A HE2  3  
ATOM   4695  H  HE3  . LYS A 1 96  ? -5.020  12.529  41.624  1.00 0.00 ? 453 LYS A HE3  3  
ATOM   4696  H  HZ1  . LYS A 1 96  ? -4.490  14.706  40.274  1.00 0.00 ? 453 LYS A HZ1  3  
ATOM   4697  H  HZ2  . LYS A 1 96  ? -4.611  15.419  41.804  1.00 0.00 ? 453 LYS A HZ2  3  
ATOM   4698  H  HZ3  . LYS A 1 96  ? -5.916  14.551  41.170  1.00 0.00 ? 453 LYS A HZ3  3  
ATOM   4699  N  N    . ARG A 1 97  ? -8.179  13.206  45.055  1.00 0.00 ? 454 ARG A N    3  
ATOM   4700  C  CA   . ARG A 1 97  ? -9.241  14.204  44.987  1.00 0.00 ? 454 ARG A CA   3  
ATOM   4701  C  C    . ARG A 1 97  ? -10.397 13.830  45.909  1.00 0.00 ? 454 ARG A C    3  
ATOM   4702  O  O    . ARG A 1 97  ? -10.873 14.655  46.691  1.00 0.00 ? 454 ARG A O    3  
ATOM   4703  C  CB   . ARG A 1 97  ? -9.745  14.346  43.550  1.00 0.00 ? 454 ARG A CB   3  
ATOM   4704  C  CG   . ARG A 1 97  ? -9.024  15.422  42.755  1.00 0.00 ? 454 ARG A CG   3  
ATOM   4705  C  CD   . ARG A 1 97  ? -9.721  16.768  42.878  1.00 0.00 ? 454 ARG A CD   3  
ATOM   4706  N  NE   . ARG A 1 97  ? -8.989  17.828  42.190  1.00 0.00 ? 454 ARG A NE   3  
ATOM   4707  C  CZ   . ARG A 1 97  ? -9.549  18.961  41.780  1.00 0.00 ? 454 ARG A CZ   3  
ATOM   4708  N  NH1  . ARG A 1 97  ? -10.840 19.180  41.990  1.00 0.00 ? 454 ARG A NH1  3  
ATOM   4709  N  NH2  . ARG A 1 97  ? -8.817  19.878  41.161  1.00 0.00 ? 454 ARG A NH2  3  
ATOM   4710  H  H    . ARG A 1 97  ? -7.920  12.729  44.239  1.00 0.00 ? 454 ARG A H    3  
ATOM   4711  H  HA   . ARG A 1 97  ? -8.829  15.149  45.310  1.00 0.00 ? 454 ARG A HA   3  
ATOM   4712  H  HB2  . ARG A 1 97  ? -9.614  13.404  43.040  1.00 0.00 ? 454 ARG A HB2  3  
ATOM   4713  H  HB3  . ARG A 1 97  ? -10.796 14.591  43.573  1.00 0.00 ? 454 ARG A HB3  3  
ATOM   4714  H  HG2  . ARG A 1 97  ? -8.014  15.517  43.128  1.00 0.00 ? 454 ARG A HG2  3  
ATOM   4715  H  HG3  . ARG A 1 97  ? -9.000  15.132  41.715  1.00 0.00 ? 454 ARG A HG3  3  
ATOM   4716  H  HD2  . ARG A 1 97  ? -10.708 16.688  42.448  1.00 0.00 ? 454 ARG A HD2  3  
ATOM   4717  H  HD3  . ARG A 1 97  ? -9.803  17.021  43.924  1.00 0.00 ? 454 ARG A HD3  3  
ATOM   4718  H  HE   . ARG A 1 97  ? -8.034  17.687  42.024  1.00 0.00 ? 454 ARG A HE   3  
ATOM   4719  H  HH11 . ARG A 1 97  ? -11.394 18.491  42.457  1.00 0.00 ? 454 ARG A HH11 3  
ATOM   4720  H  HH12 . ARG A 1 97  ? -11.259 20.035  41.682  1.00 0.00 ? 454 ARG A HH12 3  
ATOM   4721  H  HH21 . ARG A 1 97  ? -7.844  19.717  41.001  1.00 0.00 ? 454 ARG A HH21 3  
ATOM   4722  H  HH22 . ARG A 1 97  ? -9.239  20.730  40.853  1.00 0.00 ? 454 ARG A HH22 3  
ATOM   4723  N  N    . HIS A 1 98  ? -10.846 12.583  45.812  1.00 0.00 ? 455 HIS A N    3  
ATOM   4724  C  CA   . HIS A 1 98  ? -11.947 12.100  46.638  1.00 0.00 ? 455 HIS A CA   3  
ATOM   4725  C  C    . HIS A 1 98  ? -11.612 12.230  48.121  1.00 0.00 ? 455 HIS A C    3  
ATOM   4726  O  O    . HIS A 1 98  ? -12.377 12.811  48.890  1.00 0.00 ? 455 HIS A O    3  
ATOM   4727  C  CB   . HIS A 1 98  ? -12.263 10.642  46.301  1.00 0.00 ? 455 HIS A CB   3  
ATOM   4728  C  CG   . HIS A 1 98  ? -13.177 10.485  45.125  1.00 0.00 ? 455 HIS A CG   3  
ATOM   4729  N  ND1  . HIS A 1 98  ? -14.231 11.337  44.871  1.00 0.00 ? 455 HIS A ND1  3  
ATOM   4730  C  CD2  . HIS A 1 98  ? -13.189 9.567   44.129  1.00 0.00 ? 455 HIS A CD2  3  
ATOM   4731  C  CE1  . HIS A 1 98  ? -14.853 10.949  43.771  1.00 0.00 ? 455 HIS A CE1  3  
ATOM   4732  N  NE2  . HIS A 1 98  ? -14.240 9.878   43.302  1.00 0.00 ? 455 HIS A NE2  3  
ATOM   4733  H  H    . HIS A 1 98  ? -10.425 11.973  45.171  1.00 0.00 ? 455 HIS A H    3  
ATOM   4734  H  HA   . HIS A 1 98  ? -12.813 12.706  46.423  1.00 0.00 ? 455 HIS A HA   3  
ATOM   4735  H  HB2  . HIS A 1 98  ? -11.343 10.123  46.077  1.00 0.00 ? 455 HIS A HB2  3  
ATOM   4736  H  HB3  . HIS A 1 98  ? -12.736 10.177  47.154  1.00 0.00 ? 455 HIS A HB3  3  
ATOM   4737  H  HD1  . HIS A 1 98  ? -14.487 12.109  45.416  1.00 0.00 ? 455 HIS A HD1  3  
ATOM   4738  H  HD2  . HIS A 1 98  ? -12.500 8.743   44.008  1.00 0.00 ? 455 HIS A HD2  3  
ATOM   4739  H  HE1  . HIS A 1 98  ? -15.715 11.426  43.331  1.00 0.00 ? 455 HIS A HE1  3  
ATOM   4740  N  N    . GLN A 1 99  ? -10.465 11.685  48.514  1.00 0.00 ? 456 GLN A N    3  
ATOM   4741  C  CA   . GLN A 1 99  ? -10.031 11.740  49.905  1.00 0.00 ? 456 GLN A CA   3  
ATOM   4742  C  C    . GLN A 1 99  ? -9.633  13.160  50.295  1.00 0.00 ? 456 GLN A C    3  
ATOM   4743  O  O    . GLN A 1 99  ? -9.380  14.002  49.435  1.00 0.00 ? 456 GLN A O    3  
ATOM   4744  C  CB   . GLN A 1 99  ? -8.856  10.787  50.132  1.00 0.00 ? 456 GLN A CB   3  
ATOM   4745  C  CG   . GLN A 1 99  ? -9.234  9.319   50.026  1.00 0.00 ? 456 GLN A CG   3  
ATOM   4746  C  CD   . GLN A 1 99  ? -9.853  8.782   51.301  1.00 0.00 ? 456 GLN A CD   3  
ATOM   4747  O  OE1  . GLN A 1 99  ? -10.584 9.488   51.996  1.00 0.00 ? 456 GLN A OE1  3  
ATOM   4748  N  NE2  . GLN A 1 99  ? -9.563  7.525   51.616  1.00 0.00 ? 456 GLN A NE2  3  
ATOM   4749  H  H    . GLN A 1 99  ? -9.898  11.236  47.853  1.00 0.00 ? 456 GLN A H    3  
ATOM   4750  H  HA   . GLN A 1 99  ? -10.860 11.429  50.523  1.00 0.00 ? 456 GLN A HA   3  
ATOM   4751  H  HB2  . GLN A 1 99  ? -8.093  10.995  49.397  1.00 0.00 ? 456 GLN A HB2  3  
ATOM   4752  H  HB3  . GLN A 1 99  ? -8.452  10.962  51.118  1.00 0.00 ? 456 GLN A HB3  3  
ATOM   4753  H  HG2  . GLN A 1 99  ? -9.946  9.201   49.222  1.00 0.00 ? 456 GLN A HG2  3  
ATOM   4754  H  HG3  . GLN A 1 99  ? -8.345  8.747   49.805  1.00 0.00 ? 456 GLN A HG3  3  
ATOM   4755  H  HE21 . GLN A 1 99  ? -8.972  7.022   51.016  1.00 0.00 ? 456 GLN A HE21 3  
ATOM   4756  H  HE22 . GLN A 1 99  ? -9.948  7.152   52.436  1.00 0.00 ? 456 GLN A HE22 3  
ATOM   4757  N  N    . ASN A 1 100 ? -9.580  13.417  51.598  1.00 0.00 ? 457 ASN A N    3  
ATOM   4758  C  CA   . ASN A 1 100 ? -9.213  14.735  52.103  1.00 0.00 ? 457 ASN A CA   3  
ATOM   4759  C  C    . ASN A 1 100 ? -7.968  14.655  52.980  1.00 0.00 ? 457 ASN A C    3  
ATOM   4760  O  O    . ASN A 1 100 ? -7.946  13.936  53.979  1.00 0.00 ? 457 ASN A O    3  
ATOM   4761  C  CB   . ASN A 1 100 ? -10.373 15.341  52.897  1.00 0.00 ? 457 ASN A CB   3  
ATOM   4762  C  CG   . ASN A 1 100 ? -11.523 15.769  52.005  1.00 0.00 ? 457 ASN A CG   3  
ATOM   4763  O  OD1  . ASN A 1 100 ? -12.529 15.069  51.893  1.00 0.00 ? 457 ASN A OD1  3  
ATOM   4764  N  ND2  . ASN A 1 100 ? -11.378 16.923  51.366  1.00 0.00 ? 457 ASN A ND2  3  
ATOM   4765  H  H    . ASN A 1 100 ? -9.793  12.704  52.236  1.00 0.00 ? 457 ASN A H    3  
ATOM   4766  H  HA   . ASN A 1 100 ? -9.001  15.368  51.254  1.00 0.00 ? 457 ASN A HA   3  
ATOM   4767  H  HB2  . ASN A 1 100 ? -10.741 14.608  53.600  1.00 0.00 ? 457 ASN A HB2  3  
ATOM   4768  H  HB3  . ASN A 1 100 ? -10.018 16.206  53.437  1.00 0.00 ? 457 ASN A HB3  3  
ATOM   4769  H  HD21 . ASN A 1 100 ? -10.548 17.428  51.503  1.00 0.00 ? 457 ASN A HD21 3  
ATOM   4770  H  HD22 . ASN A 1 100 ? -12.106 17.224  50.784  1.00 0.00 ? 457 ASN A HD22 3  
HETATM 4771  ZN ZN   . ZN  B 2 .   ? 15.409  -0.754  10.247  1.00 0.00 ? 100 ZN  A ZN   3  
HETATM 4772  ZN ZN   . ZN  C 2 .   ? -9.382  5.134   23.008  1.00 0.00 ? 200 ZN  A ZN   3  
HETATM 4773  ZN ZN   . ZN  D 2 .   ? -13.527 9.037   41.575  1.00 0.00 ? 300 ZN  A ZN   3  
ATOM   4774  N  N    . GLY A 1 1   ? 73.685  -16.163 22.566  1.00 0.00 ? 358 GLY A N    4  
ATOM   4775  C  CA   . GLY A 1 1   ? 72.615  -15.182 22.568  1.00 0.00 ? 358 GLY A CA   4  
ATOM   4776  C  C    . GLY A 1 1   ? 71.252  -15.811 22.780  1.00 0.00 ? 358 GLY A C    4  
ATOM   4777  O  O    . GLY A 1 1   ? 71.091  -17.023 22.637  1.00 0.00 ? 358 GLY A O    4  
ATOM   4778  H  H1   . GLY A 1 1   ? 73.494  -17.094 22.806  1.00 0.00 ? 358 GLY A H1   4  
ATOM   4779  H  HA2  . GLY A 1 1   ? 72.798  -14.468 23.357  1.00 0.00 ? 358 GLY A HA2  4  
ATOM   4780  H  HA3  . GLY A 1 1   ? 72.616  -14.664 21.620  1.00 0.00 ? 358 GLY A HA3  4  
ATOM   4781  N  N    . SER A 1 2   ? 70.269  -14.985 23.123  1.00 0.00 ? 359 SER A N    4  
ATOM   4782  C  CA   . SER A 1 2   ? 68.914  -15.468 23.360  1.00 0.00 ? 359 SER A CA   4  
ATOM   4783  C  C    . SER A 1 2   ? 67.957  -14.305 23.606  1.00 0.00 ? 359 SER A C    4  
ATOM   4784  O  O    . SER A 1 2   ? 68.384  -13.185 23.886  1.00 0.00 ? 359 SER A O    4  
ATOM   4785  C  CB   . SER A 1 2   ? 68.892  -16.422 24.557  1.00 0.00 ? 359 SER A CB   4  
ATOM   4786  O  OG   . SER A 1 2   ? 67.850  -17.374 24.431  1.00 0.00 ? 359 SER A OG   4  
ATOM   4787  H  H    . SER A 1 2   ? 70.460  -14.029 23.221  1.00 0.00 ? 359 SER A H    4  
ATOM   4788  H  HA   . SER A 1 2   ? 68.593  -16.003 22.479  1.00 0.00 ? 359 SER A HA   4  
ATOM   4789  H  HB2  . SER A 1 2   ? 69.835  -16.944 24.615  1.00 0.00 ? 359 SER A HB2  4  
ATOM   4790  H  HB3  . SER A 1 2   ? 68.738  -15.854 25.463  1.00 0.00 ? 359 SER A HB3  4  
ATOM   4791  H  HG   . SER A 1 2   ? 67.993  -17.904 23.644  1.00 0.00 ? 359 SER A HG   4  
ATOM   4792  N  N    . SER A 1 3   ? 66.661  -14.579 23.497  1.00 0.00 ? 360 SER A N    4  
ATOM   4793  C  CA   . SER A 1 3   ? 65.643  -13.556 23.703  1.00 0.00 ? 360 SER A CA   4  
ATOM   4794  C  C    . SER A 1 3   ? 64.262  -14.186 23.851  1.00 0.00 ? 360 SER A C    4  
ATOM   4795  O  O    . SER A 1 3   ? 64.106  -15.401 23.742  1.00 0.00 ? 360 SER A O    4  
ATOM   4796  C  CB   . SER A 1 3   ? 65.642  -12.566 22.537  1.00 0.00 ? 360 SER A CB   4  
ATOM   4797  O  OG   . SER A 1 3   ? 65.496  -13.238 21.297  1.00 0.00 ? 360 SER A OG   4  
ATOM   4798  H  H    . SER A 1 3   ? 66.384  -15.492 23.271  1.00 0.00 ? 360 SER A H    4  
ATOM   4799  H  HA   . SER A 1 3   ? 65.884  -13.027 24.613  1.00 0.00 ? 360 SER A HA   4  
ATOM   4800  H  HB2  . SER A 1 3   ? 64.823  -11.874 22.656  1.00 0.00 ? 360 SER A HB2  4  
ATOM   4801  H  HB3  . SER A 1 3   ? 66.575  -12.021 22.530  1.00 0.00 ? 360 SER A HB3  4  
ATOM   4802  H  HG   . SER A 1 3   ? 66.303  -13.717 21.096  1.00 0.00 ? 360 SER A HG   4  
ATOM   4803  N  N    . GLY A 1 4   ? 63.260  -13.348 24.101  1.00 0.00 ? 361 GLY A N    4  
ATOM   4804  C  CA   . GLY A 1 4   ? 61.904  -13.840 24.261  1.00 0.00 ? 361 GLY A CA   4  
ATOM   4805  C  C    . GLY A 1 4   ? 60.925  -12.738 24.617  1.00 0.00 ? 361 GLY A C    4  
ATOM   4806  O  O    . GLY A 1 4   ? 61.313  -11.711 25.174  1.00 0.00 ? 361 GLY A O    4  
ATOM   4807  H  H    . GLY A 1 4   ? 63.443  -12.388 24.178  1.00 0.00 ? 361 GLY A H    4  
ATOM   4808  H  HA2  . GLY A 1 4   ? 61.589  -14.302 23.337  1.00 0.00 ? 361 GLY A HA2  4  
ATOM   4809  H  HA3  . GLY A 1 4   ? 61.893  -14.583 25.045  1.00 0.00 ? 361 GLY A HA3  4  
ATOM   4810  N  N    . SER A 1 5   ? 59.654  -12.951 24.293  1.00 0.00 ? 362 SER A N    4  
ATOM   4811  C  CA   . SER A 1 5   ? 58.618  -11.965 24.578  1.00 0.00 ? 362 SER A CA   4  
ATOM   4812  C  C    . SER A 1 5   ? 57.235  -12.608 24.553  1.00 0.00 ? 362 SER A C    4  
ATOM   4813  O  O    . SER A 1 5   ? 57.095  -13.797 24.264  1.00 0.00 ? 362 SER A O    4  
ATOM   4814  C  CB   . SER A 1 5   ? 58.679  -10.822 23.562  1.00 0.00 ? 362 SER A CB   4  
ATOM   4815  O  OG   . SER A 1 5   ? 59.611  -9.833  23.964  1.00 0.00 ? 362 SER A OG   4  
ATOM   4816  H  H    . SER A 1 5   ? 59.407  -13.790 23.850  1.00 0.00 ? 362 SER A H    4  
ATOM   4817  H  HA   . SER A 1 5   ? 58.800  -11.568 25.565  1.00 0.00 ? 362 SER A HA   4  
ATOM   4818  H  HB2  . SER A 1 5   ? 58.980  -11.213 22.602  1.00 0.00 ? 362 SER A HB2  4  
ATOM   4819  H  HB3  . SER A 1 5   ? 57.703  -10.368 23.477  1.00 0.00 ? 362 SER A HB3  4  
ATOM   4820  H  HG   . SER A 1 5   ? 59.395  -9.531  24.850  1.00 0.00 ? 362 SER A HG   4  
ATOM   4821  N  N    . SER A 1 6   ? 56.214  -11.814 24.860  1.00 0.00 ? 363 SER A N    4  
ATOM   4822  C  CA   . SER A 1 6   ? 54.841  -12.305 24.877  1.00 0.00 ? 363 SER A CA   4  
ATOM   4823  C  C    . SER A 1 6   ? 53.857  -11.160 25.095  1.00 0.00 ? 363 SER A C    4  
ATOM   4824  O  O    . SER A 1 6   ? 54.246  -10.054 25.468  1.00 0.00 ? 363 SER A O    4  
ATOM   4825  C  CB   . SER A 1 6   ? 54.668  -13.357 25.974  1.00 0.00 ? 363 SER A CB   4  
ATOM   4826  O  OG   . SER A 1 6   ? 54.968  -14.654 25.488  1.00 0.00 ? 363 SER A OG   4  
ATOM   4827  H  H    . SER A 1 6   ? 56.389  -10.875 25.082  1.00 0.00 ? 363 SER A H    4  
ATOM   4828  H  HA   . SER A 1 6   ? 54.640  -12.760 23.919  1.00 0.00 ? 363 SER A HA   4  
ATOM   4829  H  HB2  . SER A 1 6   ? 55.331  -13.131 26.795  1.00 0.00 ? 363 SER A HB2  4  
ATOM   4830  H  HB3  . SER A 1 6   ? 53.645  -13.344 26.323  1.00 0.00 ? 363 SER A HB3  4  
ATOM   4831  H  HG   . SER A 1 6   ? 54.153  -15.107 25.258  1.00 0.00 ? 363 SER A HG   4  
ATOM   4832  N  N    . GLY A 1 7   ? 52.578  -11.434 24.858  1.00 0.00 ? 364 GLY A N    4  
ATOM   4833  C  CA   . GLY A 1 7   ? 51.556  -10.418 25.033  1.00 0.00 ? 364 GLY A CA   4  
ATOM   4834  C  C    . GLY A 1 7   ? 50.155  -10.969 24.863  1.00 0.00 ? 364 GLY A C    4  
ATOM   4835  O  O    . GLY A 1 7   ? 49.786  -11.471 23.801  1.00 0.00 ? 364 GLY A O    4  
ATOM   4836  H  H    . GLY A 1 7   ? 52.325  -12.334 24.562  1.00 0.00 ? 364 GLY A H    4  
ATOM   4837  H  HA2  . GLY A 1 7   ? 51.649  -9.996  26.023  1.00 0.00 ? 364 GLY A HA2  4  
ATOM   4838  H  HA3  . GLY A 1 7   ? 51.714  -9.636  24.304  1.00 0.00 ? 364 GLY A HA3  4  
ATOM   4839  N  N    . PRO A 1 8   ? 49.347  -10.881 25.930  1.00 0.00 ? 365 PRO A N    4  
ATOM   4840  C  CA   . PRO A 1 8   ? 47.965  -11.371 25.920  1.00 0.00 ? 365 PRO A CA   4  
ATOM   4841  C  C    . PRO A 1 8   ? 47.056  -10.522 25.038  1.00 0.00 ? 365 PRO A C    4  
ATOM   4842  O  O    . PRO A 1 8   ? 47.122  -9.293  25.063  1.00 0.00 ? 365 PRO A O    4  
ATOM   4843  C  CB   . PRO A 1 8   ? 47.540  -11.264 27.387  1.00 0.00 ? 365 PRO A CB   4  
ATOM   4844  C  CG   . PRO A 1 8   ? 48.407  -10.194 27.955  1.00 0.00 ? 365 PRO A CG   4  
ATOM   4845  C  CD   . PRO A 1 8   ? 49.720  -10.295 27.229  1.00 0.00 ? 365 PRO A CD   4  
ATOM   4846  H  HA   . PRO A 1 8   ? 47.912  -12.402 25.603  1.00 0.00 ? 365 PRO A HA   4  
ATOM   4847  H  HB2  . PRO A 1 8   ? 46.494  -10.997 27.442  1.00 0.00 ? 365 PRO A HB2  4  
ATOM   4848  H  HB3  . PRO A 1 8   ? 47.703  -12.209 27.882  1.00 0.00 ? 365 PRO A HB3  4  
ATOM   4849  H  HG2  . PRO A 1 8   ? 47.957  -9.228  27.785  1.00 0.00 ? 365 PRO A HG2  4  
ATOM   4850  H  HG3  . PRO A 1 8   ? 48.550  -10.362 29.013  1.00 0.00 ? 365 PRO A HG3  4  
ATOM   4851  H  HD2  . PRO A 1 8   ? 50.156  -9.315  27.099  1.00 0.00 ? 365 PRO A HD2  4  
ATOM   4852  H  HD3  . PRO A 1 8   ? 50.398  -10.944 27.763  1.00 0.00 ? 365 PRO A HD3  4  
ATOM   4853  N  N    . ASP A 1 9   ? 46.207  -11.185 24.261  1.00 0.00 ? 366 ASP A N    4  
ATOM   4854  C  CA   . ASP A 1 9   ? 45.282  -10.491 23.372  1.00 0.00 ? 366 ASP A CA   4  
ATOM   4855  C  C    . ASP A 1 9   ? 43.983  -10.152 24.097  1.00 0.00 ? 366 ASP A C    4  
ATOM   4856  O  O    . ASP A 1 9   ? 43.678  -10.721 25.146  1.00 0.00 ? 366 ASP A O    4  
ATOM   4857  C  CB   . ASP A 1 9   ? 44.985  -11.348 22.141  1.00 0.00 ? 366 ASP A CB   4  
ATOM   4858  C  CG   . ASP A 1 9   ? 44.918  -12.827 22.467  1.00 0.00 ? 366 ASP A CG   4  
ATOM   4859  O  OD1  . ASP A 1 9   ? 45.984  -13.430 22.704  1.00 0.00 ? 366 ASP A OD1  4  
ATOM   4860  O  OD2  . ASP A 1 9   ? 43.798  -13.381 22.484  1.00 0.00 ? 366 ASP A OD2  4  
ATOM   4861  H  H    . ASP A 1 9   ? 46.201  -12.165 24.286  1.00 0.00 ? 366 ASP A H    4  
ATOM   4862  H  HA   . ASP A 1 9   ? 45.753  -9.573  23.056  1.00 0.00 ? 366 ASP A HA   4  
ATOM   4863  H  HB2  . ASP A 1 9   ? 44.035  -11.047 21.722  1.00 0.00 ? 366 ASP A HB2  4  
ATOM   4864  H  HB3  . ASP A 1 9   ? 45.762  -11.194 21.407  1.00 0.00 ? 366 ASP A HB3  4  
ATOM   4865  N  N    . LEU A 1 10  ? 43.222  -9.221  23.532  1.00 0.00 ? 367 LEU A N    4  
ATOM   4866  C  CA   . LEU A 1 10  ? 41.956  -8.804  24.125  1.00 0.00 ? 367 LEU A CA   4  
ATOM   4867  C  C    . LEU A 1 10  ? 41.179  -7.902  23.171  1.00 0.00 ? 367 LEU A C    4  
ATOM   4868  O  O    . LEU A 1 10  ? 41.755  -7.294  22.270  1.00 0.00 ? 367 LEU A O    4  
ATOM   4869  C  CB   . LEU A 1 10  ? 42.204  -8.075  25.446  1.00 0.00 ? 367 LEU A CB   4  
ATOM   4870  C  CG   . LEU A 1 10  ? 43.153  -6.878  25.385  1.00 0.00 ? 367 LEU A CG   4  
ATOM   4871  C  CD1  . LEU A 1 10  ? 42.385  -5.603  25.073  1.00 0.00 ? 367 LEU A CD1  4  
ATOM   4872  C  CD2  . LEU A 1 10  ? 43.918  -6.736  26.693  1.00 0.00 ? 367 LEU A CD2  4  
ATOM   4873  H  H    . LEU A 1 10  ? 43.518  -8.803  22.697  1.00 0.00 ? 367 LEU A H    4  
ATOM   4874  H  HA   . LEU A 1 10  ? 41.372  -9.692  24.317  1.00 0.00 ? 367 LEU A HA   4  
ATOM   4875  H  HB2  . LEU A 1 10  ? 41.252  -7.724  25.813  1.00 0.00 ? 367 LEU A HB2  4  
ATOM   4876  H  HB3  . LEU A 1 10  ? 42.616  -8.790  26.145  1.00 0.00 ? 367 LEU A HB3  4  
ATOM   4877  H  HG   . LEU A 1 10  ? 43.871  -7.037  24.592  1.00 0.00 ? 367 LEU A HG   4  
ATOM   4878  H  HD11 . LEU A 1 10  ? 43.005  -4.747  25.291  1.00 0.00 ? 367 LEU A HD11 4  
ATOM   4879  H  HD12 . LEU A 1 10  ? 41.491  -5.564  25.678  1.00 0.00 ? 367 LEU A HD12 4  
ATOM   4880  H  HD13 . LEU A 1 10  ? 42.112  -5.594  24.027  1.00 0.00 ? 367 LEU A HD13 4  
ATOM   4881  H  HD21 . LEU A 1 10  ? 43.347  -7.182  27.493  1.00 0.00 ? 367 LEU A HD21 4  
ATOM   4882  H  HD22 . LEU A 1 10  ? 44.077  -5.689  26.904  1.00 0.00 ? 367 LEU A HD22 4  
ATOM   4883  H  HD23 . LEU A 1 10  ? 44.872  -7.235  26.608  1.00 0.00 ? 367 LEU A HD23 4  
ATOM   4884  N  N    . GLU A 1 11  ? 39.868  -7.820  23.378  1.00 0.00 ? 368 GLU A N    4  
ATOM   4885  C  CA   . GLU A 1 11  ? 39.013  -6.991  22.537  1.00 0.00 ? 368 GLU A CA   4  
ATOM   4886  C  C    . GLU A 1 11  ? 37.629  -6.832  23.158  1.00 0.00 ? 368 GLU A C    4  
ATOM   4887  O  O    . GLU A 1 11  ? 37.256  -7.569  24.070  1.00 0.00 ? 368 GLU A O    4  
ATOM   4888  C  CB   . GLU A 1 11  ? 38.890  -7.600  21.139  1.00 0.00 ? 368 GLU A CB   4  
ATOM   4889  C  CG   . GLU A 1 11  ? 38.324  -9.010  21.137  1.00 0.00 ? 368 GLU A CG   4  
ATOM   4890  C  CD   . GLU A 1 11  ? 38.337  -9.643  19.759  1.00 0.00 ? 368 GLU A CD   4  
ATOM   4891  O  OE1  . GLU A 1 11  ? 39.372  -10.234 19.387  1.00 0.00 ? 368 GLU A OE1  4  
ATOM   4892  O  OE2  . GLU A 1 11  ? 37.312  -9.546  19.052  1.00 0.00 ? 368 GLU A OE2  4  
ATOM   4893  H  H    . GLU A 1 11  ? 39.467  -8.329  24.113  1.00 0.00 ? 368 GLU A H    4  
ATOM   4894  H  HA   . GLU A 1 11  ? 39.472  -6.017  22.456  1.00 0.00 ? 368 GLU A HA   4  
ATOM   4895  H  HB2  . GLU A 1 11  ? 38.244  -6.974  20.542  1.00 0.00 ? 368 GLU A HB2  4  
ATOM   4896  H  HB3  . GLU A 1 11  ? 39.869  -7.628  20.684  1.00 0.00 ? 368 GLU A HB3  4  
ATOM   4897  H  HG2  . GLU A 1 11  ? 38.915  -9.622  21.802  1.00 0.00 ? 368 GLU A HG2  4  
ATOM   4898  H  HG3  . GLU A 1 11  ? 37.305  -8.976  21.492  1.00 0.00 ? 368 GLU A HG3  4  
ATOM   4899  N  N    . LYS A 1 12  ? 36.870  -5.862  22.657  1.00 0.00 ? 369 LYS A N    4  
ATOM   4900  C  CA   . LYS A 1 12  ? 35.526  -5.605  23.161  1.00 0.00 ? 369 LYS A CA   4  
ATOM   4901  C  C    . LYS A 1 12  ? 34.723  -4.773  22.166  1.00 0.00 ? 369 LYS A C    4  
ATOM   4902  O  O    . LYS A 1 12  ? 35.173  -3.717  21.720  1.00 0.00 ? 369 LYS A O    4  
ATOM   4903  C  CB   . LYS A 1 12  ? 35.594  -4.883  24.508  1.00 0.00 ? 369 LYS A CB   4  
ATOM   4904  C  CG   . LYS A 1 12  ? 34.359  -5.084  25.369  1.00 0.00 ? 369 LYS A CG   4  
ATOM   4905  C  CD   . LYS A 1 12  ? 33.194  -4.241  24.877  1.00 0.00 ? 369 LYS A CD   4  
ATOM   4906  C  CE   . LYS A 1 12  ? 32.054  -4.224  25.885  1.00 0.00 ? 369 LYS A CE   4  
ATOM   4907  N  NZ   . LYS A 1 12  ? 32.198  -3.113  26.865  1.00 0.00 ? 369 LYS A NZ   4  
ATOM   4908  H  H    . LYS A 1 12  ? 37.223  -5.307  21.930  1.00 0.00 ? 369 LYS A H    4  
ATOM   4909  H  HA   . LYS A 1 12  ? 35.034  -6.556  23.296  1.00 0.00 ? 369 LYS A HA   4  
ATOM   4910  H  HB2  . LYS A 1 12  ? 36.451  -5.246  25.055  1.00 0.00 ? 369 LYS A HB2  4  
ATOM   4911  H  HB3  . LYS A 1 12  ? 35.714  -3.824  24.330  1.00 0.00 ? 369 LYS A HB3  4  
ATOM   4912  H  HG2  . LYS A 1 12  ? 34.075  -6.125  25.338  1.00 0.00 ? 369 LYS A HG2  4  
ATOM   4913  H  HG3  . LYS A 1 12  ? 34.590  -4.802  26.387  1.00 0.00 ? 369 LYS A HG3  4  
ATOM   4914  H  HD2  . LYS A 1 12  ? 33.534  -3.229  24.719  1.00 0.00 ? 369 LYS A HD2  4  
ATOM   4915  H  HD3  . LYS A 1 12  ? 32.832  -4.652  23.945  1.00 0.00 ? 369 LYS A HD3  4  
ATOM   4916  H  HE2  . LYS A 1 12  ? 31.123  -4.105  25.353  1.00 0.00 ? 369 LYS A HE2  4  
ATOM   4917  H  HE3  . LYS A 1 12  ? 32.047  -5.164  26.417  1.00 0.00 ? 369 LYS A HE3  4  
ATOM   4918  H  HZ1  . LYS A 1 12  ? 33.114  -3.181  27.352  1.00 0.00 ? 369 LYS A HZ1  4  
ATOM   4919  H  HZ2  . LYS A 1 12  ? 31.437  -3.160  27.573  1.00 0.00 ? 369 LYS A HZ2  4  
ATOM   4920  H  HZ3  . LYS A 1 12  ? 32.144  -2.196  26.377  1.00 0.00 ? 369 LYS A HZ3  4  
ATOM   4921  N  N    . ARG A 1 13  ? 33.532  -5.254  21.825  1.00 0.00 ? 370 ARG A N    4  
ATOM   4922  C  CA   . ARG A 1 13  ? 32.667  -4.554  20.883  1.00 0.00 ? 370 ARG A CA   4  
ATOM   4923  C  C    . ARG A 1 13  ? 31.209  -4.963  21.077  1.00 0.00 ? 370 ARG A C    4  
ATOM   4924  O  O    . ARG A 1 13  ? 30.919  -6.087  21.485  1.00 0.00 ? 370 ARG A O    4  
ATOM   4925  C  CB   . ARG A 1 13  ? 33.101  -4.844  19.445  1.00 0.00 ? 370 ARG A CB   4  
ATOM   4926  C  CG   . ARG A 1 13  ? 32.954  -6.303  19.047  1.00 0.00 ? 370 ARG A CG   4  
ATOM   4927  C  CD   . ARG A 1 13  ? 33.331  -6.524  17.590  1.00 0.00 ? 370 ARG A CD   4  
ATOM   4928  N  NE   . ARG A 1 13  ? 34.777  -6.600  17.405  1.00 0.00 ? 370 ARG A NE   4  
ATOM   4929  C  CZ   . ARG A 1 13  ? 35.354  -6.974  16.268  1.00 0.00 ? 370 ARG A CZ   4  
ATOM   4930  N  NH1  . ARG A 1 13  ? 34.611  -7.304  15.221  1.00 0.00 ? 370 ARG A NH1  4  
ATOM   4931  N  NH2  . ARG A 1 13  ? 36.677  -7.017  16.177  1.00 0.00 ? 370 ARG A NH2  4  
ATOM   4932  H  H    . ARG A 1 13  ? 33.229  -6.101  22.214  1.00 0.00 ? 370 ARG A H    4  
ATOM   4933  H  HA   . ARG A 1 13  ? 32.759  -3.495  21.071  1.00 0.00 ? 370 ARG A HA   4  
ATOM   4934  H  HB2  . ARG A 1 13  ? 32.502  -4.248  18.773  1.00 0.00 ? 370 ARG A HB2  4  
ATOM   4935  H  HB3  . ARG A 1 13  ? 34.138  -4.566  19.333  1.00 0.00 ? 370 ARG A HB3  4  
ATOM   4936  H  HG2  . ARG A 1 13  ? 33.600  -6.904  19.670  1.00 0.00 ? 370 ARG A HG2  4  
ATOM   4937  H  HG3  . ARG A 1 13  ? 31.927  -6.605  19.194  1.00 0.00 ? 370 ARG A HG3  4  
ATOM   4938  H  HD2  . ARG A 1 13  ? 32.886  -7.448  17.253  1.00 0.00 ? 370 ARG A HD2  4  
ATOM   4939  H  HD3  . ARG A 1 13  ? 32.944  -5.704  17.004  1.00 0.00 ? 370 ARG A HD3  4  
ATOM   4940  H  HE   . ARG A 1 13  ? 35.346  -6.360  18.166  1.00 0.00 ? 370 ARG A HE   4  
ATOM   4941  H  HH11 . ARG A 1 13  ? 33.614  -7.271  15.287  1.00 0.00 ? 370 ARG A HH11 4  
ATOM   4942  H  HH12 . ARG A 1 13  ? 35.048  -7.584  14.366  1.00 0.00 ? 370 ARG A HH12 4  
ATOM   4943  H  HH21 . ARG A 1 13  ? 37.241  -6.769  16.964  1.00 0.00 ? 370 ARG A HH21 4  
ATOM   4944  H  HH22 . ARG A 1 13  ? 37.110  -7.299  15.322  1.00 0.00 ? 370 ARG A HH22 4  
ATOM   4945  N  N    . ARG A 1 14  ? 30.298  -4.041  20.784  1.00 0.00 ? 371 ARG A N    4  
ATOM   4946  C  CA   . ARG A 1 14  ? 28.871  -4.305  20.928  1.00 0.00 ? 371 ARG A CA   4  
ATOM   4947  C  C    . ARG A 1 14  ? 28.089  -3.720  19.755  1.00 0.00 ? 371 ARG A C    4  
ATOM   4948  O  O    . ARG A 1 14  ? 28.367  -2.609  19.303  1.00 0.00 ? 371 ARG A O    4  
ATOM   4949  C  CB   . ARG A 1 14  ? 28.353  -3.719  22.242  1.00 0.00 ? 371 ARG A CB   4  
ATOM   4950  C  CG   . ARG A 1 14  ? 26.946  -4.171  22.598  1.00 0.00 ? 371 ARG A CG   4  
ATOM   4951  C  CD   . ARG A 1 14  ? 26.595  -3.821  24.035  1.00 0.00 ? 371 ARG A CD   4  
ATOM   4952  N  NE   . ARG A 1 14  ? 26.229  -2.415  24.183  1.00 0.00 ? 371 ARG A NE   4  
ATOM   4953  C  CZ   . ARG A 1 14  ? 27.113  -1.442  24.372  1.00 0.00 ? 371 ARG A CZ   4  
ATOM   4954  N  NH1  . ARG A 1 14  ? 28.408  -1.721  24.436  1.00 0.00 ? 371 ARG A NH1  4  
ATOM   4955  N  NH2  . ARG A 1 14  ? 26.703  -0.186  24.497  1.00 0.00 ? 371 ARG A NH2  4  
ATOM   4956  H  H    . ARG A 1 14  ? 30.591  -3.163  20.463  1.00 0.00 ? 371 ARG A H    4  
ATOM   4957  H  HA   . ARG A 1 14  ? 28.731  -5.375  20.941  1.00 0.00 ? 371 ARG A HA   4  
ATOM   4958  H  HB2  . ARG A 1 14  ? 29.015  -4.017  23.042  1.00 0.00 ? 371 ARG A HB2  4  
ATOM   4959  H  HB3  . ARG A 1 14  ? 28.353  -2.642  22.168  1.00 0.00 ? 371 ARG A HB3  4  
ATOM   4960  H  HG2  . ARG A 1 14  ? 26.243  -3.683  21.938  1.00 0.00 ? 371 ARG A HG2  4  
ATOM   4961  H  HG3  . ARG A 1 14  ? 26.879  -5.241  22.470  1.00 0.00 ? 371 ARG A HG3  4  
ATOM   4962  H  HD2  . ARG A 1 14  ? 25.762  -4.434  24.348  1.00 0.00 ? 371 ARG A HD2  4  
ATOM   4963  H  HD3  . ARG A 1 14  ? 27.450  -4.029  24.661  1.00 0.00 ? 371 ARG A HD3  4  
ATOM   4964  H  HE   . ARG A 1 14  ? 25.278  -2.186  24.139  1.00 0.00 ? 371 ARG A HE   4  
ATOM   4965  H  HH11 . ARG A 1 14  ? 28.720  -2.666  24.341  1.00 0.00 ? 371 ARG A HH11 4  
ATOM   4966  H  HH12 . ARG A 1 14  ? 29.072  -0.986  24.578  1.00 0.00 ? 371 ARG A HH12 4  
ATOM   4967  H  HH21 . ARG A 1 14  ? 25.728  0.028   24.449  1.00 0.00 ? 371 ARG A HH21 4  
ATOM   4968  H  HH22 . ARG A 1 14  ? 27.369  0.545   24.640  1.00 0.00 ? 371 ARG A HH22 4  
ATOM   4969  N  N    . ILE A 1 15  ? 27.112  -4.476  19.267  1.00 0.00 ? 372 ILE A N    4  
ATOM   4970  C  CA   . ILE A 1 15  ? 26.290  -4.033  18.148  1.00 0.00 ? 372 ILE A CA   4  
ATOM   4971  C  C    . ILE A 1 15  ? 24.807  -4.233  18.442  1.00 0.00 ? 372 ILE A C    4  
ATOM   4972  O  O    . ILE A 1 15  ? 24.414  -5.219  19.066  1.00 0.00 ? 372 ILE A O    4  
ATOM   4973  C  CB   . ILE A 1 15  ? 26.650  -4.784  16.852  1.00 0.00 ? 372 ILE A CB   4  
ATOM   4974  C  CG1  . ILE A 1 15  ? 28.106  -4.512  16.468  1.00 0.00 ? 372 ILE A CG1  4  
ATOM   4975  C  CG2  . ILE A 1 15  ? 25.714  -4.375  15.725  1.00 0.00 ? 372 ILE A CG2  4  
ATOM   4976  C  CD1  . ILE A 1 15  ? 28.702  -5.572  15.568  1.00 0.00 ? 372 ILE A CD1  4  
ATOM   4977  H  H    . ILE A 1 15  ? 26.938  -5.353  19.670  1.00 0.00 ? 372 ILE A H    4  
ATOM   4978  H  HA   . ILE A 1 15  ? 26.477  -2.980  17.994  1.00 0.00 ? 372 ILE A HA   4  
ATOM   4979  H  HB   . ILE A 1 15  ? 26.523  -5.841  17.028  1.00 0.00 ? 372 ILE A HB   4  
ATOM   4980  H  HG12 . ILE A 1 15  ? 28.165  -3.568  15.951  1.00 0.00 ? 372 ILE A HG12 4  
ATOM   4981  H  HG13 . ILE A 1 15  ? 28.705  -4.464  17.367  1.00 0.00 ? 372 ILE A HG13 4  
ATOM   4982  H  HG21 . ILE A 1 15  ? 26.112  -4.723  14.783  1.00 0.00 ? 372 ILE A HG21 4  
ATOM   4983  H  HG22 . ILE A 1 15  ? 24.742  -4.814  15.888  1.00 0.00 ? 372 ILE A HG22 4  
ATOM   4984  H  HG23 . ILE A 1 15  ? 25.625  -3.299  15.703  1.00 0.00 ? 372 ILE A HG23 4  
ATOM   4985  H  HD11 . ILE A 1 15  ? 29.010  -5.121  14.636  1.00 0.00 ? 372 ILE A HD11 4  
ATOM   4986  H  HD12 . ILE A 1 15  ? 29.559  -6.016  16.052  1.00 0.00 ? 372 ILE A HD12 4  
ATOM   4987  H  HD13 . ILE A 1 15  ? 27.963  -6.335  15.372  1.00 0.00 ? 372 ILE A HD13 4  
ATOM   4988  N  N    . HIS A 1 16  ? 23.987  -3.291  17.986  1.00 0.00 ? 373 HIS A N    4  
ATOM   4989  C  CA   . HIS A 1 16  ? 22.545  -3.364  18.198  1.00 0.00 ? 373 HIS A CA   4  
ATOM   4990  C  C    . HIS A 1 16  ? 21.816  -3.626  16.884  1.00 0.00 ? 373 HIS A C    4  
ATOM   4991  O  O    . HIS A 1 16  ? 21.904  -2.834  15.945  1.00 0.00 ? 373 HIS A O    4  
ATOM   4992  C  CB   . HIS A 1 16  ? 22.035  -2.069  18.829  1.00 0.00 ? 373 HIS A CB   4  
ATOM   4993  C  CG   . HIS A 1 16  ? 22.751  -1.694  20.090  1.00 0.00 ? 373 HIS A CG   4  
ATOM   4994  N  ND1  . HIS A 1 16  ? 22.108  -1.515  21.297  1.00 0.00 ? 373 HIS A ND1  4  
ATOM   4995  C  CD2  . HIS A 1 16  ? 24.064  -1.467  20.329  1.00 0.00 ? 373 HIS A CD2  4  
ATOM   4996  C  CE1  . HIS A 1 16  ? 22.993  -1.192  22.222  1.00 0.00 ? 373 HIS A CE1  4  
ATOM   4997  N  NE2  . HIS A 1 16  ? 24.188  -1.156  21.660  1.00 0.00 ? 373 HIS A NE2  4  
ATOM   4998  H  H    . HIS A 1 16  ? 24.360  -2.529  17.496  1.00 0.00 ? 373 HIS A H    4  
ATOM   4999  H  HA   . HIS A 1 16  ? 22.351  -4.184  18.872  1.00 0.00 ? 373 HIS A HA   4  
ATOM   5000  H  HB2  . HIS A 1 16  ? 22.159  -1.260  18.125  1.00 0.00 ? 373 HIS A HB2  4  
ATOM   5001  H  HB3  . HIS A 1 16  ? 20.985  -2.179  19.063  1.00 0.00 ? 373 HIS A HB3  4  
ATOM   5002  H  HD1  . HIS A 1 16  ? 21.145  -1.609  21.451  1.00 0.00 ? 373 HIS A HD1  4  
ATOM   5003  H  HD2  . HIS A 1 16  ? 24.866  -1.519  19.605  1.00 0.00 ? 373 HIS A HD2  4  
ATOM   5004  H  HE1  . HIS A 1 16  ? 22.778  -0.991  23.261  1.00 0.00 ? 373 HIS A HE1  4  
ATOM   5005  N  N    . TYR A 1 17  ? 21.096  -4.741  16.824  1.00 0.00 ? 374 TYR A N    4  
ATOM   5006  C  CA   . TYR A 1 17  ? 20.354  -5.108  15.623  1.00 0.00 ? 374 TYR A CA   4  
ATOM   5007  C  C    . TYR A 1 17  ? 18.910  -4.623  15.707  1.00 0.00 ? 374 TYR A C    4  
ATOM   5008  O  O    . TYR A 1 17  ? 18.164  -5.008  16.608  1.00 0.00 ? 374 TYR A O    4  
ATOM   5009  C  CB   . TYR A 1 17  ? 20.385  -6.624  15.423  1.00 0.00 ? 374 TYR A CB   4  
ATOM   5010  C  CG   . TYR A 1 17  ? 21.626  -7.116  14.715  1.00 0.00 ? 374 TYR A CG   4  
ATOM   5011  C  CD1  . TYR A 1 17  ? 22.889  -6.687  15.105  1.00 0.00 ? 374 TYR A CD1  4  
ATOM   5012  C  CD2  . TYR A 1 17  ? 21.537  -8.012  13.657  1.00 0.00 ? 374 TYR A CD2  4  
ATOM   5013  C  CE1  . TYR A 1 17  ? 24.026  -7.134  14.460  1.00 0.00 ? 374 TYR A CE1  4  
ATOM   5014  C  CE2  . TYR A 1 17  ? 22.669  -8.465  13.007  1.00 0.00 ? 374 TYR A CE2  4  
ATOM   5015  C  CZ   . TYR A 1 17  ? 23.911  -8.023  13.412  1.00 0.00 ? 374 TYR A CZ   4  
ATOM   5016  O  OH   . TYR A 1 17  ? 25.041  -8.472  12.768  1.00 0.00 ? 374 TYR A OH   4  
ATOM   5017  H  H    . TYR A 1 17  ? 21.065  -5.332  17.604  1.00 0.00 ? 374 TYR A H    4  
ATOM   5018  H  HA   . TYR A 1 17  ? 20.833  -4.633  14.779  1.00 0.00 ? 374 TYR A HA   4  
ATOM   5019  H  HB2  . TYR A 1 17  ? 20.339  -7.108  16.386  1.00 0.00 ? 374 TYR A HB2  4  
ATOM   5020  H  HB3  . TYR A 1 17  ? 19.528  -6.920  14.836  1.00 0.00 ? 374 TYR A HB3  4  
ATOM   5021  H  HD1  . TYR A 1 17  ? 22.975  -5.991  15.927  1.00 0.00 ? 374 TYR A HD1  4  
ATOM   5022  H  HD2  . TYR A 1 17  ? 20.563  -8.357  13.342  1.00 0.00 ? 374 TYR A HD2  4  
ATOM   5023  H  HE1  . TYR A 1 17  ? 24.999  -6.788  14.778  1.00 0.00 ? 374 TYR A HE1  4  
ATOM   5024  H  HE2  . TYR A 1 17  ? 22.579  -9.161  12.186  1.00 0.00 ? 374 TYR A HE2  4  
ATOM   5025  H  HH   . TYR A 1 17  ? 25.806  -7.987  13.089  1.00 0.00 ? 374 TYR A HH   4  
ATOM   5026  N  N    . CYS A 1 18  ? 18.521  -3.776  14.759  1.00 0.00 ? 375 CYS A N    4  
ATOM   5027  C  CA   . CYS A 1 18  ? 17.167  -3.238  14.723  1.00 0.00 ? 375 CYS A CA   4  
ATOM   5028  C  C    . CYS A 1 18  ? 16.138  -4.337  14.969  1.00 0.00 ? 375 CYS A C    4  
ATOM   5029  O  O    . CYS A 1 18  ? 16.131  -5.360  14.284  1.00 0.00 ? 375 CYS A O    4  
ATOM   5030  C  CB   . CYS A 1 18  ? 16.899  -2.565  13.375  1.00 0.00 ? 375 CYS A CB   4  
ATOM   5031  S  SG   . CYS A 1 18  ? 15.318  -1.664  13.294  1.00 0.00 ? 375 CYS A SG   4  
ATOM   5032  H  H    . CYS A 1 18  ? 19.162  -3.506  14.067  1.00 0.00 ? 375 CYS A H    4  
ATOM   5033  H  HA   . CYS A 1 18  ? 17.082  -2.500  15.506  1.00 0.00 ? 375 CYS A HA   4  
ATOM   5034  H  HB2  . CYS A 1 18  ? 17.690  -1.858  13.170  1.00 0.00 ? 375 CYS A HB2  4  
ATOM   5035  H  HB3  . CYS A 1 18  ? 16.889  -3.319  12.601  1.00 0.00 ? 375 CYS A HB3  4  
ATOM   5036  N  N    . ASP A 1 19  ? 15.270  -4.118  15.950  1.00 0.00 ? 376 ASP A N    4  
ATOM   5037  C  CA   . ASP A 1 19  ? 14.235  -5.089  16.286  1.00 0.00 ? 376 ASP A CA   4  
ATOM   5038  C  C    . ASP A 1 19  ? 13.040  -4.956  15.346  1.00 0.00 ? 376 ASP A C    4  
ATOM   5039  O  O    . ASP A 1 19  ? 11.889  -5.035  15.775  1.00 0.00 ? 376 ASP A O    4  
ATOM   5040  C  CB   . ASP A 1 19  ? 13.782  -4.903  17.735  1.00 0.00 ? 376 ASP A CB   4  
ATOM   5041  C  CG   . ASP A 1 19  ? 14.766  -5.489  18.728  1.00 0.00 ? 376 ASP A CG   4  
ATOM   5042  O  OD1  . ASP A 1 19  ? 14.919  -6.728  18.751  1.00 0.00 ? 376 ASP A OD1  4  
ATOM   5043  O  OD2  . ASP A 1 19  ? 15.384  -4.708  19.483  1.00 0.00 ? 376 ASP A OD2  4  
ATOM   5044  H  H    . ASP A 1 19  ? 15.326  -3.283  16.460  1.00 0.00 ? 376 ASP A H    4  
ATOM   5045  H  HA   . ASP A 1 19  ? 14.657  -6.076  16.174  1.00 0.00 ? 376 ASP A HA   4  
ATOM   5046  H  HB2  . ASP A 1 19  ? 13.678  -3.847  17.940  1.00 0.00 ? 376 ASP A HB2  4  
ATOM   5047  H  HB3  . ASP A 1 19  ? 12.827  -5.388  17.872  1.00 0.00 ? 376 ASP A HB3  4  
ATOM   5048  N  N    . TYR A 1 20  ? 13.322  -4.754  14.064  1.00 0.00 ? 377 TYR A N    4  
ATOM   5049  C  CA   . TYR A 1 20  ? 12.271  -4.608  13.064  1.00 0.00 ? 377 TYR A CA   4  
ATOM   5050  C  C    . TYR A 1 20  ? 12.356  -5.715  12.018  1.00 0.00 ? 377 TYR A C    4  
ATOM   5051  O  O    . TYR A 1 20  ? 13.436  -6.100  11.570  1.00 0.00 ? 377 TYR A O    4  
ATOM   5052  C  CB   . TYR A 1 20  ? 12.371  -3.241  12.385  1.00 0.00 ? 377 TYR A CB   4  
ATOM   5053  C  CG   . TYR A 1 20  ? 11.123  -2.847  11.628  1.00 0.00 ? 377 TYR A CG   4  
ATOM   5054  C  CD1  . TYR A 1 20  ? 10.829  -3.412  10.393  1.00 0.00 ? 377 TYR A CD1  4  
ATOM   5055  C  CD2  . TYR A 1 20  ? 10.237  -1.912  12.148  1.00 0.00 ? 377 TYR A CD2  4  
ATOM   5056  C  CE1  . TYR A 1 20  ? 9.690   -3.055  9.698   1.00 0.00 ? 377 TYR A CE1  4  
ATOM   5057  C  CE2  . TYR A 1 20  ? 9.095   -1.550  11.461  1.00 0.00 ? 377 TYR A CE2  4  
ATOM   5058  C  CZ   . TYR A 1 20  ? 8.826   -2.124  10.235  1.00 0.00 ? 377 TYR A CZ   4  
ATOM   5059  O  OH   . TYR A 1 20  ? 7.690   -1.767  9.546   1.00 0.00 ? 377 TYR A OH   4  
ATOM   5060  H  H    . TYR A 1 20  ? 14.259  -4.701  13.783  1.00 0.00 ? 377 TYR A H    4  
ATOM   5061  H  HA   . TYR A 1 20  ? 11.319  -4.678  13.570  1.00 0.00 ? 377 TYR A HA   4  
ATOM   5062  H  HB2  . TYR A 1 20  ? 12.555  -2.486  13.135  1.00 0.00 ? 377 TYR A HB2  4  
ATOM   5063  H  HB3  . TYR A 1 20  ? 13.194  -3.253  11.686  1.00 0.00 ? 377 TYR A HB3  4  
ATOM   5064  H  HD1  . TYR A 1 20  ? 11.508  -4.141  9.975   1.00 0.00 ? 377 TYR A HD1  4  
ATOM   5065  H  HD2  . TYR A 1 20  ? 10.450  -1.464  13.108  1.00 0.00 ? 377 TYR A HD2  4  
ATOM   5066  H  HE1  . TYR A 1 20  ? 9.479   -3.505  8.738   1.00 0.00 ? 377 TYR A HE1  4  
ATOM   5067  H  HE2  . TYR A 1 20  ? 8.418   -0.821  11.881  1.00 0.00 ? 377 TYR A HE2  4  
ATOM   5068  H  HH   . TYR A 1 20  ? 7.344   -0.946  9.903   1.00 0.00 ? 377 TYR A HH   4  
ATOM   5069  N  N    . PRO A 1 21  ? 11.188  -6.240  11.618  1.00 0.00 ? 378 PRO A N    4  
ATOM   5070  C  CA   . PRO A 1 21  ? 11.102  -7.309  10.619  1.00 0.00 ? 378 PRO A CA   4  
ATOM   5071  C  C    . PRO A 1 21  ? 11.477  -6.829  9.221   1.00 0.00 ? 378 PRO A C    4  
ATOM   5072  O  O    . PRO A 1 21  ? 10.913  -5.860  8.715   1.00 0.00 ? 378 PRO A O    4  
ATOM   5073  C  CB   . PRO A 1 21  ? 9.628   -7.720  10.666  1.00 0.00 ? 378 PRO A CB   4  
ATOM   5074  C  CG   . PRO A 1 21  ? 8.914   -6.512  11.163  1.00 0.00 ? 378 PRO A CG   4  
ATOM   5075  C  CD   . PRO A 1 21  ? 9.862   -5.829  12.109  1.00 0.00 ? 378 PRO A CD   4  
ATOM   5076  H  HA   . PRO A 1 21  ? 11.722  -8.153  10.887  1.00 0.00 ? 378 PRO A HA   4  
ATOM   5077  H  HB2  . PRO A 1 21  ? 9.298   -7.996  9.674   1.00 0.00 ? 378 PRO A HB2  4  
ATOM   5078  H  HB3  . PRO A 1 21  ? 9.505   -8.556  11.338  1.00 0.00 ? 378 PRO A HB3  4  
ATOM   5079  H  HG2  . PRO A 1 21  ? 8.675   -5.860  10.336  1.00 0.00 ? 378 PRO A HG2  4  
ATOM   5080  H  HG3  . PRO A 1 21  ? 8.013   -6.805  11.682  1.00 0.00 ? 378 PRO A HG3  4  
ATOM   5081  H  HD2  . PRO A 1 21  ? 9.745   -4.757  12.054  1.00 0.00 ? 378 PRO A HD2  4  
ATOM   5082  H  HD3  . PRO A 1 21  ? 9.702   -6.176  13.120  1.00 0.00 ? 378 PRO A HD3  4  
ATOM   5083  N  N    . GLY A 1 22  ? 12.434  -7.514  8.602   1.00 0.00 ? 379 GLY A N    4  
ATOM   5084  C  CA   . GLY A 1 22  ? 12.868  -7.141  7.268   1.00 0.00 ? 379 GLY A CA   4  
ATOM   5085  C  C    . GLY A 1 22  ? 14.104  -6.265  7.284   1.00 0.00 ? 379 GLY A C    4  
ATOM   5086  O  O    . GLY A 1 22  ? 15.084  -6.549  6.595   1.00 0.00 ? 379 GLY A O    4  
ATOM   5087  H  H    . GLY A 1 22  ? 12.849  -8.278  9.054   1.00 0.00 ? 379 GLY A H    4  
ATOM   5088  H  HA2  . GLY A 1 22  ? 13.082  -8.039  6.707   1.00 0.00 ? 379 GLY A HA2  4  
ATOM   5089  H  HA3  . GLY A 1 22  ? 12.067  -6.606  6.778   1.00 0.00 ? 379 GLY A HA3  4  
ATOM   5090  N  N    . CYS A 1 23  ? 14.059  -5.195  8.071   1.00 0.00 ? 380 CYS A N    4  
ATOM   5091  C  CA   . CYS A 1 23  ? 15.183  -4.272  8.172   1.00 0.00 ? 380 CYS A CA   4  
ATOM   5092  C  C    . CYS A 1 23  ? 16.466  -5.015  8.536   1.00 0.00 ? 380 CYS A C    4  
ATOM   5093  O  O    . CYS A 1 23  ? 16.481  -5.841  9.449   1.00 0.00 ? 380 CYS A O    4  
ATOM   5094  C  CB   . CYS A 1 23  ? 14.891  -3.193  9.218   1.00 0.00 ? 380 CYS A CB   4  
ATOM   5095  S  SG   . CYS A 1 23  ? 16.343  -2.195  9.680   1.00 0.00 ? 380 CYS A SG   4  
ATOM   5096  H  H    . CYS A 1 23  ? 13.249  -5.021  8.596   1.00 0.00 ? 380 CYS A H    4  
ATOM   5097  H  HA   . CYS A 1 23  ? 15.314  -3.802  7.210   1.00 0.00 ? 380 CYS A HA   4  
ATOM   5098  H  HB2  . CYS A 1 23  ? 14.141  -2.520  8.829   1.00 0.00 ? 380 CYS A HB2  4  
ATOM   5099  H  HB3  . CYS A 1 23  ? 14.516  -3.664  10.114  1.00 0.00 ? 380 CYS A HB3  4  
ATOM   5100  N  N    . THR A 1 24  ? 17.542  -4.714  7.815   1.00 0.00 ? 381 THR A N    4  
ATOM   5101  C  CA   . THR A 1 24  ? 18.828  -5.352  8.061   1.00 0.00 ? 381 THR A CA   4  
ATOM   5102  C  C    . THR A 1 24  ? 19.899  -4.320  8.397   1.00 0.00 ? 381 THR A C    4  
ATOM   5103  O  O    . THR A 1 24  ? 21.035  -4.415  7.931   1.00 0.00 ? 381 THR A O    4  
ATOM   5104  C  CB   . THR A 1 24  ? 19.289  -6.174  6.842   1.00 0.00 ? 381 THR A CB   4  
ATOM   5105  O  OG1  . THR A 1 24  ? 19.408  -5.326  5.695   1.00 0.00 ? 381 THR A OG1  4  
ATOM   5106  C  CG2  . THR A 1 24  ? 18.309  -7.300  6.547   1.00 0.00 ? 381 THR A CG2  4  
ATOM   5107  H  H    . THR A 1 24  ? 17.466  -4.047  7.102   1.00 0.00 ? 381 THR A H    4  
ATOM   5108  H  HA   . THR A 1 24  ? 18.713  -6.024  8.899   1.00 0.00 ? 381 THR A HA   4  
ATOM   5109  H  HB   . THR A 1 24  ? 20.255  -6.607  7.062   1.00 0.00 ? 381 THR A HB   4  
ATOM   5110  H  HG1  . THR A 1 24  ? 19.508  -5.865  4.907   1.00 0.00 ? 381 THR A HG1  4  
ATOM   5111  H  HG21 . THR A 1 24  ? 18.691  -8.225  6.952   1.00 0.00 ? 381 THR A HG21 4  
ATOM   5112  H  HG22 . THR A 1 24  ? 18.185  -7.399  5.479   1.00 0.00 ? 381 THR A HG22 4  
ATOM   5113  H  HG23 . THR A 1 24  ? 17.355  -7.075  7.001   1.00 0.00 ? 381 THR A HG23 4  
ATOM   5114  N  N    . LYS A 1 25  ? 19.530  -3.335  9.209   1.00 0.00 ? 382 LYS A N    4  
ATOM   5115  C  CA   . LYS A 1 25  ? 20.459  -2.286  9.610   1.00 0.00 ? 382 LYS A CA   4  
ATOM   5116  C  C    . LYS A 1 25  ? 20.846  -2.434  11.078  1.00 0.00 ? 382 LYS A C    4  
ATOM   5117  O  O    . LYS A 1 25  ? 20.007  -2.743  11.923  1.00 0.00 ? 382 LYS A O    4  
ATOM   5118  C  CB   . LYS A 1 25  ? 19.838  -0.908  9.372   1.00 0.00 ? 382 LYS A CB   4  
ATOM   5119  C  CG   . LYS A 1 25  ? 19.757  -0.522  7.905   1.00 0.00 ? 382 LYS A CG   4  
ATOM   5120  C  CD   . LYS A 1 25  ? 21.070  0.059   7.408   1.00 0.00 ? 382 LYS A CD   4  
ATOM   5121  C  CE   . LYS A 1 25  ? 20.857  0.974   6.211   1.00 0.00 ? 382 LYS A CE   4  
ATOM   5122  N  NZ   . LYS A 1 25  ? 22.147  1.430   5.625   1.00 0.00 ? 382 LYS A NZ   4  
ATOM   5123  H  H    . LYS A 1 25  ? 18.610  -3.314  9.547   1.00 0.00 ? 382 LYS A H    4  
ATOM   5124  H  HA   . LYS A 1 25  ? 21.348  -2.380  9.005   1.00 0.00 ? 382 LYS A HA   4  
ATOM   5125  H  HB2  . LYS A 1 25  ? 18.838  -0.902  9.780   1.00 0.00 ? 382 LYS A HB2  4  
ATOM   5126  H  HB3  . LYS A 1 25  ? 20.431  -0.165  9.885   1.00 0.00 ? 382 LYS A HB3  4  
ATOM   5127  H  HG2  . LYS A 1 25  ? 19.523  -1.402  7.323   1.00 0.00 ? 382 LYS A HG2  4  
ATOM   5128  H  HG3  . LYS A 1 25  ? 18.976  0.214   7.778   1.00 0.00 ? 382 LYS A HG3  4  
ATOM   5129  H  HD2  . LYS A 1 25  ? 21.526  0.628   8.204   1.00 0.00 ? 382 LYS A HD2  4  
ATOM   5130  H  HD3  . LYS A 1 25  ? 21.726  -0.750  7.119   1.00 0.00 ? 382 LYS A HD3  4  
ATOM   5131  H  HE2  . LYS A 1 25  ? 20.299  0.437   5.459   1.00 0.00 ? 382 LYS A HE2  4  
ATOM   5132  H  HE3  . LYS A 1 25  ? 20.291  1.837   6.531   1.00 0.00 ? 382 LYS A HE3  4  
ATOM   5133  H  HZ1  . LYS A 1 25  ? 22.023  1.651   4.616   1.00 0.00 ? 382 LYS A HZ1  4  
ATOM   5134  H  HZ2  . LYS A 1 25  ? 22.866  0.684   5.720   1.00 0.00 ? 382 LYS A HZ2  4  
ATOM   5135  H  HZ3  . LYS A 1 25  ? 22.482  2.282   6.117   1.00 0.00 ? 382 LYS A HZ3  4  
ATOM   5136  N  N    . VAL A 1 26  ? 22.122  -2.208  11.375  1.00 0.00 ? 383 VAL A N    4  
ATOM   5137  C  CA   . VAL A 1 26  ? 22.620  -2.314  12.741  1.00 0.00 ? 383 VAL A CA   4  
ATOM   5138  C  C    . VAL A 1 26  ? 23.457  -1.097  13.117  1.00 0.00 ? 383 VAL A C    4  
ATOM   5139  O  O    . VAL A 1 26  ? 23.922  -0.358  12.248  1.00 0.00 ? 383 VAL A O    4  
ATOM   5140  C  CB   . VAL A 1 26  ? 23.467  -3.586  12.933  1.00 0.00 ? 383 VAL A CB   4  
ATOM   5141  C  CG1  . VAL A 1 26  ? 22.724  -4.806  12.411  1.00 0.00 ? 383 VAL A CG1  4  
ATOM   5142  C  CG2  . VAL A 1 26  ? 24.815  -3.437  12.245  1.00 0.00 ? 383 VAL A CG2  4  
ATOM   5143  H  H    . VAL A 1 26  ? 22.744  -1.965  10.657  1.00 0.00 ? 383 VAL A H    4  
ATOM   5144  H  HA   . VAL A 1 26  ? 21.768  -2.371  13.403  1.00 0.00 ? 383 VAL A HA   4  
ATOM   5145  H  HB   . VAL A 1 26  ? 23.640  -3.723  13.991  1.00 0.00 ? 383 VAL A HB   4  
ATOM   5146  H  HG11 . VAL A 1 26  ? 22.138  -4.528  11.547  1.00 0.00 ? 383 VAL A HG11 4  
ATOM   5147  H  HG12 . VAL A 1 26  ? 23.436  -5.570  12.133  1.00 0.00 ? 383 VAL A HG12 4  
ATOM   5148  H  HG13 . VAL A 1 26  ? 22.070  -5.187  13.182  1.00 0.00 ? 383 VAL A HG13 4  
ATOM   5149  H  HG21 . VAL A 1 26  ? 25.330  -2.575  12.643  1.00 0.00 ? 383 VAL A HG21 4  
ATOM   5150  H  HG22 . VAL A 1 26  ? 25.407  -4.322  12.419  1.00 0.00 ? 383 VAL A HG22 4  
ATOM   5151  H  HG23 . VAL A 1 26  ? 24.665  -3.307  11.183  1.00 0.00 ? 383 VAL A HG23 4  
ATOM   5152  N  N    . TYR A 1 27  ? 23.647  -0.894  14.416  1.00 0.00 ? 384 TYR A N    4  
ATOM   5153  C  CA   . TYR A 1 27  ? 24.427  0.235   14.907  1.00 0.00 ? 384 TYR A CA   4  
ATOM   5154  C  C    . TYR A 1 27  ? 25.112  -0.109  16.226  1.00 0.00 ? 384 TYR A C    4  
ATOM   5155  O  O    . TYR A 1 27  ? 24.496  -0.669  17.133  1.00 0.00 ? 384 TYR A O    4  
ATOM   5156  C  CB   . TYR A 1 27  ? 23.531  1.461   15.090  1.00 0.00 ? 384 TYR A CB   4  
ATOM   5157  C  CG   . TYR A 1 27  ? 22.987  2.012   13.791  1.00 0.00 ? 384 TYR A CG   4  
ATOM   5158  C  CD1  . TYR A 1 27  ? 23.812  2.688   12.901  1.00 0.00 ? 384 TYR A CD1  4  
ATOM   5159  C  CD2  . TYR A 1 27  ? 21.648  1.857   13.455  1.00 0.00 ? 384 TYR A CD2  4  
ATOM   5160  C  CE1  . TYR A 1 27  ? 23.319  3.194   11.714  1.00 0.00 ? 384 TYR A CE1  4  
ATOM   5161  C  CE2  . TYR A 1 27  ? 21.146  2.359   12.269  1.00 0.00 ? 384 TYR A CE2  4  
ATOM   5162  C  CZ   . TYR A 1 27  ? 21.986  3.027   11.402  1.00 0.00 ? 384 TYR A CZ   4  
ATOM   5163  O  OH   . TYR A 1 27  ? 21.491  3.528   10.220  1.00 0.00 ? 384 TYR A OH   4  
ATOM   5164  H  H    . TYR A 1 27  ? 23.251  -1.517  15.060  1.00 0.00 ? 384 TYR A H    4  
ATOM   5165  H  HA   . TYR A 1 27  ? 25.184  0.461   14.170  1.00 0.00 ? 384 TYR A HA   4  
ATOM   5166  H  HB2  . TYR A 1 27  ? 22.692  1.195   15.714  1.00 0.00 ? 384 TYR A HB2  4  
ATOM   5167  H  HB3  . TYR A 1 27  ? 24.098  2.244   15.572  1.00 0.00 ? 384 TYR A HB3  4  
ATOM   5168  H  HD1  . TYR A 1 27  ? 24.856  2.817   13.147  1.00 0.00 ? 384 TYR A HD1  4  
ATOM   5169  H  HD2  . TYR A 1 27  ? 20.993  1.333   14.136  1.00 0.00 ? 384 TYR A HD2  4  
ATOM   5170  H  HE1  . TYR A 1 27  ? 23.976  3.717   11.034  1.00 0.00 ? 384 TYR A HE1  4  
ATOM   5171  H  HE2  . TYR A 1 27  ? 20.102  2.228   12.025  1.00 0.00 ? 384 TYR A HE2  4  
ATOM   5172  H  HH   . TYR A 1 27  ? 21.191  4.430   10.356  1.00 0.00 ? 384 TYR A HH   4  
ATOM   5173  N  N    . THR A 1 28  ? 26.394  0.230   16.326  1.00 0.00 ? 385 THR A N    4  
ATOM   5174  C  CA   . THR A 1 28  ? 27.165  -0.042  17.533  1.00 0.00 ? 385 THR A CA   4  
ATOM   5175  C  C    . THR A 1 28  ? 26.555  0.654   18.744  1.00 0.00 ? 385 THR A C    4  
ATOM   5176  O  O    . THR A 1 28  ? 26.421  0.059   19.813  1.00 0.00 ? 385 THR A O    4  
ATOM   5177  C  CB   . THR A 1 28  ? 28.629  0.411   17.378  1.00 0.00 ? 385 THR A CB   4  
ATOM   5178  O  OG1  . THR A 1 28  ? 28.677  1.766   16.919  1.00 0.00 ? 385 THR A OG1  4  
ATOM   5179  C  CG2  . THR A 1 28  ? 29.373  -0.488  16.401  1.00 0.00 ? 385 THR A CG2  4  
ATOM   5180  H  H    . THR A 1 28  ? 26.830  0.674   15.569  1.00 0.00 ? 385 THR A H    4  
ATOM   5181  H  HA   . THR A 1 28  ? 27.156  -1.109  17.700  1.00 0.00 ? 385 THR A HA   4  
ATOM   5182  H  HB   . THR A 1 28  ? 29.113  0.348   18.342  1.00 0.00 ? 385 THR A HB   4  
ATOM   5183  H  HG1  . THR A 1 28  ? 27.847  1.988   16.489  1.00 0.00 ? 385 THR A HG1  4  
ATOM   5184  H  HG21 . THR A 1 28  ? 30.351  -0.075  16.207  1.00 0.00 ? 385 THR A HG21 4  
ATOM   5185  H  HG22 . THR A 1 28  ? 28.819  -0.550  15.476  1.00 0.00 ? 385 THR A HG22 4  
ATOM   5186  H  HG23 . THR A 1 28  ? 29.476  -1.474  16.826  1.00 0.00 ? 385 THR A HG23 4  
ATOM   5187  N  N    . LYS A 1 29  ? 26.186  1.919   18.570  1.00 0.00 ? 386 LYS A N    4  
ATOM   5188  C  CA   . LYS A 1 29  ? 25.588  2.697   19.648  1.00 0.00 ? 386 LYS A CA   4  
ATOM   5189  C  C    . LYS A 1 29  ? 24.071  2.535   19.659  1.00 0.00 ? 386 LYS A C    4  
ATOM   5190  O  O    . LYS A 1 29  ? 23.470  2.163   18.651  1.00 0.00 ? 386 LYS A O    4  
ATOM   5191  C  CB   . LYS A 1 29  ? 25.953  4.176   19.501  1.00 0.00 ? 386 LYS A CB   4  
ATOM   5192  C  CG   . LYS A 1 29  ? 27.419  4.470   19.767  1.00 0.00 ? 386 LYS A CG   4  
ATOM   5193  C  CD   . LYS A 1 29  ? 27.862  5.755   19.089  1.00 0.00 ? 386 LYS A CD   4  
ATOM   5194  C  CE   . LYS A 1 29  ? 27.650  6.962   19.990  1.00 0.00 ? 386 LYS A CE   4  
ATOM   5195  N  NZ   . LYS A 1 29  ? 28.534  6.923   21.188  1.00 0.00 ? 386 LYS A NZ   4  
ATOM   5196  H  H    . LYS A 1 29  ? 26.319  2.339   17.694  1.00 0.00 ? 386 LYS A H    4  
ATOM   5197  H  HA   . LYS A 1 29  ? 25.984  2.328   20.582  1.00 0.00 ? 386 LYS A HA   4  
ATOM   5198  H  HB2  . LYS A 1 29  ? 25.720  4.493   18.495  1.00 0.00 ? 386 LYS A HB2  4  
ATOM   5199  H  HB3  . LYS A 1 29  ? 25.360  4.751   20.197  1.00 0.00 ? 386 LYS A HB3  4  
ATOM   5200  H  HG2  . LYS A 1 29  ? 27.570  4.567   20.832  1.00 0.00 ? 386 LYS A HG2  4  
ATOM   5201  H  HG3  . LYS A 1 29  ? 28.015  3.651   19.390  1.00 0.00 ? 386 LYS A HG3  4  
ATOM   5202  H  HD2  . LYS A 1 29  ? 28.912  5.682   18.847  1.00 0.00 ? 386 LYS A HD2  4  
ATOM   5203  H  HD3  . LYS A 1 29  ? 27.290  5.889   18.182  1.00 0.00 ? 386 LYS A HD3  4  
ATOM   5204  H  HE2  . LYS A 1 29  ? 27.862  7.858   19.426  1.00 0.00 ? 386 LYS A HE2  4  
ATOM   5205  H  HE3  . LYS A 1 29  ? 26.619  6.976   20.314  1.00 0.00 ? 386 LYS A HE3  4  
ATOM   5206  H  HZ1  . LYS A 1 29  ? 29.523  6.788   20.898  1.00 0.00 ? 386 LYS A HZ1  4  
ATOM   5207  H  HZ2  . LYS A 1 29  ? 28.256  6.137   21.811  1.00 0.00 ? 386 LYS A HZ2  4  
ATOM   5208  H  HZ3  . LYS A 1 29  ? 28.457  7.814   21.718  1.00 0.00 ? 386 LYS A HZ3  4  
ATOM   5209  N  N    . SER A 1 30  ? 23.459  2.818   20.804  1.00 0.00 ? 387 SER A N    4  
ATOM   5210  C  CA   . SER A 1 30  ? 22.012  2.702   20.946  1.00 0.00 ? 387 SER A CA   4  
ATOM   5211  C  C    . SER A 1 30  ? 21.311  3.941   20.397  1.00 0.00 ? 387 SER A C    4  
ATOM   5212  O  O    . SER A 1 30  ? 20.510  3.853   19.467  1.00 0.00 ? 387 SER A O    4  
ATOM   5213  C  CB   . SER A 1 30  ? 21.637  2.499   22.416  1.00 0.00 ? 387 SER A CB   4  
ATOM   5214  O  OG   . SER A 1 30  ? 22.220  1.315   22.932  1.00 0.00 ? 387 SER A OG   4  
ATOM   5215  H  H    . SER A 1 30  ? 23.993  3.110   21.572  1.00 0.00 ? 387 SER A H    4  
ATOM   5216  H  HA   . SER A 1 30  ? 21.692  1.841   20.380  1.00 0.00 ? 387 SER A HA   4  
ATOM   5217  H  HB2  . SER A 1 30  ? 21.989  3.341   22.993  1.00 0.00 ? 387 SER A HB2  4  
ATOM   5218  H  HB3  . SER A 1 30  ? 20.563  2.426   22.503  1.00 0.00 ? 387 SER A HB3  4  
ATOM   5219  H  HG   . SER A 1 30  ? 21.534  0.661   23.085  1.00 0.00 ? 387 SER A HG   4  
ATOM   5220  N  N    . SER A 1 31  ? 21.619  5.095   20.981  1.00 0.00 ? 388 SER A N    4  
ATOM   5221  C  CA   . SER A 1 31  ? 21.016  6.352   20.553  1.00 0.00 ? 388 SER A CA   4  
ATOM   5222  C  C    . SER A 1 31  ? 20.875  6.399   19.035  1.00 0.00 ? 388 SER A C    4  
ATOM   5223  O  O    . SER A 1 31  ? 19.796  6.671   18.508  1.00 0.00 ? 388 SER A O    4  
ATOM   5224  C  CB   . SER A 1 31  ? 21.858  7.535   21.035  1.00 0.00 ? 388 SER A CB   4  
ATOM   5225  O  OG   . SER A 1 31  ? 21.079  8.717   21.113  1.00 0.00 ? 388 SER A OG   4  
ATOM   5226  H  H    . SER A 1 31  ? 22.265  5.100   21.718  1.00 0.00 ? 388 SER A H    4  
ATOM   5227  H  HA   . SER A 1 31  ? 20.033  6.416   20.997  1.00 0.00 ? 388 SER A HA   4  
ATOM   5228  H  HB2  . SER A 1 31  ? 22.255  7.316   22.015  1.00 0.00 ? 388 SER A HB2  4  
ATOM   5229  H  HB3  . SER A 1 31  ? 22.672  7.699   20.345  1.00 0.00 ? 388 SER A HB3  4  
ATOM   5230  H  HG   . SER A 1 31  ? 20.764  8.835   22.012  1.00 0.00 ? 388 SER A HG   4  
ATOM   5231  N  N    . HIS A 1 32  ? 21.974  6.131   18.337  1.00 0.00 ? 389 HIS A N    4  
ATOM   5232  C  CA   . HIS A 1 32  ? 21.974  6.141   16.878  1.00 0.00 ? 389 HIS A CA   4  
ATOM   5233  C  C    . HIS A 1 32  ? 20.810  5.322   16.329  1.00 0.00 ? 389 HIS A C    4  
ATOM   5234  O  O    . HIS A 1 32  ? 20.137  5.736   15.384  1.00 0.00 ? 389 HIS A O    4  
ATOM   5235  C  CB   . HIS A 1 32  ? 23.297  5.592   16.343  1.00 0.00 ? 389 HIS A CB   4  
ATOM   5236  C  CG   . HIS A 1 32  ? 24.392  6.612   16.292  1.00 0.00 ? 389 HIS A CG   4  
ATOM   5237  N  ND1  . HIS A 1 32  ? 25.731  6.281   16.289  1.00 0.00 ? 389 HIS A ND1  4  
ATOM   5238  C  CD2  . HIS A 1 32  ? 24.341  7.964   16.239  1.00 0.00 ? 389 HIS A CD2  4  
ATOM   5239  C  CE1  . HIS A 1 32  ? 26.455  7.384   16.238  1.00 0.00 ? 389 HIS A CE1  4  
ATOM   5240  N  NE2  . HIS A 1 32  ? 25.636  8.420   16.207  1.00 0.00 ? 389 HIS A NE2  4  
ATOM   5241  H  H    . HIS A 1 32  ? 22.804  5.921   18.813  1.00 0.00 ? 389 HIS A H    4  
ATOM   5242  H  HA   . HIS A 1 32  ? 21.862  7.165   16.554  1.00 0.00 ? 389 HIS A HA   4  
ATOM   5243  H  HB2  . HIS A 1 32  ? 23.627  4.784   16.979  1.00 0.00 ? 389 HIS A HB2  4  
ATOM   5244  H  HB3  . HIS A 1 32  ? 23.145  5.216   15.342  1.00 0.00 ? 389 HIS A HB3  4  
ATOM   5245  H  HD1  . HIS A 1 32  ? 26.095  5.372   16.321  1.00 0.00 ? 389 HIS A HD1  4  
ATOM   5246  H  HD2  . HIS A 1 32  ? 23.448  8.573   16.225  1.00 0.00 ? 389 HIS A HD2  4  
ATOM   5247  H  HE1  . HIS A 1 32  ? 27.534  7.432   16.225  1.00 0.00 ? 389 HIS A HE1  4  
ATOM   5248  N  N    . LEU A 1 33  ? 20.580  4.157   16.925  1.00 0.00 ? 390 LEU A N    4  
ATOM   5249  C  CA   . LEU A 1 33  ? 19.497  3.279   16.495  1.00 0.00 ? 390 LEU A CA   4  
ATOM   5250  C  C    . LEU A 1 33  ? 18.147  3.977   16.621  1.00 0.00 ? 390 LEU A C    4  
ATOM   5251  O  O    . LEU A 1 33  ? 17.300  3.878   15.733  1.00 0.00 ? 390 LEU A O    4  
ATOM   5252  C  CB   . LEU A 1 33  ? 19.499  1.993   17.323  1.00 0.00 ? 390 LEU A CB   4  
ATOM   5253  C  CG   . LEU A 1 33  ? 18.413  0.972   16.979  1.00 0.00 ? 390 LEU A CG   4  
ATOM   5254  C  CD1  . LEU A 1 33  ? 18.645  0.393   15.592  1.00 0.00 ? 390 LEU A CD1  4  
ATOM   5255  C  CD2  . LEU A 1 33  ? 18.374  -0.136  18.022  1.00 0.00 ? 390 LEU A CD2  4  
ATOM   5256  H  H    . LEU A 1 33  ? 21.150  3.881   17.672  1.00 0.00 ? 390 LEU A H    4  
ATOM   5257  H  HA   . LEU A 1 33  ? 19.665  3.030   15.458  1.00 0.00 ? 390 LEU A HA   4  
ATOM   5258  H  HB2  . LEU A 1 33  ? 20.457  1.514   17.189  1.00 0.00 ? 390 LEU A HB2  4  
ATOM   5259  H  HB3  . LEU A 1 33  ? 19.378  2.268   18.361  1.00 0.00 ? 390 LEU A HB3  4  
ATOM   5260  H  HG   . LEU A 1 33  ? 17.451  1.466   16.978  1.00 0.00 ? 390 LEU A HG   4  
ATOM   5261  H  HD11 . LEU A 1 33  ? 18.772  1.197   14.883  1.00 0.00 ? 390 LEU A HD11 4  
ATOM   5262  H  HD12 . LEU A 1 33  ? 17.794  -0.208  15.306  1.00 0.00 ? 390 LEU A HD12 4  
ATOM   5263  H  HD13 . LEU A 1 33  ? 19.532  -0.222  15.603  1.00 0.00 ? 390 LEU A HD13 4  
ATOM   5264  H  HD21 . LEU A 1 33  ? 17.347  -0.364  18.266  1.00 0.00 ? 390 LEU A HD21 4  
ATOM   5265  H  HD22 . LEU A 1 33  ? 18.893  0.189   18.911  1.00 0.00 ? 390 LEU A HD22 4  
ATOM   5266  H  HD23 . LEU A 1 33  ? 18.855  -1.019  17.627  1.00 0.00 ? 390 LEU A HD23 4  
ATOM   5267  N  N    . LYS A 1 34  ? 17.953  4.684   17.729  1.00 0.00 ? 391 LYS A N    4  
ATOM   5268  C  CA   . LYS A 1 34  ? 16.708  5.402   17.970  1.00 0.00 ? 391 LYS A CA   4  
ATOM   5269  C  C    . LYS A 1 34  ? 16.349  6.286   16.780  1.00 0.00 ? 391 LYS A C    4  
ATOM   5270  O  O    . LYS A 1 34  ? 15.248  6.196   16.238  1.00 0.00 ? 391 LYS A O    4  
ATOM   5271  C  CB   . LYS A 1 34  ? 16.824  6.255   19.235  1.00 0.00 ? 391 LYS A CB   4  
ATOM   5272  C  CG   . LYS A 1 34  ? 15.495  6.503   19.927  1.00 0.00 ? 391 LYS A CG   4  
ATOM   5273  C  CD   . LYS A 1 34  ? 15.517  7.790   20.734  1.00 0.00 ? 391 LYS A CD   4  
ATOM   5274  C  CE   . LYS A 1 34  ? 14.327  7.876   21.678  1.00 0.00 ? 391 LYS A CE   4  
ATOM   5275  N  NZ   . LYS A 1 34  ? 14.435  6.900   22.798  1.00 0.00 ? 391 LYS A NZ   4  
ATOM   5276  H  H    . LYS A 1 34  ? 18.667  4.725   18.400  1.00 0.00 ? 391 LYS A H    4  
ATOM   5277  H  HA   . LYS A 1 34  ? 15.925  4.672   18.110  1.00 0.00 ? 391 LYS A HA   4  
ATOM   5278  H  HB2  . LYS A 1 34  ? 17.482  5.757   19.932  1.00 0.00 ? 391 LYS A HB2  4  
ATOM   5279  H  HB3  . LYS A 1 34  ? 17.252  7.212   18.972  1.00 0.00 ? 391 LYS A HB3  4  
ATOM   5280  H  HG2  . LYS A 1 34  ? 14.718  6.572   19.180  1.00 0.00 ? 391 LYS A HG2  4  
ATOM   5281  H  HG3  . LYS A 1 34  ? 15.285  5.675   20.591  1.00 0.00 ? 391 LYS A HG3  4  
ATOM   5282  H  HD2  . LYS A 1 34  ? 16.426  7.824   21.316  1.00 0.00 ? 391 LYS A HD2  4  
ATOM   5283  H  HD3  . LYS A 1 34  ? 15.489  8.630   20.056  1.00 0.00 ? 391 LYS A HD3  4  
ATOM   5284  H  HE2  . LYS A 1 34  ? 14.280  8.874   22.086  1.00 0.00 ? 391 LYS A HE2  4  
ATOM   5285  H  HE3  . LYS A 1 34  ? 13.426  7.672   21.120  1.00 0.00 ? 391 LYS A HE3  4  
ATOM   5286  H  HZ1  . LYS A 1 34  ? 14.964  6.059   22.489  1.00 0.00 ? 391 LYS A HZ1  4  
ATOM   5287  H  HZ2  . LYS A 1 34  ? 13.487  6.605   23.107  1.00 0.00 ? 391 LYS A HZ2  4  
ATOM   5288  H  HZ3  . LYS A 1 34  ? 14.931  7.332   23.603  1.00 0.00 ? 391 LYS A HZ3  4  
ATOM   5289  N  N    . ALA A 1 35  ? 17.286  7.138   16.378  1.00 0.00 ? 392 ALA A N    4  
ATOM   5290  C  CA   . ALA A 1 35  ? 17.070  8.035   15.249  1.00 0.00 ? 392 ALA A CA   4  
ATOM   5291  C  C    . ALA A 1 35  ? 16.643  7.261   14.007  1.00 0.00 ? 392 ALA A C    4  
ATOM   5292  O  O    . ALA A 1 35  ? 15.741  7.681   13.281  1.00 0.00 ? 392 ALA A O    4  
ATOM   5293  C  CB   . ALA A 1 35  ? 18.330  8.839   14.965  1.00 0.00 ? 392 ALA A CB   4  
ATOM   5294  H  H    . ALA A 1 35  ? 18.144  7.163   16.850  1.00 0.00 ? 392 ALA A H    4  
ATOM   5295  H  HA   . ALA A 1 35  ? 16.284  8.726   15.518  1.00 0.00 ? 392 ALA A HA   4  
ATOM   5296  H  HB1  . ALA A 1 35  ? 18.991  8.262   14.336  1.00 0.00 ? 392 ALA A HB1  4  
ATOM   5297  H  HB2  . ALA A 1 35  ? 18.064  9.757   14.461  1.00 0.00 ? 392 ALA A HB2  4  
ATOM   5298  H  HB3  . ALA A 1 35  ? 18.827  9.069   15.895  1.00 0.00 ? 392 ALA A HB3  4  
ATOM   5299  N  N    . HIS A 1 36  ? 17.296  6.128   13.767  1.00 0.00 ? 393 HIS A N    4  
ATOM   5300  C  CA   . HIS A 1 36  ? 16.983  5.295   12.611  1.00 0.00 ? 393 HIS A CA   4  
ATOM   5301  C  C    . HIS A 1 36  ? 15.562  4.747   12.705  1.00 0.00 ? 393 HIS A C    4  
ATOM   5302  O  O    . HIS A 1 36  ? 14.772  4.879   11.769  1.00 0.00 ? 393 HIS A O    4  
ATOM   5303  C  CB   . HIS A 1 36  ? 17.981  4.141   12.503  1.00 0.00 ? 393 HIS A CB   4  
ATOM   5304  C  CG   . HIS A 1 36  ? 17.433  2.940   11.796  1.00 0.00 ? 393 HIS A CG   4  
ATOM   5305  N  ND1  . HIS A 1 36  ? 17.115  2.936   10.455  1.00 0.00 ? 393 HIS A ND1  4  
ATOM   5306  C  CD2  . HIS A 1 36  ? 17.147  1.698   12.253  1.00 0.00 ? 393 HIS A CD2  4  
ATOM   5307  C  CE1  . HIS A 1 36  ? 16.657  1.744   10.117  1.00 0.00 ? 393 HIS A CE1  4  
ATOM   5308  N  NE2  . HIS A 1 36  ? 16.666  0.974   11.190  1.00 0.00 ? 393 HIS A NE2  4  
ATOM   5309  H  H    . HIS A 1 36  ? 18.005  5.846   14.382  1.00 0.00 ? 393 HIS A H    4  
ATOM   5310  H  HA   . HIS A 1 36  ? 17.061  5.911   11.728  1.00 0.00 ? 393 HIS A HA   4  
ATOM   5311  H  HB2  . HIS A 1 36  ? 18.851  4.477   11.958  1.00 0.00 ? 393 HIS A HB2  4  
ATOM   5312  H  HB3  . HIS A 1 36  ? 18.279  3.837   13.496  1.00 0.00 ? 393 HIS A HB3  4  
ATOM   5313  H  HD1  . HIS A 1 36  ? 17.210  3.694   9.842   1.00 0.00 ? 393 HIS A HD1  4  
ATOM   5314  H  HD2  . HIS A 1 36  ? 17.274  1.342   13.266  1.00 0.00 ? 393 HIS A HD2  4  
ATOM   5315  H  HE1  . HIS A 1 36  ? 16.330  1.448   9.131   1.00 0.00 ? 393 HIS A HE1  4  
ATOM   5316  N  N    . LEU A 1 37  ? 15.244  4.133   13.839  1.00 0.00 ? 394 LEU A N    4  
ATOM   5317  C  CA   . LEU A 1 37  ? 13.918  3.564   14.055  1.00 0.00 ? 394 LEU A CA   4  
ATOM   5318  C  C    . LEU A 1 37  ? 12.839  4.454   13.447  1.00 0.00 ? 394 LEU A C    4  
ATOM   5319  O  O    . LEU A 1 37  ? 11.972  3.981   12.712  1.00 0.00 ? 394 LEU A O    4  
ATOM   5320  C  CB   . LEU A 1 37  ? 13.659  3.377   15.551  1.00 0.00 ? 394 LEU A CB   4  
ATOM   5321  C  CG   . LEU A 1 37  ? 14.264  2.124   16.185  1.00 0.00 ? 394 LEU A CG   4  
ATOM   5322  C  CD1  . LEU A 1 37  ? 14.109  2.163   17.697  1.00 0.00 ? 394 LEU A CD1  4  
ATOM   5323  C  CD2  . LEU A 1 37  ? 13.617  0.871   15.613  1.00 0.00 ? 394 LEU A CD2  4  
ATOM   5324  H  H    . LEU A 1 37  ? 15.916  4.059   14.548  1.00 0.00 ? 394 LEU A H    4  
ATOM   5325  H  HA   . LEU A 1 37  ? 13.888  2.600   13.569  1.00 0.00 ? 394 LEU A HA   4  
ATOM   5326  H  HB2  . LEU A 1 37  ? 14.062  4.235   16.066  1.00 0.00 ? 394 LEU A HB2  4  
ATOM   5327  H  HB3  . LEU A 1 37  ? 12.589  3.340   15.698  1.00 0.00 ? 394 LEU A HB3  4  
ATOM   5328  H  HG   . LEU A 1 37  ? 15.321  2.088   15.960  1.00 0.00 ? 394 LEU A HG   4  
ATOM   5329  H  HD11 . LEU A 1 37  ? 14.991  2.601   18.139  1.00 0.00 ? 394 LEU A HD11 4  
ATOM   5330  H  HD12 . LEU A 1 37  ? 13.979  1.159   18.072  1.00 0.00 ? 394 LEU A HD12 4  
ATOM   5331  H  HD13 . LEU A 1 37  ? 13.244  2.757   17.955  1.00 0.00 ? 394 LEU A HD13 4  
ATOM   5332  H  HD21 . LEU A 1 37  ? 12.898  1.150   14.857  1.00 0.00 ? 394 LEU A HD21 4  
ATOM   5333  H  HD22 . LEU A 1 37  ? 13.118  0.331   16.404  1.00 0.00 ? 394 LEU A HD22 4  
ATOM   5334  H  HD23 . LEU A 1 37  ? 14.378  0.243   15.172  1.00 0.00 ? 394 LEU A HD23 4  
ATOM   5335  N  N    . ARG A 1 38  ? 12.899  5.745   13.758  1.00 0.00 ? 395 ARG A N    4  
ATOM   5336  C  CA   . ARG A 1 38  ? 11.927  6.701   13.243  1.00 0.00 ? 395 ARG A CA   4  
ATOM   5337  C  C    . ARG A 1 38  ? 11.538  6.360   11.807  1.00 0.00 ? 395 ARG A C    4  
ATOM   5338  O  O    . ARG A 1 38  ? 10.355  6.288   11.473  1.00 0.00 ? 395 ARG A O    4  
ATOM   5339  C  CB   . ARG A 1 38  ? 12.494  8.121   13.305  1.00 0.00 ? 395 ARG A CB   4  
ATOM   5340  C  CG   . ARG A 1 38  ? 12.620  8.664   14.719  1.00 0.00 ? 395 ARG A CG   4  
ATOM   5341  C  CD   . ARG A 1 38  ? 13.115  10.102  14.721  1.00 0.00 ? 395 ARG A CD   4  
ATOM   5342  N  NE   . ARG A 1 38  ? 12.124  11.023  14.170  1.00 0.00 ? 395 ARG A NE   4  
ATOM   5343  C  CZ   . ARG A 1 38  ? 12.080  12.318  14.464  1.00 0.00 ? 395 ARG A CZ   4  
ATOM   5344  N  NH1  . ARG A 1 38  ? 12.967  12.841  15.299  1.00 0.00 ? 395 ARG A NH1  4  
ATOM   5345  N  NH2  . ARG A 1 38  ? 11.149  13.091  13.922  1.00 0.00 ? 395 ARG A NH2  4  
ATOM   5346  H  H    . ARG A 1 38  ? 13.614  6.061   14.349  1.00 0.00 ? 395 ARG A H    4  
ATOM   5347  H  HA   . ARG A 1 38  ? 11.046  6.647   13.864  1.00 0.00 ? 395 ARG A HA   4  
ATOM   5348  H  HB2  . ARG A 1 38  ? 13.475  8.125   12.853  1.00 0.00 ? 395 ARG A HB2  4  
ATOM   5349  H  HB3  . ARG A 1 38  ? 11.846  8.779   12.746  1.00 0.00 ? 395 ARG A HB3  4  
ATOM   5350  H  HG2  . ARG A 1 38  ? 11.651  8.628   15.197  1.00 0.00 ? 395 ARG A HG2  4  
ATOM   5351  H  HG3  . ARG A 1 38  ? 13.318  8.051   15.270  1.00 0.00 ? 395 ARG A HG3  4  
ATOM   5352  H  HD2  . ARG A 1 38  ? 13.334  10.392  15.738  1.00 0.00 ? 395 ARG A HD2  4  
ATOM   5353  H  HD3  . ARG A 1 38  ? 14.015  10.159  14.128  1.00 0.00 ? 395 ARG A HD3  4  
ATOM   5354  H  HE   . ARG A 1 38  ? 11.459  10.657  13.551  1.00 0.00 ? 395 ARG A HE   4  
ATOM   5355  H  HH11 . ARG A 1 38  ? 13.671  12.261  15.708  1.00 0.00 ? 395 ARG A HH11 4  
ATOM   5356  H  HH12 . ARG A 1 38  ? 12.933  13.817  15.518  1.00 0.00 ? 395 ARG A HH12 4  
ATOM   5357  H  HH21 . ARG A 1 38  ? 10.479  12.700  13.292  1.00 0.00 ? 395 ARG A HH21 4  
ATOM   5358  H  HH22 . ARG A 1 38  ? 11.117  14.065  14.144  1.00 0.00 ? 395 ARG A HH22 4  
ATOM   5359  N  N    . THR A 1 39  ? 12.542  6.152   10.961  1.00 0.00 ? 396 THR A N    4  
ATOM   5360  C  CA   . THR A 1 39  ? 12.306  5.821   9.561   1.00 0.00 ? 396 THR A CA   4  
ATOM   5361  C  C    . THR A 1 39  ? 11.144  4.845   9.416   1.00 0.00 ? 396 THR A C    4  
ATOM   5362  O  O    . THR A 1 39  ? 10.271  5.025   8.566   1.00 0.00 ? 396 THR A O    4  
ATOM   5363  C  CB   . THR A 1 39  ? 13.560  5.209   8.909   1.00 0.00 ? 396 THR A CB   4  
ATOM   5364  O  OG1  . THR A 1 39  ? 13.899  3.979   9.559   1.00 0.00 ? 396 THR A OG1  4  
ATOM   5365  C  CG2  . THR A 1 39  ? 14.736  6.171   8.989   1.00 0.00 ? 396 THR A CG2  4  
ATOM   5366  H  H    . THR A 1 39  ? 13.463  6.225   11.287  1.00 0.00 ? 396 THR A H    4  
ATOM   5367  H  HA   . THR A 1 39  ? 12.063  6.735   9.039   1.00 0.00 ? 396 THR A HA   4  
ATOM   5368  H  HB   . THR A 1 39  ? 13.346  5.011   7.869   1.00 0.00 ? 396 THR A HB   4  
ATOM   5369  H  HG1  . THR A 1 39  ? 13.739  4.060   10.502  1.00 0.00 ? 396 THR A HG1  4  
ATOM   5370  H  HG21 . THR A 1 39  ? 14.373  7.187   8.946   1.00 0.00 ? 396 THR A HG21 4  
ATOM   5371  H  HG22 . THR A 1 39  ? 15.404  5.993   8.160   1.00 0.00 ? 396 THR A HG22 4  
ATOM   5372  H  HG23 . THR A 1 39  ? 15.264  6.017   9.918   1.00 0.00 ? 396 THR A HG23 4  
ATOM   5373  N  N    . HIS A 1 40  ? 11.137  3.811   10.251  1.00 0.00 ? 397 HIS A N    4  
ATOM   5374  C  CA   . HIS A 1 40  ? 10.080  2.807   10.216  1.00 0.00 ? 397 HIS A CA   4  
ATOM   5375  C  C    . HIS A 1 40  ? 8.755   3.396   10.690  1.00 0.00 ? 397 HIS A C    4  
ATOM   5376  O  O    . HIS A 1 40  ? 7.703   3.139   10.103  1.00 0.00 ? 397 HIS A O    4  
ATOM   5377  C  CB   . HIS A 1 40  ? 10.459  1.607   11.085  1.00 0.00 ? 397 HIS A CB   4  
ATOM   5378  C  CG   . HIS A 1 40  ? 11.735  0.943   10.668  1.00 0.00 ? 397 HIS A CG   4  
ATOM   5379  N  ND1  . HIS A 1 40  ? 11.982  0.534   9.374   1.00 0.00 ? 397 HIS A ND1  4  
ATOM   5380  C  CD2  . HIS A 1 40  ? 12.839  0.620   11.380  1.00 0.00 ? 397 HIS A CD2  4  
ATOM   5381  C  CE1  . HIS A 1 40  ? 13.182  -0.014  9.310   1.00 0.00 ? 397 HIS A CE1  4  
ATOM   5382  N  NE2  . HIS A 1 40  ? 13.723  0.026   10.514  1.00 0.00 ? 397 HIS A NE2  4  
ATOM   5383  H  H    . HIS A 1 40  ? 11.860  3.722   10.907  1.00 0.00 ? 397 HIS A H    4  
ATOM   5384  H  HA   . HIS A 1 40  ? 9.969   2.478   9.194   1.00 0.00 ? 397 HIS A HA   4  
ATOM   5385  H  HB2  . HIS A 1 40  ? 10.575  1.934   12.108  1.00 0.00 ? 397 HIS A HB2  4  
ATOM   5386  H  HB3  . HIS A 1 40  ? 9.669   0.871   11.035  1.00 0.00 ? 397 HIS A HB3  4  
ATOM   5387  H  HD1  . HIS A 1 40  ? 11.368  0.630   8.617   1.00 0.00 ? 397 HIS A HD1  4  
ATOM   5388  H  HD2  . HIS A 1 40  ? 12.996  0.796   12.436  1.00 0.00 ? 397 HIS A HD2  4  
ATOM   5389  H  HE1  . HIS A 1 40  ? 13.643  -0.425  8.424   1.00 0.00 ? 397 HIS A HE1  4  
ATOM   5390  N  N    . THR A 1 41  ? 8.812   4.187   11.757  1.00 0.00 ? 398 THR A N    4  
ATOM   5391  C  CA   . THR A 1 41  ? 7.617   4.811   12.311  1.00 0.00 ? 398 THR A CA   4  
ATOM   5392  C  C    . THR A 1 41  ? 6.674   5.270   11.205  1.00 0.00 ? 398 THR A C    4  
ATOM   5393  O  O    . THR A 1 41  ? 7.085   5.958   10.271  1.00 0.00 ? 398 THR A O    4  
ATOM   5394  C  CB   . THR A 1 41  ? 7.974   6.017   13.200  1.00 0.00 ? 398 THR A CB   4  
ATOM   5395  O  OG1  . THR A 1 41  ? 8.811   5.596   14.283  1.00 0.00 ? 398 THR A OG1  4  
ATOM   5396  C  CG2  . THR A 1 41  ? 6.717   6.675   13.749  1.00 0.00 ? 398 THR A CG2  4  
ATOM   5397  H  H    . THR A 1 41  ? 9.680   4.354   12.181  1.00 0.00 ? 398 THR A H    4  
ATOM   5398  H  HA   . THR A 1 41  ? 7.111   4.077   12.921  1.00 0.00 ? 398 THR A HA   4  
ATOM   5399  H  HB   . THR A 1 41  ? 8.509   6.740   12.601  1.00 0.00 ? 398 THR A HB   4  
ATOM   5400  H  HG1  . THR A 1 41  ? 9.400   4.901   13.981  1.00 0.00 ? 398 THR A HG1  4  
ATOM   5401  H  HG21 . THR A 1 41  ? 6.059   5.917   14.146  1.00 0.00 ? 398 THR A HG21 4  
ATOM   5402  H  HG22 . THR A 1 41  ? 6.214   7.208   12.956  1.00 0.00 ? 398 THR A HG22 4  
ATOM   5403  H  HG23 . THR A 1 41  ? 6.986   7.366   14.534  1.00 0.00 ? 398 THR A HG23 4  
ATOM   5404  N  N    . GLY A 1 42  ? 5.406   4.886   11.317  1.00 0.00 ? 399 GLY A N    4  
ATOM   5405  C  CA   . GLY A 1 42  ? 4.424   5.268   10.320  1.00 0.00 ? 399 GLY A CA   4  
ATOM   5406  C  C    . GLY A 1 42  ? 4.200   6.767   10.272  1.00 0.00 ? 399 GLY A C    4  
ATOM   5407  O  O    . GLY A 1 42  ? 5.100   7.524   9.911   1.00 0.00 ? 399 GLY A O    4  
ATOM   5408  H  H    . GLY A 1 42  ? 5.135   4.338   12.083  1.00 0.00 ? 399 GLY A H    4  
ATOM   5409  H  HA2  . GLY A 1 42  ? 4.762   4.934   9.350   1.00 0.00 ? 399 GLY A HA2  4  
ATOM   5410  H  HA3  . GLY A 1 42  ? 3.486   4.783   10.549  1.00 0.00 ? 399 GLY A HA3  4  
ATOM   5411  N  N    . GLU A 1 43  ? 2.995   7.195   10.635  1.00 0.00 ? 400 GLU A N    4  
ATOM   5412  C  CA   . GLU A 1 43  ? 2.656   8.613   10.629  1.00 0.00 ? 400 GLU A CA   4  
ATOM   5413  C  C    . GLU A 1 43  ? 1.505   8.902   11.590  1.00 0.00 ? 400 GLU A C    4  
ATOM   5414  O  O    . GLU A 1 43  ? 0.394   8.402   11.413  1.00 0.00 ? 400 GLU A O    4  
ATOM   5415  C  CB   . GLU A 1 43  ? 2.280   9.065   9.217   1.00 0.00 ? 400 GLU A CB   4  
ATOM   5416  C  CG   . GLU A 1 43  ? 2.498   10.549  8.974   1.00 0.00 ? 400 GLU A CG   4  
ATOM   5417  C  CD   . GLU A 1 43  ? 3.961   10.941  9.028   1.00 0.00 ? 400 GLU A CD   4  
ATOM   5418  O  OE1  . GLU A 1 43  ? 4.800   10.172  8.513   1.00 0.00 ? 400 GLU A OE1  4  
ATOM   5419  O  OE2  . GLU A 1 43  ? 4.269   12.015  9.585   1.00 0.00 ? 400 GLU A OE2  4  
ATOM   5420  H  H    . GLU A 1 43  ? 2.319   6.543   10.914  1.00 0.00 ? 400 GLU A H    4  
ATOM   5421  H  HA   . GLU A 1 43  ? 3.525   9.164   10.954  1.00 0.00 ? 400 GLU A HA   4  
ATOM   5422  H  HB2  . GLU A 1 43  ? 2.876   8.513   8.505   1.00 0.00 ? 400 GLU A HB2  4  
ATOM   5423  H  HB3  . GLU A 1 43  ? 1.237   8.843   9.047   1.00 0.00 ? 400 GLU A HB3  4  
ATOM   5424  H  HG2  . GLU A 1 43  ? 2.109   10.802  7.999   1.00 0.00 ? 400 GLU A HG2  4  
ATOM   5425  H  HG3  . GLU A 1 43  ? 1.963   11.106  9.729   1.00 0.00 ? 400 GLU A HG3  4  
ATOM   5426  N  N    . LYS A 1 44  ? 1.780   9.710   12.608  1.00 0.00 ? 401 LYS A N    4  
ATOM   5427  C  CA   . LYS A 1 44  ? 0.770   10.067  13.597  1.00 0.00 ? 401 LYS A CA   4  
ATOM   5428  C  C    . LYS A 1 44  ? 0.730   11.576  13.813  1.00 0.00 ? 401 LYS A C    4  
ATOM   5429  O  O    . LYS A 1 44  ? 1.471   12.131  14.625  1.00 0.00 ? 401 LYS A O    4  
ATOM   5430  C  CB   . LYS A 1 44  ? 1.053   9.358   14.923  1.00 0.00 ? 401 LYS A CB   4  
ATOM   5431  C  CG   . LYS A 1 44  ? 0.936   7.846   14.842  1.00 0.00 ? 401 LYS A CG   4  
ATOM   5432  C  CD   . LYS A 1 44  ? 1.182   7.194   16.192  1.00 0.00 ? 401 LYS A CD   4  
ATOM   5433  C  CE   . LYS A 1 44  ? 2.657   6.887   16.402  1.00 0.00 ? 401 LYS A CE   4  
ATOM   5434  N  NZ   . LYS A 1 44  ? 3.089   5.688   15.631  1.00 0.00 ? 401 LYS A NZ   4  
ATOM   5435  H  H    . LYS A 1 44  ? 2.685   10.077  12.695  1.00 0.00 ? 401 LYS A H    4  
ATOM   5436  H  HA   . LYS A 1 44  ? -0.189  9.743   13.223  1.00 0.00 ? 401 LYS A HA   4  
ATOM   5437  H  HB2  . LYS A 1 44  ? 2.055   9.604   15.243  1.00 0.00 ? 401 LYS A HB2  4  
ATOM   5438  H  HB3  . LYS A 1 44  ? 0.351   9.713   15.664  1.00 0.00 ? 401 LYS A HB3  4  
ATOM   5439  H  HG2  . LYS A 1 44  ? -0.057  7.588   14.506  1.00 0.00 ? 401 LYS A HG2  4  
ATOM   5440  H  HG3  . LYS A 1 44  ? 1.665   7.475   14.135  1.00 0.00 ? 401 LYS A HG3  4  
ATOM   5441  H  HD2  . LYS A 1 44  ? 0.852   7.864   16.972  1.00 0.00 ? 401 LYS A HD2  4  
ATOM   5442  H  HD3  . LYS A 1 44  ? 0.620   6.272   16.245  1.00 0.00 ? 401 LYS A HD3  4  
ATOM   5443  H  HE2  . LYS A 1 44  ? 3.238   7.738   16.082  1.00 0.00 ? 401 LYS A HE2  4  
ATOM   5444  H  HE3  . LYS A 1 44  ? 2.828   6.709   17.453  1.00 0.00 ? 401 LYS A HE3  4  
ATOM   5445  H  HZ1  . LYS A 1 44  ? 2.763   4.822   16.106  1.00 0.00 ? 401 LYS A HZ1  4  
ATOM   5446  H  HZ2  . LYS A 1 44  ? 4.127   5.663   15.562  1.00 0.00 ? 401 LYS A HZ2  4  
ATOM   5447  H  HZ3  . LYS A 1 44  ? 2.689   5.717   14.672  1.00 0.00 ? 401 LYS A HZ3  4  
ATOM   5448  N  N    . PRO A 1 45  ? -0.157  12.258  13.073  1.00 0.00 ? 402 PRO A N    4  
ATOM   5449  C  CA   . PRO A 1 45  ? -0.316  13.712  13.168  1.00 0.00 ? 402 PRO A CA   4  
ATOM   5450  C  C    . PRO A 1 45  ? -0.943  14.141  14.490  1.00 0.00 ? 402 PRO A C    4  
ATOM   5451  O  O    . PRO A 1 45  ? -0.803  15.289  14.911  1.00 0.00 ? 402 PRO A O    4  
ATOM   5452  C  CB   . PRO A 1 45  ? -1.250  14.043  12.001  1.00 0.00 ? 402 PRO A CB   4  
ATOM   5453  C  CG   . PRO A 1 45  ? -2.013  12.787  11.758  1.00 0.00 ? 402 PRO A CG   4  
ATOM   5454  C  CD   . PRO A 1 45  ? -1.072  11.661  12.086  1.00 0.00 ? 402 PRO A CD   4  
ATOM   5455  H  HA   . PRO A 1 45  ? 0.626   14.224  13.035  1.00 0.00 ? 402 PRO A HA   4  
ATOM   5456  H  HB2  . PRO A 1 45  ? -1.904  14.857  12.280  1.00 0.00 ? 402 PRO A HB2  4  
ATOM   5457  H  HB3  . PRO A 1 45  ? -0.666  14.324  11.137  1.00 0.00 ? 402 PRO A HB3  4  
ATOM   5458  H  HG2  . PRO A 1 45  ? -2.878  12.753  12.402  1.00 0.00 ? 402 PRO A HG2  4  
ATOM   5459  H  HG3  . PRO A 1 45  ? -2.312  12.735  10.721  1.00 0.00 ? 402 PRO A HG3  4  
ATOM   5460  H  HD2  . PRO A 1 45  ? -1.613  10.830  12.514  1.00 0.00 ? 402 PRO A HD2  4  
ATOM   5461  H  HD3  . PRO A 1 45  ? -0.535  11.349  11.202  1.00 0.00 ? 402 PRO A HD3  4  
ATOM   5462  N  N    . TYR A 1 46  ? -1.634  13.211  15.141  1.00 0.00 ? 403 TYR A N    4  
ATOM   5463  C  CA   . TYR A 1 46  ? -2.285  13.495  16.415  1.00 0.00 ? 403 TYR A CA   4  
ATOM   5464  C  C    . TYR A 1 46  ? -1.285  13.419  17.565  1.00 0.00 ? 403 TYR A C    4  
ATOM   5465  O  O    . TYR A 1 46  ? -0.693  12.370  17.821  1.00 0.00 ? 403 TYR A O    4  
ATOM   5466  C  CB   . TYR A 1 46  ? -3.432  12.512  16.655  1.00 0.00 ? 403 TYR A CB   4  
ATOM   5467  C  CG   . TYR A 1 46  ? -4.517  12.579  15.604  1.00 0.00 ? 403 TYR A CG   4  
ATOM   5468  C  CD1  . TYR A 1 46  ? -5.522  13.535  15.675  1.00 0.00 ? 403 TYR A CD1  4  
ATOM   5469  C  CD2  . TYR A 1 46  ? -4.537  11.685  14.541  1.00 0.00 ? 403 TYR A CD2  4  
ATOM   5470  C  CE1  . TYR A 1 46  ? -6.516  13.600  14.718  1.00 0.00 ? 403 TYR A CE1  4  
ATOM   5471  C  CE2  . TYR A 1 46  ? -5.526  11.743  13.578  1.00 0.00 ? 403 TYR A CE2  4  
ATOM   5472  C  CZ   . TYR A 1 46  ? -6.513  12.702  13.671  1.00 0.00 ? 403 TYR A CZ   4  
ATOM   5473  O  OH   . TYR A 1 46  ? -7.501  12.762  12.715  1.00 0.00 ? 403 TYR A OH   4  
ATOM   5474  H  H    . TYR A 1 46  ? -1.710  12.314  14.755  1.00 0.00 ? 403 TYR A H    4  
ATOM   5475  H  HA   . TYR A 1 46  ? -2.686  14.496  16.367  1.00 0.00 ? 403 TYR A HA   4  
ATOM   5476  H  HB2  . TYR A 1 46  ? -3.040  11.506  16.663  1.00 0.00 ? 403 TYR A HB2  4  
ATOM   5477  H  HB3  . TYR A 1 46  ? -3.884  12.724  17.613  1.00 0.00 ? 403 TYR A HB3  4  
ATOM   5478  H  HD1  . TYR A 1 46  ? -5.521  14.237  16.497  1.00 0.00 ? 403 TYR A HD1  4  
ATOM   5479  H  HD2  . TYR A 1 46  ? -3.763  10.935  14.471  1.00 0.00 ? 403 TYR A HD2  4  
ATOM   5480  H  HE1  . TYR A 1 46  ? -7.289  14.351  14.790  1.00 0.00 ? 403 TYR A HE1  4  
ATOM   5481  H  HE2  . TYR A 1 46  ? -5.525  11.040  12.758  1.00 0.00 ? 403 TYR A HE2  4  
ATOM   5482  H  HH   . TYR A 1 46  ? -8.267  13.215  13.074  1.00 0.00 ? 403 TYR A HH   4  
ATOM   5483  N  N    . LYS A 1 47  ? -1.104  14.538  18.257  1.00 0.00 ? 404 LYS A N    4  
ATOM   5484  C  CA   . LYS A 1 47  ? -0.179  14.601  19.383  1.00 0.00 ? 404 LYS A CA   4  
ATOM   5485  C  C    . LYS A 1 47  ? -0.906  15.002  20.662  1.00 0.00 ? 404 LYS A C    4  
ATOM   5486  O  O    . LYS A 1 47  ? -1.850  15.792  20.631  1.00 0.00 ? 404 LYS A O    4  
ATOM   5487  C  CB   . LYS A 1 47  ? 0.946   15.596  19.089  1.00 0.00 ? 404 LYS A CB   4  
ATOM   5488  C  CG   . LYS A 1 47  ? 1.980   15.690  20.198  1.00 0.00 ? 404 LYS A CG   4  
ATOM   5489  C  CD   . LYS A 1 47  ? 3.240   16.397  19.728  1.00 0.00 ? 404 LYS A CD   4  
ATOM   5490  C  CE   . LYS A 1 47  ? 4.332   16.351  20.785  1.00 0.00 ? 404 LYS A CE   4  
ATOM   5491  N  NZ   . LYS A 1 47  ? 4.071   17.310  21.894  1.00 0.00 ? 404 LYS A NZ   4  
ATOM   5492  H  H    . LYS A 1 47  ? -1.606  15.342  18.005  1.00 0.00 ? 404 LYS A H    4  
ATOM   5493  H  HA   . LYS A 1 47  ? 0.247   13.619  19.517  1.00 0.00 ? 404 LYS A HA   4  
ATOM   5494  H  HB2  . LYS A 1 47  ? 1.448   15.296  18.181  1.00 0.00 ? 404 LYS A HB2  4  
ATOM   5495  H  HB3  . LYS A 1 47  ? 0.515   16.576  18.944  1.00 0.00 ? 404 LYS A HB3  4  
ATOM   5496  H  HG2  . LYS A 1 47  ? 1.558   16.241  21.025  1.00 0.00 ? 404 LYS A HG2  4  
ATOM   5497  H  HG3  . LYS A 1 47  ? 2.238   14.692  20.522  1.00 0.00 ? 404 LYS A HG3  4  
ATOM   5498  H  HD2  . LYS A 1 47  ? 3.601   15.913  18.832  1.00 0.00 ? 404 LYS A HD2  4  
ATOM   5499  H  HD3  . LYS A 1 47  ? 3.003   17.429  19.511  1.00 0.00 ? 404 LYS A HD3  4  
ATOM   5500  H  HE2  . LYS A 1 47  ? 4.383   15.352  21.189  1.00 0.00 ? 404 LYS A HE2  4  
ATOM   5501  H  HE3  . LYS A 1 47  ? 5.275   16.600  20.320  1.00 0.00 ? 404 LYS A HE3  4  
ATOM   5502  H  HZ1  . LYS A 1 47  ? 4.551   18.213  21.708  1.00 0.00 ? 404 LYS A HZ1  4  
ATOM   5503  H  HZ2  . LYS A 1 47  ? 4.423   16.921  22.793  1.00 0.00 ? 404 LYS A HZ2  4  
ATOM   5504  H  HZ3  . LYS A 1 47  ? 3.049   17.484  21.983  1.00 0.00 ? 404 LYS A HZ3  4  
ATOM   5505  N  N    . CYS A 1 48  ? -0.459  14.454  21.787  1.00 0.00 ? 405 CYS A N    4  
ATOM   5506  C  CA   . CYS A 1 48  ? -1.065  14.755  23.079  1.00 0.00 ? 405 CYS A CA   4  
ATOM   5507  C  C    . CYS A 1 48  ? -0.709  16.168  23.531  1.00 0.00 ? 405 CYS A C    4  
ATOM   5508  O  O    . CYS A 1 48  ? 0.454   16.473  23.798  1.00 0.00 ? 405 CYS A O    4  
ATOM   5509  C  CB   . CYS A 1 48  ? -0.608  13.741  24.129  1.00 0.00 ? 405 CYS A CB   4  
ATOM   5510  S  SG   . CYS A 1 48  ? -1.374  13.970  25.766  1.00 0.00 ? 405 CYS A SG   4  
ATOM   5511  H  H    . CYS A 1 48  ? 0.298   13.831  21.749  1.00 0.00 ? 405 CYS A H    4  
ATOM   5512  H  HA   . CYS A 1 48  ? -2.137  14.686  22.966  1.00 0.00 ? 405 CYS A HA   4  
ATOM   5513  H  HB2  . CYS A 1 48  ? -0.854  12.746  23.788  1.00 0.00 ? 405 CYS A HB2  4  
ATOM   5514  H  HB3  . CYS A 1 48  ? 0.462   13.820  24.252  1.00 0.00 ? 405 CYS A HB3  4  
ATOM   5515  N  N    . THR A 1 49  ? -1.719  17.029  23.615  1.00 0.00 ? 406 THR A N    4  
ATOM   5516  C  CA   . THR A 1 49  ? -1.513  18.410  24.033  1.00 0.00 ? 406 THR A CA   4  
ATOM   5517  C  C    . THR A 1 49  ? -1.468  18.523  25.553  1.00 0.00 ? 406 THR A C    4  
ATOM   5518  O  O    . THR A 1 49  ? -2.096  19.406  26.137  1.00 0.00 ? 406 THR A O    4  
ATOM   5519  C  CB   . THR A 1 49  ? -2.623  19.332  23.494  1.00 0.00 ? 406 THR A CB   4  
ATOM   5520  O  OG1  . THR A 1 49  ? -2.796  19.119  22.088  1.00 0.00 ? 406 THR A OG1  4  
ATOM   5521  C  CG2  . THR A 1 49  ? -2.287  20.793  23.753  1.00 0.00 ? 406 THR A CG2  4  
ATOM   5522  H  H    . THR A 1 49  ? -2.623  16.727  23.388  1.00 0.00 ? 406 THR A H    4  
ATOM   5523  H  HA   . THR A 1 49  ? -0.568  18.744  23.629  1.00 0.00 ? 406 THR A HA   4  
ATOM   5524  H  HB   . THR A 1 49  ? -3.546  19.095  24.003  1.00 0.00 ? 406 THR A HB   4  
ATOM   5525  H  HG1  . THR A 1 49  ? -3.408  19.772  21.739  1.00 0.00 ? 406 THR A HG1  4  
ATOM   5526  H  HG21 . THR A 1 49  ? -3.176  21.316  24.070  1.00 0.00 ? 406 THR A HG21 4  
ATOM   5527  H  HG22 . THR A 1 49  ? -1.910  21.242  22.846  1.00 0.00 ? 406 THR A HG22 4  
ATOM   5528  H  HG23 . THR A 1 49  ? -1.536  20.857  24.526  1.00 0.00 ? 406 THR A HG23 4  
ATOM   5529  N  N    . TRP A 1 50  ? -0.722  17.625  26.186  1.00 0.00 ? 407 TRP A N    4  
ATOM   5530  C  CA   . TRP A 1 50  ? -0.596  17.625  27.639  1.00 0.00 ? 407 TRP A CA   4  
ATOM   5531  C  C    . TRP A 1 50  ? 0.784   18.115  28.065  1.00 0.00 ? 407 TRP A C    4  
ATOM   5532  O  O    . TRP A 1 50  ? 1.724   18.116  27.271  1.00 0.00 ? 407 TRP A O    4  
ATOM   5533  C  CB   . TRP A 1 50  ? -0.846  16.222  28.193  1.00 0.00 ? 407 TRP A CB   4  
ATOM   5534  C  CG   . TRP A 1 50  ? -0.754  16.148  29.688  1.00 0.00 ? 407 TRP A CG   4  
ATOM   5535  C  CD1  . TRP A 1 50  ? 0.261   15.604  30.421  1.00 0.00 ? 407 TRP A CD1  4  
ATOM   5536  C  CD2  . TRP A 1 50  ? -1.716  16.634  30.630  1.00 0.00 ? 407 TRP A CD2  4  
ATOM   5537  N  NE1  . TRP A 1 50  ? -0.012  15.722  31.762  1.00 0.00 ? 407 TRP A NE1  4  
ATOM   5538  C  CE2  . TRP A 1 50  ? -1.218  16.351  31.917  1.00 0.00 ? 407 TRP A CE2  4  
ATOM   5539  C  CE3  . TRP A 1 50  ? -2.948  17.282  30.512  1.00 0.00 ? 407 TRP A CE3  4  
ATOM   5540  C  CZ2  . TRP A 1 50  ? -1.912  16.693  33.075  1.00 0.00 ? 407 TRP A CZ2  4  
ATOM   5541  C  CZ3  . TRP A 1 50  ? -3.636  17.621  31.662  1.00 0.00 ? 407 TRP A CZ3  4  
ATOM   5542  C  CH2  . TRP A 1 50  ? -3.116  17.327  32.930  1.00 0.00 ? 407 TRP A CH2  4  
ATOM   5543  H  H    . TRP A 1 50  ? -0.246  16.946  25.664  1.00 0.00 ? 407 TRP A H    4  
ATOM   5544  H  HA   . TRP A 1 50  ? -1.342  18.297  28.036  1.00 0.00 ? 407 TRP A HA   4  
ATOM   5545  H  HB2  . TRP A 1 50  ? -1.834  15.898  27.904  1.00 0.00 ? 407 TRP A HB2  4  
ATOM   5546  H  HB3  . TRP A 1 50  ? -0.113  15.544  27.780  1.00 0.00 ? 407 TRP A HB3  4  
ATOM   5547  H  HD1  . TRP A 1 50  ? 1.143   15.149  29.995  1.00 0.00 ? 407 TRP A HD1  4  
ATOM   5548  H  HE1  . TRP A 1 50  ? 0.566   15.408  32.490  1.00 0.00 ? 407 TRP A HE1  4  
ATOM   5549  H  HE3  . TRP A 1 50  ? -3.366  17.517  29.544  1.00 0.00 ? 407 TRP A HE3  4  
ATOM   5550  H  HZ2  . TRP A 1 50  ? -1.524  16.474  34.059  1.00 0.00 ? 407 TRP A HZ2  4  
ATOM   5551  H  HZ3  . TRP A 1 50  ? -4.590  18.122  31.591  1.00 0.00 ? 407 TRP A HZ3  4  
ATOM   5552  H  HH2  . TRP A 1 50  ? -3.687  17.610  33.801  1.00 0.00 ? 407 TRP A HH2  4  
ATOM   5553  N  N    . GLU A 1 51  ? 0.897   18.531  29.322  1.00 0.00 ? 408 GLU A N    4  
ATOM   5554  C  CA   . GLU A 1 51  ? 2.163   19.024  29.852  1.00 0.00 ? 408 GLU A CA   4  
ATOM   5555  C  C    . GLU A 1 51  ? 3.098   17.867  30.194  1.00 0.00 ? 408 GLU A C    4  
ATOM   5556  O  O    . GLU A 1 51  ? 2.810   17.064  31.081  1.00 0.00 ? 408 GLU A O    4  
ATOM   5557  C  CB   . GLU A 1 51  ? 1.922   19.884  31.094  1.00 0.00 ? 408 GLU A CB   4  
ATOM   5558  C  CG   . GLU A 1 51  ? 3.140   20.682  31.529  1.00 0.00 ? 408 GLU A CG   4  
ATOM   5559  C  CD   . GLU A 1 51  ? 4.278   19.799  32.001  1.00 0.00 ? 408 GLU A CD   4  
ATOM   5560  O  OE1  . GLU A 1 51  ? 4.290   19.435  33.196  1.00 0.00 ? 408 GLU A OE1  4  
ATOM   5561  O  OE2  . GLU A 1 51  ? 5.157   19.471  31.176  1.00 0.00 ? 408 GLU A OE2  4  
ATOM   5562  H  H    . GLU A 1 51  ? 0.111   18.507  29.907  1.00 0.00 ? 408 GLU A H    4  
ATOM   5563  H  HA   . GLU A 1 51  ? 2.627   19.632  29.090  1.00 0.00 ? 408 GLU A HA   4  
ATOM   5564  H  HB2  . GLU A 1 51  ? 1.118   20.575  30.889  1.00 0.00 ? 408 GLU A HB2  4  
ATOM   5565  H  HB3  . GLU A 1 51  ? 1.630   19.240  31.911  1.00 0.00 ? 408 GLU A HB3  4  
ATOM   5566  H  HG2  . GLU A 1 51  ? 3.485   21.271  30.692  1.00 0.00 ? 408 GLU A HG2  4  
ATOM   5567  H  HG3  . GLU A 1 51  ? 2.854   21.339  32.337  1.00 0.00 ? 408 GLU A HG3  4  
ATOM   5568  N  N    . GLY A 1 52  ? 4.218   17.788  29.483  1.00 0.00 ? 409 GLY A N    4  
ATOM   5569  C  CA   . GLY A 1 52  ? 5.177   16.727  29.725  1.00 0.00 ? 409 GLY A CA   4  
ATOM   5570  C  C    . GLY A 1 52  ? 5.005   15.561  28.770  1.00 0.00 ? 409 GLY A C    4  
ATOM   5571  O  O    . GLY A 1 52  ? 5.970   15.105  28.156  1.00 0.00 ? 409 GLY A O    4  
ATOM   5572  H  H    . GLY A 1 52  ? 4.395   18.457  28.788  1.00 0.00 ? 409 GLY A H    4  
ATOM   5573  H  HA2  . GLY A 1 52  ? 6.175   17.125  29.614  1.00 0.00 ? 409 GLY A HA2  4  
ATOM   5574  H  HA3  . GLY A 1 52  ? 5.054   16.369  30.737  1.00 0.00 ? 409 GLY A HA3  4  
ATOM   5575  N  N    . CYS A 1 53  ? 3.774   15.077  28.646  1.00 0.00 ? 410 CYS A N    4  
ATOM   5576  C  CA   . CYS A 1 53  ? 3.478   13.957  27.762  1.00 0.00 ? 410 CYS A CA   4  
ATOM   5577  C  C    . CYS A 1 53  ? 3.832   14.296  26.317  1.00 0.00 ? 410 CYS A C    4  
ATOM   5578  O  O    . CYS A 1 53  ? 3.504   15.374  25.823  1.00 0.00 ? 410 CYS A O    4  
ATOM   5579  C  CB   . CYS A 1 53  ? 1.999   13.579  27.861  1.00 0.00 ? 410 CYS A CB   4  
ATOM   5580  S  SG   . CYS A 1 53  ? 1.597   11.953  27.144  1.00 0.00 ? 410 CYS A SG   4  
ATOM   5581  H  H    . CYS A 1 53  ? 3.046   15.484  29.162  1.00 0.00 ? 410 CYS A H    4  
ATOM   5582  H  HA   . CYS A 1 53  ? 4.077   13.117  28.079  1.00 0.00 ? 410 CYS A HA   4  
ATOM   5583  H  HB2  . CYS A 1 53  ? 1.709   13.559  28.901  1.00 0.00 ? 410 CYS A HB2  4  
ATOM   5584  H  HB3  . CYS A 1 53  ? 1.410   14.322  27.343  1.00 0.00 ? 410 CYS A HB3  4  
ATOM   5585  N  N    . ASP A 1 54  ? 4.504   13.367  25.645  1.00 0.00 ? 411 ASP A N    4  
ATOM   5586  C  CA   . ASP A 1 54  ? 4.903   13.566  24.256  1.00 0.00 ? 411 ASP A CA   4  
ATOM   5587  C  C    . ASP A 1 54  ? 4.531   12.356  23.406  1.00 0.00 ? 411 ASP A C    4  
ATOM   5588  O  O    . ASP A 1 54  ? 5.285   11.951  22.522  1.00 0.00 ? 411 ASP A O    4  
ATOM   5589  C  CB   . ASP A 1 54  ? 6.407   13.825  24.167  1.00 0.00 ? 411 ASP A CB   4  
ATOM   5590  C  CG   . ASP A 1 54  ? 6.771   15.253  24.522  1.00 0.00 ? 411 ASP A CG   4  
ATOM   5591  O  OD1  . ASP A 1 54  ? 6.532   16.151  23.687  1.00 0.00 ? 411 ASP A OD1  4  
ATOM   5592  O  OD2  . ASP A 1 54  ? 7.297   15.473  25.633  1.00 0.00 ? 411 ASP A OD2  4  
ATOM   5593  H  H    . ASP A 1 54  ? 4.738   12.527  26.094  1.00 0.00 ? 411 ASP A H    4  
ATOM   5594  H  HA   . ASP A 1 54  ? 4.375   14.430  23.881  1.00 0.00 ? 411 ASP A HA   4  
ATOM   5595  H  HB2  . ASP A 1 54  ? 6.921   13.162  24.849  1.00 0.00 ? 411 ASP A HB2  4  
ATOM   5596  H  HB3  . ASP A 1 54  ? 6.741   13.627  23.159  1.00 0.00 ? 411 ASP A HB3  4  
ATOM   5597  N  N    . TRP A 1 55  ? 3.364   11.783  23.680  1.00 0.00 ? 412 TRP A N    4  
ATOM   5598  C  CA   . TRP A 1 55  ? 2.893   10.617  22.940  1.00 0.00 ? 412 TRP A CA   4  
ATOM   5599  C  C    . TRP A 1 55  ? 2.015   11.036  21.766  1.00 0.00 ? 412 TRP A C    4  
ATOM   5600  O  O    . TRP A 1 55  ? 1.441   12.125  21.766  1.00 0.00 ? 412 TRP A O    4  
ATOM   5601  C  CB   . TRP A 1 55  ? 2.115   9.681   23.866  1.00 0.00 ? 412 TRP A CB   4  
ATOM   5602  C  CG   . TRP A 1 55  ? 2.993   8.742   24.637  1.00 0.00 ? 412 TRP A CG   4  
ATOM   5603  C  CD1  . TRP A 1 55  ? 3.230   8.759   25.982  1.00 0.00 ? 412 TRP A CD1  4  
ATOM   5604  C  CD2  . TRP A 1 55  ? 3.753   7.650   24.107  1.00 0.00 ? 412 TRP A CD2  4  
ATOM   5605  N  NE1  . TRP A 1 55  ? 4.091   7.744   26.320  1.00 0.00 ? 412 TRP A NE1  4  
ATOM   5606  C  CE2  . TRP A 1 55  ? 4.426   7.049   25.189  1.00 0.00 ? 412 TRP A CE2  4  
ATOM   5607  C  CE3  . TRP A 1 55  ? 3.929   7.121   22.826  1.00 0.00 ? 412 TRP A CE3  4  
ATOM   5608  C  CZ2  . TRP A 1 55  ? 5.261   5.946   25.025  1.00 0.00 ? 412 TRP A CZ2  4  
ATOM   5609  C  CZ3  . TRP A 1 55  ? 4.759   6.028   22.665  1.00 0.00 ? 412 TRP A CZ3  4  
ATOM   5610  C  CH2  . TRP A 1 55  ? 5.415   5.449   23.760  1.00 0.00 ? 412 TRP A CH2  4  
ATOM   5611  H  H    . TRP A 1 55  ? 2.806   12.152  24.397  1.00 0.00 ? 412 TRP A H    4  
ATOM   5612  H  HA   . TRP A 1 55  ? 3.758   10.095  22.560  1.00 0.00 ? 412 TRP A HA   4  
ATOM   5613  H  HB2  . TRP A 1 55  ? 1.553   10.270  24.575  1.00 0.00 ? 412 TRP A HB2  4  
ATOM   5614  H  HB3  . TRP A 1 55  ? 1.431   9.089   23.274  1.00 0.00 ? 412 TRP A HB3  4  
ATOM   5615  H  HD1  . TRP A 1 55  ? 2.798   9.474   26.666  1.00 0.00 ? 412 TRP A HD1  4  
ATOM   5616  H  HE1  . TRP A 1 55  ? 4.411   7.548   27.226  1.00 0.00 ? 412 TRP A HE1  4  
ATOM   5617  H  HE3  . TRP A 1 55  ? 3.432   7.553   21.970  1.00 0.00 ? 412 TRP A HE3  4  
ATOM   5618  H  HZ2  . TRP A 1 55  ? 5.774   5.489   25.859  1.00 0.00 ? 412 TRP A HZ2  4  
ATOM   5619  H  HZ3  . TRP A 1 55  ? 4.907   5.605   21.682  1.00 0.00 ? 412 TRP A HZ3  4  
ATOM   5620  H  HH2  . TRP A 1 55  ? 6.053   4.596   23.587  1.00 0.00 ? 412 TRP A HH2  4  
ATOM   5621  N  N    . ARG A 1 56  ? 1.916   10.166  20.767  1.00 0.00 ? 413 ARG A N    4  
ATOM   5622  C  CA   . ARG A 1 56  ? 1.109   10.447  19.586  1.00 0.00 ? 413 ARG A CA   4  
ATOM   5623  C  C    . ARG A 1 56  ? 0.237   9.247   19.225  1.00 0.00 ? 413 ARG A C    4  
ATOM   5624  O  O    . ARG A 1 56  ? 0.401   8.159   19.776  1.00 0.00 ? 413 ARG A O    4  
ATOM   5625  C  CB   . ARG A 1 56  ? 2.007   10.813  18.403  1.00 0.00 ? 413 ARG A CB   4  
ATOM   5626  C  CG   . ARG A 1 56  ? 2.971   11.950  18.700  1.00 0.00 ? 413 ARG A CG   4  
ATOM   5627  C  CD   . ARG A 1 56  ? 4.140   11.957  17.726  1.00 0.00 ? 413 ARG A CD   4  
ATOM   5628  N  NE   . ARG A 1 56  ? 3.749   12.443  16.406  1.00 0.00 ? 413 ARG A NE   4  
ATOM   5629  C  CZ   . ARG A 1 56  ? 3.727   13.729  16.073  1.00 0.00 ? 413 ARG A CZ   4  
ATOM   5630  N  NH1  . ARG A 1 56  ? 4.072   14.653  16.960  1.00 0.00 ? 413 ARG A NH1  4  
ATOM   5631  N  NH2  . ARG A 1 56  ? 3.360   14.093  14.851  1.00 0.00 ? 413 ARG A NH2  4  
ATOM   5632  H  H    . ARG A 1 56  ? 2.398   9.314   20.825  1.00 0.00 ? 413 ARG A H    4  
ATOM   5633  H  HA   . ARG A 1 56  ? 0.469   11.286  19.814  1.00 0.00 ? 413 ARG A HA   4  
ATOM   5634  H  HB2  . ARG A 1 56  ? 2.585   9.944   18.122  1.00 0.00 ? 413 ARG A HB2  4  
ATOM   5635  H  HB3  . ARG A 1 56  ? 1.384   11.105  17.571  1.00 0.00 ? 413 ARG A HB3  4  
ATOM   5636  H  HG2  . ARG A 1 56  ? 2.443   12.888  18.617  1.00 0.00 ? 413 ARG A HG2  4  
ATOM   5637  H  HG3  . ARG A 1 56  ? 3.351   11.835  19.704  1.00 0.00 ? 413 ARG A HG3  4  
ATOM   5638  H  HD2  . ARG A 1 56  ? 4.915   12.597  18.120  1.00 0.00 ? 413 ARG A HD2  4  
ATOM   5639  H  HD3  . ARG A 1 56  ? 4.518   10.950  17.632  1.00 0.00 ? 413 ARG A HD3  4  
ATOM   5640  H  HE   . ARG A 1 56  ? 3.491   11.778  15.735  1.00 0.00 ? 413 ARG A HE   4  
ATOM   5641  H  HH11 . ARG A 1 56  ? 4.349   14.381  17.881  1.00 0.00 ? 413 ARG A HH11 4  
ATOM   5642  H  HH12 . ARG A 1 56  ? 4.055   15.620  16.706  1.00 0.00 ? 413 ARG A HH12 4  
ATOM   5643  H  HH21 . ARG A 1 56  ? 3.100   13.400  14.180  1.00 0.00 ? 413 ARG A HH21 4  
ATOM   5644  H  HH22 . ARG A 1 56  ? 3.344   15.061  14.602  1.00 0.00 ? 413 ARG A HH22 4  
ATOM   5645  N  N    . PHE A 1 57  ? -0.690  9.454   18.295  1.00 0.00 ? 414 PHE A N    4  
ATOM   5646  C  CA   . PHE A 1 57  ? -1.588  8.391   17.861  1.00 0.00 ? 414 PHE A CA   4  
ATOM   5647  C  C    . PHE A 1 57  ? -2.001  8.588   16.405  1.00 0.00 ? 414 PHE A C    4  
ATOM   5648  O  O    . PHE A 1 57  ? -1.898  9.688   15.864  1.00 0.00 ? 414 PHE A O    4  
ATOM   5649  C  CB   . PHE A 1 57  ? -2.830  8.347   18.754  1.00 0.00 ? 414 PHE A CB   4  
ATOM   5650  C  CG   . PHE A 1 57  ? -2.517  8.118   20.205  1.00 0.00 ? 414 PHE A CG   4  
ATOM   5651  C  CD1  . PHE A 1 57  ? -2.116  9.169   21.015  1.00 0.00 ? 414 PHE A CD1  4  
ATOM   5652  C  CD2  . PHE A 1 57  ? -2.624  6.853   20.760  1.00 0.00 ? 414 PHE A CD2  4  
ATOM   5653  C  CE1  . PHE A 1 57  ? -1.826  8.961   22.350  1.00 0.00 ? 414 PHE A CE1  4  
ATOM   5654  C  CE2  . PHE A 1 57  ? -2.337  6.640   22.095  1.00 0.00 ? 414 PHE A CE2  4  
ATOM   5655  C  CZ   . PHE A 1 57  ? -1.938  7.695   22.891  1.00 0.00 ? 414 PHE A CZ   4  
ATOM   5656  H  H    . PHE A 1 57  ? -0.772  10.344  17.892  1.00 0.00 ? 414 PHE A H    4  
ATOM   5657  H  HA   . PHE A 1 57  ? -1.059  7.455   17.949  1.00 0.00 ? 414 PHE A HA   4  
ATOM   5658  H  HB2  . PHE A 1 57  ? -3.356  9.286   18.673  1.00 0.00 ? 414 PHE A HB2  4  
ATOM   5659  H  HB3  . PHE A 1 57  ? -3.474  7.547   18.422  1.00 0.00 ? 414 PHE A HB3  4  
ATOM   5660  H  HD1  . PHE A 1 57  ? -2.029  10.160  20.593  1.00 0.00 ? 414 PHE A HD1  4  
ATOM   5661  H  HD2  . PHE A 1 57  ? -2.936  6.026   20.137  1.00 0.00 ? 414 PHE A HD2  4  
ATOM   5662  H  HE1  . PHE A 1 57  ? -1.515  9.788   22.971  1.00 0.00 ? 414 PHE A HE1  4  
ATOM   5663  H  HE2  . PHE A 1 57  ? -2.425  5.648   22.514  1.00 0.00 ? 414 PHE A HE2  4  
ATOM   5664  H  HZ   . PHE A 1 57  ? -1.712  7.530   23.934  1.00 0.00 ? 414 PHE A HZ   4  
ATOM   5665  N  N    . ALA A 1 58  ? -2.468  7.513   15.779  1.00 0.00 ? 415 ALA A N    4  
ATOM   5666  C  CA   . ALA A 1 58  ? -2.898  7.568   14.387  1.00 0.00 ? 415 ALA A CA   4  
ATOM   5667  C  C    . ALA A 1 58  ? -4.369  7.957   14.282  1.00 0.00 ? 415 ALA A C    4  
ATOM   5668  O  O    . ALA A 1 58  ? -4.743  8.791   13.457  1.00 0.00 ? 415 ALA A O    4  
ATOM   5669  C  CB   . ALA A 1 58  ? -2.655  6.229   13.706  1.00 0.00 ? 415 ALA A CB   4  
ATOM   5670  H  H    . ALA A 1 58  ? -2.527  6.664   16.264  1.00 0.00 ? 415 ALA A H    4  
ATOM   5671  H  HA   . ALA A 1 58  ? -2.302  8.314   13.882  1.00 0.00 ? 415 ALA A HA   4  
ATOM   5672  H  HB1  . ALA A 1 58  ? -2.188  6.393   12.747  1.00 0.00 ? 415 ALA A HB1  4  
ATOM   5673  H  HB2  . ALA A 1 58  ? -2.005  5.625   14.324  1.00 0.00 ? 415 ALA A HB2  4  
ATOM   5674  H  HB3  . ALA A 1 58  ? -3.596  5.719   13.568  1.00 0.00 ? 415 ALA A HB3  4  
ATOM   5675  N  N    . ARG A 1 59  ? -5.200  7.346   15.120  1.00 0.00 ? 416 ARG A N    4  
ATOM   5676  C  CA   . ARG A 1 59  ? -6.630  7.627   15.120  1.00 0.00 ? 416 ARG A CA   4  
ATOM   5677  C  C    . ARG A 1 59  ? -6.959  8.774   16.071  1.00 0.00 ? 416 ARG A C    4  
ATOM   5678  O  O    . ARG A 1 59  ? -6.373  8.889   17.147  1.00 0.00 ? 416 ARG A O    4  
ATOM   5679  C  CB   . ARG A 1 59  ? -7.417  6.378   15.519  1.00 0.00 ? 416 ARG A CB   4  
ATOM   5680  C  CG   . ARG A 1 59  ? -7.360  5.266   14.485  1.00 0.00 ? 416 ARG A CG   4  
ATOM   5681  C  CD   . ARG A 1 59  ? -8.276  5.554   13.306  1.00 0.00 ? 416 ARG A CD   4  
ATOM   5682  N  NE   . ARG A 1 59  ? -8.101  4.585   12.227  1.00 0.00 ? 416 ARG A NE   4  
ATOM   5683  C  CZ   . ARG A 1 59  ? -8.690  3.395   12.204  1.00 0.00 ? 416 ARG A CZ   4  
ATOM   5684  N  NH1  . ARG A 1 59  ? -9.489  3.028   13.197  1.00 0.00 ? 416 ARG A NH1  4  
ATOM   5685  N  NH2  . ARG A 1 59  ? -8.481  2.569   11.187  1.00 0.00 ? 416 ARG A NH2  4  
ATOM   5686  H  H    . ARG A 1 59  ? -4.842  6.690   15.754  1.00 0.00 ? 416 ARG A H    4  
ATOM   5687  H  HA   . ARG A 1 59  ? -6.911  7.914   14.118  1.00 0.00 ? 416 ARG A HA   4  
ATOM   5688  H  HB2  . ARG A 1 59  ? -7.019  5.997   16.448  1.00 0.00 ? 416 ARG A HB2  4  
ATOM   5689  H  HB3  . ARG A 1 59  ? -8.452  6.651   15.666  1.00 0.00 ? 416 ARG A HB3  4  
ATOM   5690  H  HG2  . ARG A 1 59  ? -6.346  5.173   14.124  1.00 0.00 ? 416 ARG A HG2  4  
ATOM   5691  H  HG3  . ARG A 1 59  ? -7.665  4.340   14.949  1.00 0.00 ? 416 ARG A HG3  4  
ATOM   5692  H  HD2  . ARG A 1 59  ? -9.301  5.518   13.646  1.00 0.00 ? 416 ARG A HD2  4  
ATOM   5693  H  HD3  . ARG A 1 59  ? -8.057  6.542   12.930  1.00 0.00 ? 416 ARG A HD3  4  
ATOM   5694  H  HE   . ARG A 1 59  ? -7.515  4.836   11.483  1.00 0.00 ? 416 ARG A HE   4  
ATOM   5695  H  HH11 . ARG A 1 59  ? -9.649  3.649   13.964  1.00 0.00 ? 416 ARG A HH11 4  
ATOM   5696  H  HH12 . ARG A 1 59  ? -9.932  2.132   13.177  1.00 0.00 ? 416 ARG A HH12 4  
ATOM   5697  H  HH21 . ARG A 1 59  ? -7.879  2.842   10.437  1.00 0.00 ? 416 ARG A HH21 4  
ATOM   5698  H  HH22 . ARG A 1 59  ? -8.925  1.673   11.172  1.00 0.00 ? 416 ARG A HH22 4  
ATOM   5699  N  N    . SER A 1 60  ? -7.900  9.621   15.665  1.00 0.00 ? 417 SER A N    4  
ATOM   5700  C  CA   . SER A 1 60  ? -8.303  10.762  16.479  1.00 0.00 ? 417 SER A CA   4  
ATOM   5701  C  C    . SER A 1 60  ? -8.962  10.299  17.775  1.00 0.00 ? 417 SER A C    4  
ATOM   5702  O  O    . SER A 1 60  ? -9.056  11.056  18.741  1.00 0.00 ? 417 SER A O    4  
ATOM   5703  C  CB   . SER A 1 60  ? -9.266  11.658  15.697  1.00 0.00 ? 417 SER A CB   4  
ATOM   5704  O  OG   . SER A 1 60  ? -10.204 10.885  14.968  1.00 0.00 ? 417 SER A OG   4  
ATOM   5705  H  H    . SER A 1 60  ? -8.330  9.477   14.797  1.00 0.00 ? 417 SER A H    4  
ATOM   5706  H  HA   . SER A 1 60  ? -7.416  11.327  16.721  1.00 0.00 ? 417 SER A HA   4  
ATOM   5707  H  HB2  . SER A 1 60  ? -9.800  12.295  16.385  1.00 0.00 ? 417 SER A HB2  4  
ATOM   5708  H  HB3  . SER A 1 60  ? -8.703  12.268  15.004  1.00 0.00 ? 417 SER A HB3  4  
ATOM   5709  H  HG   . SER A 1 60  ? -10.241 9.998   15.333  1.00 0.00 ? 417 SER A HG   4  
ATOM   5710  N  N    . ASP A 1 61  ? -9.415  9.050   17.787  1.00 0.00 ? 418 ASP A N    4  
ATOM   5711  C  CA   . ASP A 1 61  ? -10.064 8.484   18.964  1.00 0.00 ? 418 ASP A CA   4  
ATOM   5712  C  C    . ASP A 1 61  ? -9.029  7.990   19.970  1.00 0.00 ? 418 ASP A C    4  
ATOM   5713  O  O    . ASP A 1 61  ? -9.190  8.166   21.177  1.00 0.00 ? 418 ASP A O    4  
ATOM   5714  C  CB   . ASP A 1 61  ? -10.989 7.336   18.560  1.00 0.00 ? 418 ASP A CB   4  
ATOM   5715  C  CG   . ASP A 1 61  ? -11.516 6.568   19.756  1.00 0.00 ? 418 ASP A CG   4  
ATOM   5716  O  OD1  . ASP A 1 61  ? -12.186 7.186   20.610  1.00 0.00 ? 418 ASP A OD1  4  
ATOM   5717  O  OD2  . ASP A 1 61  ? -11.257 5.348   19.840  1.00 0.00 ? 418 ASP A OD2  4  
ATOM   5718  H  H    . ASP A 1 61  ? -9.311  8.496   16.986  1.00 0.00 ? 418 ASP A H    4  
ATOM   5719  H  HA   . ASP A 1 61  ? -10.652 9.263   19.425  1.00 0.00 ? 418 ASP A HA   4  
ATOM   5720  H  HB2  . ASP A 1 61  ? -11.831 7.736   18.014  1.00 0.00 ? 418 ASP A HB2  4  
ATOM   5721  H  HB3  . ASP A 1 61  ? -10.446 6.651   17.925  1.00 0.00 ? 418 ASP A HB3  4  
ATOM   5722  N  N    . GLU A 1 62  ? -7.968  7.370   19.464  1.00 0.00 ? 419 GLU A N    4  
ATOM   5723  C  CA   . GLU A 1 62  ? -6.908  6.849   20.319  1.00 0.00 ? 419 GLU A CA   4  
ATOM   5724  C  C    . GLU A 1 62  ? -6.342  7.947   21.215  1.00 0.00 ? 419 GLU A C    4  
ATOM   5725  O  O    . GLU A 1 62  ? -6.005  7.706   22.375  1.00 0.00 ? 419 GLU A O    4  
ATOM   5726  C  CB   . GLU A 1 62  ? -5.789  6.242   19.470  1.00 0.00 ? 419 GLU A CB   4  
ATOM   5727  C  CG   . GLU A 1 62  ? -6.243  5.074   18.611  1.00 0.00 ? 419 GLU A CG   4  
ATOM   5728  C  CD   . GLU A 1 62  ? -6.114  3.741   19.323  1.00 0.00 ? 419 GLU A CD   4  
ATOM   5729  O  OE1  . GLU A 1 62  ? -6.574  3.638   20.479  1.00 0.00 ? 419 GLU A OE1  4  
ATOM   5730  O  OE2  . GLU A 1 62  ? -5.552  2.801   18.722  1.00 0.00 ? 419 GLU A OE2  4  
ATOM   5731  H  H    . GLU A 1 62  ? -7.896  7.261   18.493  1.00 0.00 ? 419 GLU A H    4  
ATOM   5732  H  HA   . GLU A 1 62  ? -7.334  6.077   20.942  1.00 0.00 ? 419 GLU A HA   4  
ATOM   5733  H  HB2  . GLU A 1 62  ? -5.391  7.007   18.821  1.00 0.00 ? 419 GLU A HB2  4  
ATOM   5734  H  HB3  . GLU A 1 62  ? -5.005  5.895   20.126  1.00 0.00 ? 419 GLU A HB3  4  
ATOM   5735  H  HG2  . GLU A 1 62  ? -7.278  5.222   18.343  1.00 0.00 ? 419 GLU A HG2  4  
ATOM   5736  H  HG3  . GLU A 1 62  ? -5.641  5.047   17.715  1.00 0.00 ? 419 GLU A HG3  4  
ATOM   5737  N  N    . LEU A 1 63  ? -6.241  9.154   20.669  1.00 0.00 ? 420 LEU A N    4  
ATOM   5738  C  CA   . LEU A 1 63  ? -5.715  10.291  21.417  1.00 0.00 ? 420 LEU A CA   4  
ATOM   5739  C  C    . LEU A 1 63  ? -6.739  10.798  22.428  1.00 0.00 ? 420 LEU A C    4  
ATOM   5740  O  O    . LEU A 1 63  ? -6.415  11.037  23.591  1.00 0.00 ? 420 LEU A O    4  
ATOM   5741  C  CB   . LEU A 1 63  ? -5.324  11.419  20.461  1.00 0.00 ? 420 LEU A CB   4  
ATOM   5742  C  CG   . LEU A 1 63  ? -5.068  12.784  21.102  1.00 0.00 ? 420 LEU A CG   4  
ATOM   5743  C  CD1  . LEU A 1 63  ? -3.884  12.713  22.053  1.00 0.00 ? 420 LEU A CD1  4  
ATOM   5744  C  CD2  . LEU A 1 63  ? -4.834  13.840  20.032  1.00 0.00 ? 420 LEU A CD2  4  
ATOM   5745  H  H    . LEU A 1 63  ? -6.526  9.285   19.741  1.00 0.00 ? 420 LEU A H    4  
ATOM   5746  H  HA   . LEU A 1 63  ? -4.836  9.959   21.949  1.00 0.00 ? 420 LEU A HA   4  
ATOM   5747  H  HB2  . LEU A 1 63  ? -4.422  11.120  19.949  1.00 0.00 ? 420 LEU A HB2  4  
ATOM   5748  H  HB3  . LEU A 1 63  ? -6.123  11.534  19.742  1.00 0.00 ? 420 LEU A HB3  4  
ATOM   5749  H  HG   . LEU A 1 63  ? -5.939  13.074  21.675  1.00 0.00 ? 420 LEU A HG   4  
ATOM   5750  H  HD11 . LEU A 1 63  ? -4.002  11.868  22.714  1.00 0.00 ? 420 LEU A HD11 4  
ATOM   5751  H  HD12 . LEU A 1 63  ? -3.835  13.622  22.636  1.00 0.00 ? 420 LEU A HD12 4  
ATOM   5752  H  HD13 . LEU A 1 63  ? -2.972  12.602  21.485  1.00 0.00 ? 420 LEU A HD13 4  
ATOM   5753  H  HD21 . LEU A 1 63  ? -3.890  13.653  19.543  1.00 0.00 ? 420 LEU A HD21 4  
ATOM   5754  H  HD22 . LEU A 1 63  ? -4.814  14.818  20.490  1.00 0.00 ? 420 LEU A HD22 4  
ATOM   5755  H  HD23 . LEU A 1 63  ? -5.632  13.799  19.305  1.00 0.00 ? 420 LEU A HD23 4  
ATOM   5756  N  N    . THR A 1 64  ? -7.980  10.957  21.976  1.00 0.00 ? 421 THR A N    4  
ATOM   5757  C  CA   . THR A 1 64  ? -9.052  11.434  22.841  1.00 0.00 ? 421 THR A CA   4  
ATOM   5758  C  C    . THR A 1 64  ? -9.234  10.520  24.046  1.00 0.00 ? 421 THR A C    4  
ATOM   5759  O  O    . THR A 1 64  ? -9.447  10.987  25.166  1.00 0.00 ? 421 THR A O    4  
ATOM   5760  C  CB   . THR A 1 64  ? -10.387 11.532  22.078  1.00 0.00 ? 421 THR A CB   4  
ATOM   5761  O  OG1  . THR A 1 64  ? -10.217 12.314  20.891  1.00 0.00 ? 421 THR A OG1  4  
ATOM   5762  C  CG2  . THR A 1 64  ? -11.465 12.155  22.952  1.00 0.00 ? 421 THR A CG2  4  
ATOM   5763  H  H    . THR A 1 64  ? -8.177  10.750  21.039  1.00 0.00 ? 421 THR A H    4  
ATOM   5764  H  HA   . THR A 1 64  ? -8.787  12.422  23.187  1.00 0.00 ? 421 THR A HA   4  
ATOM   5765  H  HB   . THR A 1 64  ? -10.700 10.535  21.802  1.00 0.00 ? 421 THR A HB   4  
ATOM   5766  H  HG1  . THR A 1 64  ? -9.562  11.897  20.324  1.00 0.00 ? 421 THR A HG1  4  
ATOM   5767  H  HG21 . THR A 1 64  ? -11.139 13.129  23.284  1.00 0.00 ? 421 THR A HG21 4  
ATOM   5768  H  HG22 . THR A 1 64  ? -11.643 11.523  23.809  1.00 0.00 ? 421 THR A HG22 4  
ATOM   5769  H  HG23 . THR A 1 64  ? -12.377 12.255  22.382  1.00 0.00 ? 421 THR A HG23 4  
ATOM   5770  N  N    . ARG A 1 65  ? -9.150  9.214   23.812  1.00 0.00 ? 422 ARG A N    4  
ATOM   5771  C  CA   . ARG A 1 65  ? -9.306  8.234   24.879  1.00 0.00 ? 422 ARG A CA   4  
ATOM   5772  C  C    . ARG A 1 65  ? -8.128  8.292   25.848  1.00 0.00 ? 422 ARG A C    4  
ATOM   5773  O  O    . ARG A 1 65  ? -8.290  8.093   27.052  1.00 0.00 ? 422 ARG A O    4  
ATOM   5774  C  CB   . ARG A 1 65  ? -9.429  6.826   24.294  1.00 0.00 ? 422 ARG A CB   4  
ATOM   5775  C  CG   . ARG A 1 65  ? -9.914  5.790   25.295  1.00 0.00 ? 422 ARG A CG   4  
ATOM   5776  C  CD   . ARG A 1 65  ? -11.415 5.890   25.518  1.00 0.00 ? 422 ARG A CD   4  
ATOM   5777  N  NE   . ARG A 1 65  ? -12.164 5.072   24.568  1.00 0.00 ? 422 ARG A NE   4  
ATOM   5778  C  CZ   . ARG A 1 65  ? -13.457 4.796   24.695  1.00 0.00 ? 422 ARG A CZ   4  
ATOM   5779  N  NH1  . ARG A 1 65  ? -14.141 5.270   25.728  1.00 0.00 ? 422 ARG A NH1  4  
ATOM   5780  N  NH2  . ARG A 1 65  ? -14.069 4.044   23.789  1.00 0.00 ? 422 ARG A NH2  4  
ATOM   5781  H  H    . ARG A 1 65  ? -8.979  8.903   22.898  1.00 0.00 ? 422 ARG A H    4  
ATOM   5782  H  HA   . ARG A 1 65  ? -10.211 8.471   25.418  1.00 0.00 ? 422 ARG A HA   4  
ATOM   5783  H  HB2  . ARG A 1 65  ? -10.127 6.851   23.470  1.00 0.00 ? 422 ARG A HB2  4  
ATOM   5784  H  HB3  . ARG A 1 65  ? -8.463  6.516   23.927  1.00 0.00 ? 422 ARG A HB3  4  
ATOM   5785  H  HG2  . ARG A 1 65  ? -9.681  4.804   24.921  1.00 0.00 ? 422 ARG A HG2  4  
ATOM   5786  H  HG3  . ARG A 1 65  ? -9.408  5.949   26.236  1.00 0.00 ? 422 ARG A HG3  4  
ATOM   5787  H  HD2  . ARG A 1 65  ? -11.640 5.557   26.520  1.00 0.00 ? 422 ARG A HD2  4  
ATOM   5788  H  HD3  . ARG A 1 65  ? -11.714 6.921   25.405  1.00 0.00 ? 422 ARG A HD3  4  
ATOM   5789  H  HE   . ARG A 1 65  ? -11.678 4.711   23.797  1.00 0.00 ? 422 ARG A HE   4  
ATOM   5790  H  HH11 . ARG A 1 65  ? -13.683 5.837   26.411  1.00 0.00 ? 422 ARG A HH11 4  
ATOM   5791  H  HH12 . ARG A 1 65  ? -15.115 5.061   25.821  1.00 0.00 ? 422 ARG A HH12 4  
ATOM   5792  H  HH21 . ARG A 1 65  ? -13.557 3.685   23.009  1.00 0.00 ? 422 ARG A HH21 4  
ATOM   5793  H  HH22 . ARG A 1 65  ? -15.042 3.837   23.886  1.00 0.00 ? 422 ARG A HH22 4  
ATOM   5794  N  N    . HIS A 1 66  ? -6.942  8.566   25.313  1.00 0.00 ? 423 HIS A N    4  
ATOM   5795  C  CA   . HIS A 1 66  ? -5.737  8.651   26.130  1.00 0.00 ? 423 HIS A CA   4  
ATOM   5796  C  C    . HIS A 1 66  ? -5.756  9.905   26.999  1.00 0.00 ? 423 HIS A C    4  
ATOM   5797  O  O    . HIS A 1 66  ? -5.636  9.826   28.222  1.00 0.00 ? 423 HIS A O    4  
ATOM   5798  C  CB   . HIS A 1 66  ? -4.492  8.652   25.241  1.00 0.00 ? 423 HIS A CB   4  
ATOM   5799  C  CG   . HIS A 1 66  ? -3.289  9.259   25.896  1.00 0.00 ? 423 HIS A CG   4  
ATOM   5800  N  ND1  . HIS A 1 66  ? -2.588  8.636   26.906  1.00 0.00 ? 423 HIS A ND1  4  
ATOM   5801  C  CD2  . HIS A 1 66  ? -2.664  10.439  25.678  1.00 0.00 ? 423 HIS A CD2  4  
ATOM   5802  C  CE1  . HIS A 1 66  ? -1.584  9.407   27.282  1.00 0.00 ? 423 HIS A CE1  4  
ATOM   5803  N  NE2  . HIS A 1 66  ? -1.607  10.507  26.552  1.00 0.00 ? 423 HIS A NE2  4  
ATOM   5804  H  H    . HIS A 1 66  ? -6.877  8.715   24.347  1.00 0.00 ? 423 HIS A H    4  
ATOM   5805  H  HA   . HIS A 1 66  ? -5.709  7.784   26.772  1.00 0.00 ? 423 HIS A HA   4  
ATOM   5806  H  HB2  . HIS A 1 66  ? -4.247  7.634   24.976  1.00 0.00 ? 423 HIS A HB2  4  
ATOM   5807  H  HB3  . HIS A 1 66  ? -4.700  9.214   24.342  1.00 0.00 ? 423 HIS A HB3  4  
ATOM   5808  H  HD1  . HIS A 1 66  ? -2.796  7.759   27.291  1.00 0.00 ? 423 HIS A HD1  4  
ATOM   5809  H  HD2  . HIS A 1 66  ? -2.943  11.189  24.951  1.00 0.00 ? 423 HIS A HD2  4  
ATOM   5810  H  HE1  . HIS A 1 66  ? -0.865  9.178   28.055  1.00 0.00 ? 423 HIS A HE1  4  
ATOM   5811  N  N    . TYR A 1 67  ? -5.908  11.059  26.360  1.00 0.00 ? 424 TYR A N    4  
ATOM   5812  C  CA   . TYR A 1 67  ? -5.940  12.330  27.075  1.00 0.00 ? 424 TYR A CA   4  
ATOM   5813  C  C    . TYR A 1 67  ? -6.747  12.209  28.365  1.00 0.00 ? 424 TYR A C    4  
ATOM   5814  O  O    . TYR A 1 67  ? -6.285  12.599  29.437  1.00 0.00 ? 424 TYR A O    4  
ATOM   5815  C  CB   . TYR A 1 67  ? -6.537  13.423  26.188  1.00 0.00 ? 424 TYR A CB   4  
ATOM   5816  C  CG   . TYR A 1 67  ? -6.143  14.823  26.603  1.00 0.00 ? 424 TYR A CG   4  
ATOM   5817  C  CD1  . TYR A 1 67  ? -4.845  15.283  26.422  1.00 0.00 ? 424 TYR A CD1  4  
ATOM   5818  C  CD2  . TYR A 1 67  ? -7.070  15.685  27.176  1.00 0.00 ? 424 TYR A CD2  4  
ATOM   5819  C  CE1  . TYR A 1 67  ? -4.481  16.560  26.801  1.00 0.00 ? 424 TYR A CE1  4  
ATOM   5820  C  CE2  . TYR A 1 67  ? -6.715  16.965  27.557  1.00 0.00 ? 424 TYR A CE2  4  
ATOM   5821  C  CZ   . TYR A 1 67  ? -5.419  17.398  27.368  1.00 0.00 ? 424 TYR A CZ   4  
ATOM   5822  O  OH   . TYR A 1 67  ? -5.061  18.671  27.745  1.00 0.00 ? 424 TYR A OH   4  
ATOM   5823  H  H    . TYR A 1 67  ? -5.999  11.058  25.385  1.00 0.00 ? 424 TYR A H    4  
ATOM   5824  H  HA   . TYR A 1 67  ? -4.923  12.597  27.323  1.00 0.00 ? 424 TYR A HA   4  
ATOM   5825  H  HB2  . TYR A 1 67  ? -6.206  13.274  25.172  1.00 0.00 ? 424 TYR A HB2  4  
ATOM   5826  H  HB3  . TYR A 1 67  ? -7.615  13.357  26.223  1.00 0.00 ? 424 TYR A HB3  4  
ATOM   5827  H  HD1  . TYR A 1 67  ? -4.113  14.625  25.978  1.00 0.00 ? 424 TYR A HD1  4  
ATOM   5828  H  HD2  . TYR A 1 67  ? -8.085  15.343  27.323  1.00 0.00 ? 424 TYR A HD2  4  
ATOM   5829  H  HE1  . TYR A 1 67  ? -3.466  16.900  26.653  1.00 0.00 ? 424 TYR A HE1  4  
ATOM   5830  H  HE2  . TYR A 1 67  ? -7.450  17.621  28.000  1.00 0.00 ? 424 TYR A HE2  4  
ATOM   5831  H  HH   . TYR A 1 67  ? -4.172  18.659  28.109  1.00 0.00 ? 424 TYR A HH   4  
ATOM   5832  N  N    . ARG A 1 68  ? -7.954  11.666  28.251  1.00 0.00 ? 425 ARG A N    4  
ATOM   5833  C  CA   . ARG A 1 68  ? -8.826  11.494  29.407  1.00 0.00 ? 425 ARG A CA   4  
ATOM   5834  C  C    . ARG A 1 68  ? -8.022  11.092  30.640  1.00 0.00 ? 425 ARG A C    4  
ATOM   5835  O  O    . ARG A 1 68  ? -8.102  11.738  31.685  1.00 0.00 ? 425 ARG A O    4  
ATOM   5836  C  CB   . ARG A 1 68  ? -9.893  10.437  29.115  1.00 0.00 ? 425 ARG A CB   4  
ATOM   5837  C  CG   . ARG A 1 68  ? -10.940 10.890  28.110  1.00 0.00 ? 425 ARG A CG   4  
ATOM   5838  C  CD   . ARG A 1 68  ? -12.227 10.093  28.249  1.00 0.00 ? 425 ARG A CD   4  
ATOM   5839  N  NE   . ARG A 1 68  ? -13.053 10.574  29.353  1.00 0.00 ? 425 ARG A NE   4  
ATOM   5840  C  CZ   . ARG A 1 68  ? -13.972 9.832   29.961  1.00 0.00 ? 425 ARG A CZ   4  
ATOM   5841  N  NH1  . ARG A 1 68  ? -14.181 8.581   29.574  1.00 0.00 ? 425 ARG A NH1  4  
ATOM   5842  N  NH2  . ARG A 1 68  ? -14.684 10.341  30.959  1.00 0.00 ? 425 ARG A NH2  4  
ATOM   5843  H  H    . ARG A 1 68  ? -8.267  11.375  27.369  1.00 0.00 ? 425 ARG A H    4  
ATOM   5844  H  HA   . ARG A 1 68  ? -9.311  12.438  29.600  1.00 0.00 ? 425 ARG A HA   4  
ATOM   5845  H  HB2  . ARG A 1 68  ? -9.410  9.553   28.724  1.00 0.00 ? 425 ARG A HB2  4  
ATOM   5846  H  HB3  . ARG A 1 68  ? -10.395 10.185  30.036  1.00 0.00 ? 425 ARG A HB3  4  
ATOM   5847  H  HG2  . ARG A 1 68  ? -11.157 11.935  28.278  1.00 0.00 ? 425 ARG A HG2  4  
ATOM   5848  H  HG3  . ARG A 1 68  ? -10.550 10.757  27.113  1.00 0.00 ? 425 ARG A HG3  4  
ATOM   5849  H  HD2  . ARG A 1 68  ? -12.788 10.176  27.330  1.00 0.00 ? 425 ARG A HD2  4  
ATOM   5850  H  HD3  . ARG A 1 68  ? -11.976 9.057   28.424  1.00 0.00 ? 425 ARG A HD3  4  
ATOM   5851  H  HE   . ARG A 1 68  ? -12.915 11.495  29.655  1.00 0.00 ? 425 ARG A HE   4  
ATOM   5852  H  HH11 . ARG A 1 68  ? -13.646 8.195   28.823  1.00 0.00 ? 425 ARG A HH11 4  
ATOM   5853  H  HH12 . ARG A 1 68  ? -14.873 8.024   30.034  1.00 0.00 ? 425 ARG A HH12 4  
ATOM   5854  H  HH21 . ARG A 1 68  ? -14.529 11.283  31.253  1.00 0.00 ? 425 ARG A HH21 4  
ATOM   5855  H  HH22 . ARG A 1 68  ? -15.375 9.782   31.415  1.00 0.00 ? 425 ARG A HH22 4  
ATOM   5856  N  N    . LYS A 1 69  ? -7.246  10.021  30.511  1.00 0.00 ? 426 LYS A N    4  
ATOM   5857  C  CA   . LYS A 1 69  ? -6.426  9.532   31.613  1.00 0.00 ? 426 LYS A CA   4  
ATOM   5858  C  C    . LYS A 1 69  ? -5.797  10.692  32.379  1.00 0.00 ? 426 LYS A C    4  
ATOM   5859  O  O    . LYS A 1 69  ? -5.858  10.742  33.608  1.00 0.00 ? 426 LYS A O    4  
ATOM   5860  C  CB   . LYS A 1 69  ? -5.331  8.601   31.087  1.00 0.00 ? 426 LYS A CB   4  
ATOM   5861  C  CG   . LYS A 1 69  ? -5.798  7.172   30.872  1.00 0.00 ? 426 LYS A CG   4  
ATOM   5862  C  CD   . LYS A 1 69  ? -6.336  6.967   29.466  1.00 0.00 ? 426 LYS A CD   4  
ATOM   5863  C  CE   . LYS A 1 69  ? -6.535  5.491   29.155  1.00 0.00 ? 426 LYS A CE   4  
ATOM   5864  N  NZ   . LYS A 1 69  ? -7.895  5.022   29.540  1.00 0.00 ? 426 LYS A NZ   4  
ATOM   5865  H  H    . LYS A 1 69  ? -7.224  9.548   29.652  1.00 0.00 ? 426 LYS A H    4  
ATOM   5866  H  HA   . LYS A 1 69  ? -7.066  8.978   32.283  1.00 0.00 ? 426 LYS A HA   4  
ATOM   5867  H  HB2  . LYS A 1 69  ? -4.970  8.986   30.144  1.00 0.00 ? 426 LYS A HB2  4  
ATOM   5868  H  HB3  . LYS A 1 69  ? -4.515  8.588   31.796  1.00 0.00 ? 426 LYS A HB3  4  
ATOM   5869  H  HG2  . LYS A 1 69  ? -4.965  6.503   31.029  1.00 0.00 ? 426 LYS A HG2  4  
ATOM   5870  H  HG3  . LYS A 1 69  ? -6.581  6.949   31.583  1.00 0.00 ? 426 LYS A HG3  4  
ATOM   5871  H  HD2  . LYS A 1 69  ? -7.285  7.474   29.375  1.00 0.00 ? 426 LYS A HD2  4  
ATOM   5872  H  HD3  . LYS A 1 69  ? -5.634  7.384   28.757  1.00 0.00 ? 426 LYS A HD3  4  
ATOM   5873  H  HE2  . LYS A 1 69  ? -6.397  5.338   28.096  1.00 0.00 ? 426 LYS A HE2  4  
ATOM   5874  H  HE3  . LYS A 1 69  ? -5.799  4.920   29.701  1.00 0.00 ? 426 LYS A HE3  4  
ATOM   5875  H  HZ1  . LYS A 1 69  ? -8.485  5.830   29.823  1.00 0.00 ? 426 LYS A HZ1  4  
ATOM   5876  H  HZ2  . LYS A 1 69  ? -7.831  4.357   30.337  1.00 0.00 ? 426 LYS A HZ2  4  
ATOM   5877  H  HZ3  . LYS A 1 69  ? -8.347  4.540   28.737  1.00 0.00 ? 426 LYS A HZ3  4  
ATOM   5878  N  N    . HIS A 1 70  ? -5.195  11.623  31.646  1.00 0.00 ? 427 HIS A N    4  
ATOM   5879  C  CA   . HIS A 1 70  ? -4.558  12.783  32.257  1.00 0.00 ? 427 HIS A CA   4  
ATOM   5880  C  C    . HIS A 1 70  ? -5.533  13.523  33.168  1.00 0.00 ? 427 HIS A C    4  
ATOM   5881  O  O    . HIS A 1 70  ? -5.211  13.843  34.312  1.00 0.00 ? 427 HIS A O    4  
ATOM   5882  C  CB   . HIS A 1 70  ? -4.031  13.730  31.178  1.00 0.00 ? 427 HIS A CB   4  
ATOM   5883  C  CG   . HIS A 1 70  ? -2.832  13.204  30.453  1.00 0.00 ? 427 HIS A CG   4  
ATOM   5884  N  ND1  . HIS A 1 70  ? -1.726  12.692  31.098  1.00 0.00 ? 427 HIS A ND1  4  
ATOM   5885  C  CD2  . HIS A 1 70  ? -2.569  13.110  29.128  1.00 0.00 ? 427 HIS A CD2  4  
ATOM   5886  C  CE1  . HIS A 1 70  ? -0.834  12.308  30.203  1.00 0.00 ? 427 HIS A CE1  4  
ATOM   5887  N  NE2  . HIS A 1 70  ? -1.321  12.550  28.999  1.00 0.00 ? 427 HIS A NE2  4  
ATOM   5888  H  H    . HIS A 1 70  ? -5.180  11.527  30.671  1.00 0.00 ? 427 HIS A H    4  
ATOM   5889  H  HA   . HIS A 1 70  ? -3.727  12.431  32.851  1.00 0.00 ? 427 HIS A HA   4  
ATOM   5890  H  HB2  . HIS A 1 70  ? -4.810  13.903  30.450  1.00 0.00 ? 427 HIS A HB2  4  
ATOM   5891  H  HB3  . HIS A 1 70  ? -3.758  14.670  31.635  1.00 0.00 ? 427 HIS A HB3  4  
ATOM   5892  H  HD1  . HIS A 1 70  ? -1.611  12.623  32.069  1.00 0.00 ? 427 HIS A HD1  4  
ATOM   5893  H  HD2  . HIS A 1 70  ? -3.219  13.418  28.321  1.00 0.00 ? 427 HIS A HD2  4  
ATOM   5894  H  HE1  . HIS A 1 70  ? 0.129   11.870  30.417  1.00 0.00 ? 427 HIS A HE1  4  
ATOM   5895  N  N    . THR A 1 71  ? -6.729  13.792  32.652  1.00 0.00 ? 428 THR A N    4  
ATOM   5896  C  CA   . THR A 1 71  ? -7.751  14.495  33.417  1.00 0.00 ? 428 THR A CA   4  
ATOM   5897  C  C    . THR A 1 71  ? -8.357  13.592  34.485  1.00 0.00 ? 428 THR A C    4  
ATOM   5898  O  O    . THR A 1 71  ? -8.930  14.069  35.463  1.00 0.00 ? 428 THR A O    4  
ATOM   5899  C  CB   . THR A 1 71  ? -8.876  15.018  32.504  1.00 0.00 ? 428 THR A CB   4  
ATOM   5900  O  OG1  . THR A 1 71  ? -9.463  13.931  31.779  1.00 0.00 ? 428 THR A OG1  4  
ATOM   5901  C  CG2  . THR A 1 71  ? -8.343  16.056  31.528  1.00 0.00 ? 428 THR A CG2  4  
ATOM   5902  H  H    . THR A 1 71  ? -6.926  13.511  31.734  1.00 0.00 ? 428 THR A H    4  
ATOM   5903  H  HA   . THR A 1 71  ? -7.283  15.342  33.898  1.00 0.00 ? 428 THR A HA   4  
ATOM   5904  H  HB   . THR A 1 71  ? -9.633  15.480  33.120  1.00 0.00 ? 428 THR A HB   4  
ATOM   5905  H  HG1  . THR A 1 71  ? -9.752  13.254  32.396  1.00 0.00 ? 428 THR A HG1  4  
ATOM   5906  H  HG21 . THR A 1 71  ? -8.087  16.956  32.065  1.00 0.00 ? 428 THR A HG21 4  
ATOM   5907  H  HG22 . THR A 1 71  ? -9.099  16.279  30.791  1.00 0.00 ? 428 THR A HG22 4  
ATOM   5908  H  HG23 . THR A 1 71  ? -7.463  15.668  31.035  1.00 0.00 ? 428 THR A HG23 4  
ATOM   5909  N  N    . GLY A 1 72  ? -8.225  12.283  34.291  1.00 0.00 ? 429 GLY A N    4  
ATOM   5910  C  CA   . GLY A 1 72  ? -8.765  11.333  35.247  1.00 0.00 ? 429 GLY A CA   4  
ATOM   5911  C  C    . GLY A 1 72  ? -10.279 11.276  35.215  1.00 0.00 ? 429 GLY A C    4  
ATOM   5912  O  O    . GLY A 1 72  ? -10.903 11.698  34.242  1.00 0.00 ? 429 GLY A O    4  
ATOM   5913  H  H    . GLY A 1 72  ? -7.758  11.959  33.492  1.00 0.00 ? 429 GLY A H    4  
ATOM   5914  H  HA2  . GLY A 1 72  ? -8.373  10.352  35.023  1.00 0.00 ? 429 GLY A HA2  4  
ATOM   5915  H  HA3  . GLY A 1 72  ? -8.447  11.619  36.239  1.00 0.00 ? 429 GLY A HA3  4  
ATOM   5916  N  N    . ALA A 1 73  ? -10.872 10.752  36.283  1.00 0.00 ? 430 ALA A N    4  
ATOM   5917  C  CA   . ALA A 1 73  ? -12.323 10.642  36.374  1.00 0.00 ? 430 ALA A CA   4  
ATOM   5918  C  C    . ALA A 1 73  ? -12.967 12.012  36.553  1.00 0.00 ? 430 ALA A C    4  
ATOM   5919  O  O    . ALA A 1 73  ? -13.808 12.423  35.753  1.00 0.00 ? 430 ALA A O    4  
ATOM   5920  C  CB   . ALA A 1 73  ? -12.711 9.720   37.520  1.00 0.00 ? 430 ALA A CB   4  
ATOM   5921  H  H    . ALA A 1 73  ? -10.321 10.433  37.027  1.00 0.00 ? 430 ALA A H    4  
ATOM   5922  H  HA   . ALA A 1 73  ? -12.682 10.203  35.454  1.00 0.00 ? 430 ALA A HA   4  
ATOM   5923  H  HB1  . ALA A 1 73  ? -12.170 8.789   37.432  1.00 0.00 ? 430 ALA A HB1  4  
ATOM   5924  H  HB2  . ALA A 1 73  ? -12.465 10.192  38.460  1.00 0.00 ? 430 ALA A HB2  4  
ATOM   5925  H  HB3  . ALA A 1 73  ? -13.772 9.525   37.482  1.00 0.00 ? 430 ALA A HB3  4  
ATOM   5926  N  N    . LYS A 1 74  ? -12.569 12.715  37.608  1.00 0.00 ? 431 LYS A N    4  
ATOM   5927  C  CA   . LYS A 1 74  ? -13.107 14.040  37.892  1.00 0.00 ? 431 LYS A CA   4  
ATOM   5928  C  C    . LYS A 1 74  ? -12.804 15.006  36.752  1.00 0.00 ? 431 LYS A C    4  
ATOM   5929  O  O    . LYS A 1 74  ? -11.900 14.789  35.946  1.00 0.00 ? 431 LYS A O    4  
ATOM   5930  C  CB   . LYS A 1 74  ? -12.524 14.579  39.201  1.00 0.00 ? 431 LYS A CB   4  
ATOM   5931  C  CG   . LYS A 1 74  ? -13.302 14.153  40.434  1.00 0.00 ? 431 LYS A CG   4  
ATOM   5932  C  CD   . LYS A 1 74  ? -13.091 12.681  40.745  1.00 0.00 ? 431 LYS A CD   4  
ATOM   5933  C  CE   . LYS A 1 74  ? -14.215 12.127  41.607  1.00 0.00 ? 431 LYS A CE   4  
ATOM   5934  N  NZ   . LYS A 1 74  ? -13.920 10.746  42.082  1.00 0.00 ? 431 LYS A NZ   4  
ATOM   5935  H  H    . LYS A 1 74  ? -11.895 12.333  38.209  1.00 0.00 ? 431 LYS A H    4  
ATOM   5936  H  HA   . LYS A 1 74  ? -14.178 13.948  37.996  1.00 0.00 ? 431 LYS A HA   4  
ATOM   5937  H  HB2  . LYS A 1 74  ? -11.509 14.226  39.301  1.00 0.00 ? 431 LYS A HB2  4  
ATOM   5938  H  HB3  . LYS A 1 74  ? -12.518 15.659  39.160  1.00 0.00 ? 431 LYS A HB3  4  
ATOM   5939  H  HG2  . LYS A 1 74  ? -12.970 14.739  41.278  1.00 0.00 ? 431 LYS A HG2  4  
ATOM   5940  H  HG3  . LYS A 1 74  ? -14.354 14.328  40.263  1.00 0.00 ? 431 LYS A HG3  4  
ATOM   5941  H  HD2  . LYS A 1 74  ? -13.056 12.127  39.819  1.00 0.00 ? 431 LYS A HD2  4  
ATOM   5942  H  HD3  . LYS A 1 74  ? -12.154 12.564  41.272  1.00 0.00 ? 431 LYS A HD3  4  
ATOM   5943  H  HE2  . LYS A 1 74  ? -14.346 12.772  42.462  1.00 0.00 ? 431 LYS A HE2  4  
ATOM   5944  H  HE3  . LYS A 1 74  ? -15.123 12.112  41.024  1.00 0.00 ? 431 LYS A HE3  4  
ATOM   5945  H  HZ1  . LYS A 1 74  ? -12.912 10.530  41.951  1.00 0.00 ? 431 LYS A HZ1  4  
ATOM   5946  H  HZ2  . LYS A 1 74  ? -14.484 10.056  41.546  1.00 0.00 ? 431 LYS A HZ2  4  
ATOM   5947  H  HZ3  . LYS A 1 74  ? -14.154 10.658  43.092  1.00 0.00 ? 431 LYS A HZ3  4  
ATOM   5948  N  N    . PRO A 1 75  ? -13.577 16.101  36.682  1.00 0.00 ? 432 PRO A N    4  
ATOM   5949  C  CA   . PRO A 1 75  ? -13.409 17.123  35.645  1.00 0.00 ? 432 PRO A CA   4  
ATOM   5950  C  C    . PRO A 1 75  ? -12.123 17.923  35.823  1.00 0.00 ? 432 PRO A C    4  
ATOM   5951  O  O    . PRO A 1 75  ? -11.731 18.691  34.944  1.00 0.00 ? 432 PRO A O    4  
ATOM   5952  C  CB   . PRO A 1 75  ? -14.631 18.026  35.836  1.00 0.00 ? 432 PRO A CB   4  
ATOM   5953  C  CG   . PRO A 1 75  ? -15.014 17.847  37.264  1.00 0.00 ? 432 PRO A CG   4  
ATOM   5954  C  CD   . PRO A 1 75  ? -14.674 16.424  37.610  1.00 0.00 ? 432 PRO A CD   4  
ATOM   5955  H  HA   . PRO A 1 75  ? -13.429 16.692  34.655  1.00 0.00 ? 432 PRO A HA   4  
ATOM   5956  H  HB2  . PRO A 1 75  ? -14.361 19.051  35.624  1.00 0.00 ? 432 PRO A HB2  4  
ATOM   5957  H  HB3  . PRO A 1 75  ? -15.422 17.711  35.172  1.00 0.00 ? 432 PRO A HB3  4  
ATOM   5958  H  HG2  . PRO A 1 75  ? -14.451 18.528  37.884  1.00 0.00 ? 432 PRO A HG2  4  
ATOM   5959  H  HG3  . PRO A 1 75  ? -16.074 18.018  37.383  1.00 0.00 ? 432 PRO A HG3  4  
ATOM   5960  H  HD2  . PRO A 1 75  ? -14.345 16.353  38.636  1.00 0.00 ? 432 PRO A HD2  4  
ATOM   5961  H  HD3  . PRO A 1 75  ? -15.525 15.780  37.439  1.00 0.00 ? 432 PRO A HD3  4  
ATOM   5962  N  N    . PHE A 1 76  ? -11.470 17.738  36.966  1.00 0.00 ? 433 PHE A N    4  
ATOM   5963  C  CA   . PHE A 1 76  ? -10.228 18.443  37.259  1.00 0.00 ? 433 PHE A CA   4  
ATOM   5964  C  C    . PHE A 1 76  ? -9.262  17.547  38.029  1.00 0.00 ? 433 PHE A C    4  
ATOM   5965  O  O    . PHE A 1 76  ? -9.581  17.061  39.114  1.00 0.00 ? 433 PHE A O    4  
ATOM   5966  C  CB   . PHE A 1 76  ? -10.515 19.712  38.065  1.00 0.00 ? 433 PHE A CB   4  
ATOM   5967  C  CG   . PHE A 1 76  ? -11.705 20.482  37.567  1.00 0.00 ? 433 PHE A CG   4  
ATOM   5968  C  CD1  . PHE A 1 76  ? -11.608 21.282  36.441  1.00 0.00 ? 433 PHE A CD1  4  
ATOM   5969  C  CD2  . PHE A 1 76  ? -12.921 20.405  38.227  1.00 0.00 ? 433 PHE A CD2  4  
ATOM   5970  C  CE1  . PHE A 1 76  ? -12.701 21.991  35.980  1.00 0.00 ? 433 PHE A CE1  4  
ATOM   5971  C  CE2  . PHE A 1 76  ? -14.018 21.111  37.771  1.00 0.00 ? 433 PHE A CE2  4  
ATOM   5972  C  CZ   . PHE A 1 76  ? -13.908 21.906  36.647  1.00 0.00 ? 433 PHE A CZ   4  
ATOM   5973  H  H    . PHE A 1 76  ? -11.833 17.113  37.628  1.00 0.00 ? 433 PHE A H    4  
ATOM   5974  H  HA   . PHE A 1 76  ? -9.774  18.718  36.320  1.00 0.00 ? 433 PHE A HA   4  
ATOM   5975  H  HB2  . PHE A 1 76  ? -10.701 19.443  39.093  1.00 0.00 ? 433 PHE A HB2  4  
ATOM   5976  H  HB3  . PHE A 1 76  ? -9.654  20.362  38.017  1.00 0.00 ? 433 PHE A HB3  4  
ATOM   5977  H  HD1  . PHE A 1 76  ? -10.664 21.350  35.918  1.00 0.00 ? 433 PHE A HD1  4  
ATOM   5978  H  HD2  . PHE A 1 76  ? -13.009 19.784  39.107  1.00 0.00 ? 433 PHE A HD2  4  
ATOM   5979  H  HE1  . PHE A 1 76  ? -12.611 22.612  35.101  1.00 0.00 ? 433 PHE A HE1  4  
ATOM   5980  H  HE2  . PHE A 1 76  ? -14.960 21.043  38.294  1.00 0.00 ? 433 PHE A HE2  4  
ATOM   5981  H  HZ   . PHE A 1 76  ? -14.763 22.458  36.288  1.00 0.00 ? 433 PHE A HZ   4  
ATOM   5982  N  N    . GLN A 1 77  ? -8.081  17.332  37.458  1.00 0.00 ? 434 GLN A N    4  
ATOM   5983  C  CA   . GLN A 1 77  ? -7.069  16.493  38.089  1.00 0.00 ? 434 GLN A CA   4  
ATOM   5984  C  C    . GLN A 1 77  ? -5.697  17.156  38.028  1.00 0.00 ? 434 GLN A C    4  
ATOM   5985  O  O    . GLN A 1 77  ? -5.303  17.697  36.995  1.00 0.00 ? 434 GLN A O    4  
ATOM   5986  C  CB   . GLN A 1 77  ? -7.018  15.123  37.411  1.00 0.00 ? 434 GLN A CB   4  
ATOM   5987  C  CG   . GLN A 1 77  ? -6.051  14.153  38.072  1.00 0.00 ? 434 GLN A CG   4  
ATOM   5988  C  CD   . GLN A 1 77  ? -6.393  12.704  37.788  1.00 0.00 ? 434 GLN A CD   4  
ATOM   5989  O  OE1  . GLN A 1 77  ? -6.379  12.265  36.638  1.00 0.00 ? 434 GLN A OE1  4  
ATOM   5990  N  NE2  . GLN A 1 77  ? -6.703  11.951  38.838  1.00 0.00 ? 434 GLN A NE2  4  
ATOM   5991  H  H    . GLN A 1 77  ? -7.886  17.747  36.592  1.00 0.00 ? 434 GLN A H    4  
ATOM   5992  H  HA   . GLN A 1 77  ? -7.346  16.362  39.124  1.00 0.00 ? 434 GLN A HA   4  
ATOM   5993  H  HB2  . GLN A 1 77  ? -8.005  14.686  37.434  1.00 0.00 ? 434 GLN A HB2  4  
ATOM   5994  H  HB3  . GLN A 1 77  ? -6.714  15.254  36.383  1.00 0.00 ? 434 GLN A HB3  4  
ATOM   5995  H  HG2  . GLN A 1 77  ? -5.055  14.350  37.705  1.00 0.00 ? 434 GLN A HG2  4  
ATOM   5996  H  HG3  . GLN A 1 77  ? -6.077  14.311  39.140  1.00 0.00 ? 434 GLN A HG3  4  
ATOM   5997  H  HE21 . GLN A 1 77  ? -6.695  12.369  39.725  1.00 0.00 ? 434 GLN A HE21 4  
ATOM   5998  H  HE22 . GLN A 1 77  ? -6.929  11.011  38.683  1.00 0.00 ? 434 GLN A HE22 4  
ATOM   5999  N  N    . CYS A 1 78  ? -4.974  17.111  39.142  1.00 0.00 ? 435 CYS A N    4  
ATOM   6000  C  CA   . CYS A 1 78  ? -3.646  17.707  39.217  1.00 0.00 ? 435 CYS A CA   4  
ATOM   6001  C  C    . CYS A 1 78  ? -2.642  16.905  38.393  1.00 0.00 ? 435 CYS A C    4  
ATOM   6002  O  O    . CYS A 1 78  ? -2.996  15.911  37.760  1.00 0.00 ? 435 CYS A O    4  
ATOM   6003  C  CB   . CYS A 1 78  ? -3.180  17.786  40.672  1.00 0.00 ? 435 CYS A CB   4  
ATOM   6004  S  SG   . CYS A 1 78  ? -2.060  19.179  41.020  1.00 0.00 ? 435 CYS A SG   4  
ATOM   6005  H  H    . CYS A 1 78  ? -5.343  16.665  39.934  1.00 0.00 ? 435 CYS A H    4  
ATOM   6006  H  HA   . CYS A 1 78  ? -3.707  18.706  38.813  1.00 0.00 ? 435 CYS A HA   4  
ATOM   6007  H  HB2  . CYS A 1 78  ? -4.043  17.891  41.313  1.00 0.00 ? 435 CYS A HB2  4  
ATOM   6008  H  HB3  . CYS A 1 78  ? -2.660  16.874  40.925  1.00 0.00 ? 435 CYS A HB3  4  
ATOM   6009  N  N    . GLY A 1 79  ? -1.388  17.346  38.406  1.00 0.00 ? 436 GLY A N    4  
ATOM   6010  C  CA   . GLY A 1 79  ? -0.352  16.658  37.657  1.00 0.00 ? 436 GLY A CA   4  
ATOM   6011  C  C    . GLY A 1 79  ? 0.763   16.145  38.546  1.00 0.00 ? 436 GLY A C    4  
ATOM   6012  O  O    . GLY A 1 79  ? 1.081   14.956  38.533  1.00 0.00 ? 436 GLY A O    4  
ATOM   6013  H  H    . GLY A 1 79  ? -1.164  18.144  38.929  1.00 0.00 ? 436 GLY A H    4  
ATOM   6014  H  HA2  . GLY A 1 79  ? -0.795  15.823  37.135  1.00 0.00 ? 436 GLY A HA2  4  
ATOM   6015  H  HA3  . GLY A 1 79  ? 0.066   17.342  36.933  1.00 0.00 ? 436 GLY A HA3  4  
ATOM   6016  N  N    . VAL A 1 80  ? 1.361   17.045  39.321  1.00 0.00 ? 437 VAL A N    4  
ATOM   6017  C  CA   . VAL A 1 80  ? 2.448   16.677  40.221  1.00 0.00 ? 437 VAL A CA   4  
ATOM   6018  C  C    . VAL A 1 80  ? 1.981   15.666  41.262  1.00 0.00 ? 437 VAL A C    4  
ATOM   6019  O  O    . VAL A 1 80  ? 2.564   14.591  41.405  1.00 0.00 ? 437 VAL A O    4  
ATOM   6020  C  CB   . VAL A 1 80  ? 3.023   17.911  40.941  1.00 0.00 ? 437 VAL A CB   4  
ATOM   6021  C  CG1  . VAL A 1 80  ? 3.968   17.488  42.055  1.00 0.00 ? 437 VAL A CG1  4  
ATOM   6022  C  CG2  . VAL A 1 80  ? 3.728   18.825  39.950  1.00 0.00 ? 437 VAL A CG2  4  
ATOM   6023  H  H    . VAL A 1 80  ? 1.063   17.978  39.288  1.00 0.00 ? 437 VAL A H    4  
ATOM   6024  H  HA   . VAL A 1 80  ? 3.235   16.232  39.629  1.00 0.00 ? 437 VAL A HA   4  
ATOM   6025  H  HB   . VAL A 1 80  ? 2.203   18.459  41.383  1.00 0.00 ? 437 VAL A HB   4  
ATOM   6026  H  HG11 . VAL A 1 80  ? 3.462   16.796  42.712  1.00 0.00 ? 437 VAL A HG11 4  
ATOM   6027  H  HG12 . VAL A 1 80  ? 4.837   17.010  41.628  1.00 0.00 ? 437 VAL A HG12 4  
ATOM   6028  H  HG13 . VAL A 1 80  ? 4.274   18.358  42.617  1.00 0.00 ? 437 VAL A HG13 4  
ATOM   6029  H  HG21 . VAL A 1 80  ? 3.839   18.315  39.005  1.00 0.00 ? 437 VAL A HG21 4  
ATOM   6030  H  HG22 . VAL A 1 80  ? 3.144   19.722  39.810  1.00 0.00 ? 437 VAL A HG22 4  
ATOM   6031  H  HG23 . VAL A 1 80  ? 4.704   19.087  40.333  1.00 0.00 ? 437 VAL A HG23 4  
ATOM   6032  N  N    . CYS A 1 81  ? 0.926   16.018  41.989  1.00 0.00 ? 438 CYS A N    4  
ATOM   6033  C  CA   . CYS A 1 81  ? 0.380   15.143  43.019  1.00 0.00 ? 438 CYS A CA   4  
ATOM   6034  C  C    . CYS A 1 81  ? -0.674  14.206  42.433  1.00 0.00 ? 438 CYS A C    4  
ATOM   6035  O  O    . CYS A 1 81  ? -0.886  13.104  42.936  1.00 0.00 ? 438 CYS A O    4  
ATOM   6036  C  CB   . CYS A 1 81  ? -0.231  15.971  44.151  1.00 0.00 ? 438 CYS A CB   4  
ATOM   6037  S  SG   . CYS A 1 81  ? -1.836  16.728  43.736  1.00 0.00 ? 438 CYS A SG   4  
ATOM   6038  H  H    . CYS A 1 81  ? 0.504   16.889  41.829  1.00 0.00 ? 438 CYS A H    4  
ATOM   6039  H  HA   . CYS A 1 81  ? 1.190   14.550  43.415  1.00 0.00 ? 438 CYS A HA   4  
ATOM   6040  H  HB2  . CYS A 1 81  ? -0.382  15.335  45.011  1.00 0.00 ? 438 CYS A HB2  4  
ATOM   6041  H  HB3  . CYS A 1 81  ? 0.450   16.767  44.412  1.00 0.00 ? 438 CYS A HB3  4  
ATOM   6042  N  N    . ASN A 1 82  ? -1.329  14.654  41.368  1.00 0.00 ? 439 ASN A N    4  
ATOM   6043  C  CA   . ASN A 1 82  ? -2.361  13.857  40.714  1.00 0.00 ? 439 ASN A CA   4  
ATOM   6044  C  C    . ASN A 1 82  ? -3.562  13.662  41.633  1.00 0.00 ? 439 ASN A C    4  
ATOM   6045  O  O    . ASN A 1 82  ? -4.029  12.540  41.832  1.00 0.00 ? 439 ASN A O    4  
ATOM   6046  C  CB   . ASN A 1 82  ? -1.796  12.497  40.298  1.00 0.00 ? 439 ASN A CB   4  
ATOM   6047  C  CG   . ASN A 1 82  ? -0.562  12.625  39.426  1.00 0.00 ? 439 ASN A CG   4  
ATOM   6048  O  OD1  . ASN A 1 82  ? 0.541   12.264  39.835  1.00 0.00 ? 439 ASN A OD1  4  
ATOM   6049  N  ND2  . ASN A 1 82  ? -0.744  13.143  38.216  1.00 0.00 ? 439 ASN A ND2  4  
ATOM   6050  H  H    . ASN A 1 82  ? -1.115  15.542  41.013  1.00 0.00 ? 439 ASN A H    4  
ATOM   6051  H  HA   . ASN A 1 82  ? -2.680  14.389  39.831  1.00 0.00 ? 439 ASN A HA   4  
ATOM   6052  H  HB2  . ASN A 1 82  ? -1.530  11.939  41.184  1.00 0.00 ? 439 ASN A HB2  4  
ATOM   6053  H  HB3  . ASN A 1 82  ? -2.549  11.954  39.748  1.00 0.00 ? 439 ASN A HB3  4  
ATOM   6054  H  HD21 . ASN A 1 82  ? -1.651  13.409  37.958  1.00 0.00 ? 439 ASN A HD21 4  
ATOM   6055  H  HD22 . ASN A 1 82  ? 0.036   13.236  37.631  1.00 0.00 ? 439 ASN A HD22 4  
ATOM   6056  N  N    . ARG A 1 83  ? -4.059  14.762  42.191  1.00 0.00 ? 440 ARG A N    4  
ATOM   6057  C  CA   . ARG A 1 83  ? -5.205  14.712  43.089  1.00 0.00 ? 440 ARG A CA   4  
ATOM   6058  C  C    . ARG A 1 83  ? -6.465  15.217  42.392  1.00 0.00 ? 440 ARG A C    4  
ATOM   6059  O  O    . ARG A 1 83  ? -6.415  16.164  41.607  1.00 0.00 ? 440 ARG A O    4  
ATOM   6060  C  CB   . ARG A 1 83  ? -4.934  15.545  44.343  1.00 0.00 ? 440 ARG A CB   4  
ATOM   6061  C  CG   . ARG A 1 83  ? -4.088  14.827  45.381  1.00 0.00 ? 440 ARG A CG   4  
ATOM   6062  C  CD   . ARG A 1 83  ? -3.577  15.787  46.444  1.00 0.00 ? 440 ARG A CD   4  
ATOM   6063  N  NE   . ARG A 1 83  ? -2.471  15.218  47.209  1.00 0.00 ? 440 ARG A NE   4  
ATOM   6064  C  CZ   . ARG A 1 83  ? -2.635  14.376  48.224  1.00 0.00 ? 440 ARG A CZ   4  
ATOM   6065  N  NH1  . ARG A 1 83  ? -3.854  14.008  48.594  1.00 0.00 ? 440 ARG A NH1  4  
ATOM   6066  N  NH2  . ARG A 1 83  ? -1.578  13.901  48.871  1.00 0.00 ? 440 ARG A NH2  4  
ATOM   6067  H  H    . ARG A 1 83  ? -3.643  15.627  41.993  1.00 0.00 ? 440 ARG A H    4  
ATOM   6068  H  HA   . ARG A 1 83  ? -5.356  13.682  43.378  1.00 0.00 ? 440 ARG A HA   4  
ATOM   6069  H  HB2  . ARG A 1 83  ? -4.420  16.450  44.055  1.00 0.00 ? 440 ARG A HB2  4  
ATOM   6070  H  HB3  . ARG A 1 83  ? -5.878  15.807  44.798  1.00 0.00 ? 440 ARG A HB3  4  
ATOM   6071  H  HG2  . ARG A 1 83  ? -4.689  14.067  45.858  1.00 0.00 ? 440 ARG A HG2  4  
ATOM   6072  H  HG3  . ARG A 1 83  ? -3.245  14.366  44.889  1.00 0.00 ? 440 ARG A HG3  4  
ATOM   6073  H  HD2  . ARG A 1 83  ? -3.240  16.692  45.961  1.00 0.00 ? 440 ARG A HD2  4  
ATOM   6074  H  HD3  . ARG A 1 83  ? -4.387  16.020  47.119  1.00 0.00 ? 440 ARG A HD3  4  
ATOM   6075  H  HE   . ARG A 1 83  ? -1.561  15.476  46.953  1.00 0.00 ? 440 ARG A HE   4  
ATOM   6076  H  HH11 . ARG A 1 83  ? -4.652  14.364  48.107  1.00 0.00 ? 440 ARG A HH11 4  
ATOM   6077  H  HH12 . ARG A 1 83  ? -3.975  13.374  49.357  1.00 0.00 ? 440 ARG A HH12 4  
ATOM   6078  H  HH21 . ARG A 1 83  ? -0.658  14.176  48.595  1.00 0.00 ? 440 ARG A HH21 4  
ATOM   6079  H  HH22 . ARG A 1 83  ? -1.703  13.268  49.634  1.00 0.00 ? 440 ARG A HH22 4  
ATOM   6080  N  N    . SER A 1 84  ? -7.593  14.577  42.684  1.00 0.00 ? 441 SER A N    4  
ATOM   6081  C  CA   . SER A 1 84  ? -8.866  14.959  42.081  1.00 0.00 ? 441 SER A CA   4  
ATOM   6082  C  C    . SER A 1 84  ? -9.580  16.002  42.936  1.00 0.00 ? 441 SER A C    4  
ATOM   6083  O  O    . SER A 1 84  ? -9.448  16.015  44.159  1.00 0.00 ? 441 SER A O    4  
ATOM   6084  C  CB   . SER A 1 84  ? -9.759  13.729  41.904  1.00 0.00 ? 441 SER A CB   4  
ATOM   6085  O  OG   . SER A 1 84  ? -9.959  13.062  43.139  1.00 0.00 ? 441 SER A OG   4  
ATOM   6086  H  H    . SER A 1 84  ? -7.569  13.830  43.317  1.00 0.00 ? 441 SER A H    4  
ATOM   6087  H  HA   . SER A 1 84  ? -8.659  15.385  41.111  1.00 0.00 ? 441 SER A HA   4  
ATOM   6088  H  HB2  . SER A 1 84  ? -10.718 14.037  41.516  1.00 0.00 ? 441 SER A HB2  4  
ATOM   6089  H  HB3  . SER A 1 84  ? -9.292  13.046  41.211  1.00 0.00 ? 441 SER A HB3  4  
ATOM   6090  H  HG   . SER A 1 84  ? -10.894 13.067  43.357  1.00 0.00 ? 441 SER A HG   4  
ATOM   6091  N  N    . PHE A 1 85  ? -10.337 16.876  42.280  1.00 0.00 ? 442 PHE A N    4  
ATOM   6092  C  CA   . PHE A 1 85  ? -11.072 17.924  42.978  1.00 0.00 ? 442 PHE A CA   4  
ATOM   6093  C  C    . PHE A 1 85  ? -12.383 18.237  42.263  1.00 0.00 ? 442 PHE A C    4  
ATOM   6094  O  O    . PHE A 1 85  ? -12.417 18.381  41.041  1.00 0.00 ? 442 PHE A O    4  
ATOM   6095  C  CB   . PHE A 1 85  ? -10.220 19.191  43.083  1.00 0.00 ? 442 PHE A CB   4  
ATOM   6096  C  CG   . PHE A 1 85  ? -8.833  18.939  43.601  1.00 0.00 ? 442 PHE A CG   4  
ATOM   6097  C  CD1  . PHE A 1 85  ? -8.614  18.712  44.950  1.00 0.00 ? 442 PHE A CD1  4  
ATOM   6098  C  CD2  . PHE A 1 85  ? -7.748  18.930  42.739  1.00 0.00 ? 442 PHE A CD2  4  
ATOM   6099  C  CE1  . PHE A 1 85  ? -7.339  18.479  45.430  1.00 0.00 ? 442 PHE A CE1  4  
ATOM   6100  C  CE2  . PHE A 1 85  ? -6.471  18.698  43.214  1.00 0.00 ? 442 PHE A CE2  4  
ATOM   6101  C  CZ   . PHE A 1 85  ? -6.266  18.473  44.561  1.00 0.00 ? 442 PHE A CZ   4  
ATOM   6102  H  H    . PHE A 1 85  ? -10.402 16.814  41.304  1.00 0.00 ? 442 PHE A H    4  
ATOM   6103  H  HA   . PHE A 1 85  ? -11.294 17.567  43.972  1.00 0.00 ? 442 PHE A HA   4  
ATOM   6104  H  HB2  . PHE A 1 85  ? -10.132 19.638  42.104  1.00 0.00 ? 442 PHE A HB2  4  
ATOM   6105  H  HB3  . PHE A 1 85  ? -10.704 19.887  43.751  1.00 0.00 ? 442 PHE A HB3  4  
ATOM   6106  H  HD1  . PHE A 1 85  ? -9.453  18.716  45.632  1.00 0.00 ? 442 PHE A HD1  4  
ATOM   6107  H  HD2  . PHE A 1 85  ? -7.907  19.107  41.685  1.00 0.00 ? 442 PHE A HD2  4  
ATOM   6108  H  HE1  . PHE A 1 85  ? -7.182  18.304  46.484  1.00 0.00 ? 442 PHE A HE1  4  
ATOM   6109  H  HE2  . PHE A 1 85  ? -5.634  18.694  42.532  1.00 0.00 ? 442 PHE A HE2  4  
ATOM   6110  H  HZ   . PHE A 1 85  ? -5.269  18.291  44.934  1.00 0.00 ? 442 PHE A HZ   4  
ATOM   6111  N  N    . SER A 1 86  ? -13.461 18.341  43.034  1.00 0.00 ? 443 SER A N    4  
ATOM   6112  C  CA   . SER A 1 86  ? -14.776 18.632  42.475  1.00 0.00 ? 443 SER A CA   4  
ATOM   6113  C  C    . SER A 1 86  ? -14.866 20.088  42.028  1.00 0.00 ? 443 SER A C    4  
ATOM   6114  O  O    . SER A 1 86  ? -15.362 20.386  40.942  1.00 0.00 ? 443 SER A O    4  
ATOM   6115  C  CB   . SER A 1 86  ? -15.868 18.334  43.503  1.00 0.00 ? 443 SER A CB   4  
ATOM   6116  O  OG   . SER A 1 86  ? -17.154 18.614  42.977  1.00 0.00 ? 443 SER A OG   4  
ATOM   6117  H  H    . SER A 1 86  ? -13.370 18.215  44.002  1.00 0.00 ? 443 SER A H    4  
ATOM   6118  H  HA   . SER A 1 86  ? -14.919 17.995  41.615  1.00 0.00 ? 443 SER A HA   4  
ATOM   6119  H  HB2  . SER A 1 86  ? -15.825 17.291  43.779  1.00 0.00 ? 443 SER A HB2  4  
ATOM   6120  H  HB3  . SER A 1 86  ? -15.710 18.945  44.380  1.00 0.00 ? 443 SER A HB3  4  
ATOM   6121  H  HG   . SER A 1 86  ? -17.760 17.910  43.221  1.00 0.00 ? 443 SER A HG   4  
ATOM   6122  N  N    . ARG A 1 87  ? -14.382 20.991  42.875  1.00 0.00 ? 444 ARG A N    4  
ATOM   6123  C  CA   . ARG A 1 87  ? -14.408 22.416  42.569  1.00 0.00 ? 444 ARG A CA   4  
ATOM   6124  C  C    . ARG A 1 87  ? -13.175 22.823  41.767  1.00 0.00 ? 444 ARG A C    4  
ATOM   6125  O  O    . ARG A 1 87  ? -12.067 22.360  42.036  1.00 0.00 ? 444 ARG A O    4  
ATOM   6126  C  CB   . ARG A 1 87  ? -14.483 23.235  43.859  1.00 0.00 ? 444 ARG A CB   4  
ATOM   6127  C  CG   . ARG A 1 87  ? -15.656 22.862  44.750  1.00 0.00 ? 444 ARG A CG   4  
ATOM   6128  C  CD   . ARG A 1 87  ? -16.892 23.682  44.416  1.00 0.00 ? 444 ARG A CD   4  
ATOM   6129  N  NE   . ARG A 1 87  ? -16.762 25.070  44.850  1.00 0.00 ? 444 ARG A NE   4  
ATOM   6130  C  CZ   . ARG A 1 87  ? -17.042 25.485  46.081  1.00 0.00 ? 444 ARG A CZ   4  
ATOM   6131  N  NH1  . ARG A 1 87  ? -17.466 24.622  46.994  1.00 0.00 ? 444 ARG A NH1  4  
ATOM   6132  N  NH2  . ARG A 1 87  ? -16.898 26.764  46.400  1.00 0.00 ? 444 ARG A NH2  4  
ATOM   6133  H  H    . ARG A 1 87  ? -13.999 20.692  43.726  1.00 0.00 ? 444 ARG A H    4  
ATOM   6134  H  HA   . ARG A 1 87  ? -15.289 22.613  41.977  1.00 0.00 ? 444 ARG A HA   4  
ATOM   6135  H  HB2  . ARG A 1 87  ? -13.572 23.086  44.420  1.00 0.00 ? 444 ARG A HB2  4  
ATOM   6136  H  HB3  . ARG A 1 87  ? -14.571 24.280  43.604  1.00 0.00 ? 444 ARG A HB3  4  
ATOM   6137  H  HG2  . ARG A 1 87  ? -15.884 21.815  44.611  1.00 0.00 ? 444 ARG A HG2  4  
ATOM   6138  H  HG3  . ARG A 1 87  ? -15.385 23.039  45.780  1.00 0.00 ? 444 ARG A HG3  4  
ATOM   6139  H  HD2  . ARG A 1 87  ? -17.043 23.662  43.347  1.00 0.00 ? 444 ARG A HD2  4  
ATOM   6140  H  HD3  . ARG A 1 87  ? -17.746 23.239  44.908  1.00 0.00 ? 444 ARG A HD3  4  
ATOM   6141  H  HE   . ARG A 1 87  ? -16.450 25.725  44.191  1.00 0.00 ? 444 ARG A HE   4  
ATOM   6142  H  HH11 . ARG A 1 87  ? -17.574 23.657  46.757  1.00 0.00 ? 444 ARG A HH11 4  
ATOM   6143  H  HH12 . ARG A 1 87  ? -17.675 24.936  47.921  1.00 0.00 ? 444 ARG A HH12 4  
ATOM   6144  H  HH21 . ARG A 1 87  ? -16.579 27.418  45.715  1.00 0.00 ? 444 ARG A HH21 4  
ATOM   6145  H  HH22 . ARG A 1 87  ? -17.109 27.075  47.326  1.00 0.00 ? 444 ARG A HH22 4  
ATOM   6146  N  N    . SER A 1 88  ? -13.377 23.691  40.781  1.00 0.00 ? 445 SER A N    4  
ATOM   6147  C  CA   . SER A 1 88  ? -12.284 24.157  39.936  1.00 0.00 ? 445 SER A CA   4  
ATOM   6148  C  C    . SER A 1 88  ? -11.337 25.059  40.722  1.00 0.00 ? 445 SER A C    4  
ATOM   6149  O  O    . SER A 1 88  ? -10.116 24.944  40.610  1.00 0.00 ? 445 SER A O    4  
ATOM   6150  C  CB   . SER A 1 88  ? -12.833 24.909  38.723  1.00 0.00 ? 445 SER A CB   4  
ATOM   6151  O  OG   . SER A 1 88  ? -13.594 26.036  39.123  1.00 0.00 ? 445 SER A OG   4  
ATOM   6152  H  H    . SER A 1 88  ? -14.285 24.024  40.616  1.00 0.00 ? 445 SER A H    4  
ATOM   6153  H  HA   . SER A 1 88  ? -11.737 23.291  39.595  1.00 0.00 ? 445 SER A HA   4  
ATOM   6154  H  HB2  . SER A 1 88  ? -12.012 25.245  38.108  1.00 0.00 ? 445 SER A HB2  4  
ATOM   6155  H  HB3  . SER A 1 88  ? -13.466 24.248  38.149  1.00 0.00 ? 445 SER A HB3  4  
ATOM   6156  H  HG   . SER A 1 88  ? -13.338 26.798  38.598  1.00 0.00 ? 445 SER A HG   4  
ATOM   6157  N  N    . ASP A 1 89  ? -11.909 25.956  41.518  1.00 0.00 ? 446 ASP A N    4  
ATOM   6158  C  CA   . ASP A 1 89  ? -11.117 26.878  42.324  1.00 0.00 ? 446 ASP A CA   4  
ATOM   6159  C  C    . ASP A 1 89  ? -10.127 26.119  43.202  1.00 0.00 ? 446 ASP A C    4  
ATOM   6160  O  O    . ASP A 1 89  ? -8.948  26.470  43.273  1.00 0.00 ? 446 ASP A O    4  
ATOM   6161  C  CB   . ASP A 1 89  ? -12.031 27.742  43.194  1.00 0.00 ? 446 ASP A CB   4  
ATOM   6162  C  CG   . ASP A 1 89  ? -11.267 28.807  43.956  1.00 0.00 ? 446 ASP A CG   4  
ATOM   6163  O  OD1  . ASP A 1 89  ? -10.378 29.445  43.355  1.00 0.00 ? 446 ASP A OD1  4  
ATOM   6164  O  OD2  . ASP A 1 89  ? -11.559 29.002  45.155  1.00 0.00 ? 446 ASP A OD2  4  
ATOM   6165  H  H    . ASP A 1 89  ? -12.887 25.999  41.564  1.00 0.00 ? 446 ASP A H    4  
ATOM   6166  H  HA   . ASP A 1 89  ? -10.566 27.517  41.651  1.00 0.00 ? 446 ASP A HA   4  
ATOM   6167  H  HB2  . ASP A 1 89  ? -12.761 28.231  42.564  1.00 0.00 ? 446 ASP A HB2  4  
ATOM   6168  H  HB3  . ASP A 1 89  ? -12.542 27.111  43.906  1.00 0.00 ? 446 ASP A HB3  4  
ATOM   6169  N  N    . HIS A 1 90  ? -10.613 25.078  43.871  1.00 0.00 ? 447 HIS A N    4  
ATOM   6170  C  CA   . HIS A 1 90  ? -9.771  24.270  44.745  1.00 0.00 ? 447 HIS A CA   4  
ATOM   6171  C  C    . HIS A 1 90  ? -8.448  23.932  44.064  1.00 0.00 ? 447 HIS A C    4  
ATOM   6172  O  O    . HIS A 1 90  ? -7.388  23.967  44.691  1.00 0.00 ? 447 HIS A O    4  
ATOM   6173  C  CB   . HIS A 1 90  ? -10.497 22.985  45.142  1.00 0.00 ? 447 HIS A CB   4  
ATOM   6174  C  CG   . HIS A 1 90  ? -11.485 23.173  46.252  1.00 0.00 ? 447 HIS A CG   4  
ATOM   6175  N  ND1  . HIS A 1 90  ? -12.599 22.376  46.412  1.00 0.00 ? 447 HIS A ND1  4  
ATOM   6176  C  CD2  . HIS A 1 90  ? -11.522 24.075  47.261  1.00 0.00 ? 447 HIS A CD2  4  
ATOM   6177  C  CE1  . HIS A 1 90  ? -13.279 22.779  47.470  1.00 0.00 ? 447 HIS A CE1  4  
ATOM   6178  N  NE2  . HIS A 1 90  ? -12.646 23.809  48.004  1.00 0.00 ? 447 HIS A NE2  4  
ATOM   6179  H  H    . HIS A 1 90  ? -11.561 24.849  43.774  1.00 0.00 ? 447 HIS A H    4  
ATOM   6180  H  HA   . HIS A 1 90  ? -9.566  24.847  45.634  1.00 0.00 ? 447 HIS A HA   4  
ATOM   6181  H  HB2  . HIS A 1 90  ? -11.031 22.601  44.285  1.00 0.00 ? 447 HIS A HB2  4  
ATOM   6182  H  HB3  . HIS A 1 90  ? -9.770  22.253  45.465  1.00 0.00 ? 447 HIS A HB3  4  
ATOM   6183  H  HD1  . HIS A 1 90  ? -12.854 21.627  45.834  1.00 0.00 ? 447 HIS A HD1  4  
ATOM   6184  H  HD2  . HIS A 1 90  ? -10.802 24.859  47.448  1.00 0.00 ? 447 HIS A HD2  4  
ATOM   6185  H  HE1  . HIS A 1 90  ? -14.195 22.343  47.837  1.00 0.00 ? 447 HIS A HE1  4  
ATOM   6186  N  N    . LEU A 1 91  ? -8.517  23.603  42.779  1.00 0.00 ? 448 LEU A N    4  
ATOM   6187  C  CA   . LEU A 1 91  ? -7.325  23.257  42.012  1.00 0.00 ? 448 LEU A CA   4  
ATOM   6188  C  C    . LEU A 1 91  ? -6.399  24.461  41.873  1.00 0.00 ? 448 LEU A C    4  
ATOM   6189  O  O    . LEU A 1 91  ? -5.237  24.413  42.276  1.00 0.00 ? 448 LEU A O    4  
ATOM   6190  C  CB   . LEU A 1 91  ? -7.718  22.739  40.628  1.00 0.00 ? 448 LEU A CB   4  
ATOM   6191  C  CG   . LEU A 1 91  ? -6.562  22.386  39.691  1.00 0.00 ? 448 LEU A CG   4  
ATOM   6192  C  CD1  . LEU A 1 91  ? -5.809  21.170  40.206  1.00 0.00 ? 448 LEU A CD1  4  
ATOM   6193  C  CD2  . LEU A 1 91  ? -7.076  22.139  38.280  1.00 0.00 ? 448 LEU A CD2  4  
ATOM   6194  H  H    . LEU A 1 91  ? -9.390  23.593  42.334  1.00 0.00 ? 448 LEU A H    4  
ATOM   6195  H  HA   . LEU A 1 91  ? -6.803  22.477  42.546  1.00 0.00 ? 448 LEU A HA   4  
ATOM   6196  H  HB2  . LEU A 1 91  ? -8.315  21.850  40.765  1.00 0.00 ? 448 LEU A HB2  4  
ATOM   6197  H  HB3  . LEU A 1 91  ? -8.314  23.501  40.147  1.00 0.00 ? 448 LEU A HB3  4  
ATOM   6198  H  HG   . LEU A 1 91  ? -5.870  23.216  39.655  1.00 0.00 ? 448 LEU A HG   4  
ATOM   6199  H  HD11 . LEU A 1 91  ? -5.296  20.690  39.387  1.00 0.00 ? 448 LEU A HD11 4  
ATOM   6200  H  HD12 . LEU A 1 91  ? -6.507  20.475  40.650  1.00 0.00 ? 448 LEU A HD12 4  
ATOM   6201  H  HD13 . LEU A 1 91  ? -5.090  21.480  40.950  1.00 0.00 ? 448 LEU A HD13 4  
ATOM   6202  H  HD21 . LEU A 1 91  ? -8.005  21.592  38.326  1.00 0.00 ? 448 LEU A HD21 4  
ATOM   6203  H  HD22 . LEU A 1 91  ? -6.347  21.565  37.727  1.00 0.00 ? 448 LEU A HD22 4  
ATOM   6204  H  HD23 . LEU A 1 91  ? -7.239  23.086  37.785  1.00 0.00 ? 448 LEU A HD23 4  
ATOM   6205  N  N    . ALA A 1 92  ? -6.922  25.541  41.301  1.00 0.00 ? 449 ALA A N    4  
ATOM   6206  C  CA   . ALA A 1 92  ? -6.144  26.759  41.113  1.00 0.00 ? 449 ALA A CA   4  
ATOM   6207  C  C    . ALA A 1 92  ? -5.421  27.152  42.397  1.00 0.00 ? 449 ALA A C    4  
ATOM   6208  O  O    . ALA A 1 92  ? -4.218  27.419  42.387  1.00 0.00 ? 449 ALA A O    4  
ATOM   6209  C  CB   . ALA A 1 92  ? -7.043  27.893  40.643  1.00 0.00 ? 449 ALA A CB   4  
ATOM   6210  H  H    . ALA A 1 92  ? -7.855  25.518  41.000  1.00 0.00 ? 449 ALA A H    4  
ATOM   6211  H  HA   . ALA A 1 92  ? -5.411  26.571  40.342  1.00 0.00 ? 449 ALA A HA   4  
ATOM   6212  H  HB1  . ALA A 1 92  ? -6.945  28.732  41.314  1.00 0.00 ? 449 ALA A HB1  4  
ATOM   6213  H  HB2  . ALA A 1 92  ? -6.753  28.192  39.646  1.00 0.00 ? 449 ALA A HB2  4  
ATOM   6214  H  HB3  . ALA A 1 92  ? -8.070  27.557  40.633  1.00 0.00 ? 449 ALA A HB3  4  
ATOM   6215  N  N    . LEU A 1 93  ? -6.160  27.188  43.500  1.00 0.00 ? 450 LEU A N    4  
ATOM   6216  C  CA   . LEU A 1 93  ? -5.589  27.550  44.792  1.00 0.00 ? 450 LEU A CA   4  
ATOM   6217  C  C    . LEU A 1 93  ? -4.574  26.507  45.250  1.00 0.00 ? 450 LEU A C    4  
ATOM   6218  O  O    . LEU A 1 93  ? -3.524  26.846  45.796  1.00 0.00 ? 450 LEU A O    4  
ATOM   6219  C  CB   . LEU A 1 93  ? -6.696  27.695  45.838  1.00 0.00 ? 450 LEU A CB   4  
ATOM   6220  C  CG   . LEU A 1 93  ? -7.363  29.068  45.924  1.00 0.00 ? 450 LEU A CG   4  
ATOM   6221  C  CD1  . LEU A 1 93  ? -8.790  28.937  46.433  1.00 0.00 ? 450 LEU A CD1  4  
ATOM   6222  C  CD2  . LEU A 1 93  ? -6.558  29.997  46.821  1.00 0.00 ? 450 LEU A CD2  4  
ATOM   6223  H  H    . LEU A 1 93  ? -7.113  26.965  43.445  1.00 0.00 ? 450 LEU A H    4  
ATOM   6224  H  HA   . LEU A 1 93  ? -5.086  28.498  44.678  1.00 0.00 ? 450 LEU A HA   4  
ATOM   6225  H  HB2  . LEU A 1 93  ? -7.462  26.969  45.612  1.00 0.00 ? 450 LEU A HB2  4  
ATOM   6226  H  HB3  . LEU A 1 93  ? -6.267  27.473  46.805  1.00 0.00 ? 450 LEU A HB3  4  
ATOM   6227  H  HG   . LEU A 1 93  ? -7.400  29.505  44.936  1.00 0.00 ? 450 LEU A HG   4  
ATOM   6228  H  HD11 . LEU A 1 93  ? -8.783  28.870  47.510  1.00 0.00 ? 450 LEU A HD11 4  
ATOM   6229  H  HD12 . LEU A 1 93  ? -9.240  28.047  46.020  1.00 0.00 ? 450 LEU A HD12 4  
ATOM   6230  H  HD13 . LEU A 1 93  ? -9.361  29.803  46.129  1.00 0.00 ? 450 LEU A HD13 4  
ATOM   6231  H  HD21 . LEU A 1 93  ? -7.072  30.124  47.762  1.00 0.00 ? 450 LEU A HD21 4  
ATOM   6232  H  HD22 . LEU A 1 93  ? -6.447  30.956  46.338  1.00 0.00 ? 450 LEU A HD22 4  
ATOM   6233  H  HD23 . LEU A 1 93  ? -5.581  29.569  46.998  1.00 0.00 ? 450 LEU A HD23 4  
ATOM   6234  N  N    . HIS A 1 94  ? -4.895  25.237  45.023  1.00 0.00 ? 451 HIS A N    4  
ATOM   6235  C  CA   . HIS A 1 94  ? -4.009  24.145  45.410  1.00 0.00 ? 451 HIS A CA   4  
ATOM   6236  C  C    . HIS A 1 94  ? -2.614  24.343  44.826  1.00 0.00 ? 451 HIS A C    4  
ATOM   6237  O  O    . HIS A 1 94  ? -1.610  24.157  45.514  1.00 0.00 ? 451 HIS A O    4  
ATOM   6238  C  CB   . HIS A 1 94  ? -4.583  22.806  44.945  1.00 0.00 ? 451 HIS A CB   4  
ATOM   6239  C  CG   . HIS A 1 94  ? -3.577  21.697  44.926  1.00 0.00 ? 451 HIS A CG   4  
ATOM   6240  N  ND1  . HIS A 1 94  ? -3.157  21.042  46.064  1.00 0.00 ? 451 HIS A ND1  4  
ATOM   6241  C  CD2  . HIS A 1 94  ? -2.907  21.126  43.897  1.00 0.00 ? 451 HIS A CD2  4  
ATOM   6242  C  CE1  . HIS A 1 94  ? -2.271  20.118  45.737  1.00 0.00 ? 451 HIS A CE1  4  
ATOM   6243  N  NE2  . HIS A 1 94  ? -2.102  20.148  44.428  1.00 0.00 ? 451 HIS A NE2  4  
ATOM   6244  H  H    . HIS A 1 94  ? -5.746  25.030  44.584  1.00 0.00 ? 451 HIS A H    4  
ATOM   6245  H  HA   . HIS A 1 94  ? -3.938  24.141  46.487  1.00 0.00 ? 451 HIS A HA   4  
ATOM   6246  H  HB2  . HIS A 1 94  ? -5.384  22.515  45.608  1.00 0.00 ? 451 HIS A HB2  4  
ATOM   6247  H  HB3  . HIS A 1 94  ? -4.974  22.917  43.944  1.00 0.00 ? 451 HIS A HB3  4  
ATOM   6248  H  HD1  . HIS A 1 94  ? -3.462  21.228  46.977  1.00 0.00 ? 451 HIS A HD1  4  
ATOM   6249  H  HD2  . HIS A 1 94  ? -2.989  21.391  42.852  1.00 0.00 ? 451 HIS A HD2  4  
ATOM   6250  H  HE1  . HIS A 1 94  ? -1.771  19.451  46.423  1.00 0.00 ? 451 HIS A HE1  4  
ATOM   6251  N  N    . MET A 1 95  ? -2.558  24.722  43.553  1.00 0.00 ? 452 MET A N    4  
ATOM   6252  C  CA   . MET A 1 95  ? -1.286  24.946  42.877  1.00 0.00 ? 452 MET A CA   4  
ATOM   6253  C  C    . MET A 1 95  ? -0.313  25.695  43.784  1.00 0.00 ? 452 MET A C    4  
ATOM   6254  O  O    . MET A 1 95  ? 0.865   25.348  43.869  1.00 0.00 ? 452 MET A O    4  
ATOM   6255  C  CB   . MET A 1 95  ? -1.502  25.732  41.583  1.00 0.00 ? 452 MET A CB   4  
ATOM   6256  C  CG   . MET A 1 95  ? -2.147  24.914  40.476  1.00 0.00 ? 452 MET A CG   4  
ATOM   6257  S  SD   . MET A 1 95  ? -0.935  24.081  39.433  1.00 0.00 ? 452 MET A SD   4  
ATOM   6258  C  CE   . MET A 1 95  ? -0.671  22.571  40.359  1.00 0.00 ? 452 MET A CE   4  
ATOM   6259  H  H    . MET A 1 95  ? -3.393  24.854  43.056  1.00 0.00 ? 452 MET A H    4  
ATOM   6260  H  HA   . MET A 1 95  ? -0.864  23.982  42.636  1.00 0.00 ? 452 MET A HA   4  
ATOM   6261  H  HB2  . MET A 1 95  ? -2.139  26.579  41.792  1.00 0.00 ? 452 MET A HB2  4  
ATOM   6262  H  HB3  . MET A 1 95  ? -0.547  26.089  41.228  1.00 0.00 ? 452 MET A HB3  4  
ATOM   6263  H  HG2  . MET A 1 95  ? -2.787  24.168  40.923  1.00 0.00 ? 452 MET A HG2  4  
ATOM   6264  H  HG3  . MET A 1 95  ? -2.740  25.573  39.859  1.00 0.00 ? 452 MET A HG3  4  
ATOM   6265  H  HE1  . MET A 1 95  ? -1.561  22.336  40.925  1.00 0.00 ? 452 MET A HE1  4  
ATOM   6266  H  HE2  . MET A 1 95  ? -0.455  21.762  39.677  1.00 0.00 ? 452 MET A HE2  4  
ATOM   6267  H  HE3  . MET A 1 95  ? 0.161   22.704  41.035  1.00 0.00 ? 452 MET A HE3  4  
ATOM   6268  N  N    . LYS A 1 96  ? -0.814  26.724  44.459  1.00 0.00 ? 453 LYS A N    4  
ATOM   6269  C  CA   . LYS A 1 96  ? 0.009   27.522  45.360  1.00 0.00 ? 453 LYS A CA   4  
ATOM   6270  C  C    . LYS A 1 96  ? 1.040   26.650  46.071  1.00 0.00 ? 453 LYS A C    4  
ATOM   6271  O  O    . LYS A 1 96  ? 2.196   27.042  46.226  1.00 0.00 ? 453 LYS A O    4  
ATOM   6272  C  CB   . LYS A 1 96  ? -0.870  28.234  46.391  1.00 0.00 ? 453 LYS A CB   4  
ATOM   6273  C  CG   . LYS A 1 96  ? -1.837  29.232  45.779  1.00 0.00 ? 453 LYS A CG   4  
ATOM   6274  C  CD   . LYS A 1 96  ? -1.181  30.586  45.565  1.00 0.00 ? 453 LYS A CD   4  
ATOM   6275  C  CE   . LYS A 1 96  ? -2.209  31.706  45.542  1.00 0.00 ? 453 LYS A CE   4  
ATOM   6276  N  NZ   . LYS A 1 96  ? -3.050  31.663  44.314  1.00 0.00 ? 453 LYS A NZ   4  
ATOM   6277  H  H    . LYS A 1 96  ? -1.762  26.952  44.349  1.00 0.00 ? 453 LYS A H    4  
ATOM   6278  H  HA   . LYS A 1 96  ? 0.527   28.261  44.769  1.00 0.00 ? 453 LYS A HA   4  
ATOM   6279  H  HB2  . LYS A 1 96  ? -1.442  27.494  46.931  1.00 0.00 ? 453 LYS A HB2  4  
ATOM   6280  H  HB3  . LYS A 1 96  ? -0.233  28.761  47.086  1.00 0.00 ? 453 LYS A HB3  4  
ATOM   6281  H  HG2  . LYS A 1 96  ? -2.176  28.854  44.826  1.00 0.00 ? 453 LYS A HG2  4  
ATOM   6282  H  HG3  . LYS A 1 96  ? -2.682  29.353  46.442  1.00 0.00 ? 453 LYS A HG3  4  
ATOM   6283  H  HD2  . LYS A 1 96  ? -0.483  30.769  46.369  1.00 0.00 ? 453 LYS A HD2  4  
ATOM   6284  H  HD3  . LYS A 1 96  ? -0.652  30.574  44.623  1.00 0.00 ? 453 LYS A HD3  4  
ATOM   6285  H  HE2  . LYS A 1 96  ? -2.846  31.611  46.408  1.00 0.00 ? 453 LYS A HE2  4  
ATOM   6286  H  HE3  . LYS A 1 96  ? -1.690  32.653  45.580  1.00 0.00 ? 453 LYS A HE3  4  
ATOM   6287  H  HZ1  . LYS A 1 96  ? -2.461  31.443  43.485  1.00 0.00 ? 453 LYS A HZ1  4  
ATOM   6288  H  HZ2  . LYS A 1 96  ? -3.511  32.583  44.165  1.00 0.00 ? 453 LYS A HZ2  4  
ATOM   6289  H  HZ3  . LYS A 1 96  ? -3.782  30.931  44.409  1.00 0.00 ? 453 LYS A HZ3  4  
ATOM   6290  N  N    . ARG A 1 97  ? 0.613   25.466  46.498  1.00 0.00 ? 454 ARG A N    4  
ATOM   6291  C  CA   . ARG A 1 97  ? 1.500   24.539  47.191  1.00 0.00 ? 454 ARG A CA   4  
ATOM   6292  C  C    . ARG A 1 97  ? 2.608   24.051  46.264  1.00 0.00 ? 454 ARG A C    4  
ATOM   6293  O  O    . ARG A 1 97  ? 3.789   24.106  46.608  1.00 0.00 ? 454 ARG A O    4  
ATOM   6294  C  CB   . ARG A 1 97  ? 0.706   23.347  47.728  1.00 0.00 ? 454 ARG A CB   4  
ATOM   6295  C  CG   . ARG A 1 97  ? 0.191   23.545  49.144  1.00 0.00 ? 454 ARG A CG   4  
ATOM   6296  C  CD   . ARG A 1 97  ? 1.260   23.220  50.176  1.00 0.00 ? 454 ARG A CD   4  
ATOM   6297  N  NE   . ARG A 1 97  ? 0.682   22.878  51.473  1.00 0.00 ? 454 ARG A NE   4  
ATOM   6298  C  CZ   . ARG A 1 97  ? 1.386   22.815  52.598  1.00 0.00 ? 454 ARG A CZ   4  
ATOM   6299  N  NH1  . ARG A 1 97  ? 2.687   23.070  52.585  1.00 0.00 ? 454 ARG A NH1  4  
ATOM   6300  N  NH2  . ARG A 1 97  ? 0.789   22.497  53.739  1.00 0.00 ? 454 ARG A NH2  4  
ATOM   6301  H  H    . ARG A 1 97  ? -0.320  25.210  46.344  1.00 0.00 ? 454 ARG A H    4  
ATOM   6302  H  HA   . ARG A 1 97  ? 1.947   25.066  48.021  1.00 0.00 ? 454 ARG A HA   4  
ATOM   6303  H  HB2  . ARG A 1 97  ? -0.142  23.172  47.082  1.00 0.00 ? 454 ARG A HB2  4  
ATOM   6304  H  HB3  . ARG A 1 97  ? 1.341   22.474  47.718  1.00 0.00 ? 454 ARG A HB3  4  
ATOM   6305  H  HG2  . ARG A 1 97  ? -0.110  24.575  49.267  1.00 0.00 ? 454 ARG A HG2  4  
ATOM   6306  H  HG3  . ARG A 1 97  ? -0.659  22.898  49.302  1.00 0.00 ? 454 ARG A HG3  4  
ATOM   6307  H  HD2  . ARG A 1 97  ? 1.842   22.383  49.821  1.00 0.00 ? 454 ARG A HD2  4  
ATOM   6308  H  HD3  . ARG A 1 97  ? 1.901   24.081  50.294  1.00 0.00 ? 454 ARG A HD3  4  
ATOM   6309  H  HE   . ARG A 1 97  ? -0.278  22.686  51.506  1.00 0.00 ? 454 ARG A HE   4  
ATOM   6310  H  HH11 . ARG A 1 97  ? 3.140   23.311  51.726  1.00 0.00 ? 454 ARG A HH11 4  
ATOM   6311  H  HH12 . ARG A 1 97  ? 3.215   23.023  53.433  1.00 0.00 ? 454 ARG A HH12 4  
ATOM   6312  H  HH21 . ARG A 1 97  ? -0.192  22.304  53.753  1.00 0.00 ? 454 ARG A HH21 4  
ATOM   6313  H  HH22 . ARG A 1 97  ? 1.319   22.450  54.585  1.00 0.00 ? 454 ARG A HH22 4  
ATOM   6314  N  N    . HIS A 1 98  ? 2.220   23.572  45.086  1.00 0.00 ? 455 HIS A N    4  
ATOM   6315  C  CA   . HIS A 1 98  ? 3.181   23.073  44.109  1.00 0.00 ? 455 HIS A CA   4  
ATOM   6316  C  C    . HIS A 1 98  ? 4.120   24.186  43.655  1.00 0.00 ? 455 HIS A C    4  
ATOM   6317  O  O    . HIS A 1 98  ? 5.339   24.017  43.648  1.00 0.00 ? 455 HIS A O    4  
ATOM   6318  C  CB   . HIS A 1 98  ? 2.452   22.480  42.903  1.00 0.00 ? 455 HIS A CB   4  
ATOM   6319  C  CG   . HIS A 1 98  ? 1.906   21.108  43.148  1.00 0.00 ? 455 HIS A CG   4  
ATOM   6320  N  ND1  . HIS A 1 98  ? 2.447   20.236  44.069  1.00 0.00 ? 455 HIS A ND1  4  
ATOM   6321  C  CD2  . HIS A 1 98  ? 0.860   20.457  42.586  1.00 0.00 ? 455 HIS A CD2  4  
ATOM   6322  C  CE1  . HIS A 1 98  ? 1.759   19.109  44.063  1.00 0.00 ? 455 HIS A CE1  4  
ATOM   6323  N  NE2  . HIS A 1 98  ? 0.790   19.217  43.172  1.00 0.00 ? 455 HIS A NE2  4  
ATOM   6324  H  H    . HIS A 1 98  ? 1.264   23.554  44.870  1.00 0.00 ? 455 HIS A H    4  
ATOM   6325  H  HA   . HIS A 1 98  ? 3.764   22.298  44.583  1.00 0.00 ? 455 HIS A HA   4  
ATOM   6326  H  HB2  . HIS A 1 98  ? 1.625   23.123  42.638  1.00 0.00 ? 455 HIS A HB2  4  
ATOM   6327  H  HB3  . HIS A 1 98  ? 3.137   22.422  42.069  1.00 0.00 ? 455 HIS A HB3  4  
ATOM   6328  H  HD1  . HIS A 1 98  ? 3.222   20.416  44.641  1.00 0.00 ? 455 HIS A HD1  4  
ATOM   6329  H  HD2  . HIS A 1 98  ? 0.203   20.842  41.819  1.00 0.00 ? 455 HIS A HD2  4  
ATOM   6330  H  HE1  . HIS A 1 98  ? 1.954   18.245  44.681  1.00 0.00 ? 455 HIS A HE1  4  
ATOM   6331  N  N    . GLN A 1 99  ? 3.544   25.322  43.275  1.00 0.00 ? 456 GLN A N    4  
ATOM   6332  C  CA   . GLN A 1 99  ? 4.331   26.461  42.818  1.00 0.00 ? 456 GLN A CA   4  
ATOM   6333  C  C    . GLN A 1 99  ? 5.534   26.693  43.727  1.00 0.00 ? 456 GLN A C    4  
ATOM   6334  O  O    . GLN A 1 99  ? 5.582   26.189  44.849  1.00 0.00 ? 456 GLN A O    4  
ATOM   6335  C  CB   . GLN A 1 99  ? 3.464   27.721  42.770  1.00 0.00 ? 456 GLN A CB   4  
ATOM   6336  C  CG   . GLN A 1 99  ? 2.434   27.707  41.652  1.00 0.00 ? 456 GLN A CG   4  
ATOM   6337  C  CD   . GLN A 1 99  ? 1.683   29.019  41.535  1.00 0.00 ? 456 GLN A CD   4  
ATOM   6338  O  OE1  . GLN A 1 99  ? 2.276   30.096  41.603  1.00 0.00 ? 456 GLN A OE1  4  
ATOM   6339  N  NE2  . GLN A 1 99  ? 0.370   28.935  41.357  1.00 0.00 ? 456 GLN A NE2  4  
ATOM   6340  H  H    . GLN A 1 99  ? 2.568   25.396  43.303  1.00 0.00 ? 456 GLN A H    4  
ATOM   6341  H  HA   . GLN A 1 99  ? 4.686   26.241  41.823  1.00 0.00 ? 456 GLN A HA   4  
ATOM   6342  H  HB2  . GLN A 1 99  ? 2.943   27.821  43.710  1.00 0.00 ? 456 GLN A HB2  4  
ATOM   6343  H  HB3  . GLN A 1 99  ? 4.105   28.579  42.629  1.00 0.00 ? 456 GLN A HB3  4  
ATOM   6344  H  HG2  . GLN A 1 99  ? 2.939   27.515  40.716  1.00 0.00 ? 456 GLN A HG2  4  
ATOM   6345  H  HG3  . GLN A 1 99  ? 1.723   26.918  41.844  1.00 0.00 ? 456 GLN A HG3  4  
ATOM   6346  H  HE21 . GLN A 1 99  ? -0.035  28.043  41.314  1.00 0.00 ? 456 GLN A HE21 4  
ATOM   6347  H  HE22 . GLN A 1 99  ? -0.141  29.767  41.279  1.00 0.00 ? 456 GLN A HE22 4  
ATOM   6348  N  N    . ASN A 1 100 ? 6.503   27.457  43.235  1.00 0.00 ? 457 ASN A N    4  
ATOM   6349  C  CA   . ASN A 1 100 ? 7.707   27.754  44.003  1.00 0.00 ? 457 ASN A CA   4  
ATOM   6350  C  C    . ASN A 1 100 ? 7.361   28.076  45.454  1.00 0.00 ? 457 ASN A C    4  
ATOM   6351  O  O    . ASN A 1 100 ? 6.204   28.333  45.784  1.00 0.00 ? 457 ASN A O    4  
ATOM   6352  C  CB   . ASN A 1 100 ? 8.462   28.927  43.375  1.00 0.00 ? 457 ASN A CB   4  
ATOM   6353  C  CG   . ASN A 1 100 ? 9.755   29.239  44.103  1.00 0.00 ? 457 ASN A CG   4  
ATOM   6354  O  OD1  . ASN A 1 100 ? 10.245  28.433  44.894  1.00 0.00 ? 457 ASN A OD1  4  
ATOM   6355  N  ND2  . ASN A 1 100 ? 10.314  30.414  43.838  1.00 0.00 ? 457 ASN A ND2  4  
ATOM   6356  H  H    . ASN A 1 100 ? 6.408   27.830  42.334  1.00 0.00 ? 457 ASN A H    4  
ATOM   6357  H  HA   . ASN A 1 100 ? 8.338   26.878  43.982  1.00 0.00 ? 457 ASN A HA   4  
ATOM   6358  H  HB2  . ASN A 1 100 ? 8.698   28.686  42.348  1.00 0.00 ? 457 ASN A HB2  4  
ATOM   6359  H  HB3  . ASN A 1 100 ? 7.835   29.805  43.399  1.00 0.00 ? 457 ASN A HB3  4  
ATOM   6360  H  HD21 . ASN A 1 100 ? 9.867   31.006  43.197  1.00 0.00 ? 457 ASN A HD21 4  
ATOM   6361  H  HD22 . ASN A 1 100 ? 11.151  30.641  44.295  1.00 0.00 ? 457 ASN A HD22 4  
HETATM 6362  ZN ZN   . ZN  B 2 .   ? 15.489  -0.646  11.189  1.00 0.00 ? 100 ZN  A ZN   4  
HETATM 6363  ZN ZN   . ZN  C 2 .   ? -0.665  12.170  27.101  1.00 0.00 ? 200 ZN  A ZN   4  
HETATM 6364  ZN ZN   . ZN  D 2 .   ? -1.222  18.825  43.167  1.00 0.00 ? 300 ZN  A ZN   4  
ATOM   6365  N  N    . GLY A 1 1   ? 68.120  -28.603 31.523  1.00 0.00 ? 358 GLY A N    5  
ATOM   6366  C  CA   . GLY A 1 1   ? 67.313  -27.398 31.557  1.00 0.00 ? 358 GLY A CA   5  
ATOM   6367  C  C    . GLY A 1 1   ? 65.936  -27.605 30.960  1.00 0.00 ? 358 GLY A C    5  
ATOM   6368  O  O    . GLY A 1 1   ? 65.652  -28.657 30.387  1.00 0.00 ? 358 GLY A O    5  
ATOM   6369  H  H1   . GLY A 1 1   ? 67.717  -29.453 31.248  1.00 0.00 ? 358 GLY A H1   5  
ATOM   6370  H  HA2  . GLY A 1 1   ? 67.205  -27.079 32.583  1.00 0.00 ? 358 GLY A HA2  5  
ATOM   6371  H  HA3  . GLY A 1 1   ? 67.821  -26.622 31.002  1.00 0.00 ? 358 GLY A HA3  5  
ATOM   6372  N  N    . SER A 1 2   ? 65.076  -26.600 31.095  1.00 0.00 ? 359 SER A N    5  
ATOM   6373  C  CA   . SER A 1 2   ? 63.719  -26.679 30.568  1.00 0.00 ? 359 SER A CA   5  
ATOM   6374  C  C    . SER A 1 2   ? 62.998  -25.344 30.722  1.00 0.00 ? 359 SER A C    5  
ATOM   6375  O  O    . SER A 1 2   ? 63.280  -24.576 31.642  1.00 0.00 ? 359 SER A O    5  
ATOM   6376  C  CB   . SER A 1 2   ? 62.935  -27.781 31.284  1.00 0.00 ? 359 SER A CB   5  
ATOM   6377  O  OG   . SER A 1 2   ? 61.620  -27.888 30.768  1.00 0.00 ? 359 SER A OG   5  
ATOM   6378  H  H    . SER A 1 2   ? 65.362  -25.787 31.562  1.00 0.00 ? 359 SER A H    5  
ATOM   6379  H  HA   . SER A 1 2   ? 63.784  -26.920 29.517  1.00 0.00 ? 359 SER A HA   5  
ATOM   6380  H  HB2  . SER A 1 2   ? 63.440  -28.725 31.148  1.00 0.00 ? 359 SER A HB2  5  
ATOM   6381  H  HB3  . SER A 1 2   ? 62.878  -27.551 32.338  1.00 0.00 ? 359 SER A HB3  5  
ATOM   6382  H  HG   . SER A 1 2   ? 61.120  -27.101 30.996  1.00 0.00 ? 359 SER A HG   5  
ATOM   6383  N  N    . SER A 1 3   ? 62.064  -25.074 29.815  1.00 0.00 ? 360 SER A N    5  
ATOM   6384  C  CA   . SER A 1 3   ? 61.304  -23.830 29.847  1.00 0.00 ? 360 SER A CA   5  
ATOM   6385  C  C    . SER A 1 3   ? 60.130  -23.886 28.875  1.00 0.00 ? 360 SER A C    5  
ATOM   6386  O  O    . SER A 1 3   ? 59.987  -24.839 28.111  1.00 0.00 ? 360 SER A O    5  
ATOM   6387  C  CB   . SER A 1 3   ? 62.209  -22.645 29.502  1.00 0.00 ? 360 SER A CB   5  
ATOM   6388  O  OG   . SER A 1 3   ? 61.638  -21.424 29.936  1.00 0.00 ? 360 SER A OG   5  
ATOM   6389  H  H    . SER A 1 3   ? 61.885  -25.726 29.106  1.00 0.00 ? 360 SER A H    5  
ATOM   6390  H  HA   . SER A 1 3   ? 60.922  -23.701 30.848  1.00 0.00 ? 360 SER A HA   5  
ATOM   6391  H  HB2  . SER A 1 3   ? 63.165  -22.774 29.987  1.00 0.00 ? 360 SER A HB2  5  
ATOM   6392  H  HB3  . SER A 1 3   ? 62.351  -22.603 28.432  1.00 0.00 ? 360 SER A HB3  5  
ATOM   6393  H  HG   . SER A 1 3   ? 61.379  -20.902 29.173  1.00 0.00 ? 360 SER A HG   5  
ATOM   6394  N  N    . GLY A 1 4   ? 59.290  -22.856 28.911  1.00 0.00 ? 361 GLY A N    5  
ATOM   6395  C  CA   . GLY A 1 4   ? 58.138  -22.806 28.030  1.00 0.00 ? 361 GLY A CA   5  
ATOM   6396  C  C    . GLY A 1 4   ? 57.461  -21.450 28.036  1.00 0.00 ? 361 GLY A C    5  
ATOM   6397  O  O    . GLY A 1 4   ? 57.951  -20.507 28.657  1.00 0.00 ? 361 GLY A O    5  
ATOM   6398  H  H    . GLY A 1 4   ? 59.454  -22.123 29.541  1.00 0.00 ? 361 GLY A H    5  
ATOM   6399  H  HA2  . GLY A 1 4   ? 58.458  -23.033 27.024  1.00 0.00 ? 361 GLY A HA2  5  
ATOM   6400  H  HA3  . GLY A 1 4   ? 57.424  -23.553 28.347  1.00 0.00 ? 361 GLY A HA3  5  
ATOM   6401  N  N    . SER A 1 5   ? 56.332  -21.351 27.341  1.00 0.00 ? 362 SER A N    5  
ATOM   6402  C  CA   . SER A 1 5   ? 55.590  -20.098 27.264  1.00 0.00 ? 362 SER A CA   5  
ATOM   6403  C  C    . SER A 1 5   ? 54.181  -20.334 26.728  1.00 0.00 ? 362 SER A C    5  
ATOM   6404  O  O    . SER A 1 5   ? 53.883  -21.393 26.177  1.00 0.00 ? 362 SER A O    5  
ATOM   6405  C  CB   . SER A 1 5   ? 56.326  -19.098 26.370  1.00 0.00 ? 362 SER A CB   5  
ATOM   6406  O  OG   . SER A 1 5   ? 57.342  -18.422 27.091  1.00 0.00 ? 362 SER A OG   5  
ATOM   6407  H  H    . SER A 1 5   ? 55.992  -22.138 26.866  1.00 0.00 ? 362 SER A H    5  
ATOM   6408  H  HA   . SER A 1 5   ? 55.520  -19.692 28.262  1.00 0.00 ? 362 SER A HA   5  
ATOM   6409  H  HB2  . SER A 1 5   ? 56.778  -19.624 25.543  1.00 0.00 ? 362 SER A HB2  5  
ATOM   6410  H  HB3  . SER A 1 5   ? 55.623  -18.370 25.993  1.00 0.00 ? 362 SER A HB3  5  
ATOM   6411  H  HG   . SER A 1 5   ? 56.941  -17.861 27.760  1.00 0.00 ? 362 SER A HG   5  
ATOM   6412  N  N    . SER A 1 6   ? 53.317  -19.338 26.895  1.00 0.00 ? 363 SER A N    5  
ATOM   6413  C  CA   . SER A 1 6   ? 51.937  -19.437 26.433  1.00 0.00 ? 363 SER A CA   5  
ATOM   6414  C  C    . SER A 1 6   ? 51.235  -18.085 26.526  1.00 0.00 ? 363 SER A C    5  
ATOM   6415  O  O    . SER A 1 6   ? 51.668  -17.197 27.258  1.00 0.00 ? 363 SER A O    5  
ATOM   6416  C  CB   . SER A 1 6   ? 51.175  -20.478 27.255  1.00 0.00 ? 363 SER A CB   5  
ATOM   6417  O  OG   . SER A 1 6   ? 51.218  -20.168 28.637  1.00 0.00 ? 363 SER A OG   5  
ATOM   6418  H  H    . SER A 1 6   ? 53.614  -18.518 27.343  1.00 0.00 ? 363 SER A H    5  
ATOM   6419  H  HA   . SER A 1 6   ? 51.956  -19.749 25.400  1.00 0.00 ? 363 SER A HA   5  
ATOM   6420  H  HB2  . SER A 1 6   ? 50.144  -20.501 26.935  1.00 0.00 ? 363 SER A HB2  5  
ATOM   6421  H  HB3  . SER A 1 6   ? 51.621  -21.450 27.102  1.00 0.00 ? 363 SER A HB3  5  
ATOM   6422  H  HG   . SER A 1 6   ? 50.367  -19.821 28.914  1.00 0.00 ? 363 SER A HG   5  
ATOM   6423  N  N    . GLY A 1 7   ? 50.146  -17.938 25.777  1.00 0.00 ? 364 GLY A N    5  
ATOM   6424  C  CA   . GLY A 1 7   ? 49.401  -16.694 25.788  1.00 0.00 ? 364 GLY A CA   5  
ATOM   6425  C  C    . GLY A 1 7   ? 48.154  -16.757 24.928  1.00 0.00 ? 364 GLY A C    5  
ATOM   6426  O  O    . GLY A 1 7   ? 48.196  -16.530 23.719  1.00 0.00 ? 364 GLY A O    5  
ATOM   6427  H  H    . GLY A 1 7   ? 49.847  -18.681 25.212  1.00 0.00 ? 364 GLY A H    5  
ATOM   6428  H  HA2  . GLY A 1 7   ? 49.114  -16.468 26.804  1.00 0.00 ? 364 GLY A HA2  5  
ATOM   6429  H  HA3  . GLY A 1 7   ? 50.037  -15.903 25.420  1.00 0.00 ? 364 GLY A HA3  5  
ATOM   6430  N  N    . PRO A 1 8   ? 47.012  -17.073 25.557  1.00 0.00 ? 365 PRO A N    5  
ATOM   6431  C  CA   . PRO A 1 8   ? 45.726  -17.174 24.860  1.00 0.00 ? 365 PRO A CA   5  
ATOM   6432  C  C    . PRO A 1 8   ? 45.210  -15.816 24.397  1.00 0.00 ? 365 PRO A C    5  
ATOM   6433  O  O    . PRO A 1 8   ? 45.888  -14.800 24.546  1.00 0.00 ? 365 PRO A O    5  
ATOM   6434  C  CB   . PRO A 1 8   ? 44.794  -17.768 25.920  1.00 0.00 ? 365 PRO A CB   5  
ATOM   6435  C  CG   . PRO A 1 8   ? 45.401  -17.374 27.222  1.00 0.00 ? 365 PRO A CG   5  
ATOM   6436  C  CD   . PRO A 1 8   ? 46.888  -17.356 26.997  1.00 0.00 ? 365 PRO A CD   5  
ATOM   6437  H  HA   . PRO A 1 8   ? 45.785  -17.843 24.014  1.00 0.00 ? 365 PRO A HA   5  
ATOM   6438  H  HB2  . PRO A 1 8   ? 43.803  -17.353 25.803  1.00 0.00 ? 365 PRO A HB2  5  
ATOM   6439  H  HB3  . PRO A 1 8   ? 44.757  -18.841 25.811  1.00 0.00 ? 365 PRO A HB3  5  
ATOM   6440  H  HG2  . PRO A 1 8   ? 45.053  -16.393 27.507  1.00 0.00 ? 365 PRO A HG2  5  
ATOM   6441  H  HG3  . PRO A 1 8   ? 45.146  -18.099 27.980  1.00 0.00 ? 365 PRO A HG3  5  
ATOM   6442  H  HD2  . PRO A 1 8   ? 47.349  -16.575 27.584  1.00 0.00 ? 365 PRO A HD2  5  
ATOM   6443  H  HD3  . PRO A 1 8   ? 47.318  -18.317 27.239  1.00 0.00 ? 365 PRO A HD3  5  
ATOM   6444  N  N    . ASP A 1 9   ? 44.006  -15.807 23.835  1.00 0.00 ? 366 ASP A N    5  
ATOM   6445  C  CA   . ASP A 1 9   ? 43.397  -14.573 23.352  1.00 0.00 ? 366 ASP A CA   5  
ATOM   6446  C  C    . ASP A 1 9   ? 41.875  -14.660 23.404  1.00 0.00 ? 366 ASP A C    5  
ATOM   6447  O  O    . ASP A 1 9   ? 41.306  -15.752 23.438  1.00 0.00 ? 366 ASP A O    5  
ATOM   6448  C  CB   . ASP A 1 9   ? 43.855  -14.280 21.922  1.00 0.00 ? 366 ASP A CB   5  
ATOM   6449  C  CG   . ASP A 1 9   ? 43.892  -12.795 21.618  1.00 0.00 ? 366 ASP A CG   5  
ATOM   6450  O  OD1  . ASP A 1 9   ? 42.842  -12.243 21.229  1.00 0.00 ? 366 ASP A OD1  5  
ATOM   6451  O  OD2  . ASP A 1 9   ? 44.972  -12.185 21.770  1.00 0.00 ? 366 ASP A OD2  5  
ATOM   6452  H  H    . ASP A 1 9   ? 43.514  -16.650 23.745  1.00 0.00 ? 366 ASP A H    5  
ATOM   6453  H  HA   . ASP A 1 9   ? 43.721  -13.769 23.995  1.00 0.00 ? 366 ASP A HA   5  
ATOM   6454  H  HB2  . ASP A 1 9   ? 44.847  -14.683 21.778  1.00 0.00 ? 366 ASP A HB2  5  
ATOM   6455  H  HB3  . ASP A 1 9   ? 43.175  -14.754 21.229  1.00 0.00 ? 366 ASP A HB3  5  
ATOM   6456  N  N    . LEU A 1 10  ? 41.221  -13.504 23.411  1.00 0.00 ? 367 LEU A N    5  
ATOM   6457  C  CA   . LEU A 1 10  ? 39.764  -13.449 23.460  1.00 0.00 ? 367 LEU A CA   5  
ATOM   6458  C  C    . LEU A 1 10  ? 39.240  -12.224 22.720  1.00 0.00 ? 367 LEU A C    5  
ATOM   6459  O  O    . LEU A 1 10  ? 40.007  -11.336 22.349  1.00 0.00 ? 367 LEU A O    5  
ATOM   6460  C  CB   . LEU A 1 10  ? 39.284  -13.426 24.913  1.00 0.00 ? 367 LEU A CB   5  
ATOM   6461  C  CG   . LEU A 1 10  ? 39.378  -14.750 25.672  1.00 0.00 ? 367 LEU A CG   5  
ATOM   6462  C  CD1  . LEU A 1 10  ? 39.255  -14.516 27.170  1.00 0.00 ? 367 LEU A CD1  5  
ATOM   6463  C  CD2  . LEU A 1 10  ? 38.305  -15.717 25.192  1.00 0.00 ? 367 LEU A CD2  5  
ATOM   6464  H  H    . LEU A 1 10  ? 41.729  -12.667 23.382  1.00 0.00 ? 367 LEU A H    5  
ATOM   6465  H  HA   . LEU A 1 10  ? 39.383  -14.337 22.978  1.00 0.00 ? 367 LEU A HA   5  
ATOM   6466  H  HB2  . LEU A 1 10  ? 39.876  -12.697 25.445  1.00 0.00 ? 367 LEU A HB2  5  
ATOM   6467  H  HB3  . LEU A 1 10  ? 38.249  -13.115 24.913  1.00 0.00 ? 367 LEU A HB3  5  
ATOM   6468  H  HG   . LEU A 1 10  ? 40.343  -15.199 25.483  1.00 0.00 ? 367 LEU A HG   5  
ATOM   6469  H  HD11 . LEU A 1 10  ? 40.233  -14.324 27.585  1.00 0.00 ? 367 LEU A HD11 5  
ATOM   6470  H  HD12 . LEU A 1 10  ? 38.831  -15.392 27.637  1.00 0.00 ? 367 LEU A HD12 5  
ATOM   6471  H  HD13 . LEU A 1 10  ? 38.614  -13.666 27.350  1.00 0.00 ? 367 LEU A HD13 5  
ATOM   6472  H  HD21 . LEU A 1 10  ? 37.508  -15.760 25.920  1.00 0.00 ? 367 LEU A HD21 5  
ATOM   6473  H  HD22 . LEU A 1 10  ? 38.736  -16.699 25.070  1.00 0.00 ? 367 LEU A HD22 5  
ATOM   6474  H  HD23 . LEU A 1 10  ? 37.911  -15.376 24.245  1.00 0.00 ? 367 LEU A HD23 5  
ATOM   6475  N  N    . GLU A 1 11  ? 37.928  -12.182 22.509  1.00 0.00 ? 368 GLU A N    5  
ATOM   6476  C  CA   . GLU A 1 11  ? 37.302  -11.064 21.814  1.00 0.00 ? 368 GLU A CA   5  
ATOM   6477  C  C    . GLU A 1 11  ? 35.795  -11.050 22.052  1.00 0.00 ? 368 GLU A C    5  
ATOM   6478  O  O    . GLU A 1 11  ? 35.176  -12.096 22.253  1.00 0.00 ? 368 GLU A O    5  
ATOM   6479  C  CB   . GLU A 1 11  ? 37.591  -11.141 20.313  1.00 0.00 ? 368 GLU A CB   5  
ATOM   6480  C  CG   . GLU A 1 11  ? 36.794  -12.215 19.594  1.00 0.00 ? 368 GLU A CG   5  
ATOM   6481  C  CD   . GLU A 1 11  ? 36.605  -11.913 18.120  1.00 0.00 ? 368 GLU A CD   5  
ATOM   6482  O  OE1  . GLU A 1 11  ? 37.550  -12.156 17.340  1.00 0.00 ? 368 GLU A OE1  5  
ATOM   6483  O  OE2  . GLU A 1 11  ? 35.514  -11.435 17.747  1.00 0.00 ? 368 GLU A OE2  5  
ATOM   6484  H  H    . GLU A 1 11  ? 37.369  -12.920 22.829  1.00 0.00 ? 368 GLU A H    5  
ATOM   6485  H  HA   . GLU A 1 11  ? 37.724  -10.151 22.206  1.00 0.00 ? 368 GLU A HA   5  
ATOM   6486  H  HB2  . GLU A 1 11  ? 37.358  -10.186 19.864  1.00 0.00 ? 368 GLU A HB2  5  
ATOM   6487  H  HB3  . GLU A 1 11  ? 38.642  -11.347 20.172  1.00 0.00 ? 368 GLU A HB3  5  
ATOM   6488  H  HG2  . GLU A 1 11  ? 37.315  -13.156 19.689  1.00 0.00 ? 368 GLU A HG2  5  
ATOM   6489  H  HG3  . GLU A 1 11  ? 35.822  -12.295 20.057  1.00 0.00 ? 368 GLU A HG3  5  
ATOM   6490  N  N    . LYS A 1 12  ? 35.209  -9.858  22.029  1.00 0.00 ? 369 LYS A N    5  
ATOM   6491  C  CA   . LYS A 1 12  ? 33.774  -9.706  22.241  1.00 0.00 ? 369 LYS A CA   5  
ATOM   6492  C  C    . LYS A 1 12  ? 33.295  -8.339  21.763  1.00 0.00 ? 369 LYS A C    5  
ATOM   6493  O  O    . LYS A 1 12  ? 33.691  -7.307  22.306  1.00 0.00 ? 369 LYS A O    5  
ATOM   6494  C  CB   . LYS A 1 12  ? 33.435  -9.887  23.722  1.00 0.00 ? 369 LYS A CB   5  
ATOM   6495  C  CG   . LYS A 1 12  ? 33.969  -8.776  24.609  1.00 0.00 ? 369 LYS A CG   5  
ATOM   6496  C  CD   . LYS A 1 12  ? 33.894  -9.151  26.080  1.00 0.00 ? 369 LYS A CD   5  
ATOM   6497  C  CE   . LYS A 1 12  ? 34.318  -7.995  26.973  1.00 0.00 ? 369 LYS A CE   5  
ATOM   6498  N  NZ   . LYS A 1 12  ? 33.327  -6.884  26.949  1.00 0.00 ? 369 LYS A NZ   5  
ATOM   6499  H  H    . LYS A 1 12  ? 35.755  -9.060  21.864  1.00 0.00 ? 369 LYS A H    5  
ATOM   6500  H  HA   . LYS A 1 12  ? 33.271  -10.470 21.669  1.00 0.00 ? 369 LYS A HA   5  
ATOM   6501  H  HB2  . LYS A 1 12  ? 32.361  -9.922  23.832  1.00 0.00 ? 369 LYS A HB2  5  
ATOM   6502  H  HB3  . LYS A 1 12  ? 33.853  -10.824 24.063  1.00 0.00 ? 369 LYS A HB3  5  
ATOM   6503  H  HG2  . LYS A 1 12  ? 35.000  -8.585  24.350  1.00 0.00 ? 369 LYS A HG2  5  
ATOM   6504  H  HG3  . LYS A 1 12  ? 33.384  -7.883  24.444  1.00 0.00 ? 369 LYS A HG3  5  
ATOM   6505  H  HD2  . LYS A 1 12  ? 32.877  -9.424  26.321  1.00 0.00 ? 369 LYS A HD2  5  
ATOM   6506  H  HD3  . LYS A 1 12  ? 34.547  -9.993  26.262  1.00 0.00 ? 369 LYS A HD3  5  
ATOM   6507  H  HE2  . LYS A 1 12  ? 34.416  -8.356  27.985  1.00 0.00 ? 369 LYS A HE2  5  
ATOM   6508  H  HE3  . LYS A 1 12  ? 35.272  -7.623  26.629  1.00 0.00 ? 369 LYS A HE3  5  
ATOM   6509  H  HZ1  . LYS A 1 12  ? 32.451  -7.195  26.483  1.00 0.00 ? 369 LYS A HZ1  5  
ATOM   6510  H  HZ2  . LYS A 1 12  ? 33.714  -6.071  26.428  1.00 0.00 ? 369 LYS A HZ2  5  
ATOM   6511  H  HZ3  . LYS A 1 12  ? 33.103  -6.584  27.919  1.00 0.00 ? 369 LYS A HZ3  5  
ATOM   6512  N  N    . ARG A 1 13  ? 32.441  -8.339  20.745  1.00 0.00 ? 370 ARG A N    5  
ATOM   6513  C  CA   . ARG A 1 13  ? 31.909  -7.098  20.194  1.00 0.00 ? 370 ARG A CA   5  
ATOM   6514  C  C    . ARG A 1 13  ? 30.414  -6.975  20.478  1.00 0.00 ? 370 ARG A C    5  
ATOM   6515  O  O    . ARG A 1 13  ? 29.733  -7.972  20.714  1.00 0.00 ? 370 ARG A O    5  
ATOM   6516  C  CB   . ARG A 1 13  ? 32.159  -7.035  18.687  1.00 0.00 ? 370 ARG A CB   5  
ATOM   6517  C  CG   . ARG A 1 13  ? 33.607  -6.754  18.321  1.00 0.00 ? 370 ARG A CG   5  
ATOM   6518  C  CD   . ARG A 1 13  ? 33.911  -5.265  18.350  1.00 0.00 ? 370 ARG A CD   5  
ATOM   6519  N  NE   . ARG A 1 13  ? 33.642  -4.626  17.065  1.00 0.00 ? 370 ARG A NE   5  
ATOM   6520  C  CZ   . ARG A 1 13  ? 34.465  -4.692  16.025  1.00 0.00 ? 370 ARG A CZ   5  
ATOM   6521  N  NH1  . ARG A 1 13  ? 35.603  -5.366  16.118  1.00 0.00 ? 370 ARG A NH1  5  
ATOM   6522  N  NH2  . ARG A 1 13  ? 34.150  -4.085  14.888  1.00 0.00 ? 370 ARG A NH2  5  
ATOM   6523  H  H    . ARG A 1 13  ? 32.163  -9.193  20.354  1.00 0.00 ? 370 ARG A H    5  
ATOM   6524  H  HA   . ARG A 1 13  ? 32.422  -6.276  20.670  1.00 0.00 ? 370 ARG A HA   5  
ATOM   6525  H  HB2  . ARG A 1 13  ? 31.877  -7.980  18.247  1.00 0.00 ? 370 ARG A HB2  5  
ATOM   6526  H  HB3  . ARG A 1 13  ? 31.546  -6.253  18.264  1.00 0.00 ? 370 ARG A HB3  5  
ATOM   6527  H  HG2  . ARG A 1 13  ? 34.251  -7.255  19.029  1.00 0.00 ? 370 ARG A HG2  5  
ATOM   6528  H  HG3  . ARG A 1 13  ? 33.798  -7.133  17.328  1.00 0.00 ? 370 ARG A HG3  5  
ATOM   6529  H  HD2  . ARG A 1 13  ? 33.296  -4.800  19.107  1.00 0.00 ? 370 ARG A HD2  5  
ATOM   6530  H  HD3  . ARG A 1 13  ? 34.952  -5.128  18.599  1.00 0.00 ? 370 ARG A HD3  5  
ATOM   6531  H  HE   . ARG A 1 13  ? 32.806  -4.123  16.974  1.00 0.00 ? 370 ARG A HE   5  
ATOM   6532  H  HH11 . ARG A 1 13  ? 35.843  -5.826  16.973  1.00 0.00 ? 370 ARG A HH11 5  
ATOM   6533  H  HH12 . ARG A 1 13  ? 36.221  -5.415  15.333  1.00 0.00 ? 370 ARG A HH12 5  
ATOM   6534  H  HH21 . ARG A 1 13  ? 33.293  -3.576  14.814  1.00 0.00 ? 370 ARG A HH21 5  
ATOM   6535  H  HH22 . ARG A 1 13  ? 34.771  -4.135  14.106  1.00 0.00 ? 370 ARG A HH22 5  
ATOM   6536  N  N    . ARG A 1 14  ? 29.912  -5.744  20.455  1.00 0.00 ? 371 ARG A N    5  
ATOM   6537  C  CA   . ARG A 1 14  ? 28.500  -5.490  20.711  1.00 0.00 ? 371 ARG A CA   5  
ATOM   6538  C  C    . ARG A 1 14  ? 27.837  -4.835  19.503  1.00 0.00 ? 371 ARG A C    5  
ATOM   6539  O  O    . ARG A 1 14  ? 28.358  -3.868  18.946  1.00 0.00 ? 371 ARG A O    5  
ATOM   6540  C  CB   . ARG A 1 14  ? 28.335  -4.598  21.942  1.00 0.00 ? 371 ARG A CB   5  
ATOM   6541  C  CG   . ARG A 1 14  ? 28.624  -3.130  21.674  1.00 0.00 ? 371 ARG A CG   5  
ATOM   6542  C  CD   . ARG A 1 14  ? 28.571  -2.309  22.953  1.00 0.00 ? 371 ARG A CD   5  
ATOM   6543  N  NE   . ARG A 1 14  ? 29.444  -1.140  22.889  1.00 0.00 ? 371 ARG A NE   5  
ATOM   6544  C  CZ   . ARG A 1 14  ? 30.755  -1.190  23.097  1.00 0.00 ? 371 ARG A CZ   5  
ATOM   6545  N  NH1  . ARG A 1 14  ? 31.342  -2.345  23.381  1.00 0.00 ? 371 ARG A NH1  5  
ATOM   6546  N  NH2  . ARG A 1 14  ? 31.483  -0.083  23.022  1.00 0.00 ? 371 ARG A NH2  5  
ATOM   6547  H  H    . ARG A 1 14  ? 30.506  -4.989  20.261  1.00 0.00 ? 371 ARG A H    5  
ATOM   6548  H  HA   . ARG A 1 14  ? 28.021  -6.440  20.899  1.00 0.00 ? 371 ARG A HA   5  
ATOM   6549  H  HB2  . ARG A 1 14  ? 27.320  -4.682  22.301  1.00 0.00 ? 371 ARG A HB2  5  
ATOM   6550  H  HB3  . ARG A 1 14  ? 29.010  -4.940  22.712  1.00 0.00 ? 371 ARG A HB3  5  
ATOM   6551  H  HG2  . ARG A 1 14  ? 29.610  -3.040  21.242  1.00 0.00 ? 371 ARG A HG2  5  
ATOM   6552  H  HG3  . ARG A 1 14  ? 27.889  -2.749  20.981  1.00 0.00 ? 371 ARG A HG3  5  
ATOM   6553  H  HD2  . ARG A 1 14  ? 27.555  -1.979  23.111  1.00 0.00 ? 371 ARG A HD2  5  
ATOM   6554  H  HD3  . ARG A 1 14  ? 28.880  -2.933  23.778  1.00 0.00 ? 371 ARG A HD3  5  
ATOM   6555  H  HE   . ARG A 1 14  ? 29.032  -0.276  22.681  1.00 0.00 ? 371 ARG A HE   5  
ATOM   6556  H  HH11 . ARG A 1 14  ? 30.796  -3.181  23.437  1.00 0.00 ? 371 ARG A HH11 5  
ATOM   6557  H  HH12 . ARG A 1 14  ? 32.329  -2.380  23.536  1.00 0.00 ? 371 ARG A HH12 5  
ATOM   6558  H  HH21 . ARG A 1 14  ? 31.044  0.790   22.808  1.00 0.00 ? 371 ARG A HH21 5  
ATOM   6559  H  HH22 . ARG A 1 14  ? 32.469  -0.121  23.179  1.00 0.00 ? 371 ARG A HH22 5  
ATOM   6560  N  N    . ILE A 1 15  ? 26.688  -5.368  19.103  1.00 0.00 ? 372 ILE A N    5  
ATOM   6561  C  CA   . ILE A 1 15  ? 25.954  -4.835  17.962  1.00 0.00 ? 372 ILE A CA   5  
ATOM   6562  C  C    . ILE A 1 15  ? 24.466  -4.714  18.273  1.00 0.00 ? 372 ILE A C    5  
ATOM   6563  O  O    . ILE A 1 15  ? 23.840  -5.663  18.745  1.00 0.00 ? 372 ILE A O    5  
ATOM   6564  C  CB   . ILE A 1 15  ? 26.136  -5.718  16.713  1.00 0.00 ? 372 ILE A CB   5  
ATOM   6565  C  CG1  . ILE A 1 15  ? 27.621  -5.850  16.367  1.00 0.00 ? 372 ILE A CG1  5  
ATOM   6566  C  CG2  . ILE A 1 15  ? 25.362  -5.140  15.538  1.00 0.00 ? 372 ILE A CG2  5  
ATOM   6567  C  CD1  . ILE A 1 15  ? 28.207  -4.606  15.737  1.00 0.00 ? 372 ILE A CD1  5  
ATOM   6568  H  H    . ILE A 1 15  ? 26.324  -6.138  19.588  1.00 0.00 ? 372 ILE A H    5  
ATOM   6569  H  HA   . ILE A 1 15  ? 26.347  -3.852  17.744  1.00 0.00 ? 372 ILE A HA   5  
ATOM   6570  H  HB   . ILE A 1 15  ? 25.737  -6.697  16.930  1.00 0.00 ? 372 ILE A HB   5  
ATOM   6571  H  HG12 . ILE A 1 15  ? 28.177  -6.059  17.267  1.00 0.00 ? 372 ILE A HG12 5  
ATOM   6572  H  HG13 . ILE A 1 15  ? 27.749  -6.667  15.672  1.00 0.00 ? 372 ILE A HG13 5  
ATOM   6573  H  HG21 . ILE A 1 15  ? 24.392  -4.806  15.876  1.00 0.00 ? 372 ILE A HG21 5  
ATOM   6574  H  HG22 . ILE A 1 15  ? 25.906  -4.304  15.126  1.00 0.00 ? 372 ILE A HG22 5  
ATOM   6575  H  HG23 . ILE A 1 15  ? 25.238  -5.899  14.780  1.00 0.00 ? 372 ILE A HG23 5  
ATOM   6576  H  HD11 . ILE A 1 15  ? 29.286  -4.667  15.755  1.00 0.00 ? 372 ILE A HD11 5  
ATOM   6577  H  HD12 . ILE A 1 15  ? 27.870  -4.526  14.714  1.00 0.00 ? 372 ILE A HD12 5  
ATOM   6578  H  HD13 . ILE A 1 15  ? 27.888  -3.736  16.291  1.00 0.00 ? 372 ILE A HD13 5  
ATOM   6579  N  N    . HIS A 1 16  ? 23.905  -3.540  18.002  1.00 0.00 ? 373 HIS A N    5  
ATOM   6580  C  CA   . HIS A 1 16  ? 22.489  -3.294  18.250  1.00 0.00 ? 373 HIS A CA   5  
ATOM   6581  C  C    . HIS A 1 16  ? 21.660  -3.586  17.003  1.00 0.00 ? 373 HIS A C    5  
ATOM   6582  O  O    . HIS A 1 16  ? 21.484  -2.720  16.146  1.00 0.00 ? 373 HIS A O    5  
ATOM   6583  C  CB   . HIS A 1 16  ? 22.270  -1.848  18.695  1.00 0.00 ? 373 HIS A CB   5  
ATOM   6584  C  CG   . HIS A 1 16  ? 22.532  -1.624  20.153  1.00 0.00 ? 373 HIS A CG   5  
ATOM   6585  N  ND1  . HIS A 1 16  ? 21.535  -1.616  21.104  1.00 0.00 ? 373 HIS A ND1  5  
ATOM   6586  C  CD2  . HIS A 1 16  ? 23.688  -1.399  20.820  1.00 0.00 ? 373 HIS A CD2  5  
ATOM   6587  C  CE1  . HIS A 1 16  ? 22.065  -1.395  22.294  1.00 0.00 ? 373 HIS A CE1  5  
ATOM   6588  N  NE2  . HIS A 1 16  ? 23.371  -1.261  22.149  1.00 0.00 ? 373 HIS A NE2  5  
ATOM   6589  H  H    . HIS A 1 16  ? 24.456  -2.822  17.626  1.00 0.00 ? 373 HIS A H    5  
ATOM   6590  H  HA   . HIS A 1 16  ? 22.171  -3.957  19.041  1.00 0.00 ? 373 HIS A HA   5  
ATOM   6591  H  HB2  . HIS A 1 16  ? 22.932  -1.203  18.136  1.00 0.00 ? 373 HIS A HB2  5  
ATOM   6592  H  HB3  . HIS A 1 16  ? 21.246  -1.567  18.494  1.00 0.00 ? 373 HIS A HB3  5  
ATOM   6593  H  HD1  . HIS A 1 16  ? 20.579  -1.751  20.933  1.00 0.00 ? 373 HIS A HD1  5  
ATOM   6594  H  HD2  . HIS A 1 16  ? 24.678  -1.340  20.388  1.00 0.00 ? 373 HIS A HD2  5  
ATOM   6595  H  HE1  . HIS A 1 16  ? 21.524  -1.336  23.226  1.00 0.00 ? 373 HIS A HE1  5  
ATOM   6596  N  N    . TYR A 1 17  ? 21.155  -4.811  16.907  1.00 0.00 ? 374 TYR A N    5  
ATOM   6597  C  CA   . TYR A 1 17  ? 20.347  -5.218  15.763  1.00 0.00 ? 374 TYR A CA   5  
ATOM   6598  C  C    . TYR A 1 17  ? 18.964  -4.577  15.817  1.00 0.00 ? 374 TYR A C    5  
ATOM   6599  O  O    . TYR A 1 17  ? 18.269  -4.656  16.831  1.00 0.00 ? 374 TYR A O    5  
ATOM   6600  C  CB   . TYR A 1 17  ? 20.215  -6.741  15.722  1.00 0.00 ? 374 TYR A CB   5  
ATOM   6601  C  CG   . TYR A 1 17  ? 21.529  -7.468  15.899  1.00 0.00 ? 374 TYR A CG   5  
ATOM   6602  C  CD1  . TYR A 1 17  ? 22.535  -7.367  14.945  1.00 0.00 ? 374 TYR A CD1  5  
ATOM   6603  C  CD2  . TYR A 1 17  ? 21.764  -8.256  17.018  1.00 0.00 ? 374 TYR A CD2  5  
ATOM   6604  C  CE1  . TYR A 1 17  ? 23.736  -8.030  15.102  1.00 0.00 ? 374 TYR A CE1  5  
ATOM   6605  C  CE2  . TYR A 1 17  ? 22.963  -8.922  17.184  1.00 0.00 ? 374 TYR A CE2  5  
ATOM   6606  C  CZ   . TYR A 1 17  ? 23.946  -8.806  16.223  1.00 0.00 ? 374 TYR A CZ   5  
ATOM   6607  O  OH   . TYR A 1 17  ? 25.142  -9.468  16.384  1.00 0.00 ? 374 TYR A OH   5  
ATOM   6608  H  H    . TYR A 1 17  ? 21.330  -5.458  17.622  1.00 0.00 ? 374 TYR A H    5  
ATOM   6609  H  HA   . TYR A 1 17  ? 20.851  -4.885  14.867  1.00 0.00 ? 374 TYR A HA   5  
ATOM   6610  H  HB2  . TYR A 1 17  ? 19.551  -7.059  16.511  1.00 0.00 ? 374 TYR A HB2  5  
ATOM   6611  H  HB3  . TYR A 1 17  ? 19.799  -7.033  14.769  1.00 0.00 ? 374 TYR A HB3  5  
ATOM   6612  H  HD1  . TYR A 1 17  ? 22.368  -6.759  14.068  1.00 0.00 ? 374 TYR A HD1  5  
ATOM   6613  H  HD2  . TYR A 1 17  ? 20.992  -8.345  17.768  1.00 0.00 ? 374 TYR A HD2  5  
ATOM   6614  H  HE1  . TYR A 1 17  ? 24.507  -7.939  14.350  1.00 0.00 ? 374 TYR A HE1  5  
ATOM   6615  H  HE2  . TYR A 1 17  ? 23.127  -9.529  18.062  1.00 0.00 ? 374 TYR A HE2  5  
ATOM   6616  H  HH   . TYR A 1 17  ? 25.868  -8.855  16.247  1.00 0.00 ? 374 TYR A HH   5  
ATOM   6617  N  N    . CYS A 1 18  ? 18.570  -3.942  14.719  1.00 0.00 ? 375 CYS A N    5  
ATOM   6618  C  CA   . CYS A 1 18  ? 17.270  -3.287  14.638  1.00 0.00 ? 375 CYS A CA   5  
ATOM   6619  C  C    . CYS A 1 18  ? 16.145  -4.270  14.952  1.00 0.00 ? 375 CYS A C    5  
ATOM   6620  O  O    . CYS A 1 18  ? 16.076  -5.355  14.374  1.00 0.00 ? 375 CYS A O    5  
ATOM   6621  C  CB   . CYS A 1 18  ? 17.063  -2.687  13.246  1.00 0.00 ? 375 CYS A CB   5  
ATOM   6622  S  SG   . CYS A 1 18  ? 15.456  -1.859  13.024  1.00 0.00 ? 375 CYS A SG   5  
ATOM   6623  H  H    . CYS A 1 18  ? 19.168  -3.913  13.942  1.00 0.00 ? 375 CYS A H    5  
ATOM   6624  H  HA   . CYS A 1 18  ? 17.252  -2.494  15.369  1.00 0.00 ? 375 CYS A HA   5  
ATOM   6625  H  HB2  . CYS A 1 18  ? 17.837  -1.956  13.060  1.00 0.00 ? 375 CYS A HB2  5  
ATOM   6626  H  HB3  . CYS A 1 18  ? 17.133  -3.473  12.509  1.00 0.00 ? 375 CYS A HB3  5  
ATOM   6627  N  N    . ASP A 1 19  ? 15.267  -3.881  15.870  1.00 0.00 ? 376 ASP A N    5  
ATOM   6628  C  CA   . ASP A 1 19  ? 14.144  -4.726  16.260  1.00 0.00 ? 376 ASP A CA   5  
ATOM   6629  C  C    . ASP A 1 19  ? 12.983  -4.573  15.283  1.00 0.00 ? 376 ASP A C    5  
ATOM   6630  O  O    . ASP A 1 19  ? 11.819  -4.548  15.685  1.00 0.00 ? 376 ASP A O    5  
ATOM   6631  C  CB   . ASP A 1 19  ? 13.685  -4.378  17.677  1.00 0.00 ? 376 ASP A CB   5  
ATOM   6632  C  CG   . ASP A 1 19  ? 14.847  -4.120  18.615  1.00 0.00 ? 376 ASP A CG   5  
ATOM   6633  O  OD1  . ASP A 1 19  ? 15.668  -5.041  18.809  1.00 0.00 ? 376 ASP A OD1  5  
ATOM   6634  O  OD2  . ASP A 1 19  ? 14.935  -2.998  19.157  1.00 0.00 ? 376 ASP A OD2  5  
ATOM   6635  H  H    . ASP A 1 19  ? 15.376  -3.005  16.295  1.00 0.00 ? 376 ASP A H    5  
ATOM   6636  H  HA   . ASP A 1 19  ? 14.480  -5.752  16.242  1.00 0.00 ? 376 ASP A HA   5  
ATOM   6637  H  HB2  . ASP A 1 19  ? 13.071  -3.490  17.641  1.00 0.00 ? 376 ASP A HB2  5  
ATOM   6638  H  HB3  . ASP A 1 19  ? 13.102  -5.198  18.070  1.00 0.00 ? 376 ASP A HB3  5  
ATOM   6639  N  N    . TYR A 1 20  ? 13.307  -4.469  13.999  1.00 0.00 ? 377 TYR A N    5  
ATOM   6640  C  CA   . TYR A 1 20  ? 12.291  -4.314  12.964  1.00 0.00 ? 377 TYR A CA   5  
ATOM   6641  C  C    . TYR A 1 20  ? 12.332  -5.481  11.982  1.00 0.00 ? 377 TYR A C    5  
ATOM   6642  O  O    . TYR A 1 20  ? 13.396  -5.959  11.590  1.00 0.00 ? 377 TYR A O    5  
ATOM   6643  C  CB   . TYR A 1 20  ? 12.492  -2.995  12.216  1.00 0.00 ? 377 TYR A CB   5  
ATOM   6644  C  CG   . TYR A 1 20  ? 11.234  -2.473  11.561  1.00 0.00 ? 377 TYR A CG   5  
ATOM   6645  C  CD1  . TYR A 1 20  ? 10.371  -1.626  12.246  1.00 0.00 ? 377 TYR A CD1  5  
ATOM   6646  C  CD2  . TYR A 1 20  ? 10.907  -2.826  10.257  1.00 0.00 ? 377 TYR A CD2  5  
ATOM   6647  C  CE1  . TYR A 1 20  ? 9.219   -1.147  11.652  1.00 0.00 ? 377 TYR A CE1  5  
ATOM   6648  C  CE2  . TYR A 1 20  ? 9.759   -2.350  9.655   1.00 0.00 ? 377 TYR A CE2  5  
ATOM   6649  C  CZ   . TYR A 1 20  ? 8.918   -1.511  10.356  1.00 0.00 ? 377 TYR A CZ   5  
ATOM   6650  O  OH   . TYR A 1 20  ? 7.772   -1.036  9.760   1.00 0.00 ? 377 TYR A OH   5  
ATOM   6651  H  H    . TYR A 1 20  ? 14.252  -4.495  13.740  1.00 0.00 ? 377 TYR A H    5  
ATOM   6652  H  HA   . TYR A 1 20  ? 11.325  -4.298  13.448  1.00 0.00 ? 377 TYR A HA   5  
ATOM   6653  H  HB2  . TYR A 1 20  ? 12.841  -2.245  12.909  1.00 0.00 ? 377 TYR A HB2  5  
ATOM   6654  H  HB3  . TYR A 1 20  ? 13.234  -3.137  11.444  1.00 0.00 ? 377 TYR A HB3  5  
ATOM   6655  H  HD1  . TYR A 1 20  ? 10.609  -1.343  13.261  1.00 0.00 ? 377 TYR A HD1  5  
ATOM   6656  H  HD2  . TYR A 1 20  ? 11.568  -3.483  9.711   1.00 0.00 ? 377 TYR A HD2  5  
ATOM   6657  H  HE1  . TYR A 1 20  ? 8.561   -0.490  12.200  1.00 0.00 ? 377 TYR A HE1  5  
ATOM   6658  H  HE2  . TYR A 1 20  ? 9.523   -2.635  8.640   1.00 0.00 ? 377 TYR A HE2  5  
ATOM   6659  H  HH   . TYR A 1 20  ? 7.005   -1.371  10.229  1.00 0.00 ? 377 TYR A HH   5  
ATOM   6660  N  N    . PRO A 1 21  ? 11.143  -5.950  11.573  1.00 0.00 ? 378 PRO A N    5  
ATOM   6661  C  CA   . PRO A 1 21  ? 11.015  -7.065  10.630  1.00 0.00 ? 378 PRO A CA   5  
ATOM   6662  C  C    . PRO A 1 21  ? 11.461  -6.688  9.222   1.00 0.00 ? 378 PRO A C    5  
ATOM   6663  O  O    . PRO A 1 21  ? 10.984  -5.708  8.651   1.00 0.00 ? 378 PRO A O    5  
ATOM   6664  C  CB   . PRO A 1 21  ? 9.516   -7.376  10.652  1.00 0.00 ? 378 PRO A CB   5  
ATOM   6665  C  CG   . PRO A 1 21  ? 8.870   -6.097  11.060  1.00 0.00 ? 378 PRO A CG   5  
ATOM   6666  C  CD   . PRO A 1 21  ? 9.834   -5.427  11.999  1.00 0.00 ? 378 PRO A CD   5  
ATOM   6667  H  HA   . PRO A 1 21  ? 11.568  -7.931  10.962  1.00 0.00 ? 378 PRO A HA   5  
ATOM   6668  H  HB2  . PRO A 1 21  ? 9.196   -7.684  9.666   1.00 0.00 ? 378 PRO A HB2  5  
ATOM   6669  H  HB3  . PRO A 1 21  ? 9.318   -8.163  11.363  1.00 0.00 ? 378 PRO A HB3  5  
ATOM   6670  H  HG2  . PRO A 1 21  ? 8.699   -5.478  10.193  1.00 0.00 ? 378 PRO A HG2  5  
ATOM   6671  H  HG3  . PRO A 1 21  ? 7.937   -6.303  11.565  1.00 0.00 ? 378 PRO A HG3  5  
ATOM   6672  H  HD2  . PRO A 1 21  ? 9.791   -4.355  11.883  1.00 0.00 ? 378 PRO A HD2  5  
ATOM   6673  H  HD3  . PRO A 1 21  ? 9.622   -5.707  13.021  1.00 0.00 ? 378 PRO A HD3  5  
ATOM   6674  N  N    . GLY A 1 22  ? 12.378  -7.473  8.666   1.00 0.00 ? 379 GLY A N    5  
ATOM   6675  C  CA   . GLY A 1 22  ? 12.873  -7.205  7.328   1.00 0.00 ? 379 GLY A CA   5  
ATOM   6676  C  C    . GLY A 1 22  ? 14.146  -6.383  7.335   1.00 0.00 ? 379 GLY A C    5  
ATOM   6677  O  O    . GLY A 1 22  ? 15.125  -6.735  6.676   1.00 0.00 ? 379 GLY A O    5  
ATOM   6678  H  H    . GLY A 1 22  ? 12.722  -8.241  9.169   1.00 0.00 ? 379 GLY A H    5  
ATOM   6679  H  HA2  . GLY A 1 22  ? 13.066  -8.145  6.833   1.00 0.00 ? 379 GLY A HA2  5  
ATOM   6680  H  HA3  . GLY A 1 22  ? 12.114  -6.668  6.778   1.00 0.00 ? 379 GLY A HA3  5  
ATOM   6681  N  N    . CYS A 1 23  ? 14.134  -5.283  8.080   1.00 0.00 ? 380 CYS A N    5  
ATOM   6682  C  CA   . CYS A 1 23  ? 15.296  -4.406  8.168   1.00 0.00 ? 380 CYS A CA   5  
ATOM   6683  C  C    . CYS A 1 23  ? 16.548  -5.197  8.535   1.00 0.00 ? 380 CYS A C    5  
ATOM   6684  O  O    . CYS A 1 23  ? 16.525  -6.036  9.437   1.00 0.00 ? 380 CYS A O    5  
ATOM   6685  C  CB   . CYS A 1 23  ? 15.053  -3.306  9.204   1.00 0.00 ? 380 CYS A CB   5  
ATOM   6686  S  SG   . CYS A 1 23  ? 16.443  -2.144  9.394   1.00 0.00 ? 380 CYS A SG   5  
ATOM   6687  H  H    . CYS A 1 23  ? 13.324  -5.054  8.583   1.00 0.00 ? 380 CYS A H    5  
ATOM   6688  H  HA   . CYS A 1 23  ? 15.443  -3.951  7.201   1.00 0.00 ? 380 CYS A HA   5  
ATOM   6689  H  HB2  . CYS A 1 23  ? 14.185  -2.733  8.912   1.00 0.00 ? 380 CYS A HB2  5  
ATOM   6690  H  HB3  . CYS A 1 23  ? 14.871  -3.762  10.166  1.00 0.00 ? 380 CYS A HB3  5  
ATOM   6691  N  N    . THR A 1 24  ? 17.641  -4.925  7.830   1.00 0.00 ? 381 THR A N    5  
ATOM   6692  C  CA   . THR A 1 24  ? 18.903  -5.611  8.079   1.00 0.00 ? 381 THR A CA   5  
ATOM   6693  C  C    . THR A 1 24  ? 20.017  -4.617  8.390   1.00 0.00 ? 381 THR A C    5  
ATOM   6694  O  O    . THR A 1 24  ? 21.161  -4.801  7.974   1.00 0.00 ? 381 THR A O    5  
ATOM   6695  C  CB   . THR A 1 24  ? 19.321  -6.473  6.874   1.00 0.00 ? 381 THR A CB   5  
ATOM   6696  O  OG1  . THR A 1 24  ? 19.538  -5.642  5.728   1.00 0.00 ? 381 THR A OG1  5  
ATOM   6697  C  CG2  . THR A 1 24  ? 18.257  -7.514  6.558   1.00 0.00 ? 381 THR A CG2  5  
ATOM   6698  H  H    . THR A 1 24  ? 17.597  -4.246  7.124   1.00 0.00 ? 381 THR A H    5  
ATOM   6699  H  HA   . THR A 1 24  ? 18.766  -6.261  8.931   1.00 0.00 ? 381 THR A HA   5  
ATOM   6700  H  HB   . THR A 1 24  ? 20.242  -6.984  7.118   1.00 0.00 ? 381 THR A HB   5  
ATOM   6701  H  HG1  . THR A 1 24  ? 20.384  -5.861  5.329   1.00 0.00 ? 381 THR A HG1  5  
ATOM   6702  H  HG21 . THR A 1 24  ? 17.302  -7.174  6.927   1.00 0.00 ? 381 THR A HG21 5  
ATOM   6703  H  HG22 . THR A 1 24  ? 18.515  -8.448  7.034   1.00 0.00 ? 381 THR A HG22 5  
ATOM   6704  H  HG23 . THR A 1 24  ? 18.201  -7.657  5.489   1.00 0.00 ? 381 THR A HG23 5  
ATOM   6705  N  N    . LYS A 1 25  ? 19.676  -3.564  9.125   1.00 0.00 ? 382 LYS A N    5  
ATOM   6706  C  CA   . LYS A 1 25  ? 20.647  -2.541  9.494   1.00 0.00 ? 382 LYS A CA   5  
ATOM   6707  C  C    . LYS A 1 25  ? 21.075  -2.698  10.950  1.00 0.00 ? 382 LYS A C    5  
ATOM   6708  O  O    . LYS A 1 25  ? 20.301  -3.157  11.789  1.00 0.00 ? 382 LYS A O    5  
ATOM   6709  C  CB   . LYS A 1 25  ? 20.059  -1.146  9.271   1.00 0.00 ? 382 LYS A CB   5  
ATOM   6710  C  CG   . LYS A 1 25  ? 20.089  -0.699  7.820   1.00 0.00 ? 382 LYS A CG   5  
ATOM   6711  C  CD   . LYS A 1 25  ? 21.409  -0.035  7.467   1.00 0.00 ? 382 LYS A CD   5  
ATOM   6712  C  CE   . LYS A 1 25  ? 21.285  0.826   6.220   1.00 0.00 ? 382 LYS A CE   5  
ATOM   6713  N  NZ   . LYS A 1 25  ? 22.604  1.358   5.779   1.00 0.00 ? 382 LYS A NZ   5  
ATOM   6714  H  H    . LYS A 1 25  ? 18.747  -3.473  9.427   1.00 0.00 ? 382 LYS A H    5  
ATOM   6715  H  HA   . LYS A 1 25  ? 21.514  -2.663  8.862   1.00 0.00 ? 382 LYS A HA   5  
ATOM   6716  H  HB2  . LYS A 1 25  ? 19.033  -1.143  9.607   1.00 0.00 ? 382 LYS A HB2  5  
ATOM   6717  H  HB3  . LYS A 1 25  ? 20.622  -0.434  9.857   1.00 0.00 ? 382 LYS A HB3  5  
ATOM   6718  H  HG2  . LYS A 1 25  ? 19.950  -1.560  7.184   1.00 0.00 ? 382 LYS A HG2  5  
ATOM   6719  H  HG3  . LYS A 1 25  ? 19.286  0.007   7.654   1.00 0.00 ? 382 LYS A HG3  5  
ATOM   6720  H  HD2  . LYS A 1 25  ? 21.721  0.589   8.292   1.00 0.00 ? 382 LYS A HD2  5  
ATOM   6721  H  HD3  . LYS A 1 25  ? 22.152  -0.801  7.293   1.00 0.00 ? 382 LYS A HD3  5  
ATOM   6722  H  HE2  . LYS A 1 25  ? 20.864  0.229   5.426   1.00 0.00 ? 382 LYS A HE2  5  
ATOM   6723  H  HE3  . LYS A 1 25  ? 20.626  1.655   6.435   1.00 0.00 ? 382 LYS A HE3  5  
ATOM   6724  H  HZ1  . LYS A 1 25  ? 22.843  2.214   6.319   1.00 0.00 ? 382 LYS A HZ1  5  
ATOM   6725  H  HZ2  . LYS A 1 25  ? 22.573  1.597   4.767   1.00 0.00 ? 382 LYS A HZ2  5  
ATOM   6726  H  HZ3  . LYS A 1 25  ? 23.346  0.645   5.932   1.00 0.00 ? 382 LYS A HZ3  5  
ATOM   6727  N  N    . VAL A 1 26  ? 22.313  -2.310  11.243  1.00 0.00 ? 383 VAL A N    5  
ATOM   6728  C  CA   . VAL A 1 26  ? 22.842  -2.405  12.598  1.00 0.00 ? 383 VAL A CA   5  
ATOM   6729  C  C    . VAL A 1 26  ? 23.811  -1.264  12.891  1.00 0.00 ? 383 VAL A C    5  
ATOM   6730  O  O    . VAL A 1 26  ? 24.521  -0.796  12.001  1.00 0.00 ? 383 VAL A O    5  
ATOM   6731  C  CB   . VAL A 1 26  ? 23.563  -3.747  12.826  1.00 0.00 ? 383 VAL A CB   5  
ATOM   6732  C  CG1  . VAL A 1 26  ? 22.670  -4.909  12.420  1.00 0.00 ? 383 VAL A CG1  5  
ATOM   6733  C  CG2  . VAL A 1 26  ? 24.878  -3.781  12.062  1.00 0.00 ? 383 VAL A CG2  5  
ATOM   6734  H  H    . VAL A 1 26  ? 22.882  -1.952  10.531  1.00 0.00 ? 383 VAL A H    5  
ATOM   6735  H  HA   . VAL A 1 26  ? 22.012  -2.345  13.286  1.00 0.00 ? 383 VAL A HA   5  
ATOM   6736  H  HB   . VAL A 1 26  ? 23.781  -3.841  13.880  1.00 0.00 ? 383 VAL A HB   5  
ATOM   6737  H  HG11 . VAL A 1 26  ? 21.884  -5.031  13.150  1.00 0.00 ? 383 VAL A HG11 5  
ATOM   6738  H  HG12 . VAL A 1 26  ? 22.236  -4.708  11.451  1.00 0.00 ? 383 VAL A HG12 5  
ATOM   6739  H  HG13 . VAL A 1 26  ? 23.258  -5.814  12.371  1.00 0.00 ? 383 VAL A HG13 5  
ATOM   6740  H  HG21 . VAL A 1 26  ? 25.416  -2.860  12.228  1.00 0.00 ? 383 VAL A HG21 5  
ATOM   6741  H  HG22 . VAL A 1 26  ? 25.473  -4.613  12.409  1.00 0.00 ? 383 VAL A HG22 5  
ATOM   6742  H  HG23 . VAL A 1 26  ? 24.679  -3.897  11.007  1.00 0.00 ? 383 VAL A HG23 5  
ATOM   6743  N  N    . TYR A 1 27  ? 23.834  -0.822  14.143  1.00 0.00 ? 384 TYR A N    5  
ATOM   6744  C  CA   . TYR A 1 27  ? 24.714  0.266   14.553  1.00 0.00 ? 384 TYR A CA   5  
ATOM   6745  C  C    . TYR A 1 27  ? 25.283  0.011   15.946  1.00 0.00 ? 384 TYR A C    5  
ATOM   6746  O  O    . TYR A 1 27  ? 24.594  -0.505  16.827  1.00 0.00 ? 384 TYR A O    5  
ATOM   6747  C  CB   . TYR A 1 27  ? 23.958  1.596   14.535  1.00 0.00 ? 384 TYR A CB   5  
ATOM   6748  C  CG   . TYR A 1 27  ? 23.120  1.799   13.293  1.00 0.00 ? 384 TYR A CG   5  
ATOM   6749  C  CD1  . TYR A 1 27  ? 23.702  1.805   12.031  1.00 0.00 ? 384 TYR A CD1  5  
ATOM   6750  C  CD2  . TYR A 1 27  ? 21.746  1.984   13.381  1.00 0.00 ? 384 TYR A CD2  5  
ATOM   6751  C  CE1  . TYR A 1 27  ? 22.941  1.991   10.894  1.00 0.00 ? 384 TYR A CE1  5  
ATOM   6752  C  CE2  . TYR A 1 27  ? 20.976  2.169   12.249  1.00 0.00 ? 384 TYR A CE2  5  
ATOM   6753  C  CZ   . TYR A 1 27  ? 21.578  2.172   11.008  1.00 0.00 ? 384 TYR A CZ   5  
ATOM   6754  O  OH   . TYR A 1 27  ? 20.816  2.357   9.877   1.00 0.00 ? 384 TYR A OH   5  
ATOM   6755  H  H    . TYR A 1 27  ? 23.244  -1.235  14.807  1.00 0.00 ? 384 TYR A H    5  
ATOM   6756  H  HA   . TYR A 1 27  ? 25.529  0.317   13.847  1.00 0.00 ? 384 TYR A HA   5  
ATOM   6757  H  HB2  . TYR A 1 27  ? 23.300  1.640   15.389  1.00 0.00 ? 384 TYR A HB2  5  
ATOM   6758  H  HB3  . TYR A 1 27  ? 24.669  2.407   14.592  1.00 0.00 ? 384 TYR A HB3  5  
ATOM   6759  H  HD1  . TYR A 1 27  ? 24.770  1.662   11.946  1.00 0.00 ? 384 TYR A HD1  5  
ATOM   6760  H  HD2  . TYR A 1 27  ? 21.277  1.980   14.354  1.00 0.00 ? 384 TYR A HD2  5  
ATOM   6761  H  HE1  . TYR A 1 27  ? 23.412  1.993   9.922   1.00 0.00 ? 384 TYR A HE1  5  
ATOM   6762  H  HE2  . TYR A 1 27  ? 19.909  2.311   12.337  1.00 0.00 ? 384 TYR A HE2  5  
ATOM   6763  H  HH   . TYR A 1 27  ? 20.162  1.656   9.814   1.00 0.00 ? 384 TYR A HH   5  
ATOM   6764  N  N    . THR A 1 28  ? 26.546  0.376   16.137  1.00 0.00 ? 385 THR A N    5  
ATOM   6765  C  CA   . THR A 1 28  ? 27.210  0.187   17.421  1.00 0.00 ? 385 THR A CA   5  
ATOM   6766  C  C    . THR A 1 28  ? 26.917  1.346   18.367  1.00 0.00 ? 385 THR A C    5  
ATOM   6767  O  O    . THR A 1 28  ? 27.783  1.771   19.132  1.00 0.00 ? 385 THR A O    5  
ATOM   6768  C  CB   . THR A 1 28  ? 28.735  0.052   17.250  1.00 0.00 ? 385 THR A CB   5  
ATOM   6769  O  OG1  . THR A 1 28  ? 29.234  1.123   16.441  1.00 0.00 ? 385 THR A OG1  5  
ATOM   6770  C  CG2  . THR A 1 28  ? 29.092  -1.282  16.613  1.00 0.00 ? 385 THR A CG2  5  
ATOM   6771  H  H    . THR A 1 28  ? 27.043  0.782   15.396  1.00 0.00 ? 385 THR A H    5  
ATOM   6772  H  HA   . THR A 1 28  ? 26.836  -0.726  17.859  1.00 0.00 ? 385 THR A HA   5  
ATOM   6773  H  HB   . THR A 1 28  ? 29.197  0.103   18.226  1.00 0.00 ? 385 THR A HB   5  
ATOM   6774  H  HG1  . THR A 1 28  ? 28.931  1.009   15.537  1.00 0.00 ? 385 THR A HG1  5  
ATOM   6775  H  HG21 . THR A 1 28  ? 28.880  -2.081  17.307  1.00 0.00 ? 385 THR A HG21 5  
ATOM   6776  H  HG22 . THR A 1 28  ? 30.143  -1.292  16.363  1.00 0.00 ? 385 THR A HG22 5  
ATOM   6777  H  HG23 . THR A 1 28  ? 28.508  -1.420  15.715  1.00 0.00 ? 385 THR A HG23 5  
ATOM   6778  N  N    . LYS A 1 29  ? 25.690  1.853   18.312  1.00 0.00 ? 386 LYS A N    5  
ATOM   6779  C  CA   . LYS A 1 29  ? 25.280  2.962   19.165  1.00 0.00 ? 386 LYS A CA   5  
ATOM   6780  C  C    . LYS A 1 29  ? 23.849  2.770   19.657  1.00 0.00 ? 386 LYS A C    5  
ATOM   6781  O  O    . LYS A 1 29  ? 23.030  2.144   18.984  1.00 0.00 ? 386 LYS A O    5  
ATOM   6782  C  CB   . LYS A 1 29  ? 25.398  4.286   18.407  1.00 0.00 ? 386 LYS A CB   5  
ATOM   6783  C  CG   . LYS A 1 29  ? 26.762  4.941   18.535  1.00 0.00 ? 386 LYS A CG   5  
ATOM   6784  C  CD   . LYS A 1 29  ? 27.084  5.799   17.323  1.00 0.00 ? 386 LYS A CD   5  
ATOM   6785  C  CE   . LYS A 1 29  ? 28.585  5.918   17.107  1.00 0.00 ? 386 LYS A CE   5  
ATOM   6786  N  NZ   . LYS A 1 29  ? 28.927  6.089   15.667  1.00 0.00 ? 386 LYS A NZ   5  
ATOM   6787  H  H    . LYS A 1 29  ? 25.043  1.471   17.681  1.00 0.00 ? 386 LYS A H    5  
ATOM   6788  H  HA   . LYS A 1 29  ? 25.941  2.985   20.019  1.00 0.00 ? 386 LYS A HA   5  
ATOM   6789  H  HB2  . LYS A 1 29  ? 25.204  4.106   17.360  1.00 0.00 ? 386 LYS A HB2  5  
ATOM   6790  H  HB3  . LYS A 1 29  ? 24.656  4.972   18.789  1.00 0.00 ? 386 LYS A HB3  5  
ATOM   6791  H  HG2  . LYS A 1 29  ? 26.772  5.564   19.416  1.00 0.00 ? 386 LYS A HG2  5  
ATOM   6792  H  HG3  . LYS A 1 29  ? 27.514  4.170   18.628  1.00 0.00 ? 386 LYS A HG3  5  
ATOM   6793  H  HD2  . LYS A 1 29  ? 26.641  5.350   16.446  1.00 0.00 ? 386 LYS A HD2  5  
ATOM   6794  H  HD3  . LYS A 1 29  ? 26.671  6.787   17.472  1.00 0.00 ? 386 LYS A HD3  5  
ATOM   6795  H  HE2  . LYS A 1 29  ? 28.948  6.772   17.658  1.00 0.00 ? 386 LYS A HE2  5  
ATOM   6796  H  HE3  . LYS A 1 29  ? 29.061  5.022   17.477  1.00 0.00 ? 386 LYS A HE3  5  
ATOM   6797  H  HZ1  . LYS A 1 29  ? 28.788  5.193   15.158  1.00 0.00 ? 386 LYS A HZ1  5  
ATOM   6798  H  HZ2  . LYS A 1 29  ? 29.920  6.381   15.568  1.00 0.00 ? 386 LYS A HZ2  5  
ATOM   6799  H  HZ3  . LYS A 1 29  ? 28.319  6.816   15.240  1.00 0.00 ? 386 LYS A HZ3  5  
ATOM   6800  N  N    . SER A 1 30  ? 23.554  3.314   20.833  1.00 0.00 ? 387 SER A N    5  
ATOM   6801  C  CA   . SER A 1 30  ? 22.222  3.201   21.415  1.00 0.00 ? 387 SER A CA   5  
ATOM   6802  C  C    . SER A 1 30  ? 21.328  4.347   20.952  1.00 0.00 ? 387 SER A C    5  
ATOM   6803  O  O    . SER A 1 30  ? 20.209  4.127   20.487  1.00 0.00 ? 387 SER A O    5  
ATOM   6804  C  CB   . SER A 1 30  ? 22.309  3.192   22.943  1.00 0.00 ? 387 SER A CB   5  
ATOM   6805  O  OG   . SER A 1 30  ? 23.068  4.291   23.417  1.00 0.00 ? 387 SER A OG   5  
ATOM   6806  H  H    . SER A 1 30  ? 24.250  3.801   21.322  1.00 0.00 ? 387 SER A H    5  
ATOM   6807  H  HA   . SER A 1 30  ? 21.793  2.268   21.082  1.00 0.00 ? 387 SER A HA   5  
ATOM   6808  H  HB2  . SER A 1 30  ? 21.315  3.251   23.358  1.00 0.00 ? 387 SER A HB2  5  
ATOM   6809  H  HB3  . SER A 1 30  ? 22.782  2.276   23.268  1.00 0.00 ? 387 SER A HB3  5  
ATOM   6810  H  HG   . SER A 1 30  ? 22.569  4.758   24.091  1.00 0.00 ? 387 SER A HG   5  
ATOM   6811  N  N    . SER A 1 31  ? 21.829  5.571   21.084  1.00 0.00 ? 388 SER A N    5  
ATOM   6812  C  CA   . SER A 1 31  ? 21.075  6.753   20.683  1.00 0.00 ? 388 SER A CA   5  
ATOM   6813  C  C    . SER A 1 31  ? 20.797  6.737   19.183  1.00 0.00 ? 388 SER A C    5  
ATOM   6814  O  O    . SER A 1 31  ? 19.669  6.969   18.747  1.00 0.00 ? 388 SER A O    5  
ATOM   6815  C  CB   . SER A 1 31  ? 21.841  8.023   21.057  1.00 0.00 ? 388 SER A CB   5  
ATOM   6816  O  OG   . SER A 1 31  ? 21.659  8.344   22.426  1.00 0.00 ? 388 SER A OG   5  
ATOM   6817  H  H    . SER A 1 31  ? 22.727  5.681   21.462  1.00 0.00 ? 388 SER A H    5  
ATOM   6818  H  HA   . SER A 1 31  ? 20.134  6.741   21.212  1.00 0.00 ? 388 SER A HA   5  
ATOM   6819  H  HB2  . SER A 1 31  ? 22.894  7.874   20.872  1.00 0.00 ? 388 SER A HB2  5  
ATOM   6820  H  HB3  . SER A 1 31  ? 21.482  8.847   20.456  1.00 0.00 ? 388 SER A HB3  5  
ATOM   6821  H  HG   . SER A 1 31  ? 21.254  9.211   22.501  1.00 0.00 ? 388 SER A HG   5  
ATOM   6822  N  N    . HIS A 1 32  ? 21.834  6.461   18.398  1.00 0.00 ? 389 HIS A N    5  
ATOM   6823  C  CA   . HIS A 1 32  ? 21.702  6.414   16.946  1.00 0.00 ? 389 HIS A CA   5  
ATOM   6824  C  C    . HIS A 1 32  ? 20.559  5.490   16.534  1.00 0.00 ? 389 HIS A C    5  
ATOM   6825  O  O    . HIS A 1 32  ? 19.642  5.901   15.822  1.00 0.00 ? 389 HIS A O    5  
ATOM   6826  C  CB   . HIS A 1 32  ? 23.009  5.941   16.309  1.00 0.00 ? 389 HIS A CB   5  
ATOM   6827  C  CG   . HIS A 1 32  ? 24.076  6.993   16.281  1.00 0.00 ? 389 HIS A CG   5  
ATOM   6828  N  ND1  . HIS A 1 32  ? 24.900  7.199   15.195  1.00 0.00 ? 389 HIS A ND1  5  
ATOM   6829  C  CD2  . HIS A 1 32  ? 24.449  7.900   17.213  1.00 0.00 ? 389 HIS A CD2  5  
ATOM   6830  C  CE1  . HIS A 1 32  ? 25.736  8.188   15.461  1.00 0.00 ? 389 HIS A CE1  5  
ATOM   6831  N  NE2  . HIS A 1 32  ? 25.482  8.630   16.680  1.00 0.00 ? 389 HIS A NE2  5  
ATOM   6832  H  H    . HIS A 1 32  ? 22.707  6.285   18.805  1.00 0.00 ? 389 HIS A H    5  
ATOM   6833  H  HA   . HIS A 1 32  ? 21.483  7.413   16.600  1.00 0.00 ? 389 HIS A HA   5  
ATOM   6834  H  HB2  . HIS A 1 32  ? 23.390  5.099   16.867  1.00 0.00 ? 389 HIS A HB2  5  
ATOM   6835  H  HB3  . HIS A 1 32  ? 22.817  5.636   15.291  1.00 0.00 ? 389 HIS A HB3  5  
ATOM   6836  H  HD1  . HIS A 1 32  ? 24.877  6.696   14.355  1.00 0.00 ? 389 HIS A HD1  5  
ATOM   6837  H  HD2  . HIS A 1 32  ? 24.015  8.027   18.195  1.00 0.00 ? 389 HIS A HD2  5  
ATOM   6838  H  HE1  . HIS A 1 32  ? 26.496  8.569   14.797  1.00 0.00 ? 389 HIS A HE1  5  
ATOM   6839  N  N    . LEU A 1 33  ? 20.621  4.243   16.985  1.00 0.00 ? 390 LEU A N    5  
ATOM   6840  C  CA   . LEU A 1 33  ? 19.592  3.260   16.663  1.00 0.00 ? 390 LEU A CA   5  
ATOM   6841  C  C    . LEU A 1 33  ? 18.202  3.887   16.728  1.00 0.00 ? 390 LEU A C    5  
ATOM   6842  O  O    . LEU A 1 33  ? 17.497  3.964   15.722  1.00 0.00 ? 390 LEU A O    5  
ATOM   6843  C  CB   . LEU A 1 33  ? 19.674  2.073   17.624  1.00 0.00 ? 390 LEU A CB   5  
ATOM   6844  C  CG   . LEU A 1 33  ? 18.725  0.909   17.334  1.00 0.00 ? 390 LEU A CG   5  
ATOM   6845  C  CD1  . LEU A 1 33  ? 19.051  0.276   15.991  1.00 0.00 ? 390 LEU A CD1  5  
ATOM   6846  C  CD2  . LEU A 1 33  ? 18.798  -0.127  18.446  1.00 0.00 ? 390 LEU A CD2  5  
ATOM   6847  H  H    . LEU A 1 33  ? 21.376  3.974   17.549  1.00 0.00 ? 390 LEU A H    5  
ATOM   6848  H  HA   . LEU A 1 33  ? 19.770  2.912   15.657  1.00 0.00 ? 390 LEU A HA   5  
ATOM   6849  H  HB2  . LEU A 1 33  ? 20.683  1.692   17.593  1.00 0.00 ? 390 LEU A HB2  5  
ATOM   6850  H  HB3  . LEU A 1 33  ? 19.458  2.437   18.618  1.00 0.00 ? 390 LEU A HB3  5  
ATOM   6851  H  HG   . LEU A 1 33  ? 17.711  1.282   17.289  1.00 0.00 ? 390 LEU A HG   5  
ATOM   6852  H  HD11 . LEU A 1 33  ? 19.984  -0.263  16.064  1.00 0.00 ? 390 LEU A HD11 5  
ATOM   6853  H  HD12 . LEU A 1 33  ? 19.139  1.048   15.241  1.00 0.00 ? 390 LEU A HD12 5  
ATOM   6854  H  HD13 . LEU A 1 33  ? 18.261  -0.407  15.713  1.00 0.00 ? 390 LEU A HD13 5  
ATOM   6855  H  HD21 . LEU A 1 33  ? 19.249  -1.032  18.066  1.00 0.00 ? 390 LEU A HD21 5  
ATOM   6856  H  HD22 . LEU A 1 33  ? 17.801  -0.343  18.802  1.00 0.00 ? 390 LEU A HD22 5  
ATOM   6857  H  HD23 . LEU A 1 33  ? 19.395  0.259   19.260  1.00 0.00 ? 390 LEU A HD23 5  
ATOM   6858  N  N    . LYS A 1 34  ? 17.816  4.334   17.918  1.00 0.00 ? 391 LYS A N    5  
ATOM   6859  C  CA   . LYS A 1 34  ? 16.512  4.957   18.115  1.00 0.00 ? 391 LYS A CA   5  
ATOM   6860  C  C    . LYS A 1 34  ? 16.192  5.921   16.977  1.00 0.00 ? 391 LYS A C    5  
ATOM   6861  O  O    . LYS A 1 34  ? 15.099  5.889   16.413  1.00 0.00 ? 391 LYS A O    5  
ATOM   6862  C  CB   . LYS A 1 34  ? 16.476  5.701   19.452  1.00 0.00 ? 391 LYS A CB   5  
ATOM   6863  C  CG   . LYS A 1 34  ? 15.095  5.754   20.082  1.00 0.00 ? 391 LYS A CG   5  
ATOM   6864  C  CD   . LYS A 1 34  ? 15.008  6.837   21.143  1.00 0.00 ? 391 LYS A CD   5  
ATOM   6865  C  CE   . LYS A 1 34  ? 13.678  6.789   21.881  1.00 0.00 ? 391 LYS A CE   5  
ATOM   6866  N  NZ   . LYS A 1 34  ? 13.566  7.875   22.894  1.00 0.00 ? 391 LYS A NZ   5  
ATOM   6867  H  H    . LYS A 1 34  ? 18.423  4.244   18.683  1.00 0.00 ? 391 LYS A H    5  
ATOM   6868  H  HA   . LYS A 1 34  ? 15.769  4.174   18.128  1.00 0.00 ? 391 LYS A HA   5  
ATOM   6869  H  HB2  . LYS A 1 34  ? 17.145  5.208   20.142  1.00 0.00 ? 391 LYS A HB2  5  
ATOM   6870  H  HB3  . LYS A 1 34  ? 16.817  6.714   19.296  1.00 0.00 ? 391 LYS A HB3  5  
ATOM   6871  H  HG2  . LYS A 1 34  ? 14.366  5.960   19.312  1.00 0.00 ? 391 LYS A HG2  5  
ATOM   6872  H  HG3  . LYS A 1 34  ? 14.880  4.798   20.537  1.00 0.00 ? 391 LYS A HG3  5  
ATOM   6873  H  HD2  . LYS A 1 34  ? 15.807  6.697   21.856  1.00 0.00 ? 391 LYS A HD2  5  
ATOM   6874  H  HD3  . LYS A 1 34  ? 15.111  7.803   20.669  1.00 0.00 ? 391 LYS A HD3  5  
ATOM   6875  H  HE2  . LYS A 1 34  ? 12.879  6.893   21.164  1.00 0.00 ? 391 LYS A HE2  5  
ATOM   6876  H  HE3  . LYS A 1 34  ? 13.593  5.834   22.379  1.00 0.00 ? 391 LYS A HE3  5  
ATOM   6877  H  HZ1  . LYS A 1 34  ? 14.433  7.922   23.466  1.00 0.00 ? 391 LYS A HZ1  5  
ATOM   6878  H  HZ2  . LYS A 1 34  ? 12.758  7.694   23.523  1.00 0.00 ? 391 LYS A HZ2  5  
ATOM   6879  H  HZ3  . LYS A 1 34  ? 13.425  8.790   22.421  1.00 0.00 ? 391 LYS A HZ3  5  
ATOM   6880  N  N    . ALA A 1 35  ? 17.154  6.775   16.643  1.00 0.00 ? 392 ALA A N    5  
ATOM   6881  C  CA   . ALA A 1 35  ? 16.975  7.745   15.570  1.00 0.00 ? 392 ALA A CA   5  
ATOM   6882  C  C    . ALA A 1 35  ? 16.642  7.052   14.253  1.00 0.00 ? 392 ALA A C    5  
ATOM   6883  O  O    . ALA A 1 35  ? 15.802  7.524   13.486  1.00 0.00 ? 392 ALA A O    5  
ATOM   6884  C  CB   . ALA A 1 35  ? 18.224  8.600   15.417  1.00 0.00 ? 392 ALA A CB   5  
ATOM   6885  H  H    . ALA A 1 35  ? 18.004  6.752   17.129  1.00 0.00 ? 392 ALA A H    5  
ATOM   6886  H  HA   . ALA A 1 35  ? 16.155  8.395   15.840  1.00 0.00 ? 392 ALA A HA   5  
ATOM   6887  H  HB1  . ALA A 1 35  ? 18.104  9.266   14.576  1.00 0.00 ? 392 ALA A HB1  5  
ATOM   6888  H  HB2  . ALA A 1 35  ? 18.374  9.180   16.317  1.00 0.00 ? 392 ALA A HB2  5  
ATOM   6889  H  HB3  . ALA A 1 35  ? 19.079  7.962   15.253  1.00 0.00 ? 392 ALA A HB3  5  
ATOM   6890  N  N    . HIS A 1 36  ? 17.306  5.929   13.996  1.00 0.00 ? 393 HIS A N    5  
ATOM   6891  C  CA   . HIS A 1 36  ? 17.081  5.171   12.771  1.00 0.00 ? 393 HIS A CA   5  
ATOM   6892  C  C    . HIS A 1 36  ? 15.653  4.634   12.719  1.00 0.00 ? 393 HIS A C    5  
ATOM   6893  O  O    . HIS A 1 36  ? 14.987  4.712   11.686  1.00 0.00 ? 393 HIS A O    5  
ATOM   6894  C  CB   . HIS A 1 36  ? 18.076  4.014   12.672  1.00 0.00 ? 393 HIS A CB   5  
ATOM   6895  C  CG   . HIS A 1 36  ? 17.563  2.848   11.885  1.00 0.00 ? 393 HIS A CG   5  
ATOM   6896  N  ND1  . HIS A 1 36  ? 17.540  2.821   10.506  1.00 0.00 ? 393 HIS A ND1  5  
ATOM   6897  C  CD2  . HIS A 1 36  ? 17.053  1.662   12.291  1.00 0.00 ? 393 HIS A CD2  5  
ATOM   6898  C  CE1  . HIS A 1 36  ? 17.036  1.670   10.099  1.00 0.00 ? 393 HIS A CE1  5  
ATOM   6899  N  NE2  . HIS A 1 36  ? 16.733  0.948   11.162  1.00 0.00 ? 393 HIS A NE2  5  
ATOM   6900  H  H    . HIS A 1 36  ? 17.963  5.603   14.646  1.00 0.00 ? 393 HIS A H    5  
ATOM   6901  H  HA   . HIS A 1 36  ? 17.232  5.837   11.936  1.00 0.00 ? 393 HIS A HA   5  
ATOM   6902  H  HB2  . HIS A 1 36  ? 18.979  4.365   12.193  1.00 0.00 ? 393 HIS A HB2  5  
ATOM   6903  H  HB3  . HIS A 1 36  ? 18.314  3.666   13.666  1.00 0.00 ? 393 HIS A HB3  5  
ATOM   6904  H  HD1  . HIS A 1 36  ? 17.845  3.540   9.915   1.00 0.00 ? 393 HIS A HD1  5  
ATOM   6905  H  HD2  . HIS A 1 36  ? 16.921  1.336   13.313  1.00 0.00 ? 393 HIS A HD2  5  
ATOM   6906  H  HE1  . HIS A 1 36  ? 16.896  1.370   9.071   1.00 0.00 ? 393 HIS A HE1  5  
ATOM   6907  N  N    . LEU A 1 37  ? 15.190  4.089   13.839  1.00 0.00 ? 394 LEU A N    5  
ATOM   6908  C  CA   . LEU A 1 37  ? 13.842  3.539   13.921  1.00 0.00 ? 394 LEU A CA   5  
ATOM   6909  C  C    . LEU A 1 37  ? 12.842  4.439   13.203  1.00 0.00 ? 394 LEU A C    5  
ATOM   6910  O  O    . LEU A 1 37  ? 11.875  3.961   12.609  1.00 0.00 ? 394 LEU A O    5  
ATOM   6911  C  CB   . LEU A 1 37  ? 13.429  3.364   15.383  1.00 0.00 ? 394 LEU A CB   5  
ATOM   6912  C  CG   . LEU A 1 37  ? 14.208  2.316   16.179  1.00 0.00 ? 394 LEU A CG   5  
ATOM   6913  C  CD1  . LEU A 1 37  ? 13.823  2.368   17.650  1.00 0.00 ? 394 LEU A CD1  5  
ATOM   6914  C  CD2  . LEU A 1 37  ? 13.964  0.925   15.611  1.00 0.00 ? 394 LEU A CD2  5  
ATOM   6915  H  H    . LEU A 1 37  ? 15.768  4.056   14.629  1.00 0.00 ? 394 LEU A H    5  
ATOM   6916  H  HA   . LEU A 1 37  ? 13.848  2.573   13.439  1.00 0.00 ? 394 LEU A HA   5  
ATOM   6917  H  HB2  . LEU A 1 37  ? 13.554  4.315   15.878  1.00 0.00 ? 394 LEU A HB2  5  
ATOM   6918  H  HB3  . LEU A 1 37  ? 12.385  3.085   15.401  1.00 0.00 ? 394 LEU A HB3  5  
ATOM   6919  H  HG   . LEU A 1 37  ? 15.266  2.528   16.104  1.00 0.00 ? 394 LEU A HG   5  
ATOM   6920  H  HD11 . LEU A 1 37  ? 13.432  3.346   17.885  1.00 0.00 ? 394 LEU A HD11 5  
ATOM   6921  H  HD12 . LEU A 1 37  ? 14.695  2.173   18.257  1.00 0.00 ? 394 LEU A HD12 5  
ATOM   6922  H  HD13 . LEU A 1 37  ? 13.070  1.620   17.851  1.00 0.00 ? 394 LEU A HD13 5  
ATOM   6923  H  HD21 . LEU A 1 37  ? 12.919  0.673   15.712  1.00 0.00 ? 394 LEU A HD21 5  
ATOM   6924  H  HD22 . LEU A 1 37  ? 14.562  0.206   16.152  1.00 0.00 ? 394 LEU A HD22 5  
ATOM   6925  H  HD23 . LEU A 1 37  ? 14.241  0.910   14.567  1.00 0.00 ? 394 LEU A HD23 5  
ATOM   6926  N  N    . ARG A 1 38  ? 13.082  5.745   13.260  1.00 0.00 ? 395 ARG A N    5  
ATOM   6927  C  CA   . ARG A 1 38  ? 12.203  6.713   12.614  1.00 0.00 ? 395 ARG A CA   5  
ATOM   6928  C  C    . ARG A 1 38  ? 11.905  6.301   11.175  1.00 0.00 ? 395 ARG A C    5  
ATOM   6929  O  O    . ARG A 1 38  ? 10.749  6.269   10.753  1.00 0.00 ? 395 ARG A O    5  
ATOM   6930  C  CB   . ARG A 1 38  ? 12.836  8.105   12.637  1.00 0.00 ? 395 ARG A CB   5  
ATOM   6931  C  CG   . ARG A 1 38  ? 12.964  8.693   14.033  1.00 0.00 ? 395 ARG A CG   5  
ATOM   6932  C  CD   . ARG A 1 38  ? 13.292  10.177  13.985  1.00 0.00 ? 395 ARG A CD   5  
ATOM   6933  N  NE   . ARG A 1 38  ? 12.222  10.954  13.366  1.00 0.00 ? 395 ARG A NE   5  
ATOM   6934  C  CZ   . ARG A 1 38  ? 12.033  12.251  13.588  1.00 0.00 ? 395 ARG A CZ   5  
ATOM   6935  N  NH1  . ARG A 1 38  ? 12.839  12.911  14.407  1.00 0.00 ? 395 ARG A NH1  5  
ATOM   6936  N  NH2  . ARG A 1 38  ? 11.036  12.889  12.988  1.00 0.00 ? 395 ARG A NH2  5  
ATOM   6937  H  H    . ARG A 1 38  ? 13.869  6.066   13.748  1.00 0.00 ? 395 ARG A H    5  
ATOM   6938  H  HA   . ARG A 1 38  ? 11.276  6.739   13.167  1.00 0.00 ? 395 ARG A HA   5  
ATOM   6939  H  HB2  . ARG A 1 38  ? 13.824  8.045   12.205  1.00 0.00 ? 395 ARG A HB2  5  
ATOM   6940  H  HB3  . ARG A 1 38  ? 12.231  8.772   12.043  1.00 0.00 ? 395 ARG A HB3  5  
ATOM   6941  H  HG2  . ARG A 1 38  ? 12.028  8.560   14.556  1.00 0.00 ? 395 ARG A HG2  5  
ATOM   6942  H  HG3  . ARG A 1 38  ? 13.751  8.175   14.561  1.00 0.00 ? 395 ARG A HG3  5  
ATOM   6943  H  HD2  . ARG A 1 38  ? 13.445  10.531  14.993  1.00 0.00 ? 395 ARG A HD2  5  
ATOM   6944  H  HD3  . ARG A 1 38  ? 14.199  10.312  13.414  1.00 0.00 ? 395 ARG A HD3  5  
ATOM   6945  H  HE   . ARG A 1 38  ? 11.614  10.486  12.757  1.00 0.00 ? 395 ARG A HE   5  
ATOM   6946  H  HH11 . ARG A 1 38  ? 13.591  12.433  14.860  1.00 0.00 ? 395 ARG A HH11 5  
ATOM   6947  H  HH12 . ARG A 1 38  ? 12.695  13.887  14.571  1.00 0.00 ? 395 ARG A HH12 5  
ATOM   6948  H  HH21 . ARG A 1 38  ? 10.427  12.394  12.369  1.00 0.00 ? 395 ARG A HH21 5  
ATOM   6949  H  HH22 . ARG A 1 38  ? 10.895  13.864  13.155  1.00 0.00 ? 395 ARG A HH22 5  
ATOM   6950  N  N    . THR A 1 39  ? 12.957  5.987   10.425  1.00 0.00 ? 396 THR A N    5  
ATOM   6951  C  CA   . THR A 1 39  ? 12.810  5.580   9.034   1.00 0.00 ? 396 THR A CA   5  
ATOM   6952  C  C    . THR A 1 39  ? 11.536  4.768   8.831   1.00 0.00 ? 396 THR A C    5  
ATOM   6953  O  O    . THR A 1 39  ? 10.709  5.094   7.979   1.00 0.00 ? 396 THR A O    5  
ATOM   6954  C  CB   . THR A 1 39  ? 14.017  4.748   8.561   1.00 0.00 ? 396 THR A CB   5  
ATOM   6955  O  OG1  . THR A 1 39  ? 14.082  3.520   9.294   1.00 0.00 ? 396 THR A OG1  5  
ATOM   6956  C  CG2  . THR A 1 39  ? 15.313  5.523   8.743   1.00 0.00 ? 396 THR A CG2  5  
ATOM   6957  H  H    . THR A 1 39  ? 13.854  6.032   10.819  1.00 0.00 ? 396 THR A H    5  
ATOM   6958  H  HA   . THR A 1 39  ? 12.756  6.474   8.428   1.00 0.00 ? 396 THR A HA   5  
ATOM   6959  H  HB   . THR A 1 39  ? 13.892  4.525   7.511   1.00 0.00 ? 396 THR A HB   5  
ATOM   6960  H  HG1  . THR A 1 39  ? 14.104  3.710   10.236  1.00 0.00 ? 396 THR A HG1  5  
ATOM   6961  H  HG21 . THR A 1 39  ? 16.080  4.859   9.113   1.00 0.00 ? 396 THR A HG21 5  
ATOM   6962  H  HG22 . THR A 1 39  ? 15.158  6.323   9.451   1.00 0.00 ? 396 THR A HG22 5  
ATOM   6963  H  HG23 . THR A 1 39  ? 15.621  5.936   7.794   1.00 0.00 ? 396 THR A HG23 5  
ATOM   6964  N  N    . HIS A 1 40  ? 11.383  3.708   9.619   1.00 0.00 ? 397 HIS A N    5  
ATOM   6965  C  CA   . HIS A 1 40  ? 10.208  2.849   9.526   1.00 0.00 ? 397 HIS A CA   5  
ATOM   6966  C  C    . HIS A 1 40  ? 8.960   3.583   10.007  1.00 0.00 ? 397 HIS A C    5  
ATOM   6967  O  O    . HIS A 1 40  ? 7.898   3.497   9.388   1.00 0.00 ? 397 HIS A O    5  
ATOM   6968  C  CB   . HIS A 1 40  ? 10.414  1.577   10.348  1.00 0.00 ? 397 HIS A CB   5  
ATOM   6969  C  CG   . HIS A 1 40  ? 11.775  0.973   10.185  1.00 0.00 ? 397 HIS A CG   5  
ATOM   6970  N  ND1  . HIS A 1 40  ? 12.360  0.755   8.956   1.00 0.00 ? 397 HIS A ND1  5  
ATOM   6971  C  CD2  . HIS A 1 40  ? 12.668  0.541   11.107  1.00 0.00 ? 397 HIS A CD2  5  
ATOM   6972  C  CE1  . HIS A 1 40  ? 13.553  0.214   9.128   1.00 0.00 ? 397 HIS A CE1  5  
ATOM   6973  N  NE2  . HIS A 1 40  ? 13.764  0.074   10.424  1.00 0.00 ? 397 HIS A NE2  5  
ATOM   6974  H  H    . HIS A 1 40  ? 12.077  3.500   10.278  1.00 0.00 ? 397 HIS A H    5  
ATOM   6975  H  HA   . HIS A 1 40  ? 10.075  2.580   8.489   1.00 0.00 ? 397 HIS A HA   5  
ATOM   6976  H  HB2  . HIS A 1 40  ? 10.276  1.806   11.394  1.00 0.00 ? 397 HIS A HB2  5  
ATOM   6977  H  HB3  . HIS A 1 40  ? 9.684   0.839   10.046  1.00 0.00 ? 397 HIS A HB3  5  
ATOM   6978  H  HD1  . HIS A 1 40  ? 11.959  0.964   8.087   1.00 0.00 ? 397 HIS A HD1  5  
ATOM   6979  H  HD2  . HIS A 1 40  ? 12.542  0.560   12.180  1.00 0.00 ? 397 HIS A HD2  5  
ATOM   6980  H  HE1  . HIS A 1 40  ? 14.239  -0.066  8.343   1.00 0.00 ? 397 HIS A HE1  5  
ATOM   6981  N  N    . THR A 1 41  ? 9.093   4.305   11.115  1.00 0.00 ? 398 THR A N    5  
ATOM   6982  C  CA   . THR A 1 41  ? 7.976   5.051   11.680  1.00 0.00 ? 398 THR A CA   5  
ATOM   6983  C  C    . THR A 1 41  ? 7.110   5.659   10.583  1.00 0.00 ? 398 THR A C    5  
ATOM   6984  O  O    . THR A 1 41  ? 7.587   6.446   9.767   1.00 0.00 ? 398 THR A O    5  
ATOM   6985  C  CB   . THR A 1 41  ? 8.466   6.175   12.613  1.00 0.00 ? 398 THR A CB   5  
ATOM   6986  O  OG1  . THR A 1 41  ? 9.313   5.631   13.632  1.00 0.00 ? 398 THR A OG1  5  
ATOM   6987  C  CG2  . THR A 1 41  ? 7.291   6.897   13.255  1.00 0.00 ? 398 THR A CG2  5  
ATOM   6988  H  H    . THR A 1 41  ? 9.964   4.334   11.563  1.00 0.00 ? 398 THR A H    5  
ATOM   6989  H  HA   . THR A 1 41  ? 7.376   4.366   12.261  1.00 0.00 ? 398 THR A HA   5  
ATOM   6990  H  HB   . THR A 1 41  ? 9.031   6.887   12.029  1.00 0.00 ? 398 THR A HB   5  
ATOM   6991  H  HG1  . THR A 1 41  ? 9.590   4.747   13.380  1.00 0.00 ? 398 THR A HG1  5  
ATOM   6992  H  HG21 . THR A 1 41  ? 7.432   7.963   13.165  1.00 0.00 ? 398 THR A HG21 5  
ATOM   6993  H  HG22 . THR A 1 41  ? 7.231   6.629   14.299  1.00 0.00 ? 398 THR A HG22 5  
ATOM   6994  H  HG23 . THR A 1 41  ? 6.377   6.610   12.756  1.00 0.00 ? 398 THR A HG23 5  
ATOM   6995  N  N    . GLY A 1 42  ? 5.833   5.289   10.570  1.00 0.00 ? 399 GLY A N    5  
ATOM   6996  C  CA   . GLY A 1 42  ? 4.920   5.809   9.568   1.00 0.00 ? 399 GLY A CA   5  
ATOM   6997  C  C    . GLY A 1 42  ? 3.467   5.592   9.940   1.00 0.00 ? 399 GLY A C    5  
ATOM   6998  O  O    . GLY A 1 42  ? 2.840   6.458   10.548  1.00 0.00 ? 399 GLY A O    5  
ATOM   6999  H  H    . GLY A 1 42  ? 5.508   4.658   11.246  1.00 0.00 ? 399 GLY A H    5  
ATOM   7000  H  HA2  . GLY A 1 42  ? 5.097   6.867   9.450   1.00 0.00 ? 399 GLY A HA2  5  
ATOM   7001  H  HA3  . GLY A 1 42  ? 5.117   5.314   8.628   1.00 0.00 ? 399 GLY A HA3  5  
ATOM   7002  N  N    . GLU A 1 43  ? 2.930   4.432   9.572   1.00 0.00 ? 400 GLU A N    5  
ATOM   7003  C  CA   . GLU A 1 43  ? 1.540   4.106   9.869   1.00 0.00 ? 400 GLU A CA   5  
ATOM   7004  C  C    . GLU A 1 43  ? 1.197   4.455   11.315  1.00 0.00 ? 400 GLU A C    5  
ATOM   7005  O  O    . GLU A 1 43  ? 1.436   3.667   12.229  1.00 0.00 ? 400 GLU A O    5  
ATOM   7006  C  CB   . GLU A 1 43  ? 1.276   2.621   9.615   1.00 0.00 ? 400 GLU A CB   5  
ATOM   7007  C  CG   . GLU A 1 43  ? 2.342   1.705   10.193  1.00 0.00 ? 400 GLU A CG   5  
ATOM   7008  C  CD   . GLU A 1 43  ? 2.102   0.246   9.858   1.00 0.00 ? 400 GLU A CD   5  
ATOM   7009  O  OE1  . GLU A 1 43  ? 2.479   -0.177  8.745   1.00 0.00 ? 400 GLU A OE1  5  
ATOM   7010  O  OE2  . GLU A 1 43  ? 1.537   -0.473  10.709  1.00 0.00 ? 400 GLU A OE2  5  
ATOM   7011  H  H    . GLU A 1 43  ? 3.482   3.782   9.090   1.00 0.00 ? 400 GLU A H    5  
ATOM   7012  H  HA   . GLU A 1 43  ? 0.915   4.691   9.212   1.00 0.00 ? 400 GLU A HA   5  
ATOM   7013  H  HB2  . GLU A 1 43  ? 0.326   2.356   10.054  1.00 0.00 ? 400 GLU A HB2  5  
ATOM   7014  H  HB3  . GLU A 1 43  ? 1.228   2.454   8.549   1.00 0.00 ? 400 GLU A HB3  5  
ATOM   7015  H  HG2  . GLU A 1 43  ? 3.303   1.996   9.795   1.00 0.00 ? 400 GLU A HG2  5  
ATOM   7016  H  HG3  . GLU A 1 43  ? 2.350   1.817   11.267  1.00 0.00 ? 400 GLU A HG3  5  
ATOM   7017  N  N    . LYS A 1 44  ? 0.635   5.643   11.513  1.00 0.00 ? 401 LYS A N    5  
ATOM   7018  C  CA   . LYS A 1 44  ? 0.257   6.098   12.845  1.00 0.00 ? 401 LYS A CA   5  
ATOM   7019  C  C    . LYS A 1 44  ? -1.196  6.561   12.870  1.00 0.00 ? 401 LYS A C    5  
ATOM   7020  O  O    . LYS A 1 44  ? -1.493  7.756   12.873  1.00 0.00 ? 401 LYS A O    5  
ATOM   7021  C  CB   . LYS A 1 44  ? 1.173   7.237   13.297  1.00 0.00 ? 401 LYS A CB   5  
ATOM   7022  C  CG   . LYS A 1 44  ? 2.627   6.823   13.452  1.00 0.00 ? 401 LYS A CG   5  
ATOM   7023  C  CD   . LYS A 1 44  ? 2.918   6.329   14.859  1.00 0.00 ? 401 LYS A CD   5  
ATOM   7024  C  CE   . LYS A 1 44  ? 4.393   6.466   15.203  1.00 0.00 ? 401 LYS A CE   5  
ATOM   7025  N  NZ   . LYS A 1 44  ? 4.700   7.790   15.813  1.00 0.00 ? 401 LYS A NZ   5  
ATOM   7026  H  H    . LYS A 1 44  ? 0.469   6.227   10.743  1.00 0.00 ? 401 LYS A H    5  
ATOM   7027  H  HA   . LYS A 1 44  ? 0.369   5.266   13.524  1.00 0.00 ? 401 LYS A HA   5  
ATOM   7028  H  HB2  . LYS A 1 44  ? 1.123   8.033   12.569  1.00 0.00 ? 401 LYS A HB2  5  
ATOM   7029  H  HB3  . LYS A 1 44  ? 0.823   7.609   14.249  1.00 0.00 ? 401 LYS A HB3  5  
ATOM   7030  H  HG2  . LYS A 1 44  ? 2.843   6.031   12.751  1.00 0.00 ? 401 LYS A HG2  5  
ATOM   7031  H  HG3  . LYS A 1 44  ? 3.258   7.675   13.241  1.00 0.00 ? 401 LYS A HG3  5  
ATOM   7032  H  HD2  . LYS A 1 44  ? 2.341   6.910   15.563  1.00 0.00 ? 401 LYS A HD2  5  
ATOM   7033  H  HD3  . LYS A 1 44  ? 2.636   5.288   14.931  1.00 0.00 ? 401 LYS A HD3  5  
ATOM   7034  H  HE2  . LYS A 1 44  ? 4.661   5.687   15.901  1.00 0.00 ? 401 LYS A HE2  5  
ATOM   7035  H  HE3  . LYS A 1 44  ? 4.973   6.353   14.299  1.00 0.00 ? 401 LYS A HE3  5  
ATOM   7036  H  HZ1  . LYS A 1 44  ? 3.857   8.399   15.788  1.00 0.00 ? 401 LYS A HZ1  5  
ATOM   7037  H  HZ2  . LYS A 1 44  ? 5.468   8.255   15.288  1.00 0.00 ? 401 LYS A HZ2  5  
ATOM   7038  H  HZ3  . LYS A 1 44  ? 4.996   7.667   16.802  1.00 0.00 ? 401 LYS A HZ3  5  
ATOM   7039  N  N    . PRO A 1 45  ? -2.126  5.594   12.891  1.00 0.00 ? 402 PRO A N    5  
ATOM   7040  C  CA   . PRO A 1 45  ? -3.564  5.878   12.919  1.00 0.00 ? 402 PRO A CA   5  
ATOM   7041  C  C    . PRO A 1 45  ? -4.012  6.473   14.249  1.00 0.00 ? 402 PRO A C    5  
ATOM   7042  O  O    . PRO A 1 45  ? -5.044  7.139   14.326  1.00 0.00 ? 402 PRO A O    5  
ATOM   7043  C  CB   . PRO A 1 45  ? -4.201  4.503   12.706  1.00 0.00 ? 402 PRO A CB   5  
ATOM   7044  C  CG   . PRO A 1 45  ? -3.182  3.533   13.195  1.00 0.00 ? 402 PRO A CG   5  
ATOM   7045  C  CD   . PRO A 1 45  ? -1.845  4.148   12.890  1.00 0.00 ? 402 PRO A CD   5  
ATOM   7046  H  HA   . PRO A 1 45  ? -3.853  6.539   12.115  1.00 0.00 ? 402 PRO A HA   5  
ATOM   7047  H  HB2  . PRO A 1 45  ? -5.118  4.436   13.275  1.00 0.00 ? 402 PRO A HB2  5  
ATOM   7048  H  HB3  . PRO A 1 45  ? -4.412  4.358   11.657  1.00 0.00 ? 402 PRO A HB3  5  
ATOM   7049  H  HG2  . PRO A 1 45  ? -3.295  3.388   14.259  1.00 0.00 ? 402 PRO A HG2  5  
ATOM   7050  H  HG3  . PRO A 1 45  ? -3.290  2.593   12.673  1.00 0.00 ? 402 PRO A HG3  5  
ATOM   7051  H  HD2  . PRO A 1 45  ? -1.129  3.894   13.657  1.00 0.00 ? 402 PRO A HD2  5  
ATOM   7052  H  HD3  . PRO A 1 45  ? -1.493  3.825   11.921  1.00 0.00 ? 402 PRO A HD3  5  
ATOM   7053  N  N    . TYR A 1 46  ? -3.229  6.228   15.295  1.00 0.00 ? 403 TYR A N    5  
ATOM   7054  C  CA   . TYR A 1 46  ? -3.547  6.738   16.623  1.00 0.00 ? 403 TYR A CA   5  
ATOM   7055  C  C    . TYR A 1 46  ? -3.066  8.176   16.784  1.00 0.00 ? 403 TYR A C    5  
ATOM   7056  O  O    . TYR A 1 46  ? -1.893  8.480   16.563  1.00 0.00 ? 403 TYR A O    5  
ATOM   7057  C  CB   . TYR A 1 46  ? -2.912  5.853   17.697  1.00 0.00 ? 403 TYR A CB   5  
ATOM   7058  C  CG   . TYR A 1 46  ? -3.459  4.444   17.722  1.00 0.00 ? 403 TYR A CG   5  
ATOM   7059  C  CD1  . TYR A 1 46  ? -4.690  4.166   18.305  1.00 0.00 ? 403 TYR A CD1  5  
ATOM   7060  C  CD2  . TYR A 1 46  ? -2.746  3.390   17.164  1.00 0.00 ? 403 TYR A CD2  5  
ATOM   7061  C  CE1  . TYR A 1 46  ? -5.194  2.880   18.331  1.00 0.00 ? 403 TYR A CE1  5  
ATOM   7062  C  CE2  . TYR A 1 46  ? -3.243  2.101   17.184  1.00 0.00 ? 403 TYR A CE2  5  
ATOM   7063  C  CZ   . TYR A 1 46  ? -4.467  1.851   17.769  1.00 0.00 ? 403 TYR A CZ   5  
ATOM   7064  O  OH   . TYR A 1 46  ? -4.965  0.568   17.792  1.00 0.00 ? 403 TYR A OH   5  
ATOM   7065  H  H    . TYR A 1 46  ? -2.420  5.690   15.170  1.00 0.00 ? 403 TYR A H    5  
ATOM   7066  H  HA   . TYR A 1 46  ? -4.621  6.714   16.740  1.00 0.00 ? 403 TYR A HA   5  
ATOM   7067  H  HB2  . TYR A 1 46  ? -1.849  5.792   17.522  1.00 0.00 ? 403 TYR A HB2  5  
ATOM   7068  H  HB3  . TYR A 1 46  ? -3.087  6.294   18.667  1.00 0.00 ? 403 TYR A HB3  5  
ATOM   7069  H  HD1  . TYR A 1 46  ? -5.257  4.974   18.745  1.00 0.00 ? 403 TYR A HD1  5  
ATOM   7070  H  HD2  . TYR A 1 46  ? -1.788  3.589   16.707  1.00 0.00 ? 403 TYR A HD2  5  
ATOM   7071  H  HE1  . TYR A 1 46  ? -6.152  2.683   18.789  1.00 0.00 ? 403 TYR A HE1  5  
ATOM   7072  H  HE2  . TYR A 1 46  ? -2.674  1.295   16.744  1.00 0.00 ? 403 TYR A HE2  5  
ATOM   7073  H  HH   . TYR A 1 46  ? -4.783  0.139   16.952  1.00 0.00 ? 403 TYR A HH   5  
ATOM   7074  N  N    . LYS A 1 47  ? -3.980  9.059   17.171  1.00 0.00 ? 404 LYS A N    5  
ATOM   7075  C  CA   . LYS A 1 47  ? -3.652  10.467  17.364  1.00 0.00 ? 404 LYS A CA   5  
ATOM   7076  C  C    . LYS A 1 47  ? -4.149  10.960  18.719  1.00 0.00 ? 404 LYS A C    5  
ATOM   7077  O  O    . LYS A 1 47  ? -5.300  10.731  19.091  1.00 0.00 ? 404 LYS A O    5  
ATOM   7078  C  CB   . LYS A 1 47  ? -4.265  11.313  16.246  1.00 0.00 ? 404 LYS A CB   5  
ATOM   7079  C  CG   . LYS A 1 47  ? -3.746  12.740  16.209  1.00 0.00 ? 404 LYS A CG   5  
ATOM   7080  C  CD   . LYS A 1 47  ? -4.662  13.645  15.402  1.00 0.00 ? 404 LYS A CD   5  
ATOM   7081  C  CE   . LYS A 1 47  ? -4.617  13.306  13.920  1.00 0.00 ? 404 LYS A CE   5  
ATOM   7082  N  NZ   . LYS A 1 47  ? -5.532  12.182  13.581  1.00 0.00 ? 404 LYS A NZ   5  
ATOM   7083  H  H    . LYS A 1 47  ? -4.899  8.756   17.331  1.00 0.00 ? 404 LYS A H    5  
ATOM   7084  H  HA   . LYS A 1 47  ? -2.578  10.565  17.331  1.00 0.00 ? 404 LYS A HA   5  
ATOM   7085  H  HB2  . LYS A 1 47  ? -4.045  10.847  15.297  1.00 0.00 ? 404 LYS A HB2  5  
ATOM   7086  H  HB3  . LYS A 1 47  ? -5.336  11.345  16.381  1.00 0.00 ? 404 LYS A HB3  5  
ATOM   7087  H  HG2  . LYS A 1 47  ? -3.683  13.117  17.219  1.00 0.00 ? 404 LYS A HG2  5  
ATOM   7088  H  HG3  . LYS A 1 47  ? -2.763  12.744  15.759  1.00 0.00 ? 404 LYS A HG3  5  
ATOM   7089  H  HD2  . LYS A 1 47  ? -5.675  13.526  15.757  1.00 0.00 ? 404 LYS A HD2  5  
ATOM   7090  H  HD3  . LYS A 1 47  ? -4.350  14.671  15.538  1.00 0.00 ? 404 LYS A HD3  5  
ATOM   7091  H  HE2  . LYS A 1 47  ? -4.908  14.179  13.356  1.00 0.00 ? 404 LYS A HE2  5  
ATOM   7092  H  HE3  . LYS A 1 47  ? -3.606  13.029  13.659  1.00 0.00 ? 404 LYS A HE3  5  
ATOM   7093  H  HZ1  . LYS A 1 47  ? -6.243  12.061  14.329  1.00 0.00 ? 404 LYS A HZ1  5  
ATOM   7094  H  HZ2  . LYS A 1 47  ? -4.992  11.298  13.484  1.00 0.00 ? 404 LYS A HZ2  5  
ATOM   7095  H  HZ3  . LYS A 1 47  ? -6.019  12.376  12.683  1.00 0.00 ? 404 LYS A HZ3  5  
ATOM   7096  N  N    . CYS A 1 48  ? -3.274  11.640  19.453  1.00 0.00 ? 405 CYS A N    5  
ATOM   7097  C  CA   . CYS A 1 48  ? -3.623  12.167  20.767  1.00 0.00 ? 405 CYS A CA   5  
ATOM   7098  C  C    . CYS A 1 48  ? -4.698  13.244  20.652  1.00 0.00 ? 405 CYS A C    5  
ATOM   7099  O  O    . CYS A 1 48  ? -4.464  14.314  20.090  1.00 0.00 ? 405 CYS A O    5  
ATOM   7100  C  CB   . CYS A 1 48  ? -2.383  12.739  21.456  1.00 0.00 ? 405 CYS A CB   5  
ATOM   7101  S  SG   . CYS A 1 48  ? -2.682  13.331  23.153  1.00 0.00 ? 405 CYS A SG   5  
ATOM   7102  H  H    . CYS A 1 48  ? -2.370  11.791  19.103  1.00 0.00 ? 405 CYS A H    5  
ATOM   7103  H  HA   . CYS A 1 48  ? -4.010  11.352  21.360  1.00 0.00 ? 405 CYS A HA   5  
ATOM   7104  H  HB2  . CYS A 1 48  ? -1.623  11.974  21.506  1.00 0.00 ? 405 CYS A HB2  5  
ATOM   7105  H  HB3  . CYS A 1 48  ? -2.011  13.572  20.878  1.00 0.00 ? 405 CYS A HB3  5  
ATOM   7106  N  N    . THR A 1 49  ? -5.879  12.955  21.191  1.00 0.00 ? 406 THR A N    5  
ATOM   7107  C  CA   . THR A 1 49  ? -6.990  13.897  21.149  1.00 0.00 ? 406 THR A CA   5  
ATOM   7108  C  C    . THR A 1 49  ? -6.888  14.917  22.277  1.00 0.00 ? 406 THR A C    5  
ATOM   7109  O  O    . THR A 1 49  ? -7.872  15.199  22.962  1.00 0.00 ? 406 THR A O    5  
ATOM   7110  C  CB   . THR A 1 49  ? -8.345  13.172  21.248  1.00 0.00 ? 406 THR A CB   5  
ATOM   7111  O  OG1  . THR A 1 49  ? -8.384  12.078  20.326  1.00 0.00 ? 406 THR A OG1  5  
ATOM   7112  C  CG2  . THR A 1 49  ? -9.493  14.127  20.959  1.00 0.00 ? 406 THR A CG2  5  
ATOM   7113  H  H    . THR A 1 49  ? -6.004  12.085  21.626  1.00 0.00 ? 406 THR A H    5  
ATOM   7114  H  HA   . THR A 1 49  ? -6.951  14.416  20.202  1.00 0.00 ? 406 THR A HA   5  
ATOM   7115  H  HB   . THR A 1 49  ? -8.459  12.790  22.253  1.00 0.00 ? 406 THR A HB   5  
ATOM   7116  H  HG1  . THR A 1 49  ? -7.498  11.726  20.209  1.00 0.00 ? 406 THR A HG1  5  
ATOM   7117  H  HG21 . THR A 1 49  ? -9.159  14.892  20.273  1.00 0.00 ? 406 THR A HG21 5  
ATOM   7118  H  HG22 . THR A 1 49  ? -9.819  14.588  21.879  1.00 0.00 ? 406 THR A HG22 5  
ATOM   7119  H  HG23 . THR A 1 49  ? -10.313 13.581  20.518  1.00 0.00 ? 406 THR A HG23 5  
ATOM   7120  N  N    . TRP A 1 50  ? -5.694  15.468  22.464  1.00 0.00 ? 407 TRP A N    5  
ATOM   7121  C  CA   . TRP A 1 50  ? -5.465  16.458  23.510  1.00 0.00 ? 407 TRP A CA   5  
ATOM   7122  C  C    . TRP A 1 50  ? -5.294  17.851  22.913  1.00 0.00 ? 407 TRP A C    5  
ATOM   7123  O  O    . TRP A 1 50  ? -4.430  18.070  22.065  1.00 0.00 ? 407 TRP A O    5  
ATOM   7124  C  CB   . TRP A 1 50  ? -4.229  16.087  24.331  1.00 0.00 ? 407 TRP A CB   5  
ATOM   7125  C  CG   . TRP A 1 50  ? -4.031  16.959  25.534  1.00 0.00 ? 407 TRP A CG   5  
ATOM   7126  C  CD1  . TRP A 1 50  ? -3.287  18.102  25.604  1.00 0.00 ? 407 TRP A CD1  5  
ATOM   7127  C  CD2  . TRP A 1 50  ? -4.584  16.757  26.839  1.00 0.00 ? 407 TRP A CD2  5  
ATOM   7128  N  NE1  . TRP A 1 50  ? -3.344  18.623  26.874  1.00 0.00 ? 407 TRP A NE1  5  
ATOM   7129  C  CE2  . TRP A 1 50  ? -4.134  17.816  27.651  1.00 0.00 ? 407 TRP A CE2  5  
ATOM   7130  C  CE3  . TRP A 1 50  ? -5.417  15.785  27.401  1.00 0.00 ? 407 TRP A CE3  5  
ATOM   7131  C  CZ2  . TRP A 1 50  ? -4.489  17.928  28.992  1.00 0.00 ? 407 TRP A CZ2  5  
ATOM   7132  C  CZ3  . TRP A 1 50  ? -5.768  15.898  28.732  1.00 0.00 ? 407 TRP A CZ3  5  
ATOM   7133  C  CH2  . TRP A 1 50  ? -5.305  16.963  29.516  1.00 0.00 ? 407 TRP A CH2  5  
ATOM   7134  H  H    . TRP A 1 50  ? -4.949  15.202  21.886  1.00 0.00 ? 407 TRP A H    5  
ATOM   7135  H  HA   . TRP A 1 50  ? -6.329  16.461  24.158  1.00 0.00 ? 407 TRP A HA   5  
ATOM   7136  H  HB2  . TRP A 1 50  ? -4.324  15.067  24.671  1.00 0.00 ? 407 TRP A HB2  5  
ATOM   7137  H  HB3  . TRP A 1 50  ? -3.352  16.175  23.706  1.00 0.00 ? 407 TRP A HB3  5  
ATOM   7138  H  HD1  . TRP A 1 50  ? -2.738  18.522  24.775  1.00 0.00 ? 407 TRP A HD1  5  
ATOM   7139  H  HE1  . TRP A 1 50  ? -2.893  19.440  27.175  1.00 0.00 ? 407 TRP A HE1  5  
ATOM   7140  H  HE3  . TRP A 1 50  ? -5.784  14.957  26.813  1.00 0.00 ? 407 TRP A HE3  5  
ATOM   7141  H  HZ2  . TRP A 1 50  ? -4.141  18.744  29.609  1.00 0.00 ? 407 TRP A HZ2  5  
ATOM   7142  H  HZ3  . TRP A 1 50  ? -6.410  15.156  29.184  1.00 0.00 ? 407 TRP A HZ3  5  
ATOM   7143  H  HH2  . TRP A 1 50  ? -5.604  17.011  30.552  1.00 0.00 ? 407 TRP A HH2  5  
ATOM   7144  N  N    . GLU A 1 51  ? -6.124  18.788  23.361  1.00 0.00 ? 408 GLU A N    5  
ATOM   7145  C  CA   . GLU A 1 51  ? -6.063  20.159  22.868  1.00 0.00 ? 408 GLU A CA   5  
ATOM   7146  C  C    . GLU A 1 51  ? -4.620  20.650  22.802  1.00 0.00 ? 408 GLU A C    5  
ATOM   7147  O  O    . GLU A 1 51  ? -3.945  20.768  23.824  1.00 0.00 ? 408 GLU A O    5  
ATOM   7148  C  CB   . GLU A 1 51  ? -6.887  21.084  23.767  1.00 0.00 ? 408 GLU A CB   5  
ATOM   7149  C  CG   . GLU A 1 51  ? -7.084  22.476  23.190  1.00 0.00 ? 408 GLU A CG   5  
ATOM   7150  C  CD   . GLU A 1 51  ? -7.876  23.383  24.112  1.00 0.00 ? 408 GLU A CD   5  
ATOM   7151  O  OE1  . GLU A 1 51  ? -7.500  23.501  25.296  1.00 0.00 ? 408 GLU A OE1  5  
ATOM   7152  O  OE2  . GLU A 1 51  ? -8.873  23.975  23.647  1.00 0.00 ? 408 GLU A OE2  5  
ATOM   7153  H  H    . GLU A 1 51  ? -6.792  18.552  24.037  1.00 0.00 ? 408 GLU A H    5  
ATOM   7154  H  HA   . GLU A 1 51  ? -6.481  20.173  21.873  1.00 0.00 ? 408 GLU A HA   5  
ATOM   7155  H  HB2  . GLU A 1 51  ? -7.860  20.641  23.924  1.00 0.00 ? 408 GLU A HB2  5  
ATOM   7156  H  HB3  . GLU A 1 51  ? -6.387  21.180  24.719  1.00 0.00 ? 408 GLU A HB3  5  
ATOM   7157  H  HG2  . GLU A 1 51  ? -6.116  22.921  23.018  1.00 0.00 ? 408 GLU A HG2  5  
ATOM   7158  H  HG3  . GLU A 1 51  ? -7.612  22.392  22.251  1.00 0.00 ? 408 GLU A HG3  5  
ATOM   7159  N  N    . GLY A 1 52  ? -4.153  20.935  21.591  1.00 0.00 ? 409 GLY A N    5  
ATOM   7160  C  CA   . GLY A 1 52  ? -2.793  21.409  21.413  1.00 0.00 ? 409 GLY A CA   5  
ATOM   7161  C  C    . GLY A 1 52  ? -1.857  20.319  20.928  1.00 0.00 ? 409 GLY A C    5  
ATOM   7162  O  O    . GLY A 1 52  ? -1.080  20.527  19.996  1.00 0.00 ? 409 GLY A O    5  
ATOM   7163  H  H    . GLY A 1 52  ? -4.736  20.823  20.811  1.00 0.00 ? 409 GLY A H    5  
ATOM   7164  H  HA2  . GLY A 1 52  ? -2.795  22.214  20.692  1.00 0.00 ? 409 GLY A HA2  5  
ATOM   7165  H  HA3  . GLY A 1 52  ? -2.428  21.786  22.357  1.00 0.00 ? 409 GLY A HA3  5  
ATOM   7166  N  N    . CYS A 1 53  ? -1.930  19.154  21.563  1.00 0.00 ? 410 CYS A N    5  
ATOM   7167  C  CA   . CYS A 1 53  ? -1.082  18.027  21.193  1.00 0.00 ? 410 CYS A CA   5  
ATOM   7168  C  C    . CYS A 1 53  ? -1.452  17.499  19.811  1.00 0.00 ? 410 CYS A C    5  
ATOM   7169  O  O    . CYS A 1 53  ? -2.629  17.317  19.499  1.00 0.00 ? 410 CYS A O    5  
ATOM   7170  C  CB   . CYS A 1 53  ? -1.205  16.908  22.229  1.00 0.00 ? 410 CYS A CB   5  
ATOM   7171  S  SG   . CYS A 1 53  ? 0.131   15.672  22.151  1.00 0.00 ? 410 CYS A SG   5  
ATOM   7172  H  H    . CYS A 1 53  ? -2.570  19.050  22.299  1.00 0.00 ? 410 CYS A H    5  
ATOM   7173  H  HA   . CYS A 1 53  ? -0.060  18.374  21.171  1.00 0.00 ? 410 CYS A HA   5  
ATOM   7174  H  HB2  . CYS A 1 53  ? -1.193  17.341  23.219  1.00 0.00 ? 410 CYS A HB2  5  
ATOM   7175  H  HB3  . CYS A 1 53  ? -2.142  16.391  22.080  1.00 0.00 ? 410 CYS A HB3  5  
ATOM   7176  N  N    . ASP A 1 54  ? -0.440  17.254  18.986  1.00 0.00 ? 411 ASP A N    5  
ATOM   7177  C  CA   . ASP A 1 54  ? -0.658  16.744  17.637  1.00 0.00 ? 411 ASP A CA   5  
ATOM   7178  C  C    . ASP A 1 54  ? 0.232   15.536  17.362  1.00 0.00 ? 411 ASP A C    5  
ATOM   7179  O  O    . ASP A 1 54  ? 0.531   15.223  16.210  1.00 0.00 ? 411 ASP A O    5  
ATOM   7180  C  CB   . ASP A 1 54  ? -0.385  17.840  16.605  1.00 0.00 ? 411 ASP A CB   5  
ATOM   7181  C  CG   . ASP A 1 54  ? -1.488  18.878  16.558  1.00 0.00 ? 411 ASP A CG   5  
ATOM   7182  O  OD1  . ASP A 1 54  ? -1.772  19.492  17.609  1.00 0.00 ? 411 ASP A OD1  5  
ATOM   7183  O  OD2  . ASP A 1 54  ? -2.067  19.079  15.470  1.00 0.00 ? 411 ASP A OD2  5  
ATOM   7184  H  H    . ASP A 1 54  ? 0.477   17.419  19.293  1.00 0.00 ? 411 ASP A H    5  
ATOM   7185  H  HA   . ASP A 1 54  ? -1.691  16.440  17.561  1.00 0.00 ? 411 ASP A HA   5  
ATOM   7186  H  HB2  . ASP A 1 54  ? 0.542   18.337  16.854  1.00 0.00 ? 411 ASP A HB2  5  
ATOM   7187  H  HB3  . ASP A 1 54  ? -0.296  17.390  15.628  1.00 0.00 ? 411 ASP A HB3  5  
ATOM   7188  N  N    . TRP A 1 55  ? 0.651   14.862  18.427  1.00 0.00 ? 412 TRP A N    5  
ATOM   7189  C  CA   . TRP A 1 55  ? 1.508   13.689  18.300  1.00 0.00 ? 412 TRP A CA   5  
ATOM   7190  C  C    . TRP A 1 55  ? 0.684   12.444  17.989  1.00 0.00 ? 412 TRP A C    5  
ATOM   7191  O  O    . TRP A 1 55  ? -0.520  12.407  18.243  1.00 0.00 ? 412 TRP A O    5  
ATOM   7192  C  CB   . TRP A 1 55  ? 2.310   13.476  19.585  1.00 0.00 ? 412 TRP A CB   5  
ATOM   7193  C  CG   . TRP A 1 55  ? 3.603   14.233  19.610  1.00 0.00 ? 412 TRP A CG   5  
ATOM   7194  C  CD1  . TRP A 1 55  ? 3.960   15.217  20.488  1.00 0.00 ? 412 TRP A CD1  5  
ATOM   7195  C  CD2  . TRP A 1 55  ? 4.710   14.068  18.717  1.00 0.00 ? 412 TRP A CD2  5  
ATOM   7196  N  NE1  . TRP A 1 55  ? 5.222   15.674  20.193  1.00 0.00 ? 412 TRP A NE1  5  
ATOM   7197  C  CE2  . TRP A 1 55  ? 5.704   14.985  19.112  1.00 0.00 ? 412 TRP A CE2  5  
ATOM   7198  C  CE3  . TRP A 1 55  ? 4.959   13.235  17.623  1.00 0.00 ? 412 TRP A CE3  5  
ATOM   7199  C  CZ2  . TRP A 1 55  ? 6.924   15.090  18.450  1.00 0.00 ? 412 TRP A CZ2  5  
ATOM   7200  C  CZ3  . TRP A 1 55  ? 6.170   13.340  16.967  1.00 0.00 ? 412 TRP A CZ3  5  
ATOM   7201  C  CH2  . TRP A 1 55  ? 7.141   14.261  17.382  1.00 0.00 ? 412 TRP A CH2  5  
ATOM   7202  H  H    . TRP A 1 55  ? 0.379   15.161  19.320  1.00 0.00 ? 412 TRP A H    5  
ATOM   7203  H  HA   . TRP A 1 55  ? 2.193   13.866  17.484  1.00 0.00 ? 412 TRP A HA   5  
ATOM   7204  H  HB2  . TRP A 1 55  ? 1.719   13.799  20.429  1.00 0.00 ? 412 TRP A HB2  5  
ATOM   7205  H  HB3  . TRP A 1 55  ? 2.536   12.424  19.690  1.00 0.00 ? 412 TRP A HB3  5  
ATOM   7206  H  HD1  . TRP A 1 55  ? 3.332   15.574  21.289  1.00 0.00 ? 412 TRP A HD1  5  
ATOM   7207  H  HE1  . TRP A 1 55  ? 5.700   16.378  20.680  1.00 0.00 ? 412 TRP A HE1  5  
ATOM   7208  H  HE3  . TRP A 1 55  ? 4.223   12.518  17.288  1.00 0.00 ? 412 TRP A HE3  5  
ATOM   7209  H  HZ2  . TRP A 1 55  ? 7.683   15.794  18.758  1.00 0.00 ? 412 TRP A HZ2  5  
ATOM   7210  H  HZ3  . TRP A 1 55  ? 6.380   12.705  16.119  1.00 0.00 ? 412 TRP A HZ3  5  
ATOM   7211  H  HH2  . TRP A 1 55  ? 8.073   14.310  16.840  1.00 0.00 ? 412 TRP A HH2  5  
ATOM   7212  N  N    . ARG A 1 56  ? 1.339   11.428  17.438  1.00 0.00 ? 413 ARG A N    5  
ATOM   7213  C  CA   . ARG A 1 56  ? 0.666   10.182  17.091  1.00 0.00 ? 413 ARG A CA   5  
ATOM   7214  C  C    . ARG A 1 56  ? 1.537   8.979   17.439  1.00 0.00 ? 413 ARG A C    5  
ATOM   7215  O  O    . ARG A 1 56  ? 2.757   9.095   17.557  1.00 0.00 ? 413 ARG A O    5  
ATOM   7216  C  CB   . ARG A 1 56  ? 0.321   10.162  15.601  1.00 0.00 ? 413 ARG A CB   5  
ATOM   7217  C  CG   . ARG A 1 56  ? -0.618  11.280  15.178  1.00 0.00 ? 413 ARG A CG   5  
ATOM   7218  C  CD   . ARG A 1 56  ? -0.468  11.605  13.700  1.00 0.00 ? 413 ARG A CD   5  
ATOM   7219  N  NE   . ARG A 1 56  ? -1.050  10.569  12.851  1.00 0.00 ? 413 ARG A NE   5  
ATOM   7220  C  CZ   . ARG A 1 56  ? -1.426  10.775  11.593  1.00 0.00 ? 413 ARG A CZ   5  
ATOM   7221  N  NH1  . ARG A 1 56  ? -1.281  11.972  11.042  1.00 0.00 ? 413 ARG A NH1  5  
ATOM   7222  N  NH2  . ARG A 1 56  ? -1.947  9.782   10.884  1.00 0.00 ? 413 ARG A NH2  5  
ATOM   7223  H  H    . ARG A 1 56  ? 2.299   11.518  17.260  1.00 0.00 ? 413 ARG A H    5  
ATOM   7224  H  HA   . ARG A 1 56  ? -0.247  10.128  17.664  1.00 0.00 ? 413 ARG A HA   5  
ATOM   7225  H  HB2  . ARG A 1 56  ? 1.233   10.253  15.030  1.00 0.00 ? 413 ARG A HB2  5  
ATOM   7226  H  HB3  . ARG A 1 56  ? -0.149  9.219   15.366  1.00 0.00 ? 413 ARG A HB3  5  
ATOM   7227  H  HG2  . ARG A 1 56  ? -1.636  10.974  15.366  1.00 0.00 ? 413 ARG A HG2  5  
ATOM   7228  H  HG3  . ARG A 1 56  ? -0.393  12.164  15.756  1.00 0.00 ? 413 ARG A HG3  5  
ATOM   7229  H  HD2  . ARG A 1 56  ? -0.964  12.542  13.499  1.00 0.00 ? 413 ARG A HD2  5  
ATOM   7230  H  HD3  . ARG A 1 56  ? 0.583   11.697  13.471  1.00 0.00 ? 413 ARG A HD3  5  
ATOM   7231  H  HE   . ARG A 1 56  ? -1.166  9.676   13.238  1.00 0.00 ? 413 ARG A HE   5  
ATOM   7232  H  HH11 . ARG A 1 56  ? -0.887  12.722  11.574  1.00 0.00 ? 413 ARG A HH11 5  
ATOM   7233  H  HH12 . ARG A 1 56  ? -1.564  12.124  10.095  1.00 0.00 ? 413 ARG A HH12 5  
ATOM   7234  H  HH21 . ARG A 1 56  ? -2.057  8.878   11.296  1.00 0.00 ? 413 ARG A HH21 5  
ATOM   7235  H  HH22 . ARG A 1 56  ? -2.230  9.937   9.939   1.00 0.00 ? 413 ARG A HH22 5  
ATOM   7236  N  N    . PHE A 1 57  ? 0.902   7.823   17.602  1.00 0.00 ? 414 PHE A N    5  
ATOM   7237  C  CA   . PHE A 1 57  ? 1.618   6.598   17.938  1.00 0.00 ? 414 PHE A CA   5  
ATOM   7238  C  C    . PHE A 1 57  ? 1.091   5.419   17.124  1.00 0.00 ? 414 PHE A C    5  
ATOM   7239  O  O    . PHE A 1 57  ? 0.113   5.547   16.388  1.00 0.00 ? 414 PHE A O    5  
ATOM   7240  C  CB   . PHE A 1 57  ? 1.487   6.299   19.433  1.00 0.00 ? 414 PHE A CB   5  
ATOM   7241  C  CG   . PHE A 1 57  ? 2.082   7.362   20.311  1.00 0.00 ? 414 PHE A CG   5  
ATOM   7242  C  CD1  . PHE A 1 57  ? 3.456   7.502   20.417  1.00 0.00 ? 414 PHE A CD1  5  
ATOM   7243  C  CD2  . PHE A 1 57  ? 1.267   8.220   21.032  1.00 0.00 ? 414 PHE A CD2  5  
ATOM   7244  C  CE1  . PHE A 1 57  ? 4.007   8.479   21.225  1.00 0.00 ? 414 PHE A CE1  5  
ATOM   7245  C  CE2  . PHE A 1 57  ? 1.812   9.199   21.840  1.00 0.00 ? 414 PHE A CE2  5  
ATOM   7246  C  CZ   . PHE A 1 57  ? 3.184   9.329   21.938  1.00 0.00 ? 414 PHE A CZ   5  
ATOM   7247  H  H    . PHE A 1 57  ? -0.073  7.793   17.495  1.00 0.00 ? 414 PHE A H    5  
ATOM   7248  H  HA   . PHE A 1 57  ? 2.659   6.748   17.700  1.00 0.00 ? 414 PHE A HA   5  
ATOM   7249  H  HB2  . PHE A 1 57  ? 0.441   6.208   19.684  1.00 0.00 ? 414 PHE A HB2  5  
ATOM   7250  H  HB3  . PHE A 1 57  ? 1.987   5.367   19.651  1.00 0.00 ? 414 PHE A HB3  5  
ATOM   7251  H  HD1  . PHE A 1 57  ? 4.101   6.837   19.860  1.00 0.00 ? 414 PHE A HD1  5  
ATOM   7252  H  HD2  . PHE A 1 57  ? 0.194   8.120   20.957  1.00 0.00 ? 414 PHE A HD2  5  
ATOM   7253  H  HE1  . PHE A 1 57  ? 5.080   8.577   21.298  1.00 0.00 ? 414 PHE A HE1  5  
ATOM   7254  H  HE2  . PHE A 1 57  ? 1.166   9.862   22.397  1.00 0.00 ? 414 PHE A HE2  5  
ATOM   7255  H  HZ   . PHE A 1 57  ? 3.612   10.093  22.568  1.00 0.00 ? 414 PHE A HZ   5  
ATOM   7256  N  N    . ALA A 1 58  ? 1.748   4.272   17.262  1.00 0.00 ? 415 ALA A N    5  
ATOM   7257  C  CA   . ALA A 1 58  ? 1.346   3.071   16.541  1.00 0.00 ? 415 ALA A CA   5  
ATOM   7258  C  C    . ALA A 1 58  ? 0.509   2.153   17.427  1.00 0.00 ? 415 ALA A C    5  
ATOM   7259  O  O    . ALA A 1 58  ? -0.511  1.617   16.993  1.00 0.00 ? 415 ALA A O    5  
ATOM   7260  C  CB   . ALA A 1 58  ? 2.570   2.332   16.022  1.00 0.00 ? 415 ALA A CB   5  
ATOM   7261  H  H    . ALA A 1 58  ? 2.520   4.233   17.864  1.00 0.00 ? 415 ALA A H    5  
ATOM   7262  H  HA   . ALA A 1 58  ? 0.751   3.374   15.692  1.00 0.00 ? 415 ALA A HA   5  
ATOM   7263  H  HB1  . ALA A 1 58  ? 2.295   1.324   15.752  1.00 0.00 ? 415 ALA A HB1  5  
ATOM   7264  H  HB2  . ALA A 1 58  ? 2.956   2.845   15.152  1.00 0.00 ? 415 ALA A HB2  5  
ATOM   7265  H  HB3  . ALA A 1 58  ? 3.328   2.306   16.791  1.00 0.00 ? 415 ALA A HB3  5  
ATOM   7266  N  N    . ARG A 1 59  ? 0.947   1.977   18.669  1.00 0.00 ? 416 ARG A N    5  
ATOM   7267  C  CA   . ARG A 1 59  ? 0.239   1.122   19.615  1.00 0.00 ? 416 ARG A CA   5  
ATOM   7268  C  C    . ARG A 1 59  ? -0.676  1.948   20.514  1.00 0.00 ? 416 ARG A C    5  
ATOM   7269  O  O    . ARG A 1 59  ? -0.264  2.968   21.067  1.00 0.00 ? 416 ARG A O    5  
ATOM   7270  C  CB   . ARG A 1 59  ? 1.235   0.335   20.468  1.00 0.00 ? 416 ARG A CB   5  
ATOM   7271  C  CG   . ARG A 1 59  ? 1.924   -0.792  19.716  1.00 0.00 ? 416 ARG A CG   5  
ATOM   7272  C  CD   . ARG A 1 59  ? 3.168   -1.272  20.449  1.00 0.00 ? 416 ARG A CD   5  
ATOM   7273  N  NE   . ARG A 1 59  ? 2.852   -1.806  21.771  1.00 0.00 ? 416 ARG A NE   5  
ATOM   7274  C  CZ   . ARG A 1 59  ? 3.675   -2.583  22.466  1.00 0.00 ? 416 ARG A CZ   5  
ATOM   7275  N  NH1  . ARG A 1 59  ? 4.858   -2.914  21.967  1.00 0.00 ? 416 ARG A NH1  5  
ATOM   7276  N  NH2  . ARG A 1 59  ? 3.316   -3.030  23.662  1.00 0.00 ? 416 ARG A NH2  5  
ATOM   7277  H  H    . ARG A 1 59  ? 1.767   2.431   18.956  1.00 0.00 ? 416 ARG A H    5  
ATOM   7278  H  HA   . ARG A 1 59  ? -0.363  0.428   19.048  1.00 0.00 ? 416 ARG A HA   5  
ATOM   7279  H  HB2  . ARG A 1 59  ? 1.994   1.012   20.832  1.00 0.00 ? 416 ARG A HB2  5  
ATOM   7280  H  HB3  . ARG A 1 59  ? 0.711   -0.091  21.310  1.00 0.00 ? 416 ARG A HB3  5  
ATOM   7281  H  HG2  . ARG A 1 59  ? 1.237   -1.619  19.617  1.00 0.00 ? 416 ARG A HG2  5  
ATOM   7282  H  HG3  . ARG A 1 59  ? 2.209   -0.437  18.737  1.00 0.00 ? 416 ARG A HG3  5  
ATOM   7283  H  HD2  . ARG A 1 59  ? 3.639   -2.046  19.862  1.00 0.00 ? 416 ARG A HD2  5  
ATOM   7284  H  HD3  . ARG A 1 59  ? 3.847   -0.440  20.560  1.00 0.00 ? 416 ARG A HD3  5  
ATOM   7285  H  HE   . ARG A 1 59  ? 1.983   -1.574  22.158  1.00 0.00 ? 416 ARG A HE   5  
ATOM   7286  H  HH11 . ARG A 1 59  ? 5.131   -2.578  21.066  1.00 0.00 ? 416 ARG A HH11 5  
ATOM   7287  H  HH12 . ARG A 1 59  ? 5.477   -3.499  22.492  1.00 0.00 ? 416 ARG A HH12 5  
ATOM   7288  H  HH21 . ARG A 1 59  ? 2.425   -2.782  24.042  1.00 0.00 ? 416 ARG A HH21 5  
ATOM   7289  H  HH22 . ARG A 1 59  ? 3.936   -3.615  24.184  1.00 0.00 ? 416 ARG A HH22 5  
ATOM   7290  N  N    . SER A 1 60  ? -1.920  1.501   20.655  1.00 0.00 ? 417 SER A N    5  
ATOM   7291  C  CA   . SER A 1 60  ? -2.895  2.201   21.483  1.00 0.00 ? 417 SER A CA   5  
ATOM   7292  C  C    . SER A 1 60  ? -2.355  2.415   22.894  1.00 0.00 ? 417 SER A C    5  
ATOM   7293  O  O    . SER A 1 60  ? -2.358  3.533   23.409  1.00 0.00 ? 417 SER A O    5  
ATOM   7294  C  CB   . SER A 1 60  ? -4.205  1.414   21.540  1.00 0.00 ? 417 SER A CB   5  
ATOM   7295  O  OG   . SER A 1 60  ? -4.004  0.127   22.098  1.00 0.00 ? 417 SER A OG   5  
ATOM   7296  H  H    . SER A 1 60  ? -2.188  0.682   20.188  1.00 0.00 ? 417 SER A H    5  
ATOM   7297  H  HA   . SER A 1 60  ? -3.082  3.164   21.032  1.00 0.00 ? 417 SER A HA   5  
ATOM   7298  H  HB2  . SER A 1 60  ? -4.918  1.950   22.149  1.00 0.00 ? 417 SER A HB2  5  
ATOM   7299  H  HB3  . SER A 1 60  ? -4.598  1.302   20.540  1.00 0.00 ? 417 SER A HB3  5  
ATOM   7300  H  HG   . SER A 1 60  ? -3.605  -0.448  21.441  1.00 0.00 ? 417 SER A HG   5  
ATOM   7301  N  N    . ASP A 1 61  ? -1.893  1.334   23.514  1.00 0.00 ? 418 ASP A N    5  
ATOM   7302  C  CA   . ASP A 1 61  ? -1.349  1.402   24.865  1.00 0.00 ? 418 ASP A CA   5  
ATOM   7303  C  C    . ASP A 1 61  ? -0.407  2.593   25.013  1.00 0.00 ? 418 ASP A C    5  
ATOM   7304  O  O    . ASP A 1 61  ? -0.506  3.359   25.971  1.00 0.00 ? 418 ASP A O    5  
ATOM   7305  C  CB   . ASP A 1 61  ? -0.610  0.107   25.206  1.00 0.00 ? 418 ASP A CB   5  
ATOM   7306  C  CG   . ASP A 1 61  ? 0.293   0.256   26.415  1.00 0.00 ? 418 ASP A CG   5  
ATOM   7307  O  OD1  . ASP A 1 61  ? -0.180  0.775   27.447  1.00 0.00 ? 418 ASP A OD1  5  
ATOM   7308  O  OD2  . ASP A 1 61  ? 1.472   -0.145  26.328  1.00 0.00 ? 418 ASP A OD2  5  
ATOM   7309  H  H    . ASP A 1 61  ? -1.918  0.470   23.051  1.00 0.00 ? 418 ASP A H    5  
ATOM   7310  H  HA   . ASP A 1 61  ? -2.174  1.525   25.549  1.00 0.00 ? 418 ASP A HA   5  
ATOM   7311  H  HB2  . ASP A 1 61  ? -1.333  -0.669  25.413  1.00 0.00 ? 418 ASP A HB2  5  
ATOM   7312  H  HB3  . ASP A 1 61  ? -0.004  -0.187  24.361  1.00 0.00 ? 418 ASP A HB3  5  
ATOM   7313  N  N    . GLU A 1 62  ? 0.505   2.742   24.058  1.00 0.00 ? 419 GLU A N    5  
ATOM   7314  C  CA   . GLU A 1 62  ? 1.466   3.839   24.084  1.00 0.00 ? 419 GLU A CA   5  
ATOM   7315  C  C    . GLU A 1 62  ? 0.753   5.183   24.204  1.00 0.00 ? 419 GLU A C    5  
ATOM   7316  O  O    . GLU A 1 62  ? 1.108   6.014   25.041  1.00 0.00 ? 419 GLU A O    5  
ATOM   7317  C  CB   . GLU A 1 62  ? 2.330   3.819   22.822  1.00 0.00 ? 419 GLU A CB   5  
ATOM   7318  C  CG   . GLU A 1 62  ? 3.273   2.630   22.748  1.00 0.00 ? 419 GLU A CG   5  
ATOM   7319  C  CD   . GLU A 1 62  ? 4.417   2.730   23.738  1.00 0.00 ? 419 GLU A CD   5  
ATOM   7320  O  OE1  . GLU A 1 62  ? 4.846   3.864   24.035  1.00 0.00 ? 419 GLU A OE1  5  
ATOM   7321  O  OE2  . GLU A 1 62  ? 4.883   1.674   24.215  1.00 0.00 ? 419 GLU A OE2  5  
ATOM   7322  H  H    . GLU A 1 62  ? 0.534   2.098   23.319  1.00 0.00 ? 419 GLU A H    5  
ATOM   7323  H  HA   . GLU A 1 62  ? 2.101   3.704   24.946  1.00 0.00 ? 419 GLU A HA   5  
ATOM   7324  H  HB2  . GLU A 1 62  ? 1.684   3.795   21.957  1.00 0.00 ? 419 GLU A HB2  5  
ATOM   7325  H  HB3  . GLU A 1 62  ? 2.922   4.722   22.792  1.00 0.00 ? 419 GLU A HB3  5  
ATOM   7326  H  HG2  . GLU A 1 62  ? 2.714   1.730   22.957  1.00 0.00 ? 419 GLU A HG2  5  
ATOM   7327  H  HG3  . GLU A 1 62  ? 3.683   2.573   21.750  1.00 0.00 ? 419 GLU A HG3  5  
ATOM   7328  N  N    . LEU A 1 63  ? -0.254  5.389   23.362  1.00 0.00 ? 420 LEU A N    5  
ATOM   7329  C  CA   . LEU A 1 63  ? -1.017  6.632   23.373  1.00 0.00 ? 420 LEU A CA   5  
ATOM   7330  C  C    . LEU A 1 63  ? -1.731  6.822   24.708  1.00 0.00 ? 420 LEU A C    5  
ATOM   7331  O  O    . LEU A 1 63  ? -1.859  7.942   25.203  1.00 0.00 ? 420 LEU A O    5  
ATOM   7332  C  CB   . LEU A 1 63  ? -2.036  6.638   22.232  1.00 0.00 ? 420 LEU A CB   5  
ATOM   7333  C  CG   . LEU A 1 63  ? -2.976  7.843   22.177  1.00 0.00 ? 420 LEU A CG   5  
ATOM   7334  C  CD1  . LEU A 1 63  ? -2.182  9.133   22.040  1.00 0.00 ? 420 LEU A CD1  5  
ATOM   7335  C  CD2  . LEU A 1 63  ? -3.963  7.697   21.028  1.00 0.00 ? 420 LEU A CD2  5  
ATOM   7336  H  H    . LEU A 1 63  ? -0.490  4.690   22.718  1.00 0.00 ? 420 LEU A H    5  
ATOM   7337  H  HA   . LEU A 1 63  ? -0.325  7.448   23.230  1.00 0.00 ? 420 LEU A HA   5  
ATOM   7338  H  HB2  . LEU A 1 63  ? -1.491  6.601   21.302  1.00 0.00 ? 420 LEU A HB2  5  
ATOM   7339  H  HB3  . LEU A 1 63  ? -2.643  5.748   22.327  1.00 0.00 ? 420 LEU A HB3  5  
ATOM   7340  H  HG   . LEU A 1 63  ? -3.539  7.895   23.098  1.00 0.00 ? 420 LEU A HG   5  
ATOM   7341  H  HD11 . LEU A 1 63  ? -2.829  9.976   22.228  1.00 0.00 ? 420 LEU A HD11 5  
ATOM   7342  H  HD12 . LEU A 1 63  ? -1.780  9.203   21.040  1.00 0.00 ? 420 LEU A HD12 5  
ATOM   7343  H  HD13 . LEU A 1 63  ? -1.371  9.134   22.754  1.00 0.00 ? 420 LEU A HD13 5  
ATOM   7344  H  HD21 . LEU A 1 63  ? -4.661  8.521   21.046  1.00 0.00 ? 420 LEU A HD21 5  
ATOM   7345  H  HD22 . LEU A 1 63  ? -4.501  6.767   21.131  1.00 0.00 ? 420 LEU A HD22 5  
ATOM   7346  H  HD23 . LEU A 1 63  ? -3.426  7.700   20.090  1.00 0.00 ? 420 LEU A HD23 5  
ATOM   7347  N  N    . THR A 1 64  ? -2.193  5.718   25.288  1.00 0.00 ? 421 THR A N    5  
ATOM   7348  C  CA   . THR A 1 64  ? -2.892  5.762   26.566  1.00 0.00 ? 421 THR A CA   5  
ATOM   7349  C  C    . THR A 1 64  ? -1.996  6.322   27.664  1.00 0.00 ? 421 THR A C    5  
ATOM   7350  O  O    . THR A 1 64  ? -2.353  7.287   28.339  1.00 0.00 ? 421 THR A O    5  
ATOM   7351  C  CB   . THR A 1 64  ? -3.386  4.364   26.984  1.00 0.00 ? 421 THR A CB   5  
ATOM   7352  O  OG1  . THR A 1 64  ? -4.278  3.843   25.993  1.00 0.00 ? 421 THR A OG1  5  
ATOM   7353  C  CG2  . THR A 1 64  ? -4.093  4.421   28.330  1.00 0.00 ? 421 THR A CG2  5  
ATOM   7354  H  H    . THR A 1 64  ? -2.060  4.855   24.844  1.00 0.00 ? 421 THR A H    5  
ATOM   7355  H  HA   . THR A 1 64  ? -3.752  6.406   26.453  1.00 0.00 ? 421 THR A HA   5  
ATOM   7356  H  HB   . THR A 1 64  ? -2.532  3.708   27.070  1.00 0.00 ? 421 THR A HB   5  
ATOM   7357  H  HG1  . THR A 1 64  ? -5.150  4.228   26.112  1.00 0.00 ? 421 THR A HG1  5  
ATOM   7358  H  HG21 . THR A 1 64  ? -4.475  3.441   28.577  1.00 0.00 ? 421 THR A HG21 5  
ATOM   7359  H  HG22 . THR A 1 64  ? -4.912  5.123   28.277  1.00 0.00 ? 421 THR A HG22 5  
ATOM   7360  H  HG23 . THR A 1 64  ? -3.395  4.738   29.090  1.00 0.00 ? 421 THR A HG23 5  
ATOM   7361  N  N    . ARG A 1 65  ? -0.829  5.709   27.839  1.00 0.00 ? 422 ARG A N    5  
ATOM   7362  C  CA   . ARG A 1 65  ? 0.119   6.147   28.856  1.00 0.00 ? 422 ARG A CA   5  
ATOM   7363  C  C    . ARG A 1 65  ? 0.488   7.614   28.661  1.00 0.00 ? 422 ARG A C    5  
ATOM   7364  O  O    . ARG A 1 65  ? 0.483   8.399   29.610  1.00 0.00 ? 422 ARG A O    5  
ATOM   7365  C  CB   . ARG A 1 65  ? 1.380   5.282   28.814  1.00 0.00 ? 422 ARG A CB   5  
ATOM   7366  C  CG   . ARG A 1 65  ? 2.395   5.633   29.890  1.00 0.00 ? 422 ARG A CG   5  
ATOM   7367  C  CD   . ARG A 1 65  ? 3.735   4.961   29.632  1.00 0.00 ? 422 ARG A CD   5  
ATOM   7368  N  NE   . ARG A 1 65  ? 4.664   5.149   30.743  1.00 0.00 ? 422 ARG A NE   5  
ATOM   7369  C  CZ   . ARG A 1 65  ? 5.971   4.927   30.653  1.00 0.00 ? 422 ARG A CZ   5  
ATOM   7370  N  NH1  . ARG A 1 65  ? 6.499   4.511   29.510  1.00 0.00 ? 422 ARG A NH1  5  
ATOM   7371  N  NH2  . ARG A 1 65  ? 6.752   5.121   31.708  1.00 0.00 ? 422 ARG A NH2  5  
ATOM   7372  H  H    . ARG A 1 65  ? -0.600  4.945   27.270  1.00 0.00 ? 422 ARG A H    5  
ATOM   7373  H  HA   . ARG A 1 65  ? -0.353  6.032   29.821  1.00 0.00 ? 422 ARG A HA   5  
ATOM   7374  H  HB2  . ARG A 1 65  ? 1.098   4.247   28.941  1.00 0.00 ? 422 ARG A HB2  5  
ATOM   7375  H  HB3  . ARG A 1 65  ? 1.852   5.403   27.851  1.00 0.00 ? 422 ARG A HB3  5  
ATOM   7376  H  HG2  . ARG A 1 65  ? 2.539   6.704   29.901  1.00 0.00 ? 422 ARG A HG2  5  
ATOM   7377  H  HG3  . ARG A 1 65  ? 2.017   5.308   30.848  1.00 0.00 ? 422 ARG A HG3  5  
ATOM   7378  H  HD2  . ARG A 1 65  ? 3.570   3.903   29.488  1.00 0.00 ? 422 ARG A HD2  5  
ATOM   7379  H  HD3  . ARG A 1 65  ? 4.167   5.382   28.737  1.00 0.00 ? 422 ARG A HD3  5  
ATOM   7380  H  HE   . ARG A 1 65  ? 4.295   5.455   31.597  1.00 0.00 ? 422 ARG A HE   5  
ATOM   7381  H  HH11 . ARG A 1 65  ? 5.913   4.365   28.714  1.00 0.00 ? 422 ARG A HH11 5  
ATOM   7382  H  HH12 . ARG A 1 65  ? 7.484   4.346   29.445  1.00 0.00 ? 422 ARG A HH12 5  
ATOM   7383  H  HH21 . ARG A 1 65  ? 6.357   5.434   32.572  1.00 0.00 ? 422 ARG A HH21 5  
ATOM   7384  H  HH22 . ARG A 1 65  ? 7.735   4.953   31.640  1.00 0.00 ? 422 ARG A HH22 5  
ATOM   7385  N  N    . HIS A 1 66  ? 0.809   7.978   27.423  1.00 0.00 ? 423 HIS A N    5  
ATOM   7386  C  CA   . HIS A 1 66  ? 1.181   9.352   27.102  1.00 0.00 ? 423 HIS A CA   5  
ATOM   7387  C  C    . HIS A 1 66  ? 0.049   10.316  27.445  1.00 0.00 ? 423 HIS A C    5  
ATOM   7388  O  O    . HIS A 1 66  ? 0.250   11.296  28.163  1.00 0.00 ? 423 HIS A O    5  
ATOM   7389  C  CB   . HIS A 1 66  ? 1.538   9.473   25.621  1.00 0.00 ? 423 HIS A CB   5  
ATOM   7390  C  CG   . HIS A 1 66  ? 1.357   10.855  25.072  1.00 0.00 ? 423 HIS A CG   5  
ATOM   7391  N  ND1  . HIS A 1 66  ? 2.317   11.839  25.178  1.00 0.00 ? 423 HIS A ND1  5  
ATOM   7392  C  CD2  . HIS A 1 66  ? 0.319   11.414  24.408  1.00 0.00 ? 423 HIS A CD2  5  
ATOM   7393  C  CE1  . HIS A 1 66  ? 1.877   12.944  24.604  1.00 0.00 ? 423 HIS A CE1  5  
ATOM   7394  N  NE2  . HIS A 1 66  ? 0.666   12.713  24.128  1.00 0.00 ? 423 HIS A NE2  5  
ATOM   7395  H  H    . HIS A 1 66  ? 0.794   7.308   26.709  1.00 0.00 ? 423 HIS A H    5  
ATOM   7396  H  HA   . HIS A 1 66  ? 2.046   9.608   27.694  1.00 0.00 ? 423 HIS A HA   5  
ATOM   7397  H  HB2  . HIS A 1 66  ? 2.572   9.195   25.483  1.00 0.00 ? 423 HIS A HB2  5  
ATOM   7398  H  HB3  . HIS A 1 66  ? 0.911   8.803   25.050  1.00 0.00 ? 423 HIS A HB3  5  
ATOM   7399  H  HD1  . HIS A 1 66  ? 3.190   11.741  25.611  1.00 0.00 ? 423 HIS A HD1  5  
ATOM   7400  H  HD2  . HIS A 1 66  ? -0.612  10.930  24.146  1.00 0.00 ? 423 HIS A HD2  5  
ATOM   7401  H  HE1  . HIS A 1 66  ? 2.414   13.878  24.535  1.00 0.00 ? 423 HIS A HE1  5  
ATOM   7402  N  N    . TYR A 1 67  ? -1.141  10.031  26.927  1.00 0.00 ? 424 TYR A N    5  
ATOM   7403  C  CA   . TYR A 1 67  ? -2.304  10.874  27.176  1.00 0.00 ? 424 TYR A CA   5  
ATOM   7404  C  C    . TYR A 1 67  ? -2.447  11.180  28.664  1.00 0.00 ? 424 TYR A C    5  
ATOM   7405  O  O    . TYR A 1 67  ? -2.839  12.282  29.048  1.00 0.00 ? 424 TYR A O    5  
ATOM   7406  C  CB   . TYR A 1 67  ? -3.573  10.194  26.660  1.00 0.00 ? 424 TYR A CB   5  
ATOM   7407  C  CG   . TYR A 1 67  ? -4.752  11.132  26.529  1.00 0.00 ? 424 TYR A CG   5  
ATOM   7408  C  CD1  . TYR A 1 67  ? -5.342  11.699  27.652  1.00 0.00 ? 424 TYR A CD1  5  
ATOM   7409  C  CD2  . TYR A 1 67  ? -5.277  11.450  25.282  1.00 0.00 ? 424 TYR A CD2  5  
ATOM   7410  C  CE1  . TYR A 1 67  ? -6.420  12.555  27.537  1.00 0.00 ? 424 TYR A CE1  5  
ATOM   7411  C  CE2  . TYR A 1 67  ? -6.353  12.307  25.158  1.00 0.00 ? 424 TYR A CE2  5  
ATOM   7412  C  CZ   . TYR A 1 67  ? -6.921  12.857  26.288  1.00 0.00 ? 424 TYR A CZ   5  
ATOM   7413  O  OH   . TYR A 1 67  ? -7.995  13.709  26.168  1.00 0.00 ? 424 TYR A OH   5  
ATOM   7414  H  H    . TYR A 1 67  ? -1.239  9.236   26.363  1.00 0.00 ? 424 TYR A H    5  
ATOM   7415  H  HA   . TYR A 1 67  ? -2.162  11.802  26.642  1.00 0.00 ? 424 TYR A HA   5  
ATOM   7416  H  HB2  . TYR A 1 67  ? -3.376  9.772   25.687  1.00 0.00 ? 424 TYR A HB2  5  
ATOM   7417  H  HB3  . TYR A 1 67  ? -3.852  9.403   27.341  1.00 0.00 ? 424 TYR A HB3  5  
ATOM   7418  H  HD1  . TYR A 1 67  ? -4.947  11.461  28.629  1.00 0.00 ? 424 TYR A HD1  5  
ATOM   7419  H  HD2  . TYR A 1 67  ? -4.830  11.017  24.399  1.00 0.00 ? 424 TYR A HD2  5  
ATOM   7420  H  HE1  . TYR A 1 67  ? -6.865  12.987  28.421  1.00 0.00 ? 424 TYR A HE1  5  
ATOM   7421  H  HE2  . TYR A 1 67  ? -6.747  12.542  24.180  1.00 0.00 ? 424 TYR A HE2  5  
ATOM   7422  H  HH   . TYR A 1 67  ? -7.903  14.228  25.366  1.00 0.00 ? 424 TYR A HH   5  
ATOM   7423  N  N    . ARG A 1 68  ? -2.126  10.196  29.497  1.00 0.00 ? 425 ARG A N    5  
ATOM   7424  C  CA   . ARG A 1 68  ? -2.218  10.358  30.943  1.00 0.00 ? 425 ARG A CA   5  
ATOM   7425  C  C    . ARG A 1 68  ? -1.264  11.445  31.431  1.00 0.00 ? 425 ARG A C    5  
ATOM   7426  O  O    . ARG A 1 68  ? -1.657  12.343  32.176  1.00 0.00 ? 425 ARG A O    5  
ATOM   7427  C  CB   . ARG A 1 68  ? -1.905  9.036   31.647  1.00 0.00 ? 425 ARG A CB   5  
ATOM   7428  C  CG   . ARG A 1 68  ? -2.987  7.983   31.474  1.00 0.00 ? 425 ARG A CG   5  
ATOM   7429  C  CD   . ARG A 1 68  ? -2.989  6.992   32.627  1.00 0.00 ? 425 ARG A CD   5  
ATOM   7430  N  NE   . ARG A 1 68  ? -3.491  5.681   32.222  1.00 0.00 ? 425 ARG A NE   5  
ATOM   7431  C  CZ   . ARG A 1 68  ? -3.255  4.562   32.897  1.00 0.00 ? 425 ARG A CZ   5  
ATOM   7432  N  NH1  . ARG A 1 68  ? -2.528  4.594   34.006  1.00 0.00 ? 425 ARG A NH1  5  
ATOM   7433  N  NH2  . ARG A 1 68  ? -3.747  3.409   32.465  1.00 0.00 ? 425 ARG A NH2  5  
ATOM   7434  H  H    . ARG A 1 68  ? -1.819  9.340   29.131  1.00 0.00 ? 425 ARG A H    5  
ATOM   7435  H  HA   . ARG A 1 68  ? -3.230  10.651  31.180  1.00 0.00 ? 425 ARG A HA   5  
ATOM   7436  H  HB2  . ARG A 1 68  ? -0.982  8.640   31.250  1.00 0.00 ? 425 ARG A HB2  5  
ATOM   7437  H  HB3  . ARG A 1 68  ? -1.782  9.225   32.703  1.00 0.00 ? 425 ARG A HB3  5  
ATOM   7438  H  HG2  . ARG A 1 68  ? -3.950  8.472   31.434  1.00 0.00 ? 425 ARG A HG2  5  
ATOM   7439  H  HG3  . ARG A 1 68  ? -2.814  7.450   30.552  1.00 0.00 ? 425 ARG A HG3  5  
ATOM   7440  H  HD2  . ARG A 1 68  ? -1.978  6.882   32.991  1.00 0.00 ? 425 ARG A HD2  5  
ATOM   7441  H  HD3  . ARG A 1 68  ? -3.615  7.379   33.417  1.00 0.00 ? 425 ARG A HD3  5  
ATOM   7442  H  HE   . ARG A 1 68  ? -4.030  5.635   31.405  1.00 0.00 ? 425 ARG A HE   5  
ATOM   7443  H  HH11 . ARG A 1 68  ? -2.157  5.463   34.335  1.00 0.00 ? 425 ARG A HH11 5  
ATOM   7444  H  HH12 . ARG A 1 68  ? -2.353  3.750   34.513  1.00 0.00 ? 425 ARG A HH12 5  
ATOM   7445  H  HH21 . ARG A 1 68  ? -4.295  3.381   31.630  1.00 0.00 ? 425 ARG A HH21 5  
ATOM   7446  H  HH22 . ARG A 1 68  ? -3.568  2.567   32.974  1.00 0.00 ? 425 ARG A HH22 5  
ATOM   7447  N  N    . LYS A 1 69  ? -0.008  11.356  31.006  1.00 0.00 ? 426 LYS A N    5  
ATOM   7448  C  CA   . LYS A 1 69  ? 1.003   12.331  31.397  1.00 0.00 ? 426 LYS A CA   5  
ATOM   7449  C  C    . LYS A 1 69  ? 0.429   13.744  31.387  1.00 0.00 ? 426 LYS A C    5  
ATOM   7450  O  O    . LYS A 1 69  ? 0.654   14.523  32.314  1.00 0.00 ? 426 LYS A O    5  
ATOM   7451  C  CB   . LYS A 1 69  ? 2.208   12.252  30.458  1.00 0.00 ? 426 LYS A CB   5  
ATOM   7452  C  CG   . LYS A 1 69  ? 2.929   10.916  30.505  1.00 0.00 ? 426 LYS A CG   5  
ATOM   7453  C  CD   . LYS A 1 69  ? 3.813   10.803  31.736  1.00 0.00 ? 426 LYS A CD   5  
ATOM   7454  C  CE   . LYS A 1 69  ? 5.200   11.374  31.481  1.00 0.00 ? 426 LYS A CE   5  
ATOM   7455  N  NZ   . LYS A 1 69  ? 5.236   12.850  31.675  1.00 0.00 ? 426 LYS A NZ   5  
ATOM   7456  H  H    . LYS A 1 69  ? 0.245   10.617  30.413  1.00 0.00 ? 426 LYS A H    5  
ATOM   7457  H  HA   . LYS A 1 69  ? 1.323   12.093  32.400  1.00 0.00 ? 426 LYS A HA   5  
ATOM   7458  H  HB2  . LYS A 1 69  ? 1.872   12.420  29.445  1.00 0.00 ? 426 LYS A HB2  5  
ATOM   7459  H  HB3  . LYS A 1 69  ? 2.911   13.026  30.727  1.00 0.00 ? 426 LYS A HB3  5  
ATOM   7460  H  HG2  . LYS A 1 69  ? 2.197   10.122  30.527  1.00 0.00 ? 426 LYS A HG2  5  
ATOM   7461  H  HG3  . LYS A 1 69  ? 3.544   10.817  29.621  1.00 0.00 ? 426 LYS A HG3  5  
ATOM   7462  H  HD2  . LYS A 1 69  ? 3.356   11.347  32.548  1.00 0.00 ? 426 LYS A HD2  5  
ATOM   7463  H  HD3  . LYS A 1 69  ? 3.907   9.760   32.006  1.00 0.00 ? 426 LYS A HD3  5  
ATOM   7464  H  HE2  . LYS A 1 69  ? 5.896   10.912  32.164  1.00 0.00 ? 426 LYS A HE2  5  
ATOM   7465  H  HE3  . LYS A 1 69  ? 5.487   11.146  30.465  1.00 0.00 ? 426 LYS A HE3  5  
ATOM   7466  H  HZ1  . LYS A 1 69  ? 5.200   13.333  30.755  1.00 0.00 ? 426 LYS A HZ1  5  
ATOM   7467  H  HZ2  . LYS A 1 69  ? 6.112   13.124  32.165  1.00 0.00 ? 426 LYS A HZ2  5  
ATOM   7468  H  HZ3  . LYS A 1 69  ? 4.423   13.155  32.247  1.00 0.00 ? 426 LYS A HZ3  5  
ATOM   7469  N  N    . HIS A 1 70  ? -0.314  14.069  30.333  1.00 0.00 ? 427 HIS A N    5  
ATOM   7470  C  CA   . HIS A 1 70  ? -0.922  15.388  30.204  1.00 0.00 ? 427 HIS A CA   5  
ATOM   7471  C  C    . HIS A 1 70  ? -1.585  15.812  31.511  1.00 0.00 ? 427 HIS A C    5  
ATOM   7472  O  O    . HIS A 1 70  ? -1.201  16.811  32.120  1.00 0.00 ? 427 HIS A O    5  
ATOM   7473  C  CB   . HIS A 1 70  ? -1.951  15.390  29.073  1.00 0.00 ? 427 HIS A CB   5  
ATOM   7474  C  CG   . HIS A 1 70  ? -1.339  15.435  27.707  1.00 0.00 ? 427 HIS A CG   5  
ATOM   7475  N  ND1  . HIS A 1 70  ? -0.346  16.325  27.356  1.00 0.00 ? 427 HIS A ND1  5  
ATOM   7476  C  CD2  . HIS A 1 70  ? -1.585  14.692  26.602  1.00 0.00 ? 427 HIS A CD2  5  
ATOM   7477  C  CE1  . HIS A 1 70  ? -0.008  16.128  26.094  1.00 0.00 ? 427 HIS A CE1  5  
ATOM   7478  N  NE2  . HIS A 1 70  ? -0.744  15.143  25.614  1.00 0.00 ? 427 HIS A NE2  5  
ATOM   7479  H  H    . HIS A 1 70  ? -0.457  13.405  29.627  1.00 0.00 ? 427 HIS A H    5  
ATOM   7480  H  HA   . HIS A 1 70  ? -0.139  16.093  29.967  1.00 0.00 ? 427 HIS A HA   5  
ATOM   7481  H  HB2  . HIS A 1 70  ? -2.550  14.494  29.139  1.00 0.00 ? 427 HIS A HB2  5  
ATOM   7482  H  HB3  . HIS A 1 70  ? -2.592  16.254  29.179  1.00 0.00 ? 427 HIS A HB3  5  
ATOM   7483  H  HD1  . HIS A 1 70  ? 0.051   17.000  27.944  1.00 0.00 ? 427 HIS A HD1  5  
ATOM   7484  H  HD2  . HIS A 1 70  ? -2.307  13.893  26.513  1.00 0.00 ? 427 HIS A HD2  5  
ATOM   7485  H  HE1  . HIS A 1 70  ? 0.744   16.679  25.548  1.00 0.00 ? 427 HIS A HE1  5  
ATOM   7486  N  N    . THR A 1 71  ? -2.584  15.045  31.939  1.00 0.00 ? 428 THR A N    5  
ATOM   7487  C  CA   . THR A 1 71  ? -3.301  15.341  33.172  1.00 0.00 ? 428 THR A CA   5  
ATOM   7488  C  C    . THR A 1 71  ? -2.795  14.480  34.323  1.00 0.00 ? 428 THR A C    5  
ATOM   7489  O  O    . THR A 1 71  ? -3.549  14.138  35.233  1.00 0.00 ? 428 THR A O    5  
ATOM   7490  C  CB   . THR A 1 71  ? -4.816  15.120  33.008  1.00 0.00 ? 428 THR A CB   5  
ATOM   7491  O  OG1  . THR A 1 71  ? -5.498  15.481  34.214  1.00 0.00 ? 428 THR A OG1  5  
ATOM   7492  C  CG2  . THR A 1 71  ? -5.117  13.669  32.664  1.00 0.00 ? 428 THR A CG2  5  
ATOM   7493  H  H    . THR A 1 71  ? -2.843  14.262  31.410  1.00 0.00 ? 428 THR A H    5  
ATOM   7494  H  HA   . THR A 1 71  ? -3.134  16.381  33.413  1.00 0.00 ? 428 THR A HA   5  
ATOM   7495  H  HB   . THR A 1 71  ? -5.171  15.747  32.201  1.00 0.00 ? 428 THR A HB   5  
ATOM   7496  H  HG1  . THR A 1 71  ? -4.978  15.201  34.971  1.00 0.00 ? 428 THR A HG1  5  
ATOM   7497  H  HG21 . THR A 1 71  ? -6.165  13.469  32.834  1.00 0.00 ? 428 THR A HG21 5  
ATOM   7498  H  HG22 . THR A 1 71  ? -4.522  13.020  33.289  1.00 0.00 ? 428 THR A HG22 5  
ATOM   7499  H  HG23 . THR A 1 71  ? -4.879  13.488  31.627  1.00 0.00 ? 428 THR A HG23 5  
ATOM   7500  N  N    . GLY A 1 72  ? -1.513  14.131  34.276  1.00 0.00 ? 429 GLY A N    5  
ATOM   7501  C  CA   . GLY A 1 72  ? -0.928  13.312  35.322  1.00 0.00 ? 429 GLY A CA   5  
ATOM   7502  C  C    . GLY A 1 72  ? -0.011  14.103  36.234  1.00 0.00 ? 429 GLY A C    5  
ATOM   7503  O  O    . GLY A 1 72  ? -0.448  15.036  36.907  1.00 0.00 ? 429 GLY A O    5  
ATOM   7504  H  H    . GLY A 1 72  ? -0.959  14.433  33.526  1.00 0.00 ? 429 GLY A H    5  
ATOM   7505  H  HA2  . GLY A 1 72  ? -1.722  12.881  35.913  1.00 0.00 ? 429 GLY A HA2  5  
ATOM   7506  H  HA3  . GLY A 1 72  ? -0.361  12.515  34.864  1.00 0.00 ? 429 GLY A HA3  5  
ATOM   7507  N  N    . ALA A 1 73  ? 1.264   13.729  36.257  1.00 0.00 ? 430 ALA A N    5  
ATOM   7508  C  CA   . ALA A 1 73  ? 2.245   14.411  37.093  1.00 0.00 ? 430 ALA A CA   5  
ATOM   7509  C  C    . ALA A 1 73  ? 3.424   14.907  36.263  1.00 0.00 ? 430 ALA A C    5  
ATOM   7510  O  O    . ALA A 1 73  ? 4.062   14.134  35.547  1.00 0.00 ? 430 ALA A O    5  
ATOM   7511  C  CB   . ALA A 1 73  ? 2.728   13.486  38.200  1.00 0.00 ? 430 ALA A CB   5  
ATOM   7512  H  H    . ALA A 1 73  ? 1.552   12.978  35.698  1.00 0.00 ? 430 ALA A H    5  
ATOM   7513  H  HA   . ALA A 1 73  ? 1.759   15.259  37.553  1.00 0.00 ? 430 ALA A HA   5  
ATOM   7514  H  HB1  . ALA A 1 73  ? 3.162   14.073  38.996  1.00 0.00 ? 430 ALA A HB1  5  
ATOM   7515  H  HB2  . ALA A 1 73  ? 1.893   12.919  38.585  1.00 0.00 ? 430 ALA A HB2  5  
ATOM   7516  H  HB3  . ALA A 1 73  ? 3.471   12.810  37.805  1.00 0.00 ? 430 ALA A HB3  5  
ATOM   7517  N  N    . LYS A 1 74  ? 3.708   16.201  36.362  1.00 0.00 ? 431 LYS A N    5  
ATOM   7518  C  CA   . LYS A 1 74  ? 4.811   16.801  35.620  1.00 0.00 ? 431 LYS A CA   5  
ATOM   7519  C  C    . LYS A 1 74  ? 5.990   17.095  36.542  1.00 0.00 ? 431 LYS A C    5  
ATOM   7520  O  O    . LYS A 1 74  ? 5.937   17.981  37.395  1.00 0.00 ? 431 LYS A O    5  
ATOM   7521  C  CB   . LYS A 1 74  ? 4.351   18.090  34.936  1.00 0.00 ? 431 LYS A CB   5  
ATOM   7522  C  CG   . LYS A 1 74  ? 3.410   17.856  33.767  1.00 0.00 ? 431 LYS A CG   5  
ATOM   7523  C  CD   . LYS A 1 74  ? 4.171   17.490  32.504  1.00 0.00 ? 431 LYS A CD   5  
ATOM   7524  C  CE   . LYS A 1 74  ? 3.336   17.743  31.258  1.00 0.00 ? 431 LYS A CE   5  
ATOM   7525  N  NZ   . LYS A 1 74  ? 2.230   16.754  31.121  1.00 0.00 ? 431 LYS A NZ   5  
ATOM   7526  H  H    . LYS A 1 74  ? 3.163   16.766  36.949  1.00 0.00 ? 431 LYS A H    5  
ATOM   7527  H  HA   . LYS A 1 74  ? 5.126   16.096  34.866  1.00 0.00 ? 431 LYS A HA   5  
ATOM   7528  H  HB2  . LYS A 1 74  ? 3.843   18.707  35.663  1.00 0.00 ? 431 LYS A HB2  5  
ATOM   7529  H  HB3  . LYS A 1 74  ? 5.220   18.620  34.572  1.00 0.00 ? 431 LYS A HB3  5  
ATOM   7530  H  HG2  . LYS A 1 74  ? 2.736   17.050  34.015  1.00 0.00 ? 431 LYS A HG2  5  
ATOM   7531  H  HG3  . LYS A 1 74  ? 2.844   18.759  33.587  1.00 0.00 ? 431 LYS A HG3  5  
ATOM   7532  H  HD2  . LYS A 1 74  ? 5.069   18.087  32.449  1.00 0.00 ? 431 LYS A HD2  5  
ATOM   7533  H  HD3  . LYS A 1 74  ? 4.434   16.443  32.544  1.00 0.00 ? 431 LYS A HD3  5  
ATOM   7534  H  HE2  . LYS A 1 74  ? 2.915   18.735  31.317  1.00 0.00 ? 431 LYS A HE2  5  
ATOM   7535  H  HE3  . LYS A 1 74  ? 3.977   17.675  30.391  1.00 0.00 ? 431 LYS A HE3  5  
ATOM   7536  H  HZ1  . LYS A 1 74  ? 2.617   15.790  31.071  1.00 0.00 ? 431 LYS A HZ1  5  
ATOM   7537  H  HZ2  . LYS A 1 74  ? 1.687   16.944  30.255  1.00 0.00 ? 431 LYS A HZ2  5  
ATOM   7538  H  HZ3  . LYS A 1 74  ? 1.591   16.818  31.939  1.00 0.00 ? 431 LYS A HZ3  5  
ATOM   7539  N  N    . PRO A 1 75  ? 7.082   16.335  36.369  1.00 0.00 ? 432 PRO A N    5  
ATOM   7540  C  CA   . PRO A 1 75  ? 8.296   16.497  37.175  1.00 0.00 ? 432 PRO A CA   5  
ATOM   7541  C  C    . PRO A 1 75  ? 9.030   17.796  36.862  1.00 0.00 ? 432 PRO A C    5  
ATOM   7542  O  O    . PRO A 1 75  ? 10.069  18.091  37.453  1.00 0.00 ? 432 PRO A O    5  
ATOM   7543  C  CB   . PRO A 1 75  ? 9.150   15.291  36.776  1.00 0.00 ? 432 PRO A CB   5  
ATOM   7544  C  CG   . PRO A 1 75  ? 8.683   14.932  35.408  1.00 0.00 ? 432 PRO A CG   5  
ATOM   7545  C  CD   . PRO A 1 75  ? 7.216   15.260  35.371  1.00 0.00 ? 432 PRO A CD   5  
ATOM   7546  H  HA   . PRO A 1 75  ? 8.078   16.453  38.232  1.00 0.00 ? 432 PRO A HA   5  
ATOM   7547  H  HB2  . PRO A 1 75  ? 10.194  15.570  36.778  1.00 0.00 ? 432 PRO A HB2  5  
ATOM   7548  H  HB3  . PRO A 1 75  ? 8.986   14.483  37.474  1.00 0.00 ? 432 PRO A HB3  5  
ATOM   7549  H  HG2  . PRO A 1 75  ? 9.216   15.515  34.673  1.00 0.00 ? 432 PRO A HG2  5  
ATOM   7550  H  HG3  . PRO A 1 75  ? 8.835   13.877  35.234  1.00 0.00 ? 432 PRO A HG3  5  
ATOM   7551  H  HD2  . PRO A 1 75  ? 6.931   15.607  34.389  1.00 0.00 ? 432 PRO A HD2  5  
ATOM   7552  H  HD3  . PRO A 1 75  ? 6.629   14.398  35.654  1.00 0.00 ? 432 PRO A HD3  5  
ATOM   7553  N  N    . PHE A 1 76  ? 8.483   18.570  35.931  1.00 0.00 ? 433 PHE A N    5  
ATOM   7554  C  CA   . PHE A 1 76  ? 9.087   19.839  35.539  1.00 0.00 ? 433 PHE A CA   5  
ATOM   7555  C  C    . PHE A 1 76  ? 8.070   20.973  35.621  1.00 0.00 ? 433 PHE A C    5  
ATOM   7556  O  O    . PHE A 1 76  ? 7.114   21.020  34.847  1.00 0.00 ? 433 PHE A O    5  
ATOM   7557  C  CB   . PHE A 1 76  ? 9.649   19.744  34.120  1.00 0.00 ? 433 PHE A CB   5  
ATOM   7558  C  CG   . PHE A 1 76  ? 10.503  18.529  33.893  1.00 0.00 ? 433 PHE A CG   5  
ATOM   7559  C  CD1  . PHE A 1 76  ? 11.772  18.446  34.443  1.00 0.00 ? 433 PHE A CD1  5  
ATOM   7560  C  CD2  . PHE A 1 76  ? 10.037  17.471  33.130  1.00 0.00 ? 433 PHE A CD2  5  
ATOM   7561  C  CE1  . PHE A 1 76  ? 12.561  17.330  34.236  1.00 0.00 ? 433 PHE A CE1  5  
ATOM   7562  C  CE2  . PHE A 1 76  ? 10.821  16.352  32.921  1.00 0.00 ? 433 PHE A CE2  5  
ATOM   7563  C  CZ   . PHE A 1 76  ? 12.084  16.282  33.474  1.00 0.00 ? 433 PHE A CZ   5  
ATOM   7564  H  H    . PHE A 1 76  ? 7.653   18.281  35.495  1.00 0.00 ? 433 PHE A H    5  
ATOM   7565  H  HA   . PHE A 1 76  ? 9.895   20.046  36.224  1.00 0.00 ? 433 PHE A HA   5  
ATOM   7566  H  HB2  . PHE A 1 76  ? 8.830   19.708  33.417  1.00 0.00 ? 433 PHE A HB2  5  
ATOM   7567  H  HB3  . PHE A 1 76  ? 10.251  20.617  33.920  1.00 0.00 ? 433 PHE A HB3  5  
ATOM   7568  H  HD1  . PHE A 1 76  ? 12.146  19.266  35.040  1.00 0.00 ? 433 PHE A HD1  5  
ATOM   7569  H  HD2  . PHE A 1 76  ? 9.049   17.524  32.696  1.00 0.00 ? 433 PHE A HD2  5  
ATOM   7570  H  HE1  . PHE A 1 76  ? 13.548  17.278  34.670  1.00 0.00 ? 433 PHE A HE1  5  
ATOM   7571  H  HE2  . PHE A 1 76  ? 10.446  15.534  32.324  1.00 0.00 ? 433 PHE A HE2  5  
ATOM   7572  H  HZ   . PHE A 1 76  ? 12.698  15.408  33.312  1.00 0.00 ? 433 PHE A HZ   5  
ATOM   7573  N  N    . GLN A 1 77  ? 8.283   21.885  36.564  1.00 0.00 ? 434 GLN A N    5  
ATOM   7574  C  CA   . GLN A 1 77  ? 7.385   23.018  36.748  1.00 0.00 ? 434 GLN A CA   5  
ATOM   7575  C  C    . GLN A 1 77  ? 8.171   24.304  36.981  1.00 0.00 ? 434 GLN A C    5  
ATOM   7576  O  O    . GLN A 1 77  ? 9.181   24.308  37.686  1.00 0.00 ? 434 GLN A O    5  
ATOM   7577  C  CB   . GLN A 1 77  ? 6.442   22.763  37.926  1.00 0.00 ? 434 GLN A CB   5  
ATOM   7578  C  CG   . GLN A 1 77  ? 5.186   23.618  37.895  1.00 0.00 ? 434 GLN A CG   5  
ATOM   7579  C  CD   . GLN A 1 77  ? 4.201   23.248  38.987  1.00 0.00 ? 434 GLN A CD   5  
ATOM   7580  O  OE1  . GLN A 1 77  ? 4.149   22.100  39.428  1.00 0.00 ? 434 GLN A OE1  5  
ATOM   7581  N  NE2  . GLN A 1 77  ? 3.413   24.221  39.429  1.00 0.00 ? 434 GLN A NE2  5  
ATOM   7582  H  H    . GLN A 1 77  ? 9.063   21.793  37.151  1.00 0.00 ? 434 GLN A H    5  
ATOM   7583  H  HA   . GLN A 1 77  ? 6.800   23.127  35.848  1.00 0.00 ? 434 GLN A HA   5  
ATOM   7584  H  HB2  . GLN A 1 77  ? 6.146   21.725  37.916  1.00 0.00 ? 434 GLN A HB2  5  
ATOM   7585  H  HB3  . GLN A 1 77  ? 6.970   22.970  38.845  1.00 0.00 ? 434 GLN A HB3  5  
ATOM   7586  H  HG2  . GLN A 1 77  ? 5.467   24.654  38.022  1.00 0.00 ? 434 GLN A HG2  5  
ATOM   7587  H  HG3  . GLN A 1 77  ? 4.703   23.492  36.937  1.00 0.00 ? 434 GLN A HG3  5  
ATOM   7588  H  HE21 . GLN A 1 77  ? 3.510   25.112  39.029  1.00 0.00 ? 434 GLN A HE21 5  
ATOM   7589  H  HE22 . GLN A 1 77  ? 2.767   24.010  40.133  1.00 0.00 ? 434 GLN A HE22 5  
ATOM   7590  N  N    . CYS A 1 78  ? 7.703   25.395  36.383  1.00 0.00 ? 435 CYS A N    5  
ATOM   7591  C  CA   . CYS A 1 78  ? 8.362   26.687  36.523  1.00 0.00 ? 435 CYS A CA   5  
ATOM   7592  C  C    . CYS A 1 78  ? 8.036   27.320  37.873  1.00 0.00 ? 435 CYS A C    5  
ATOM   7593  O  O    . CYS A 1 78  ? 7.243   26.785  38.646  1.00 0.00 ? 435 CYS A O    5  
ATOM   7594  C  CB   . CYS A 1 78  ? 7.938   27.625  35.391  1.00 0.00 ? 435 CYS A CB   5  
ATOM   7595  S  SG   . CYS A 1 78  ? 9.168   28.906  34.986  1.00 0.00 ? 435 CYS A SG   5  
ATOM   7596  H  H    . CYS A 1 78  ? 6.894   25.328  35.832  1.00 0.00 ? 435 CYS A H    5  
ATOM   7597  H  HA   . CYS A 1 78  ? 9.428   26.525  36.464  1.00 0.00 ? 435 CYS A HA   5  
ATOM   7598  H  HB2  . CYS A 1 78  ? 7.764   27.044  34.498  1.00 0.00 ? 435 CYS A HB2  5  
ATOM   7599  H  HB3  . CYS A 1 78  ? 7.023   28.125  35.673  1.00 0.00 ? 435 CYS A HB3  5  
ATOM   7600  N  N    . GLY A 1 79  ? 8.655   28.464  38.149  1.00 0.00 ? 436 GLY A N    5  
ATOM   7601  C  CA   . GLY A 1 79  ? 8.418   29.152  39.405  1.00 0.00 ? 436 GLY A CA   5  
ATOM   7602  C  C    . GLY A 1 79  ? 7.619   30.428  39.225  1.00 0.00 ? 436 GLY A C    5  
ATOM   7603  O  O    . GLY A 1 79  ? 6.698   30.705  39.993  1.00 0.00 ? 436 GLY A O    5  
ATOM   7604  H  H    . GLY A 1 79  ? 9.278   28.845  37.494  1.00 0.00 ? 436 GLY A H    5  
ATOM   7605  H  HA2  . GLY A 1 79  ? 7.879   28.492  40.068  1.00 0.00 ? 436 GLY A HA2  5  
ATOM   7606  H  HA3  . GLY A 1 79  ? 9.370   29.397  39.853  1.00 0.00 ? 436 GLY A HA3  5  
ATOM   7607  N  N    . VAL A 1 80  ? 7.974   31.208  38.210  1.00 0.00 ? 437 VAL A N    5  
ATOM   7608  C  CA   . VAL A 1 80  ? 7.284   32.462  37.932  1.00 0.00 ? 437 VAL A CA   5  
ATOM   7609  C  C    . VAL A 1 80  ? 5.919   32.210  37.301  1.00 0.00 ? 437 VAL A C    5  
ATOM   7610  O  O    . VAL A 1 80  ? 4.882   32.464  37.915  1.00 0.00 ? 437 VAL A O    5  
ATOM   7611  C  CB   . VAL A 1 80  ? 8.111   33.363  36.997  1.00 0.00 ? 437 VAL A CB   5  
ATOM   7612  C  CG1  . VAL A 1 80  ? 7.335   34.623  36.644  1.00 0.00 ? 437 VAL A CG1  5  
ATOM   7613  C  CG2  . VAL A 1 80  ? 9.446   33.712  37.637  1.00 0.00 ? 437 VAL A CG2  5  
ATOM   7614  H  H    . VAL A 1 80  ? 8.717   30.934  37.632  1.00 0.00 ? 437 VAL A H    5  
ATOM   7615  H  HA   . VAL A 1 80  ? 7.146   32.982  38.869  1.00 0.00 ? 437 VAL A HA   5  
ATOM   7616  H  HB   . VAL A 1 80  ? 8.305   32.819  36.084  1.00 0.00 ? 437 VAL A HB   5  
ATOM   7617  H  HG11 . VAL A 1 80  ? 6.447   34.355  36.090  1.00 0.00 ? 437 VAL A HG11 5  
ATOM   7618  H  HG12 . VAL A 1 80  ? 7.054   35.139  37.550  1.00 0.00 ? 437 VAL A HG12 5  
ATOM   7619  H  HG13 . VAL A 1 80  ? 7.954   35.269  36.039  1.00 0.00 ? 437 VAL A HG13 5  
ATOM   7620  H  HG21 . VAL A 1 80  ? 9.317   33.821  38.703  1.00 0.00 ? 437 VAL A HG21 5  
ATOM   7621  H  HG22 . VAL A 1 80  ? 10.156  32.923  37.439  1.00 0.00 ? 437 VAL A HG22 5  
ATOM   7622  H  HG23 . VAL A 1 80  ? 9.814   34.639  37.222  1.00 0.00 ? 437 VAL A HG23 5  
ATOM   7623  N  N    . CYS A 1 81  ? 5.926   31.710  36.070  1.00 0.00 ? 438 CYS A N    5  
ATOM   7624  C  CA   . CYS A 1 81  ? 4.689   31.423  35.354  1.00 0.00 ? 438 CYS A CA   5  
ATOM   7625  C  C    . CYS A 1 81  ? 4.007   30.181  35.922  1.00 0.00 ? 438 CYS A C    5  
ATOM   7626  O  O    . CYS A 1 81  ? 2.807   29.982  35.740  1.00 0.00 ? 438 CYS A O    5  
ATOM   7627  C  CB   . CYS A 1 81  ? 4.972   31.226  33.863  1.00 0.00 ? 438 CYS A CB   5  
ATOM   7628  S  SG   . CYS A 1 81  ? 5.841   29.674  33.470  1.00 0.00 ? 438 CYS A SG   5  
ATOM   7629  H  H    . CYS A 1 81  ? 6.784   31.528  35.632  1.00 0.00 ? 438 CYS A H    5  
ATOM   7630  H  HA   . CYS A 1 81  ? 4.030   32.268  35.478  1.00 0.00 ? 438 CYS A HA   5  
ATOM   7631  H  HB2  . CYS A 1 81  ? 4.036   31.223  33.324  1.00 0.00 ? 438 CYS A HB2  5  
ATOM   7632  H  HB3  . CYS A 1 81  ? 5.582   32.044  33.510  1.00 0.00 ? 438 CYS A HB3  5  
ATOM   7633  N  N    . ASN A 1 82  ? 4.782   29.350  36.611  1.00 0.00 ? 439 ASN A N    5  
ATOM   7634  C  CA   . ASN A 1 82  ? 4.254   28.128  37.205  1.00 0.00 ? 439 ASN A CA   5  
ATOM   7635  C  C    . ASN A 1 82  ? 3.645   27.223  36.138  1.00 0.00 ? 439 ASN A C    5  
ATOM   7636  O  O    . ASN A 1 82  ? 2.499   26.790  36.257  1.00 0.00 ? 439 ASN A O    5  
ATOM   7637  C  CB   . ASN A 1 82  ? 3.202   28.464  38.264  1.00 0.00 ? 439 ASN A CB   5  
ATOM   7638  C  CG   . ASN A 1 82  ? 3.808   29.108  39.496  1.00 0.00 ? 439 ASN A CG   5  
ATOM   7639  O  OD1  . ASN A 1 82  ? 4.218   30.269  39.465  1.00 0.00 ? 439 ASN A OD1  5  
ATOM   7640  N  ND2  . ASN A 1 82  ? 3.866   28.356  40.589  1.00 0.00 ? 439 ASN A ND2  5  
ATOM   7641  H  H    . ASN A 1 82  ? 5.732   29.563  36.722  1.00 0.00 ? 439 ASN A H    5  
ATOM   7642  H  HA   . ASN A 1 82  ? 5.073   27.607  37.677  1.00 0.00 ? 439 ASN A HA   5  
ATOM   7643  H  HB2  . ASN A 1 82  ? 2.481   29.148  37.842  1.00 0.00 ? 439 ASN A HB2  5  
ATOM   7644  H  HB3  . ASN A 1 82  ? 2.699   27.557  38.565  1.00 0.00 ? 439 ASN A HB3  5  
ATOM   7645  H  HD21 . ASN A 1 82  ? 3.521   27.440  40.540  1.00 0.00 ? 439 ASN A HD21 5  
ATOM   7646  H  HD22 . ASN A 1 82  ? 4.253   28.748  41.400  1.00 0.00 ? 439 ASN A HD22 5  
ATOM   7647  N  N    . ARG A 1 83  ? 4.422   26.941  35.097  1.00 0.00 ? 440 ARG A N    5  
ATOM   7648  C  CA   . ARG A 1 83  ? 3.959   26.088  34.008  1.00 0.00 ? 440 ARG A CA   5  
ATOM   7649  C  C    . ARG A 1 83  ? 4.678   24.742  34.029  1.00 0.00 ? 440 ARG A C    5  
ATOM   7650  O  O    . ARG A 1 83  ? 5.777   24.622  34.571  1.00 0.00 ? 440 ARG A O    5  
ATOM   7651  C  CB   . ARG A 1 83  ? 4.184   26.777  32.661  1.00 0.00 ? 440 ARG A CB   5  
ATOM   7652  C  CG   . ARG A 1 83  ? 3.103   27.784  32.304  1.00 0.00 ? 440 ARG A CG   5  
ATOM   7653  C  CD   . ARG A 1 83  ? 3.232   28.252  30.863  1.00 0.00 ? 440 ARG A CD   5  
ATOM   7654  N  NE   . ARG A 1 83  ? 4.239   29.299  30.716  1.00 0.00 ? 440 ARG A NE   5  
ATOM   7655  C  CZ   . ARG A 1 83  ? 3.999   30.587  30.934  1.00 0.00 ? 440 ARG A CZ   5  
ATOM   7656  N  NH1  . ARG A 1 83  ? 2.791   30.985  31.308  1.00 0.00 ? 440 ARG A NH1  5  
ATOM   7657  N  NH2  . ARG A 1 83  ? 4.968   31.479  30.779  1.00 0.00 ? 440 ARG A NH2  5  
ATOM   7658  H  H    . ARG A 1 83  ? 5.326   27.315  35.059  1.00 0.00 ? 440 ARG A H    5  
ATOM   7659  H  HA   . ARG A 1 83  ? 2.902   25.920  34.145  1.00 0.00 ? 440 ARG A HA   5  
ATOM   7660  H  HB2  . ARG A 1 83  ? 5.132   27.295  32.688  1.00 0.00 ? 440 ARG A HB2  5  
ATOM   7661  H  HB3  . ARG A 1 83  ? 4.216   26.025  31.887  1.00 0.00 ? 440 ARG A HB3  5  
ATOM   7662  H  HG2  . ARG A 1 83  ? 2.136   27.321  32.436  1.00 0.00 ? 440 ARG A HG2  5  
ATOM   7663  H  HG3  . ARG A 1 83  ? 3.188   28.637  32.960  1.00 0.00 ? 440 ARG A HG3  5  
ATOM   7664  H  HD2  . ARG A 1 83  ? 3.509   27.409  30.248  1.00 0.00 ? 440 ARG A HD2  5  
ATOM   7665  H  HD3  . ARG A 1 83  ? 2.277   28.636  30.537  1.00 0.00 ? 440 ARG A HD3  5  
ATOM   7666  H  HE   . ARG A 1 83  ? 5.139   29.027  30.440  1.00 0.00 ? 440 ARG A HE   5  
ATOM   7667  H  HH11 . ARG A 1 83  ? 2.059   30.314  31.427  1.00 0.00 ? 440 ARG A HH11 5  
ATOM   7668  H  HH12 . ARG A 1 83  ? 2.613   31.955  31.473  1.00 0.00 ? 440 ARG A HH12 5  
ATOM   7669  H  HH21 . ARG A 1 83  ? 5.880   31.183  30.497  1.00 0.00 ? 440 ARG A HH21 5  
ATOM   7670  H  HH22 . ARG A 1 83  ? 4.786   32.448  30.943  1.00 0.00 ? 440 ARG A HH22 5  
ATOM   7671  N  N    . SER A 1 84  ? 4.050   23.732  33.437  1.00 0.00 ? 441 SER A N    5  
ATOM   7672  C  CA   . SER A 1 84  ? 4.627   22.393  33.392  1.00 0.00 ? 441 SER A CA   5  
ATOM   7673  C  C    . SER A 1 84  ? 5.097   22.052  31.981  1.00 0.00 ? 441 SER A C    5  
ATOM   7674  O  O    . SER A 1 84  ? 4.617   22.621  31.000  1.00 0.00 ? 441 SER A O    5  
ATOM   7675  C  CB   . SER A 1 84  ? 3.605   21.358  33.866  1.00 0.00 ? 441 SER A CB   5  
ATOM   7676  O  OG   . SER A 1 84  ? 2.566   21.196  32.917  1.00 0.00 ? 441 SER A OG   5  
ATOM   7677  H  H    . SER A 1 84  ? 3.175   23.890  33.023  1.00 0.00 ? 441 SER A H    5  
ATOM   7678  H  HA   . SER A 1 84  ? 5.478   22.377  34.056  1.00 0.00 ? 441 SER A HA   5  
ATOM   7679  H  HB2  . SER A 1 84  ? 4.098   20.408  34.007  1.00 0.00 ? 441 SER A HB2  5  
ATOM   7680  H  HB3  . SER A 1 84  ? 3.175   21.683  34.802  1.00 0.00 ? 441 SER A HB3  5  
ATOM   7681  H  HG   . SER A 1 84  ? 1.796   20.815  33.346  1.00 0.00 ? 441 SER A HG   5  
ATOM   7682  N  N    . PHE A 1 85  ? 6.039   21.119  31.887  1.00 0.00 ? 442 PHE A N    5  
ATOM   7683  C  CA   . PHE A 1 85  ? 6.576   20.702  30.597  1.00 0.00 ? 442 PHE A CA   5  
ATOM   7684  C  C    . PHE A 1 85  ? 6.906   19.212  30.602  1.00 0.00 ? 442 PHE A C    5  
ATOM   7685  O  O    . PHE A 1 85  ? 7.335   18.664  31.617  1.00 0.00 ? 442 PHE A O    5  
ATOM   7686  C  CB   . PHE A 1 85  ? 7.828   21.512  30.255  1.00 0.00 ? 442 PHE A CB   5  
ATOM   7687  C  CG   . PHE A 1 85  ? 7.633   22.997  30.377  1.00 0.00 ? 442 PHE A CG   5  
ATOM   7688  C  CD1  . PHE A 1 85  ? 7.759   23.626  31.605  1.00 0.00 ? 442 PHE A CD1  5  
ATOM   7689  C  CD2  . PHE A 1 85  ? 7.324   23.762  29.264  1.00 0.00 ? 442 PHE A CD2  5  
ATOM   7690  C  CE1  . PHE A 1 85  ? 7.579   24.992  31.720  1.00 0.00 ? 442 PHE A CE1  5  
ATOM   7691  C  CE2  . PHE A 1 85  ? 7.144   25.128  29.373  1.00 0.00 ? 442 PHE A CE2  5  
ATOM   7692  C  CZ   . PHE A 1 85  ? 7.272   25.744  30.603  1.00 0.00 ? 442 PHE A CZ   5  
ATOM   7693  H  H    . PHE A 1 85  ? 6.382   20.702  32.705  1.00 0.00 ? 442 PHE A H    5  
ATOM   7694  H  HA   . PHE A 1 85  ? 5.821   20.889  29.849  1.00 0.00 ? 442 PHE A HA   5  
ATOM   7695  H  HB2  . PHE A 1 85  ? 8.626   21.227  30.924  1.00 0.00 ? 442 PHE A HB2  5  
ATOM   7696  H  HB3  . PHE A 1 85  ? 8.120   21.297  29.239  1.00 0.00 ? 442 PHE A HB3  5  
ATOM   7697  H  HD1  . PHE A 1 85  ? 7.999   23.040  32.480  1.00 0.00 ? 442 PHE A HD1  5  
ATOM   7698  H  HD2  . PHE A 1 85  ? 7.223   23.281  28.302  1.00 0.00 ? 442 PHE A HD2  5  
ATOM   7699  H  HE1  . PHE A 1 85  ? 7.681   25.471  32.682  1.00 0.00 ? 442 PHE A HE1  5  
ATOM   7700  H  HE2  . PHE A 1 85  ? 6.904   25.713  28.498  1.00 0.00 ? 442 PHE A HE2  5  
ATOM   7701  H  HZ   . PHE A 1 85  ? 7.131   26.811  30.690  1.00 0.00 ? 442 PHE A HZ   5  
ATOM   7702  N  N    . SER A 1 86  ? 6.703   18.563  29.460  1.00 0.00 ? 443 SER A N    5  
ATOM   7703  C  CA   . SER A 1 86  ? 6.974   17.136  29.333  1.00 0.00 ? 443 SER A CA   5  
ATOM   7704  C  C    . SER A 1 86  ? 8.476   16.871  29.292  1.00 0.00 ? 443 SER A C    5  
ATOM   7705  O  O    . SER A 1 86  ? 8.973   15.954  29.946  1.00 0.00 ? 443 SER A O    5  
ATOM   7706  C  CB   . SER A 1 86  ? 6.312   16.580  28.071  1.00 0.00 ? 443 SER A CB   5  
ATOM   7707  O  OG   . SER A 1 86  ? 6.893   17.135  26.903  1.00 0.00 ? 443 SER A OG   5  
ATOM   7708  H  H    . SER A 1 86  ? 6.359   19.056  28.685  1.00 0.00 ? 443 SER A H    5  
ATOM   7709  H  HA   . SER A 1 86  ? 6.556   16.641  30.196  1.00 0.00 ? 443 SER A HA   5  
ATOM   7710  H  HB2  . SER A 1 86  ? 6.435   15.508  28.045  1.00 0.00 ? 443 SER A HB2  5  
ATOM   7711  H  HB3  . SER A 1 86  ? 5.259   16.821  28.084  1.00 0.00 ? 443 SER A HB3  5  
ATOM   7712  H  HG   . SER A 1 86  ? 6.409   17.923  26.648  1.00 0.00 ? 443 SER A HG   5  
ATOM   7713  N  N    . ARG A 1 87  ? 9.193   17.679  28.518  1.00 0.00 ? 444 ARG A N    5  
ATOM   7714  C  CA   . ARG A 1 87  ? 10.637  17.532  28.390  1.00 0.00 ? 444 ARG A CA   5  
ATOM   7715  C  C    . ARG A 1 87  ? 11.367  18.462  29.355  1.00 0.00 ? 444 ARG A C    5  
ATOM   7716  O  O    . ARG A 1 87  ? 10.862  19.530  29.704  1.00 0.00 ? 444 ARG A O    5  
ATOM   7717  C  CB   . ARG A 1 87  ? 11.076  17.824  26.954  1.00 0.00 ? 444 ARG A CB   5  
ATOM   7718  C  CG   . ARG A 1 87  ? 10.594  16.791  25.948  1.00 0.00 ? 444 ARG A CG   5  
ATOM   7719  C  CD   . ARG A 1 87  ? 11.367  16.883  24.641  1.00 0.00 ? 444 ARG A CD   5  
ATOM   7720  N  NE   . ARG A 1 87  ? 10.883  15.925  23.651  1.00 0.00 ? 444 ARG A NE   5  
ATOM   7721  C  CZ   . ARG A 1 87  ? 11.502  15.681  22.501  1.00 0.00 ? 444 ARG A CZ   5  
ATOM   7722  N  NH1  . ARG A 1 87  ? 12.622  16.322  22.199  1.00 0.00 ? 444 ARG A NH1  5  
ATOM   7723  N  NH2  . ARG A 1 87  ? 11.000  14.794  21.651  1.00 0.00 ? 444 ARG A NH2  5  
ATOM   7724  H  H    . ARG A 1 87  ? 8.739   18.392  28.021  1.00 0.00 ? 444 ARG A H    5  
ATOM   7725  H  HA   . ARG A 1 87  ? 10.890  16.511  28.633  1.00 0.00 ? 444 ARG A HA   5  
ATOM   7726  H  HB2  . ARG A 1 87  ? 10.688  18.788  26.660  1.00 0.00 ? 444 ARG A HB2  5  
ATOM   7727  H  HB3  . ARG A 1 87  ? 12.154  17.853  26.918  1.00 0.00 ? 444 ARG A HB3  5  
ATOM   7728  H  HG2  . ARG A 1 87  ? 10.731  15.804  26.365  1.00 0.00 ? 444 ARG A HG2  5  
ATOM   7729  H  HG3  . ARG A 1 87  ? 9.546   16.958  25.749  1.00 0.00 ? 444 ARG A HG3  5  
ATOM   7730  H  HD2  . ARG A 1 87  ? 11.259  17.881  24.245  1.00 0.00 ? 444 ARG A HD2  5  
ATOM   7731  H  HD3  . ARG A 1 87  ? 12.409  16.685  24.841  1.00 0.00 ? 444 ARG A HD3  5  
ATOM   7732  H  HE   . ARG A 1 87  ? 10.057  15.440  23.854  1.00 0.00 ? 444 ARG A HE   5  
ATOM   7733  H  HH11 . ARG A 1 87  ? 13.003  16.990  22.838  1.00 0.00 ? 444 ARG A HH11 5  
ATOM   7734  H  HH12 . ARG A 1 87  ? 13.087  16.136  21.332  1.00 0.00 ? 444 ARG A HH12 5  
ATOM   7735  H  HH21 . ARG A 1 87  ? 10.155  14.309  21.876  1.00 0.00 ? 444 ARG A HH21 5  
ATOM   7736  H  HH22 . ARG A 1 87  ? 11.466  14.612  20.786  1.00 0.00 ? 444 ARG A HH22 5  
ATOM   7737  N  N    . SER A 1 88  ? 12.556  18.050  29.782  1.00 0.00 ? 445 SER A N    5  
ATOM   7738  C  CA   . SER A 1 88  ? 13.352  18.844  30.710  1.00 0.00 ? 445 SER A CA   5  
ATOM   7739  C  C    . SER A 1 88  ? 14.048  19.992  29.984  1.00 0.00 ? 445 SER A C    5  
ATOM   7740  O  O    . SER A 1 88  ? 13.854  21.161  30.318  1.00 0.00 ? 445 SER A O    5  
ATOM   7741  C  CB   . SER A 1 88  ? 14.391  17.963  31.407  1.00 0.00 ? 445 SER A CB   5  
ATOM   7742  O  OG   . SER A 1 88  ? 15.278  18.743  32.190  1.00 0.00 ? 445 SER A OG   5  
ATOM   7743  H  H    . SER A 1 88  ? 12.904  17.189  29.467  1.00 0.00 ? 445 SER A H    5  
ATOM   7744  H  HA   . SER A 1 88  ? 12.685  19.255  31.452  1.00 0.00 ? 445 SER A HA   5  
ATOM   7745  H  HB2  . SER A 1 88  ? 13.887  17.257  32.050  1.00 0.00 ? 445 SER A HB2  5  
ATOM   7746  H  HB3  . SER A 1 88  ? 14.962  17.427  30.663  1.00 0.00 ? 445 SER A HB3  5  
ATOM   7747  H  HG   . SER A 1 88  ? 14.860  19.578  32.412  1.00 0.00 ? 445 SER A HG   5  
ATOM   7748  N  N    . ASP A 1 89  ? 14.858  19.649  28.989  1.00 0.00 ? 446 ASP A N    5  
ATOM   7749  C  CA   . ASP A 1 89  ? 15.583  20.650  28.214  1.00 0.00 ? 446 ASP A CA   5  
ATOM   7750  C  C    . ASP A 1 89  ? 14.710  21.875  27.957  1.00 0.00 ? 446 ASP A C    5  
ATOM   7751  O  O    . ASP A 1 89  ? 15.179  23.011  28.036  1.00 0.00 ? 446 ASP A O    5  
ATOM   7752  C  CB   . ASP A 1 89  ? 16.052  20.055  26.885  1.00 0.00 ? 446 ASP A CB   5  
ATOM   7753  C  CG   . ASP A 1 89  ? 17.049  20.947  26.172  1.00 0.00 ? 446 ASP A CG   5  
ATOM   7754  O  OD1  . ASP A 1 89  ? 18.216  21.004  26.613  1.00 0.00 ? 446 ASP A OD1  5  
ATOM   7755  O  OD2  . ASP A 1 89  ? 16.663  21.586  25.171  1.00 0.00 ? 446 ASP A OD2  5  
ATOM   7756  H  H    . ASP A 1 89  ? 14.972  18.700  28.770  1.00 0.00 ? 446 ASP A H    5  
ATOM   7757  H  HA   . ASP A 1 89  ? 16.446  20.952  28.787  1.00 0.00 ? 446 ASP A HA   5  
ATOM   7758  H  HB2  . ASP A 1 89  ? 16.521  19.100  27.071  1.00 0.00 ? 446 ASP A HB2  5  
ATOM   7759  H  HB3  . ASP A 1 89  ? 15.197  19.913  26.240  1.00 0.00 ? 446 ASP A HB3  5  
ATOM   7760  N  N    . HIS A 1 90  ? 13.439  21.636  27.649  1.00 0.00 ? 447 HIS A N    5  
ATOM   7761  C  CA   . HIS A 1 90  ? 12.501  22.720  27.380  1.00 0.00 ? 447 HIS A CA   5  
ATOM   7762  C  C    . HIS A 1 90  ? 12.416  23.672  28.570  1.00 0.00 ? 447 HIS A C    5  
ATOM   7763  O  O    . HIS A 1 90  ? 12.434  24.892  28.404  1.00 0.00 ? 447 HIS A O    5  
ATOM   7764  C  CB   . HIS A 1 90  ? 11.116  22.156  27.063  1.00 0.00 ? 447 HIS A CB   5  
ATOM   7765  C  CG   . HIS A 1 90  ? 10.997  21.607  25.674  1.00 0.00 ? 447 HIS A CG   5  
ATOM   7766  N  ND1  . HIS A 1 90  ? 10.077  20.641  25.324  1.00 0.00 ? 447 HIS A ND1  5  
ATOM   7767  C  CD2  . HIS A 1 90  ? 11.687  21.894  24.546  1.00 0.00 ? 447 HIS A CD2  5  
ATOM   7768  C  CE1  . HIS A 1 90  ? 10.208  20.356  24.040  1.00 0.00 ? 447 HIS A CE1  5  
ATOM   7769  N  NE2  . HIS A 1 90  ? 11.178  21.104  23.545  1.00 0.00 ? 447 HIS A NE2  5  
ATOM   7770  H  H    . HIS A 1 90  ? 13.125  20.709  27.602  1.00 0.00 ? 447 HIS A H    5  
ATOM   7771  H  HA   . HIS A 1 90  ? 12.863  23.267  26.523  1.00 0.00 ? 447 HIS A HA   5  
ATOM   7772  H  HB2  . HIS A 1 90  ? 10.892  21.358  27.755  1.00 0.00 ? 447 HIS A HB2  5  
ATOM   7773  H  HB3  . HIS A 1 90  ? 10.381  22.941  27.174  1.00 0.00 ? 447 HIS A HB3  5  
ATOM   7774  H  HD1  . HIS A 1 90  ? 9.427   20.224  25.926  1.00 0.00 ? 447 HIS A HD1  5  
ATOM   7775  H  HD2  . HIS A 1 90  ? 12.490  22.612  24.450  1.00 0.00 ? 447 HIS A HD2  5  
ATOM   7776  H  HE1  . HIS A 1 90  ? 9.623   19.636  23.489  1.00 0.00 ? 447 HIS A HE1  5  
ATOM   7777  N  N    . LEU A 1 91  ? 12.322  23.106  29.768  1.00 0.00 ? 448 LEU A N    5  
ATOM   7778  C  CA   . LEU A 1 91  ? 12.233  23.905  30.986  1.00 0.00 ? 448 LEU A CA   5  
ATOM   7779  C  C    . LEU A 1 91  ? 13.476  24.771  31.161  1.00 0.00 ? 448 LEU A C    5  
ATOM   7780  O  O    . LEU A 1 91  ? 13.384  25.994  31.257  1.00 0.00 ? 448 LEU A O    5  
ATOM   7781  C  CB   . LEU A 1 91  ? 12.054  22.996  32.203  1.00 0.00 ? 448 LEU A CB   5  
ATOM   7782  C  CG   . LEU A 1 91  ? 12.251  23.656  33.568  1.00 0.00 ? 448 LEU A CG   5  
ATOM   7783  C  CD1  . LEU A 1 91  ? 11.077  24.565  33.896  1.00 0.00 ? 448 LEU A CD1  5  
ATOM   7784  C  CD2  . LEU A 1 91  ? 12.429  22.601  34.650  1.00 0.00 ? 448 LEU A CD2  5  
ATOM   7785  H  H    . LEU A 1 91  ? 12.312  22.129  29.837  1.00 0.00 ? 448 LEU A H    5  
ATOM   7786  H  HA   . LEU A 1 91  ? 11.370  24.548  30.897  1.00 0.00 ? 448 LEU A HA   5  
ATOM   7787  H  HB2  . LEU A 1 91  ? 11.053  22.594  32.172  1.00 0.00 ? 448 LEU A HB2  5  
ATOM   7788  H  HB3  . LEU A 1 91  ? 12.767  22.188  32.119  1.00 0.00 ? 448 LEU A HB3  5  
ATOM   7789  H  HG   . LEU A 1 91  ? 13.145  24.263  33.542  1.00 0.00 ? 448 LEU A HG   5  
ATOM   7790  H  HD11 . LEU A 1 91  ? 11.221  25.524  33.421  1.00 0.00 ? 448 LEU A HD11 5  
ATOM   7791  H  HD12 . LEU A 1 91  ? 11.013  24.699  34.965  1.00 0.00 ? 448 LEU A HD12 5  
ATOM   7792  H  HD13 . LEU A 1 91  ? 10.163  24.117  33.534  1.00 0.00 ? 448 LEU A HD13 5  
ATOM   7793  H  HD21 . LEU A 1 91  ? 13.440  22.638  35.027  1.00 0.00 ? 448 LEU A HD21 5  
ATOM   7794  H  HD22 . LEU A 1 91  ? 12.235  21.623  34.234  1.00 0.00 ? 448 LEU A HD22 5  
ATOM   7795  H  HD23 . LEU A 1 91  ? 11.736  22.792  35.457  1.00 0.00 ? 448 LEU A HD23 5  
ATOM   7796  N  N    . ALA A 1 92  ? 14.638  24.127  31.201  1.00 0.00 ? 449 ALA A N    5  
ATOM   7797  C  CA   . ALA A 1 92  ? 15.900  24.839  31.360  1.00 0.00 ? 449 ALA A CA   5  
ATOM   7798  C  C    . ALA A 1 92  ? 15.957  26.065  30.455  1.00 0.00 ? 449 ALA A C    5  
ATOM   7799  O  O    . ALA A 1 92  ? 16.187  27.182  30.920  1.00 0.00 ? 449 ALA A O    5  
ATOM   7800  C  CB   . ALA A 1 92  ? 17.070  23.910  31.070  1.00 0.00 ? 449 ALA A CB   5  
ATOM   7801  H  H    . ALA A 1 92  ? 14.647  23.151  31.119  1.00 0.00 ? 449 ALA A H    5  
ATOM   7802  H  HA   . ALA A 1 92  ? 15.974  25.160  32.389  1.00 0.00 ? 449 ALA A HA   5  
ATOM   7803  H  HB1  . ALA A 1 92  ? 17.582  23.678  31.991  1.00 0.00 ? 449 ALA A HB1  5  
ATOM   7804  H  HB2  . ALA A 1 92  ? 16.702  22.999  30.622  1.00 0.00 ? 449 ALA A HB2  5  
ATOM   7805  H  HB3  . ALA A 1 92  ? 17.754  24.396  30.389  1.00 0.00 ? 449 ALA A HB3  5  
ATOM   7806  N  N    . LEU A 1 93  ? 15.748  25.849  29.161  1.00 0.00 ? 450 LEU A N    5  
ATOM   7807  C  CA   . LEU A 1 93  ? 15.776  26.937  28.190  1.00 0.00 ? 450 LEU A CA   5  
ATOM   7808  C  C    . LEU A 1 93  ? 14.634  27.918  28.437  1.00 0.00 ? 450 LEU A C    5  
ATOM   7809  O  O    . LEU A 1 93  ? 14.818  29.133  28.360  1.00 0.00 ? 450 LEU A O    5  
ATOM   7810  C  CB   . LEU A 1 93  ? 15.687  26.380  26.768  1.00 0.00 ? 450 LEU A CB   5  
ATOM   7811  C  CG   . LEU A 1 93  ? 16.174  27.305  25.652  1.00 0.00 ? 450 LEU A CG   5  
ATOM   7812  C  CD1  . LEU A 1 93  ? 17.657  27.091  25.391  1.00 0.00 ? 450 LEU A CD1  5  
ATOM   7813  C  CD2  . LEU A 1 93  ? 15.369  27.078  24.381  1.00 0.00 ? 450 LEU A CD2  5  
ATOM   7814  H  H    . LEU A 1 93  ? 15.570  24.937  28.851  1.00 0.00 ? 450 LEU A H    5  
ATOM   7815  H  HA   . LEU A 1 93  ? 16.714  27.459  28.305  1.00 0.00 ? 450 LEU A HA   5  
ATOM   7816  H  HB2  . LEU A 1 93  ? 16.276  25.477  26.729  1.00 0.00 ? 450 LEU A HB2  5  
ATOM   7817  H  HB3  . LEU A 1 93  ? 14.651  26.141  26.572  1.00 0.00 ? 450 LEU A HB3  5  
ATOM   7818  H  HG   . LEU A 1 93  ? 16.035  28.333  25.959  1.00 0.00 ? 450 LEU A HG   5  
ATOM   7819  H  HD11 . LEU A 1 93  ? 17.875  26.034  25.399  1.00 0.00 ? 450 LEU A HD11 5  
ATOM   7820  H  HD12 . LEU A 1 93  ? 18.233  27.583  26.162  1.00 0.00 ? 450 LEU A HD12 5  
ATOM   7821  H  HD13 . LEU A 1 93  ? 17.917  27.507  24.429  1.00 0.00 ? 450 LEU A HD13 5  
ATOM   7822  H  HD21 . LEU A 1 93  ? 16.034  27.072  23.531  1.00 0.00 ? 450 LEU A HD21 5  
ATOM   7823  H  HD22 . LEU A 1 93  ? 14.646  27.873  24.267  1.00 0.00 ? 450 LEU A HD22 5  
ATOM   7824  H  HD23 . LEU A 1 93  ? 14.855  26.130  24.445  1.00 0.00 ? 450 LEU A HD23 5  
ATOM   7825  N  N    . HIS A 1 94  ? 13.455  27.382  28.736  1.00 0.00 ? 451 HIS A N    5  
ATOM   7826  C  CA   . HIS A 1 94  ? 12.284  28.210  28.998  1.00 0.00 ? 451 HIS A CA   5  
ATOM   7827  C  C    . HIS A 1 94  ? 12.595  29.277  30.043  1.00 0.00 ? 451 HIS A C    5  
ATOM   7828  O  O    . HIS A 1 94  ? 12.205  30.435  29.896  1.00 0.00 ? 451 HIS A O    5  
ATOM   7829  C  CB   . HIS A 1 94  ? 11.115  27.344  29.469  1.00 0.00 ? 451 HIS A CB   5  
ATOM   7830  C  CG   . HIS A 1 94  ? 10.026  28.121  30.141  1.00 0.00 ? 451 HIS A CG   5  
ATOM   7831  N  ND1  . HIS A 1 94  ? 8.843   28.455  29.514  1.00 0.00 ? 451 HIS A ND1  5  
ATOM   7832  C  CD2  . HIS A 1 94  ? 9.943   28.630  31.392  1.00 0.00 ? 451 HIS A CD2  5  
ATOM   7833  C  CE1  . HIS A 1 94  ? 8.082   29.137  30.351  1.00 0.00 ? 451 HIS A CE1  5  
ATOM   7834  N  NE2  . HIS A 1 94  ? 8.726   29.256  31.498  1.00 0.00 ? 451 HIS A NE2  5  
ATOM   7835  H  H    . HIS A 1 94  ? 13.372  26.407  28.783  1.00 0.00 ? 451 HIS A H    5  
ATOM   7836  H  HA   . HIS A 1 94  ? 12.009  28.697  28.075  1.00 0.00 ? 451 HIS A HA   5  
ATOM   7837  H  HB2  . HIS A 1 94  ? 10.685  26.837  28.618  1.00 0.00 ? 451 HIS A HB2  5  
ATOM   7838  H  HB3  . HIS A 1 94  ? 11.481  26.609  30.172  1.00 0.00 ? 451 HIS A HB3  5  
ATOM   7839  H  HD1  . HIS A 1 94  ? 8.600   28.227  28.593  1.00 0.00 ? 451 HIS A HD1  5  
ATOM   7840  H  HD2  . HIS A 1 94  ? 10.695  28.557  32.166  1.00 0.00 ? 451 HIS A HD2  5  
ATOM   7841  H  HE1  . HIS A 1 94  ? 7.099   29.529  30.135  1.00 0.00 ? 451 HIS A HE1  5  
ATOM   7842  N  N    . MET A 1 95  ? 13.299  28.879  31.097  1.00 0.00 ? 452 MET A N    5  
ATOM   7843  C  CA   . MET A 1 95  ? 13.663  29.802  32.166  1.00 0.00 ? 452 MET A CA   5  
ATOM   7844  C  C    . MET A 1 95  ? 14.207  31.107  31.595  1.00 0.00 ? 452 MET A C    5  
ATOM   7845  O  O    . MET A 1 95  ? 13.822  32.194  32.026  1.00 0.00 ? 452 MET A O    5  
ATOM   7846  C  CB   . MET A 1 95  ? 14.702  29.162  33.089  1.00 0.00 ? 452 MET A CB   5  
ATOM   7847  C  CG   . MET A 1 95  ? 14.092  28.385  34.244  1.00 0.00 ? 452 MET A CG   5  
ATOM   7848  S  SD   . MET A 1 95  ? 13.829  29.406  35.707  1.00 0.00 ? 452 MET A SD   5  
ATOM   7849  C  CE   . MET A 1 95  ? 12.386  28.617  36.416  1.00 0.00 ? 452 MET A CE   5  
ATOM   7850  H  H    . MET A 1 95  ? 13.582  27.942  31.158  1.00 0.00 ? 452 MET A H    5  
ATOM   7851  H  HA   . MET A 1 95  ? 12.771  30.016  32.736  1.00 0.00 ? 452 MET A HA   5  
ATOM   7852  H  HB2  . MET A 1 95  ? 15.312  28.486  32.510  1.00 0.00 ? 452 MET A HB2  5  
ATOM   7853  H  HB3  . MET A 1 95  ? 15.329  29.940  33.499  1.00 0.00 ? 452 MET A HB3  5  
ATOM   7854  H  HG2  . MET A 1 95  ? 13.141  27.983  33.928  1.00 0.00 ? 452 MET A HG2  5  
ATOM   7855  H  HG3  . MET A 1 95  ? 14.755  27.573  34.503  1.00 0.00 ? 452 MET A HG3  5  
ATOM   7856  H  HE1  . MET A 1 95  ? 12.149  27.727  35.851  1.00 0.00 ? 452 MET A HE1  5  
ATOM   7857  H  HE2  . MET A 1 95  ? 12.591  28.347  37.442  1.00 0.00 ? 452 MET A HE2  5  
ATOM   7858  H  HE3  . MET A 1 95  ? 11.550  29.299  36.383  1.00 0.00 ? 452 MET A HE3  5  
ATOM   7859  N  N    . LYS A 1 96  ? 15.106  30.993  30.623  1.00 0.00 ? 453 LYS A N    5  
ATOM   7860  C  CA   . LYS A 1 96  ? 15.704  32.164  29.992  1.00 0.00 ? 453 LYS A CA   5  
ATOM   7861  C  C    . LYS A 1 96  ? 14.637  33.197  29.641  1.00 0.00 ? 453 LYS A C    5  
ATOM   7862  O  O    . LYS A 1 96  ? 14.844  34.398  29.812  1.00 0.00 ? 453 LYS A O    5  
ATOM   7863  C  CB   . LYS A 1 96  ? 16.468  31.755  28.731  1.00 0.00 ? 453 LYS A CB   5  
ATOM   7864  C  CG   . LYS A 1 96  ? 17.534  30.703  28.980  1.00 0.00 ? 453 LYS A CG   5  
ATOM   7865  C  CD   . LYS A 1 96  ? 18.874  31.336  29.315  1.00 0.00 ? 453 LYS A CD   5  
ATOM   7866  C  CE   . LYS A 1 96  ? 19.588  31.825  28.064  1.00 0.00 ? 453 LYS A CE   5  
ATOM   7867  N  NZ   . LYS A 1 96  ? 20.482  32.980  28.352  1.00 0.00 ? 453 LYS A NZ   5  
ATOM   7868  H  H    . LYS A 1 96  ? 15.374  30.099  30.322  1.00 0.00 ? 453 LYS A H    5  
ATOM   7869  H  HA   . LYS A 1 96  ? 16.396  32.603  30.695  1.00 0.00 ? 453 LYS A HA   5  
ATOM   7870  H  HB2  . LYS A 1 96  ? 15.765  31.362  28.011  1.00 0.00 ? 453 LYS A HB2  5  
ATOM   7871  H  HB3  . LYS A 1 96  ? 16.945  32.630  28.314  1.00 0.00 ? 453 LYS A HB3  5  
ATOM   7872  H  HG2  . LYS A 1 96  ? 17.226  30.079  29.806  1.00 0.00 ? 453 LYS A HG2  5  
ATOM   7873  H  HG3  . LYS A 1 96  ? 17.644  30.097  28.091  1.00 0.00 ? 453 LYS A HG3  5  
ATOM   7874  H  HD2  . LYS A 1 96  ? 18.711  32.175  29.974  1.00 0.00 ? 453 LYS A HD2  5  
ATOM   7875  H  HD3  . LYS A 1 96  ? 19.495  30.602  29.810  1.00 0.00 ? 453 LYS A HD3  5  
ATOM   7876  H  HE2  . LYS A 1 96  ? 20.178  31.016  27.663  1.00 0.00 ? 453 LYS A HE2  5  
ATOM   7877  H  HE3  . LYS A 1 96  ? 18.848  32.125  27.338  1.00 0.00 ? 453 LYS A HE3  5  
ATOM   7878  H  HZ1  . LYS A 1 96  ? 21.395  32.855  27.870  1.00 0.00 ? 453 LYS A HZ1  5  
ATOM   7879  H  HZ2  . LYS A 1 96  ? 20.650  33.056  29.376  1.00 0.00 ? 453 LYS A HZ2  5  
ATOM   7880  H  HZ3  . LYS A 1 96  ? 20.044  33.863  28.018  1.00 0.00 ? 453 LYS A HZ3  5  
ATOM   7881  N  N    . ARG A 1 97  ? 13.497  32.720  29.152  1.00 0.00 ? 454 ARG A N    5  
ATOM   7882  C  CA   . ARG A 1 97  ? 12.399  33.603  28.777  1.00 0.00 ? 454 ARG A CA   5  
ATOM   7883  C  C    . ARG A 1 97  ? 12.090  34.592  29.897  1.00 0.00 ? 454 ARG A C    5  
ATOM   7884  O  O    . ARG A 1 97  ? 11.740  35.745  29.643  1.00 0.00 ? 454 ARG A O    5  
ATOM   7885  C  CB   . ARG A 1 97  ? 11.149  32.785  28.447  1.00 0.00 ? 454 ARG A CB   5  
ATOM   7886  C  CG   . ARG A 1 97  ? 9.920   33.635  28.169  1.00 0.00 ? 454 ARG A CG   5  
ATOM   7887  C  CD   . ARG A 1 97  ? 9.959   34.228  26.769  1.00 0.00 ? 454 ARG A CD   5  
ATOM   7888  N  NE   . ARG A 1 97  ? 9.112   35.412  26.653  1.00 0.00 ? 454 ARG A NE   5  
ATOM   7889  C  CZ   . ARG A 1 97  ? 9.114   36.216  25.595  1.00 0.00 ? 454 ARG A CZ   5  
ATOM   7890  N  NH1  . ARG A 1 97  ? 9.912   35.963  24.567  1.00 0.00 ? 454 ARG A NH1  5  
ATOM   7891  N  NH2  . ARG A 1 97  ? 8.315   37.275  25.564  1.00 0.00 ? 454 ARG A NH2  5  
ATOM   7892  H  H    . ARG A 1 97  ? 13.392  31.752  29.039  1.00 0.00 ? 454 ARG A H    5  
ATOM   7893  H  HA   . ARG A 1 97  ? 12.700  34.154  27.899  1.00 0.00 ? 454 ARG A HA   5  
ATOM   7894  H  HB2  . ARG A 1 97  ? 11.348  32.182  27.573  1.00 0.00 ? 454 ARG A HB2  5  
ATOM   7895  H  HB3  . ARG A 1 97  ? 10.929  32.134  29.280  1.00 0.00 ? 454 ARG A HB3  5  
ATOM   7896  H  HG2  . ARG A 1 97  ? 9.039   33.018  28.262  1.00 0.00 ? 454 ARG A HG2  5  
ATOM   7897  H  HG3  . ARG A 1 97  ? 9.879   34.438  28.890  1.00 0.00 ? 454 ARG A HG3  5  
ATOM   7898  H  HD2  . ARG A 1 97  ? 10.977  34.500  26.535  1.00 0.00 ? 454 ARG A HD2  5  
ATOM   7899  H  HD3  . ARG A 1 97  ? 9.616   33.482  26.067  1.00 0.00 ? 454 ARG A HD3  5  
ATOM   7900  H  HE   . ARG A 1 97  ? 8.514   35.618  27.401  1.00 0.00 ? 454 ARG A HE   5  
ATOM   7901  H  HH11 . ARG A 1 97  ? 10.515  35.165  24.588  1.00 0.00 ? 454 ARG A HH11 5  
ATOM   7902  H  HH12 . ARG A 1 97  ? 9.911   36.569  23.772  1.00 0.00 ? 454 ARG A HH12 5  
ATOM   7903  H  HH21 . ARG A 1 97  ? 7.711   37.468  26.337  1.00 0.00 ? 454 ARG A HH21 5  
ATOM   7904  H  HH22 . ARG A 1 97  ? 8.317   37.879  24.768  1.00 0.00 ? 454 ARG A HH22 5  
ATOM   7905  N  N    . HIS A 1 98  ? 12.223  34.134  31.138  1.00 0.00 ? 455 HIS A N    5  
ATOM   7906  C  CA   . HIS A 1 98  ? 11.958  34.979  32.297  1.00 0.00 ? 455 HIS A CA   5  
ATOM   7907  C  C    . HIS A 1 98  ? 13.161  35.863  32.611  1.00 0.00 ? 455 HIS A C    5  
ATOM   7908  O  O    . HIS A 1 98  ? 13.007  37.004  33.046  1.00 0.00 ? 455 HIS A O    5  
ATOM   7909  C  CB   . HIS A 1 98  ? 11.612  34.118  33.513  1.00 0.00 ? 455 HIS A CB   5  
ATOM   7910  C  CG   . HIS A 1 98  ? 10.295  33.416  33.395  1.00 0.00 ? 455 HIS A CG   5  
ATOM   7911  N  ND1  . HIS A 1 98  ? 9.112   34.074  33.134  1.00 0.00 ? 455 HIS A ND1  5  
ATOM   7912  C  CD2  . HIS A 1 98  ? 9.979   32.104  33.501  1.00 0.00 ? 455 HIS A CD2  5  
ATOM   7913  C  CE1  . HIS A 1 98  ? 8.124   33.197  33.087  1.00 0.00 ? 455 HIS A CE1  5  
ATOM   7914  N  NE2  . HIS A 1 98  ? 8.624   31.995  33.306  1.00 0.00 ? 455 HIS A NE2  5  
ATOM   7915  H  H    . HIS A 1 98  ? 12.505  33.206  31.277  1.00 0.00 ? 455 HIS A H    5  
ATOM   7916  H  HA   . HIS A 1 98  ? 11.115  35.610  32.062  1.00 0.00 ? 455 HIS A HA   5  
ATOM   7917  H  HB2  . HIS A 1 98  ? 12.378  33.368  33.644  1.00 0.00 ? 455 HIS A HB2  5  
ATOM   7918  H  HB3  . HIS A 1 98  ? 11.577  34.746  34.392  1.00 0.00 ? 455 HIS A HB3  5  
ATOM   7919  H  HD1  . HIS A 1 98  ? 9.011   35.039  33.005  1.00 0.00 ? 455 HIS A HD1  5  
ATOM   7920  H  HD2  . HIS A 1 98  ? 10.664  31.293  33.703  1.00 0.00 ? 455 HIS A HD2  5  
ATOM   7921  H  HE1  . HIS A 1 98  ? 7.085   33.425  32.901  1.00 0.00 ? 455 HIS A HE1  5  
ATOM   7922  N  N    . GLN A 1 99  ? 14.357  35.329  32.387  1.00 0.00 ? 456 GLN A N    5  
ATOM   7923  C  CA   . GLN A 1 99  ? 15.585  36.070  32.647  1.00 0.00 ? 456 GLN A CA   5  
ATOM   7924  C  C    . GLN A 1 99  ? 15.965  36.932  31.448  1.00 0.00 ? 456 GLN A C    5  
ATOM   7925  O  O    . GLN A 1 99  ? 17.069  36.822  30.917  1.00 0.00 ? 456 GLN A O    5  
ATOM   7926  C  CB   . GLN A 1 99  ? 16.726  35.107  32.980  1.00 0.00 ? 456 GLN A CB   5  
ATOM   7927  C  CG   . GLN A 1 99  ? 17.894  35.770  33.691  1.00 0.00 ? 456 GLN A CG   5  
ATOM   7928  C  CD   . GLN A 1 99  ? 17.481  36.455  34.979  1.00 0.00 ? 456 GLN A CD   5  
ATOM   7929  O  OE1  . GLN A 1 99  ? 16.362  36.273  35.461  1.00 0.00 ? 456 GLN A OE1  5  
ATOM   7930  N  NE2  . GLN A 1 99  ? 18.383  37.249  35.544  1.00 0.00 ? 456 GLN A NE2  5  
ATOM   7931  H  H    . GLN A 1 99  ? 14.415  34.415  32.039  1.00 0.00 ? 456 GLN A H    5  
ATOM   7932  H  HA   . GLN A 1 99  ? 15.411  36.713  33.496  1.00 0.00 ? 456 GLN A HA   5  
ATOM   7933  H  HB2  . GLN A 1 99  ? 16.345  34.321  33.614  1.00 0.00 ? 456 GLN A HB2  5  
ATOM   7934  H  HB3  . GLN A 1 99  ? 17.093  34.671  32.062  1.00 0.00 ? 456 GLN A HB3  5  
ATOM   7935  H  HG2  . GLN A 1 99  ? 18.633  35.017  33.924  1.00 0.00 ? 456 GLN A HG2  5  
ATOM   7936  H  HG3  . GLN A 1 99  ? 18.329  36.507  33.032  1.00 0.00 ? 456 GLN A HG3  5  
ATOM   7937  H  HE21 . GLN A 1 99  ? 19.253  37.348  35.103  1.00 0.00 ? 456 GLN A HE21 5  
ATOM   7938  H  HE22 . GLN A 1 99  ? 18.142  37.705  36.376  1.00 0.00 ? 456 GLN A HE22 5  
ATOM   7939  N  N    . ASN A 1 100 ? 15.042  37.791  31.027  1.00 0.00 ? 457 ASN A N    5  
ATOM   7940  C  CA   . ASN A 1 100 ? 15.280  38.672  29.889  1.00 0.00 ? 457 ASN A CA   5  
ATOM   7941  C  C    . ASN A 1 100 ? 14.638  40.037  30.115  1.00 0.00 ? 457 ASN A C    5  
ATOM   7942  O  O    . ASN A 1 100 ? 13.431  40.139  30.329  1.00 0.00 ? 457 ASN A O    5  
ATOM   7943  C  CB   . ASN A 1 100 ? 14.730  38.043  28.607  1.00 0.00 ? 457 ASN A CB   5  
ATOM   7944  C  CG   . ASN A 1 100 ? 15.750  37.163  27.911  1.00 0.00 ? 457 ASN A CG   5  
ATOM   7945  O  OD1  . ASN A 1 100 ? 16.954  37.289  28.139  1.00 0.00 ? 457 ASN A OD1  5  
ATOM   7946  N  ND2  . ASN A 1 100 ? 15.272  36.265  27.057  1.00 0.00 ? 457 ASN A ND2  5  
ATOM   7947  H  H    . ASN A 1 100 ? 14.180  37.833  31.491  1.00 0.00 ? 457 ASN A H    5  
ATOM   7948  H  HA   . ASN A 1 100 ? 16.347  38.801  29.787  1.00 0.00 ? 457 ASN A HA   5  
ATOM   7949  H  HB2  . ASN A 1 100 ? 13.869  37.439  28.850  1.00 0.00 ? 457 ASN A HB2  5  
ATOM   7950  H  HB3  . ASN A 1 100 ? 14.434  38.828  27.927  1.00 0.00 ? 457 ASN A HB3  5  
ATOM   7951  H  HD21 . ASN A 1 100 ? 14.302  36.222  26.926  1.00 0.00 ? 457 ASN A HD21 5  
ATOM   7952  H  HD22 . ASN A 1 100 ? 15.910  35.683  26.594  1.00 0.00 ? 457 ASN A HD22 5  
HETATM 7953  ZN ZN   . ZN  B 2 .   ? 15.541  -0.693  10.988  1.00 0.00 ? 100 ZN  A ZN   5  
HETATM 7954  ZN ZN   . ZN  C 2 .   ? -0.618  14.258  23.772  1.00 0.00 ? 200 ZN  A ZN   5  
HETATM 7955  ZN ZN   . ZN  D 2 .   ? 8.100   30.058  33.246  1.00 0.00 ? 300 ZN  A ZN   5  
ATOM   7956  N  N    . GLY A 1 1   ? 35.477  -30.845 59.122  1.00 0.00 ? 358 GLY A N    6  
ATOM   7957  C  CA   . GLY A 1 1   ? 35.474  -30.751 57.674  1.00 0.00 ? 358 GLY A CA   6  
ATOM   7958  C  C    . GLY A 1 1   ? 35.326  -29.324 57.186  1.00 0.00 ? 358 GLY A C    6  
ATOM   7959  O  O    . GLY A 1 1   ? 34.942  -28.437 57.948  1.00 0.00 ? 358 GLY A O    6  
ATOM   7960  H  H1   . GLY A 1 1   ? 35.391  -30.033 59.664  1.00 0.00 ? 358 GLY A H1   6  
ATOM   7961  H  HA2  . GLY A 1 1   ? 36.402  -31.156 57.296  1.00 0.00 ? 358 GLY A HA2  6  
ATOM   7962  H  HA3  . GLY A 1 1   ? 34.654  -31.338 57.288  1.00 0.00 ? 358 GLY A HA3  6  
ATOM   7963  N  N    . SER A 1 2   ? 35.634  -29.101 55.912  1.00 0.00 ? 359 SER A N    6  
ATOM   7964  C  CA   . SER A 1 2   ? 35.539  -27.770 55.324  1.00 0.00 ? 359 SER A CA   6  
ATOM   7965  C  C    . SER A 1 2   ? 35.619  -27.841 53.802  1.00 0.00 ? 359 SER A C    6  
ATOM   7966  O  O    . SER A 1 2   ? 36.213  -28.763 53.243  1.00 0.00 ? 359 SER A O    6  
ATOM   7967  C  CB   . SER A 1 2   ? 36.652  -26.870 55.864  1.00 0.00 ? 359 SER A CB   6  
ATOM   7968  O  OG   . SER A 1 2   ? 36.247  -25.512 55.881  1.00 0.00 ? 359 SER A OG   6  
ATOM   7969  H  H    . SER A 1 2   ? 35.935  -29.849 55.355  1.00 0.00 ? 359 SER A H    6  
ATOM   7970  H  HA   . SER A 1 2   ? 34.583  -27.352 55.604  1.00 0.00 ? 359 SER A HA   6  
ATOM   7971  H  HB2  . SER A 1 2   ? 36.900  -27.172 56.870  1.00 0.00 ? 359 SER A HB2  6  
ATOM   7972  H  HB3  . SER A 1 2   ? 37.525  -26.965 55.234  1.00 0.00 ? 359 SER A HB3  6  
ATOM   7973  H  HG   . SER A 1 2   ? 36.434  -25.133 56.743  1.00 0.00 ? 359 SER A HG   6  
ATOM   7974  N  N    . SER A 1 3   ? 35.017  -26.860 53.138  1.00 0.00 ? 360 SER A N    6  
ATOM   7975  C  CA   . SER A 1 3   ? 35.016  -26.812 51.681  1.00 0.00 ? 360 SER A CA   6  
ATOM   7976  C  C    . SER A 1 3   ? 34.517  -25.459 51.182  1.00 0.00 ? 360 SER A C    6  
ATOM   7977  O  O    . SER A 1 3   ? 33.544  -24.913 51.701  1.00 0.00 ? 360 SER A O    6  
ATOM   7978  C  CB   . SER A 1 3   ? 34.141  -27.931 51.113  1.00 0.00 ? 360 SER A CB   6  
ATOM   7979  O  OG   . SER A 1 3   ? 34.567  -28.302 49.813  1.00 0.00 ? 360 SER A OG   6  
ATOM   7980  H  H    . SER A 1 3   ? 34.559  -26.153 53.640  1.00 0.00 ? 360 SER A H    6  
ATOM   7981  H  HA   . SER A 1 3   ? 36.032  -26.954 51.344  1.00 0.00 ? 360 SER A HA   6  
ATOM   7982  H  HB2  . SER A 1 3   ? 34.202  -28.794 51.758  1.00 0.00 ? 360 SER A HB2  6  
ATOM   7983  H  HB3  . SER A 1 3   ? 33.117  -27.592 51.060  1.00 0.00 ? 360 SER A HB3  6  
ATOM   7984  H  HG   . SER A 1 3   ? 34.096  -27.779 49.160  1.00 0.00 ? 360 SER A HG   6  
ATOM   7985  N  N    . GLY A 1 4   ? 35.192  -24.922 50.170  1.00 0.00 ? 361 GLY A N    6  
ATOM   7986  C  CA   . GLY A 1 4   ? 34.804  -23.638 49.617  1.00 0.00 ? 361 GLY A CA   6  
ATOM   7987  C  C    . GLY A 1 4   ? 35.371  -23.409 48.230  1.00 0.00 ? 361 GLY A C    6  
ATOM   7988  O  O    . GLY A 1 4   ? 36.452  -23.899 47.905  1.00 0.00 ? 361 GLY A O    6  
ATOM   7989  H  H    . GLY A 1 4   ? 35.960  -25.403 49.795  1.00 0.00 ? 361 GLY A H    6  
ATOM   7990  H  HA2  . GLY A 1 4   ? 33.727  -23.591 49.567  1.00 0.00 ? 361 GLY A HA2  6  
ATOM   7991  H  HA3  . GLY A 1 4   ? 35.159  -22.855 50.272  1.00 0.00 ? 361 GLY A HA3  6  
ATOM   7992  N  N    . SER A 1 5   ? 34.638  -22.663 47.409  1.00 0.00 ? 362 SER A N    6  
ATOM   7993  C  CA   . SER A 1 5   ? 35.071  -22.374 46.047  1.00 0.00 ? 362 SER A CA   6  
ATOM   7994  C  C    . SER A 1 5   ? 34.195  -21.297 45.415  1.00 0.00 ? 362 SER A C    6  
ATOM   7995  O  O    . SER A 1 5   ? 33.239  -20.821 46.026  1.00 0.00 ? 362 SER A O    6  
ATOM   7996  C  CB   . SER A 1 5   ? 35.031  -23.645 45.196  1.00 0.00 ? 362 SER A CB   6  
ATOM   7997  O  OG   . SER A 1 5   ? 36.242  -24.372 45.306  1.00 0.00 ? 362 SER A OG   6  
ATOM   7998  H  H    . SER A 1 5   ? 33.785  -22.300 47.727  1.00 0.00 ? 362 SER A H    6  
ATOM   7999  H  HA   . SER A 1 5   ? 36.088  -22.014 46.092  1.00 0.00 ? 362 SER A HA   6  
ATOM   8000  H  HB2  . SER A 1 5   ? 34.217  -24.272 45.529  1.00 0.00 ? 362 SER A HB2  6  
ATOM   8001  H  HB3  . SER A 1 5   ? 34.878  -23.377 44.161  1.00 0.00 ? 362 SER A HB3  6  
ATOM   8002  H  HG   . SER A 1 5   ? 36.110  -25.265 44.981  1.00 0.00 ? 362 SER A HG   6  
ATOM   8003  N  N    . SER A 1 6   ? 34.530  -20.916 44.186  1.00 0.00 ? 363 SER A N    6  
ATOM   8004  C  CA   . SER A 1 6   ? 33.777  -19.893 43.471  1.00 0.00 ? 363 SER A CA   6  
ATOM   8005  C  C    . SER A 1 6   ? 34.272  -19.758 42.034  1.00 0.00 ? 363 SER A C    6  
ATOM   8006  O  O    . SER A 1 6   ? 35.251  -20.390 41.641  1.00 0.00 ? 363 SER A O    6  
ATOM   8007  C  CB   . SER A 1 6   ? 33.894  -18.548 44.191  1.00 0.00 ? 363 SER A CB   6  
ATOM   8008  O  OG   . SER A 1 6   ? 32.822  -17.688 43.843  1.00 0.00 ? 363 SER A OG   6  
ATOM   8009  H  H    . SER A 1 6   ? 35.303  -21.333 43.751  1.00 0.00 ? 363 SER A H    6  
ATOM   8010  H  HA   . SER A 1 6   ? 32.740  -20.194 43.455  1.00 0.00 ? 363 SER A HA   6  
ATOM   8011  H  HB2  . SER A 1 6   ? 33.877  -18.710 45.257  1.00 0.00 ? 363 SER A HB2  6  
ATOM   8012  H  HB3  . SER A 1 6   ? 34.824  -18.074 43.913  1.00 0.00 ? 363 SER A HB3  6  
ATOM   8013  H  HG   . SER A 1 6   ? 33.058  -16.781 44.050  1.00 0.00 ? 363 SER A HG   6  
ATOM   8014  N  N    . GLY A 1 7   ? 33.586  -18.929 41.253  1.00 0.00 ? 364 GLY A N    6  
ATOM   8015  C  CA   . GLY A 1 7   ? 33.969  -18.726 39.869  1.00 0.00 ? 364 GLY A CA   6  
ATOM   8016  C  C    . GLY A 1 7   ? 33.081  -17.720 39.163  1.00 0.00 ? 364 GLY A C    6  
ATOM   8017  O  O    . GLY A 1 7   ? 32.083  -18.075 38.535  1.00 0.00 ? 364 GLY A O    6  
ATOM   8018  H  H    . GLY A 1 7   ? 32.812  -18.451 41.621  1.00 0.00 ? 364 GLY A H    6  
ATOM   8019  H  HA2  . GLY A 1 7   ? 34.989  -18.374 39.837  1.00 0.00 ? 364 GLY A HA2  6  
ATOM   8020  H  HA3  . GLY A 1 7   ? 33.908  -19.670 39.348  1.00 0.00 ? 364 GLY A HA3  6  
ATOM   8021  N  N    . PRO A 1 8   ? 33.443  -16.433 39.263  1.00 0.00 ? 365 PRO A N    6  
ATOM   8022  C  CA   . PRO A 1 8   ? 32.685  -15.346 38.635  1.00 0.00 ? 365 PRO A CA   6  
ATOM   8023  C  C    . PRO A 1 8   ? 32.798  -15.362 37.115  1.00 0.00 ? 365 PRO A C    6  
ATOM   8024  O  O    . PRO A 1 8   ? 33.544  -16.160 36.547  1.00 0.00 ? 365 PRO A O    6  
ATOM   8025  C  CB   . PRO A 1 8   ? 33.335  -14.084 39.207  1.00 0.00 ? 365 PRO A CB   6  
ATOM   8026  C  CG   . PRO A 1 8   ? 34.719  -14.500 39.567  1.00 0.00 ? 365 PRO A CG   6  
ATOM   8027  C  CD   . PRO A 1 8   ? 34.621  -15.938 39.995  1.00 0.00 ? 365 PRO A CD   6  
ATOM   8028  H  HA   . PRO A 1 8   ? 31.642  -15.376 38.918  1.00 0.00 ? 365 PRO A HA   6  
ATOM   8029  H  HB2  . PRO A 1 8   ? 33.337  -13.306 38.457  1.00 0.00 ? 365 PRO A HB2  6  
ATOM   8030  H  HB3  . PRO A 1 8   ? 32.784  -13.753 40.075  1.00 0.00 ? 365 PRO A HB3  6  
ATOM   8031  H  HG2  . PRO A 1 8   ? 35.365  -14.408 38.707  1.00 0.00 ? 365 PRO A HG2  6  
ATOM   8032  H  HG3  . PRO A 1 8   ? 35.086  -13.891 40.380  1.00 0.00 ? 365 PRO A HG3  6  
ATOM   8033  H  HD2  . PRO A 1 8   ? 35.510  -16.479 39.706  1.00 0.00 ? 365 PRO A HD2  6  
ATOM   8034  H  HD3  . PRO A 1 8   ? 34.467  -16.005 41.062  1.00 0.00 ? 365 PRO A HD3  6  
ATOM   8035  N  N    . ASP A 1 9   ? 32.055  -14.476 36.462  1.00 0.00 ? 366 ASP A N    6  
ATOM   8036  C  CA   . ASP A 1 9   ? 32.074  -14.387 35.006  1.00 0.00 ? 366 ASP A CA   6  
ATOM   8037  C  C    . ASP A 1 9   ? 31.517  -13.047 34.536  1.00 0.00 ? 366 ASP A C    6  
ATOM   8038  O  O    . ASP A 1 9   ? 30.577  -12.512 35.125  1.00 0.00 ? 366 ASP A O    6  
ATOM   8039  C  CB   . ASP A 1 9   ? 31.266  -15.532 34.393  1.00 0.00 ? 366 ASP A CB   6  
ATOM   8040  C  CG   . ASP A 1 9   ? 31.719  -15.873 32.987  1.00 0.00 ? 366 ASP A CG   6  
ATOM   8041  O  OD1  . ASP A 1 9   ? 31.246  -15.216 32.037  1.00 0.00 ? 366 ASP A OD1  6  
ATOM   8042  O  OD2  . ASP A 1 9   ? 32.546  -16.797 32.837  1.00 0.00 ? 366 ASP A OD2  6  
ATOM   8043  H  H    . ASP A 1 9   ? 31.480  -13.866 36.970  1.00 0.00 ? 366 ASP A H    6  
ATOM   8044  H  HA   . ASP A 1 9   ? 33.100  -14.470 34.682  1.00 0.00 ? 366 ASP A HA   6  
ATOM   8045  H  HB2  . ASP A 1 9   ? 31.376  -16.412 35.010  1.00 0.00 ? 366 ASP A HB2  6  
ATOM   8046  H  HB3  . ASP A 1 9   ? 30.224  -15.251 34.359  1.00 0.00 ? 366 ASP A HB3  6  
ATOM   8047  N  N    . LEU A 1 10  ? 32.104  -12.508 33.473  1.00 0.00 ? 367 LEU A N    6  
ATOM   8048  C  CA   . LEU A 1 10  ? 31.668  -11.229 32.924  1.00 0.00 ? 367 LEU A CA   6  
ATOM   8049  C  C    . LEU A 1 10  ? 32.030  -11.119 31.447  1.00 0.00 ? 367 LEU A C    6  
ATOM   8050  O  O    . LEU A 1 10  ? 32.770  -11.947 30.916  1.00 0.00 ? 367 LEU A O    6  
ATOM   8051  C  CB   . LEU A 1 10  ? 32.300  -10.075 33.704  1.00 0.00 ? 367 LEU A CB   6  
ATOM   8052  C  CG   . LEU A 1 10  ? 31.923  -9.978  35.183  1.00 0.00 ? 367 LEU A CG   6  
ATOM   8053  C  CD1  . LEU A 1 10  ? 32.768  -8.924  35.881  1.00 0.00 ? 367 LEU A CD1  6  
ATOM   8054  C  CD2  . LEU A 1 10  ? 30.442  -9.664  35.336  1.00 0.00 ? 367 LEU A CD2  6  
ATOM   8055  H  H    . LEU A 1 10  ? 32.849  -12.981 33.047  1.00 0.00 ? 367 LEU A H    6  
ATOM   8056  H  HA   . LEU A 1 10  ? 30.594  -11.175 33.024  1.00 0.00 ? 367 LEU A HA   6  
ATOM   8057  H  HB2  . LEU A 1 10  ? 33.372  -10.182 33.642  1.00 0.00 ? 367 LEU A HB2  6  
ATOM   8058  H  HB3  . LEU A 1 10  ? 32.004  -9.152  33.225  1.00 0.00 ? 367 LEU A HB3  6  
ATOM   8059  H  HG   . LEU A 1 10  ? 32.115  -10.929 35.660  1.00 0.00 ? 367 LEU A HG   6  
ATOM   8060  H  HD11 . LEU A 1 10  ? 32.141  -8.097  36.175  1.00 0.00 ? 367 LEU A HD11 6  
ATOM   8061  H  HD12 . LEU A 1 10  ? 33.535  -8.573  35.206  1.00 0.00 ? 367 LEU A HD12 6  
ATOM   8062  H  HD13 . LEU A 1 10  ? 33.231  -9.356  36.756  1.00 0.00 ? 367 LEU A HD13 6  
ATOM   8063  H  HD21 . LEU A 1 10  ? 29.943  -10.501 35.802  1.00 0.00 ? 367 LEU A HD21 6  
ATOM   8064  H  HD22 . LEU A 1 10  ? 30.010  -9.483  34.363  1.00 0.00 ? 367 LEU A HD22 6  
ATOM   8065  H  HD23 . LEU A 1 10  ? 30.322  -8.784  35.952  1.00 0.00 ? 367 LEU A HD23 6  
ATOM   8066  N  N    . GLU A 1 11  ? 31.506  -10.089 30.789  1.00 0.00 ? 368 GLU A N    6  
ATOM   8067  C  CA   . GLU A 1 11  ? 31.776  -9.870  29.373  1.00 0.00 ? 368 GLU A CA   6  
ATOM   8068  C  C    . GLU A 1 11  ? 31.647  -8.392  29.017  1.00 0.00 ? 368 GLU A C    6  
ATOM   8069  O  O    . GLU A 1 11  ? 31.184  -7.585  29.823  1.00 0.00 ? 368 GLU A O    6  
ATOM   8070  C  CB   . GLU A 1 11  ? 30.818  -10.698 28.514  1.00 0.00 ? 368 GLU A CB   6  
ATOM   8071  C  CG   . GLU A 1 11  ? 31.288  -12.124 28.280  1.00 0.00 ? 368 GLU A CG   6  
ATOM   8072  C  CD   . GLU A 1 11  ? 30.573  -12.791 27.120  1.00 0.00 ? 368 GLU A CD   6  
ATOM   8073  O  OE1  . GLU A 1 11  ? 30.924  -12.494 25.959  1.00 0.00 ? 368 GLU A OE1  6  
ATOM   8074  O  OE2  . GLU A 1 11  ? 29.664  -13.608 27.374  1.00 0.00 ? 368 GLU A OE2  6  
ATOM   8075  H  H    . GLU A 1 11  ? 30.923  -9.463  31.267  1.00 0.00 ? 368 GLU A H    6  
ATOM   8076  H  HA   . GLU A 1 11  ? 32.788  -10.189 29.175  1.00 0.00 ? 368 GLU A HA   6  
ATOM   8077  H  HB2  . GLU A 1 11  ? 29.855  -10.734 29.003  1.00 0.00 ? 368 GLU A HB2  6  
ATOM   8078  H  HB3  . GLU A 1 11  ? 30.706  -10.216 27.554  1.00 0.00 ? 368 GLU A HB3  6  
ATOM   8079  H  HG2  . GLU A 1 11  ? 32.347  -12.111 28.070  1.00 0.00 ? 368 GLU A HG2  6  
ATOM   8080  H  HG3  . GLU A 1 11  ? 31.107  -12.701 29.175  1.00 0.00 ? 368 GLU A HG3  6  
ATOM   8081  N  N    . LYS A 1 12  ? 32.062  -8.044  27.803  1.00 0.00 ? 369 LYS A N    6  
ATOM   8082  C  CA   . LYS A 1 12  ? 31.993  -6.664  27.337  1.00 0.00 ? 369 LYS A CA   6  
ATOM   8083  C  C    . LYS A 1 12  ? 31.705  -6.608  25.841  1.00 0.00 ? 369 LYS A C    6  
ATOM   8084  O  O    . LYS A 1 12  ? 32.422  -7.207  25.039  1.00 0.00 ? 369 LYS A O    6  
ATOM   8085  C  CB   . LYS A 1 12  ? 33.304  -5.936  27.643  1.00 0.00 ? 369 LYS A CB   6  
ATOM   8086  C  CG   . LYS A 1 12  ? 33.159  -4.425  27.710  1.00 0.00 ? 369 LYS A CG   6  
ATOM   8087  C  CD   . LYS A 1 12  ? 34.440  -3.763  28.188  1.00 0.00 ? 369 LYS A CD   6  
ATOM   8088  C  CE   . LYS A 1 12  ? 34.172  -2.381  28.766  1.00 0.00 ? 369 LYS A CE   6  
ATOM   8089  N  NZ   . LYS A 1 12  ? 33.571  -2.456  30.126  1.00 0.00 ? 369 LYS A NZ   6  
ATOM   8090  H  H    . LYS A 1 12  ? 32.421  -8.733  27.205  1.00 0.00 ? 369 LYS A H    6  
ATOM   8091  H  HA   . LYS A 1 12  ? 31.188  -6.175  27.865  1.00 0.00 ? 369 LYS A HA   6  
ATOM   8092  H  HB2  . LYS A 1 12  ? 33.682  -6.283  28.593  1.00 0.00 ? 369 LYS A HB2  6  
ATOM   8093  H  HB3  . LYS A 1 12  ? 34.022  -6.173  26.871  1.00 0.00 ? 369 LYS A HB3  6  
ATOM   8094  H  HG2  . LYS A 1 12  ? 32.919  -4.051  26.726  1.00 0.00 ? 369 LYS A HG2  6  
ATOM   8095  H  HG3  . LYS A 1 12  ? 32.360  -4.180  28.396  1.00 0.00 ? 369 LYS A HG3  6  
ATOM   8096  H  HD2  . LYS A 1 12  ? 34.891  -4.378  28.953  1.00 0.00 ? 369 LYS A HD2  6  
ATOM   8097  H  HD3  . LYS A 1 12  ? 35.120  -3.669  27.353  1.00 0.00 ? 369 LYS A HD3  6  
ATOM   8098  H  HE2  . LYS A 1 12  ? 35.105  -1.842  28.823  1.00 0.00 ? 369 LYS A HE2  6  
ATOM   8099  H  HE3  . LYS A 1 12  ? 33.493  -1.857  28.109  1.00 0.00 ? 369 LYS A HE3  6  
ATOM   8100  H  HZ1  . LYS A 1 12  ? 34.286  -2.227  30.846  1.00 0.00 ? 369 LYS A HZ1  6  
ATOM   8101  H  HZ2  . LYS A 1 12  ? 33.209  -3.415  30.304  1.00 0.00 ? 369 LYS A HZ2  6  
ATOM   8102  H  HZ3  . LYS A 1 12  ? 32.784  -1.781  30.207  1.00 0.00 ? 369 LYS A HZ3  6  
ATOM   8103  N  N    . ARG A 1 13  ? 30.653  -5.885  25.471  1.00 0.00 ? 370 ARG A N    6  
ATOM   8104  C  CA   . ARG A 1 13  ? 30.272  -5.751  24.071  1.00 0.00 ? 370 ARG A CA   6  
ATOM   8105  C  C    . ARG A 1 13  ? 29.181  -4.698  23.902  1.00 0.00 ? 370 ARG A C    6  
ATOM   8106  O  O    . ARG A 1 13  ? 28.304  -4.556  24.755  1.00 0.00 ? 370 ARG A O    6  
ATOM   8107  C  CB   . ARG A 1 13  ? 29.787  -7.095  23.522  1.00 0.00 ? 370 ARG A CB   6  
ATOM   8108  C  CG   . ARG A 1 13  ? 29.972  -7.241  22.020  1.00 0.00 ? 370 ARG A CG   6  
ATOM   8109  C  CD   . ARG A 1 13  ? 31.385  -7.684  21.674  1.00 0.00 ? 370 ARG A CD   6  
ATOM   8110  N  NE   . ARG A 1 13  ? 32.330  -6.571  21.704  1.00 0.00 ? 370 ARG A NE   6  
ATOM   8111  C  CZ   . ARG A 1 13  ? 33.649  -6.727  21.734  1.00 0.00 ? 370 ARG A CZ   6  
ATOM   8112  N  NH1  . ARG A 1 13  ? 34.176  -7.943  21.737  1.00 0.00 ? 370 ARG A NH1  6  
ATOM   8113  N  NH2  . ARG A 1 13  ? 34.444  -5.664  21.760  1.00 0.00 ? 370 ARG A NH2  6  
ATOM   8114  H  H    . ARG A 1 13  ? 30.121  -5.431  26.157  1.00 0.00 ? 370 ARG A H    6  
ATOM   8115  H  HA   . ARG A 1 13  ? 31.145  -5.440  23.517  1.00 0.00 ? 370 ARG A HA   6  
ATOM   8116  H  HB2  . ARG A 1 13  ? 30.335  -7.888  24.009  1.00 0.00 ? 370 ARG A HB2  6  
ATOM   8117  H  HB3  . ARG A 1 13  ? 28.737  -7.203  23.745  1.00 0.00 ? 370 ARG A HB3  6  
ATOM   8118  H  HG2  . ARG A 1 13  ? 29.275  -7.979  21.651  1.00 0.00 ? 370 ARG A HG2  6  
ATOM   8119  H  HG3  . ARG A 1 13  ? 29.776  -6.290  21.548  1.00 0.00 ? 370 ARG A HG3  6  
ATOM   8120  H  HD2  . ARG A 1 13  ? 31.700  -8.430  22.388  1.00 0.00 ? 370 ARG A HD2  6  
ATOM   8121  H  HD3  . ARG A 1 13  ? 31.381  -8.114  20.683  1.00 0.00 ? 370 ARG A HD3  6  
ATOM   8122  H  HE   . ARG A 1 13  ? 31.962  -5.663  21.702  1.00 0.00 ? 370 ARG A HE   6  
ATOM   8123  H  HH11 . ARG A 1 13  ? 33.580  -8.746  21.717  1.00 0.00 ? 370 ARG A HH11 6  
ATOM   8124  H  HH12 . ARG A 1 13  ? 35.169  -8.058  21.759  1.00 0.00 ? 370 ARG A HH12 6  
ATOM   8125  H  HH21 . ARG A 1 13  ? 34.050  -4.746  21.757  1.00 0.00 ? 370 ARG A HH21 6  
ATOM   8126  H  HH22 . ARG A 1 13  ? 35.436  -5.783  21.783  1.00 0.00 ? 370 ARG A HH22 6  
ATOM   8127  N  N    . ARG A 1 14  ? 29.243  -3.960  22.798  1.00 0.00 ? 371 ARG A N    6  
ATOM   8128  C  CA   . ARG A 1 14  ? 28.262  -2.919  22.519  1.00 0.00 ? 371 ARG A CA   6  
ATOM   8129  C  C    . ARG A 1 14  ? 27.732  -3.038  21.093  1.00 0.00 ? 371 ARG A C    6  
ATOM   8130  O  O    . ARG A 1 14  ? 28.253  -2.409  20.172  1.00 0.00 ? 371 ARG A O    6  
ATOM   8131  C  CB   . ARG A 1 14  ? 28.881  -1.536  22.730  1.00 0.00 ? 371 ARG A CB   6  
ATOM   8132  C  CG   . ARG A 1 14  ? 27.868  -0.403  22.693  1.00 0.00 ? 371 ARG A CG   6  
ATOM   8133  C  CD   . ARG A 1 14  ? 28.508  0.928   23.059  1.00 0.00 ? 371 ARG A CD   6  
ATOM   8134  N  NE   . ARG A 1 14  ? 28.696  1.067   24.500  1.00 0.00 ? 371 ARG A NE   6  
ATOM   8135  C  CZ   . ARG A 1 14  ? 27.745  1.483   25.329  1.00 0.00 ? 371 ARG A CZ   6  
ATOM   8136  N  NH1  . ARG A 1 14  ? 26.545  1.799   24.861  1.00 0.00 ? 371 ARG A NH1  6  
ATOM   8137  N  NH2  . ARG A 1 14  ? 27.993  1.584   26.628  1.00 0.00 ? 371 ARG A NH2  6  
ATOM   8138  H  H    . ARG A 1 14  ? 29.966  -4.120  22.156  1.00 0.00 ? 371 ARG A H    6  
ATOM   8139  H  HA   . ARG A 1 14  ? 27.440  -3.044  23.208  1.00 0.00 ? 371 ARG A HA   6  
ATOM   8140  H  HB2  . ARG A 1 14  ? 29.374  -1.517  23.691  1.00 0.00 ? 371 ARG A HB2  6  
ATOM   8141  H  HB3  . ARG A 1 14  ? 29.613  -1.361  21.956  1.00 0.00 ? 371 ARG A HB3  6  
ATOM   8142  H  HG2  . ARG A 1 14  ? 27.459  -0.331  21.696  1.00 0.00 ? 371 ARG A HG2  6  
ATOM   8143  H  HG3  . ARG A 1 14  ? 27.077  -0.617  23.395  1.00 0.00 ? 371 ARG A HG3  6  
ATOM   8144  H  HD2  . ARG A 1 14  ? 29.469  0.996   22.571  1.00 0.00 ? 371 ARG A HD2  6  
ATOM   8145  H  HD3  . ARG A 1 14  ? 27.870  1.726   22.709  1.00 0.00 ? 371 ARG A HD3  6  
ATOM   8146  H  HE   . ARG A 1 14  ? 29.575  0.839   24.867  1.00 0.00 ? 371 ARG A HE   6  
ATOM   8147  H  HH11 . ARG A 1 14  ? 26.355  1.723   23.883  1.00 0.00 ? 371 ARG A HH11 6  
ATOM   8148  H  HH12 . ARG A 1 14  ? 25.831  2.111   25.488  1.00 0.00 ? 371 ARG A HH12 6  
ATOM   8149  H  HH21 . ARG A 1 14  ? 28.897  1.346   26.985  1.00 0.00 ? 371 ARG A HH21 6  
ATOM   8150  H  HH22 . ARG A 1 14  ? 27.277  1.897   27.251  1.00 0.00 ? 371 ARG A HH22 6  
ATOM   8151  N  N    . ILE A 1 15  ? 26.695  -3.850  20.920  1.00 0.00 ? 372 ILE A N    6  
ATOM   8152  C  CA   . ILE A 1 15  ? 26.095  -4.051  19.607  1.00 0.00 ? 372 ILE A CA   6  
ATOM   8153  C  C    . ILE A 1 15  ? 24.576  -3.937  19.673  1.00 0.00 ? 372 ILE A C    6  
ATOM   8154  O  O    . ILE A 1 15  ? 23.965  -4.226  20.702  1.00 0.00 ? 372 ILE A O    6  
ATOM   8155  C  CB   . ILE A 1 15  ? 26.469  -5.426  19.021  1.00 0.00 ? 372 ILE A CB   6  
ATOM   8156  C  CG1  . ILE A 1 15  ? 27.990  -5.569  18.931  1.00 0.00 ? 372 ILE A CG1  6  
ATOM   8157  C  CG2  . ILE A 1 15  ? 25.832  -5.610  17.652  1.00 0.00 ? 372 ILE A CG2  6  
ATOM   8158  C  CD1  . ILE A 1 15  ? 28.627  -4.624  17.936  1.00 0.00 ? 372 ILE A CD1  6  
ATOM   8159  H  H    . ILE A 1 15  ? 26.323  -4.324  21.693  1.00 0.00 ? 372 ILE A H    6  
ATOM   8160  H  HA   . ILE A 1 15  ? 26.474  -3.285  18.946  1.00 0.00 ? 372 ILE A HA   6  
ATOM   8161  H  HB   . ILE A 1 15  ? 26.082  -6.190  19.678  1.00 0.00 ? 372 ILE A HB   6  
ATOM   8162  H  HG12 . ILE A 1 15  ? 28.422  -5.371  19.899  1.00 0.00 ? 372 ILE A HG12 6  
ATOM   8163  H  HG13 . ILE A 1 15  ? 28.232  -6.578  18.633  1.00 0.00 ? 372 ILE A HG13 6  
ATOM   8164  H  HG21 . ILE A 1 15  ? 24.761  -5.689  17.761  1.00 0.00 ? 372 ILE A HG21 6  
ATOM   8165  H  HG22 . ILE A 1 15  ? 26.068  -4.760  17.029  1.00 0.00 ? 372 ILE A HG22 6  
ATOM   8166  H  HG23 . ILE A 1 15  ? 26.215  -6.510  17.194  1.00 0.00 ? 372 ILE A HG23 6  
ATOM   8167  H  HD11 . ILE A 1 15  ? 29.700  -4.756  17.951  1.00 0.00 ? 372 ILE A HD11 6  
ATOM   8168  H  HD12 . ILE A 1 15  ? 28.254  -4.838  16.946  1.00 0.00 ? 372 ILE A HD12 6  
ATOM   8169  H  HD13 . ILE A 1 15  ? 28.387  -3.605  18.201  1.00 0.00 ? 372 ILE A HD13 6  
ATOM   8170  N  N    . HIS A 1 16  ? 23.970  -3.515  18.567  1.00 0.00 ? 373 HIS A N    6  
ATOM   8171  C  CA   . HIS A 1 16  ? 22.521  -3.364  18.498  1.00 0.00 ? 373 HIS A CA   6  
ATOM   8172  C  C    . HIS A 1 16  ? 21.990  -3.832  17.147  1.00 0.00 ? 373 HIS A C    6  
ATOM   8173  O  O    . HIS A 1 16  ? 22.370  -3.303  16.102  1.00 0.00 ? 373 HIS A O    6  
ATOM   8174  C  CB   . HIS A 1 16  ? 22.127  -1.907  18.738  1.00 0.00 ? 373 HIS A CB   6  
ATOM   8175  C  CG   . HIS A 1 16  ? 22.306  -1.463  20.157  1.00 0.00 ? 373 HIS A CG   6  
ATOM   8176  N  ND1  . HIS A 1 16  ? 21.411  -1.769  21.160  1.00 0.00 ? 373 HIS A ND1  6  
ATOM   8177  C  CD2  . HIS A 1 16  ? 23.286  -0.733  20.739  1.00 0.00 ? 373 HIS A CD2  6  
ATOM   8178  C  CE1  . HIS A 1 16  ? 21.831  -1.245  22.297  1.00 0.00 ? 373 HIS A CE1  6  
ATOM   8179  N  NE2  . HIS A 1 16  ? 22.967  -0.612  22.070  1.00 0.00 ? 373 HIS A NE2  6  
ATOM   8180  H  H    . HIS A 1 16  ? 24.511  -3.300  17.779  1.00 0.00 ? 373 HIS A H    6  
ATOM   8181  H  HA   . HIS A 1 16  ? 22.087  -3.977  19.274  1.00 0.00 ? 373 HIS A HA   6  
ATOM   8182  H  HB2  . HIS A 1 16  ? 22.734  -1.269  18.112  1.00 0.00 ? 373 HIS A HB2  6  
ATOM   8183  H  HB3  . HIS A 1 16  ? 21.087  -1.774  18.476  1.00 0.00 ? 373 HIS A HB3  6  
ATOM   8184  H  HD1  . HIS A 1 16  ? 20.589  -2.291  21.053  1.00 0.00 ? 373 HIS A HD1  6  
ATOM   8185  H  HD2  . HIS A 1 16  ? 24.157  -0.321  20.249  1.00 0.00 ? 373 HIS A HD2  6  
ATOM   8186  H  HE1  . HIS A 1 16  ? 21.332  -1.322  23.252  1.00 0.00 ? 373 HIS A HE1  6  
ATOM   8187  N  N    . TYR A 1 17  ? 21.111  -4.827  17.175  1.00 0.00 ? 374 TYR A N    6  
ATOM   8188  C  CA   . TYR A 1 17  ? 20.530  -5.369  15.952  1.00 0.00 ? 374 TYR A CA   6  
ATOM   8189  C  C    . TYR A 1 17  ? 19.057  -4.986  15.833  1.00 0.00 ? 374 TYR A C    6  
ATOM   8190  O  O    . TYR A 1 17  ? 18.214  -5.474  16.586  1.00 0.00 ? 374 TYR A O    6  
ATOM   8191  C  CB   . TYR A 1 17  ? 20.677  -6.891  15.923  1.00 0.00 ? 374 TYR A CB   6  
ATOM   8192  C  CG   . TYR A 1 17  ? 22.110  -7.363  16.012  1.00 0.00 ? 374 TYR A CG   6  
ATOM   8193  C  CD1  . TYR A 1 17  ? 22.936  -7.350  14.894  1.00 0.00 ? 374 TYR A CD1  6  
ATOM   8194  C  CD2  . TYR A 1 17  ? 22.639  -7.821  17.212  1.00 0.00 ? 374 TYR A CD2  6  
ATOM   8195  C  CE1  . TYR A 1 17  ? 24.247  -7.781  14.970  1.00 0.00 ? 374 TYR A CE1  6  
ATOM   8196  C  CE2  . TYR A 1 17  ? 23.949  -8.252  17.297  1.00 0.00 ? 374 TYR A CE2  6  
ATOM   8197  C  CZ   . TYR A 1 17  ? 24.749  -8.230  16.174  1.00 0.00 ? 374 TYR A CZ   6  
ATOM   8198  O  OH   . TYR A 1 17  ? 26.053  -8.660  16.254  1.00 0.00 ? 374 TYR A OH   6  
ATOM   8199  H  H    . TYR A 1 17  ? 20.847  -5.208  18.038  1.00 0.00 ? 374 TYR A H    6  
ATOM   8200  H  HA   . TYR A 1 17  ? 21.068  -4.949  15.115  1.00 0.00 ? 374 TYR A HA   6  
ATOM   8201  H  HB2  . TYR A 1 17  ? 20.137  -7.314  16.756  1.00 0.00 ? 374 TYR A HB2  6  
ATOM   8202  H  HB3  . TYR A 1 17  ? 20.259  -7.268  15.001  1.00 0.00 ? 374 TYR A HB3  6  
ATOM   8203  H  HD1  . TYR A 1 17  ? 22.541  -6.998  13.953  1.00 0.00 ? 374 TYR A HD1  6  
ATOM   8204  H  HD2  . TYR A 1 17  ? 22.010  -7.837  18.090  1.00 0.00 ? 374 TYR A HD2  6  
ATOM   8205  H  HE1  . TYR A 1 17  ? 24.874  -7.764  14.091  1.00 0.00 ? 374 TYR A HE1  6  
ATOM   8206  H  HE2  . TYR A 1 17  ? 24.342  -8.605  18.239  1.00 0.00 ? 374 TYR A HE2  6  
ATOM   8207  H  HH   . TYR A 1 17  ? 26.391  -8.824  15.371  1.00 0.00 ? 374 TYR A HH   6  
ATOM   8208  N  N    . CYS A 1 18  ? 18.756  -4.110  14.880  1.00 0.00 ? 375 CYS A N    6  
ATOM   8209  C  CA   . CYS A 1 18  ? 17.387  -3.661  14.659  1.00 0.00 ? 375 CYS A CA   6  
ATOM   8210  C  C    . CYS A 1 18  ? 16.397  -4.800  14.887  1.00 0.00 ? 375 CYS A C    6  
ATOM   8211  O  O    . CYS A 1 18  ? 16.598  -5.916  14.409  1.00 0.00 ? 375 CYS A O    6  
ATOM   8212  C  CB   . CYS A 1 18  ? 17.231  -3.112  13.240  1.00 0.00 ? 375 CYS A CB   6  
ATOM   8213  S  SG   . CYS A 1 18  ? 15.505  -2.792  12.751  1.00 0.00 ? 375 CYS A SG   6  
ATOM   8214  H  H    . CYS A 1 18  ? 19.473  -3.757  14.311  1.00 0.00 ? 375 CYS A H    6  
ATOM   8215  H  HA   . CYS A 1 18  ? 17.178  -2.872  15.366  1.00 0.00 ? 375 CYS A HA   6  
ATOM   8216  H  HB2  . CYS A 1 18  ? 17.771  -2.180  13.161  1.00 0.00 ? 375 CYS A HB2  6  
ATOM   8217  H  HB3  . CYS A 1 18  ? 17.645  -3.822  12.539  1.00 0.00 ? 375 CYS A HB3  6  
ATOM   8218  N  N    . ASP A 1 19  ? 15.328  -4.509  15.621  1.00 0.00 ? 376 ASP A N    6  
ATOM   8219  C  CA   . ASP A 1 19  ? 14.306  -5.507  15.912  1.00 0.00 ? 376 ASP A CA   6  
ATOM   8220  C  C    . ASP A 1 19  ? 13.089  -5.316  15.012  1.00 0.00 ? 376 ASP A C    6  
ATOM   8221  O  O    . ASP A 1 19  ? 11.949  -5.463  15.454  1.00 0.00 ? 376 ASP A O    6  
ATOM   8222  C  CB   . ASP A 1 19  ? 13.887  -5.426  17.380  1.00 0.00 ? 376 ASP A CB   6  
ATOM   8223  C  CG   . ASP A 1 19  ? 12.836  -6.457  17.740  1.00 0.00 ? 376 ASP A CG   6  
ATOM   8224  O  OD1  . ASP A 1 19  ? 13.073  -7.659  17.495  1.00 0.00 ? 376 ASP A OD1  6  
ATOM   8225  O  OD2  . ASP A 1 19  ? 11.775  -6.063  18.268  1.00 0.00 ? 376 ASP A OD2  6  
ATOM   8226  H  H    . ASP A 1 19  ? 15.224  -3.600  15.974  1.00 0.00 ? 376 ASP A H    6  
ATOM   8227  H  HA   . ASP A 1 19  ? 14.730  -6.481  15.721  1.00 0.00 ? 376 ASP A HA   6  
ATOM   8228  H  HB2  . ASP A 1 19  ? 14.754  -5.591  18.004  1.00 0.00 ? 376 ASP A HB2  6  
ATOM   8229  H  HB3  . ASP A 1 19  ? 13.486  -4.444  17.580  1.00 0.00 ? 376 ASP A HB3  6  
ATOM   8230  N  N    . TYR A 1 20  ? 13.338  -4.988  13.749  1.00 0.00 ? 377 TYR A N    6  
ATOM   8231  C  CA   . TYR A 1 20  ? 12.263  -4.774  12.788  1.00 0.00 ? 377 TYR A CA   6  
ATOM   8232  C  C    . TYR A 1 20  ? 12.319  -5.808  11.668  1.00 0.00 ? 377 TYR A C    6  
ATOM   8233  O  O    . TYR A 1 20  ? 13.385  -6.147  11.154  1.00 0.00 ? 377 TYR A O    6  
ATOM   8234  C  CB   . TYR A 1 20  ? 12.349  -3.364  12.201  1.00 0.00 ? 377 TYR A CB   6  
ATOM   8235  C  CG   . TYR A 1 20  ? 11.011  -2.801  11.779  1.00 0.00 ? 377 TYR A CG   6  
ATOM   8236  C  CD1  . TYR A 1 20  ? 9.972   -2.668  12.693  1.00 0.00 ? 377 TYR A CD1  6  
ATOM   8237  C  CD2  . TYR A 1 20  ? 10.784  -2.403  10.468  1.00 0.00 ? 377 TYR A CD2  6  
ATOM   8238  C  CE1  . TYR A 1 20  ? 8.747   -2.155  12.312  1.00 0.00 ? 377 TYR A CE1  6  
ATOM   8239  C  CE2  . TYR A 1 20  ? 9.563   -1.887  10.078  1.00 0.00 ? 377 TYR A CE2  6  
ATOM   8240  C  CZ   . TYR A 1 20  ? 8.548   -1.766  11.004  1.00 0.00 ? 377 TYR A CZ   6  
ATOM   8241  O  OH   . TYR A 1 20  ? 7.330   -1.254  10.620  1.00 0.00 ? 377 TYR A OH   6  
ATOM   8242  H  H    . TYR A 1 20  ? 14.268  -4.886  13.456  1.00 0.00 ? 377 TYR A H    6  
ATOM   8243  H  HA   . TYR A 1 20  ? 11.324  -4.878  13.312  1.00 0.00 ? 377 TYR A HA   6  
ATOM   8244  H  HB2  . TYR A 1 20  ? 12.770  -2.699  12.939  1.00 0.00 ? 377 TYR A HB2  6  
ATOM   8245  H  HB3  . TYR A 1 20  ? 12.990  -3.382  11.332  1.00 0.00 ? 377 TYR A HB3  6  
ATOM   8246  H  HD1  . TYR A 1 20  ? 10.131  -2.975  13.717  1.00 0.00 ? 377 TYR A HD1  6  
ATOM   8247  H  HD2  . TYR A 1 20  ? 11.582  -2.500  9.745   1.00 0.00 ? 377 TYR A HD2  6  
ATOM   8248  H  HE1  . TYR A 1 20  ? 7.952   -2.060  13.036  1.00 0.00 ? 377 TYR A HE1  6  
ATOM   8249  H  HE2  . TYR A 1 20  ? 9.407   -1.582  9.054   1.00 0.00 ? 377 TYR A HE2  6  
ATOM   8250  H  HH   . TYR A 1 20  ? 6.650   -1.554  11.228  1.00 0.00 ? 377 TYR A HH   6  
ATOM   8251  N  N    . PRO A 1 21  ? 11.143  -6.322  11.279  1.00 0.00 ? 378 PRO A N    6  
ATOM   8252  C  CA   . PRO A 1 21  ? 11.030  -7.324  10.215  1.00 0.00 ? 378 PRO A CA   6  
ATOM   8253  C  C    . PRO A 1 21  ? 11.344  -6.747  8.839   1.00 0.00 ? 378 PRO A C    6  
ATOM   8254  O  O    . PRO A 1 21  ? 10.825  -5.697  8.463   1.00 0.00 ? 378 PRO A O    6  
ATOM   8255  C  CB   . PRO A 1 21  ? 9.564   -7.758  10.291  1.00 0.00 ? 378 PRO A CB   6  
ATOM   8256  C  CG   . PRO A 1 21  ? 8.855   -6.595  10.895  1.00 0.00 ? 378 PRO A CG   6  
ATOM   8257  C  CD   . PRO A 1 21  ? 9.833   -5.964  11.848  1.00 0.00 ? 378 PRO A CD   6  
ATOM   8258  H  HA   . PRO A 1 21  ? 11.669  -8.175  10.402  1.00 0.00 ? 378 PRO A HA   6  
ATOM   8259  H  HB2  . PRO A 1 21  ? 9.197   -7.972  9.297   1.00 0.00 ? 378 PRO A HB2  6  
ATOM   8260  H  HB3  . PRO A 1 21  ? 9.477   -8.638  10.910  1.00 0.00 ? 378 PRO A HB3  6  
ATOM   8261  H  HG2  . PRO A 1 21  ? 8.577   -5.893  10.123  1.00 0.00 ? 378 PRO A HG2  6  
ATOM   8262  H  HG3  . PRO A 1 21  ? 7.980   -6.935  11.428  1.00 0.00 ? 378 PRO A HG3  6  
ATOM   8263  H  HD2  . PRO A 1 21  ? 9.701   -4.892  11.868  1.00 0.00 ? 378 PRO A HD2  6  
ATOM   8264  H  HD3  . PRO A 1 21  ? 9.716   -6.379  12.838  1.00 0.00 ? 378 PRO A HD3  6  
ATOM   8265  N  N    . GLY A 1 22  ? 12.197  -7.440  8.092   1.00 0.00 ? 379 GLY A N    6  
ATOM   8266  C  CA   . GLY A 1 22  ? 12.565  -6.981  6.766   1.00 0.00 ? 379 GLY A CA   6  
ATOM   8267  C  C    . GLY A 1 22  ? 13.780  -6.075  6.782   1.00 0.00 ? 379 GLY A C    6  
ATOM   8268  O  O    . GLY A 1 22  ? 14.671  -6.202  5.941   1.00 0.00 ? 379 GLY A O    6  
ATOM   8269  H  H    . GLY A 1 22  ? 12.580  -8.271  8.444   1.00 0.00 ? 379 GLY A H    6  
ATOM   8270  H  HA2  . GLY A 1 22  ? 12.777  -7.839  6.145   1.00 0.00 ? 379 GLY A HA2  6  
ATOM   8271  H  HA3  . GLY A 1 22  ? 11.732  -6.439  6.341   1.00 0.00 ? 379 GLY A HA3  6  
ATOM   8272  N  N    . CYS A 1 23  ? 13.818  -5.155  7.741   1.00 0.00 ? 380 CYS A N    6  
ATOM   8273  C  CA   . CYS A 1 23  ? 14.931  -4.222  7.863   1.00 0.00 ? 380 CYS A CA   6  
ATOM   8274  C  C    . CYS A 1 23  ? 16.170  -4.923  8.414   1.00 0.00 ? 380 CYS A C    6  
ATOM   8275  O  O    . CYS A 1 23  ? 16.090  -5.683  9.380   1.00 0.00 ? 380 CYS A O    6  
ATOM   8276  C  CB   . CYS A 1 23  ? 14.547  -3.053  8.772   1.00 0.00 ? 380 CYS A CB   6  
ATOM   8277  S  SG   . CYS A 1 23  ? 15.927  -1.930  9.163   1.00 0.00 ? 380 CYS A SG   6  
ATOM   8278  H  H    . CYS A 1 23  ? 13.078  -5.103  8.382   1.00 0.00 ? 380 CYS A H    6  
ATOM   8279  H  HA   . CYS A 1 23  ? 15.156  -3.843  6.878   1.00 0.00 ? 380 CYS A HA   6  
ATOM   8280  H  HB2  . CYS A 1 23  ? 13.777  -2.469  8.288   1.00 0.00 ? 380 CYS A HB2  6  
ATOM   8281  H  HB3  . CYS A 1 23  ? 14.164  -3.442  9.703   1.00 0.00 ? 380 CYS A HB3  6  
ATOM   8282  N  N    . THR A 1 24  ? 17.316  -4.662  7.794   1.00 0.00 ? 381 THR A N    6  
ATOM   8283  C  CA   . THR A 1 24  ? 18.572  -5.267  8.221   1.00 0.00 ? 381 THR A CA   6  
ATOM   8284  C  C    . THR A 1 24  ? 19.601  -4.201  8.581   1.00 0.00 ? 381 THR A C    6  
ATOM   8285  O  O    . THR A 1 24  ? 20.786  -4.339  8.277   1.00 0.00 ? 381 THR A O    6  
ATOM   8286  C  CB   . THR A 1 24  ? 19.156  -6.179  7.126   1.00 0.00 ? 381 THR A CB   6  
ATOM   8287  O  OG1  . THR A 1 24  ? 19.360  -5.431  5.922   1.00 0.00 ? 381 THR A OG1  6  
ATOM   8288  C  CG2  . THR A 1 24  ? 18.229  -7.353  6.848   1.00 0.00 ? 381 THR A CG2  6  
ATOM   8289  H  H    . THR A 1 24  ? 17.316  -4.047  7.030   1.00 0.00 ? 381 THR A H    6  
ATOM   8290  H  HA   . THR A 1 24  ? 18.371  -5.870  9.094   1.00 0.00 ? 381 THR A HA   6  
ATOM   8291  H  HB   . THR A 1 24  ? 20.107  -6.563  7.468   1.00 0.00 ? 381 THR A HB   6  
ATOM   8292  H  HG1  . THR A 1 24  ? 18.812  -4.643  5.938   1.00 0.00 ? 381 THR A HG1  6  
ATOM   8293  H  HG21 . THR A 1 24  ? 18.714  -8.042  6.173   1.00 0.00 ? 381 THR A HG21 6  
ATOM   8294  H  HG22 . THR A 1 24  ? 17.316  -6.992  6.399   1.00 0.00 ? 381 THR A HG22 6  
ATOM   8295  H  HG23 . THR A 1 24  ? 18.000  -7.858  7.775   1.00 0.00 ? 381 THR A HG23 6  
ATOM   8296  N  N    . LYS A 1 25  ? 19.141  -3.138  9.233   1.00 0.00 ? 382 LYS A N    6  
ATOM   8297  C  CA   . LYS A 1 25  ? 20.022  -2.049  9.638   1.00 0.00 ? 382 LYS A CA   6  
ATOM   8298  C  C    . LYS A 1 25  ? 20.527  -2.258  11.062  1.00 0.00 ? 382 LYS A C    6  
ATOM   8299  O  O    . LYS A 1 25  ? 19.778  -2.687  11.940  1.00 0.00 ? 382 LYS A O    6  
ATOM   8300  C  CB   . LYS A 1 25  ? 19.289  -0.709  9.537   1.00 0.00 ? 382 LYS A CB   6  
ATOM   8301  C  CG   . LYS A 1 25  ? 19.419  -0.046  8.176   1.00 0.00 ? 382 LYS A CG   6  
ATOM   8302  C  CD   . LYS A 1 25  ? 20.663  0.821   8.095   1.00 0.00 ? 382 LYS A CD   6  
ATOM   8303  C  CE   . LYS A 1 25  ? 20.748  1.551   6.763   1.00 0.00 ? 382 LYS A CE   6  
ATOM   8304  N  NZ   . LYS A 1 25  ? 21.223  0.658   5.670   1.00 0.00 ? 382 LYS A NZ   6  
ATOM   8305  H  H    . LYS A 1 25  ? 18.186  -3.085  9.447   1.00 0.00 ? 382 LYS A H    6  
ATOM   8306  H  HA   . LYS A 1 25  ? 20.867  -2.039  8.966   1.00 0.00 ? 382 LYS A HA   6  
ATOM   8307  H  HB2  . LYS A 1 25  ? 18.241  -0.870  9.738   1.00 0.00 ? 382 LYS A HB2  6  
ATOM   8308  H  HB3  . LYS A 1 25  ? 19.691  -0.036  10.281  1.00 0.00 ? 382 LYS A HB3  6  
ATOM   8309  H  HG2  . LYS A 1 25  ? 19.476  -0.811  7.417   1.00 0.00 ? 382 LYS A HG2  6  
ATOM   8310  H  HG3  . LYS A 1 25  ? 18.549  0.571   8.003   1.00 0.00 ? 382 LYS A HG3  6  
ATOM   8311  H  HD2  . LYS A 1 25  ? 20.637  1.551   8.891   1.00 0.00 ? 382 LYS A HD2  6  
ATOM   8312  H  HD3  . LYS A 1 25  ? 21.537  0.194   8.208   1.00 0.00 ? 382 LYS A HD3  6  
ATOM   8313  H  HE2  . LYS A 1 25  ? 19.768  1.926   6.510   1.00 0.00 ? 382 LYS A HE2  6  
ATOM   8314  H  HE3  . LYS A 1 25  ? 21.435  2.379   6.864   1.00 0.00 ? 382 LYS A HE3  6  
ATOM   8315  H  HZ1  . LYS A 1 25  ? 20.707  -0.244  5.696   1.00 0.00 ? 382 LYS A HZ1  6  
ATOM   8316  H  HZ2  . LYS A 1 25  ? 22.239  0.467   5.782   1.00 0.00 ? 382 LYS A HZ2  6  
ATOM   8317  H  HZ3  . LYS A 1 25  ? 21.066  1.109   4.747   1.00 0.00 ? 382 LYS A HZ3  6  
ATOM   8318  N  N    . VAL A 1 26  ? 21.801  -1.952  11.284  1.00 0.00 ? 383 VAL A N    6  
ATOM   8319  C  CA   . VAL A 1 26  ? 22.406  -2.104  12.602  1.00 0.00 ? 383 VAL A CA   6  
ATOM   8320  C  C    . VAL A 1 26  ? 23.270  -0.898  12.953  1.00 0.00 ? 383 VAL A C    6  
ATOM   8321  O  O    . VAL A 1 26  ? 23.738  -0.179  12.070  1.00 0.00 ? 383 VAL A O    6  
ATOM   8322  C  CB   . VAL A 1 26  ? 23.265  -3.379  12.682  1.00 0.00 ? 383 VAL A CB   6  
ATOM   8323  C  CG1  . VAL A 1 26  ? 22.414  -4.614  12.429  1.00 0.00 ? 383 VAL A CG1  6  
ATOM   8324  C  CG2  . VAL A 1 26  ? 24.419  -3.306  11.693  1.00 0.00 ? 383 VAL A CG2  6  
ATOM   8325  H  H    . VAL A 1 26  ? 22.348  -1.614  10.544  1.00 0.00 ? 383 VAL A H    6  
ATOM   8326  H  HA   . VAL A 1 26  ? 21.609  -2.186  13.327  1.00 0.00 ? 383 VAL A HA   6  
ATOM   8327  H  HB   . VAL A 1 26  ? 23.677  -3.450  13.678  1.00 0.00 ? 383 VAL A HB   6  
ATOM   8328  H  HG11 . VAL A 1 26  ? 21.579  -4.352  11.795  1.00 0.00 ? 383 VAL A HG11 6  
ATOM   8329  H  HG12 . VAL A 1 26  ? 23.012  -5.371  11.944  1.00 0.00 ? 383 VAL A HG12 6  
ATOM   8330  H  HG13 . VAL A 1 26  ? 22.045  -4.995  13.370  1.00 0.00 ? 383 VAL A HG13 6  
ATOM   8331  H  HG21 . VAL A 1 26  ? 24.121  -2.723  10.834  1.00 0.00 ? 383 VAL A HG21 6  
ATOM   8332  H  HG22 . VAL A 1 26  ? 25.270  -2.840  12.167  1.00 0.00 ? 383 VAL A HG22 6  
ATOM   8333  H  HG23 . VAL A 1 26  ? 24.686  -4.304  11.376  1.00 0.00 ? 383 VAL A HG23 6  
ATOM   8334  N  N    . TYR A 1 27  ? 23.479  -0.684  14.247  1.00 0.00 ? 384 TYR A N    6  
ATOM   8335  C  CA   . TYR A 1 27  ? 24.287  0.436   14.715  1.00 0.00 ? 384 TYR A CA   6  
ATOM   8336  C  C    . TYR A 1 27  ? 25.009  0.083   16.012  1.00 0.00 ? 384 TYR A C    6  
ATOM   8337  O  O    . TYR A 1 27  ? 24.388  -0.345  16.986  1.00 0.00 ? 384 TYR A O    6  
ATOM   8338  C  CB   . TYR A 1 27  ? 23.410  1.672   14.927  1.00 0.00 ? 384 TYR A CB   6  
ATOM   8339  C  CG   . TYR A 1 27  ? 22.735  2.158   13.664  1.00 0.00 ? 384 TYR A CG   6  
ATOM   8340  C  CD1  . TYR A 1 27  ? 21.608  1.517   13.164  1.00 0.00 ? 384 TYR A CD1  6  
ATOM   8341  C  CD2  . TYR A 1 27  ? 23.224  3.258   12.971  1.00 0.00 ? 384 TYR A CD2  6  
ATOM   8342  C  CE1  . TYR A 1 27  ? 20.988  1.958   12.011  1.00 0.00 ? 384 TYR A CE1  6  
ATOM   8343  C  CE2  . TYR A 1 27  ? 22.610  3.707   11.818  1.00 0.00 ? 384 TYR A CE2  6  
ATOM   8344  C  CZ   . TYR A 1 27  ? 21.492  3.053   11.342  1.00 0.00 ? 384 TYR A CZ   6  
ATOM   8345  O  OH   . TYR A 1 27  ? 20.878  3.496   10.193  1.00 0.00 ? 384 TYR A OH   6  
ATOM   8346  H  H    . TYR A 1 27  ? 23.080  -1.292  14.903  1.00 0.00 ? 384 TYR A H    6  
ATOM   8347  H  HA   . TYR A 1 27  ? 25.023  0.656   13.955  1.00 0.00 ? 384 TYR A HA   6  
ATOM   8348  H  HB2  . TYR A 1 27  ? 22.639  1.439   15.645  1.00 0.00 ? 384 TYR A HB2  6  
ATOM   8349  H  HB3  . TYR A 1 27  ? 24.020  2.477   15.309  1.00 0.00 ? 384 TYR A HB3  6  
ATOM   8350  H  HD1  . TYR A 1 27  ? 21.215  0.659   13.691  1.00 0.00 ? 384 TYR A HD1  6  
ATOM   8351  H  HD2  . TYR A 1 27  ? 24.100  3.768   13.346  1.00 0.00 ? 384 TYR A HD2  6  
ATOM   8352  H  HE1  . TYR A 1 27  ? 20.113  1.447   11.638  1.00 0.00 ? 384 TYR A HE1  6  
ATOM   8353  H  HE2  . TYR A 1 27  ? 23.005  4.564   11.293  1.00 0.00 ? 384 TYR A HE2  6  
ATOM   8354  H  HH   . TYR A 1 27  ? 21.051  4.434   10.079  1.00 0.00 ? 384 TYR A HH   6  
ATOM   8355  N  N    . THR A 1 28  ? 26.325  0.267   16.018  1.00 0.00 ? 385 THR A N    6  
ATOM   8356  C  CA   . THR A 1 28  ? 27.134  -0.032  17.193  1.00 0.00 ? 385 THR A CA   6  
ATOM   8357  C  C    . THR A 1 28  ? 26.618  0.712   18.419  1.00 0.00 ? 385 THR A C    6  
ATOM   8358  O  O    . THR A 1 28  ? 26.514  0.143   19.506  1.00 0.00 ? 385 THR A O    6  
ATOM   8359  C  CB   . THR A 1 28  ? 28.612  0.337   16.967  1.00 0.00 ? 385 THR A CB   6  
ATOM   8360  O  OG1  . THR A 1 28  ? 29.052  -0.158  15.697  1.00 0.00 ? 385 THR A OG1  6  
ATOM   8361  C  CG2  . THR A 1 28  ? 29.488  -0.236  18.071  1.00 0.00 ? 385 THR A CG2  6  
ATOM   8362  H  H    . THR A 1 28  ? 26.762  0.611   15.211  1.00 0.00 ? 385 THR A H    6  
ATOM   8363  H  HA   . THR A 1 28  ? 27.074  -1.095  17.377  1.00 0.00 ? 385 THR A HA   6  
ATOM   8364  H  HB   . THR A 1 28  ? 28.704  1.413   16.976  1.00 0.00 ? 385 THR A HB   6  
ATOM   8365  H  HG1  . THR A 1 28  ? 28.737  0.422   15.000  1.00 0.00 ? 385 THR A HG1  6  
ATOM   8366  H  HG21 . THR A 1 28  ? 29.531  0.462   18.894  1.00 0.00 ? 385 THR A HG21 6  
ATOM   8367  H  HG22 . THR A 1 28  ? 30.484  -0.404  17.690  1.00 0.00 ? 385 THR A HG22 6  
ATOM   8368  H  HG23 . THR A 1 28  ? 29.070  -1.171  18.414  1.00 0.00 ? 385 THR A HG23 6  
ATOM   8369  N  N    . LYS A 1 29  ? 26.294  1.988   18.238  1.00 0.00 ? 386 LYS A N    6  
ATOM   8370  C  CA   . LYS A 1 29  ? 25.786  2.811   19.329  1.00 0.00 ? 386 LYS A CA   6  
ATOM   8371  C  C    . LYS A 1 29  ? 24.261  2.787   19.364  1.00 0.00 ? 386 LYS A C    6  
ATOM   8372  O  O    . LYS A 1 29  ? 23.610  2.621   18.333  1.00 0.00 ? 386 LYS A O    6  
ATOM   8373  C  CB   . LYS A 1 29  ? 26.281  4.251   19.181  1.00 0.00 ? 386 LYS A CB   6  
ATOM   8374  C  CG   . LYS A 1 29  ? 27.669  4.479   19.755  1.00 0.00 ? 386 LYS A CG   6  
ATOM   8375  C  CD   . LYS A 1 29  ? 28.135  5.909   19.536  1.00 0.00 ? 386 LYS A CD   6  
ATOM   8376  C  CE   . LYS A 1 29  ? 28.759  6.088   18.161  1.00 0.00 ? 386 LYS A CE   6  
ATOM   8377  N  NZ   . LYS A 1 29  ? 29.391  7.427   18.008  1.00 0.00 ? 386 LYS A NZ   6  
ATOM   8378  H  H    . LYS A 1 29  ? 26.398  2.385   17.347  1.00 0.00 ? 386 LYS A H    6  
ATOM   8379  H  HA   . LYS A 1 29  ? 26.162  2.403   20.255  1.00 0.00 ? 386 LYS A HA   6  
ATOM   8380  H  HB2  . LYS A 1 29  ? 26.301  4.507   18.132  1.00 0.00 ? 386 LYS A HB2  6  
ATOM   8381  H  HB3  . LYS A 1 29  ? 25.592  4.910   19.690  1.00 0.00 ? 386 LYS A HB3  6  
ATOM   8382  H  HG2  . LYS A 1 29  ? 27.648  4.277   20.815  1.00 0.00 ? 386 LYS A HG2  6  
ATOM   8383  H  HG3  . LYS A 1 29  ? 28.363  3.806   19.272  1.00 0.00 ? 386 LYS A HG3  6  
ATOM   8384  H  HD2  . LYS A 1 29  ? 27.287  6.572   19.622  1.00 0.00 ? 386 LYS A HD2  6  
ATOM   8385  H  HD3  . LYS A 1 29  ? 28.868  6.159   20.290  1.00 0.00 ? 386 LYS A HD3  6  
ATOM   8386  H  HE2  . LYS A 1 29  ? 29.511  5.326   18.020  1.00 0.00 ? 386 LYS A HE2  6  
ATOM   8387  H  HE3  . LYS A 1 29  ? 27.989  5.975   17.413  1.00 0.00 ? 386 LYS A HE3  6  
ATOM   8388  H  HZ1  . LYS A 1 29  ? 30.427  7.333   17.981  1.00 0.00 ? 386 LYS A HZ1  6  
ATOM   8389  H  HZ2  . LYS A 1 29  ? 29.130  8.038   18.809  1.00 0.00 ? 386 LYS A HZ2  6  
ATOM   8390  H  HZ3  . LYS A 1 29  ? 29.071  7.875   17.126  1.00 0.00 ? 386 LYS A HZ3  6  
ATOM   8391  N  N    . SER A 1 30  ? 23.698  2.956   20.556  1.00 0.00 ? 387 SER A N    6  
ATOM   8392  C  CA   . SER A 1 30  ? 22.250  2.952   20.725  1.00 0.00 ? 387 SER A CA   6  
ATOM   8393  C  C    . SER A 1 30  ? 21.657  4.311   20.366  1.00 0.00 ? 387 SER A C    6  
ATOM   8394  O  O    . SER A 1 30  ? 20.676  4.397   19.627  1.00 0.00 ? 387 SER A O    6  
ATOM   8395  C  CB   . SER A 1 30  ? 21.885  2.588   22.166  1.00 0.00 ? 387 SER A CB   6  
ATOM   8396  O  OG   . SER A 1 30  ? 22.404  3.539   23.079  1.00 0.00 ? 387 SER A OG   6  
ATOM   8397  H  H    . SER A 1 30  ? 24.271  3.084   21.341  1.00 0.00 ? 387 SER A H    6  
ATOM   8398  H  HA   . SER A 1 30  ? 21.841  2.207   20.060  1.00 0.00 ? 387 SER A HA   6  
ATOM   8399  H  HB2  . SER A 1 30  ? 20.810  2.560   22.266  1.00 0.00 ? 387 SER A HB2  6  
ATOM   8400  H  HB3  . SER A 1 30  ? 22.294  1.617   22.404  1.00 0.00 ? 387 SER A HB3  6  
ATOM   8401  H  HG   . SER A 1 30  ? 23.272  3.825   22.785  1.00 0.00 ? 387 SER A HG   6  
ATOM   8402  N  N    . SER A 1 31  ? 22.260  5.371   20.895  1.00 0.00 ? 388 SER A N    6  
ATOM   8403  C  CA   . SER A 1 31  ? 21.790  6.727   20.634  1.00 0.00 ? 388 SER A CA   6  
ATOM   8404  C  C    . SER A 1 31  ? 21.376  6.887   19.174  1.00 0.00 ? 388 SER A C    6  
ATOM   8405  O  O    . SER A 1 31  ? 20.320  7.444   18.874  1.00 0.00 ? 388 SER A O    6  
ATOM   8406  C  CB   . SER A 1 31  ? 22.881  7.742   20.981  1.00 0.00 ? 388 SER A CB   6  
ATOM   8407  O  OG   . SER A 1 31  ? 22.509  9.048   20.575  1.00 0.00 ? 388 SER A OG   6  
ATOM   8408  H  H    . SER A 1 31  ? 23.038  5.238   21.476  1.00 0.00 ? 388 SER A H    6  
ATOM   8409  H  HA   . SER A 1 31  ? 20.930  6.906   21.262  1.00 0.00 ? 388 SER A HA   6  
ATOM   8410  H  HB2  . SER A 1 31  ? 23.042  7.743   22.048  1.00 0.00 ? 388 SER A HB2  6  
ATOM   8411  H  HB3  . SER A 1 31  ? 23.797  7.469   20.478  1.00 0.00 ? 388 SER A HB3  6  
ATOM   8412  H  HG   . SER A 1 31  ? 21.657  9.016   20.134  1.00 0.00 ? 388 SER A HG   6  
ATOM   8413  N  N    . HIS A 1 32  ? 22.217  6.394   18.270  1.00 0.00 ? 389 HIS A N    6  
ATOM   8414  C  CA   . HIS A 1 32  ? 21.939  6.481   16.840  1.00 0.00 ? 389 HIS A CA   6  
ATOM   8415  C  C    . HIS A 1 32  ? 20.755  5.596   16.462  1.00 0.00 ? 389 HIS A C    6  
ATOM   8416  O  O    . HIS A 1 32  ? 19.835  6.034   15.770  1.00 0.00 ? 389 HIS A O    6  
ATOM   8417  C  CB   . HIS A 1 32  ? 23.173  6.075   16.034  1.00 0.00 ? 389 HIS A CB   6  
ATOM   8418  C  CG   . HIS A 1 32  ? 24.253  7.112   16.029  1.00 0.00 ? 389 HIS A CG   6  
ATOM   8419  N  ND1  . HIS A 1 32  ? 25.576  6.819   15.770  1.00 0.00 ? 389 HIS A ND1  6  
ATOM   8420  C  CD2  . HIS A 1 32  ? 24.201  8.446   16.252  1.00 0.00 ? 389 HIS A CD2  6  
ATOM   8421  C  CE1  . HIS A 1 32  ? 26.291  7.928   15.835  1.00 0.00 ? 389 HIS A CE1  6  
ATOM   8422  N  NE2  . HIS A 1 32  ? 25.480  8.930   16.126  1.00 0.00 ? 389 HIS A NE2  6  
ATOM   8423  H  H    . HIS A 1 32  ? 23.043  5.961   18.571  1.00 0.00 ? 389 HIS A H    6  
ATOM   8424  H  HA   . HIS A 1 32  ? 21.693  7.507   16.613  1.00 0.00 ? 389 HIS A HA   6  
ATOM   8425  H  HB2  . HIS A 1 32  ? 23.585  5.168   16.452  1.00 0.00 ? 389 HIS A HB2  6  
ATOM   8426  H  HB3  . HIS A 1 32  ? 22.881  5.893   15.010  1.00 0.00 ? 389 HIS A HB3  6  
ATOM   8427  H  HD1  . HIS A 1 32  ? 25.937  5.931   15.570  1.00 0.00 ? 389 HIS A HD1  6  
ATOM   8428  H  HD2  . HIS A 1 32  ? 23.318  9.023   16.486  1.00 0.00 ? 389 HIS A HD2  6  
ATOM   8429  H  HE1  . HIS A 1 32  ? 27.356  8.004   15.678  1.00 0.00 ? 389 HIS A HE1  6  
ATOM   8430  N  N    . LEU A 1 33  ? 20.785  4.349   16.920  1.00 0.00 ? 390 LEU A N    6  
ATOM   8431  C  CA   . LEU A 1 33  ? 19.714  3.402   16.629  1.00 0.00 ? 390 LEU A CA   6  
ATOM   8432  C  C    . LEU A 1 33  ? 18.347  4.055   16.804  1.00 0.00 ? 390 LEU A C    6  
ATOM   8433  O  O    . LEU A 1 33  ? 17.482  3.954   15.934  1.00 0.00 ? 390 LEU A O    6  
ATOM   8434  C  CB   . LEU A 1 33  ? 19.828  2.178   17.540  1.00 0.00 ? 390 LEU A CB   6  
ATOM   8435  C  CG   . LEU A 1 33  ? 18.657  1.196   17.494  1.00 0.00 ? 390 LEU A CG   6  
ATOM   8436  C  CD1  . LEU A 1 33  ? 18.632  0.457   16.166  1.00 0.00 ? 390 LEU A CD1  6  
ATOM   8437  C  CD2  . LEU A 1 33  ? 18.740  0.213   18.653  1.00 0.00 ? 390 LEU A CD2  6  
ATOM   8438  H  H    . LEU A 1 33  ? 21.543  4.058   17.467  1.00 0.00 ? 390 LEU A H    6  
ATOM   8439  H  HA   . LEU A 1 33  ? 19.821  3.087   15.602  1.00 0.00 ? 390 LEU A HA   6  
ATOM   8440  H  HB2  . LEU A 1 33  ? 20.721  1.640   17.261  1.00 0.00 ? 390 LEU A HB2  6  
ATOM   8441  H  HB3  . LEU A 1 33  ? 19.926  2.532   18.557  1.00 0.00 ? 390 LEU A HB3  6  
ATOM   8442  H  HG   . LEU A 1 33  ? 17.730  1.746   17.587  1.00 0.00 ? 390 LEU A HG   6  
ATOM   8443  H  HD11 . LEU A 1 33  ? 19.503  -0.175  16.089  1.00 0.00 ? 390 LEU A HD11 6  
ATOM   8444  H  HD12 . LEU A 1 33  ? 18.633  1.172   15.356  1.00 0.00 ? 390 LEU A HD12 6  
ATOM   8445  H  HD13 . LEU A 1 33  ? 17.740  -0.150  16.108  1.00 0.00 ? 390 LEU A HD13 6  
ATOM   8446  H  HD21 . LEU A 1 33  ? 17.803  -0.316  18.744  1.00 0.00 ? 390 LEU A HD21 6  
ATOM   8447  H  HD22 . LEU A 1 33  ? 18.941  0.751   19.567  1.00 0.00 ? 390 LEU A HD22 6  
ATOM   8448  H  HD23 . LEU A 1 33  ? 19.537  -0.494  18.468  1.00 0.00 ? 390 LEU A HD23 6  
ATOM   8449  N  N    . LYS A 1 34  ? 18.158  4.726   17.935  1.00 0.00 ? 391 LYS A N    6  
ATOM   8450  C  CA   . LYS A 1 34  ? 16.897  5.400   18.225  1.00 0.00 ? 391 LYS A CA   6  
ATOM   8451  C  C    . LYS A 1 34  ? 16.379  6.136   16.994  1.00 0.00 ? 391 LYS A C    6  
ATOM   8452  O  O    . LYS A 1 34  ? 15.213  6.001   16.623  1.00 0.00 ? 391 LYS A O    6  
ATOM   8453  C  CB   . LYS A 1 34  ? 17.075  6.383   19.384  1.00 0.00 ? 391 LYS A CB   6  
ATOM   8454  C  CG   . LYS A 1 34  ? 16.774  5.780   20.745  1.00 0.00 ? 391 LYS A CG   6  
ATOM   8455  C  CD   . LYS A 1 34  ? 17.888  4.854   21.203  1.00 0.00 ? 391 LYS A CD   6  
ATOM   8456  C  CE   . LYS A 1 34  ? 17.408  3.897   22.284  1.00 0.00 ? 391 LYS A CE   6  
ATOM   8457  N  NZ   . LYS A 1 34  ? 17.579  4.471   23.648  1.00 0.00 ? 391 LYS A NZ   6  
ATOM   8458  H  H    . LYS A 1 34  ? 18.885  4.771   18.591  1.00 0.00 ? 391 LYS A H    6  
ATOM   8459  H  HA   . LYS A 1 34  ? 16.177  4.647   18.509  1.00 0.00 ? 391 LYS A HA   6  
ATOM   8460  H  HB2  . LYS A 1 34  ? 18.096  6.736   19.387  1.00 0.00 ? 391 LYS A HB2  6  
ATOM   8461  H  HB3  . LYS A 1 34  ? 16.413  7.223   19.231  1.00 0.00 ? 391 LYS A HB3  6  
ATOM   8462  H  HG2  . LYS A 1 34  ? 16.663  6.576   21.465  1.00 0.00 ? 391 LYS A HG2  6  
ATOM   8463  H  HG3  . LYS A 1 34  ? 15.853  5.217   20.683  1.00 0.00 ? 391 LYS A HG3  6  
ATOM   8464  H  HD2  . LYS A 1 34  ? 18.237  4.279   20.359  1.00 0.00 ? 391 LYS A HD2  6  
ATOM   8465  H  HD3  . LYS A 1 34  ? 18.700  5.450   21.596  1.00 0.00 ? 391 LYS A HD3  6  
ATOM   8466  H  HE2  . LYS A 1 34  ? 16.363  3.685   22.120  1.00 0.00 ? 391 LYS A HE2  6  
ATOM   8467  H  HE3  . LYS A 1 34  ? 17.977  2.982   22.214  1.00 0.00 ? 391 LYS A HE3  6  
ATOM   8468  H  HZ1  . LYS A 1 34  ? 18.285  5.233   23.629  1.00 0.00 ? 391 LYS A HZ1  6  
ATOM   8469  H  HZ2  . LYS A 1 34  ? 17.898  3.733   24.308  1.00 0.00 ? 391 LYS A HZ2  6  
ATOM   8470  H  HZ3  . LYS A 1 34  ? 16.675  4.857   23.988  1.00 0.00 ? 391 LYS A HZ3  6  
ATOM   8471  N  N    . ALA A 1 35  ? 17.253  6.914   16.364  1.00 0.00 ? 392 ALA A N    6  
ATOM   8472  C  CA   . ALA A 1 35  ? 16.884  7.669   15.173  1.00 0.00 ? 392 ALA A CA   6  
ATOM   8473  C  C    . ALA A 1 35  ? 16.493  6.737   14.031  1.00 0.00 ? 392 ALA A C    6  
ATOM   8474  O  O    . ALA A 1 35  ? 15.440  6.902   13.415  1.00 0.00 ? 392 ALA A O    6  
ATOM   8475  C  CB   . ALA A 1 35  ? 18.029  8.576   14.747  1.00 0.00 ? 392 ALA A CB   6  
ATOM   8476  H  H    . ALA A 1 35  ? 18.168  6.981   16.707  1.00 0.00 ? 392 ALA A H    6  
ATOM   8477  H  HA   . ALA A 1 35  ? 16.038  8.293   15.422  1.00 0.00 ? 392 ALA A HA   6  
ATOM   8478  H  HB1  . ALA A 1 35  ? 18.926  8.298   15.280  1.00 0.00 ? 392 ALA A HB1  6  
ATOM   8479  H  HB2  . ALA A 1 35  ? 18.195  8.471   13.684  1.00 0.00 ? 392 ALA A HB2  6  
ATOM   8480  H  HB3  . ALA A 1 35  ? 17.779  9.602   14.973  1.00 0.00 ? 392 ALA A HB3  6  
ATOM   8481  N  N    . HIS A 1 36  ? 17.347  5.757   13.754  1.00 0.00 ? 393 HIS A N    6  
ATOM   8482  C  CA   . HIS A 1 36  ? 17.090  4.798   12.685  1.00 0.00 ? 393 HIS A CA   6  
ATOM   8483  C  C    . HIS A 1 36  ? 15.693  4.200   12.817  1.00 0.00 ? 393 HIS A C    6  
ATOM   8484  O  O    . HIS A 1 36  ? 14.988  4.019   11.823  1.00 0.00 ? 393 HIS A O    6  
ATOM   8485  C  CB   . HIS A 1 36  ? 18.138  3.685   12.707  1.00 0.00 ? 393 HIS A CB   6  
ATOM   8486  C  CG   . HIS A 1 36  ? 17.655  2.396   12.118  1.00 0.00 ? 393 HIS A CG   6  
ATOM   8487  N  ND1  . HIS A 1 36  ? 17.416  2.226   10.771  1.00 0.00 ? 393 HIS A ND1  6  
ATOM   8488  C  CD2  . HIS A 1 36  ? 17.367  1.209   12.702  1.00 0.00 ? 393 HIS A CD2  6  
ATOM   8489  C  CE1  . HIS A 1 36  ? 17.001  0.992   10.552  1.00 0.00 ? 393 HIS A CE1  6  
ATOM   8490  N  NE2  . HIS A 1 36  ? 16.962  0.353   11.707  1.00 0.00 ? 393 HIS A NE2  6  
ATOM   8491  H  H    . HIS A 1 36  ? 18.170  5.678   14.280  1.00 0.00 ? 393 HIS A H    6  
ATOM   8492  H  HA   . HIS A 1 36  ? 17.156  5.324   11.745  1.00 0.00 ? 393 HIS A HA   6  
ATOM   8493  H  HB2  . HIS A 1 36  ? 19.003  4.003   12.143  1.00 0.00 ? 393 HIS A HB2  6  
ATOM   8494  H  HB3  . HIS A 1 36  ? 18.431  3.495   13.730  1.00 0.00 ? 393 HIS A HB3  6  
ATOM   8495  H  HD1  . HIS A 1 36  ? 17.532  2.910   10.079  1.00 0.00 ? 393 HIS A HD1  6  
ATOM   8496  H  HD2  . HIS A 1 36  ? 17.441  0.977   13.756  1.00 0.00 ? 393 HIS A HD2  6  
ATOM   8497  H  HE1  . HIS A 1 36  ? 16.737  0.574   9.591   1.00 0.00 ? 393 HIS A HE1  6  
ATOM   8498  N  N    . LEU A 1 37  ? 15.299  3.895   14.048  1.00 0.00 ? 394 LEU A N    6  
ATOM   8499  C  CA   . LEU A 1 37  ? 13.986  3.316   14.310  1.00 0.00 ? 394 LEU A CA   6  
ATOM   8500  C  C    . LEU A 1 37  ? 12.875  4.263   13.866  1.00 0.00 ? 394 LEU A C    6  
ATOM   8501  O  O    . LEU A 1 37  ? 11.754  3.834   13.591  1.00 0.00 ? 394 LEU A O    6  
ATOM   8502  C  CB   . LEU A 1 37  ? 13.834  2.998   15.799  1.00 0.00 ? 394 LEU A CB   6  
ATOM   8503  C  CG   . LEU A 1 37  ? 14.388  1.647   16.256  1.00 0.00 ? 394 LEU A CG   6  
ATOM   8504  C  CD1  . LEU A 1 37  ? 14.406  1.564   17.774  1.00 0.00 ? 394 LEU A CD1  6  
ATOM   8505  C  CD2  . LEU A 1 37  ? 13.568  0.509   15.667  1.00 0.00 ? 394 LEU A CD2  6  
ATOM   8506  H  H    . LEU A 1 37  ? 15.904  4.062   14.800  1.00 0.00 ? 394 LEU A H    6  
ATOM   8507  H  HA   . LEU A 1 37  ? 13.909  2.400   13.744  1.00 0.00 ? 394 LEU A HA   6  
ATOM   8508  H  HB2  . LEU A 1 37  ? 14.344  3.769   16.355  1.00 0.00 ? 394 LEU A HB2  6  
ATOM   8509  H  HB3  . LEU A 1 37  ? 12.780  3.022   16.036  1.00 0.00 ? 394 LEU A HB3  6  
ATOM   8510  H  HG   . LEU A 1 37  ? 15.405  1.545   15.904  1.00 0.00 ? 394 LEU A HG   6  
ATOM   8511  H  HD11 . LEU A 1 37  ? 13.452  1.886   18.164  1.00 0.00 ? 394 LEU A HD11 6  
ATOM   8512  H  HD12 . LEU A 1 37  ? 15.186  2.203   18.160  1.00 0.00 ? 394 LEU A HD12 6  
ATOM   8513  H  HD13 . LEU A 1 37  ? 14.593  0.544   18.076  1.00 0.00 ? 394 LEU A HD13 6  
ATOM   8514  H  HD21 . LEU A 1 37  ? 13.282  -0.173  16.454  1.00 0.00 ? 394 LEU A HD21 6  
ATOM   8515  H  HD22 . LEU A 1 37  ? 14.159  -0.017  14.932  1.00 0.00 ? 394 LEU A HD22 6  
ATOM   8516  H  HD23 . LEU A 1 37  ? 12.681  0.909   15.197  1.00 0.00 ? 394 LEU A HD23 6  
ATOM   8517  N  N    . ARG A 1 38  ? 13.195  5.551   13.794  1.00 0.00 ? 395 ARG A N    6  
ATOM   8518  C  CA   . ARG A 1 38  ? 12.225  6.557   13.382  1.00 0.00 ? 395 ARG A CA   6  
ATOM   8519  C  C    . ARG A 1 38  ? 11.623  6.208   12.024  1.00 0.00 ? 395 ARG A C    6  
ATOM   8520  O  O    . ARG A 1 38  ? 10.436  6.430   11.783  1.00 0.00 ? 395 ARG A O    6  
ATOM   8521  C  CB   . ARG A 1 38  ? 12.884  7.936   13.320  1.00 0.00 ? 395 ARG A CB   6  
ATOM   8522  C  CG   . ARG A 1 38  ? 13.471  8.391   14.646  1.00 0.00 ? 395 ARG A CG   6  
ATOM   8523  C  CD   . ARG A 1 38  ? 12.384  8.641   15.680  1.00 0.00 ? 395 ARG A CD   6  
ATOM   8524  N  NE   . ARG A 1 38  ? 11.565  9.803   15.344  1.00 0.00 ? 395 ARG A NE   6  
ATOM   8525  C  CZ   . ARG A 1 38  ? 11.883  11.048  15.681  1.00 0.00 ? 395 ARG A CZ   6  
ATOM   8526  N  NH1  . ARG A 1 38  ? 12.996  11.291  16.359  1.00 0.00 ? 395 ARG A NH1  6  
ATOM   8527  N  NH2  . ARG A 1 38  ? 11.087  12.052  15.338  1.00 0.00 ? 395 ARG A NH2  6  
ATOM   8528  H  H    . ARG A 1 38  ? 14.106  5.831   14.026  1.00 0.00 ? 395 ARG A H    6  
ATOM   8529  H  HA   . ARG A 1 38  ? 11.435  6.578   14.118  1.00 0.00 ? 395 ARG A HA   6  
ATOM   8530  H  HB2  . ARG A 1 38  ? 13.680  7.910   12.590  1.00 0.00 ? 395 ARG A HB2  6  
ATOM   8531  H  HB3  . ARG A 1 38  ? 12.146  8.661   13.011  1.00 0.00 ? 395 ARG A HB3  6  
ATOM   8532  H  HG2  . ARG A 1 38  ? 14.136  7.625   15.017  1.00 0.00 ? 395 ARG A HG2  6  
ATOM   8533  H  HG3  . ARG A 1 38  ? 14.024  9.305   14.490  1.00 0.00 ? 395 ARG A HG3  6  
ATOM   8534  H  HD2  . ARG A 1 38  ? 11.750  7.769   15.734  1.00 0.00 ? 395 ARG A HD2  6  
ATOM   8535  H  HD3  . ARG A 1 38  ? 12.850  8.806   16.640  1.00 0.00 ? 395 ARG A HD3  6  
ATOM   8536  H  HE   . ARG A 1 38  ? 10.739  9.645   14.843  1.00 0.00 ? 395 ARG A HE   6  
ATOM   8537  H  HH11 . ARG A 1 38  ? 13.598  10.536  16.618  1.00 0.00 ? 395 ARG A HH11 6  
ATOM   8538  H  HH12 . ARG A 1 38  ? 13.233  12.230  16.611  1.00 0.00 ? 395 ARG A HH12 6  
ATOM   8539  H  HH21 . ARG A 1 38  ? 10.247  11.873  14.827  1.00 0.00 ? 395 ARG A HH21 6  
ATOM   8540  H  HH22 . ARG A 1 38  ? 11.326  12.989  15.593  1.00 0.00 ? 395 ARG A HH22 6  
ATOM   8541  N  N    . THR A 1 39  ? 12.450  5.661   11.139  1.00 0.00 ? 396 THR A N    6  
ATOM   8542  C  CA   . THR A 1 39  ? 12.001  5.283   9.805   1.00 0.00 ? 396 THR A CA   6  
ATOM   8543  C  C    . THR A 1 39  ? 10.857  4.278   9.875   1.00 0.00 ? 396 THR A C    6  
ATOM   8544  O  O    . THR A 1 39  ? 9.996   4.240   8.995   1.00 0.00 ? 396 THR A O    6  
ATOM   8545  C  CB   . THR A 1 39  ? 13.150  4.679   8.975   1.00 0.00 ? 396 THR A CB   6  
ATOM   8546  O  OG1  . THR A 1 39  ? 13.616  3.472   9.589   1.00 0.00 ? 396 THR A OG1  6  
ATOM   8547  C  CG2  . THR A 1 39  ? 14.300  5.666   8.846   1.00 0.00 ? 396 THR A CG2  6  
ATOM   8548  H  H    . THR A 1 39  ? 13.385  5.510   11.390  1.00 0.00 ? 396 THR A H    6  
ATOM   8549  H  HA   . THR A 1 39  ? 11.653  6.175   9.304   1.00 0.00 ? 396 THR A HA   6  
ATOM   8550  H  HB   . THR A 1 39  ? 12.778  4.451   7.986   1.00 0.00 ? 396 THR A HB   6  
ATOM   8551  H  HG1  . THR A 1 39  ? 12.912  2.819   9.584   1.00 0.00 ? 396 THR A HG1  6  
ATOM   8552  H  HG21 . THR A 1 39  ? 15.185  5.248   9.303   1.00 0.00 ? 396 THR A HG21 6  
ATOM   8553  H  HG22 . THR A 1 39  ? 14.041  6.589   9.343   1.00 0.00 ? 396 THR A HG22 6  
ATOM   8554  H  HG23 . THR A 1 39  ? 14.492  5.860   7.802   1.00 0.00 ? 396 THR A HG23 6  
ATOM   8555  N  N    . HIS A 1 40  ? 10.853  3.465   10.926  1.00 0.00 ? 397 HIS A N    6  
ATOM   8556  C  CA   . HIS A 1 40  ? 9.813   2.459   11.111  1.00 0.00 ? 397 HIS A CA   6  
ATOM   8557  C  C    . HIS A 1 40  ? 8.588   3.063   11.792  1.00 0.00 ? 397 HIS A C    6  
ATOM   8558  O  O    . HIS A 1 40  ? 7.670   2.346   12.193  1.00 0.00 ? 397 HIS A O    6  
ATOM   8559  C  CB   . HIS A 1 40  ? 10.346  1.289   11.939  1.00 0.00 ? 397 HIS A CB   6  
ATOM   8560  C  CG   . HIS A 1 40  ? 11.661  0.762   11.453  1.00 0.00 ? 397 HIS A CG   6  
ATOM   8561  N  ND1  . HIS A 1 40  ? 11.916  0.480   10.128  1.00 0.00 ? 397 HIS A ND1  6  
ATOM   8562  C  CD2  . HIS A 1 40  ? 12.799  0.468   12.124  1.00 0.00 ? 397 HIS A CD2  6  
ATOM   8563  C  CE1  . HIS A 1 40  ? 13.153  0.033   10.005  1.00 0.00 ? 397 HIS A CE1  6  
ATOM   8564  N  NE2  . HIS A 1 40  ? 13.711  0.017   11.202  1.00 0.00 ? 397 HIS A NE2  6  
ATOM   8565  H  H    . HIS A 1 40  ? 11.566  3.543   11.593  1.00 0.00 ? 397 HIS A H    6  
ATOM   8566  H  HA   . HIS A 1 40  ? 9.525   2.097   10.136  1.00 0.00 ? 397 HIS A HA   6  
ATOM   8567  H  HB2  . HIS A 1 40  ? 10.475  1.610   12.962  1.00 0.00 ? 397 HIS A HB2  6  
ATOM   8568  H  HB3  . HIS A 1 40  ? 9.631   0.479   11.908  1.00 0.00 ? 397 HIS A HB3  6  
ATOM   8569  H  HD1  . HIS A 1 40  ? 11.283  0.589   9.388   1.00 0.00 ? 397 HIS A HD1  6  
ATOM   8570  H  HD2  . HIS A 1 40  ? 12.961  0.569   13.188  1.00 0.00 ? 397 HIS A HD2  6  
ATOM   8571  H  HE1  . HIS A 1 40  ? 13.628  -0.267  9.083   1.00 0.00 ? 397 HIS A HE1  6  
ATOM   8572  N  N    . THR A 1 41  ? 8.581   4.386   11.921  1.00 0.00 ? 398 THR A N    6  
ATOM   8573  C  CA   . THR A 1 41  ? 7.471   5.086   12.555  1.00 0.00 ? 398 THR A CA   6  
ATOM   8574  C  C    . THR A 1 41  ? 6.695   5.918   11.541  1.00 0.00 ? 398 THR A C    6  
ATOM   8575  O  O    . THR A 1 41  ? 6.982   7.098   11.341  1.00 0.00 ? 398 THR A O    6  
ATOM   8576  C  CB   . THR A 1 41  ? 7.961   6.006   13.689  1.00 0.00 ? 398 THR A CB   6  
ATOM   8577  O  OG1  . THR A 1 41  ? 8.642   5.235   14.685  1.00 0.00 ? 398 THR A OG1  6  
ATOM   8578  C  CG2  . THR A 1 41  ? 6.796   6.750   14.324  1.00 0.00 ? 398 THR A CG2  6  
ATOM   8579  H  H    . THR A 1 41  ? 9.341   4.902   11.581  1.00 0.00 ? 398 THR A H    6  
ATOM   8580  H  HA   . THR A 1 41  ? 6.809   4.346   12.981  1.00 0.00 ? 398 THR A HA   6  
ATOM   8581  H  HB   . THR A 1 41  ? 8.648   6.730   13.273  1.00 0.00 ? 398 THR A HB   6  
ATOM   8582  H  HG1  . THR A 1 41  ? 9.562   5.507   14.727  1.00 0.00 ? 398 THR A HG1  6  
ATOM   8583  H  HG21 . THR A 1 41  ? 6.706   7.728   13.876  1.00 0.00 ? 398 THR A HG21 6  
ATOM   8584  H  HG22 . THR A 1 41  ? 6.972   6.856   15.385  1.00 0.00 ? 398 THR A HG22 6  
ATOM   8585  H  HG23 . THR A 1 41  ? 5.884   6.195   14.164  1.00 0.00 ? 398 THR A HG23 6  
ATOM   8586  N  N    . GLY A 1 42  ? 5.708   5.296   10.903  1.00 0.00 ? 399 GLY A N    6  
ATOM   8587  C  CA   . GLY A 1 42  ? 4.904   5.995   9.917   1.00 0.00 ? 399 GLY A CA   6  
ATOM   8588  C  C    . GLY A 1 42  ? 5.737   6.552   8.779   1.00 0.00 ? 399 GLY A C    6  
ATOM   8589  O  O    . GLY A 1 42  ? 6.270   5.797   7.966   1.00 0.00 ? 399 GLY A O    6  
ATOM   8590  H  H    . GLY A 1 42  ? 5.523   4.354   11.103  1.00 0.00 ? 399 GLY A H    6  
ATOM   8591  H  HA2  . GLY A 1 42  ? 4.173   5.311   9.513   1.00 0.00 ? 399 GLY A HA2  6  
ATOM   8592  H  HA3  . GLY A 1 42  ? 4.389   6.811   10.403  1.00 0.00 ? 399 GLY A HA3  6  
ATOM   8593  N  N    . GLU A 1 43  ? 5.848   7.875   8.721   1.00 0.00 ? 400 GLU A N    6  
ATOM   8594  C  CA   . GLU A 1 43  ? 6.620   8.531   7.672   1.00 0.00 ? 400 GLU A CA   6  
ATOM   8595  C  C    . GLU A 1 43  ? 6.740   10.028  7.940   1.00 0.00 ? 400 GLU A C    6  
ATOM   8596  O  O    . GLU A 1 43  ? 6.099   10.562  8.845   1.00 0.00 ? 400 GLU A O    6  
ATOM   8597  C  CB   . GLU A 1 43  ? 5.970   8.296   6.307   1.00 0.00 ? 400 GLU A CB   6  
ATOM   8598  C  CG   . GLU A 1 43  ? 4.453   8.229   6.359   1.00 0.00 ? 400 GLU A CG   6  
ATOM   8599  C  CD   . GLU A 1 43  ? 3.804   8.699   5.072   1.00 0.00 ? 400 GLU A CD   6  
ATOM   8600  O  OE1  . GLU A 1 43  ? 3.995   9.877   4.706   1.00 0.00 ? 400 GLU A OE1  6  
ATOM   8601  O  OE2  . GLU A 1 43  ? 3.104   7.887   4.430   1.00 0.00 ? 400 GLU A OE2  6  
ATOM   8602  H  H    . GLU A 1 43  ? 5.400   8.423   9.398   1.00 0.00 ? 400 GLU A H    6  
ATOM   8603  H  HA   . GLU A 1 43  ? 7.609   8.098   7.668   1.00 0.00 ? 400 GLU A HA   6  
ATOM   8604  H  HB2  . GLU A 1 43  ? 6.252   9.101   5.644   1.00 0.00 ? 400 GLU A HB2  6  
ATOM   8605  H  HB3  . GLU A 1 43  ? 6.337   7.364   5.903   1.00 0.00 ? 400 GLU A HB3  6  
ATOM   8606  H  HG2  . GLU A 1 43  ? 4.157   7.206   6.541   1.00 0.00 ? 400 GLU A HG2  6  
ATOM   8607  H  HG3  . GLU A 1 43  ? 4.105   8.852   7.169   1.00 0.00 ? 400 GLU A HG3  6  
ATOM   8608  N  N    . LYS A 1 44  ? 7.567   10.701  7.147   1.00 0.00 ? 401 LYS A N    6  
ATOM   8609  C  CA   . LYS A 1 44  ? 7.772   12.137  7.296   1.00 0.00 ? 401 LYS A CA   6  
ATOM   8610  C  C    . LYS A 1 44  ? 7.540   12.860  5.973   1.00 0.00 ? 401 LYS A C    6  
ATOM   8611  O  O    . LYS A 1 44  ? 8.473   13.326  5.320   1.00 0.00 ? 401 LYS A O    6  
ATOM   8612  C  CB   . LYS A 1 44  ? 9.189   12.420  7.802   1.00 0.00 ? 401 LYS A CB   6  
ATOM   8613  C  CG   . LYS A 1 44  ? 9.359   12.189  9.293   1.00 0.00 ? 401 LYS A CG   6  
ATOM   8614  C  CD   . LYS A 1 44  ? 10.813  12.324  9.716   1.00 0.00 ? 401 LYS A CD   6  
ATOM   8615  C  CE   . LYS A 1 44  ? 11.126  11.452  10.921  1.00 0.00 ? 401 LYS A CE   6  
ATOM   8616  N  NZ   . LYS A 1 44  ? 12.248  12.004  11.729  1.00 0.00 ? 401 LYS A NZ   6  
ATOM   8617  H  H    . LYS A 1 44  ? 8.051   10.219  6.442   1.00 0.00 ? 401 LYS A H    6  
ATOM   8618  H  HA   . LYS A 1 44  ? 7.061   12.500  8.021   1.00 0.00 ? 401 LYS A HA   6  
ATOM   8619  H  HB2  . LYS A 1 44  ? 9.881   11.778  7.277   1.00 0.00 ? 401 LYS A HB2  6  
ATOM   8620  H  HB3  . LYS A 1 44  ? 9.435   13.451  7.588   1.00 0.00 ? 401 LYS A HB3  6  
ATOM   8621  H  HG2  . LYS A 1 44  ? 8.770   12.917  9.831   1.00 0.00 ? 401 LYS A HG2  6  
ATOM   8622  H  HG3  . LYS A 1 44  ? 9.014   11.194  9.536   1.00 0.00 ? 401 LYS A HG3  6  
ATOM   8623  H  HD2  . LYS A 1 44  ? 11.447  12.025  8.894   1.00 0.00 ? 401 LYS A HD2  6  
ATOM   8624  H  HD3  . LYS A 1 44  ? 11.010  13.357  9.968   1.00 0.00 ? 401 LYS A HD3  6  
ATOM   8625  H  HE2  . LYS A 1 44  ? 10.245  11.388  11.542  1.00 0.00 ? 401 LYS A HE2  6  
ATOM   8626  H  HE3  . LYS A 1 44  ? 11.395  10.465  10.575  1.00 0.00 ? 401 LYS A HE3  6  
ATOM   8627  H  HZ1  . LYS A 1 44  ? 11.956  12.113  12.721  1.00 0.00 ? 401 LYS A HZ1  6  
ATOM   8628  H  HZ2  . LYS A 1 44  ? 12.531  12.934  11.358  1.00 0.00 ? 401 LYS A HZ2  6  
ATOM   8629  H  HZ3  . LYS A 1 44  ? 13.067  11.364  11.688  1.00 0.00 ? 401 LYS A HZ3  6  
ATOM   8630  N  N    . PRO A 1 45  ? 6.265   12.958  5.568   1.00 0.00 ? 402 PRO A N    6  
ATOM   8631  C  CA   . PRO A 1 45  ? 5.880   13.625  4.320   1.00 0.00 ? 402 PRO A CA   6  
ATOM   8632  C  C    . PRO A 1 45  ? 6.078   15.136  4.386   1.00 0.00 ? 402 PRO A C    6  
ATOM   8633  O  O    . PRO A 1 45  ? 6.019   15.824  3.367   1.00 0.00 ? 402 PRO A O    6  
ATOM   8634  C  CB   . PRO A 1 45  ? 4.393   13.286  4.181   1.00 0.00 ? 402 PRO A CB   6  
ATOM   8635  C  CG   . PRO A 1 45  ? 3.930   13.033  5.574   1.00 0.00 ? 402 PRO A CG   6  
ATOM   8636  C  CD   . PRO A 1 45  ? 5.101   12.425  6.296   1.00 0.00 ? 402 PRO A CD   6  
ATOM   8637  H  HA   . PRO A 1 45  ? 6.422   13.229  3.475   1.00 0.00 ? 402 PRO A HA   6  
ATOM   8638  H  HB2  . PRO A 1 45  ? 3.871   14.121  3.735   1.00 0.00 ? 402 PRO A HB2  6  
ATOM   8639  H  HB3  . PRO A 1 45  ? 4.277   12.410  3.561   1.00 0.00 ? 402 PRO A HB3  6  
ATOM   8640  H  HG2  . PRO A 1 45  ? 3.644   13.964  6.041   1.00 0.00 ? 402 PRO A HG2  6  
ATOM   8641  H  HG3  . PRO A 1 45  ? 3.098   12.345  5.565   1.00 0.00 ? 402 PRO A HG3  6  
ATOM   8642  H  HD2  . PRO A 1 45  ? 5.114   12.742  7.328   1.00 0.00 ? 402 PRO A HD2  6  
ATOM   8643  H  HD3  . PRO A 1 45  ? 5.066   11.348  6.230   1.00 0.00 ? 402 PRO A HD3  6  
ATOM   8644  N  N    . TYR A 1 46  ? 6.313   15.645  5.590   1.00 0.00 ? 403 TYR A N    6  
ATOM   8645  C  CA   . TYR A 1 46  ? 6.518   17.075  5.789   1.00 0.00 ? 403 TYR A CA   6  
ATOM   8646  C  C    . TYR A 1 46  ? 7.899   17.500  5.300   1.00 0.00 ? 403 TYR A C    6  
ATOM   8647  O  O    . TYR A 1 46  ? 8.882   17.425  6.037   1.00 0.00 ? 403 TYR A O    6  
ATOM   8648  C  CB   . TYR A 1 46  ? 6.354   17.434  7.266   1.00 0.00 ? 403 TYR A CB   6  
ATOM   8649  C  CG   . TYR A 1 46  ? 4.914   17.468  7.726   1.00 0.00 ? 403 TYR A CG   6  
ATOM   8650  C  CD1  . TYR A 1 46  ? 3.996   16.531  7.268   1.00 0.00 ? 403 TYR A CD1  6  
ATOM   8651  C  CD2  . TYR A 1 46  ? 4.471   18.437  8.618   1.00 0.00 ? 403 TYR A CD2  6  
ATOM   8652  C  CE1  . TYR A 1 46  ? 2.679   16.559  7.684   1.00 0.00 ? 403 TYR A CE1  6  
ATOM   8653  C  CE2  . TYR A 1 46  ? 3.157   18.471  9.041   1.00 0.00 ? 403 TYR A CE2  6  
ATOM   8654  C  CZ   . TYR A 1 46  ? 2.264   17.530  8.571   1.00 0.00 ? 403 TYR A CZ   6  
ATOM   8655  O  OH   . TYR A 1 46  ? 0.954   17.560  8.989   1.00 0.00 ? 403 TYR A OH   6  
ATOM   8656  H  H    . TYR A 1 46  ? 6.348   15.045  6.365   1.00 0.00 ? 403 TYR A H    6  
ATOM   8657  H  HA   . TYR A 1 46  ? 5.768   17.600  5.215   1.00 0.00 ? 403 TYR A HA   6  
ATOM   8658  H  HB2  . TYR A 1 46  ? 6.876   16.706  7.867   1.00 0.00 ? 403 TYR A HB2  6  
ATOM   8659  H  HB3  . TYR A 1 46  ? 6.781   18.411  7.442   1.00 0.00 ? 403 TYR A HB3  6  
ATOM   8660  H  HD1  . TYR A 1 46  ? 4.324   15.771  6.573   1.00 0.00 ? 403 TYR A HD1  6  
ATOM   8661  H  HD2  . TYR A 1 46  ? 5.173   19.172  8.985   1.00 0.00 ? 403 TYR A HD2  6  
ATOM   8662  H  HE1  . TYR A 1 46  ? 1.980   15.822  7.316   1.00 0.00 ? 403 TYR A HE1  6  
ATOM   8663  H  HE2  . TYR A 1 46  ? 2.831   19.232  9.735   1.00 0.00 ? 403 TYR A HE2  6  
ATOM   8664  H  HH   . TYR A 1 46  ? 0.876   17.105  9.831   1.00 0.00 ? 403 TYR A HH   6  
ATOM   8665  N  N    . LYS A 1 47  ? 7.965   17.949  4.051   1.00 0.00 ? 404 LYS A N    6  
ATOM   8666  C  CA   . LYS A 1 47  ? 9.224   18.389  3.461   1.00 0.00 ? 404 LYS A CA   6  
ATOM   8667  C  C    . LYS A 1 47  ? 9.307   19.912  3.430   1.00 0.00 ? 404 LYS A C    6  
ATOM   8668  O  O    . LYS A 1 47  ? 8.423   20.581  2.895   1.00 0.00 ? 404 LYS A O    6  
ATOM   8669  C  CB   . LYS A 1 47  ? 9.370   17.830  2.044   1.00 0.00 ? 404 LYS A CB   6  
ATOM   8670  C  CG   . LYS A 1 47  ? 10.764  17.995  1.466   1.00 0.00 ? 404 LYS A CG   6  
ATOM   8671  C  CD   . LYS A 1 47  ? 10.910  19.316  0.728   1.00 0.00 ? 404 LYS A CD   6  
ATOM   8672  C  CE   . LYS A 1 47  ? 10.449  19.200  -0.717  1.00 0.00 ? 404 LYS A CE   6  
ATOM   8673  N  NZ   . LYS A 1 47  ? 11.355  18.334  -1.521  1.00 0.00 ? 404 LYS A NZ   6  
ATOM   8674  H  H    . LYS A 1 47  ? 7.146   17.985  3.512   1.00 0.00 ? 404 LYS A H    6  
ATOM   8675  H  HA   . LYS A 1 47  ? 10.028  18.009  4.073   1.00 0.00 ? 404 LYS A HA   6  
ATOM   8676  H  HB2  . LYS A 1 47  ? 9.131   16.777  2.059   1.00 0.00 ? 404 LYS A HB2  6  
ATOM   8677  H  HB3  . LYS A 1 47  ? 8.672   18.340  1.396   1.00 0.00 ? 404 LYS A HB3  6  
ATOM   8678  H  HG2  . LYS A 1 47  ? 11.484  17.964  2.270   1.00 0.00 ? 404 LYS A HG2  6  
ATOM   8679  H  HG3  . LYS A 1 47  ? 10.957  17.185  0.777   1.00 0.00 ? 404 LYS A HG3  6  
ATOM   8680  H  HD2  . LYS A 1 47  ? 10.312  20.064  1.226   1.00 0.00 ? 404 LYS A HD2  6  
ATOM   8681  H  HD3  . LYS A 1 47  ? 11.949  19.614  0.743   1.00 0.00 ? 404 LYS A HD3  6  
ATOM   8682  H  HE2  . LYS A 1 47  ? 9.455   18.779  -0.732  1.00 0.00 ? 404 LYS A HE2  6  
ATOM   8683  H  HE3  . LYS A 1 47  ? 10.427  20.188  -1.154  1.00 0.00 ? 404 LYS A HE3  6  
ATOM   8684  H  HZ1  . LYS A 1 47  ? 11.674  17.525  -0.951  1.00 0.00 ? 404 LYS A HZ1  6  
ATOM   8685  H  HZ2  . LYS A 1 47  ? 12.186  18.877  -1.830  1.00 0.00 ? 404 LYS A HZ2  6  
ATOM   8686  H  HZ3  . LYS A 1 47  ? 10.856  17.977  -2.361  1.00 0.00 ? 404 LYS A HZ3  6  
ATOM   8687  N  N    . CYS A 1 48  ? 10.375  20.453  4.006   1.00 0.00 ? 405 CYS A N    6  
ATOM   8688  C  CA   . CYS A 1 48  ? 10.574  21.897  4.043   1.00 0.00 ? 405 CYS A CA   6  
ATOM   8689  C  C    . CYS A 1 48  ? 10.470  22.497  2.644   1.00 0.00 ? 405 CYS A C    6  
ATOM   8690  O  O    . CYS A 1 48  ? 11.231  22.140  1.744   1.00 0.00 ? 405 CYS A O    6  
ATOM   8691  C  CB   . CYS A 1 48  ? 11.938  22.229  4.652   1.00 0.00 ? 405 CYS A CB   6  
ATOM   8692  S  SG   . CYS A 1 48  ? 12.074  23.930  5.288   1.00 0.00 ? 405 CYS A SG   6  
ATOM   8693  H  H    . CYS A 1 48  ? 11.046  19.867  4.416   1.00 0.00 ? 405 CYS A H    6  
ATOM   8694  H  HA   . CYS A 1 48  ? 9.800   22.323  4.663   1.00 0.00 ? 405 CYS A HA   6  
ATOM   8695  H  HB2  . CYS A 1 48  ? 12.130  21.555  5.475   1.00 0.00 ? 405 CYS A HB2  6  
ATOM   8696  H  HB3  . CYS A 1 48  ? 12.702  22.096  3.900   1.00 0.00 ? 405 CYS A HB3  6  
ATOM   8697  N  N    . THR A 1 49  ? 9.522   23.413  2.468   1.00 0.00 ? 406 THR A N    6  
ATOM   8698  C  CA   . THR A 1 49  ? 9.317   24.062  1.180   1.00 0.00 ? 406 THR A CA   6  
ATOM   8699  C  C    . THR A 1 49  ? 10.284  25.225  0.990   1.00 0.00 ? 406 THR A C    6  
ATOM   8700  O  O    . THR A 1 49  ? 9.896   26.299  0.531   1.00 0.00 ? 406 THR A O    6  
ATOM   8701  C  CB   . THR A 1 49  ? 7.874   24.581  1.035   1.00 0.00 ? 406 THR A CB   6  
ATOM   8702  O  OG1  . THR A 1 49  ? 7.510   25.344  2.191   1.00 0.00 ? 406 THR A OG1  6  
ATOM   8703  C  CG2  . THR A 1 49  ? 6.899   23.426  0.856   1.00 0.00 ? 406 THR A CG2  6  
ATOM   8704  H  H    . THR A 1 49  ? 8.947   23.655  3.224   1.00 0.00 ? 406 THR A H    6  
ATOM   8705  H  HA   . THR A 1 49  ? 9.493   23.330  0.405   1.00 0.00 ? 406 THR A HA   6  
ATOM   8706  H  HB   . THR A 1 49  ? 7.821   25.216  0.163   1.00 0.00 ? 406 THR A HB   6  
ATOM   8707  H  HG1  . THR A 1 49  ? 7.124   24.762  2.850   1.00 0.00 ? 406 THR A HG1  6  
ATOM   8708  H  HG21 . THR A 1 49  ? 6.454   23.481  -0.126  1.00 0.00 ? 406 THR A HG21 6  
ATOM   8709  H  HG22 . THR A 1 49  ? 6.125   23.489  1.606   1.00 0.00 ? 406 THR A HG22 6  
ATOM   8710  H  HG23 . THR A 1 49  ? 7.427   22.490  0.960   1.00 0.00 ? 406 THR A HG23 6  
ATOM   8711  N  N    . TRP A 1 50  ? 11.545  25.004  1.345   1.00 0.00 ? 407 TRP A N    6  
ATOM   8712  C  CA   . TRP A 1 50  ? 12.568  26.034  1.213   1.00 0.00 ? 407 TRP A CA   6  
ATOM   8713  C  C    . TRP A 1 50  ? 13.522  25.711  0.068   1.00 0.00 ? 407 TRP A C    6  
ATOM   8714  O  O    . TRP A 1 50  ? 13.603  24.567  -0.378  1.00 0.00 ? 407 TRP A O    6  
ATOM   8715  C  CB   . TRP A 1 50  ? 13.350  26.177  2.520   1.00 0.00 ? 407 TRP A CB   6  
ATOM   8716  C  CG   . TRP A 1 50  ? 14.224  27.393  2.559   1.00 0.00 ? 407 TRP A CG   6  
ATOM   8717  C  CD1  . TRP A 1 50  ? 15.477  27.520  2.030   1.00 0.00 ? 407 TRP A CD1  6  
ATOM   8718  C  CD2  . TRP A 1 50  ? 13.912  28.654  3.162   1.00 0.00 ? 407 TRP A CD2  6  
ATOM   8719  N  NE1  . TRP A 1 50  ? 15.962  28.783  2.268   1.00 0.00 ? 407 TRP A NE1  6  
ATOM   8720  C  CE2  . TRP A 1 50  ? 15.021  29.498  2.959   1.00 0.00 ? 407 TRP A CE2  6  
ATOM   8721  C  CE3  . TRP A 1 50  ? 12.803  29.152  3.851   1.00 0.00 ? 407 TRP A CE3  6  
ATOM   8722  C  CZ2  . TRP A 1 50  ? 15.051  30.811  3.422   1.00 0.00 ? 407 TRP A CZ2  6  
ATOM   8723  C  CZ3  . TRP A 1 50  ? 12.834  30.455  4.310   1.00 0.00 ? 407 TRP A CZ3  6  
ATOM   8724  C  CH2  . TRP A 1 50  ? 13.951  31.273  4.094   1.00 0.00 ? 407 TRP A CH2  6  
ATOM   8725  H  H    . TRP A 1 50  ? 11.793  24.126  1.705   1.00 0.00 ? 407 TRP A H    6  
ATOM   8726  H  HA   . TRP A 1 50  ? 12.070  26.969  0.998   1.00 0.00 ? 407 TRP A HA   6  
ATOM   8727  H  HB2  . TRP A 1 50  ? 12.654  26.239  3.343   1.00 0.00 ? 407 TRP A HB2  6  
ATOM   8728  H  HB3  . TRP A 1 50  ? 13.979  25.308  2.650   1.00 0.00 ? 407 TRP A HB3  6  
ATOM   8729  H  HD1  . TRP A 1 50  ? 15.998  26.733  1.507   1.00 0.00 ? 407 TRP A HD1  6  
ATOM   8730  H  HE1  . TRP A 1 50  ? 16.840  29.117  1.986   1.00 0.00 ? 407 TRP A HE1  6  
ATOM   8731  H  HE3  . TRP A 1 50  ? 11.932  28.537  4.027   1.00 0.00 ? 407 TRP A HE3  6  
ATOM   8732  H  HZ2  . TRP A 1 50  ? 15.904  31.454  3.263   1.00 0.00 ? 407 TRP A HZ2  6  
ATOM   8733  H  HZ3  . TRP A 1 50  ? 11.986  30.857  4.845   1.00 0.00 ? 407 TRP A HZ3  6  
ATOM   8734  H  HH2  . TRP A 1 50  ? 13.932  32.284  4.470   1.00 0.00 ? 407 TRP A HH2  6  
ATOM   8735  N  N    . GLU A 1 51  ? 14.241  26.725  -0.402  1.00 0.00 ? 408 GLU A N    6  
ATOM   8736  C  CA   . GLU A 1 51  ? 15.189  26.546  -1.496  1.00 0.00 ? 408 GLU A CA   6  
ATOM   8737  C  C    . GLU A 1 51  ? 16.568  26.165  -0.964  1.00 0.00 ? 408 GLU A C    6  
ATOM   8738  O  O    . GLU A 1 51  ? 17.274  26.992  -0.390  1.00 0.00 ? 408 GLU A O    6  
ATOM   8739  C  CB   . GLU A 1 51  ? 15.288  27.825  -2.329  1.00 0.00 ? 408 GLU A CB   6  
ATOM   8740  C  CG   . GLU A 1 51  ? 16.095  27.660  -3.606  1.00 0.00 ? 408 GLU A CG   6  
ATOM   8741  C  CD   . GLU A 1 51  ? 15.820  28.757  -4.616  1.00 0.00 ? 408 GLU A CD   6  
ATOM   8742  O  OE1  . GLU A 1 51  ? 15.928  29.944  -4.247  1.00 0.00 ? 408 GLU A OE1  6  
ATOM   8743  O  OE2  . GLU A 1 51  ? 15.498  28.426  -5.776  1.00 0.00 ? 408 GLU A OE2  6  
ATOM   8744  H  H    . GLU A 1 51  ? 14.132  27.614  -0.004  1.00 0.00 ? 408 GLU A H    6  
ATOM   8745  H  HA   . GLU A 1 51  ? 14.825  25.746  -2.123  1.00 0.00 ? 408 GLU A HA   6  
ATOM   8746  H  HB2  . GLU A 1 51  ? 14.291  28.145  -2.596  1.00 0.00 ? 408 GLU A HB2  6  
ATOM   8747  H  HB3  . GLU A 1 51  ? 15.754  28.594  -1.731  1.00 0.00 ? 408 GLU A HB3  6  
ATOM   8748  H  HG2  . GLU A 1 51  ? 17.145  27.675  -3.357  1.00 0.00 ? 408 GLU A HG2  6  
ATOM   8749  H  HG3  . GLU A 1 51  ? 15.846  26.708  -4.052  1.00 0.00 ? 408 GLU A HG3  6  
ATOM   8750  N  N    . GLY A 1 52  ? 16.943  24.904  -1.159  1.00 0.00 ? 409 GLY A N    6  
ATOM   8751  C  CA   . GLY A 1 52  ? 18.235  24.434  -0.693  1.00 0.00 ? 409 GLY A CA   6  
ATOM   8752  C  C    . GLY A 1 52  ? 18.113  23.430  0.436   1.00 0.00 ? 409 GLY A C    6  
ATOM   8753  O  O    . GLY A 1 52  ? 18.805  22.411  0.448   1.00 0.00 ? 409 GLY A O    6  
ATOM   8754  H  H    . GLY A 1 52  ? 16.338  24.288  -1.623  1.00 0.00 ? 409 GLY A H    6  
ATOM   8755  H  HA2  . GLY A 1 52  ? 18.756  23.972  -1.518  1.00 0.00 ? 409 GLY A HA2  6  
ATOM   8756  H  HA3  . GLY A 1 52  ? 18.809  25.280  -0.346  1.00 0.00 ? 409 GLY A HA3  6  
ATOM   8757  N  N    . CYS A 1 53  ? 17.234  23.718  1.389   1.00 0.00 ? 410 CYS A N    6  
ATOM   8758  C  CA   . CYS A 1 53  ? 17.025  22.834  2.530   1.00 0.00 ? 410 CYS A CA   6  
ATOM   8759  C  C    . CYS A 1 53  ? 16.535  21.463  2.073   1.00 0.00 ? 410 CYS A C    6  
ATOM   8760  O  O    . CYS A 1 53  ? 15.633  21.360  1.241   1.00 0.00 ? 410 CYS A O    6  
ATOM   8761  C  CB   . CYS A 1 53  ? 16.017  23.450  3.502   1.00 0.00 ? 410 CYS A CB   6  
ATOM   8762  S  SG   . CYS A 1 53  ? 15.573  22.369  4.899   1.00 0.00 ? 410 CYS A SG   6  
ATOM   8763  H  H    . CYS A 1 53  ? 16.711  24.545  1.324   1.00 0.00 ? 410 CYS A H    6  
ATOM   8764  H  HA   . CYS A 1 53  ? 17.971  22.714  3.035   1.00 0.00 ? 410 CYS A HA   6  
ATOM   8765  H  HB2  . CYS A 1 53  ? 16.432  24.360  3.911   1.00 0.00 ? 410 CYS A HB2  6  
ATOM   8766  H  HB3  . CYS A 1 53  ? 15.109  23.685  2.966   1.00 0.00 ? 410 CYS A HB3  6  
ATOM   8767  N  N    . ASP A 1 54  ? 17.135  20.413  2.623   1.00 0.00 ? 411 ASP A N    6  
ATOM   8768  C  CA   . ASP A 1 54  ? 16.759  19.048  2.274   1.00 0.00 ? 411 ASP A CA   6  
ATOM   8769  C  C    . ASP A 1 54  ? 16.374  18.255  3.519   1.00 0.00 ? 411 ASP A C    6  
ATOM   8770  O  O    . ASP A 1 54  ? 16.719  17.080  3.650   1.00 0.00 ? 411 ASP A O    6  
ATOM   8771  C  CB   . ASP A 1 54  ? 17.909  18.350  1.546   1.00 0.00 ? 411 ASP A CB   6  
ATOM   8772  C  CG   . ASP A 1 54  ? 19.207  18.404  2.328   1.00 0.00 ? 411 ASP A CG   6  
ATOM   8773  O  OD1  . ASP A 1 54  ? 19.185  18.090  3.536   1.00 0.00 ? 411 ASP A OD1  6  
ATOM   8774  O  OD2  . ASP A 1 54  ? 20.245  18.759  1.731   1.00 0.00 ? 411 ASP A OD2  6  
ATOM   8775  H  H    . ASP A 1 54  ? 17.847  20.560  3.281   1.00 0.00 ? 411 ASP A H    6  
ATOM   8776  H  HA   . ASP A 1 54  ? 15.905  19.097  1.616   1.00 0.00 ? 411 ASP A HA   6  
ATOM   8777  H  HB2  . ASP A 1 54  ? 17.650  17.314  1.386   1.00 0.00 ? 411 ASP A HB2  6  
ATOM   8778  H  HB3  . ASP A 1 54  ? 18.065  18.830  0.591   1.00 0.00 ? 411 ASP A HB3  6  
ATOM   8779  N  N    . TRP A 1 55  ? 15.659  18.905  4.430   1.00 0.00 ? 412 TRP A N    6  
ATOM   8780  C  CA   . TRP A 1 55  ? 15.228  18.260  5.666   1.00 0.00 ? 412 TRP A CA   6  
ATOM   8781  C  C    . TRP A 1 55  ? 13.751  17.889  5.599   1.00 0.00 ? 412 TRP A C    6  
ATOM   8782  O  O    . TRP A 1 55  ? 13.035  18.315  4.694   1.00 0.00 ? 412 TRP A O    6  
ATOM   8783  C  CB   . TRP A 1 55  ? 15.483  19.181  6.861   1.00 0.00 ? 412 TRP A CB   6  
ATOM   8784  C  CG   . TRP A 1 55  ? 16.886  19.105  7.381   1.00 0.00 ? 412 TRP A CG   6  
ATOM   8785  C  CD1  . TRP A 1 55  ? 17.970  19.797  6.920   1.00 0.00 ? 412 TRP A CD1  6  
ATOM   8786  C  CD2  . TRP A 1 55  ? 17.358  18.290  8.460   1.00 0.00 ? 412 TRP A CD2  6  
ATOM   8787  N  NE1  . TRP A 1 55  ? 19.086  19.462  7.647   1.00 0.00 ? 412 TRP A NE1  6  
ATOM   8788  C  CE2  . TRP A 1 55  ? 18.737  18.540  8.598   1.00 0.00 ? 412 TRP A CE2  6  
ATOM   8789  C  CE3  . TRP A 1 55  ? 16.749  17.376  9.323   1.00 0.00 ? 412 TRP A CE3  6  
ATOM   8790  C  CZ2  . TRP A 1 55  ? 19.514  17.906  9.564   1.00 0.00 ? 412 TRP A CZ2  6  
ATOM   8791  C  CZ3  . TRP A 1 55  ? 17.522  16.748  10.281  1.00 0.00 ? 412 TRP A CZ3  6  
ATOM   8792  C  CH2  . TRP A 1 55  ? 18.892  17.016  10.396  1.00 0.00 ? 412 TRP A CH2  6  
ATOM   8793  H  H    . TRP A 1 55  ? 15.415  19.841  4.269   1.00 0.00 ? 412 TRP A H    6  
ATOM   8794  H  HA   . TRP A 1 55  ? 15.809  17.358  5.788   1.00 0.00 ? 412 TRP A HA   6  
ATOM   8795  H  HB2  . TRP A 1 55  ? 15.290  20.202  6.568   1.00 0.00 ? 412 TRP A HB2  6  
ATOM   8796  H  HB3  . TRP A 1 55  ? 14.813  18.908  7.664   1.00 0.00 ? 412 TRP A HB3  6  
ATOM   8797  H  HD1  . TRP A 1 55  ? 17.939  20.500  6.101   1.00 0.00 ? 412 TRP A HD1  6  
ATOM   8798  H  HE1  . TRP A 1 55  ? 19.986  19.825  7.508   1.00 0.00 ? 412 TRP A HE1  6  
ATOM   8799  H  HE3  . TRP A 1 55  ? 15.694  17.156  9.250   1.00 0.00 ? 412 TRP A HE3  6  
ATOM   8800  H  HZ2  . TRP A 1 55  ? 20.572  18.103  9.666   1.00 0.00 ? 412 TRP A HZ2  6  
ATOM   8801  H  HZ3  . TRP A 1 55  ? 17.068  16.038  10.957  1.00 0.00 ? 412 TRP A HZ3  6  
ATOM   8802  H  HH2  . TRP A 1 55  ? 19.457  16.502  11.159  1.00 0.00 ? 412 TRP A HH2  6  
ATOM   8803  N  N    . ARG A 1 56  ? 13.302  17.093  6.564   1.00 0.00 ? 413 ARG A N    6  
ATOM   8804  C  CA   . ARG A 1 56  ? 11.909  16.664  6.614   1.00 0.00 ? 413 ARG A CA   6  
ATOM   8805  C  C    . ARG A 1 56  ? 11.443  16.496  8.057   1.00 0.00 ? 413 ARG A C    6  
ATOM   8806  O  O    . ARG A 1 56  ? 12.227  16.646  8.995   1.00 0.00 ? 413 ARG A O    6  
ATOM   8807  C  CB   . ARG A 1 56  ? 11.731  15.350  5.852   1.00 0.00 ? 413 ARG A CB   6  
ATOM   8808  C  CG   . ARG A 1 56  ? 11.684  15.522  4.343   1.00 0.00 ? 413 ARG A CG   6  
ATOM   8809  C  CD   . ARG A 1 56  ? 11.483  14.190  3.636   1.00 0.00 ? 413 ARG A CD   6  
ATOM   8810  N  NE   . ARG A 1 56  ? 10.892  14.357  2.312   1.00 0.00 ? 413 ARG A NE   6  
ATOM   8811  C  CZ   . ARG A 1 56  ? 10.927  13.423  1.368   1.00 0.00 ? 413 ARG A CZ   6  
ATOM   8812  N  NH1  . ARG A 1 56  ? 11.523  12.262  1.602   1.00 0.00 ? 413 ARG A NH1  6  
ATOM   8813  N  NH2  . ARG A 1 56  ? 10.366  13.649  0.187   1.00 0.00 ? 413 ARG A NH2  6  
ATOM   8814  H  H    . ARG A 1 56  ? 13.921  16.786  7.259   1.00 0.00 ? 413 ARG A H    6  
ATOM   8815  H  HA   . ARG A 1 56  ? 11.310  17.428  6.141   1.00 0.00 ? 413 ARG A HA   6  
ATOM   8816  H  HB2  . ARG A 1 56  ? 12.555  14.693  6.092   1.00 0.00 ? 413 ARG A HB2  6  
ATOM   8817  H  HB3  . ARG A 1 56  ? 10.808  14.887  6.169   1.00 0.00 ? 413 ARG A HB3  6  
ATOM   8818  H  HG2  . ARG A 1 56  ? 10.863  16.177  4.090   1.00 0.00 ? 413 ARG A HG2  6  
ATOM   8819  H  HG3  . ARG A 1 56  ? 12.613  15.960  4.011   1.00 0.00 ? 413 ARG A HG3  6  
ATOM   8820  H  HD2  . ARG A 1 56  ? 12.443  13.705  3.533   1.00 0.00 ? 413 ARG A HD2  6  
ATOM   8821  H  HD3  . ARG A 1 56  ? 10.831  13.574  4.237   1.00 0.00 ? 413 ARG A HD3  6  
ATOM   8822  H  HE   . ARG A 1 56  ? 10.446  15.207  2.117   1.00 0.00 ? 413 ARG A HE   6  
ATOM   8823  H  HH11 . ARG A 1 56  ? 11.946  12.088  2.491   1.00 0.00 ? 413 ARG A HH11 6  
ATOM   8824  H  HH12 . ARG A 1 56  ? 11.548  11.559  0.890   1.00 0.00 ? 413 ARG A HH12 6  
ATOM   8825  H  HH21 . ARG A 1 56  ? 9.916   14.523  0.007   1.00 0.00 ? 413 ARG A HH21 6  
ATOM   8826  H  HH22 . ARG A 1 56  ? 10.394  12.946  -0.523  1.00 0.00 ? 413 ARG A HH22 6  
ATOM   8827  N  N    . PHE A 1 57  ? 10.163  16.183  8.227   1.00 0.00 ? 414 PHE A N    6  
ATOM   8828  C  CA   . PHE A 1 57  ? 9.592   15.996  9.556   1.00 0.00 ? 414 PHE A CA   6  
ATOM   8829  C  C    . PHE A 1 57  ? 8.296   15.193  9.483   1.00 0.00 ? 414 PHE A C    6  
ATOM   8830  O  O    . PHE A 1 57  ? 7.858   14.799  8.403   1.00 0.00 ? 414 PHE A O    6  
ATOM   8831  C  CB   . PHE A 1 57  ? 9.329   17.350  10.217  1.00 0.00 ? 414 PHE A CB   6  
ATOM   8832  C  CG   . PHE A 1 57  ? 10.533  18.248  10.243  1.00 0.00 ? 414 PHE A CG   6  
ATOM   8833  C  CD1  . PHE A 1 57  ? 10.863  19.017  9.139   1.00 0.00 ? 414 PHE A CD1  6  
ATOM   8834  C  CD2  . PHE A 1 57  ? 11.334  18.324  11.371  1.00 0.00 ? 414 PHE A CD2  6  
ATOM   8835  C  CE1  . PHE A 1 57  ? 11.971  19.844  9.159   1.00 0.00 ? 414 PHE A CE1  6  
ATOM   8836  C  CE2  . PHE A 1 57  ? 12.443  19.149  11.397  1.00 0.00 ? 414 PHE A CE2  6  
ATOM   8837  C  CZ   . PHE A 1 57  ? 12.761  19.911  10.290  1.00 0.00 ? 414 PHE A CZ   6  
ATOM   8838  H  H    . PHE A 1 57  ? 9.588   16.077  7.440   1.00 0.00 ? 414 PHE A H    6  
ATOM   8839  H  HA   . PHE A 1 57  ? 10.308  15.448  10.149  1.00 0.00 ? 414 PHE A HA   6  
ATOM   8840  H  HB2  . PHE A 1 57  ? 8.547   17.861  9.677   1.00 0.00 ? 414 PHE A HB2  6  
ATOM   8841  H  HB3  . PHE A 1 57  ? 9.012   17.189  11.237  1.00 0.00 ? 414 PHE A HB3  6  
ATOM   8842  H  HD1  . PHE A 1 57  ? 10.246  18.967  8.254   1.00 0.00 ? 414 PHE A HD1  6  
ATOM   8843  H  HD2  . PHE A 1 57  ? 11.086  17.728  12.238  1.00 0.00 ? 414 PHE A HD2  6  
ATOM   8844  H  HE1  . PHE A 1 57  ? 12.218  20.439  8.292   1.00 0.00 ? 414 PHE A HE1  6  
ATOM   8845  H  HE2  . PHE A 1 57  ? 13.058  19.198  12.283  1.00 0.00 ? 414 PHE A HE2  6  
ATOM   8846  H  HZ   . PHE A 1 57  ? 13.627  20.555  10.309  1.00 0.00 ? 414 PHE A HZ   6  
ATOM   8847  N  N    . ALA A 1 58  ? 7.688   14.955  10.641  1.00 0.00 ? 415 ALA A N    6  
ATOM   8848  C  CA   . ALA A 1 58  ? 6.443   14.202  10.709  1.00 0.00 ? 415 ALA A CA   6  
ATOM   8849  C  C    . ALA A 1 58  ? 5.343   15.018  11.381  1.00 0.00 ? 415 ALA A C    6  
ATOM   8850  O  O    . ALA A 1 58  ? 4.156   14.762  11.179  1.00 0.00 ? 415 ALA A O    6  
ATOM   8851  C  CB   . ALA A 1 58  ? 6.658   12.891  11.451  1.00 0.00 ? 415 ALA A CB   6  
ATOM   8852  H  H    . ALA A 1 58  ? 8.087   15.296  11.468  1.00 0.00 ? 415 ALA A H    6  
ATOM   8853  H  HA   . ALA A 1 58  ? 6.138   13.969  9.698   1.00 0.00 ? 415 ALA A HA   6  
ATOM   8854  H  HB1  . ALA A 1 58  ? 7.494   12.994  12.127  1.00 0.00 ? 415 ALA A HB1  6  
ATOM   8855  H  HB2  . ALA A 1 58  ? 5.769   12.646  12.013  1.00 0.00 ? 415 ALA A HB2  6  
ATOM   8856  H  HB3  . ALA A 1 58  ? 6.864   12.105  10.740  1.00 0.00 ? 415 ALA A HB3  6  
ATOM   8857  N  N    . ARG A 1 59  ? 5.747   15.999  12.181  1.00 0.00 ? 416 ARG A N    6  
ATOM   8858  C  CA   . ARG A 1 59  ? 4.795   16.851  12.884  1.00 0.00 ? 416 ARG A CA   6  
ATOM   8859  C  C    . ARG A 1 59  ? 4.849   18.280  12.352  1.00 0.00 ? 416 ARG A C    6  
ATOM   8860  O  O    . ARG A 1 59  ? 5.744   18.635  11.586  1.00 0.00 ? 416 ARG A O    6  
ATOM   8861  C  CB   . ARG A 1 59  ? 5.085   16.844  14.386  1.00 0.00 ? 416 ARG A CB   6  
ATOM   8862  C  CG   . ARG A 1 59  ? 4.348   15.751  15.143  1.00 0.00 ? 416 ARG A CG   6  
ATOM   8863  C  CD   . ARG A 1 59  ? 4.837   15.640  16.579  1.00 0.00 ? 416 ARG A CD   6  
ATOM   8864  N  NE   . ARG A 1 59  ? 4.359   16.744  17.406  1.00 0.00 ? 416 ARG A NE   6  
ATOM   8865  C  CZ   . ARG A 1 59  ? 4.249   16.677  18.729  1.00 0.00 ? 416 ARG A CZ   6  
ATOM   8866  N  NH1  . ARG A 1 59  ? 4.582   15.565  19.369  1.00 0.00 ? 416 ARG A NH1  6  
ATOM   8867  N  NH2  . ARG A 1 59  ? 3.806   17.724  19.413  1.00 0.00 ? 416 ARG A NH2  6  
ATOM   8868  H  H    . ARG A 1 59  ? 6.707   16.154  12.302  1.00 0.00 ? 416 ARG A H    6  
ATOM   8869  H  HA   . ARG A 1 59  ? 3.806   16.453  12.715  1.00 0.00 ? 416 ARG A HA   6  
ATOM   8870  H  HB2  . ARG A 1 59  ? 6.145   16.702  14.536  1.00 0.00 ? 416 ARG A HB2  6  
ATOM   8871  H  HB3  . ARG A 1 59  ? 4.795   17.797  14.801  1.00 0.00 ? 416 ARG A HB3  6  
ATOM   8872  H  HG2  . ARG A 1 59  ? 3.292   15.980  15.151  1.00 0.00 ? 416 ARG A HG2  6  
ATOM   8873  H  HG3  . ARG A 1 59  ? 4.509   14.808  14.643  1.00 0.00 ? 416 ARG A HG3  6  
ATOM   8874  H  HD2  . ARG A 1 59  ? 4.481   14.710  16.995  1.00 0.00 ? 416 ARG A HD2  6  
ATOM   8875  H  HD3  . ARG A 1 59  ? 5.917   15.644  16.578  1.00 0.00 ? 416 ARG A HD3  6  
ATOM   8876  H  HE   . ARG A 1 59  ? 4.108   17.575  16.953  1.00 0.00 ? 416 ARG A HE   6  
ATOM   8877  H  HH11 . ARG A 1 59  ? 4.917   14.775  18.857  1.00 0.00 ? 416 ARG A HH11 6  
ATOM   8878  H  HH12 . ARG A 1 59  ? 4.499   15.518  20.365  1.00 0.00 ? 416 ARG A HH12 6  
ATOM   8879  H  HH21 . ARG A 1 59  ? 3.555   18.564  18.933  1.00 0.00 ? 416 ARG A HH21 6  
ATOM   8880  H  HH22 . ARG A 1 59  ? 3.724   17.673  20.407  1.00 0.00 ? 416 ARG A HH22 6  
ATOM   8881  N  N    . SER A 1 60  ? 3.883   19.096  12.763  1.00 0.00 ? 417 SER A N    6  
ATOM   8882  C  CA   . SER A 1 60  ? 3.817   20.485  12.325  1.00 0.00 ? 417 SER A CA   6  
ATOM   8883  C  C    . SER A 1 60  ? 4.809   21.347  13.101  1.00 0.00 ? 417 SER A C    6  
ATOM   8884  O  O    . SER A 1 60  ? 5.783   21.849  12.540  1.00 0.00 ? 417 SER A O    6  
ATOM   8885  C  CB   . SER A 1 60  ? 2.400   21.032  12.504  1.00 0.00 ? 417 SER A CB   6  
ATOM   8886  O  OG   . SER A 1 60  ? 1.441   20.166  11.922  1.00 0.00 ? 417 SER A OG   6  
ATOM   8887  H  H    . SER A 1 60  ? 3.197   18.754  13.375  1.00 0.00 ? 417 SER A H    6  
ATOM   8888  H  HA   . SER A 1 60  ? 4.076   20.515  11.277  1.00 0.00 ? 417 SER A HA   6  
ATOM   8889  H  HB2  . SER A 1 60  ? 2.185   21.131  13.557  1.00 0.00 ? 417 SER A HB2  6  
ATOM   8890  H  HB3  . SER A 1 60  ? 2.328   22.000  12.030  1.00 0.00 ? 417 SER A HB3  6  
ATOM   8891  H  HG   . SER A 1 60  ? 1.690   19.254  12.090  1.00 0.00 ? 417 SER A HG   6  
ATOM   8892  N  N    . ASP A 1 61  ? 4.553   21.514  14.394  1.00 0.00 ? 418 ASP A N    6  
ATOM   8893  C  CA   . ASP A 1 61  ? 5.423   22.313  15.248  1.00 0.00 ? 418 ASP A CA   6  
ATOM   8894  C  C    . ASP A 1 61  ? 6.887   22.123  14.864  1.00 0.00 ? 418 ASP A C    6  
ATOM   8895  O  O    . ASP A 1 61  ? 7.638   23.090  14.746  1.00 0.00 ? 418 ASP A O    6  
ATOM   8896  C  CB   . ASP A 1 61  ? 5.215   21.940  16.717  1.00 0.00 ? 418 ASP A CB   6  
ATOM   8897  C  CG   . ASP A 1 61  ? 5.605   23.060  17.660  1.00 0.00 ? 418 ASP A CG   6  
ATOM   8898  O  OD1  . ASP A 1 61  ? 4.746   23.921  17.945  1.00 0.00 ? 418 ASP A OD1  6  
ATOM   8899  O  OD2  . ASP A 1 61  ? 6.768   23.077  18.114  1.00 0.00 ? 418 ASP A OD2  6  
ATOM   8900  H  H    . ASP A 1 61  ? 3.761   21.088  14.783  1.00 0.00 ? 418 ASP A H    6  
ATOM   8901  H  HA   . ASP A 1 61  ? 5.160   23.351  15.110  1.00 0.00 ? 418 ASP A HA   6  
ATOM   8902  H  HB2  . ASP A 1 61  ? 4.172   21.705  16.877  1.00 0.00 ? 418 ASP A HB2  6  
ATOM   8903  H  HB3  . ASP A 1 61  ? 5.815   21.072  16.949  1.00 0.00 ? 418 ASP A HB3  6  
ATOM   8904  N  N    . GLU A 1 62  ? 7.284   20.869  14.672  1.00 0.00 ? 419 GLU A N    6  
ATOM   8905  C  CA   . GLU A 1 62  ? 8.659   20.552  14.304  1.00 0.00 ? 419 GLU A CA   6  
ATOM   8906  C  C    . GLU A 1 62  ? 9.062   21.281  13.025  1.00 0.00 ? 419 GLU A C    6  
ATOM   8907  O  O    . GLU A 1 62  ? 10.043  22.026  13.005  1.00 0.00 ? 419 GLU A O    6  
ATOM   8908  C  CB   . GLU A 1 62  ? 8.825   19.042  14.116  1.00 0.00 ? 419 GLU A CB   6  
ATOM   8909  C  CG   . GLU A 1 62  ? 8.488   18.234  15.358  1.00 0.00 ? 419 GLU A CG   6  
ATOM   8910  C  CD   . GLU A 1 62  ? 9.414   18.537  16.521  1.00 0.00 ? 419 GLU A CD   6  
ATOM   8911  O  OE1  . GLU A 1 62  ? 9.290   19.632  17.108  1.00 0.00 ? 419 GLU A OE1  6  
ATOM   8912  O  OE2  . GLU A 1 62  ? 10.261  17.678  16.843  1.00 0.00 ? 419 GLU A OE2  6  
ATOM   8913  H  H    . GLU A 1 62  ? 6.638   20.140  14.781  1.00 0.00 ? 419 GLU A H    6  
ATOM   8914  H  HA   . GLU A 1 62  ? 9.302   20.878  15.107  1.00 0.00 ? 419 GLU A HA   6  
ATOM   8915  H  HB2  . GLU A 1 62  ? 8.180   18.718  13.314  1.00 0.00 ? 419 GLU A HB2  6  
ATOM   8916  H  HB3  . GLU A 1 62  ? 9.851   18.836  13.846  1.00 0.00 ? 419 GLU A HB3  6  
ATOM   8917  H  HG2  . GLU A 1 62  ? 7.476   18.461  15.656  1.00 0.00 ? 419 GLU A HG2  6  
ATOM   8918  H  HG3  . GLU A 1 62  ? 8.565   17.183  15.120  1.00 0.00 ? 419 GLU A HG3  6  
ATOM   8919  N  N    . LEU A 1 63  ? 8.299   21.061  11.960  1.00 0.00 ? 420 LEU A N    6  
ATOM   8920  C  CA   . LEU A 1 63  ? 8.575   21.697  10.677  1.00 0.00 ? 420 LEU A CA   6  
ATOM   8921  C  C    . LEU A 1 63  ? 8.520   23.216  10.798  1.00 0.00 ? 420 LEU A C    6  
ATOM   8922  O  O    . LEU A 1 63  ? 9.447   23.917  10.390  1.00 0.00 ? 420 LEU A O    6  
ATOM   8923  C  CB   . LEU A 1 63  ? 7.572   21.222  9.624   1.00 0.00 ? 420 LEU A CB   6  
ATOM   8924  C  CG   . LEU A 1 63  ? 7.487   22.063  8.350   1.00 0.00 ? 420 LEU A CG   6  
ATOM   8925  C  CD1  . LEU A 1 63  ? 8.797   21.999  7.580   1.00 0.00 ? 420 LEU A CD1  6  
ATOM   8926  C  CD2  . LEU A 1 63  ? 6.331   21.596  7.478   1.00 0.00 ? 420 LEU A CD2  6  
ATOM   8927  H  H    . LEU A 1 63  ? 7.531   20.458  12.038  1.00 0.00 ? 420 LEU A H    6  
ATOM   8928  H  HA   . LEU A 1 63  ? 9.569   21.408  10.371  1.00 0.00 ? 420 LEU A HA   6  
ATOM   8929  H  HB2  . LEU A 1 63  ? 7.843   20.217  9.339   1.00 0.00 ? 420 LEU A HB2  6  
ATOM   8930  H  HB3  . LEU A 1 63  ? 6.593   21.213  10.082  1.00 0.00 ? 420 LEU A HB3  6  
ATOM   8931  H  HG   . LEU A 1 63  ? 7.309   23.095  8.619   1.00 0.00 ? 420 LEU A HG   6  
ATOM   8932  H  HD11 . LEU A 1 63  ? 9.001   20.977  7.300   1.00 0.00 ? 420 LEU A HD11 6  
ATOM   8933  H  HD12 . LEU A 1 63  ? 9.599   22.369  8.202   1.00 0.00 ? 420 LEU A HD12 6  
ATOM   8934  H  HD13 . LEU A 1 63  ? 8.722   22.609  6.691   1.00 0.00 ? 420 LEU A HD13 6  
ATOM   8935  H  HD21 . LEU A 1 63  ? 6.419   20.534  7.302   1.00 0.00 ? 420 LEU A HD21 6  
ATOM   8936  H  HD22 . LEU A 1 63  ? 6.356   22.121  6.535   1.00 0.00 ? 420 LEU A HD22 6  
ATOM   8937  H  HD23 . LEU A 1 63  ? 5.396   21.802  7.979   1.00 0.00 ? 420 LEU A HD23 6  
ATOM   8938  N  N    . THR A 1 64  ? 7.428   23.721  11.365  1.00 0.00 ? 421 THR A N    6  
ATOM   8939  C  CA   . THR A 1 64  ? 7.253   25.157  11.542  1.00 0.00 ? 421 THR A CA   6  
ATOM   8940  C  C    . THR A 1 64  ? 8.442   25.770  12.274  1.00 0.00 ? 421 THR A C    6  
ATOM   8941  O  O    . THR A 1 64  ? 9.131   26.639  11.739  1.00 0.00 ? 421 THR A O    6  
ATOM   8942  C  CB   . THR A 1 64  ? 5.964   25.473  12.323  1.00 0.00 ? 421 THR A CB   6  
ATOM   8943  O  OG1  . THR A 1 64  ? 4.872   24.711  11.797  1.00 0.00 ? 421 THR A OG1  6  
ATOM   8944  C  CG2  . THR A 1 64  ? 5.637   26.957  12.249  1.00 0.00 ? 421 THR A CG2  6  
ATOM   8945  H  H    . THR A 1 64  ? 6.724   23.111  11.670  1.00 0.00 ? 421 THR A H    6  
ATOM   8946  H  HA   . THR A 1 64  ? 7.175   25.606  10.562  1.00 0.00 ? 421 THR A HA   6  
ATOM   8947  H  HB   . THR A 1 64  ? 6.115   25.205  13.359  1.00 0.00 ? 421 THR A HB   6  
ATOM   8948  H  HG1  . THR A 1 64  ? 4.048   25.032  12.171  1.00 0.00 ? 421 THR A HG1  6  
ATOM   8949  H  HG21 . THR A 1 64  ? 5.072   27.155  11.351  1.00 0.00 ? 421 THR A HG21 6  
ATOM   8950  H  HG22 . THR A 1 64  ? 6.553   27.528  12.230  1.00 0.00 ? 421 THR A HG22 6  
ATOM   8951  H  HG23 . THR A 1 64  ? 5.053   27.241  13.112  1.00 0.00 ? 421 THR A HG23 6  
ATOM   8952  N  N    . ARG A 1 65  ? 8.676   25.311  13.499  1.00 0.00 ? 422 ARG A N    6  
ATOM   8953  C  CA   . ARG A 1 65  ? 9.782   25.816  14.304  1.00 0.00 ? 422 ARG A CA   6  
ATOM   8954  C  C    . ARG A 1 65  ? 11.084  25.806  13.508  1.00 0.00 ? 422 ARG A C    6  
ATOM   8955  O  O    . ARG A 1 65  ? 11.887  26.735  13.600  1.00 0.00 ? 422 ARG A O    6  
ATOM   8956  C  CB   . ARG A 1 65  ? 9.942   24.975  15.573  1.00 0.00 ? 422 ARG A CB   6  
ATOM   8957  C  CG   . ARG A 1 65  ? 10.691  25.689  16.686  1.00 0.00 ? 422 ARG A CG   6  
ATOM   8958  C  CD   . ARG A 1 65  ? 10.480  25.005  18.027  1.00 0.00 ? 422 ARG A CD   6  
ATOM   8959  N  NE   . ARG A 1 65  ? 11.080  25.758  19.126  1.00 0.00 ? 422 ARG A NE   6  
ATOM   8960  C  CZ   . ARG A 1 65  ? 11.080  25.342  20.387  1.00 0.00 ? 422 ARG A CZ   6  
ATOM   8961  N  NH1  . ARG A 1 65  ? 10.515  24.186  20.708  1.00 0.00 ? 422 ARG A NH1  6  
ATOM   8962  N  NH2  . ARG A 1 65  ? 11.646  26.084  21.331  1.00 0.00 ? 422 ARG A NH2  6  
ATOM   8963  H  H    . ARG A 1 65  ? 8.092   24.618  13.870  1.00 0.00 ? 422 ARG A H    6  
ATOM   8964  H  HA   . ARG A 1 65  ? 9.552   26.833  14.584  1.00 0.00 ? 422 ARG A HA   6  
ATOM   8965  H  HB2  . ARG A 1 65  ? 8.962   24.711  15.941  1.00 0.00 ? 422 ARG A HB2  6  
ATOM   8966  H  HB3  . ARG A 1 65  ? 10.481  24.073  15.326  1.00 0.00 ? 422 ARG A HB3  6  
ATOM   8967  H  HG2  . ARG A 1 65  ? 11.747  25.687  16.455  1.00 0.00 ? 422 ARG A HG2  6  
ATOM   8968  H  HG3  . ARG A 1 65  ? 10.337  26.707  16.750  1.00 0.00 ? 422 ARG A HG3  6  
ATOM   8969  H  HD2  . ARG A 1 65  ? 9.419   24.911  18.205  1.00 0.00 ? 422 ARG A HD2  6  
ATOM   8970  H  HD3  . ARG A 1 65  ? 10.927  24.023  17.990  1.00 0.00 ? 422 ARG A HD3  6  
ATOM   8971  H  HE   . ARG A 1 65  ? 11.502  26.615  18.911  1.00 0.00 ? 422 ARG A HE   6  
ATOM   8972  H  HH11 . ARG A 1 65  ? 10.089  23.625  19.999  1.00 0.00 ? 422 ARG A HH11 6  
ATOM   8973  H  HH12 . ARG A 1 65  ? 10.518  23.875  21.659  1.00 0.00 ? 422 ARG A HH12 6  
ATOM   8974  H  HH21 . ARG A 1 65  ? 12.072  26.956  21.093  1.00 0.00 ? 422 ARG A HH21 6  
ATOM   8975  H  HH22 . ARG A 1 65  ? 11.645  25.770  22.280  1.00 0.00 ? 422 ARG A HH22 6  
ATOM   8976  N  N    . HIS A 1 66  ? 11.285  24.750  12.726  1.00 0.00 ? 423 HIS A N    6  
ATOM   8977  C  CA   . HIS A 1 66  ? 12.489  24.620  11.913  1.00 0.00 ? 423 HIS A CA   6  
ATOM   8978  C  C    . HIS A 1 66  ? 12.490  25.638  10.776  1.00 0.00 ? 423 HIS A C    6  
ATOM   8979  O  O    . HIS A 1 66  ? 13.524  26.225  10.456  1.00 0.00 ? 423 HIS A O    6  
ATOM   8980  C  CB   . HIS A 1 66  ? 12.596  23.204  11.345  1.00 0.00 ? 423 HIS A CB   6  
ATOM   8981  C  CG   . HIS A 1 66  ? 13.390  23.125  10.078  1.00 0.00 ? 423 HIS A CG   6  
ATOM   8982  N  ND1  . HIS A 1 66  ? 14.752  22.912  10.055  1.00 0.00 ? 423 HIS A ND1  6  
ATOM   8983  C  CD2  . HIS A 1 66  ? 13.005  23.231  8.784   1.00 0.00 ? 423 HIS A CD2  6  
ATOM   8984  C  CE1  . HIS A 1 66  ? 15.171  22.891  8.802   1.00 0.00 ? 423 HIS A CE1  6  
ATOM   8985  N  NE2  . HIS A 1 66  ? 14.131  23.082  8.011   1.00 0.00 ? 423 HIS A NE2  6  
ATOM   8986  H  H    . HIS A 1 66  ? 10.608  24.043  12.695  1.00 0.00 ? 423 HIS A H    6  
ATOM   8987  H  HA   . HIS A 1 66  ? 13.341  24.808  12.549  1.00 0.00 ? 423 HIS A HA   6  
ATOM   8988  H  HB2  . HIS A 1 66  ? 13.072  22.566  12.074  1.00 0.00 ? 423 HIS A HB2  6  
ATOM   8989  H  HB3  . HIS A 1 66  ? 11.603  22.830  11.140  1.00 0.00 ? 423 HIS A HB3  6  
ATOM   8990  H  HD1  . HIS A 1 66  ? 15.326  22.794  10.840  1.00 0.00 ? 423 HIS A HD1  6  
ATOM   8991  H  HD2  . HIS A 1 66  ? 12.000  23.402  8.425   1.00 0.00 ? 423 HIS A HD2  6  
ATOM   8992  H  HE1  . HIS A 1 66  ? 16.190  22.743  8.479   1.00 0.00 ? 423 HIS A HE1  6  
ATOM   8993  N  N    . TYR A 1 67  ? 11.326  25.842  10.170  1.00 0.00 ? 424 TYR A N    6  
ATOM   8994  C  CA   . TYR A 1 67  ? 11.194  26.786  9.067   1.00 0.00 ? 424 TYR A CA   6  
ATOM   8995  C  C    . TYR A 1 67  ? 11.562  28.198  9.512   1.00 0.00 ? 424 TYR A C    6  
ATOM   8996  O  O    . TYR A 1 67  ? 12.255  28.925  8.800   1.00 0.00 ? 424 TYR A O    6  
ATOM   8997  C  CB   . TYR A 1 67  ? 9.765   26.768  8.521   1.00 0.00 ? 424 TYR A CB   6  
ATOM   8998  C  CG   . TYR A 1 67  ? 9.616   27.472  7.192   1.00 0.00 ? 424 TYR A CG   6  
ATOM   8999  C  CD1  . TYR A 1 67  ? 9.425   28.847  7.130   1.00 0.00 ? 424 TYR A CD1  6  
ATOM   9000  C  CD2  . TYR A 1 67  ? 9.665   26.763  5.998   1.00 0.00 ? 424 TYR A CD2  6  
ATOM   9001  C  CE1  . TYR A 1 67  ? 9.288   29.495  5.918   1.00 0.00 ? 424 TYR A CE1  6  
ATOM   9002  C  CE2  . TYR A 1 67  ? 9.530   27.403  4.781   1.00 0.00 ? 424 TYR A CE2  6  
ATOM   9003  C  CZ   . TYR A 1 67  ? 9.341   28.769  4.746   1.00 0.00 ? 424 TYR A CZ   6  
ATOM   9004  O  OH   . TYR A 1 67  ? 9.205   29.410  3.536   1.00 0.00 ? 424 TYR A OH   6  
ATOM   9005  H  H    . TYR A 1 67  ? 10.537  25.344  10.470  1.00 0.00 ? 424 TYR A H    6  
ATOM   9006  H  HA   . TYR A 1 67  ? 11.872  26.479  8.285   1.00 0.00 ? 424 TYR A HA   6  
ATOM   9007  H  HB2  . TYR A 1 67  ? 9.450   25.744  8.390   1.00 0.00 ? 424 TYR A HB2  6  
ATOM   9008  H  HB3  . TYR A 1 67  ? 9.110   27.253  9.230   1.00 0.00 ? 424 TYR A HB3  6  
ATOM   9009  H  HD1  . TYR A 1 67  ? 9.384   29.413  8.049   1.00 0.00 ? 424 TYR A HD1  6  
ATOM   9010  H  HD2  . TYR A 1 67  ? 9.812   25.693  6.029   1.00 0.00 ? 424 TYR A HD2  6  
ATOM   9011  H  HE1  . TYR A 1 67  ? 9.140   30.565  5.890   1.00 0.00 ? 424 TYR A HE1  6  
ATOM   9012  H  HE2  . TYR A 1 67  ? 9.571   26.835  3.864   1.00 0.00 ? 424 TYR A HE2  6  
ATOM   9013  H  HH   . TYR A 1 67  ? 9.625   28.888  2.849   1.00 0.00 ? 424 TYR A HH   6  
ATOM   9014  N  N    . ARG A 1 68  ? 11.093  28.580  10.696  1.00 0.00 ? 425 ARG A N    6  
ATOM   9015  C  CA   . ARG A 1 68  ? 11.371  29.905  11.237  1.00 0.00 ? 425 ARG A CA   6  
ATOM   9016  C  C    . ARG A 1 68  ? 12.866  30.206  11.193  1.00 0.00 ? 425 ARG A C    6  
ATOM   9017  O  O    . ARG A 1 68  ? 13.279  31.302  10.812  1.00 0.00 ? 425 ARG A O    6  
ATOM   9018  C  CB   . ARG A 1 68  ? 10.861  30.009  12.675  1.00 0.00 ? 425 ARG A CB   6  
ATOM   9019  C  CG   . ARG A 1 68  ? 9.346   29.942  12.790  1.00 0.00 ? 425 ARG A CG   6  
ATOM   9020  C  CD   . ARG A 1 68  ? 8.887   30.157  14.224  1.00 0.00 ? 425 ARG A CD   6  
ATOM   9021  N  NE   . ARG A 1 68  ? 7.523   29.682  14.438  1.00 0.00 ? 425 ARG A NE   6  
ATOM   9022  C  CZ   . ARG A 1 68  ? 6.738   30.117  15.418  1.00 0.00 ? 425 ARG A CZ   6  
ATOM   9023  N  NH1  . ARG A 1 68  ? 7.181   31.033  16.269  1.00 0.00 ? 425 ARG A NH1  6  
ATOM   9024  N  NH2  . ARG A 1 68  ? 5.508   29.636  15.548  1.00 0.00 ? 425 ARG A NH2  6  
ATOM   9025  H  H    . ARG A 1 68  ? 10.545  27.956  11.217  1.00 0.00 ? 425 ARG A H    6  
ATOM   9026  H  HA   . ARG A 1 68  ? 10.852  30.628  10.627  1.00 0.00 ? 425 ARG A HA   6  
ATOM   9027  H  HB2  . ARG A 1 68  ? 11.279  29.198  13.253  1.00 0.00 ? 425 ARG A HB2  6  
ATOM   9028  H  HB3  . ARG A 1 68  ? 11.191  30.947  13.094  1.00 0.00 ? 425 ARG A HB3  6  
ATOM   9029  H  HG2  . ARG A 1 68  ? 8.913   30.710  12.167  1.00 0.00 ? 425 ARG A HG2  6  
ATOM   9030  H  HG3  . ARG A 1 68  ? 9.012   28.972  12.455  1.00 0.00 ? 425 ARG A HG3  6  
ATOM   9031  H  HD2  . ARG A 1 68  ? 9.552   29.622  14.885  1.00 0.00 ? 425 ARG A HD2  6  
ATOM   9032  H  HD3  . ARG A 1 68  ? 8.930   31.212  14.447  1.00 0.00 ? 425 ARG A HD3  6  
ATOM   9033  H  HE   . ARG A 1 68  ? 7.176   29.005  13.821  1.00 0.00 ? 425 ARG A HE   6  
ATOM   9034  H  HH11 . ARG A 1 68  ? 8.107   31.397  16.173  1.00 0.00 ? 425 ARG A HH11 6  
ATOM   9035  H  HH12 . ARG A 1 68  ? 6.588   31.360  17.005  1.00 0.00 ? 425 ARG A HH12 6  
ATOM   9036  H  HH21 . ARG A 1 68  ? 5.171   28.946  14.908  1.00 0.00 ? 425 ARG A HH21 6  
ATOM   9037  H  HH22 . ARG A 1 68  ? 4.919   29.964  16.286  1.00 0.00 ? 425 ARG A HH22 6  
ATOM   9038  N  N    . LYS A 1 69  ? 13.674  29.228  11.588  1.00 0.00 ? 426 LYS A N    6  
ATOM   9039  C  CA   . LYS A 1 69  ? 15.123  29.387  11.594  1.00 0.00 ? 426 LYS A CA   6  
ATOM   9040  C  C    . LYS A 1 69  ? 15.611  29.981  10.276  1.00 0.00 ? 426 LYS A C    6  
ATOM   9041  O  O    . LYS A 1 69  ? 16.370  30.950  10.265  1.00 0.00 ? 426 LYS A O    6  
ATOM   9042  C  CB   . LYS A 1 69  ? 15.804  28.038  11.840  1.00 0.00 ? 426 LYS A CB   6  
ATOM   9043  C  CG   . LYS A 1 69  ? 15.335  27.342  13.106  1.00 0.00 ? 426 LYS A CG   6  
ATOM   9044  C  CD   . LYS A 1 69  ? 15.777  28.092  14.351  1.00 0.00 ? 426 LYS A CD   6  
ATOM   9045  C  CE   . LYS A 1 69  ? 17.184  27.694  14.771  1.00 0.00 ? 426 LYS A CE   6  
ATOM   9046  N  NZ   . LYS A 1 69  ? 17.820  28.730  15.631  1.00 0.00 ? 426 LYS A NZ   6  
ATOM   9047  H  H    . LYS A 1 69  ? 13.285  28.377  11.881  1.00 0.00 ? 426 LYS A H    6  
ATOM   9048  H  HA   . LYS A 1 69  ? 15.380  30.061  12.396  1.00 0.00 ? 426 LYS A HA   6  
ATOM   9049  H  HB2  . LYS A 1 69  ? 15.602  27.388  11.001  1.00 0.00 ? 426 LYS A HB2  6  
ATOM   9050  H  HB3  . LYS A 1 69  ? 16.870  28.195  11.914  1.00 0.00 ? 426 LYS A HB3  6  
ATOM   9051  H  HG2  . LYS A 1 69  ? 14.256  27.286  13.097  1.00 0.00 ? 426 LYS A HG2  6  
ATOM   9052  H  HG3  . LYS A 1 69  ? 15.749  26.344  13.131  1.00 0.00 ? 426 LYS A HG3  6  
ATOM   9053  H  HD2  . LYS A 1 69  ? 15.762  29.153  14.147  1.00 0.00 ? 426 LYS A HD2  6  
ATOM   9054  H  HD3  . LYS A 1 69  ? 15.093  27.869  15.157  1.00 0.00 ? 426 LYS A HD3  6  
ATOM   9055  H  HE2  . LYS A 1 69  ? 17.132  26.766  15.320  1.00 0.00 ? 426 LYS A HE2  6  
ATOM   9056  H  HE3  . LYS A 1 69  ? 17.784  27.555  13.885  1.00 0.00 ? 426 LYS A HE3  6  
ATOM   9057  H  HZ1  . LYS A 1 69  ? 17.439  28.677  16.597  1.00 0.00 ? 426 LYS A HZ1  6  
ATOM   9058  H  HZ2  . LYS A 1 69  ? 17.631  29.678  15.247  1.00 0.00 ? 426 LYS A HZ2  6  
ATOM   9059  H  HZ3  . LYS A 1 69  ? 18.849  28.582  15.667  1.00 0.00 ? 426 LYS A HZ3  6  
ATOM   9060  N  N    . HIS A 1 70  ? 15.168  29.395  9.168   1.00 0.00 ? 427 HIS A N    6  
ATOM   9061  C  CA   . HIS A 1 70  ? 15.558  29.869  7.845   1.00 0.00 ? 427 HIS A CA   6  
ATOM   9062  C  C    . HIS A 1 70  ? 15.445  31.388  7.756   1.00 0.00 ? 427 HIS A C    6  
ATOM   9063  O  O    . HIS A 1 70  ? 16.422  32.079  7.467   1.00 0.00 ? 427 HIS A O    6  
ATOM   9064  C  CB   . HIS A 1 70  ? 14.689  29.217  6.770   1.00 0.00 ? 427 HIS A CB   6  
ATOM   9065  C  CG   . HIS A 1 70  ? 15.022  27.779  6.520   1.00 0.00 ? 427 HIS A CG   6  
ATOM   9066  N  ND1  . HIS A 1 70  ? 16.300  27.340  6.241   1.00 0.00 ? 427 HIS A ND1  6  
ATOM   9067  C  CD2  . HIS A 1 70  ? 14.237  26.677  6.510   1.00 0.00 ? 427 HIS A CD2  6  
ATOM   9068  C  CE1  . HIS A 1 70  ? 16.285  26.030  6.068   1.00 0.00 ? 427 HIS A CE1  6  
ATOM   9069  N  NE2  . HIS A 1 70  ? 15.045  25.603  6.226   1.00 0.00 ? 427 HIS A NE2  6  
ATOM   9070  H  H    . HIS A 1 70  ? 14.565  28.627  9.242   1.00 0.00 ? 427 HIS A H    6  
ATOM   9071  H  HA   . HIS A 1 70  ? 16.588  29.588  7.682   1.00 0.00 ? 427 HIS A HA   6  
ATOM   9072  H  HB2  . HIS A 1 70  ? 13.653  29.269  7.073   1.00 0.00 ? 427 HIS A HB2  6  
ATOM   9073  H  HB3  . HIS A 1 70  ? 14.813  29.754  5.840   1.00 0.00 ? 427 HIS A HB3  6  
ATOM   9074  H  HD1  . HIS A 1 70  ? 17.098  27.905  6.178   1.00 0.00 ? 427 HIS A HD1  6  
ATOM   9075  H  HD2  . HIS A 1 70  ? 13.172  26.646  6.690   1.00 0.00 ? 427 HIS A HD2  6  
ATOM   9076  H  HE1  . HIS A 1 70  ? 17.141  25.414  5.838   1.00 0.00 ? 427 HIS A HE1  6  
ATOM   9077  N  N    . THR A 1 71  ? 14.245  31.903  8.007   1.00 0.00 ? 428 THR A N    6  
ATOM   9078  C  CA   . THR A 1 71  ? 14.002  33.339  7.953   1.00 0.00 ? 428 THR A CA   6  
ATOM   9079  C  C    . THR A 1 71  ? 13.855  33.924  9.353   1.00 0.00 ? 428 THR A C    6  
ATOM   9080  O  O    . THR A 1 71  ? 13.123  34.891  9.558   1.00 0.00 ? 428 THR A O    6  
ATOM   9081  C  CB   . THR A 1 71  ? 12.737  33.665  7.137   1.00 0.00 ? 428 THR A CB   6  
ATOM   9082  O  OG1  . THR A 1 71  ? 12.568  35.084  7.042   1.00 0.00 ? 428 THR A OG1  6  
ATOM   9083  C  CG2  . THR A 1 71  ? 11.505  33.044  7.777   1.00 0.00 ? 428 THR A CG2  6  
ATOM   9084  H  H    . THR A 1 71  ? 13.505  31.300  8.232   1.00 0.00 ? 428 THR A H    6  
ATOM   9085  H  HA   . THR A 1 71  ? 14.849  33.802  7.467   1.00 0.00 ? 428 THR A HA   6  
ATOM   9086  H  HB   . THR A 1 71  ? 12.853  33.256  6.143   1.00 0.00 ? 428 THR A HB   6  
ATOM   9087  H  HG1  . THR A 1 71  ? 12.034  35.393  7.778   1.00 0.00 ? 428 THR A HG1  6  
ATOM   9088  H  HG21 . THR A 1 71  ? 11.747  32.057  8.140   1.00 0.00 ? 428 THR A HG21 6  
ATOM   9089  H  HG22 . THR A 1 71  ? 10.715  32.974  7.045   1.00 0.00 ? 428 THR A HG22 6  
ATOM   9090  H  HG23 . THR A 1 71  ? 11.179  33.661  8.602   1.00 0.00 ? 428 THR A HG23 6  
ATOM   9091  N  N    . GLY A 1 72  ? 14.557  33.331  10.314  1.00 0.00 ? 429 GLY A N    6  
ATOM   9092  C  CA   . GLY A 1 72  ? 14.491  33.808  11.683  1.00 0.00 ? 429 GLY A CA   6  
ATOM   9093  C  C    . GLY A 1 72  ? 15.829  34.311  12.187  1.00 0.00 ? 429 GLY A C    6  
ATOM   9094  O  O    . GLY A 1 72  ? 16.228  35.437  11.890  1.00 0.00 ? 429 GLY A O    6  
ATOM   9095  H  H    . GLY A 1 72  ? 15.124  32.563  10.092  1.00 0.00 ? 429 GLY A H    6  
ATOM   9096  H  HA2  . GLY A 1 72  ? 13.772  34.611  11.738  1.00 0.00 ? 429 GLY A HA2  6  
ATOM   9097  H  HA3  . GLY A 1 72  ? 14.161  32.999  12.319  1.00 0.00 ? 429 GLY A HA3  6  
ATOM   9098  N  N    . ALA A 1 73  ? 16.523  33.476  12.954  1.00 0.00 ? 430 ALA A N    6  
ATOM   9099  C  CA   . ALA A 1 73  ? 17.823  33.843  13.500  1.00 0.00 ? 430 ALA A CA   6  
ATOM   9100  C  C    . ALA A 1 73  ? 18.624  34.673  12.502  1.00 0.00 ? 430 ALA A C    6  
ATOM   9101  O  O    . ALA A 1 73  ? 19.208  35.697  12.858  1.00 0.00 ? 430 ALA A O    6  
ATOM   9102  C  CB   . ALA A 1 73  ? 18.601  32.596  13.895  1.00 0.00 ? 430 ALA A CB   6  
ATOM   9103  H  H    . ALA A 1 73  ? 16.151  32.592  13.156  1.00 0.00 ? 430 ALA A H    6  
ATOM   9104  H  HA   . ALA A 1 73  ? 17.658  34.431  14.391  1.00 0.00 ? 430 ALA A HA   6  
ATOM   9105  H  HB1  . ALA A 1 73  ? 19.106  32.769  14.833  1.00 0.00 ? 430 ALA A HB1  6  
ATOM   9106  H  HB2  . ALA A 1 73  ? 17.917  31.766  14.001  1.00 0.00 ? 430 ALA A HB2  6  
ATOM   9107  H  HB3  . ALA A 1 73  ? 19.328  32.368  13.130  1.00 0.00 ? 430 ALA A HB3  6  
ATOM   9108  N  N    . LYS A 1 74  ? 18.646  34.226  11.251  1.00 0.00 ? 431 LYS A N    6  
ATOM   9109  C  CA   . LYS A 1 74  ? 19.374  34.928  10.201  1.00 0.00 ? 431 LYS A CA   6  
ATOM   9110  C  C    . LYS A 1 74  ? 18.551  34.993  8.919   1.00 0.00 ? 431 LYS A C    6  
ATOM   9111  O  O    . LYS A 1 74  ? 18.075  33.980  8.405   1.00 0.00 ? 431 LYS A O    6  
ATOM   9112  C  CB   . LYS A 1 74  ? 20.710  34.233  9.926   1.00 0.00 ? 431 LYS A CB   6  
ATOM   9113  C  CG   . LYS A 1 74  ? 21.817  35.186  9.508   1.00 0.00 ? 431 LYS A CG   6  
ATOM   9114  C  CD   . LYS A 1 74  ? 22.521  35.786  10.714  1.00 0.00 ? 431 LYS A CD   6  
ATOM   9115  C  CE   . LYS A 1 74  ? 23.420  34.767  11.398  1.00 0.00 ? 431 LYS A CE   6  
ATOM   9116  N  NZ   . LYS A 1 74  ? 24.796  34.771  10.830  1.00 0.00 ? 431 LYS A NZ   6  
ATOM   9117  H  H    . LYS A 1 74  ? 18.161  33.404  11.029  1.00 0.00 ? 431 LYS A H    6  
ATOM   9118  H  HA   . LYS A 1 74  ? 19.565  35.933  10.544  1.00 0.00 ? 431 LYS A HA   6  
ATOM   9119  H  HB2  . LYS A 1 74  ? 21.026  33.719  10.822  1.00 0.00 ? 431 LYS A HB2  6  
ATOM   9120  H  HB3  . LYS A 1 74  ? 20.570  33.509  9.136   1.00 0.00 ? 431 LYS A HB3  6  
ATOM   9121  H  HG2  . LYS A 1 74  ? 22.539  34.646  8.915   1.00 0.00 ? 431 LYS A HG2  6  
ATOM   9122  H  HG3  . LYS A 1 74  ? 21.388  35.985  8.919   1.00 0.00 ? 431 LYS A HG3  6  
ATOM   9123  H  HD2  . LYS A 1 74  ? 23.124  36.620  10.390  1.00 0.00 ? 431 LYS A HD2  6  
ATOM   9124  H  HD3  . LYS A 1 74  ? 21.778  36.129  11.420  1.00 0.00 ? 431 LYS A HD3  6  
ATOM   9125  H  HE2  . LYS A 1 74  ? 23.473  35.002  12.450  1.00 0.00 ? 431 LYS A HE2  6  
ATOM   9126  H  HE3  . LYS A 1 74  ? 22.990  33.784  11.271  1.00 0.00 ? 431 LYS A HE3  6  
ATOM   9127  H  HZ1  . LYS A 1 74  ? 24.754  34.779  9.791   1.00 0.00 ? 431 LYS A HZ1  6  
ATOM   9128  H  HZ2  . LYS A 1 74  ? 25.313  33.923  11.139  1.00 0.00 ? 431 LYS A HZ2  6  
ATOM   9129  H  HZ3  . LYS A 1 74  ? 25.313  35.615  11.151  1.00 0.00 ? 431 LYS A HZ3  6  
ATOM   9130  N  N    . PRO A 1 75  ? 18.378  36.212  8.387   1.00 0.00 ? 432 PRO A N    6  
ATOM   9131  C  CA   . PRO A 1 75  ? 17.613  36.438  7.157   1.00 0.00 ? 432 PRO A CA   6  
ATOM   9132  C  C    . PRO A 1 75  ? 18.325  35.894  5.923   1.00 0.00 ? 432 PRO A C    6  
ATOM   9133  O  O    . PRO A 1 75  ? 17.699  35.641  4.894   1.00 0.00 ? 432 PRO A O    6  
ATOM   9134  C  CB   . PRO A 1 75  ? 17.505  37.963  7.082   1.00 0.00 ? 432 PRO A CB   6  
ATOM   9135  C  CG   . PRO A 1 75  ? 18.680  38.465  7.848   1.00 0.00 ? 432 PRO A CG   6  
ATOM   9136  C  CD   . PRO A 1 75  ? 18.917  37.464  8.945   1.00 0.00 ? 432 PRO A CD   6  
ATOM   9137  H  HA   . PRO A 1 75  ? 16.624  36.008  7.220   1.00 0.00 ? 432 PRO A HA   6  
ATOM   9138  H  HB2  . PRO A 1 75  ? 17.542  38.279  6.048   1.00 0.00 ? 432 PRO A HB2  6  
ATOM   9139  H  HB3  . PRO A 1 75  ? 16.576  38.284  7.529   1.00 0.00 ? 432 PRO A HB3  6  
ATOM   9140  H  HG2  . PRO A 1 75  ? 19.542  38.524  7.201   1.00 0.00 ? 432 PRO A HG2  6  
ATOM   9141  H  HG3  . PRO A 1 75  ? 18.457  39.435  8.268   1.00 0.00 ? 432 PRO A HG3  6  
ATOM   9142  H  HD2  . PRO A 1 75  ? 19.973  37.372  9.150   1.00 0.00 ? 432 PRO A HD2  6  
ATOM   9143  H  HD3  . PRO A 1 75  ? 18.380  37.749  9.838   1.00 0.00 ? 432 PRO A HD3  6  
ATOM   9144  N  N    . PHE A 1 76  ? 19.637  35.715  6.034   1.00 0.00 ? 433 PHE A N    6  
ATOM   9145  C  CA   . PHE A 1 76  ? 20.435  35.200  4.926   1.00 0.00 ? 433 PHE A CA   6  
ATOM   9146  C  C    . PHE A 1 76  ? 20.888  33.770  5.202   1.00 0.00 ? 433 PHE A C    6  
ATOM   9147  O  O    . PHE A 1 76  ? 21.592  33.508  6.177   1.00 0.00 ? 433 PHE A O    6  
ATOM   9148  C  CB   . PHE A 1 76  ? 21.652  36.096  4.687   1.00 0.00 ? 433 PHE A CB   6  
ATOM   9149  C  CG   . PHE A 1 76  ? 21.353  37.562  4.819   1.00 0.00 ? 433 PHE A CG   6  
ATOM   9150  C  CD1  . PHE A 1 76  ? 20.305  38.135  4.116   1.00 0.00 ? 433 PHE A CD1  6  
ATOM   9151  C  CD2  . PHE A 1 76  ? 22.119  38.367  5.646   1.00 0.00 ? 433 PHE A CD2  6  
ATOM   9152  C  CE1  . PHE A 1 76  ? 20.027  39.484  4.235   1.00 0.00 ? 433 PHE A CE1  6  
ATOM   9153  C  CE2  . PHE A 1 76  ? 21.845  39.716  5.770   1.00 0.00 ? 433 PHE A CE2  6  
ATOM   9154  C  CZ   . PHE A 1 76  ? 20.798  40.275  5.063   1.00 0.00 ? 433 PHE A CZ   6  
ATOM   9155  H  H    . PHE A 1 76  ? 20.080  35.935  6.880   1.00 0.00 ? 433 PHE A H    6  
ATOM   9156  H  HA   . PHE A 1 76  ? 19.816  35.205  4.043   1.00 0.00 ? 433 PHE A HA   6  
ATOM   9157  H  HB2  . PHE A 1 76  ? 22.419  35.849  5.405   1.00 0.00 ? 433 PHE A HB2  6  
ATOM   9158  H  HB3  . PHE A 1 76  ? 22.028  35.921  3.690   1.00 0.00 ? 433 PHE A HB3  6  
ATOM   9159  H  HD1  . PHE A 1 76  ? 19.701  37.516  3.467   1.00 0.00 ? 433 PHE A HD1  6  
ATOM   9160  H  HD2  . PHE A 1 76  ? 22.938  37.932  6.199   1.00 0.00 ? 433 PHE A HD2  6  
ATOM   9161  H  HE1  . PHE A 1 76  ? 19.208  39.917  3.681   1.00 0.00 ? 433 PHE A HE1  6  
ATOM   9162  H  HE2  . PHE A 1 76  ? 22.450  40.333  6.418   1.00 0.00 ? 433 PHE A HE2  6  
ATOM   9163  H  HZ   . PHE A 1 76  ? 20.582  41.329  5.158   1.00 0.00 ? 433 PHE A HZ   6  
ATOM   9164  N  N    . GLN A 1 77  ? 20.479  32.848  4.335   1.00 0.00 ? 434 GLN A N    6  
ATOM   9165  C  CA   . GLN A 1 77  ? 20.842  31.444  4.486   1.00 0.00 ? 434 GLN A CA   6  
ATOM   9166  C  C    . GLN A 1 77  ? 21.250  30.841  3.146   1.00 0.00 ? 434 GLN A C    6  
ATOM   9167  O  O    . GLN A 1 77  ? 20.624  31.103  2.119   1.00 0.00 ? 434 GLN A O    6  
ATOM   9168  C  CB   . GLN A 1 77  ? 19.674  30.655  5.080   1.00 0.00 ? 434 GLN A CB   6  
ATOM   9169  C  CG   . GLN A 1 77  ? 19.863  29.148  5.013   1.00 0.00 ? 434 GLN A CG   6  
ATOM   9170  C  CD   . GLN A 1 77  ? 19.326  28.548  3.729   1.00 0.00 ? 434 GLN A CD   6  
ATOM   9171  O  OE1  . GLN A 1 77  ? 19.150  29.247  2.730   1.00 0.00 ? 434 GLN A OE1  6  
ATOM   9172  N  NE2  . GLN A 1 77  ? 19.062  27.247  3.747   1.00 0.00 ? 434 GLN A NE2  6  
ATOM   9173  H  H    . GLN A 1 77  ? 19.920  33.119  3.578   1.00 0.00 ? 434 GLN A H    6  
ATOM   9174  H  HA   . GLN A 1 77  ? 21.682  31.390  5.162   1.00 0.00 ? 434 GLN A HA   6  
ATOM   9175  H  HB2  . GLN A 1 77  ? 19.555  30.936  6.115   1.00 0.00 ? 434 GLN A HB2  6  
ATOM   9176  H  HB3  . GLN A 1 77  ? 18.774  30.907  4.540   1.00 0.00 ? 434 GLN A HB3  6  
ATOM   9177  H  HG2  . GLN A 1 77  ? 20.918  28.926  5.082   1.00 0.00 ? 434 GLN A HG2  6  
ATOM   9178  H  HG3  . GLN A 1 77  ? 19.347  28.696  5.848   1.00 0.00 ? 434 GLN A HG3  6  
ATOM   9179  H  HE21 . GLN A 1 77  ? 19.225  26.754  4.579   1.00 0.00 ? 434 GLN A HE21 6  
ATOM   9180  H  HE22 . GLN A 1 77  ? 18.713  26.834  2.931   1.00 0.00 ? 434 GLN A HE22 6  
ATOM   9181  N  N    . CYS A 1 78  ? 22.304  30.032  3.163   1.00 0.00 ? 435 CYS A N    6  
ATOM   9182  C  CA   . CYS A 1 78  ? 22.797  29.391  1.950   1.00 0.00 ? 435 CYS A CA   6  
ATOM   9183  C  C    . CYS A 1 78  ? 22.149  28.024  1.755   1.00 0.00 ? 435 CYS A C    6  
ATOM   9184  O  O    . CYS A 1 78  ? 21.405  27.550  2.613   1.00 0.00 ? 435 CYS A O    6  
ATOM   9185  C  CB   . CYS A 1 78  ? 24.319  29.243  2.010   1.00 0.00 ? 435 CYS A CB   6  
ATOM   9186  S  SG   . CYS A 1 78  ? 25.124  29.180  0.376   1.00 0.00 ? 435 CYS A SG   6  
ATOM   9187  H  H    . CYS A 1 78  ? 22.762  29.861  4.014   1.00 0.00 ? 435 CYS A H    6  
ATOM   9188  H  HA   . CYS A 1 78  ? 22.538  30.022  1.113   1.00 0.00 ? 435 CYS A HA   6  
ATOM   9189  H  HB2  . CYS A 1 78  ? 24.734  30.082  2.547   1.00 0.00 ? 435 CYS A HB2  6  
ATOM   9190  H  HB3  . CYS A 1 78  ? 24.564  28.330  2.533   1.00 0.00 ? 435 CYS A HB3  6  
ATOM   9191  N  N    . GLY A 1 79  ? 22.437  27.395  0.619   1.00 0.00 ? 436 GLY A N    6  
ATOM   9192  C  CA   . GLY A 1 79  ? 21.874  26.089  0.331   1.00 0.00 ? 436 GLY A CA   6  
ATOM   9193  C  C    . GLY A 1 79  ? 22.916  24.988  0.369   1.00 0.00 ? 436 GLY A C    6  
ATOM   9194  O  O    . GLY A 1 79  ? 22.832  24.072  1.188   1.00 0.00 ? 436 GLY A O    6  
ATOM   9195  H  H    . GLY A 1 79  ? 23.036  27.822  -0.028  1.00 0.00 ? 436 GLY A H    6  
ATOM   9196  H  HA2  . GLY A 1 79  ? 21.108  25.870  1.060   1.00 0.00 ? 436 GLY A HA2  6  
ATOM   9197  H  HA3  . GLY A 1 79  ? 21.427  26.111  -0.652  1.00 0.00 ? 436 GLY A HA3  6  
ATOM   9198  N  N    . VAL A 1 80  ? 23.899  25.075  -0.521  1.00 0.00 ? 437 VAL A N    6  
ATOM   9199  C  CA   . VAL A 1 80  ? 24.961  24.078  -0.586  1.00 0.00 ? 437 VAL A CA   6  
ATOM   9200  C  C    . VAL A 1 80  ? 25.578  23.841  0.788   1.00 0.00 ? 437 VAL A C    6  
ATOM   9201  O  O    . VAL A 1 80  ? 25.553  22.724  1.307   1.00 0.00 ? 437 VAL A O    6  
ATOM   9202  C  CB   . VAL A 1 80  ? 26.069  24.502  -1.568  1.00 0.00 ? 437 VAL A CB   6  
ATOM   9203  C  CG1  . VAL A 1 80  ? 27.215  23.501  -1.546  1.00 0.00 ? 437 VAL A CG1  6  
ATOM   9204  C  CG2  . VAL A 1 80  ? 25.507  24.650  -2.974  1.00 0.00 ? 437 VAL A CG2  6  
ATOM   9205  H  H    . VAL A 1 80  ? 23.911  25.828  -1.148  1.00 0.00 ? 437 VAL A H    6  
ATOM   9206  H  HA   . VAL A 1 80  ? 24.529  23.153  -0.941  1.00 0.00 ? 437 VAL A HA   6  
ATOM   9207  H  HB   . VAL A 1 80  ? 26.453  25.462  -1.253  1.00 0.00 ? 437 VAL A HB   6  
ATOM   9208  H  HG11 . VAL A 1 80  ? 26.898  22.582  -2.016  1.00 0.00 ? 437 VAL A HG11 6  
ATOM   9209  H  HG12 . VAL A 1 80  ? 28.060  23.909  -2.081  1.00 0.00 ? 437 VAL A HG12 6  
ATOM   9210  H  HG13 . VAL A 1 80  ? 27.498  23.302  -0.522  1.00 0.00 ? 437 VAL A HG13 6  
ATOM   9211  H  HG21 . VAL A 1 80  ? 26.285  24.452  -3.696  1.00 0.00 ? 437 VAL A HG21 6  
ATOM   9212  H  HG22 . VAL A 1 80  ? 24.699  23.948  -3.113  1.00 0.00 ? 437 VAL A HG22 6  
ATOM   9213  H  HG23 . VAL A 1 80  ? 25.138  25.656  -3.110  1.00 0.00 ? 437 VAL A HG23 6  
ATOM   9214  N  N    . CYS A 1 81  ? 26.130  24.898  1.373   1.00 0.00 ? 438 CYS A N    6  
ATOM   9215  C  CA   . CYS A 1 81  ? 26.754  24.806  2.687   1.00 0.00 ? 438 CYS A CA   6  
ATOM   9216  C  C    . CYS A 1 81  ? 25.715  24.958  3.794   1.00 0.00 ? 438 CYS A C    6  
ATOM   9217  O  O    . CYS A 1 81  ? 25.940  24.546  4.931   1.00 0.00 ? 438 CYS A O    6  
ATOM   9218  C  CB   . CYS A 1 81  ? 27.835  25.878  2.837   1.00 0.00 ? 438 CYS A CB   6  
ATOM   9219  S  SG   . CYS A 1 81  ? 27.185  27.553  3.138   1.00 0.00 ? 438 CYS A SG   6  
ATOM   9220  H  H    . CYS A 1 81  ? 26.119  25.762  0.908   1.00 0.00 ? 438 CYS A H    6  
ATOM   9221  H  HA   . CYS A 1 81  ? 27.211  23.832  2.770   1.00 0.00 ? 438 CYS A HA   6  
ATOM   9222  H  HB2  . CYS A 1 81  ? 28.474  25.621  3.670   1.00 0.00 ? 438 CYS A HB2  6  
ATOM   9223  H  HB3  . CYS A 1 81  ? 28.426  25.912  1.934   1.00 0.00 ? 438 CYS A HB3  6  
ATOM   9224  N  N    . ASN A 1 82  ? 24.576  25.551  3.452   1.00 0.00 ? 439 ASN A N    6  
ATOM   9225  C  CA   . ASN A 1 82  ? 23.501  25.757  4.416   1.00 0.00 ? 439 ASN A CA   6  
ATOM   9226  C  C    . ASN A 1 82  ? 24.014  26.489  5.653   1.00 0.00 ? 439 ASN A C    6  
ATOM   9227  O  O    . ASN A 1 82  ? 23.813  26.038  6.781   1.00 0.00 ? 439 ASN A O    6  
ATOM   9228  C  CB   . ASN A 1 82  ? 22.887  24.416  4.821   1.00 0.00 ? 439 ASN A CB   6  
ATOM   9229  C  CG   . ASN A 1 82  ? 21.807  23.960  3.859   1.00 0.00 ? 439 ASN A CG   6  
ATOM   9230  O  OD1  . ASN A 1 82  ? 21.296  24.749  3.064   1.00 0.00 ? 439 ASN A OD1  6  
ATOM   9231  N  ND2  . ASN A 1 82  ? 21.455  22.681  3.927   1.00 0.00 ? 439 ASN A ND2  6  
ATOM   9232  H  H    . ASN A 1 82  ? 24.455  25.858  2.529   1.00 0.00 ? 439 ASN A H    6  
ATOM   9233  H  HA   . ASN A 1 82  ? 22.743  26.362  3.943   1.00 0.00 ? 439 ASN A HA   6  
ATOM   9234  H  HB2  . ASN A 1 82  ? 23.663  23.664  4.843   1.00 0.00 ? 439 ASN A HB2  6  
ATOM   9235  H  HB3  . ASN A 1 82  ? 22.452  24.508  5.805   1.00 0.00 ? 439 ASN A HB3  6  
ATOM   9236  H  HD21 . ASN A 1 82  ? 21.906  22.111  4.585   1.00 0.00 ? 439 ASN A HD21 6  
ATOM   9237  H  HD22 . ASN A 1 82  ? 20.760  22.360  3.316   1.00 0.00 ? 439 ASN A HD22 6  
ATOM   9238  N  N    . ARG A 1 83  ? 24.675  27.620  5.433   1.00 0.00 ? 440 ARG A N    6  
ATOM   9239  C  CA   . ARG A 1 83  ? 25.217  28.414  6.529   1.00 0.00 ? 440 ARG A CA   6  
ATOM   9240  C  C    . ARG A 1 83  ? 24.433  29.712  6.699   1.00 0.00 ? 440 ARG A C    6  
ATOM   9241  O  O    . ARG A 1 83  ? 23.532  30.012  5.916   1.00 0.00 ? 440 ARG A O    6  
ATOM   9242  C  CB   . ARG A 1 83  ? 26.694  28.726  6.280   1.00 0.00 ? 440 ARG A CB   6  
ATOM   9243  C  CG   . ARG A 1 83  ? 27.613  27.535  6.496   1.00 0.00 ? 440 ARG A CG   6  
ATOM   9244  C  CD   . ARG A 1 83  ? 29.049  27.865  6.120   1.00 0.00 ? 440 ARG A CD   6  
ATOM   9245  N  NE   . ARG A 1 83  ? 29.963  26.771  6.441   1.00 0.00 ? 440 ARG A NE   6  
ATOM   9246  C  CZ   . ARG A 1 83  ? 30.429  26.537  7.663   1.00 0.00 ? 440 ARG A CZ   6  
ATOM   9247  N  NH1  . ARG A 1 83  ? 30.069  27.315  8.674   1.00 0.00 ? 440 ARG A NH1  6  
ATOM   9248  N  NH2  . ARG A 1 83  ? 31.258  25.523  7.875   1.00 0.00 ? 440 ARG A NH2  6  
ATOM   9249  H  H    . ARG A 1 83  ? 24.803  27.928  4.511   1.00 0.00 ? 440 ARG A H    6  
ATOM   9250  H  HA   . ARG A 1 83  ? 25.129  27.833  7.435   1.00 0.00 ? 440 ARG A HA   6  
ATOM   9251  H  HB2  . ARG A 1 83  ? 26.812  29.063  5.260   1.00 0.00 ? 440 ARG A HB2  6  
ATOM   9252  H  HB3  . ARG A 1 83  ? 27.000  29.516  6.949   1.00 0.00 ? 440 ARG A HB3  6  
ATOM   9253  H  HG2  . ARG A 1 83  ? 27.581  27.252  7.538   1.00 0.00 ? 440 ARG A HG2  6  
ATOM   9254  H  HG3  . ARG A 1 83  ? 27.270  26.712  5.887   1.00 0.00 ? 440 ARG A HG3  6  
ATOM   9255  H  HD2  . ARG A 1 83  ? 29.094  28.059  5.059   1.00 0.00 ? 440 ARG A HD2  6  
ATOM   9256  H  HD3  . ARG A 1 83  ? 29.355  28.748  6.661   1.00 0.00 ? 440 ARG A HD3  6  
ATOM   9257  H  HE   . ARG A 1 83  ? 30.243  26.184  5.708   1.00 0.00 ? 440 ARG A HE   6  
ATOM   9258  H  HH11 . ARG A 1 83  ? 29.444  28.080  8.517   1.00 0.00 ? 440 ARG A HH11 6  
ATOM   9259  H  HH12 . ARG A 1 83  ? 30.420  27.136  9.593   1.00 0.00 ? 440 ARG A HH12 6  
ATOM   9260  H  HH21 . ARG A 1 83  ? 31.531  24.934  7.115   1.00 0.00 ? 440 ARG A HH21 6  
ATOM   9261  H  HH22 . ARG A 1 83  ? 31.608  25.347  8.794   1.00 0.00 ? 440 ARG A HH22 6  
ATOM   9262  N  N    . SER A 1 84  ? 24.783  30.478  7.727   1.00 0.00 ? 441 SER A N    6  
ATOM   9263  C  CA   . SER A 1 84  ? 24.110  31.742  8.003   1.00 0.00 ? 441 SER A CA   6  
ATOM   9264  C  C    . SER A 1 84  ? 25.090  32.908  7.926   1.00 0.00 ? 441 SER A C    6  
ATOM   9265  O  O    . SER A 1 84  ? 26.266  32.769  8.265   1.00 0.00 ? 441 SER A O    6  
ATOM   9266  C  CB   . SER A 1 84  ? 23.453  31.704  9.384   1.00 0.00 ? 441 SER A CB   6  
ATOM   9267  O  OG   . SER A 1 84  ? 22.733  30.498  9.573   1.00 0.00 ? 441 SER A OG   6  
ATOM   9268  H  H    . SER A 1 84  ? 25.510  30.185  8.316   1.00 0.00 ? 441 SER A H    6  
ATOM   9269  H  HA   . SER A 1 84  ? 23.345  31.880  7.254   1.00 0.00 ? 441 SER A HA   6  
ATOM   9270  H  HB2  . SER A 1 84  ? 24.215  31.777  10.145  1.00 0.00 ? 441 SER A HB2  6  
ATOM   9271  H  HB3  . SER A 1 84  ? 22.770  32.536  9.478   1.00 0.00 ? 441 SER A HB3  6  
ATOM   9272  H  HG   . SER A 1 84  ? 22.161  30.344  8.818   1.00 0.00 ? 441 SER A HG   6  
ATOM   9273  N  N    . PHE A 1 85  ? 24.598  34.058  7.478   1.00 0.00 ? 442 PHE A N    6  
ATOM   9274  C  CA   . PHE A 1 85  ? 25.430  35.250  7.355   1.00 0.00 ? 442 PHE A CA   6  
ATOM   9275  C  C    . PHE A 1 85  ? 24.755  36.454  8.003   1.00 0.00 ? 442 PHE A C    6  
ATOM   9276  O  O    . PHE A 1 85  ? 23.532  36.591  7.963   1.00 0.00 ? 442 PHE A O    6  
ATOM   9277  C  CB   . PHE A 1 85  ? 25.720  35.545  5.882   1.00 0.00 ? 442 PHE A CB   6  
ATOM   9278  C  CG   . PHE A 1 85  ? 26.334  34.388  5.147   1.00 0.00 ? 442 PHE A CG   6  
ATOM   9279  C  CD1  . PHE A 1 85  ? 25.583  33.263  4.849   1.00 0.00 ? 442 PHE A CD1  6  
ATOM   9280  C  CD2  . PHE A 1 85  ? 27.662  34.425  4.755   1.00 0.00 ? 442 PHE A CD2  6  
ATOM   9281  C  CE1  . PHE A 1 85  ? 26.146  32.196  4.174   1.00 0.00 ? 442 PHE A CE1  6  
ATOM   9282  C  CE2  . PHE A 1 85  ? 28.231  33.362  4.080   1.00 0.00 ? 442 PHE A CE2  6  
ATOM   9283  C  CZ   . PHE A 1 85  ? 27.471  32.246  3.788   1.00 0.00 ? 442 PHE A CZ   6  
ATOM   9284  H  H    . PHE A 1 85  ? 23.653  34.107  7.223   1.00 0.00 ? 442 PHE A H    6  
ATOM   9285  H  HA   . PHE A 1 85  ? 26.362  35.057  7.864   1.00 0.00 ? 442 PHE A HA   6  
ATOM   9286  H  HB2  . PHE A 1 85  ? 24.796  35.800  5.385   1.00 0.00 ? 442 PHE A HB2  6  
ATOM   9287  H  HB3  . PHE A 1 85  ? 26.401  36.380  5.817   1.00 0.00 ? 442 PHE A HB3  6  
ATOM   9288  H  HD1  . PHE A 1 85  ? 24.546  33.222  5.149   1.00 0.00 ? 442 PHE A HD1  6  
ATOM   9289  H  HD2  . PHE A 1 85  ? 28.258  35.298  4.983   1.00 0.00 ? 442 PHE A HD2  6  
ATOM   9290  H  HE1  . PHE A 1 85  ? 25.549  31.325  3.947   1.00 0.00 ? 442 PHE A HE1  6  
ATOM   9291  H  HE2  . PHE A 1 85  ? 29.267  33.404  3.780   1.00 0.00 ? 442 PHE A HE2  6  
ATOM   9292  H  HZ   . PHE A 1 85  ? 27.913  31.414  3.261   1.00 0.00 ? 442 PHE A HZ   6  
ATOM   9293  N  N    . SER A 1 86  ? 25.560  37.325  8.603   1.00 0.00 ? 443 SER A N    6  
ATOM   9294  C  CA   . SER A 1 86  ? 25.041  38.517  9.264   1.00 0.00 ? 443 SER A CA   6  
ATOM   9295  C  C    . SER A 1 86  ? 24.737  39.613  8.249   1.00 0.00 ? 443 SER A C    6  
ATOM   9296  O  O    . SER A 1 86  ? 23.707  40.282  8.331   1.00 0.00 ? 443 SER A O    6  
ATOM   9297  C  CB   . SER A 1 86  ? 26.044  39.029  10.300  1.00 0.00 ? 443 SER A CB   6  
ATOM   9298  O  OG   . SER A 1 86  ? 27.292  39.327  9.697   1.00 0.00 ? 443 SER A OG   6  
ATOM   9299  H  H    . SER A 1 86  ? 26.527  37.161  8.601   1.00 0.00 ? 443 SER A H    6  
ATOM   9300  H  HA   . SER A 1 86  ? 24.125  38.244  9.767   1.00 0.00 ? 443 SER A HA   6  
ATOM   9301  H  HB2  . SER A 1 86  ? 25.657  39.925  10.760  1.00 0.00 ? 443 SER A HB2  6  
ATOM   9302  H  HB3  . SER A 1 86  ? 26.195  38.272  11.056  1.00 0.00 ? 443 SER A HB3  6  
ATOM   9303  H  HG   . SER A 1 86  ? 27.946  38.683  9.978   1.00 0.00 ? 443 SER A HG   6  
ATOM   9304  N  N    . ARG A 1 87  ? 25.641  39.792  7.291   1.00 0.00 ? 444 ARG A N    6  
ATOM   9305  C  CA   . ARG A 1 87  ? 25.472  40.808  6.260   1.00 0.00 ? 444 ARG A CA   6  
ATOM   9306  C  C    . ARG A 1 87  ? 25.066  40.173  4.933   1.00 0.00 ? 444 ARG A C    6  
ATOM   9307  O  O    . ARG A 1 87  ? 25.116  38.953  4.776   1.00 0.00 ? 444 ARG A O    6  
ATOM   9308  C  CB   . ARG A 1 87  ? 26.765  41.605  6.081   1.00 0.00 ? 444 ARG A CB   6  
ATOM   9309  C  CG   . ARG A 1 87  ? 27.072  42.536  7.244   1.00 0.00 ? 444 ARG A CG   6  
ATOM   9310  C  CD   . ARG A 1 87  ? 28.105  43.584  6.860   1.00 0.00 ? 444 ARG A CD   6  
ATOM   9311  N  NE   . ARG A 1 87  ? 28.181  44.662  7.842   1.00 0.00 ? 444 ARG A NE   6  
ATOM   9312  C  CZ   . ARG A 1 87  ? 28.667  45.869  7.573   1.00 0.00 ? 444 ARG A CZ   6  
ATOM   9313  N  NH1  . ARG A 1 87  ? 29.118  46.149  6.358   1.00 0.00 ? 444 ARG A NH1  6  
ATOM   9314  N  NH2  . ARG A 1 87  ? 28.703  46.798  8.519   1.00 0.00 ? 444 ARG A NH2  6  
ATOM   9315  H  H    . ARG A 1 87  ? 26.443  39.228  7.279   1.00 0.00 ? 444 ARG A H    6  
ATOM   9316  H  HA   . ARG A 1 87  ? 24.688  41.478  6.579   1.00 0.00 ? 444 ARG A HA   6  
ATOM   9317  H  HB2  . ARG A 1 87  ? 27.589  40.915  5.975   1.00 0.00 ? 444 ARG A HB2  6  
ATOM   9318  H  HB3  . ARG A 1 87  ? 26.686  42.200  5.184   1.00 0.00 ? 444 ARG A HB3  6  
ATOM   9319  H  HG2  . ARG A 1 87  ? 26.163  43.035  7.543   1.00 0.00 ? 444 ARG A HG2  6  
ATOM   9320  H  HG3  . ARG A 1 87  ? 27.453  41.952  8.068   1.00 0.00 ? 444 ARG A HG3  6  
ATOM   9321  H  HD2  . ARG A 1 87  ? 29.071  43.108  6.787   1.00 0.00 ? 444 ARG A HD2  6  
ATOM   9322  H  HD3  . ARG A 1 87  ? 27.836  44.001  5.901   1.00 0.00 ? 444 ARG A HD3  6  
ATOM   9323  H  HE   . ARG A 1 87  ? 27.853  44.477  8.746   1.00 0.00 ? 444 ARG A HE   6  
ATOM   9324  H  HH11 . ARG A 1 87  ? 29.091  45.452  5.642   1.00 0.00 ? 444 ARG A HH11 6  
ATOM   9325  H  HH12 . ARG A 1 87  ? 29.482  47.059  6.157   1.00 0.00 ? 444 ARG A HH12 6  
ATOM   9326  H  HH21 . ARG A 1 87  ? 28.364  46.590  9.436   1.00 0.00 ? 444 ARG A HH21 6  
ATOM   9327  H  HH22 . ARG A 1 87  ? 29.069  47.705  8.316   1.00 0.00 ? 444 ARG A HH22 6  
ATOM   9328  N  N    . SER A 1 88  ? 24.663  41.009  3.981   1.00 0.00 ? 445 SER A N    6  
ATOM   9329  C  CA   . SER A 1 88  ? 24.244  40.530  2.670   1.00 0.00 ? 445 SER A CA   6  
ATOM   9330  C  C    . SER A 1 88  ? 25.448  40.341  1.750   1.00 0.00 ? 445 SER A C    6  
ATOM   9331  O  O    . SER A 1 88  ? 25.671  39.254  1.217   1.00 0.00 ? 445 SER A O    6  
ATOM   9332  C  CB   . SER A 1 88  ? 23.254  41.509  2.037   1.00 0.00 ? 445 SER A CB   6  
ATOM   9333  O  OG   . SER A 1 88  ? 22.221  41.848  2.946   1.00 0.00 ? 445 SER A OG   6  
ATOM   9334  H  H    . SER A 1 88  ? 24.645  41.972  4.167   1.00 0.00 ? 445 SER A H    6  
ATOM   9335  H  HA   . SER A 1 88  ? 23.757  39.576  2.805   1.00 0.00 ? 445 SER A HA   6  
ATOM   9336  H  HB2  . SER A 1 88  ? 23.775  42.411  1.752   1.00 0.00 ? 445 SER A HB2  6  
ATOM   9337  H  HB3  . SER A 1 88  ? 22.813  41.056  1.161   1.00 0.00 ? 445 SER A HB3  6  
ATOM   9338  H  HG   . SER A 1 88  ? 22.534  41.728  3.846   1.00 0.00 ? 445 SER A HG   6  
ATOM   9339  N  N    . ASP A 1 89  ? 26.219  41.408  1.570   1.00 0.00 ? 446 ASP A N    6  
ATOM   9340  C  CA   . ASP A 1 89  ? 27.400  41.361  0.717   1.00 0.00 ? 446 ASP A CA   6  
ATOM   9341  C  C    . ASP A 1 89  ? 28.130  40.031  0.871   1.00 0.00 ? 446 ASP A C    6  
ATOM   9342  O  O    . ASP A 1 89  ? 28.509  39.400  -0.117  1.00 0.00 ? 446 ASP A O    6  
ATOM   9343  C  CB   . ASP A 1 89  ? 28.344  42.517  1.053   1.00 0.00 ? 446 ASP A CB   6  
ATOM   9344  C  CG   . ASP A 1 89  ? 27.968  43.799  0.336   1.00 0.00 ? 446 ASP A CG   6  
ATOM   9345  O  OD1  . ASP A 1 89  ? 27.770  43.753  -0.896  1.00 0.00 ? 446 ASP A OD1  6  
ATOM   9346  O  OD2  . ASP A 1 89  ? 27.872  44.848  1.007   1.00 0.00 ? 446 ASP A OD2  6  
ATOM   9347  H  H    . ASP A 1 89  ? 25.988  42.246  2.022   1.00 0.00 ? 446 ASP A H    6  
ATOM   9348  H  HA   . ASP A 1 89  ? 27.074  41.462  -0.307  1.00 0.00 ? 446 ASP A HA   6  
ATOM   9349  H  HB2  . ASP A 1 89  ? 28.315  42.700  2.117   1.00 0.00 ? 446 ASP A HB2  6  
ATOM   9350  H  HB3  . ASP A 1 89  ? 29.350  42.247  0.766   1.00 0.00 ? 446 ASP A HB3  6  
ATOM   9351  N  N    . HIS A 1 90  ? 28.325  39.609  2.117   1.00 0.00 ? 447 HIS A N    6  
ATOM   9352  C  CA   . HIS A 1 90  ? 29.010  38.353  2.400   1.00 0.00 ? 447 HIS A CA   6  
ATOM   9353  C  C    . HIS A 1 90  ? 28.339  37.192  1.674   1.00 0.00 ? 447 HIS A C    6  
ATOM   9354  O  O    . HIS A 1 90  ? 29.004  36.386  1.022   1.00 0.00 ? 447 HIS A O    6  
ATOM   9355  C  CB   . HIS A 1 90  ? 29.028  38.087  3.906   1.00 0.00 ? 447 HIS A CB   6  
ATOM   9356  C  CG   . HIS A 1 90  ? 29.926  39.013  4.667   1.00 0.00 ? 447 HIS A CG   6  
ATOM   9357  N  ND1  . HIS A 1 90  ? 29.668  39.417  5.960   1.00 0.00 ? 447 HIS A ND1  6  
ATOM   9358  C  CD2  . HIS A 1 90  ? 31.086  39.613  4.311   1.00 0.00 ? 447 HIS A CD2  6  
ATOM   9359  C  CE1  . HIS A 1 90  ? 30.630  40.227  6.366   1.00 0.00 ? 447 HIS A CE1  6  
ATOM   9360  N  NE2  . HIS A 1 90  ? 31.503  40.362  5.384   1.00 0.00 ? 447 HIS A NE2  6  
ATOM   9361  H  H    . HIS A 1 90  ? 28.000  40.156  2.862   1.00 0.00 ? 447 HIS A H    6  
ATOM   9362  H  HA   . HIS A 1 90  ? 30.026  38.443  2.047   1.00 0.00 ? 447 HIS A HA   6  
ATOM   9363  H  HB2  . HIS A 1 90  ? 28.028  38.200  4.297   1.00 0.00 ? 447 HIS A HB2  6  
ATOM   9364  H  HB3  . HIS A 1 90  ? 29.367  37.076  4.082   1.00 0.00 ? 447 HIS A HB3  6  
ATOM   9365  H  HD1  . HIS A 1 90  ? 28.895  39.151  6.499   1.00 0.00 ? 447 HIS A HD1  6  
ATOM   9366  H  HD2  . HIS A 1 90  ? 31.590  39.521  3.360   1.00 0.00 ? 447 HIS A HD2  6  
ATOM   9367  H  HE1  . HIS A 1 90  ? 30.692  40.698  7.336   1.00 0.00 ? 447 HIS A HE1  6  
ATOM   9368  N  N    . LEU A 1 91  ? 27.018  37.112  1.791   1.00 0.00 ? 448 LEU A N    6  
ATOM   9369  C  CA   . LEU A 1 91  ? 26.256  36.048  1.147   1.00 0.00 ? 448 LEU A CA   6  
ATOM   9370  C  C    . LEU A 1 91  ? 26.486  36.051  -0.361  1.00 0.00 ? 448 LEU A C    6  
ATOM   9371  O  O    . LEU A 1 91  ? 26.910  35.049  -0.936  1.00 0.00 ? 448 LEU A O    6  
ATOM   9372  C  CB   . LEU A 1 91  ? 24.764  36.208  1.447   1.00 0.00 ? 448 LEU A CB   6  
ATOM   9373  C  CG   . LEU A 1 91  ? 23.827  35.240  0.725   1.00 0.00 ? 448 LEU A CG   6  
ATOM   9374  C  CD1  . LEU A 1 91  ? 23.943  33.844  1.316   1.00 0.00 ? 448 LEU A CD1  6  
ATOM   9375  C  CD2  . LEU A 1 91  ? 22.389  35.734  0.799   1.00 0.00 ? 448 LEU A CD2  6  
ATOM   9376  H  H    . LEU A 1 91  ? 26.543  37.783  2.324   1.00 0.00 ? 448 LEU A H    6  
ATOM   9377  H  HA   . LEU A 1 91  ? 26.596  35.106  1.549   1.00 0.00 ? 448 LEU A HA   6  
ATOM   9378  H  HB2  . LEU A 1 91  ? 24.625  36.074  2.508   1.00 0.00 ? 448 LEU A HB2  6  
ATOM   9379  H  HB3  . LEU A 1 91  ? 24.479  37.214  1.172   1.00 0.00 ? 448 LEU A HB3  6  
ATOM   9380  H  HG   . LEU A 1 91  ? 24.109  35.185  -0.317  1.00 0.00 ? 448 LEU A HG   6  
ATOM   9381  H  HD11 . LEU A 1 91  ? 24.190  33.916  2.365   1.00 0.00 ? 448 LEU A HD11 6  
ATOM   9382  H  HD12 . LEU A 1 91  ? 24.719  33.298  0.800   1.00 0.00 ? 448 LEU A HD12 6  
ATOM   9383  H  HD13 . LEU A 1 91  ? 23.002  33.325  1.202   1.00 0.00 ? 448 LEU A HD13 6  
ATOM   9384  H  HD21 . LEU A 1 91  ? 21.789  35.018  1.340   1.00 0.00 ? 448 LEU A HD21 6  
ATOM   9385  H  HD22 . LEU A 1 91  ? 21.997  35.851  -0.201  1.00 0.00 ? 448 LEU A HD22 6  
ATOM   9386  H  HD23 . LEU A 1 91  ? 22.362  36.686  1.310   1.00 0.00 ? 448 LEU A HD23 6  
ATOM   9387  N  N    . ALA A 1 92  ? 26.204  37.184  -0.996  1.00 0.00 ? 449 ALA A N    6  
ATOM   9388  C  CA   . ALA A 1 92  ? 26.385  37.318  -2.436  1.00 0.00 ? 449 ALA A CA   6  
ATOM   9389  C  C    . ALA A 1 92  ? 27.778  36.866  -2.859  1.00 0.00 ? 449 ALA A C    6  
ATOM   9390  O  O    . ALA A 1 92  ? 27.924  35.952  -3.672  1.00 0.00 ? 449 ALA A O    6  
ATOM   9391  C  CB   . ALA A 1 92  ? 26.142  38.758  -2.866  1.00 0.00 ? 449 ALA A CB   6  
ATOM   9392  H  H    . ALA A 1 92  ? 25.869  37.948  -0.483  1.00 0.00 ? 449 ALA A H    6  
ATOM   9393  H  HA   . ALA A 1 92  ? 25.650  36.694  -2.924  1.00 0.00 ? 449 ALA A HA   6  
ATOM   9394  H  HB1  . ALA A 1 92  ? 26.972  39.099  -3.465  1.00 0.00 ? 449 ALA A HB1  6  
ATOM   9395  H  HB2  . ALA A 1 92  ? 25.233  38.810  -3.447  1.00 0.00 ? 449 ALA A HB2  6  
ATOM   9396  H  HB3  . ALA A 1 92  ? 26.047  39.383  -1.991  1.00 0.00 ? 449 ALA A HB3  6  
ATOM   9397  N  N    . LEU A 1 93  ? 28.798  37.510  -2.305  1.00 0.00 ? 450 LEU A N    6  
ATOM   9398  C  CA   . LEU A 1 93  ? 30.181  37.174  -2.625  1.00 0.00 ? 450 LEU A CA   6  
ATOM   9399  C  C    . LEU A 1 93  ? 30.483  35.720  -2.276  1.00 0.00 ? 450 LEU A C    6  
ATOM   9400  O  O    . LEU A 1 93  ? 31.252  35.052  -2.968  1.00 0.00 ? 450 LEU A O    6  
ATOM   9401  C  CB   . LEU A 1 93  ? 31.139  38.100  -1.875  1.00 0.00 ? 450 LEU A CB   6  
ATOM   9402  C  CG   . LEU A 1 93  ? 32.527  38.274  -2.493  1.00 0.00 ? 450 LEU A CG   6  
ATOM   9403  C  CD1  . LEU A 1 93  ? 32.537  39.447  -3.461  1.00 0.00 ? 450 LEU A CD1  6  
ATOM   9404  C  CD2  . LEU A 1 93  ? 33.574  38.468  -1.406  1.00 0.00 ? 450 LEU A CD2  6  
ATOM   9405  H  H    . LEU A 1 93  ? 28.619  38.229  -1.664  1.00 0.00 ? 450 LEU A H    6  
ATOM   9406  H  HA   . LEU A 1 93  ? 30.318  37.313  -3.688  1.00 0.00 ? 450 LEU A HA   6  
ATOM   9407  H  HB2  . LEU A 1 93  ? 30.679  39.075  -1.816  1.00 0.00 ? 450 LEU A HB2  6  
ATOM   9408  H  HB3  . LEU A 1 93  ? 31.267  37.704  -0.877  1.00 0.00 ? 450 LEU A HB3  6  
ATOM   9409  H  HG   . LEU A 1 93  ? 32.781  37.381  -3.048  1.00 0.00 ? 450 LEU A HG   6  
ATOM   9410  H  HD11 . LEU A 1 93  ? 32.288  40.353  -2.931  1.00 0.00 ? 450 LEU A HD11 6  
ATOM   9411  H  HD12 . LEU A 1 93  ? 31.811  39.275  -4.242  1.00 0.00 ? 450 LEU A HD12 6  
ATOM   9412  H  HD13 . LEU A 1 93  ? 33.520  39.544  -3.898  1.00 0.00 ? 450 LEU A HD13 6  
ATOM   9413  H  HD21 . LEU A 1 93  ? 33.314  37.871  -0.544  1.00 0.00 ? 450 LEU A HD21 6  
ATOM   9414  H  HD22 . LEU A 1 93  ? 33.612  39.510  -1.125  1.00 0.00 ? 450 LEU A HD22 6  
ATOM   9415  H  HD23 . LEU A 1 93  ? 34.541  38.161  -1.779  1.00 0.00 ? 450 LEU A HD23 6  
ATOM   9416  N  N    . HIS A 1 94  ? 29.871  35.236  -1.201  1.00 0.00 ? 451 HIS A N    6  
ATOM   9417  C  CA   . HIS A 1 94  ? 30.072  33.859  -0.761  1.00 0.00 ? 451 HIS A CA   6  
ATOM   9418  C  C    . HIS A 1 94  ? 29.634  32.875  -1.841  1.00 0.00 ? 451 HIS A C    6  
ATOM   9419  O  O    . HIS A 1 94  ? 30.313  31.883  -2.103  1.00 0.00 ? 451 HIS A O    6  
ATOM   9420  C  CB   . HIS A 1 94  ? 29.297  33.596  0.531   1.00 0.00 ? 451 HIS A CB   6  
ATOM   9421  C  CG   . HIS A 1 94  ? 29.124  32.140  0.838   1.00 0.00 ? 451 HIS A CG   6  
ATOM   9422  N  ND1  . HIS A 1 94  ? 29.986  31.435  1.651   1.00 0.00 ? 451 HIS A ND1  6  
ATOM   9423  C  CD2  . HIS A 1 94  ? 28.179  31.258  0.438   1.00 0.00 ? 451 HIS A CD2  6  
ATOM   9424  C  CE1  . HIS A 1 94  ? 29.580  30.181  1.736   1.00 0.00 ? 451 HIS A CE1  6  
ATOM   9425  N  NE2  . HIS A 1 94  ? 28.485  30.047  1.010   1.00 0.00 ? 451 HIS A NE2  6  
ATOM   9426  H  H    . HIS A 1 94  ? 29.269  35.817  -0.691  1.00 0.00 ? 451 HIS A H    6  
ATOM   9427  H  HA   . HIS A 1 94  ? 31.126  33.722  -0.573  1.00 0.00 ? 451 HIS A HA   6  
ATOM   9428  H  HB2  . HIS A 1 94  ? 29.825  34.048  1.357   1.00 0.00 ? 451 HIS A HB2  6  
ATOM   9429  H  HB3  . HIS A 1 94  ? 28.315  34.038  0.451   1.00 0.00 ? 451 HIS A HB3  6  
ATOM   9430  H  HD1  . HIS A 1 94  ? 30.778  31.799  2.097   1.00 0.00 ? 451 HIS A HD1  6  
ATOM   9431  H  HD2  . HIS A 1 94  ? 27.340  31.466  -0.211  1.00 0.00 ? 451 HIS A HD2  6  
ATOM   9432  H  HE1  . HIS A 1 94  ? 30.060  29.398  2.304   1.00 0.00 ? 451 HIS A HE1  6  
ATOM   9433  N  N    . MET A 1 95  ? 28.494  33.156  -2.464  1.00 0.00 ? 452 MET A N    6  
ATOM   9434  C  CA   . MET A 1 95  ? 27.965  32.295  -3.516  1.00 0.00 ? 452 MET A CA   6  
ATOM   9435  C  C    . MET A 1 95  ? 29.006  32.070  -4.608  1.00 0.00 ? 452 MET A C    6  
ATOM   9436  O  O    . MET A 1 95  ? 29.207  30.946  -5.067  1.00 0.00 ? 452 MET A O    6  
ATOM   9437  C  CB   . MET A 1 95  ? 26.700  32.908  -4.118  1.00 0.00 ? 452 MET A CB   6  
ATOM   9438  C  CG   . MET A 1 95  ? 25.550  33.023  -3.130  1.00 0.00 ? 452 MET A CG   6  
ATOM   9439  S  SD   . MET A 1 95  ? 25.274  31.500  -2.205  1.00 0.00 ? 452 MET A SD   6  
ATOM   9440  C  CE   . MET A 1 95  ? 24.653  30.427  -3.497  1.00 0.00 ? 452 MET A CE   6  
ATOM   9441  H  H    . MET A 1 95  ? 27.996  33.962  -2.211  1.00 0.00 ? 452 MET A H    6  
ATOM   9442  H  HA   . MET A 1 95  ? 27.717  31.343  -3.071  1.00 0.00 ? 452 MET A HA   6  
ATOM   9443  H  HB2  . MET A 1 95  ? 26.932  33.896  -4.484  1.00 0.00 ? 452 MET A HB2  6  
ATOM   9444  H  HB3  . MET A 1 95  ? 26.375  32.293  -4.945  1.00 0.00 ? 452 MET A HB3  6  
ATOM   9445  H  HG2  . MET A 1 95  ? 25.772  33.816  -2.431  1.00 0.00 ? 452 MET A HG2  6  
ATOM   9446  H  HG3  . MET A 1 95  ? 24.650  33.266  -3.674  1.00 0.00 ? 452 MET A HG3  6  
ATOM   9447  H  HE1  . MET A 1 95  ? 24.879  30.858  -4.462  1.00 0.00 ? 452 MET A HE1  6  
ATOM   9448  H  HE2  . MET A 1 95  ? 25.123  29.458  -3.417  1.00 0.00 ? 452 MET A HE2  6  
ATOM   9449  H  HE3  . MET A 1 95  ? 23.584  30.319  -3.392  1.00 0.00 ? 452 MET A HE3  6  
ATOM   9450  N  N    . LYS A 1 96  ? 29.664  33.148  -5.022  1.00 0.00 ? 453 LYS A N    6  
ATOM   9451  C  CA   . LYS A 1 96  ? 30.685  33.069  -6.060  1.00 0.00 ? 453 LYS A CA   6  
ATOM   9452  C  C    . LYS A 1 96  ? 31.492  31.781  -5.934  1.00 0.00 ? 453 LYS A C    6  
ATOM   9453  O  O    . LYS A 1 96  ? 31.803  31.132  -6.932  1.00 0.00 ? 453 LYS A O    6  
ATOM   9454  C  CB   . LYS A 1 96  ? 31.619  34.279  -5.979  1.00 0.00 ? 453 LYS A CB   6  
ATOM   9455  C  CG   . LYS A 1 96  ? 30.923  35.603  -6.244  1.00 0.00 ? 453 LYS A CG   6  
ATOM   9456  C  CD   . LYS A 1 96  ? 30.773  35.867  -7.733  1.00 0.00 ? 453 LYS A CD   6  
ATOM   9457  C  CE   . LYS A 1 96  ? 29.603  36.795  -8.020  1.00 0.00 ? 453 LYS A CE   6  
ATOM   9458  N  NZ   . LYS A 1 96  ? 29.122  36.664  -9.423  1.00 0.00 ? 453 LYS A NZ   6  
ATOM   9459  H  H    . LYS A 1 96  ? 29.459  34.018  -4.618  1.00 0.00 ? 453 LYS A H    6  
ATOM   9460  H  HA   . LYS A 1 96  ? 30.186  33.074  -7.018  1.00 0.00 ? 453 LYS A HA   6  
ATOM   9461  H  HB2  . LYS A 1 96  ? 32.055  34.316  -4.992  1.00 0.00 ? 453 LYS A HB2  6  
ATOM   9462  H  HB3  . LYS A 1 96  ? 32.408  34.159  -6.708  1.00 0.00 ? 453 LYS A HB3  6  
ATOM   9463  H  HG2  . LYS A 1 96  ? 29.942  35.581  -5.793  1.00 0.00 ? 453 LYS A HG2  6  
ATOM   9464  H  HG3  . LYS A 1 96  ? 31.505  36.400  -5.803  1.00 0.00 ? 453 LYS A HG3  6  
ATOM   9465  H  HD2  . LYS A 1 96  ? 31.679  36.324  -8.102  1.00 0.00 ? 453 LYS A HD2  6  
ATOM   9466  H  HD3  . LYS A 1 96  ? 30.609  34.927  -8.241  1.00 0.00 ? 453 LYS A HD3  6  
ATOM   9467  H  HE2  . LYS A 1 96  ? 28.795  36.553  -7.347  1.00 0.00 ? 453 LYS A HE2  6  
ATOM   9468  H  HE3  . LYS A 1 96  ? 29.919  37.814  -7.850  1.00 0.00 ? 453 LYS A HE3  6  
ATOM   9469  H  HZ1  . LYS A 1 96  ? 28.086  36.574  -9.439  1.00 0.00 ? 453 LYS A HZ1  6  
ATOM   9470  H  HZ2  . LYS A 1 96  ? 29.540  35.821  -9.866  1.00 0.00 ? 453 LYS A HZ2  6  
ATOM   9471  H  HZ3  . LYS A 1 96  ? 29.395  37.503  -9.974  1.00 0.00 ? 453 LYS A HZ3  6  
ATOM   9472  N  N    . ARG A 1 97  ? 31.827  31.418  -4.700  1.00 0.00 ? 454 ARG A N    6  
ATOM   9473  C  CA   . ARG A 1 97  ? 32.598  30.207  -4.443  1.00 0.00 ? 454 ARG A CA   6  
ATOM   9474  C  C    . ARG A 1 97  ? 31.803  28.964  -4.831  1.00 0.00 ? 454 ARG A C    6  
ATOM   9475  O  O    . ARG A 1 97  ? 32.297  28.099  -5.556  1.00 0.00 ? 454 ARG A O    6  
ATOM   9476  C  CB   . ARG A 1 97  ? 32.994  30.132  -2.968  1.00 0.00 ? 454 ARG A CB   6  
ATOM   9477  C  CG   . ARG A 1 97  ? 34.342  30.767  -2.666  1.00 0.00 ? 454 ARG A CG   6  
ATOM   9478  C  CD   . ARG A 1 97  ? 35.487  29.813  -2.969  1.00 0.00 ? 454 ARG A CD   6  
ATOM   9479  N  NE   . ARG A 1 97  ? 35.453  28.629  -2.116  1.00 0.00 ? 454 ARG A NE   6  
ATOM   9480  C  CZ   . ARG A 1 97  ? 36.520  27.886  -1.845  1.00 0.00 ? 454 ARG A CZ   6  
ATOM   9481  N  NH1  . ARG A 1 97  ? 37.701  28.205  -2.358  1.00 0.00 ? 454 ARG A NH1  6  
ATOM   9482  N  NH2  . ARG A 1 97  ? 36.409  26.822  -1.060  1.00 0.00 ? 454 ARG A NH2  6  
ATOM   9483  H  H    . ARG A 1 97  ? 31.550  31.977  -3.944  1.00 0.00 ? 454 ARG A H    6  
ATOM   9484  H  HA   . ARG A 1 97  ? 33.493  30.250  -5.045  1.00 0.00 ? 454 ARG A HA   6  
ATOM   9485  H  HB2  . ARG A 1 97  ? 32.243  30.639  -2.379  1.00 0.00 ? 454 ARG A HB2  6  
ATOM   9486  H  HB3  . ARG A 1 97  ? 33.034  29.095  -2.670  1.00 0.00 ? 454 ARG A HB3  6  
ATOM   9487  H  HG2  . ARG A 1 97  ? 34.456  31.653  -3.273  1.00 0.00 ? 454 ARG A HG2  6  
ATOM   9488  H  HG3  . ARG A 1 97  ? 34.376  31.037  -1.621  1.00 0.00 ? 454 ARG A HG3  6  
ATOM   9489  H  HD2  . ARG A 1 97  ? 35.417  29.504  -4.001  1.00 0.00 ? 454 ARG A HD2  6  
ATOM   9490  H  HD3  . ARG A 1 97  ? 36.421  30.332  -2.811  1.00 0.00 ? 454 ARG A HD3  6  
ATOM   9491  H  HE   . ARG A 1 97  ? 34.590  28.375  -1.726  1.00 0.00 ? 454 ARG A HE   6  
ATOM   9492  H  HH11 . ARG A 1 97  ? 37.788  29.007  -2.949  1.00 0.00 ? 454 ARG A HH11 6  
ATOM   9493  H  HH12 . ARG A 1 97  ? 38.504  27.645  -2.152  1.00 0.00 ? 454 ARG A HH12 6  
ATOM   9494  H  HH21 . ARG A 1 97  ? 35.521  26.579  -0.671  1.00 0.00 ? 454 ARG A HH21 6  
ATOM   9495  H  HH22 . ARG A 1 97  ? 37.213  26.264  -0.857  1.00 0.00 ? 454 ARG A HH22 6  
ATOM   9496  N  N    . HIS A 1 98  ? 30.569  28.880  -4.343  1.00 0.00 ? 455 HIS A N    6  
ATOM   9497  C  CA   . HIS A 1 98  ? 29.706  27.743  -4.638  1.00 0.00 ? 455 HIS A CA   6  
ATOM   9498  C  C    . HIS A 1 98  ? 29.538  27.564  -6.144  1.00 0.00 ? 455 HIS A C    6  
ATOM   9499  O  O    . HIS A 1 98  ? 29.641  26.452  -6.661  1.00 0.00 ? 455 HIS A O    6  
ATOM   9500  C  CB   . HIS A 1 98  ? 28.338  27.929  -3.980  1.00 0.00 ? 455 HIS A CB   6  
ATOM   9501  C  CG   . HIS A 1 98  ? 28.302  27.505  -2.544  1.00 0.00 ? 455 HIS A CG   6  
ATOM   9502  N  ND1  . HIS A 1 98  ? 29.005  26.422  -2.061  1.00 0.00 ? 455 HIS A ND1  6  
ATOM   9503  C  CD2  . HIS A 1 98  ? 27.643  28.027  -1.483  1.00 0.00 ? 455 HIS A CD2  6  
ATOM   9504  C  CE1  . HIS A 1 98  ? 28.779  26.294  -0.766  1.00 0.00 ? 455 HIS A CE1  6  
ATOM   9505  N  NE2  . HIS A 1 98  ? 27.956  27.256  -0.390  1.00 0.00 ? 455 HIS A NE2  6  
ATOM   9506  H  H    . HIS A 1 98  ? 30.232  29.601  -3.771  1.00 0.00 ? 455 HIS A H    6  
ATOM   9507  H  HA   . HIS A 1 98  ? 30.173  26.858  -4.233  1.00 0.00 ? 455 HIS A HA   6  
ATOM   9508  H  HB2  . HIS A 1 98  ? 28.064  28.973  -4.024  1.00 0.00 ? 455 HIS A HB2  6  
ATOM   9509  H  HB3  . HIS A 1 98  ? 27.604  27.346  -4.517  1.00 0.00 ? 455 HIS A HB3  6  
ATOM   9510  H  HD1  . HIS A 1 98  ? 29.583  25.833  -2.590  1.00 0.00 ? 455 HIS A HD1  6  
ATOM   9511  H  HD2  . HIS A 1 98  ? 26.991  28.889  -1.493  1.00 0.00 ? 455 HIS A HD2  6  
ATOM   9512  H  HE1  . HIS A 1 98  ? 29.196  25.533  -0.123  1.00 0.00 ? 455 HIS A HE1  6  
ATOM   9513  N  N    . GLN A 1 99  ? 29.279  28.666  -6.840  1.00 0.00 ? 456 GLN A N    6  
ATOM   9514  C  CA   . GLN A 1 99  ? 29.096  28.630  -8.286  1.00 0.00 ? 456 GLN A CA   6  
ATOM   9515  C  C    . GLN A 1 99  ? 30.431  28.438  -9.000  1.00 0.00 ? 456 GLN A C    6  
ATOM   9516  O  O    . GLN A 1 99  ? 31.259  29.347  -9.041  1.00 0.00 ? 456 GLN A O    6  
ATOM   9517  C  CB   . GLN A 1 99  ? 28.427  29.918  -8.769  1.00 0.00 ? 456 GLN A CB   6  
ATOM   9518  C  CG   . GLN A 1 99  ? 28.348  30.032  -10.283 1.00 0.00 ? 456 GLN A CG   6  
ATOM   9519  C  CD   . GLN A 1 99  ? 27.650  28.847  -10.922 1.00 0.00 ? 456 GLN A CD   6  
ATOM   9520  O  OE1  . GLN A 1 99  ? 26.898  28.127  -10.265 1.00 0.00 ? 456 GLN A OE1  6  
ATOM   9521  N  NE2  . GLN A 1 99  ? 27.898  28.638  -12.210 1.00 0.00 ? 456 GLN A NE2  6  
ATOM   9522  H  H    . GLN A 1 99  ? 29.209  29.523  -6.371  1.00 0.00 ? 456 GLN A H    6  
ATOM   9523  H  HA   . GLN A 1 99  ? 28.455  27.793  -8.518  1.00 0.00 ? 456 GLN A HA   6  
ATOM   9524  H  HB2  . GLN A 1 99  ? 27.423  29.958  -8.374  1.00 0.00 ? 456 GLN A HB2  6  
ATOM   9525  H  HB3  . GLN A 1 99  ? 28.986  30.762  -8.396  1.00 0.00 ? 456 GLN A HB3  6  
ATOM   9526  H  HG2  . GLN A 1 99  ? 27.803  30.929  -10.536 1.00 0.00 ? 456 GLN A HG2  6  
ATOM   9527  H  HG3  . GLN A 1 99  ? 29.350  30.097  -10.679 1.00 0.00 ? 456 GLN A HG3  6  
ATOM   9528  H  HE21 . GLN A 1 99  ? 28.509  29.252  -12.669 1.00 0.00 ? 456 GLN A HE21 6  
ATOM   9529  H  HE22 . GLN A 1 99  ? 27.461  27.879  -12.648 1.00 0.00 ? 456 GLN A HE22 6  
ATOM   9530  N  N    . ASN A 1 100 ? 30.632  27.250  -9.559  1.00 0.00 ? 457 ASN A N    6  
ATOM   9531  C  CA   . ASN A 1 100 ? 31.867  26.938  -10.270 1.00 0.00 ? 457 ASN A CA   6  
ATOM   9532  C  C    . ASN A 1 100 ? 31.760  27.327  -11.741 1.00 0.00 ? 457 ASN A C    6  
ATOM   9533  O  O    . ASN A 1 100 ? 32.588  26.929  -12.560 1.00 0.00 ? 457 ASN A O    6  
ATOM   9534  C  CB   . ASN A 1 100 ? 32.189  25.448  -10.146 1.00 0.00 ? 457 ASN A CB   6  
ATOM   9535  C  CG   . ASN A 1 100 ? 31.057  24.568  -10.641 1.00 0.00 ? 457 ASN A CG   6  
ATOM   9536  O  OD1  . ASN A 1 100 ? 29.971  25.055  -10.957 1.00 0.00 ? 457 ASN A OD1  6  
ATOM   9537  N  ND2  . ASN A 1 100 ? 31.307  23.266  -10.711 1.00 0.00 ? 457 ASN A ND2  6  
ATOM   9538  H  H    . ASN A 1 100 ? 29.934  26.565  -9.492  1.00 0.00 ? 457 ASN A H    6  
ATOM   9539  H  HA   . ASN A 1 100 ? 32.663  27.509  -9.816  1.00 0.00 ? 457 ASN A HA   6  
ATOM   9540  H  HB2  . ASN A 1 100 ? 33.072  25.227  -10.728 1.00 0.00 ? 457 ASN A HB2  6  
ATOM   9541  H  HB3  . ASN A 1 100 ? 32.378  25.211  -9.110  1.00 0.00 ? 457 ASN A HB3  6  
ATOM   9542  H  HD21 . ASN A 1 100 ? 32.195  22.950  -10.442 1.00 0.00 ? 457 ASN A HD21 6  
ATOM   9543  H  HD22 . ASN A 1 100 ? 30.593  22.675  -11.028 1.00 0.00 ? 457 ASN A HD22 6  
HETATM 9544  ZN ZN   . ZN  B 2 .   ? 15.495  -0.992  11.255  1.00 0.00 ? 100 ZN  A ZN   6  
HETATM 9545  ZN ZN   . ZN  C 2 .   ? 14.254  23.750  6.148   1.00 0.00 ? 200 ZN  A ZN   6  
HETATM 9546  ZN ZN   . ZN  D 2 .   ? 27.259  28.501  1.075   1.00 0.00 ? 300 ZN  A ZN   6  
ATOM   9547  N  N    . GLY A 1 1   ? 49.078  -3.597  60.172  1.00 0.00 ? 358 GLY A N    7  
ATOM   9548  C  CA   . GLY A 1 1   ? 48.402  -3.018  59.026  1.00 0.00 ? 358 GLY A CA   7  
ATOM   9549  C  C    . GLY A 1 1   ? 48.066  -4.051  57.969  1.00 0.00 ? 358 GLY A C    7  
ATOM   9550  O  O    . GLY A 1 1   ? 48.402  -5.226  58.111  1.00 0.00 ? 358 GLY A O    7  
ATOM   9551  H  H1   . GLY A 1 1   ? 49.424  -4.513  60.124  1.00 0.00 ? 358 GLY A H1   7  
ATOM   9552  H  HA2  . GLY A 1 1   ? 47.489  -2.548  59.360  1.00 0.00 ? 358 GLY A HA2  7  
ATOM   9553  H  HA3  . GLY A 1 1   ? 49.042  -2.266  58.588  1.00 0.00 ? 358 GLY A HA3  7  
ATOM   9554  N  N    . SER A 1 2   ? 47.399  -3.612  56.906  1.00 0.00 ? 359 SER A N    7  
ATOM   9555  C  CA   . SER A 1 2   ? 47.011  -4.508  55.823  1.00 0.00 ? 359 SER A CA   7  
ATOM   9556  C  C    . SER A 1 2   ? 46.411  -3.725  54.659  1.00 0.00 ? 359 SER A C    7  
ATOM   9557  O  O    . SER A 1 2   ? 45.693  -2.746  54.860  1.00 0.00 ? 359 SER A O    7  
ATOM   9558  C  CB   . SER A 1 2   ? 46.007  -5.546  56.327  1.00 0.00 ? 359 SER A CB   7  
ATOM   9559  O  OG   . SER A 1 2   ? 45.674  -6.471  55.305  1.00 0.00 ? 359 SER A OG   7  
ATOM   9560  H  H    . SER A 1 2   ? 47.159  -2.663  56.851  1.00 0.00 ? 359 SER A H    7  
ATOM   9561  H  HA   . SER A 1 2   ? 47.900  -5.016  55.480  1.00 0.00 ? 359 SER A HA   7  
ATOM   9562  H  HB2  . SER A 1 2   ? 46.436  -6.085  57.157  1.00 0.00 ? 359 SER A HB2  7  
ATOM   9563  H  HB3  . SER A 1 2   ? 45.106  -5.044  56.649  1.00 0.00 ? 359 SER A HB3  7  
ATOM   9564  H  HG   . SER A 1 2   ? 46.364  -6.473  54.638  1.00 0.00 ? 359 SER A HG   7  
ATOM   9565  N  N    . SER A 1 3   ? 46.710  -4.166  53.441  1.00 0.00 ? 360 SER A N    7  
ATOM   9566  C  CA   . SER A 1 3   ? 46.204  -3.505  52.244  1.00 0.00 ? 360 SER A CA   7  
ATOM   9567  C  C    . SER A 1 3   ? 45.908  -4.523  51.146  1.00 0.00 ? 360 SER A C    7  
ATOM   9568  O  O    . SER A 1 3   ? 46.229  -5.703  51.276  1.00 0.00 ? 360 SER A O    7  
ATOM   9569  C  CB   . SER A 1 3   ? 47.215  -2.473  51.739  1.00 0.00 ? 360 SER A CB   7  
ATOM   9570  O  OG   . SER A 1 3   ? 47.575  -1.567  52.767  1.00 0.00 ? 360 SER A OG   7  
ATOM   9571  H  H    . SER A 1 3   ? 47.288  -4.952  53.346  1.00 0.00 ? 360 SER A H    7  
ATOM   9572  H  HA   . SER A 1 3   ? 45.287  -3.000  52.507  1.00 0.00 ? 360 SER A HA   7  
ATOM   9573  H  HB2  . SER A 1 3   ? 48.103  -2.981  51.396  1.00 0.00 ? 360 SER A HB2  7  
ATOM   9574  H  HB3  . SER A 1 3   ? 46.779  -1.917  50.921  1.00 0.00 ? 360 SER A HB3  7  
ATOM   9575  H  HG   . SER A 1 3   ? 48.350  -1.897  53.227  1.00 0.00 ? 360 SER A HG   7  
ATOM   9576  N  N    . GLY A 1 4   ? 45.292  -4.055  50.065  1.00 0.00 ? 361 GLY A N    7  
ATOM   9577  C  CA   . GLY A 1 4   ? 44.962  -4.936  48.960  1.00 0.00 ? 361 GLY A CA   7  
ATOM   9578  C  C    . GLY A 1 4   ? 43.901  -4.351  48.049  1.00 0.00 ? 361 GLY A C    7  
ATOM   9579  O  O    . GLY A 1 4   ? 42.863  -3.881  48.515  1.00 0.00 ? 361 GLY A O    7  
ATOM   9580  H  H    . GLY A 1 4   ? 45.059  -3.104  50.017  1.00 0.00 ? 361 GLY A H    7  
ATOM   9581  H  HA2  . GLY A 1 4   ? 45.855  -5.122  48.382  1.00 0.00 ? 361 GLY A HA2  7  
ATOM   9582  H  HA3  . GLY A 1 4   ? 44.601  -5.874  49.357  1.00 0.00 ? 361 GLY A HA3  7  
ATOM   9583  N  N    . SER A 1 5   ? 44.161  -4.378  46.746  1.00 0.00 ? 362 SER A N    7  
ATOM   9584  C  CA   . SER A 1 5   ? 43.223  -3.842  45.767  1.00 0.00 ? 362 SER A CA   7  
ATOM   9585  C  C    . SER A 1 5   ? 43.286  -4.632  44.464  1.00 0.00 ? 362 SER A C    7  
ATOM   9586  O  O    . SER A 1 5   ? 44.343  -4.743  43.842  1.00 0.00 ? 362 SER A O    7  
ATOM   9587  C  CB   . SER A 1 5   ? 43.524  -2.366  45.497  1.00 0.00 ? 362 SER A CB   7  
ATOM   9588  O  OG   . SER A 1 5   ? 42.527  -1.785  44.675  1.00 0.00 ? 362 SER A OG   7  
ATOM   9589  H  H    . SER A 1 5   ? 45.006  -4.767  46.436  1.00 0.00 ? 362 SER A H    7  
ATOM   9590  H  HA   . SER A 1 5   ? 42.229  -3.928  46.179  1.00 0.00 ? 362 SER A HA   7  
ATOM   9591  H  HB2  . SER A 1 5   ? 43.558  -1.831  46.434  1.00 0.00 ? 362 SER A HB2  7  
ATOM   9592  H  HB3  . SER A 1 5   ? 44.479  -2.282  44.999  1.00 0.00 ? 362 SER A HB3  7  
ATOM   9593  H  HG   . SER A 1 5   ? 41.959  -1.224  45.208  1.00 0.00 ? 362 SER A HG   7  
ATOM   9594  N  N    . SER A 1 6   ? 42.146  -5.180  44.056  1.00 0.00 ? 363 SER A N    7  
ATOM   9595  C  CA   . SER A 1 6   ? 42.070  -5.964  42.829  1.00 0.00 ? 363 SER A CA   7  
ATOM   9596  C  C    . SER A 1 6   ? 41.740  -5.074  41.635  1.00 0.00 ? 363 SER A C    7  
ATOM   9597  O  O    . SER A 1 6   ? 42.506  -4.993  40.675  1.00 0.00 ? 363 SER A O    7  
ATOM   9598  C  CB   . SER A 1 6   ? 41.017  -7.065  42.965  1.00 0.00 ? 363 SER A CB   7  
ATOM   9599  O  OG   . SER A 1 6   ? 41.475  -8.107  43.809  1.00 0.00 ? 363 SER A OG   7  
ATOM   9600  H  H    . SER A 1 6   ? 41.336  -5.056  44.595  1.00 0.00 ? 363 SER A H    7  
ATOM   9601  H  HA   . SER A 1 6   ? 43.036  -6.420  42.667  1.00 0.00 ? 363 SER A HA   7  
ATOM   9602  H  HB2  . SER A 1 6   ? 40.115  -6.647  43.387  1.00 0.00 ? 363 SER A HB2  7  
ATOM   9603  H  HB3  . SER A 1 6   ? 40.801  -7.476  41.990  1.00 0.00 ? 363 SER A HB3  7  
ATOM   9604  H  HG   . SER A 1 6   ? 40.967  -8.904  43.639  1.00 0.00 ? 363 SER A HG   7  
ATOM   9605  N  N    . GLY A 1 7   ? 40.592  -4.406  41.702  1.00 0.00 ? 364 GLY A N    7  
ATOM   9606  C  CA   . GLY A 1 7   ? 40.179  -3.530  40.621  1.00 0.00 ? 364 GLY A CA   7  
ATOM   9607  C  C    . GLY A 1 7   ? 39.739  -4.297  39.390  1.00 0.00 ? 364 GLY A C    7  
ATOM   9608  O  O    . GLY A 1 7   ? 40.511  -4.508  38.455  1.00 0.00 ? 364 GLY A O    7  
ATOM   9609  H  H    . GLY A 1 7   ? 40.021  -4.509  42.492  1.00 0.00 ? 364 GLY A H    7  
ATOM   9610  H  HA2  . GLY A 1 7   ? 39.359  -2.917  40.963  1.00 0.00 ? 364 GLY A HA2  7  
ATOM   9611  H  HA3  . GLY A 1 7   ? 41.007  -2.890  40.355  1.00 0.00 ? 364 GLY A HA3  7  
ATOM   9612  N  N    . PRO A 1 8   ? 38.469  -4.729  39.380  1.00 0.00 ? 365 PRO A N    7  
ATOM   9613  C  CA   . PRO A 1 8   ? 37.899  -5.484  38.260  1.00 0.00 ? 365 PRO A CA   7  
ATOM   9614  C  C    . PRO A 1 8   ? 37.719  -4.626  37.013  1.00 0.00 ? 365 PRO A C    7  
ATOM   9615  O  O    . PRO A 1 8   ? 37.874  -3.405  37.061  1.00 0.00 ? 365 PRO A O    7  
ATOM   9616  C  CB   . PRO A 1 8   ? 36.539  -5.940  38.796  1.00 0.00 ? 365 PRO A CB   7  
ATOM   9617  C  CG   . PRO A 1 8   ? 36.189  -4.939  39.842  1.00 0.00 ? 365 PRO A CG   7  
ATOM   9618  C  CD   . PRO A 1 8   ? 37.492  -4.513  40.460  1.00 0.00 ? 365 PRO A CD   7  
ATOM   9619  H  HA   . PRO A 1 8   ? 38.500  -6.348  38.017  1.00 0.00 ? 365 PRO A HA   7  
ATOM   9620  H  HB2  . PRO A 1 8   ? 35.816  -5.943  37.992  1.00 0.00 ? 365 PRO A HB2  7  
ATOM   9621  H  HB3  . PRO A 1 8   ? 36.627  -6.933  39.213  1.00 0.00 ? 365 PRO A HB3  7  
ATOM   9622  H  HG2  . PRO A 1 8   ? 35.694  -4.093  39.390  1.00 0.00 ? 365 PRO A HG2  7  
ATOM   9623  H  HG3  . PRO A 1 8   ? 35.552  -5.394  40.586  1.00 0.00 ? 365 PRO A HG3  7  
ATOM   9624  H  HD2  . PRO A 1 8   ? 37.453  -3.472  40.743  1.00 0.00 ? 365 PRO A HD2  7  
ATOM   9625  H  HD3  . PRO A 1 8   ? 37.723  -5.130  41.316  1.00 0.00 ? 365 PRO A HD3  7  
ATOM   9626  N  N    . ASP A 1 9   ? 37.392  -5.271  35.899  1.00 0.00 ? 366 ASP A N    7  
ATOM   9627  C  CA   . ASP A 1 9   ? 37.190  -4.565  34.638  1.00 0.00 ? 366 ASP A CA   7  
ATOM   9628  C  C    . ASP A 1 9   ? 36.646  -5.507  33.569  1.00 0.00 ? 366 ASP A C    7  
ATOM   9629  O  O    . ASP A 1 9   ? 37.363  -6.374  33.067  1.00 0.00 ? 366 ASP A O    7  
ATOM   9630  C  CB   . ASP A 1 9   ? 38.502  -3.938  34.164  1.00 0.00 ? 366 ASP A CB   7  
ATOM   9631  C  CG   . ASP A 1 9   ? 38.504  -3.656  32.674  1.00 0.00 ? 366 ASP A CG   7  
ATOM   9632  O  OD1  . ASP A 1 9   ? 38.621  -4.620  31.889  1.00 0.00 ? 366 ASP A OD1  7  
ATOM   9633  O  OD2  . ASP A 1 9   ? 38.388  -2.472  32.294  1.00 0.00 ? 366 ASP A OD2  7  
ATOM   9634  H  H    . ASP A 1 9   ? 37.283  -6.244  35.924  1.00 0.00 ? 366 ASP A H    7  
ATOM   9635  H  HA   . ASP A 1 9   ? 36.468  -3.781  34.809  1.00 0.00 ? 366 ASP A HA   7  
ATOM   9636  H  HB2  . ASP A 1 9   ? 38.659  -3.006  34.688  1.00 0.00 ? 366 ASP A HB2  7  
ATOM   9637  H  HB3  . ASP A 1 9   ? 39.316  -4.612  34.386  1.00 0.00 ? 366 ASP A HB3  7  
ATOM   9638  N  N    . LEU A 1 10  ? 35.375  -5.333  33.226  1.00 0.00 ? 367 LEU A N    7  
ATOM   9639  C  CA   . LEU A 1 10  ? 34.733  -6.169  32.217  1.00 0.00 ? 367 LEU A CA   7  
ATOM   9640  C  C    . LEU A 1 10  ? 34.611  -5.425  30.891  1.00 0.00 ? 367 LEU A C    7  
ATOM   9641  O  O    . LEU A 1 10  ? 34.297  -4.235  30.864  1.00 0.00 ? 367 LEU A O    7  
ATOM   9642  C  CB   . LEU A 1 10  ? 33.350  -6.611  32.696  1.00 0.00 ? 367 LEU A CB   7  
ATOM   9643  C  CG   . LEU A 1 10  ? 33.316  -7.420  33.994  1.00 0.00 ? 367 LEU A CG   7  
ATOM   9644  C  CD1  . LEU A 1 10  ? 33.463  -6.503  35.198  1.00 0.00 ? 367 LEU A CD1  7  
ATOM   9645  C  CD2  . LEU A 1 10  ? 32.027  -8.223  34.088  1.00 0.00 ? 367 LEU A CD2  7  
ATOM   9646  H  H    . LEU A 1 10  ? 34.854  -4.627  33.661  1.00 0.00 ? 367 LEU A H    7  
ATOM   9647  H  HA   . LEU A 1 10  ? 35.350  -7.043  32.069  1.00 0.00 ? 367 LEU A HA   7  
ATOM   9648  H  HB2  . LEU A 1 10  ? 32.752  -5.725  32.844  1.00 0.00 ? 367 LEU A HB2  7  
ATOM   9649  H  HB3  . LEU A 1 10  ? 32.908  -7.215  31.917  1.00 0.00 ? 367 LEU A HB3  7  
ATOM   9650  H  HG   . LEU A 1 10  ? 34.145  -8.114  34.000  1.00 0.00 ? 367 LEU A HG   7  
ATOM   9651  H  HD11 . LEU A 1 10  ? 32.774  -6.809  35.970  1.00 0.00 ? 367 LEU A HD11 7  
ATOM   9652  H  HD12 . LEU A 1 10  ? 33.247  -5.486  34.905  1.00 0.00 ? 367 LEU A HD12 7  
ATOM   9653  H  HD13 . LEU A 1 10  ? 34.475  -6.561  35.573  1.00 0.00 ? 367 LEU A HD13 7  
ATOM   9654  H  HD21 . LEU A 1 10  ? 31.801  -8.655  33.124  1.00 0.00 ? 367 LEU A HD21 7  
ATOM   9655  H  HD22 . LEU A 1 10  ? 31.219  -7.573  34.390  1.00 0.00 ? 367 LEU A HD22 7  
ATOM   9656  H  HD23 . LEU A 1 10  ? 32.146  -9.011  34.817  1.00 0.00 ? 367 LEU A HD23 7  
ATOM   9657  N  N    . GLU A 1 11  ? 34.859  -6.134  29.794  1.00 0.00 ? 368 GLU A N    7  
ATOM   9658  C  CA   . GLU A 1 11  ? 34.774  -5.540  28.466  1.00 0.00 ? 368 GLU A CA   7  
ATOM   9659  C  C    . GLU A 1 11  ? 33.870  -6.367  27.556  1.00 0.00 ? 368 GLU A C    7  
ATOM   9660  O  O    . GLU A 1 11  ? 34.003  -7.588  27.474  1.00 0.00 ? 368 GLU A O    7  
ATOM   9661  C  CB   . GLU A 1 11  ? 36.168  -5.421  27.846  1.00 0.00 ? 368 GLU A CB   7  
ATOM   9662  C  CG   . GLU A 1 11  ? 37.121  -4.555  28.653  1.00 0.00 ? 368 GLU A CG   7  
ATOM   9663  C  CD   . GLU A 1 11  ? 38.271  -4.021  27.821  1.00 0.00 ? 368 GLU A CD   7  
ATOM   9664  O  OE1  . GLU A 1 11  ? 38.031  -3.124  26.986  1.00 0.00 ? 368 GLU A OE1  7  
ATOM   9665  O  OE2  . GLU A 1 11  ? 39.409  -4.501  28.004  1.00 0.00 ? 368 GLU A OE2  7  
ATOM   9666  H  H    . GLU A 1 11  ? 35.104  -7.079  29.881  1.00 0.00 ? 368 GLU A H    7  
ATOM   9667  H  HA   . GLU A 1 11  ? 34.352  -4.552  28.570  1.00 0.00 ? 368 GLU A HA   7  
ATOM   9668  H  HB2  . GLU A 1 11  ? 36.596  -6.409  27.761  1.00 0.00 ? 368 GLU A HB2  7  
ATOM   9669  H  HB3  . GLU A 1 11  ? 36.075  -4.993  26.859  1.00 0.00 ? 368 GLU A HB3  7  
ATOM   9670  H  HG2  . GLU A 1 11  ? 36.572  -3.719  29.058  1.00 0.00 ? 368 GLU A HG2  7  
ATOM   9671  H  HG3  . GLU A 1 11  ? 37.526  -5.145  29.463  1.00 0.00 ? 368 GLU A HG3  7  
ATOM   9672  N  N    . LYS A 1 12  ? 32.950  -5.693  26.875  1.00 0.00 ? 369 LYS A N    7  
ATOM   9673  C  CA   . LYS A 1 12  ? 32.023  -6.363  25.970  1.00 0.00 ? 369 LYS A CA   7  
ATOM   9674  C  C    . LYS A 1 12  ? 31.854  -5.568  24.679  1.00 0.00 ? 369 LYS A C    7  
ATOM   9675  O  O    . LYS A 1 12  ? 32.189  -4.385  24.618  1.00 0.00 ? 369 LYS A O    7  
ATOM   9676  C  CB   . LYS A 1 12  ? 30.664  -6.552  26.647  1.00 0.00 ? 369 LYS A CB   7  
ATOM   9677  C  CG   . LYS A 1 12  ? 30.555  -7.841  27.444  1.00 0.00 ? 369 LYS A CG   7  
ATOM   9678  C  CD   . LYS A 1 12  ? 29.391  -7.797  28.419  1.00 0.00 ? 369 LYS A CD   7  
ATOM   9679  C  CE   . LYS A 1 12  ? 29.371  -9.023  29.319  1.00 0.00 ? 369 LYS A CE   7  
ATOM   9680  N  NZ   . LYS A 1 12  ? 28.724  -10.188 28.654  1.00 0.00 ? 369 LYS A NZ   7  
ATOM   9681  H  H    . LYS A 1 12  ? 32.893  -4.720  26.982  1.00 0.00 ? 369 LYS A H    7  
ATOM   9682  H  HA   . LYS A 1 12  ? 32.435  -7.331  25.731  1.00 0.00 ? 369 LYS A HA   7  
ATOM   9683  H  HB2  . LYS A 1 12  ? 30.491  -5.723  27.318  1.00 0.00 ? 369 LYS A HB2  7  
ATOM   9684  H  HB3  . LYS A 1 12  ? 29.895  -6.556  25.889  1.00 0.00 ? 369 LYS A HB3  7  
ATOM   9685  H  HG2  . LYS A 1 12  ? 30.408  -8.664  26.761  1.00 0.00 ? 369 LYS A HG2  7  
ATOM   9686  H  HG3  . LYS A 1 12  ? 31.472  -7.989  27.997  1.00 0.00 ? 369 LYS A HG3  7  
ATOM   9687  H  HD2  . LYS A 1 12  ? 29.482  -6.914  29.035  1.00 0.00 ? 369 LYS A HD2  7  
ATOM   9688  H  HD3  . LYS A 1 12  ? 28.467  -7.755  27.861  1.00 0.00 ? 369 LYS A HD3  7  
ATOM   9689  H  HE2  . LYS A 1 12  ? 30.387  -9.284  29.573  1.00 0.00 ? 369 LYS A HE2  7  
ATOM   9690  H  HE3  . LYS A 1 12  ? 28.825  -8.784  30.219  1.00 0.00 ? 369 LYS A HE3  7  
ATOM   9691  H  HZ1  . LYS A 1 12  ? 29.447  -10.804 28.229  1.00 0.00 ? 369 LYS A HZ1  7  
ATOM   9692  H  HZ2  . LYS A 1 12  ? 28.081  -9.860  27.906  1.00 0.00 ? 369 LYS A HZ2  7  
ATOM   9693  H  HZ3  . LYS A 1 12  ? 28.179  -10.738 29.347  1.00 0.00 ? 369 LYS A HZ3  7  
ATOM   9694  N  N    . ARG A 1 13  ? 31.330  -6.226  23.650  1.00 0.00 ? 370 ARG A N    7  
ATOM   9695  C  CA   . ARG A 1 13  ? 31.116  -5.581  22.360  1.00 0.00 ? 370 ARG A CA   7  
ATOM   9696  C  C    . ARG A 1 13  ? 29.937  -4.614  22.425  1.00 0.00 ? 370 ARG A C    7  
ATOM   9697  O  O    . ARG A 1 13  ? 29.198  -4.586  23.409  1.00 0.00 ? 370 ARG A O    7  
ATOM   9698  C  CB   . ARG A 1 13  ? 30.868  -6.631  21.275  1.00 0.00 ? 370 ARG A CB   7  
ATOM   9699  C  CG   . ARG A 1 13  ? 32.144  -7.221  20.697  1.00 0.00 ? 370 ARG A CG   7  
ATOM   9700  C  CD   . ARG A 1 13  ? 32.590  -8.451  21.473  1.00 0.00 ? 370 ARG A CD   7  
ATOM   9701  N  NE   . ARG A 1 13  ? 33.396  -8.100  22.639  1.00 0.00 ? 370 ARG A NE   7  
ATOM   9702  C  CZ   . ARG A 1 13  ? 34.658  -7.695  22.564  1.00 0.00 ? 370 ARG A CZ   7  
ATOM   9703  N  NH1  . ARG A 1 13  ? 35.256  -7.589  21.385  1.00 0.00 ? 370 ARG A NH1  7  
ATOM   9704  N  NH2  . ARG A 1 13  ? 35.326  -7.393  23.671  1.00 0.00 ? 370 ARG A NH2  7  
ATOM   9705  H  H    . ARG A 1 13  ? 31.083  -7.168  23.760  1.00 0.00 ? 370 ARG A H    7  
ATOM   9706  H  HA   . ARG A 1 13  ? 32.009  -5.026  22.114  1.00 0.00 ? 370 ARG A HA   7  
ATOM   9707  H  HB2  . ARG A 1 13  ? 30.284  -7.436  21.696  1.00 0.00 ? 370 ARG A HB2  7  
ATOM   9708  H  HB3  . ARG A 1 13  ? 30.312  -6.175  20.470  1.00 0.00 ? 370 ARG A HB3  7  
ATOM   9709  H  HG2  . ARG A 1 13  ? 31.966  -7.503  19.670  1.00 0.00 ? 370 ARG A HG2  7  
ATOM   9710  H  HG3  . ARG A 1 13  ? 32.925  -6.477  20.739  1.00 0.00 ? 370 ARG A HG3  7  
ATOM   9711  H  HD2  . ARG A 1 13  ? 31.714  -8.990  21.802  1.00 0.00 ? 370 ARG A HD2  7  
ATOM   9712  H  HD3  . ARG A 1 13  ? 33.174  -9.080  20.818  1.00 0.00 ? 370 ARG A HD3  7  
ATOM   9713  H  HE   . ARG A 1 13  ? 32.974  -8.172  23.520  1.00 0.00 ? 370 ARG A HE   7  
ATOM   9714  H  HH11 . ARG A 1 13  ? 34.755  -7.814  20.550  1.00 0.00 ? 370 ARG A HH11 7  
ATOM   9715  H  HH12 . ARG A 1 13  ? 36.206  -7.282  21.332  1.00 0.00 ? 370 ARG A HH12 7  
ATOM   9716  H  HH21 . ARG A 1 13  ? 34.879  -7.472  24.561  1.00 0.00 ? 370 ARG A HH21 7  
ATOM   9717  H  HH22 . ARG A 1 13  ? 36.276  -7.088  23.613  1.00 0.00 ? 370 ARG A HH22 7  
ATOM   9718  N  N    . ARG A 1 14  ? 29.769  -3.822  21.371  1.00 0.00 ? 371 ARG A N    7  
ATOM   9719  C  CA   . ARG A 1 14  ? 28.682  -2.852  21.309  1.00 0.00 ? 371 ARG A CA   7  
ATOM   9720  C  C    . ARG A 1 14  ? 27.981  -2.908  19.955  1.00 0.00 ? 371 ARG A C    7  
ATOM   9721  O  O    . ARG A 1 14  ? 28.375  -2.221  19.013  1.00 0.00 ? 371 ARG A O    7  
ATOM   9722  C  CB   . ARG A 1 14  ? 29.215  -1.441  21.562  1.00 0.00 ? 371 ARG A CB   7  
ATOM   9723  C  CG   . ARG A 1 14  ? 28.197  -0.512  22.205  1.00 0.00 ? 371 ARG A CG   7  
ATOM   9724  C  CD   . ARG A 1 14  ? 28.650  0.938   22.144  1.00 0.00 ? 371 ARG A CD   7  
ATOM   9725  N  NE   . ARG A 1 14  ? 29.452  1.310   23.306  1.00 0.00 ? 371 ARG A NE   7  
ATOM   9726  C  CZ   . ARG A 1 14  ? 28.932  1.677   24.472  1.00 0.00 ? 371 ARG A CZ   7  
ATOM   9727  N  NH1  . ARG A 1 14  ? 27.616  1.719   24.630  1.00 0.00 ? 371 ARG A NH1  7  
ATOM   9728  N  NH2  . ARG A 1 14  ? 29.728  2.001   25.483  1.00 0.00 ? 371 ARG A NH2  7  
ATOM   9729  H  H    . ARG A 1 14  ? 30.392  -3.891  20.617  1.00 0.00 ? 371 ARG A H    7  
ATOM   9730  H  HA   . ARG A 1 14  ? 27.970  -3.103  22.081  1.00 0.00 ? 371 ARG A HA   7  
ATOM   9731  H  HB2  . ARG A 1 14  ? 30.074  -1.504  22.214  1.00 0.00 ? 371 ARG A HB2  7  
ATOM   9732  H  HB3  . ARG A 1 14  ? 29.518  -1.009  20.620  1.00 0.00 ? 371 ARG A HB3  7  
ATOM   9733  H  HG2  . ARG A 1 14  ? 27.257  -0.606  21.683  1.00 0.00 ? 371 ARG A HG2  7  
ATOM   9734  H  HG3  . ARG A 1 14  ? 28.067  -0.797  23.239  1.00 0.00 ? 371 ARG A HG3  7  
ATOM   9735  H  HD2  . ARG A 1 14  ? 29.240  1.080   21.251  1.00 0.00 ? 371 ARG A HD2  7  
ATOM   9736  H  HD3  . ARG A 1 14  ? 27.777  1.572   22.103  1.00 0.00 ? 371 ARG A HD3  7  
ATOM   9737  H  HE   . ARG A 1 14  ? 30.427  1.286   23.211  1.00 0.00 ? 371 ARG A HE   7  
ATOM   9738  H  HH11 . ARG A 1 14  ? 27.014  1.474   23.871  1.00 0.00 ? 371 ARG A HH11 7  
ATOM   9739  H  HH12 . ARG A 1 14  ? 27.226  1.994   25.510  1.00 0.00 ? 371 ARG A HH12 7  
ATOM   9740  H  HH21 . ARG A 1 14  ? 30.720  1.970   25.367  1.00 0.00 ? 371 ARG A HH21 7  
ATOM   9741  H  HH22 . ARG A 1 14  ? 29.335  2.277   26.360  1.00 0.00 ? 371 ARG A HH22 7  
ATOM   9742  N  N    . ILE A 1 15  ? 26.940  -3.730  19.867  1.00 0.00 ? 372 ILE A N    7  
ATOM   9743  C  CA   . ILE A 1 15  ? 26.184  -3.874  18.630  1.00 0.00 ? 372 ILE A CA   7  
ATOM   9744  C  C    . ILE A 1 15  ? 24.683  -3.840  18.895  1.00 0.00 ? 372 ILE A C    7  
ATOM   9745  O  O    . ILE A 1 15  ? 24.223  -4.225  19.971  1.00 0.00 ? 372 ILE A O    7  
ATOM   9746  C  CB   . ILE A 1 15  ? 26.536  -5.186  17.904  1.00 0.00 ? 372 ILE A CB   7  
ATOM   9747  C  CG1  . ILE A 1 15  ? 28.035  -5.239  17.598  1.00 0.00 ? 372 ILE A CG1  7  
ATOM   9748  C  CG2  . ILE A 1 15  ? 25.724  -5.319  16.625  1.00 0.00 ? 372 ILE A CG2  7  
ATOM   9749  C  CD1  . ILE A 1 15  ? 28.511  -6.600  17.142  1.00 0.00 ? 372 ILE A CD1  7  
ATOM   9750  H  H    . ILE A 1 15  ? 26.675  -4.251  20.653  1.00 0.00 ? 372 ILE A H    7  
ATOM   9751  H  HA   . ILE A 1 15  ? 26.443  -3.048  17.983  1.00 0.00 ? 372 ILE A HA   7  
ATOM   9752  H  HB   . ILE A 1 15  ? 26.279  -6.010  18.552  1.00 0.00 ? 372 ILE A HB   7  
ATOM   9753  H  HG12 . ILE A 1 15  ? 28.262  -4.530  16.818  1.00 0.00 ? 372 ILE A HG12 7  
ATOM   9754  H  HG13 . ILE A 1 15  ? 28.586  -4.976  18.490  1.00 0.00 ? 372 ILE A HG13 7  
ATOM   9755  H  HG21 . ILE A 1 15  ? 24.754  -5.732  16.856  1.00 0.00 ? 372 ILE A HG21 7  
ATOM   9756  H  HG22 . ILE A 1 15  ? 25.601  -4.345  16.174  1.00 0.00 ? 372 ILE A HG22 7  
ATOM   9757  H  HG23 . ILE A 1 15  ? 26.239  -5.972  15.937  1.00 0.00 ? 372 ILE A HG23 7  
ATOM   9758  H  HD11 . ILE A 1 15  ? 29.314  -6.480  16.429  1.00 0.00 ? 372 ILE A HD11 7  
ATOM   9759  H  HD12 . ILE A 1 15  ? 28.867  -7.161  17.993  1.00 0.00 ? 372 ILE A HD12 7  
ATOM   9760  H  HD13 . ILE A 1 15  ? 27.694  -7.131  16.677  1.00 0.00 ? 372 ILE A HD13 7  
ATOM   9761  N  N    . HIS A 1 16  ? 23.923  -3.380  17.907  1.00 0.00 ? 373 HIS A N    7  
ATOM   9762  C  CA   . HIS A 1 16  ? 22.472  -3.298  18.033  1.00 0.00 ? 373 HIS A CA   7  
ATOM   9763  C  C    . HIS A 1 16  ? 21.795  -3.541  16.687  1.00 0.00 ? 373 HIS A C    7  
ATOM   9764  O  O    . HIS A 1 16  ? 22.007  -2.794  15.731  1.00 0.00 ? 373 HIS A O    7  
ATOM   9765  C  CB   . HIS A 1 16  ? 22.062  -1.932  18.584  1.00 0.00 ? 373 HIS A CB   7  
ATOM   9766  C  CG   . HIS A 1 16  ? 22.611  -1.647  19.948  1.00 0.00 ? 373 HIS A CG   7  
ATOM   9767  N  ND1  . HIS A 1 16  ? 21.829  -1.622  21.084  1.00 0.00 ? 373 HIS A ND1  7  
ATOM   9768  C  CD2  . HIS A 1 16  ? 23.873  -1.375  20.356  1.00 0.00 ? 373 HIS A CD2  7  
ATOM   9769  C  CE1  . HIS A 1 16  ? 22.586  -1.346  22.131  1.00 0.00 ? 373 HIS A CE1  7  
ATOM   9770  N  NE2  . HIS A 1 16  ? 23.831  -1.192  21.716  1.00 0.00 ? 373 HIS A NE2  7  
ATOM   9771  H  H    . HIS A 1 16  ? 24.347  -3.088  17.074  1.00 0.00 ? 373 HIS A H    7  
ATOM   9772  H  HA   . HIS A 1 16  ? 22.155  -4.064  18.724  1.00 0.00 ? 373 HIS A HA   7  
ATOM   9773  H  HB2  . HIS A 1 16  ? 22.418  -1.161  17.916  1.00 0.00 ? 373 HIS A HB2  7  
ATOM   9774  H  HB3  . HIS A 1 16  ? 20.985  -1.882  18.642  1.00 0.00 ? 373 HIS A HB3  7  
ATOM   9775  H  HD1  . HIS A 1 16  ? 20.863  -1.782  21.117  1.00 0.00 ? 373 HIS A HD1  7  
ATOM   9776  H  HD2  . HIS A 1 16  ? 24.751  -1.313  19.728  1.00 0.00 ? 373 HIS A HD2  7  
ATOM   9777  H  HE1  . HIS A 1 16  ? 22.246  -1.261  23.152  1.00 0.00 ? 373 HIS A HE1  7  
ATOM   9778  N  N    . TYR A 1 17  ? 20.982  -4.589  16.620  1.00 0.00 ? 374 TYR A N    7  
ATOM   9779  C  CA   . TYR A 1 17  ? 20.277  -4.932  15.391  1.00 0.00 ? 374 TYR A CA   7  
ATOM   9780  C  C    . TYR A 1 17  ? 18.847  -4.400  15.416  1.00 0.00 ? 374 TYR A C    7  
ATOM   9781  O  O    . TYR A 1 17  ? 18.135  -4.546  16.410  1.00 0.00 ? 374 TYR A O    7  
ATOM   9782  C  CB   . TYR A 1 17  ? 20.265  -6.448  15.192  1.00 0.00 ? 374 TYR A CB   7  
ATOM   9783  C  CG   . TYR A 1 17  ? 21.645  -7.060  15.113  1.00 0.00 ? 374 TYR A CG   7  
ATOM   9784  C  CD1  . TYR A 1 17  ? 22.316  -7.459  16.262  1.00 0.00 ? 374 TYR A CD1  7  
ATOM   9785  C  CD2  . TYR A 1 17  ? 22.278  -7.239  13.889  1.00 0.00 ? 374 TYR A CD2  7  
ATOM   9786  C  CE1  . TYR A 1 17  ? 23.578  -8.018  16.195  1.00 0.00 ? 374 TYR A CE1  7  
ATOM   9787  C  CE2  . TYR A 1 17  ? 23.540  -7.798  13.813  1.00 0.00 ? 374 TYR A CE2  7  
ATOM   9788  C  CZ   . TYR A 1 17  ? 24.185  -8.185  14.968  1.00 0.00 ? 374 TYR A CZ   7  
ATOM   9789  O  OH   . TYR A 1 17  ? 25.441  -8.743  14.897  1.00 0.00 ? 374 TYR A OH   7  
ATOM   9790  H  H    . TYR A 1 17  ? 20.854  -5.147  17.416  1.00 0.00 ? 374 TYR A H    7  
ATOM   9791  H  HA   . TYR A 1 17  ? 20.805  -4.475  14.567  1.00 0.00 ? 374 TYR A HA   7  
ATOM   9792  H  HB2  . TYR A 1 17  ? 19.745  -6.909  16.017  1.00 0.00 ? 374 TYR A HB2  7  
ATOM   9793  H  HB3  . TYR A 1 17  ? 19.747  -6.680  14.272  1.00 0.00 ? 374 TYR A HB3  7  
ATOM   9794  H  HD1  . TYR A 1 17  ? 21.837  -7.327  17.222  1.00 0.00 ? 374 TYR A HD1  7  
ATOM   9795  H  HD2  . TYR A 1 17  ? 21.770  -6.935  12.986  1.00 0.00 ? 374 TYR A HD2  7  
ATOM   9796  H  HE1  . TYR A 1 17  ? 24.084  -8.321  17.100  1.00 0.00 ? 374 TYR A HE1  7  
ATOM   9797  H  HE2  . TYR A 1 17  ? 24.016  -7.930  12.852  1.00 0.00 ? 374 TYR A HE2  7  
ATOM   9798  H  HH   . TYR A 1 17  ? 25.473  -9.367  14.169  1.00 0.00 ? 374 TYR A HH   7  
ATOM   9799  N  N    . CYS A 1 18  ? 18.434  -3.781  14.315  1.00 0.00 ? 375 CYS A N    7  
ATOM   9800  C  CA   . CYS A 1 18  ? 17.090  -3.226  14.208  1.00 0.00 ? 375 CYS A CA   7  
ATOM   9801  C  C    . CYS A 1 18  ? 16.041  -4.262  14.598  1.00 0.00 ? 375 CYS A C    7  
ATOM   9802  O  O    . CYS A 1 18  ? 16.023  -5.373  14.067  1.00 0.00 ? 375 CYS A O    7  
ATOM   9803  C  CB   . CYS A 1 18  ? 16.832  -2.733  12.783  1.00 0.00 ? 375 CYS A CB   7  
ATOM   9804  S  SG   . CYS A 1 18  ? 15.313  -1.743  12.602  1.00 0.00 ? 375 CYS A SG   7  
ATOM   9805  H  H    . CYS A 1 18  ? 19.049  -3.695  13.555  1.00 0.00 ? 375 CYS A H    7  
ATOM   9806  H  HA   . CYS A 1 18  ? 17.022  -2.389  14.887  1.00 0.00 ? 375 CYS A HA   7  
ATOM   9807  H  HB2  . CYS A 1 18  ? 17.662  -2.120  12.466  1.00 0.00 ? 375 CYS A HB2  7  
ATOM   9808  H  HB3  . CYS A 1 18  ? 16.749  -3.586  12.125  1.00 0.00 ? 375 CYS A HB3  7  
ATOM   9809  N  N    . ASP A 1 19  ? 15.169  -3.891  15.529  1.00 0.00 ? 376 ASP A N    7  
ATOM   9810  C  CA   . ASP A 1 19  ? 14.115  -4.788  15.990  1.00 0.00 ? 376 ASP A CA   7  
ATOM   9811  C  C    . ASP A 1 19  ? 12.904  -4.725  15.064  1.00 0.00 ? 376 ASP A C    7  
ATOM   9812  O  O    . ASP A 1 19  ? 11.760  -4.784  15.516  1.00 0.00 ? 376 ASP A O    7  
ATOM   9813  C  CB   . ASP A 1 19  ? 13.699  -4.430  17.418  1.00 0.00 ? 376 ASP A CB   7  
ATOM   9814  C  CG   . ASP A 1 19  ? 14.889  -4.128  18.308  1.00 0.00 ? 376 ASP A CG   7  
ATOM   9815  O  OD1  . ASP A 1 19  ? 15.721  -5.035  18.513  1.00 0.00 ? 376 ASP A OD1  7  
ATOM   9816  O  OD2  . ASP A 1 19  ? 14.986  -2.984  18.800  1.00 0.00 ? 376 ASP A OD2  7  
ATOM   9817  H  H    . ASP A 1 19  ? 15.234  -2.993  15.915  1.00 0.00 ? 376 ASP A H    7  
ATOM   9818  H  HA   . ASP A 1 19  ? 14.507  -5.794  15.980  1.00 0.00 ? 376 ASP A HA   7  
ATOM   9819  H  HB2  . ASP A 1 19  ? 13.062  -3.558  17.392  1.00 0.00 ? 376 ASP A HB2  7  
ATOM   9820  H  HB3  . ASP A 1 19  ? 13.153  -5.258  17.845  1.00 0.00 ? 376 ASP A HB3  7  
ATOM   9821  N  N    . TYR A 1 20  ? 13.164  -4.603  13.767  1.00 0.00 ? 377 TYR A N    7  
ATOM   9822  C  CA   . TYR A 1 20  ? 12.095  -4.528  12.777  1.00 0.00 ? 377 TYR A CA   7  
ATOM   9823  C  C    . TYR A 1 20  ? 12.159  -5.712  11.816  1.00 0.00 ? 377 TYR A C    7  
ATOM   9824  O  O    . TYR A 1 20  ? 13.231  -6.142  11.390  1.00 0.00 ? 377 TYR A O    7  
ATOM   9825  C  CB   . TYR A 1 20  ? 12.187  -3.217  11.996  1.00 0.00 ? 377 TYR A CB   7  
ATOM   9826  C  CG   . TYR A 1 20  ? 10.859  -2.744  11.449  1.00 0.00 ? 377 TYR A CG   7  
ATOM   9827  C  CD1  . TYR A 1 20  ? 9.868   -2.263  12.296  1.00 0.00 ? 377 TYR A CD1  7  
ATOM   9828  C  CD2  . TYR A 1 20  ? 10.594  -2.780  10.085  1.00 0.00 ? 377 TYR A CD2  7  
ATOM   9829  C  CE1  . TYR A 1 20  ? 8.653   -1.830  11.801  1.00 0.00 ? 377 TYR A CE1  7  
ATOM   9830  C  CE2  . TYR A 1 20  ? 9.382   -2.348  9.581   1.00 0.00 ? 377 TYR A CE2  7  
ATOM   9831  C  CZ   . TYR A 1 20  ? 8.415   -1.874  10.443  1.00 0.00 ? 377 TYR A CZ   7  
ATOM   9832  O  OH   . TYR A 1 20  ? 7.206   -1.445  9.946   1.00 0.00 ? 377 TYR A OH   7  
ATOM   9833  H  H    . TYR A 1 20  ? 14.096  -4.562  13.467  1.00 0.00 ? 377 TYR A H    7  
ATOM   9834  H  HA   . TYR A 1 20  ? 11.153  -4.557  13.304  1.00 0.00 ? 377 TYR A HA   7  
ATOM   9835  H  HB2  . TYR A 1 20  ? 12.571  -2.445  12.644  1.00 0.00 ? 377 TYR A HB2  7  
ATOM   9836  H  HB3  . TYR A 1 20  ? 12.861  -3.349  11.162  1.00 0.00 ? 377 TYR A HB3  7  
ATOM   9837  H  HD1  . TYR A 1 20  ? 10.058  -2.229  13.359  1.00 0.00 ? 377 TYR A HD1  7  
ATOM   9838  H  HD2  . TYR A 1 20  ? 11.354  -3.152  9.413   1.00 0.00 ? 377 TYR A HD2  7  
ATOM   9839  H  HE1  . TYR A 1 20  ? 7.895   -1.459  12.476  1.00 0.00 ? 377 TYR A HE1  7  
ATOM   9840  H  HE2  . TYR A 1 20  ? 9.196   -2.383  8.518   1.00 0.00 ? 377 TYR A HE2  7  
ATOM   9841  H  HH   . TYR A 1 20  ? 6.924   -2.032  9.240   1.00 0.00 ? 377 TYR A HH   7  
ATOM   9842  N  N    . PRO A 1 21  ? 10.982  -6.251  11.465  1.00 0.00 ? 378 PRO A N    7  
ATOM   9843  C  CA   . PRO A 1 21  ? 10.876  -7.391  10.550  1.00 0.00 ? 378 PRO A CA   7  
ATOM   9844  C  C    . PRO A 1 21  ? 11.244  -7.021  9.117   1.00 0.00 ? 378 PRO A C    7  
ATOM   9845  O  O    . PRO A 1 21  ? 10.486  -6.342  8.426   1.00 0.00 ? 378 PRO A O    7  
ATOM   9846  C  CB   . PRO A 1 21  ? 9.398   -7.781  10.638  1.00 0.00 ? 378 PRO A CB   7  
ATOM   9847  C  CG   . PRO A 1 21  ? 8.701   -6.530  11.049  1.00 0.00 ? 378 PRO A CG   7  
ATOM   9848  C  CD   . PRO A 1 21  ? 9.665   -5.790  11.935  1.00 0.00 ? 378 PRO A CD   7  
ATOM   9849  H  HA   . PRO A 1 21  ? 11.488  -8.220  10.875  1.00 0.00 ? 378 PRO A HA   7  
ATOM   9850  H  HB2  . PRO A 1 21  ? 9.056   -8.126  9.673   1.00 0.00 ? 378 PRO A HB2  7  
ATOM   9851  H  HB3  . PRO A 1 21  ? 9.271   -8.562  11.372  1.00 0.00 ? 378 PRO A HB3  7  
ATOM   9852  H  HG2  . PRO A 1 21  ? 8.463   -5.939  10.178  1.00 0.00 ? 378 PRO A HG2  7  
ATOM   9853  H  HG3  . PRO A 1 21  ? 7.802   -6.774  11.596  1.00 0.00 ? 378 PRO A HG3  7  
ATOM   9854  H  HD2  . PRO A 1 21  ? 9.559   -4.724  11.800  1.00 0.00 ? 378 PRO A HD2  7  
ATOM   9855  H  HD3  . PRO A 1 21  ? 9.510   -6.059  12.969  1.00 0.00 ? 378 PRO A HD3  7  
ATOM   9856  N  N    . GLY A 1 22  ? 12.415  -7.472  8.676   1.00 0.00 ? 379 GLY A N    7  
ATOM   9857  C  CA   . GLY A 1 22  ? 12.863  -7.178  7.328   1.00 0.00 ? 379 GLY A CA   7  
ATOM   9858  C  C    . GLY A 1 22  ? 14.121  -6.333  7.306   1.00 0.00 ? 379 GLY A C    7  
ATOM   9859  O  O    . GLY A 1 22  ? 15.033  -6.583  6.517   1.00 0.00 ? 379 GLY A O    7  
ATOM   9860  H  H    . GLY A 1 22  ? 12.979  -8.009  9.272   1.00 0.00 ? 379 GLY A H    7  
ATOM   9861  H  HA2  . GLY A 1 22  ? 13.057  -8.107  6.814   1.00 0.00 ? 379 GLY A HA2  7  
ATOM   9862  H  HA3  . GLY A 1 22  ? 12.079  -6.648  6.808   1.00 0.00 ? 379 GLY A HA3  7  
ATOM   9863  N  N    . CYS A 1 23  ? 14.172  -5.327  8.174   1.00 0.00 ? 380 CYS A N    7  
ATOM   9864  C  CA   . CYS A 1 23  ? 15.326  -4.440  8.250   1.00 0.00 ? 380 CYS A CA   7  
ATOM   9865  C  C    . CYS A 1 23  ? 16.560  -5.194  8.736   1.00 0.00 ? 380 CYS A C    7  
ATOM   9866  O  O    . CYS A 1 23  ? 16.523  -5.876  9.761   1.00 0.00 ? 380 CYS A O    7  
ATOM   9867  C  CB   . CYS A 1 23  ? 15.032  -3.266  9.186   1.00 0.00 ? 380 CYS A CB   7  
ATOM   9868  S  SG   . CYS A 1 23  ? 16.179  -1.863  9.003   1.00 0.00 ? 380 CYS A SG   7  
ATOM   9869  H  H    . CYS A 1 23  ? 13.413  -5.178  8.777   1.00 0.00 ? 380 CYS A H    7  
ATOM   9870  H  HA   . CYS A 1 23  ? 15.519  -4.059  7.259   1.00 0.00 ? 380 CYS A HA   7  
ATOM   9871  H  HB2  . CYS A 1 23  ? 14.034  -2.901  8.991   1.00 0.00 ? 380 CYS A HB2  7  
ATOM   9872  H  HB3  . CYS A 1 23  ? 15.090  -3.607  10.209  1.00 0.00 ? 380 CYS A HB3  7  
ATOM   9873  N  N    . THR A 1 24  ? 17.655  -5.067  7.992   1.00 0.00 ? 381 THR A N    7  
ATOM   9874  C  CA   . THR A 1 24  ? 18.901  -5.737  8.345   1.00 0.00 ? 381 THR A CA   7  
ATOM   9875  C  C    . THR A 1 24  ? 19.985  -4.727  8.703   1.00 0.00 ? 381 THR A C    7  
ATOM   9876  O  O    . THR A 1 24  ? 21.170  -4.960  8.461   1.00 0.00 ? 381 THR A O    7  
ATOM   9877  C  CB   . THR A 1 24  ? 19.405  -6.628  7.194   1.00 0.00 ? 381 THR A CB   7  
ATOM   9878  O  OG1  . THR A 1 24  ? 19.590  -5.843  6.011   1.00 0.00 ? 381 THR A OG1  7  
ATOM   9879  C  CG2  . THR A 1 24  ? 18.423  -7.755  6.912   1.00 0.00 ? 381 THR A CG2  7  
ATOM   9880  H  H    . THR A 1 24  ? 17.622  -4.510  7.187   1.00 0.00 ? 381 THR A H    7  
ATOM   9881  H  HA   . THR A 1 24  ? 18.710  -6.366  9.203   1.00 0.00 ? 381 THR A HA   7  
ATOM   9882  H  HB   . THR A 1 24  ? 20.353  -7.060  7.482   1.00 0.00 ? 381 THR A HB   7  
ATOM   9883  H  HG1  . THR A 1 24  ? 19.759  -4.930  6.256   1.00 0.00 ? 381 THR A HG1  7  
ATOM   9884  H  HG21 . THR A 1 24  ? 18.521  -8.516  7.672   1.00 0.00 ? 381 THR A HG21 7  
ATOM   9885  H  HG22 . THR A 1 24  ? 18.635  -8.184  5.944   1.00 0.00 ? 381 THR A HG22 7  
ATOM   9886  H  HG23 . THR A 1 24  ? 17.416  -7.365  6.921   1.00 0.00 ? 381 THR A HG23 7  
ATOM   9887  N  N    . LYS A 1 25  ? 19.574  -3.604  9.282   1.00 0.00 ? 382 LYS A N    7  
ATOM   9888  C  CA   . LYS A 1 25  ? 20.510  -2.558  9.676   1.00 0.00 ? 382 LYS A CA   7  
ATOM   9889  C  C    . LYS A 1 25  ? 21.088  -2.839  11.060  1.00 0.00 ? 382 LYS A C    7  
ATOM   9890  O  O    . LYS A 1 25  ? 20.590  -3.696  11.789  1.00 0.00 ? 382 LYS A O    7  
ATOM   9891  C  CB   . LYS A 1 25  ? 19.816  -1.194  9.669   1.00 0.00 ? 382 LYS A CB   7  
ATOM   9892  C  CG   . LYS A 1 25  ? 19.449  -0.706  8.278   1.00 0.00 ? 382 LYS A CG   7  
ATOM   9893  C  CD   . LYS A 1 25  ? 20.599  0.045   7.629   1.00 0.00 ? 382 LYS A CD   7  
ATOM   9894  C  CE   . LYS A 1 25  ? 20.147  0.787   6.381   1.00 0.00 ? 382 LYS A CE   7  
ATOM   9895  N  NZ   . LYS A 1 25  ? 19.554  2.113   6.708   1.00 0.00 ? 382 LYS A NZ   7  
ATOM   9896  H  H    . LYS A 1 25  ? 18.616  -3.476  9.449   1.00 0.00 ? 382 LYS A H    7  
ATOM   9897  H  HA   . LYS A 1 25  ? 21.316  -2.547  8.958   1.00 0.00 ? 382 LYS A HA   7  
ATOM   9898  H  HB2  . LYS A 1 25  ? 18.911  -1.261  10.255  1.00 0.00 ? 382 LYS A HB2  7  
ATOM   9899  H  HB3  . LYS A 1 25  ? 20.474  -0.467  10.121  1.00 0.00 ? 382 LYS A HB3  7  
ATOM   9900  H  HG2  . LYS A 1 25  ? 19.196  -1.557  7.663   1.00 0.00 ? 382 LYS A HG2  7  
ATOM   9901  H  HG3  . LYS A 1 25  ? 18.596  -0.046  8.352   1.00 0.00 ? 382 LYS A HG3  7  
ATOM   9902  H  HD2  . LYS A 1 25  ? 20.995  0.760   8.335   1.00 0.00 ? 382 LYS A HD2  7  
ATOM   9903  H  HD3  . LYS A 1 25  ? 21.371  -0.661  7.358   1.00 0.00 ? 382 LYS A HD3  7  
ATOM   9904  H  HE2  . LYS A 1 25  ? 21.000  0.933   5.736   1.00 0.00 ? 382 LYS A HE2  7  
ATOM   9905  H  HE3  . LYS A 1 25  ? 19.407  0.188   5.870   1.00 0.00 ? 382 LYS A HE3  7  
ATOM   9906  H  HZ1  . LYS A 1 25  ? 19.337  2.634   5.834   1.00 0.00 ? 382 LYS A HZ1  7  
ATOM   9907  H  HZ2  . LYS A 1 25  ? 20.223  2.673   7.276   1.00 0.00 ? 382 LYS A HZ2  7  
ATOM   9908  H  HZ3  . LYS A 1 25  ? 18.677  1.988   7.252   1.00 0.00 ? 382 LYS A HZ3  7  
ATOM   9909  N  N    . VAL A 1 26  ? 22.141  -2.110  11.415  1.00 0.00 ? 383 VAL A N    7  
ATOM   9910  C  CA   . VAL A 1 26  ? 22.785  -2.279  12.712  1.00 0.00 ? 383 VAL A CA   7  
ATOM   9911  C  C    . VAL A 1 26  ? 23.611  -1.051  13.080  1.00 0.00 ? 383 VAL A C    7  
ATOM   9912  O  O    . VAL A 1 26  ? 24.305  -0.481  12.237  1.00 0.00 ? 383 VAL A O    7  
ATOM   9913  C  CB   . VAL A 1 26  ? 23.696  -3.520  12.729  1.00 0.00 ? 383 VAL A CB   7  
ATOM   9914  C  CG1  . VAL A 1 26  ? 24.722  -3.446  11.608  1.00 0.00 ? 383 VAL A CG1  7  
ATOM   9915  C  CG2  . VAL A 1 26  ? 24.380  -3.661  14.080  1.00 0.00 ? 383 VAL A CG2  7  
ATOM   9916  H  H    . VAL A 1 26  ? 22.493  -1.442  10.790  1.00 0.00 ? 383 VAL A H    7  
ATOM   9917  H  HA   . VAL A 1 26  ? 22.012  -2.415  13.454  1.00 0.00 ? 383 VAL A HA   7  
ATOM   9918  H  HB   . VAL A 1 26  ? 23.083  -4.394  12.567  1.00 0.00 ? 383 VAL A HB   7  
ATOM   9919  H  HG11 . VAL A 1 26  ? 25.521  -4.145  11.805  1.00 0.00 ? 383 VAL A HG11 7  
ATOM   9920  H  HG12 . VAL A 1 26  ? 24.249  -3.692  10.669  1.00 0.00 ? 383 VAL A HG12 7  
ATOM   9921  H  HG13 . VAL A 1 26  ? 25.126  -2.445  11.556  1.00 0.00 ? 383 VAL A HG13 7  
ATOM   9922  H  HG21 . VAL A 1 26  ? 25.367  -4.078  13.944  1.00 0.00 ? 383 VAL A HG21 7  
ATOM   9923  H  HG22 . VAL A 1 26  ? 24.461  -2.689  14.545  1.00 0.00 ? 383 VAL A HG22 7  
ATOM   9924  H  HG23 . VAL A 1 26  ? 23.798  -4.314  14.713  1.00 0.00 ? 383 VAL A HG23 7  
ATOM   9925  N  N    . TYR A 1 27  ? 23.532  -0.648  14.343  1.00 0.00 ? 384 TYR A N    7  
ATOM   9926  C  CA   . TYR A 1 27  ? 24.271  0.514   14.822  1.00 0.00 ? 384 TYR A CA   7  
ATOM   9927  C  C    . TYR A 1 27  ? 24.944  0.218   16.159  1.00 0.00 ? 384 TYR A C    7  
ATOM   9928  O  O    . TYR A 1 27  ? 24.276  -0.016  17.167  1.00 0.00 ? 384 TYR A O    7  
ATOM   9929  C  CB   . TYR A 1 27  ? 23.336  1.716   14.965  1.00 0.00 ? 384 TYR A CB   7  
ATOM   9930  C  CG   . TYR A 1 27  ? 22.565  2.036   13.704  1.00 0.00 ? 384 TYR A CG   7  
ATOM   9931  C  CD1  . TYR A 1 27  ? 23.126  2.820   12.704  1.00 0.00 ? 384 TYR A CD1  7  
ATOM   9932  C  CD2  . TYR A 1 27  ? 21.276  1.553   13.513  1.00 0.00 ? 384 TYR A CD2  7  
ATOM   9933  C  CE1  . TYR A 1 27  ? 22.425  3.116   11.551  1.00 0.00 ? 384 TYR A CE1  7  
ATOM   9934  C  CE2  . TYR A 1 27  ? 20.569  1.843   12.362  1.00 0.00 ? 384 TYR A CE2  7  
ATOM   9935  C  CZ   . TYR A 1 27  ? 21.147  2.625   11.384  1.00 0.00 ? 384 TYR A CZ   7  
ATOM   9936  O  OH   . TYR A 1 27  ? 20.446  2.916   10.236  1.00 0.00 ? 384 TYR A OH   7  
ATOM   9937  H  H    . TYR A 1 27  ? 22.962  -1.143  14.968  1.00 0.00 ? 384 TYR A H    7  
ATOM   9938  H  HA   . TYR A 1 27  ? 25.032  0.747   14.093  1.00 0.00 ? 384 TYR A HA   7  
ATOM   9939  H  HB2  . TYR A 1 27  ? 22.621  1.516   15.748  1.00 0.00 ? 384 TYR A HB2  7  
ATOM   9940  H  HB3  . TYR A 1 27  ? 23.918  2.587   15.229  1.00 0.00 ? 384 TYR A HB3  7  
ATOM   9941  H  HD1  . TYR A 1 27  ? 24.128  3.203   12.837  1.00 0.00 ? 384 TYR A HD1  7  
ATOM   9942  H  HD2  . TYR A 1 27  ? 20.826  0.941   14.280  1.00 0.00 ? 384 TYR A HD2  7  
ATOM   9943  H  HE1  . TYR A 1 27  ? 22.878  3.728   10.785  1.00 0.00 ? 384 TYR A HE1  7  
ATOM   9944  H  HE2  . TYR A 1 27  ? 19.568  1.459   12.231  1.00 0.00 ? 384 TYR A HE2  7  
ATOM   9945  H  HH   . TYR A 1 27  ? 20.197  3.843   10.241  1.00 0.00 ? 384 TYR A HH   7  
ATOM   9946  N  N    . THR A 1 28  ? 26.274  0.230   16.160  1.00 0.00 ? 385 THR A N    7  
ATOM   9947  C  CA   . THR A 1 28  ? 27.039  -0.038  17.371  1.00 0.00 ? 385 THR A CA   7  
ATOM   9948  C  C    . THR A 1 28  ? 26.502  0.766   18.550  1.00 0.00 ? 385 THR A C    7  
ATOM   9949  O  O    . THR A 1 28  ? 26.392  0.255   19.665  1.00 0.00 ? 385 THR A O    7  
ATOM   9950  C  CB   . THR A 1 28  ? 28.531  0.293   17.177  1.00 0.00 ? 385 THR A CB   7  
ATOM   9951  O  OG1  . THR A 1 28  ? 28.674  1.610   16.634  1.00 0.00 ? 385 THR A OG1  7  
ATOM   9952  C  CG2  . THR A 1 28  ? 29.193  -0.717  16.252  1.00 0.00 ? 385 THR A CG2  7  
ATOM   9953  H  H    . THR A 1 28  ? 26.749  0.422   15.326  1.00 0.00 ? 385 THR A H    7  
ATOM   9954  H  HA   . THR A 1 28  ? 26.952  -1.091  17.596  1.00 0.00 ? 385 THR A HA   7  
ATOM   9955  H  HB   . THR A 1 28  ? 29.021  0.253   18.139  1.00 0.00 ? 385 THR A HB   7  
ATOM   9956  H  HG1  . THR A 1 28  ? 28.233  1.655   15.782  1.00 0.00 ? 385 THR A HG1  7  
ATOM   9957  H  HG21 . THR A 1 28  ? 29.214  -1.684  16.732  1.00 0.00 ? 385 THR A HG21 7  
ATOM   9958  H  HG22 . THR A 1 28  ? 30.203  -0.401  16.037  1.00 0.00 ? 385 THR A HG22 7  
ATOM   9959  H  HG23 . THR A 1 28  ? 28.633  -0.784  15.332  1.00 0.00 ? 385 THR A HG23 7  
ATOM   9960  N  N    . LYS A 1 29  ? 26.167  2.027   18.297  1.00 0.00 ? 386 LYS A N    7  
ATOM   9961  C  CA   . LYS A 1 29  ? 25.639  2.902   19.337  1.00 0.00 ? 386 LYS A CA   7  
ATOM   9962  C  C    . LYS A 1 29  ? 24.127  2.742   19.466  1.00 0.00 ? 386 LYS A C    7  
ATOM   9963  O  O    . LYS A 1 29  ? 23.420  2.606   18.468  1.00 0.00 ? 386 LYS A O    7  
ATOM   9964  C  CB   . LYS A 1 29  ? 25.983  4.360   19.029  1.00 0.00 ? 386 LYS A CB   7  
ATOM   9965  C  CG   . LYS A 1 29  ? 27.338  4.791   19.562  1.00 0.00 ? 386 LYS A CG   7  
ATOM   9966  C  CD   . LYS A 1 29  ? 28.448  4.507   18.564  1.00 0.00 ? 386 LYS A CD   7  
ATOM   9967  C  CE   . LYS A 1 29  ? 29.821  4.650   19.200  1.00 0.00 ? 386 LYS A CE   7  
ATOM   9968  N  NZ   . LYS A 1 29  ? 30.068  3.601   20.228  1.00 0.00 ? 386 LYS A NZ   7  
ATOM   9969  H  H    . LYS A 1 29  ? 26.278  2.377   17.388  1.00 0.00 ? 386 LYS A H    7  
ATOM   9970  H  HA   . LYS A 1 29  ? 26.100  2.622   20.272  1.00 0.00 ? 386 LYS A HA   7  
ATOM   9971  H  HB2  . LYS A 1 29  ? 25.981  4.500   17.957  1.00 0.00 ? 386 LYS A HB2  7  
ATOM   9972  H  HB3  . LYS A 1 29  ? 25.228  4.997   19.467  1.00 0.00 ? 386 LYS A HB3  7  
ATOM   9973  H  HG2  . LYS A 1 29  ? 27.315  5.852   19.765  1.00 0.00 ? 386 LYS A HG2  7  
ATOM   9974  H  HG3  . LYS A 1 29  ? 27.543  4.253   20.477  1.00 0.00 ? 386 LYS A HG3  7  
ATOM   9975  H  HD2  . LYS A 1 29  ? 28.338  3.498   18.195  1.00 0.00 ? 386 LYS A HD2  7  
ATOM   9976  H  HD3  . LYS A 1 29  ? 28.367  5.203   17.741  1.00 0.00 ? 386 LYS A HD3  7  
ATOM   9977  H  HE2  . LYS A 1 29  ? 30.572  4.569   18.429  1.00 0.00 ? 386 LYS A HE2  7  
ATOM   9978  H  HE3  . LYS A 1 29  ? 29.888  5.622   19.667  1.00 0.00 ? 386 LYS A HE3  7  
ATOM   9979  H  HZ1  . LYS A 1 29  ? 29.536  3.818   21.095  1.00 0.00 ? 386 LYS A HZ1  7  
ATOM   9980  H  HZ2  . LYS A 1 29  ? 31.082  3.558   20.458  1.00 0.00 ? 386 LYS A HZ2  7  
ATOM   9981  H  HZ3  . LYS A 1 29  ? 29.766  2.673   19.871  1.00 0.00 ? 386 LYS A HZ3  7  
ATOM   9982  N  N    . SER A 1 30  ? 23.639  2.760   20.702  1.00 0.00 ? 387 SER A N    7  
ATOM   9983  C  CA   . SER A 1 30  ? 22.211  2.614   20.962  1.00 0.00 ? 387 SER A CA   7  
ATOM   9984  C  C    . SER A 1 30  ? 21.457  3.885   20.581  1.00 0.00 ? 387 SER A C    7  
ATOM   9985  O  O    . SER A 1 30  ? 20.401  3.828   19.951  1.00 0.00 ? 387 SER A O    7  
ATOM   9986  C  CB   . SER A 1 30  ? 21.970  2.288   22.437  1.00 0.00 ? 387 SER A CB   7  
ATOM   9987  O  OG   . SER A 1 30  ? 20.595  2.060   22.691  1.00 0.00 ? 387 SER A OG   7  
ATOM   9988  H  H    . SER A 1 30  ? 24.253  2.871   21.458  1.00 0.00 ? 387 SER A H    7  
ATOM   9989  H  HA   . SER A 1 30  ? 21.846  1.798   20.357  1.00 0.00 ? 387 SER A HA   7  
ATOM   9990  H  HB2  . SER A 1 30  ? 22.524  1.400   22.702  1.00 0.00 ? 387 SER A HB2  7  
ATOM   9991  H  HB3  . SER A 1 30  ? 22.304  3.116   23.045  1.00 0.00 ? 387 SER A HB3  7  
ATOM   9992  H  HG   . SER A 1 30  ? 20.469  1.861   23.622  1.00 0.00 ? 387 SER A HG   7  
ATOM   9993  N  N    . SER A 1 31  ? 22.008  5.031   20.968  1.00 0.00 ? 388 SER A N    7  
ATOM   9994  C  CA   . SER A 1 31  ? 21.387  6.316   20.671  1.00 0.00 ? 388 SER A CA   7  
ATOM   9995  C  C    . SER A 1 31  ? 21.118  6.457   19.176  1.00 0.00 ? 388 SER A C    7  
ATOM   9996  O  O    . SER A 1 31  ? 20.024  6.844   18.764  1.00 0.00 ? 388 SER A O    7  
ATOM   9997  C  CB   . SER A 1 31  ? 22.282  7.461   21.150  1.00 0.00 ? 388 SER A CB   7  
ATOM   9998  O  OG   . SER A 1 31  ? 22.077  7.727   22.527  1.00 0.00 ? 388 SER A OG   7  
ATOM   9999  H  H    . SER A 1 31  ? 22.852  5.011   21.467  1.00 0.00 ? 388 SER A H    7  
ATOM   10000 H  HA   . SER A 1 31  ? 20.447  6.360   21.200  1.00 0.00 ? 388 SER A HA   7  
ATOM   10001 H  HB2  . SER A 1 31  ? 23.316  7.195   20.997  1.00 0.00 ? 388 SER A HB2  7  
ATOM   10002 H  HB3  . SER A 1 31  ? 22.053  8.354   20.585  1.00 0.00 ? 388 SER A HB3  7  
ATOM   10003 H  HG   . SER A 1 31  ? 21.295  7.260   22.830  1.00 0.00 ? 388 SER A HG   7  
ATOM   10004 N  N    . HIS A 1 32  ? 22.125  6.140   18.367  1.00 0.00 ? 389 HIS A N    7  
ATOM   10005 C  CA   . HIS A 1 32  ? 21.998  6.230   16.917  1.00 0.00 ? 389 HIS A CA   7  
ATOM   10006 C  C    . HIS A 1 32  ? 20.810  5.409   16.424  1.00 0.00 ? 389 HIS A C    7  
ATOM   10007 O  O    . HIS A 1 32  ? 19.995  5.890   15.634  1.00 0.00 ? 389 HIS A O    7  
ATOM   10008 C  CB   . HIS A 1 32  ? 23.281  5.748   16.241  1.00 0.00 ? 389 HIS A CB   7  
ATOM   10009 C  CG   . HIS A 1 32  ? 24.384  6.761   16.257  1.00 0.00 ? 389 HIS A CG   7  
ATOM   10010 N  ND1  . HIS A 1 32  ? 25.714  6.429   16.110  1.00 0.00 ? 389 HIS A ND1  7  
ATOM   10011 C  CD2  . HIS A 1 32  ? 24.348  8.106   16.404  1.00 0.00 ? 389 HIS A CD2  7  
ATOM   10012 C  CE1  . HIS A 1 32  ? 26.449  7.525   16.166  1.00 0.00 ? 389 HIS A CE1  7  
ATOM   10013 N  NE2  . HIS A 1 32  ? 25.644  8.557   16.344  1.00 0.00 ? 389 HIS A NE2  7  
ATOM   10014 H  H    . HIS A 1 32  ? 22.972  5.838   18.755  1.00 0.00 ? 389 HIS A H    7  
ATOM   10015 H  HA   . HIS A 1 32  ? 21.834  7.266   16.662  1.00 0.00 ? 389 HIS A HA   7  
ATOM   10016 H  HB2  . HIS A 1 32  ? 23.637  4.863   16.748  1.00 0.00 ? 389 HIS A HB2  7  
ATOM   10017 H  HB3  . HIS A 1 32  ? 23.068  5.505   15.210  1.00 0.00 ? 389 HIS A HB3  7  
ATOM   10018 H  HD1  . HIS A 1 32  ? 26.067  5.524   15.984  1.00 0.00 ? 389 HIS A HD1  7  
ATOM   10019 H  HD2  . HIS A 1 32  ? 23.465  8.714   16.543  1.00 0.00 ? 389 HIS A HD2  7  
ATOM   10020 H  HE1  . HIS A 1 32  ? 27.524  7.571   16.081  1.00 0.00 ? 389 HIS A HE1  7  
ATOM   10021 N  N    . LEU A 1 33  ? 20.717  4.170   16.893  1.00 0.00 ? 390 LEU A N    7  
ATOM   10022 C  CA   . LEU A 1 33  ? 19.629  3.282   16.499  1.00 0.00 ? 390 LEU A CA   7  
ATOM   10023 C  C    . LEU A 1 33  ? 18.275  3.951   16.715  1.00 0.00 ? 390 LEU A C    7  
ATOM   10024 O  O    . LEU A 1 33  ? 17.446  4.007   15.806  1.00 0.00 ? 390 LEU A O    7  
ATOM   10025 C  CB   . LEU A 1 33  ? 19.698  1.976   17.292  1.00 0.00 ? 390 LEU A CB   7  
ATOM   10026 C  CG   . LEU A 1 33  ? 18.596  0.956   17.002  1.00 0.00 ? 390 LEU A CG   7  
ATOM   10027 C  CD1  . LEU A 1 33  ? 18.720  0.426   15.582  1.00 0.00 ? 390 LEU A CD1  7  
ATOM   10028 C  CD2  . LEU A 1 33  ? 18.650  -0.187  18.006  1.00 0.00 ? 390 LEU A CD2  7  
ATOM   10029 H  H    . LEU A 1 33  ? 21.396  3.844   17.519  1.00 0.00 ? 390 LEU A H    7  
ATOM   10030 H  HA   . LEU A 1 33  ? 19.745  3.062   15.448  1.00 0.00 ? 390 LEU A HA   7  
ATOM   10031 H  HB2  . LEU A 1 33  ? 20.646  1.508   17.078  1.00 0.00 ? 390 LEU A HB2  7  
ATOM   10032 H  HB3  . LEU A 1 33  ? 19.651  2.225   18.343  1.00 0.00 ? 390 LEU A HB3  7  
ATOM   10033 H  HG   . LEU A 1 33  ? 17.633  1.439   17.095  1.00 0.00 ? 390 LEU A HG   7  
ATOM   10034 H  HD11 . LEU A 1 33  ? 17.833  -0.134  15.328  1.00 0.00 ? 390 LEU A HD11 7  
ATOM   10035 H  HD12 . LEU A 1 33  ? 19.585  -0.217  15.512  1.00 0.00 ? 390 LEU A HD12 7  
ATOM   10036 H  HD13 . LEU A 1 33  ? 18.831  1.255   14.897  1.00 0.00 ? 390 LEU A HD13 7  
ATOM   10037 H  HD21 . LEU A 1 33  ? 19.287  0.090   18.832  1.00 0.00 ? 390 LEU A HD21 7  
ATOM   10038 H  HD22 . LEU A 1 33  ? 19.045  -1.069  17.525  1.00 0.00 ? 390 LEU A HD22 7  
ATOM   10039 H  HD23 . LEU A 1 33  ? 17.654  -0.392  18.371  1.00 0.00 ? 390 LEU A HD23 7  
ATOM   10040 N  N    . LYS A 1 34  ? 18.058  4.459   17.923  1.00 0.00 ? 391 LYS A N    7  
ATOM   10041 C  CA   . LYS A 1 34  ? 16.807  5.128   18.259  1.00 0.00 ? 391 LYS A CA   7  
ATOM   10042 C  C    . LYS A 1 34  ? 16.369  6.060   17.134  1.00 0.00 ? 391 LYS A C    7  
ATOM   10043 O  O    . LYS A 1 34  ? 15.211  6.045   16.718  1.00 0.00 ? 391 LYS A O    7  
ATOM   10044 C  CB   . LYS A 1 34  ? 16.960  5.919   19.560  1.00 0.00 ? 391 LYS A CB   7  
ATOM   10045 C  CG   . LYS A 1 34  ? 16.772  5.076   20.810  1.00 0.00 ? 391 LYS A CG   7  
ATOM   10046 C  CD   . LYS A 1 34  ? 17.065  5.874   22.070  1.00 0.00 ? 391 LYS A CD   7  
ATOM   10047 C  CE   . LYS A 1 34  ? 15.837  6.633   22.548  1.00 0.00 ? 391 LYS A CE   7  
ATOM   10048 N  NZ   . LYS A 1 34  ? 14.817  5.722   23.137  1.00 0.00 ? 391 LYS A NZ   7  
ATOM   10049 H  H    . LYS A 1 34  ? 18.758  4.383   18.606  1.00 0.00 ? 391 LYS A H    7  
ATOM   10050 H  HA   . LYS A 1 34  ? 16.051  4.369   18.396  1.00 0.00 ? 391 LYS A HA   7  
ATOM   10051 H  HB2  . LYS A 1 34  ? 17.949  6.352   19.589  1.00 0.00 ? 391 LYS A HB2  7  
ATOM   10052 H  HB3  . LYS A 1 34  ? 16.228  6.713   19.573  1.00 0.00 ? 391 LYS A HB3  7  
ATOM   10053 H  HG2  . LYS A 1 34  ? 15.750  4.728   20.848  1.00 0.00 ? 391 LYS A HG2  7  
ATOM   10054 H  HG3  . LYS A 1 34  ? 17.442  4.229   20.767  1.00 0.00 ? 391 LYS A HG3  7  
ATOM   10055 H  HD2  . LYS A 1 34  ? 17.382  5.197   22.849  1.00 0.00 ? 391 LYS A HD2  7  
ATOM   10056 H  HD3  . LYS A 1 34  ? 17.856  6.581   21.861  1.00 0.00 ? 391 LYS A HD3  7  
ATOM   10057 H  HE2  . LYS A 1 34  ? 16.141  7.350   23.295  1.00 0.00 ? 391 LYS A HE2  7  
ATOM   10058 H  HE3  . LYS A 1 34  ? 15.401  7.152   21.708  1.00 0.00 ? 391 LYS A HE3  7  
ATOM   10059 H  HZ1  . LYS A 1 34  ? 14.572  4.973   22.459  1.00 0.00 ? 391 LYS A HZ1  7  
ATOM   10060 H  HZ2  . LYS A 1 34  ? 13.956  6.255   23.374  1.00 0.00 ? 391 LYS A HZ2  7  
ATOM   10061 H  HZ3  . LYS A 1 34  ? 15.188  5.282   24.004  1.00 0.00 ? 391 LYS A HZ3  7  
ATOM   10062 N  N    . ALA A 1 35  ? 17.303  6.869   16.645  1.00 0.00 ? 392 ALA A N    7  
ATOM   10063 C  CA   . ALA A 1 35  ? 17.014  7.805   15.565  1.00 0.00 ? 392 ALA A CA   7  
ATOM   10064 C  C    . ALA A 1 35  ? 16.568  7.070   14.306  1.00 0.00 ? 392 ALA A C    7  
ATOM   10065 O  O    . ALA A 1 35  ? 15.590  7.454   13.663  1.00 0.00 ? 392 ALA A O    7  
ATOM   10066 C  CB   . ALA A 1 35  ? 18.234  8.666   15.272  1.00 0.00 ? 392 ALA A CB   7  
ATOM   10067 H  H    . ALA A 1 35  ? 18.208  6.834   17.018  1.00 0.00 ? 392 ALA A H    7  
ATOM   10068 H  HA   . ALA A 1 35  ? 16.215  8.455   15.892  1.00 0.00 ? 392 ALA A HA   7  
ATOM   10069 H  HB1  . ALA A 1 35  ? 18.604  8.440   14.284  1.00 0.00 ? 392 ALA A HB1  7  
ATOM   10070 H  HB2  . ALA A 1 35  ? 17.958  9.709   15.325  1.00 0.00 ? 392 ALA A HB2  7  
ATOM   10071 H  HB3  . ALA A 1 35  ? 19.003  8.459   16.001  1.00 0.00 ? 392 ALA A HB3  7  
ATOM   10072 N  N    . HIS A 1 36  ? 17.291  6.010   13.957  1.00 0.00 ? 393 HIS A N    7  
ATOM   10073 C  CA   . HIS A 1 36  ? 16.969  5.221   12.774  1.00 0.00 ? 393 HIS A CA   7  
ATOM   10074 C  C    . HIS A 1 36  ? 15.539  4.693   12.845  1.00 0.00 ? 393 HIS A C    7  
ATOM   10075 O  O    . HIS A 1 36  ? 14.774  4.815   11.888  1.00 0.00 ? 393 HIS A O    7  
ATOM   10076 C  CB   . HIS A 1 36  ? 17.949  4.055   12.630  1.00 0.00 ? 393 HIS A CB   7  
ATOM   10077 C  CG   . HIS A 1 36  ? 17.431  2.940   11.776  1.00 0.00 ? 393 HIS A CG   7  
ATOM   10078 N  ND1  . HIS A 1 36  ? 17.353  3.019   10.401  1.00 0.00 ? 393 HIS A ND1  7  
ATOM   10079 C  CD2  . HIS A 1 36  ? 16.966  1.713   12.108  1.00 0.00 ? 393 HIS A CD2  7  
ATOM   10080 C  CE1  . HIS A 1 36  ? 16.860  1.889   9.925   1.00 0.00 ? 393 HIS A CE1  7  
ATOM   10081 N  NE2  . HIS A 1 36  ? 16.617  1.080   10.940  1.00 0.00 ? 393 HIS A NE2  7  
ATOM   10082 H  H    . HIS A 1 36  ? 18.058  5.753   14.510  1.00 0.00 ? 393 HIS A H    7  
ATOM   10083 H  HA   . HIS A 1 36  ? 17.060  5.864   11.912  1.00 0.00 ? 393 HIS A HA   7  
ATOM   10084 H  HB2  . HIS A 1 36  ? 18.864  4.416   12.186  1.00 0.00 ? 393 HIS A HB2  7  
ATOM   10085 H  HB3  . HIS A 1 36  ? 18.164  3.652   13.609  1.00 0.00 ? 393 HIS A HB3  7  
ATOM   10086 H  HD1  . HIS A 1 36  ? 17.618  3.789   9.856   1.00 0.00 ? 393 HIS A HD1  7  
ATOM   10087 H  HD2  . HIS A 1 36  ? 16.883  1.306   13.106  1.00 0.00 ? 393 HIS A HD2  7  
ATOM   10088 H  HE1  . HIS A 1 36  ? 16.686  1.665   8.883   1.00 0.00 ? 393 HIS A HE1  7  
ATOM   10089 N  N    . LEU A 1 37  ? 15.186  4.107   13.983  1.00 0.00 ? 394 LEU A N    7  
ATOM   10090 C  CA   . LEU A 1 37  ? 13.848  3.560   14.179  1.00 0.00 ? 394 LEU A CA   7  
ATOM   10091 C  C    . LEU A 1 37  ? 12.790  4.484   13.585  1.00 0.00 ? 394 LEU A C    7  
ATOM   10092 O  O    . LEU A 1 37  ? 11.864  4.032   12.911  1.00 0.00 ? 394 LEU A O    7  
ATOM   10093 C  CB   . LEU A 1 37  ? 13.576  3.345   15.669  1.00 0.00 ? 394 LEU A CB   7  
ATOM   10094 C  CG   . LEU A 1 37  ? 14.034  2.007   16.249  1.00 0.00 ? 394 LEU A CG   7  
ATOM   10095 C  CD1  . LEU A 1 37  ? 14.082  2.072   17.768  1.00 0.00 ? 394 LEU A CD1  7  
ATOM   10096 C  CD2  . LEU A 1 37  ? 13.115  0.884   15.790  1.00 0.00 ? 394 LEU A CD2  7  
ATOM   10097 H  H    . LEU A 1 37  ? 15.840  4.040   14.710  1.00 0.00 ? 394 LEU A H    7  
ATOM   10098 H  HA   . LEU A 1 37  ? 13.802  2.607   13.672  1.00 0.00 ? 394 LEU A HA   7  
ATOM   10099 H  HB2  . LEU A 1 37  ? 14.079  4.130   16.213  1.00 0.00 ? 394 LEU A HB2  7  
ATOM   10100 H  HB3  . LEU A 1 37  ? 12.510  3.428   15.825  1.00 0.00 ? 394 LEU A HB3  7  
ATOM   10101 H  HG   . LEU A 1 37  ? 15.032  1.790   15.893  1.00 0.00 ? 394 LEU A HG   7  
ATOM   10102 H  HD11 . LEU A 1 37  ? 14.381  1.111   18.159  1.00 0.00 ? 394 LEU A HD11 7  
ATOM   10103 H  HD12 . LEU A 1 37  ? 13.104  2.327   18.148  1.00 0.00 ? 394 LEU A HD12 7  
ATOM   10104 H  HD13 . LEU A 1 37  ? 14.794  2.824   18.073  1.00 0.00 ? 394 LEU A HD13 7  
ATOM   10105 H  HD21 . LEU A 1 37  ? 12.272  1.303   15.260  1.00 0.00 ? 394 LEU A HD21 7  
ATOM   10106 H  HD22 . LEU A 1 37  ? 12.763  0.334   16.650  1.00 0.00 ? 394 LEU A HD22 7  
ATOM   10107 H  HD23 . LEU A 1 37  ? 13.659  0.219   15.135  1.00 0.00 ? 394 LEU A HD23 7  
ATOM   10108 N  N    . ARG A 1 38  ? 12.934  5.780   13.838  1.00 0.00 ? 395 ARG A N    7  
ATOM   10109 C  CA   . ARG A 1 38  ? 11.991  6.768   13.328  1.00 0.00 ? 395 ARG A CA   7  
ATOM   10110 C  C    . ARG A 1 38  ? 11.565  6.427   11.903  1.00 0.00 ? 395 ARG A C    7  
ATOM   10111 O  O    . ARG A 1 38  ? 10.386  6.517   11.558  1.00 0.00 ? 395 ARG A O    7  
ATOM   10112 C  CB   . ARG A 1 38  ? 12.614  8.165   13.365  1.00 0.00 ? 395 ARG A CB   7  
ATOM   10113 C  CG   . ARG A 1 38  ? 12.720  8.748   14.764  1.00 0.00 ? 395 ARG A CG   7  
ATOM   10114 C  CD   . ARG A 1 38  ? 13.453  10.080  14.759  1.00 0.00 ? 395 ARG A CD   7  
ATOM   10115 N  NE   . ARG A 1 38  ? 13.777  10.532  16.110  1.00 0.00 ? 395 ARG A NE   7  
ATOM   10116 C  CZ   . ARG A 1 38  ? 14.467  11.637  16.369  1.00 0.00 ? 395 ARG A CZ   7  
ATOM   10117 N  NH1  . ARG A 1 38  ? 14.902  12.400  15.375  1.00 0.00 ? 395 ARG A NH1  7  
ATOM   10118 N  NH2  . ARG A 1 38  ? 14.722  11.982  17.625  1.00 0.00 ? 395 ARG A NH2  7  
ATOM   10119 H  H    . ARG A 1 38  ? 13.692  6.080   14.382  1.00 0.00 ? 395 ARG A H    7  
ATOM   10120 H  HA   . ARG A 1 38  ? 11.120  6.756   13.965  1.00 0.00 ? 395 ARG A HA   7  
ATOM   10121 H  HB2  . ARG A 1 38  ? 13.607  8.116   12.943  1.00 0.00 ? 395 ARG A HB2  7  
ATOM   10122 H  HB3  . ARG A 1 38  ? 12.010  8.831   12.766  1.00 0.00 ? 395 ARG A HB3  7  
ATOM   10123 H  HG2  . ARG A 1 38  ? 11.725  8.899   15.158  1.00 0.00 ? 395 ARG A HG2  7  
ATOM   10124 H  HG3  . ARG A 1 38  ? 13.257  8.054   15.394  1.00 0.00 ? 395 ARG A HG3  7  
ATOM   10125 H  HD2  . ARG A 1 38  ? 14.369  9.970   14.197  1.00 0.00 ? 395 ARG A HD2  7  
ATOM   10126 H  HD3  . ARG A 1 38  ? 12.826  10.819  14.283  1.00 0.00 ? 395 ARG A HD3  7  
ATOM   10127 H  HE   . ARG A 1 38  ? 13.465  9.984   16.859  1.00 0.00 ? 395 ARG A HE   7  
ATOM   10128 H  HH11 . ARG A 1 38  ? 14.710  12.143  14.428  1.00 0.00 ? 395 ARG A HH11 7  
ATOM   10129 H  HH12 . ARG A 1 38  ? 15.420  13.232  15.573  1.00 0.00 ? 395 ARG A HH12 7  
ATOM   10130 H  HH21 . ARG A 1 38  ? 14.395  11.410  18.376  1.00 0.00 ? 395 ARG A HH21 7  
ATOM   10131 H  HH22 . ARG A 1 38  ? 15.241  12.814  17.819  1.00 0.00 ? 395 ARG A HH22 7  
ATOM   10132 N  N    . THR A 1 39  ? 12.531  6.036   11.079  1.00 0.00 ? 396 THR A N    7  
ATOM   10133 C  CA   . THR A 1 39  ? 12.257  5.683   9.692   1.00 0.00 ? 396 THR A CA   7  
ATOM   10134 C  C    . THR A 1 39  ? 11.048  4.760   9.588   1.00 0.00 ? 396 THR A C    7  
ATOM   10135 O  O    . THR A 1 39  ? 10.195  4.934   8.717   1.00 0.00 ? 396 THR A O    7  
ATOM   10136 C  CB   . THR A 1 39  ? 13.470  4.997   9.036   1.00 0.00 ? 396 THR A CB   7  
ATOM   10137 O  OG1  . THR A 1 39  ? 13.760  3.767   9.708   1.00 0.00 ? 396 THR A OG1  7  
ATOM   10138 C  CG2  . THR A 1 39  ? 14.692  5.903   9.077   1.00 0.00 ? 396 THR A CG2  7  
ATOM   10139 H  H    . THR A 1 39  ? 13.451  5.985   11.413  1.00 0.00 ? 396 THR A H    7  
ATOM   10140 H  HA   . THR A 1 39  ? 12.049  6.595   9.151   1.00 0.00 ? 396 THR A HA   7  
ATOM   10141 H  HB   . THR A 1 39  ? 13.231  4.787   8.003   1.00 0.00 ? 396 THR A HB   7  
ATOM   10142 H  HG1  . THR A 1 39  ? 13.483  3.029   9.158   1.00 0.00 ? 396 THR A HG1  7  
ATOM   10143 H  HG21 . THR A 1 39  ? 14.509  6.723   9.756   1.00 0.00 ? 396 THR A HG21 7  
ATOM   10144 H  HG22 . THR A 1 39  ? 14.886  6.291   8.088   1.00 0.00 ? 396 THR A HG22 7  
ATOM   10145 H  HG23 . THR A 1 39  ? 15.547  5.338   9.417   1.00 0.00 ? 396 THR A HG23 7  
ATOM   10146 N  N    . HIS A 1 40  ? 10.980  3.779   10.482  1.00 0.00 ? 397 HIS A N    7  
ATOM   10147 C  CA   . HIS A 1 40  ? 9.874   2.828   10.491  1.00 0.00 ? 397 HIS A CA   7  
ATOM   10148 C  C    . HIS A 1 40  ? 8.661   3.413   11.209  1.00 0.00 ? 397 HIS A C    7  
ATOM   10149 O  O    . HIS A 1 40  ? 7.524   3.248   10.766  1.00 0.00 ? 397 HIS A O    7  
ATOM   10150 C  CB   . HIS A 1 40  ? 10.300  1.524   11.165  1.00 0.00 ? 397 HIS A CB   7  
ATOM   10151 C  CG   . HIS A 1 40  ? 11.556  0.939   10.597  1.00 0.00 ? 397 HIS A CG   7  
ATOM   10152 N  ND1  . HIS A 1 40  ? 11.659  0.500   9.294   1.00 0.00 ? 397 HIS A ND1  7  
ATOM   10153 C  CD2  . HIS A 1 40  ? 12.767  0.722   11.162  1.00 0.00 ? 397 HIS A CD2  7  
ATOM   10154 C  CE1  . HIS A 1 40  ? 12.879  0.037   9.083   1.00 0.00 ? 397 HIS A CE1  7  
ATOM   10155 N  NE2  . HIS A 1 40  ? 13.571  0.161   10.201  1.00 0.00 ? 397 HIS A NE2  7  
ATOM   10156 H  H    . HIS A 1 40  ? 11.691  3.692   11.151  1.00 0.00 ? 397 HIS A H    7  
ATOM   10157 H  HA   . HIS A 1 40  ? 9.605   2.623   9.466   1.00 0.00 ? 397 HIS A HA   7  
ATOM   10158 H  HB2  . HIS A 1 40  ? 10.466  1.708   12.217  1.00 0.00 ? 397 HIS A HB2  7  
ATOM   10159 H  HB3  . HIS A 1 40  ? 9.512   0.794   11.053  1.00 0.00 ? 397 HIS A HB3  7  
ATOM   10160 H  HD1  . HIS A 1 40  ? 10.945  0.523   8.624   1.00 0.00 ? 397 HIS A HD1  7  
ATOM   10161 H  HD2  . HIS A 1 40  ? 13.049  0.948   12.181  1.00 0.00 ? 397 HIS A HD2  7  
ATOM   10162 H  HE1  . HIS A 1 40  ? 13.248  -0.372  8.154   1.00 0.00 ? 397 HIS A HE1  7  
ATOM   10163 N  N    . THR A 1 41  ? 8.911   4.098   12.321  1.00 0.00 ? 398 THR A N    7  
ATOM   10164 C  CA   . THR A 1 41  ? 7.841   4.706   13.101  1.00 0.00 ? 398 THR A CA   7  
ATOM   10165 C  C    . THR A 1 41  ? 7.742   6.202   12.827  1.00 0.00 ? 398 THR A C    7  
ATOM   10166 O  O    . THR A 1 41  ? 8.653   6.964   13.150  1.00 0.00 ? 398 THR A O    7  
ATOM   10167 C  CB   . THR A 1 41  ? 8.050   4.484   14.611  1.00 0.00 ? 398 THR A CB   7  
ATOM   10168 O  OG1  . THR A 1 41  ? 7.005   5.125   15.350  1.00 0.00 ? 398 THR A OG1  7  
ATOM   10169 C  CG2  . THR A 1 41  ? 9.400   5.028   15.055  1.00 0.00 ? 398 THR A CG2  7  
ATOM   10170 H  H    . THR A 1 41  ? 9.838   4.195   12.623  1.00 0.00 ? 398 THR A H    7  
ATOM   10171 H  HA   . THR A 1 41  ? 6.911   4.235   12.815  1.00 0.00 ? 398 THR A HA   7  
ATOM   10172 H  HB   . THR A 1 41  ? 8.023   3.423   14.811  1.00 0.00 ? 398 THR A HB   7  
ATOM   10173 H  HG1  . THR A 1 41  ? 6.164   4.977   14.910  1.00 0.00 ? 398 THR A HG1  7  
ATOM   10174 H  HG21 . THR A 1 41  ? 10.172  4.649   14.404  1.00 0.00 ? 398 THR A HG21 7  
ATOM   10175 H  HG22 . THR A 1 41  ? 9.598   4.715   16.070  1.00 0.00 ? 398 THR A HG22 7  
ATOM   10176 H  HG23 . THR A 1 41  ? 9.386   6.107   15.008  1.00 0.00 ? 398 THR A HG23 7  
ATOM   10177 N  N    . GLY A 1 42  ? 6.629   6.618   12.231  1.00 0.00 ? 399 GLY A N    7  
ATOM   10178 C  CA   . GLY A 1 42  ? 6.432   8.023   11.925  1.00 0.00 ? 399 GLY A CA   7  
ATOM   10179 C  C    . GLY A 1 42  ? 7.077   8.427   10.614  1.00 0.00 ? 399 GLY A C    7  
ATOM   10180 O  O    . GLY A 1 42  ? 8.302   8.435   10.495  1.00 0.00 ? 399 GLY A O    7  
ATOM   10181 H  H    . GLY A 1 42  ? 5.936   5.966   11.997  1.00 0.00 ? 399 GLY A H    7  
ATOM   10182 H  HA2  . GLY A 1 42  ? 5.372   8.223   11.869  1.00 0.00 ? 399 GLY A HA2  7  
ATOM   10183 H  HA3  . GLY A 1 42  ? 6.859   8.616   12.720  1.00 0.00 ? 399 GLY A HA3  7  
ATOM   10184 N  N    . GLU A 1 43  ? 6.251   8.760   9.627   1.00 0.00 ? 400 GLU A N    7  
ATOM   10185 C  CA   . GLU A 1 43  ? 6.750   9.164   8.318   1.00 0.00 ? 400 GLU A CA   7  
ATOM   10186 C  C    . GLU A 1 43  ? 6.086   10.459  7.858   1.00 0.00 ? 400 GLU A C    7  
ATOM   10187 O  O    . GLU A 1 43  ? 5.288   11.053  8.584   1.00 0.00 ? 400 GLU A O    7  
ATOM   10188 C  CB   . GLU A 1 43  ? 6.502   8.058   7.290   1.00 0.00 ? 400 GLU A CB   7  
ATOM   10189 C  CG   . GLU A 1 43  ? 5.034   7.709   7.114   1.00 0.00 ? 400 GLU A CG   7  
ATOM   10190 C  CD   . GLU A 1 43  ? 4.824   6.269   6.686   1.00 0.00 ? 400 GLU A CD   7  
ATOM   10191 O  OE1  . GLU A 1 43  ? 5.411   5.370   7.325   1.00 0.00 ? 400 GLU A OE1  7  
ATOM   10192 O  OE2  . GLU A 1 43  ? 4.074   6.041   5.714   1.00 0.00 ? 400 GLU A OE2  7  
ATOM   10193 H  H    . GLU A 1 43  ? 5.284   8.734   9.783   1.00 0.00 ? 400 GLU A H    7  
ATOM   10194 H  HA   . GLU A 1 43  ? 7.813   9.330   8.405   1.00 0.00 ? 400 GLU A HA   7  
ATOM   10195 H  HB2  . GLU A 1 43  ? 6.892   8.377   6.334   1.00 0.00 ? 400 GLU A HB2  7  
ATOM   10196 H  HB3  . GLU A 1 43  ? 7.027   7.168   7.603   1.00 0.00 ? 400 GLU A HB3  7  
ATOM   10197 H  HG2  . GLU A 1 43  ? 4.524   7.867   8.052   1.00 0.00 ? 400 GLU A HG2  7  
ATOM   10198 H  HG3  . GLU A 1 43  ? 4.610   8.358   6.362   1.00 0.00 ? 400 GLU A HG3  7  
ATOM   10199 N  N    . LYS A 1 44  ? 6.422   10.892  6.648   1.00 0.00 ? 401 LYS A N    7  
ATOM   10200 C  CA   . LYS A 1 44  ? 5.860   12.116  6.089   1.00 0.00 ? 401 LYS A CA   7  
ATOM   10201 C  C    . LYS A 1 44  ? 5.052   11.818  4.830   1.00 0.00 ? 401 LYS A C    7  
ATOM   10202 O  O    . LYS A 1 44  ? 5.597   11.659  3.737   1.00 0.00 ? 401 LYS A O    7  
ATOM   10203 C  CB   . LYS A 1 44  ? 6.975   13.114  5.769   1.00 0.00 ? 401 LYS A CB   7  
ATOM   10204 C  CG   . LYS A 1 44  ? 7.733   13.594  6.994   1.00 0.00 ? 401 LYS A CG   7  
ATOM   10205 C  CD   . LYS A 1 44  ? 8.897   14.492  6.613   1.00 0.00 ? 401 LYS A CD   7  
ATOM   10206 C  CE   . LYS A 1 44  ? 9.756   14.834  7.821   1.00 0.00 ? 401 LYS A CE   7  
ATOM   10207 N  NZ   . LYS A 1 44  ? 10.950  15.640  7.443   1.00 0.00 ? 401 LYS A NZ   7  
ATOM   10208 H  H    . LYS A 1 44  ? 7.065   10.375  6.117   1.00 0.00 ? 401 LYS A H    7  
ATOM   10209 H  HA   . LYS A 1 44  ? 5.204   12.548  6.830   1.00 0.00 ? 401 LYS A HA   7  
ATOM   10210 H  HB2  . LYS A 1 44  ? 7.679   12.645  5.096   1.00 0.00 ? 401 LYS A HB2  7  
ATOM   10211 H  HB3  . LYS A 1 44  ? 6.541   13.974  5.279   1.00 0.00 ? 401 LYS A HB3  7  
ATOM   10212 H  HG2  . LYS A 1 44  ? 7.058   14.148  7.630   1.00 0.00 ? 401 LYS A HG2  7  
ATOM   10213 H  HG3  . LYS A 1 44  ? 8.112   12.736  7.530   1.00 0.00 ? 401 LYS A HG3  7  
ATOM   10214 H  HD2  . LYS A 1 44  ? 9.510   13.984  5.883   1.00 0.00 ? 401 LYS A HD2  7  
ATOM   10215 H  HD3  . LYS A 1 44  ? 8.510   15.407  6.187   1.00 0.00 ? 401 LYS A HD3  7  
ATOM   10216 H  HE2  . LYS A 1 44  ? 9.160   15.398  8.522   1.00 0.00 ? 401 LYS A HE2  7  
ATOM   10217 H  HE3  . LYS A 1 44  ? 10.084  13.916  8.285   1.00 0.00 ? 401 LYS A HE3  7  
ATOM   10218 H  HZ1  . LYS A 1 44  ? 10.699  16.326  6.703   1.00 0.00 ? 401 LYS A HZ1  7  
ATOM   10219 H  HZ2  . LYS A 1 44  ? 11.701  15.017  7.083   1.00 0.00 ? 401 LYS A HZ2  7  
ATOM   10220 H  HZ3  . LYS A 1 44  ? 11.311  16.155  8.271   1.00 0.00 ? 401 LYS A HZ3  7  
ATOM   10221 N  N    . PRO A 1 45  ? 3.722   11.741  4.984   1.00 0.00 ? 402 PRO A N    7  
ATOM   10222 C  CA   . PRO A 1 45  ? 2.811   11.464  3.869   1.00 0.00 ? 402 PRO A CA   7  
ATOM   10223 C  C    . PRO A 1 45  ? 2.729   12.626  2.885   1.00 0.00 ? 402 PRO A C    7  
ATOM   10224 O  O    . PRO A 1 45  ? 2.293   12.458  1.746   1.00 0.00 ? 402 PRO A O    7  
ATOM   10225 C  CB   . PRO A 1 45  ? 1.461   11.250  4.559   1.00 0.00 ? 402 PRO A CB   7  
ATOM   10226 C  CG   . PRO A 1 45  ? 1.564   12.010  5.836   1.00 0.00 ? 402 PRO A CG   7  
ATOM   10227 C  CD   . PRO A 1 45  ? 3.005   11.919  6.257   1.00 0.00 ? 402 PRO A CD   7  
ATOM   10228 H  HA   . PRO A 1 45  ? 3.093   10.565  3.340   1.00 0.00 ? 402 PRO A HA   7  
ATOM   10229 H  HB2  . PRO A 1 45  ? 0.669   11.635  3.932   1.00 0.00 ? 402 PRO A HB2  7  
ATOM   10230 H  HB3  . PRO A 1 45  ? 1.307   10.197  4.738   1.00 0.00 ? 402 PRO A HB3  7  
ATOM   10231 H  HG2  . PRO A 1 45  ? 1.285   13.040  5.674   1.00 0.00 ? 402 PRO A HG2  7  
ATOM   10232 H  HG3  . PRO A 1 45  ? 0.926   11.560  6.582   1.00 0.00 ? 402 PRO A HG3  7  
ATOM   10233 H  HD2  . PRO A 1 45  ? 3.312   12.830  6.749   1.00 0.00 ? 402 PRO A HD2  7  
ATOM   10234 H  HD3  . PRO A 1 45  ? 3.155   11.068  6.906   1.00 0.00 ? 402 PRO A HD3  7  
ATOM   10235 N  N    . TYR A 1 46  ? 3.150   13.804  3.331   1.00 0.00 ? 403 TYR A N    7  
ATOM   10236 C  CA   . TYR A 1 46  ? 3.122   14.994  2.490   1.00 0.00 ? 403 TYR A CA   7  
ATOM   10237 C  C    . TYR A 1 46  ? 4.489   15.251  1.863   1.00 0.00 ? 403 TYR A C    7  
ATOM   10238 O  O    . TYR A 1 46  ? 5.491   15.394  2.565   1.00 0.00 ? 403 TYR A O    7  
ATOM   10239 C  CB   . TYR A 1 46  ? 2.687   16.212  3.308   1.00 0.00 ? 403 TYR A CB   7  
ATOM   10240 C  CG   . TYR A 1 46  ? 1.319   16.063  3.934   1.00 0.00 ? 403 TYR A CG   7  
ATOM   10241 C  CD1  . TYR A 1 46  ? 0.174   16.451  3.248   1.00 0.00 ? 403 TYR A CD1  7  
ATOM   10242 C  CD2  . TYR A 1 46  ? 1.171   15.537  5.211   1.00 0.00 ? 403 TYR A CD2  7  
ATOM   10243 C  CE1  . TYR A 1 46  ? -1.078  16.318  3.817   1.00 0.00 ? 403 TYR A CE1  7  
ATOM   10244 C  CE2  . TYR A 1 46  ? -0.077  15.398  5.786   1.00 0.00 ? 403 TYR A CE2  7  
ATOM   10245 C  CZ   . TYR A 1 46  ? -1.199  15.791  5.085   1.00 0.00 ? 403 TYR A CZ   7  
ATOM   10246 O  OH   . TYR A 1 46  ? -2.444  15.656  5.656   1.00 0.00 ? 403 TYR A OH   7  
ATOM   10247 H  H    . TYR A 1 46  ? 3.487   13.875  4.249   1.00 0.00 ? 403 TYR A H    7  
ATOM   10248 H  HA   . TYR A 1 46  ? 2.403   14.827  1.702   1.00 0.00 ? 403 TYR A HA   7  
ATOM   10249 H  HB2  . TYR A 1 46  ? 3.399   16.376  4.102   1.00 0.00 ? 403 TYR A HB2  7  
ATOM   10250 H  HB3  . TYR A 1 46  ? 2.666   17.079  2.665   1.00 0.00 ? 403 TYR A HB3  7  
ATOM   10251 H  HD1  . TYR A 1 46  ? 0.272   16.863  2.255   1.00 0.00 ? 403 TYR A HD1  7  
ATOM   10252 H  HD2  . TYR A 1 46  ? 2.051   15.231  5.758   1.00 0.00 ? 403 TYR A HD2  7  
ATOM   10253 H  HE1  . TYR A 1 46  ? -1.956  16.624  3.268   1.00 0.00 ? 403 TYR A HE1  7  
ATOM   10254 H  HE2  . TYR A 1 46  ? -0.172  14.986  6.780   1.00 0.00 ? 403 TYR A HE2  7  
ATOM   10255 H  HH   . TYR A 1 46  ? -3.039  16.310  5.282   1.00 0.00 ? 403 TYR A HH   7  
ATOM   10256 N  N    . LYS A 1 47  ? 4.522   15.308  0.536   1.00 0.00 ? 404 LYS A N    7  
ATOM   10257 C  CA   . LYS A 1 47  ? 5.764   15.549  -0.189  1.00 0.00 ? 404 LYS A CA   7  
ATOM   10258 C  C    . LYS A 1 47  ? 5.572   16.623  -1.256  1.00 0.00 ? 404 LYS A C    7  
ATOM   10259 O  O    . LYS A 1 47  ? 4.465   16.824  -1.755  1.00 0.00 ? 404 LYS A O    7  
ATOM   10260 C  CB   . LYS A 1 47  ? 6.260   14.255  -0.836  1.00 0.00 ? 404 LYS A CB   7  
ATOM   10261 C  CG   . LYS A 1 47  ? 5.436   13.820  -2.036  1.00 0.00 ? 404 LYS A CG   7  
ATOM   10262 C  CD   . LYS A 1 47  ? 4.272   12.936  -1.621  1.00 0.00 ? 404 LYS A CD   7  
ATOM   10263 C  CE   . LYS A 1 47  ? 3.235   12.824  -2.728  1.00 0.00 ? 404 LYS A CE   7  
ATOM   10264 N  NZ   . LYS A 1 47  ? 2.202   11.797  -2.420  1.00 0.00 ? 404 LYS A NZ   7  
ATOM   10265 H  H    . LYS A 1 47  ? 3.690   15.186  0.032   1.00 0.00 ? 404 LYS A H    7  
ATOM   10266 H  HA   . LYS A 1 47  ? 6.502   15.893  0.521   1.00 0.00 ? 404 LYS A HA   7  
ATOM   10267 H  HB2  . LYS A 1 47  ? 7.281   14.396  -1.160  1.00 0.00 ? 404 LYS A HB2  7  
ATOM   10268 H  HB3  . LYS A 1 47  ? 6.231   13.464  -0.100  1.00 0.00 ? 404 LYS A HB3  7  
ATOM   10269 H  HG2  . LYS A 1 47  ? 5.049   14.697  -2.533  1.00 0.00 ? 404 LYS A HG2  7  
ATOM   10270 H  HG3  . LYS A 1 47  ? 6.070   13.268  -2.716  1.00 0.00 ? 404 LYS A HG3  7  
ATOM   10271 H  HD2  . LYS A 1 47  ? 4.644   11.949  -1.391  1.00 0.00 ? 404 LYS A HD2  7  
ATOM   10272 H  HD3  . LYS A 1 47  ? 3.804   13.360  -0.744  1.00 0.00 ? 404 LYS A HD3  7  
ATOM   10273 H  HE2  . LYS A 1 47  ? 2.753   13.782  -2.850  1.00 0.00 ? 404 LYS A HE2  7  
ATOM   10274 H  HE3  . LYS A 1 47  ? 3.736   12.554  -3.646  1.00 0.00 ? 404 LYS A HE3  7  
ATOM   10275 H  HZ1  . LYS A 1 47  ? 1.415   11.867  -3.095  1.00 0.00 ? 404 LYS A HZ1  7  
ATOM   10276 H  HZ2  . LYS A 1 47  ? 1.833   11.940  -1.457  1.00 0.00 ? 404 LYS A HZ2  7  
ATOM   10277 H  HZ3  . LYS A 1 47  ? 2.615   10.845  -2.483  1.00 0.00 ? 404 LYS A HZ3  7  
ATOM   10278 N  N    . CYS A 1 48  ? 6.657   17.308  -1.602  1.00 0.00 ? 405 CYS A N    7  
ATOM   10279 C  CA   . CYS A 1 48  ? 6.608   18.360  -2.610  1.00 0.00 ? 405 CYS A CA   7  
ATOM   10280 C  C    . CYS A 1 48  ? 6.558   17.765  -4.014  1.00 0.00 ? 405 CYS A C    7  
ATOM   10281 O  O    . CYS A 1 48  ? 7.487   17.080  -4.445  1.00 0.00 ? 405 CYS A O    7  
ATOM   10282 C  CB   . CYS A 1 48  ? 7.824   19.279  -2.477  1.00 0.00 ? 405 CYS A CB   7  
ATOM   10283 S  SG   . CYS A 1 48  ? 7.684   20.836  -3.411  1.00 0.00 ? 405 CYS A SG   7  
ATOM   10284 H  H    . CYS A 1 48  ? 7.512   17.101  -1.168  1.00 0.00 ? 405 CYS A H    7  
ATOM   10285 H  HA   . CYS A 1 48  ? 5.711   18.937  -2.445  1.00 0.00 ? 405 CYS A HA   7  
ATOM   10286 H  HB2  . CYS A 1 48  ? 7.960   19.533  -1.435  1.00 0.00 ? 405 CYS A HB2  7  
ATOM   10287 H  HB3  . CYS A 1 48  ? 8.700   18.759  -2.833  1.00 0.00 ? 405 CYS A HB3  7  
ATOM   10288 N  N    . THR A 1 49  ? 5.467   18.031  -4.725  1.00 0.00 ? 406 THR A N    7  
ATOM   10289 C  CA   . THR A 1 49  ? 5.294   17.522  -6.080  1.00 0.00 ? 406 THR A CA   7  
ATOM   10290 C  C    . THR A 1 49  ? 6.068   18.366  -7.087  1.00 0.00 ? 406 THR A C    7  
ATOM   10291 O  O    . THR A 1 49  ? 5.560   18.689  -8.160  1.00 0.00 ? 406 THR A O    7  
ATOM   10292 C  CB   . THR A 1 49  ? 3.809   17.495  -6.485  1.00 0.00 ? 406 THR A CB   7  
ATOM   10293 O  OG1  . THR A 1 49  ? 3.025   16.915  -5.436  1.00 0.00 ? 406 THR A OG1  7  
ATOM   10294 C  CG2  . THR A 1 49  ? 3.612   16.702  -7.768  1.00 0.00 ? 406 THR A CG2  7  
ATOM   10295 H  H    . THR A 1 49  ? 4.761   18.582  -4.327  1.00 0.00 ? 406 THR A H    7  
ATOM   10296 H  HA   . THR A 1 49  ? 5.672   16.510  -6.107  1.00 0.00 ? 406 THR A HA   7  
ATOM   10297 H  HB   . THR A 1 49  ? 3.478   18.510  -6.652  1.00 0.00 ? 406 THR A HB   7  
ATOM   10298 H  HG1  . THR A 1 49  ? 3.574   16.322  -4.917  1.00 0.00 ? 406 THR A HG1  7  
ATOM   10299 H  HG21 . THR A 1 49  ? 4.567   16.557  -8.251  1.00 0.00 ? 406 THR A HG21 7  
ATOM   10300 H  HG22 . THR A 1 49  ? 2.953   17.245  -8.430  1.00 0.00 ? 406 THR A HG22 7  
ATOM   10301 H  HG23 . THR A 1 49  ? 3.176   15.742  -7.535  1.00 0.00 ? 406 THR A HG23 7  
ATOM   10302 N  N    . TRP A 1 50  ? 7.299   18.719  -6.734  1.00 0.00 ? 407 TRP A N    7  
ATOM   10303 C  CA   . TRP A 1 50  ? 8.143   19.525  -7.608  1.00 0.00 ? 407 TRP A CA   7  
ATOM   10304 C  C    . TRP A 1 50  ? 9.262   18.684  -8.211  1.00 0.00 ? 407 TRP A C    7  
ATOM   10305 O  O    . TRP A 1 50  ? 9.883   17.875  -7.522  1.00 0.00 ? 407 TRP A O    7  
ATOM   10306 C  CB   . TRP A 1 50  ? 8.735   20.704  -6.834  1.00 0.00 ? 407 TRP A CB   7  
ATOM   10307 C  CG   . TRP A 1 50  ? 9.496   21.661  -7.700  1.00 0.00 ? 407 TRP A CG   7  
ATOM   10308 C  CD1  . TRP A 1 50  ? 10.853  21.739  -7.840  1.00 0.00 ? 407 TRP A CD1  7  
ATOM   10309 C  CD2  . TRP A 1 50  ? 8.945   22.678  -8.545  1.00 0.00 ? 407 TRP A CD2  7  
ATOM   10310 N  NE1  . TRP A 1 50  ? 11.178  22.743  -8.721  1.00 0.00 ? 407 TRP A NE1  7  
ATOM   10311 C  CE2  . TRP A 1 50  ? 10.025  23.333  -9.168  1.00 0.00 ? 407 TRP A CE2  7  
ATOM   10312 C  CE3  . TRP A 1 50  ? 7.644   23.096  -8.837  1.00 0.00 ? 407 TRP A CE3  7  
ATOM   10313 C  CZ2  . TRP A 1 50  ? 9.842   24.383  -10.063 1.00 0.00 ? 407 TRP A CZ2  7  
ATOM   10314 C  CZ3  . TRP A 1 50  ? 7.464   24.139  -9.725  1.00 0.00 ? 407 TRP A CZ3  7  
ATOM   10315 C  CH2  . TRP A 1 50  ? 8.558   24.773  -10.330 1.00 0.00 ? 407 TRP A CH2  7  
ATOM   10316 H  H    . TRP A 1 50  ? 7.648   18.431  -5.864  1.00 0.00 ? 407 TRP A H    7  
ATOM   10317 H  HA   . TRP A 1 50  ? 7.523   19.905  -8.407  1.00 0.00 ? 407 TRP A HA   7  
ATOM   10318 H  HB2  . TRP A 1 50  ? 7.936   21.251  -6.356  1.00 0.00 ? 407 TRP A HB2  7  
ATOM   10319 H  HB3  . TRP A 1 50  ? 9.410   20.327  -6.079  1.00 0.00 ? 407 TRP A HB3  7  
ATOM   10320 H  HD1  . TRP A 1 50  ? 11.554  21.100  -7.326  1.00 0.00 ? 407 TRP A HD1  7  
ATOM   10321 H  HE1  . TRP A 1 50  ? 12.087  22.993  -8.986  1.00 0.00 ? 407 TRP A HE1  7  
ATOM   10322 H  HE3  . TRP A 1 50  ? 6.789   22.620  -8.381  1.00 0.00 ? 407 TRP A HE3  7  
ATOM   10323 H  HZ2  . TRP A 1 50  ? 10.675  24.882  -10.538 1.00 0.00 ? 407 TRP A HZ2  7  
ATOM   10324 H  HZ3  . TRP A 1 50  ? 6.466   24.477  -9.963  1.00 0.00 ? 407 TRP A HZ3  7  
ATOM   10325 H  HH2  . TRP A 1 50  ? 8.370   25.583  -11.018 1.00 0.00 ? 407 TRP A HH2  7  
ATOM   10326 N  N    . GLU A 1 51  ? 9.515   18.880  -9.501  1.00 0.00 ? 408 GLU A N    7  
ATOM   10327 C  CA   . GLU A 1 51  ? 10.560  18.138  -10.196 1.00 0.00 ? 408 GLU A CA   7  
ATOM   10328 C  C    . GLU A 1 51  ? 11.915  18.350  -9.527  1.00 0.00 ? 408 GLU A C    7  
ATOM   10329 O  O    . GLU A 1 51  ? 12.369  19.482  -9.364  1.00 0.00 ? 408 GLU A O    7  
ATOM   10330 C  CB   . GLU A 1 51  ? 10.631  18.565  -11.663 1.00 0.00 ? 408 GLU A CB   7  
ATOM   10331 C  CG   . GLU A 1 51  ? 11.306  17.543  -12.563 1.00 0.00 ? 408 GLU A CG   7  
ATOM   10332 C  CD   . GLU A 1 51  ? 12.815  17.686  -12.579 1.00 0.00 ? 408 GLU A CD   7  
ATOM   10333 O  OE1  . GLU A 1 51  ? 13.302  18.836  -12.613 1.00 0.00 ? 408 GLU A OE1  7  
ATOM   10334 O  OE2  . GLU A 1 51  ? 13.510  16.649  -12.556 1.00 0.00 ? 408 GLU A OE2  7  
ATOM   10335 H  H    . GLU A 1 51  ? 8.986   19.539  -9.998  1.00 0.00 ? 408 GLU A H    7  
ATOM   10336 H  HA   . GLU A 1 51  ? 10.310  17.089  -10.148 1.00 0.00 ? 408 GLU A HA   7  
ATOM   10337 H  HB2  . GLU A 1 51  ? 9.628   18.729  -12.027 1.00 0.00 ? 408 GLU A HB2  7  
ATOM   10338 H  HB3  . GLU A 1 51  ? 11.183  19.491  -11.729 1.00 0.00 ? 408 GLU A HB3  7  
ATOM   10339 H  HG2  . GLU A 1 51  ? 11.057  16.553  -12.212 1.00 0.00 ? 408 GLU A HG2  7  
ATOM   10340 H  HG3  . GLU A 1 51  ? 10.937  17.670  -13.570 1.00 0.00 ? 408 GLU A HG3  7  
ATOM   10341 N  N    . GLY A 1 52  ? 12.556  17.252  -9.139  1.00 0.00 ? 409 GLY A N    7  
ATOM   10342 C  CA   . GLY A 1 52  ? 13.852  17.338  -8.491  1.00 0.00 ? 409 GLY A CA   7  
ATOM   10343 C  C    . GLY A 1 52  ? 13.741  17.432  -6.983  1.00 0.00 ? 409 GLY A C    7  
ATOM   10344 O  O    . GLY A 1 52  ? 14.469  16.755  -6.256  1.00 0.00 ? 409 GLY A O    7  
ATOM   10345 H  H    . GLY A 1 52  ? 12.146  16.375  -9.295  1.00 0.00 ? 409 GLY A H    7  
ATOM   10346 H  HA2  . GLY A 1 52  ? 14.429  16.462  -8.746  1.00 0.00 ? 409 GLY A HA2  7  
ATOM   10347 H  HA3  . GLY A 1 52  ? 14.367  18.214  -8.858  1.00 0.00 ? 409 GLY A HA3  7  
ATOM   10348 N  N    . CYS A 1 53  ? 12.829  18.275  -6.510  1.00 0.00 ? 410 CYS A N    7  
ATOM   10349 C  CA   . CYS A 1 53  ? 12.625  18.457  -5.078  1.00 0.00 ? 410 CYS A CA   7  
ATOM   10350 C  C    . CYS A 1 53  ? 12.260  17.136  -4.407  1.00 0.00 ? 410 CYS A C    7  
ATOM   10351 O  O    . CYS A 1 53  ? 11.409  16.393  -4.897  1.00 0.00 ? 410 CYS A O    7  
ATOM   10352 C  CB   . CYS A 1 53  ? 11.525  19.490  -4.825  1.00 0.00 ? 410 CYS A CB   7  
ATOM   10353 S  SG   . CYS A 1 53  ? 11.449  20.089  -3.106  1.00 0.00 ? 410 CYS A SG   7  
ATOM   10354 H  H    . CYS A 1 53  ? 12.278  18.787  -7.139  1.00 0.00 ? 410 CYS A H    7  
ATOM   10355 H  HA   . CYS A 1 53  ? 13.550  18.818  -4.654  1.00 0.00 ? 410 CYS A HA   7  
ATOM   10356 H  HB2  . CYS A 1 53  ? 11.693  20.346  -5.463  1.00 0.00 ? 410 CYS A HB2  7  
ATOM   10357 H  HB3  . CYS A 1 53  ? 10.568  19.052  -5.064  1.00 0.00 ? 410 CYS A HB3  7  
ATOM   10358 N  N    . ASP A 1 54  ? 12.910  16.850  -3.284  1.00 0.00 ? 411 ASP A N    7  
ATOM   10359 C  CA   . ASP A 1 54  ? 12.653  15.619  -2.545  1.00 0.00 ? 411 ASP A CA   7  
ATOM   10360 C  C    . ASP A 1 54  ? 12.386  15.915  -1.073  1.00 0.00 ? 411 ASP A C    7  
ATOM   10361 O  O    . ASP A 1 54  ? 12.714  15.112  -0.199  1.00 0.00 ? 411 ASP A O    7  
ATOM   10362 C  CB   . ASP A 1 54  ? 13.839  14.662  -2.679  1.00 0.00 ? 411 ASP A CB   7  
ATOM   10363 C  CG   . ASP A 1 54  ? 13.948  14.065  -4.068  1.00 0.00 ? 411 ASP A CG   7  
ATOM   10364 O  OD1  . ASP A 1 54  ? 13.625  14.773  -5.045  1.00 0.00 ? 411 ASP A OD1  7  
ATOM   10365 O  OD2  . ASP A 1 54  ? 14.356  12.890  -4.178  1.00 0.00 ? 411 ASP A OD2  7  
ATOM   10366 H  H    . ASP A 1 54  ? 13.577  17.482  -2.944  1.00 0.00 ? 411 ASP A H    7  
ATOM   10367 H  HA   . ASP A 1 54  ? 11.777  15.153  -2.970  1.00 0.00 ? 411 ASP A HA   7  
ATOM   10368 H  HB2  . ASP A 1 54  ? 14.752  15.199  -2.466  1.00 0.00 ? 411 ASP A HB2  7  
ATOM   10369 H  HB3  . ASP A 1 54  ? 13.725  13.857  -1.968  1.00 0.00 ? 411 ASP A HB3  7  
ATOM   10370 N  N    . TRP A 1 55  ? 11.791  17.072  -0.806  1.00 0.00 ? 412 TRP A N    7  
ATOM   10371 C  CA   . TRP A 1 55  ? 11.481  17.474  0.561   1.00 0.00 ? 412 TRP A CA   7  
ATOM   10372 C  C    . TRP A 1 55  ? 10.081  17.019  0.958   1.00 0.00 ? 412 TRP A C    7  
ATOM   10373 O  O    . TRP A 1 55  ? 9.146   17.087  0.160   1.00 0.00 ? 412 TRP A O    7  
ATOM   10374 C  CB   . TRP A 1 55  ? 11.598  18.992  0.707   1.00 0.00 ? 412 TRP A CB   7  
ATOM   10375 C  CG   . TRP A 1 55  ? 12.970  19.447  1.104   1.00 0.00 ? 412 TRP A CG   7  
ATOM   10376 C  CD1  . TRP A 1 55  ? 13.969  19.861  0.270   1.00 0.00 ? 412 TRP A CD1  7  
ATOM   10377 C  CD2  . TRP A 1 55  ? 13.493  19.532  2.434   1.00 0.00 ? 412 TRP A CD2  7  
ATOM   10378 N  NE1  . TRP A 1 55  ? 15.082  20.198  1.002   1.00 0.00 ? 412 TRP A NE1  7  
ATOM   10379 C  CE2  . TRP A 1 55  ? 14.816  20.006  2.332   1.00 0.00 ? 412 TRP A CE2  7  
ATOM   10380 C  CE3  . TRP A 1 55  ? 12.973  19.256  3.701   1.00 0.00 ? 412 TRP A CE3  7  
ATOM   10381 C  CZ2  . TRP A 1 55  ? 15.622  20.207  3.448   1.00 0.00 ? 412 TRP A CZ2  7  
ATOM   10382 C  CZ3  . TRP A 1 55  ? 13.775  19.456  4.808   1.00 0.00 ? 412 TRP A CZ3  7  
ATOM   10383 C  CH2  . TRP A 1 55  ? 15.087  19.928  4.677   1.00 0.00 ? 412 TRP A CH2  7  
ATOM   10384 H  H    . TRP A 1 55  ? 11.554  17.670  -1.546  1.00 0.00 ? 412 TRP A H    7  
ATOM   10385 H  HA   . TRP A 1 55  ? 12.199  17.002  1.216   1.00 0.00 ? 412 TRP A HA   7  
ATOM   10386 H  HB2  . TRP A 1 55  ? 11.352  19.458  -0.235  1.00 0.00 ? 412 TRP A HB2  7  
ATOM   10387 H  HB3  . TRP A 1 55  ? 10.903  19.328  1.463   1.00 0.00 ? 412 TRP A HB3  7  
ATOM   10388 H  HD1  . TRP A 1 55  ? 13.883  19.909  -0.805  1.00 0.00 ? 412 TRP A HD1  7  
ATOM   10389 H  HE1  . TRP A 1 55  ? 15.929  20.524  0.631   1.00 0.00 ? 412 TRP A HE1  7  
ATOM   10390 H  HE3  . TRP A 1 55  ? 11.963  18.891  3.823   1.00 0.00 ? 412 TRP A HE3  7  
ATOM   10391 H  HZ2  . TRP A 1 55  ? 16.636  20.571  3.364   1.00 0.00 ? 412 TRP A HZ2  7  
ATOM   10392 H  HZ3  . TRP A 1 55  ? 13.390  19.247  5.796   1.00 0.00 ? 412 TRP A HZ3  7  
ATOM   10393 H  HH2  . TRP A 1 55  ? 15.677  20.069  5.569   1.00 0.00 ? 412 TRP A HH2  7  
ATOM   10394 N  N    . ARG A 1 56  ? 9.943   16.556  2.197   1.00 0.00 ? 413 ARG A N    7  
ATOM   10395 C  CA   . ARG A 1 56  ? 8.656   16.089  2.698   1.00 0.00 ? 413 ARG A CA   7  
ATOM   10396 C  C    . ARG A 1 56  ? 8.252   16.855  3.955   1.00 0.00 ? 413 ARG A C    7  
ATOM   10397 O  O    . ARG A 1 56  ? 9.023   17.660  4.479   1.00 0.00 ? 413 ARG A O    7  
ATOM   10398 C  CB   . ARG A 1 56  ? 8.715   14.590  2.999   1.00 0.00 ? 413 ARG A CB   7  
ATOM   10399 C  CG   . ARG A 1 56  ? 9.006   13.735  1.776   1.00 0.00 ? 413 ARG A CG   7  
ATOM   10400 C  CD   . ARG A 1 56  ? 9.607   12.394  2.165   1.00 0.00 ? 413 ARG A CD   7  
ATOM   10401 N  NE   . ARG A 1 56  ? 11.013  12.513  2.544   1.00 0.00 ? 413 ARG A NE   7  
ATOM   10402 C  CZ   . ARG A 1 56  ? 11.658  11.606  3.268   1.00 0.00 ? 413 ARG A CZ   7  
ATOM   10403 N  NH1  . ARG A 1 56  ? 11.028  10.518  3.689   1.00 0.00 ? 413 ARG A NH1  7  
ATOM   10404 N  NH2  . ARG A 1 56  ? 12.937  11.786  3.573   1.00 0.00 ? 413 ARG A NH2  7  
ATOM   10405 H  H    . ARG A 1 56  ? 10.725  16.527  2.786   1.00 0.00 ? 413 ARG A H    7  
ATOM   10406 H  HA   . ARG A 1 56  ? 7.917   16.265  1.931   1.00 0.00 ? 413 ARG A HA   7  
ATOM   10407 H  HB2  . ARG A 1 56  ? 9.491   14.411  3.728   1.00 0.00 ? 413 ARG A HB2  7  
ATOM   10408 H  HB3  . ARG A 1 56  ? 7.766   14.281  3.411   1.00 0.00 ? 413 ARG A HB3  7  
ATOM   10409 H  HG2  . ARG A 1 56  ? 8.083   13.562  1.242   1.00 0.00 ? 413 ARG A HG2  7  
ATOM   10410 H  HG3  . ARG A 1 56  ? 9.700   14.261  1.138   1.00 0.00 ? 413 ARG A HG3  7  
ATOM   10411 H  HD2  . ARG A 1 56  ? 9.052   11.994  3.000   1.00 0.00 ? 413 ARG A HD2  7  
ATOM   10412 H  HD3  . ARG A 1 56  ? 9.527   11.721  1.324   1.00 0.00 ? 413 ARG A HD3  7  
ATOM   10413 H  HE   . ARG A 1 56  ? 11.497  13.310  2.244   1.00 0.00 ? 413 ARG A HE   7  
ATOM   10414 H  HH11 . ARG A 1 56  ? 10.065  10.379  3.460   1.00 0.00 ? 413 ARG A HH11 7  
ATOM   10415 H  HH12 . ARG A 1 56  ? 11.517  9.835   4.233   1.00 0.00 ? 413 ARG A HH12 7  
ATOM   10416 H  HH21 . ARG A 1 56  ? 13.415  12.605  3.257   1.00 0.00 ? 413 ARG A HH21 7  
ATOM   10417 H  HH22 . ARG A 1 56  ? 13.422  11.103  4.118   1.00 0.00 ? 413 ARG A HH22 7  
ATOM   10418 N  N    . PHE A 1 57  ? 7.039   16.600  4.433   1.00 0.00 ? 414 PHE A N    7  
ATOM   10419 C  CA   . PHE A 1 57  ? 6.532   17.266  5.627   1.00 0.00 ? 414 PHE A CA   7  
ATOM   10420 C  C    . PHE A 1 57  ? 5.495   16.399  6.335   1.00 0.00 ? 414 PHE A C    7  
ATOM   10421 O  O    . PHE A 1 57  ? 4.974   15.442  5.761   1.00 0.00 ? 414 PHE A O    7  
ATOM   10422 C  CB   . PHE A 1 57  ? 5.917   18.618  5.260   1.00 0.00 ? 414 PHE A CB   7  
ATOM   10423 C  CG   . PHE A 1 57  ? 6.819   19.480  4.424   1.00 0.00 ? 414 PHE A CG   7  
ATOM   10424 C  CD1  . PHE A 1 57  ? 7.744   20.321  5.021   1.00 0.00 ? 414 PHE A CD1  7  
ATOM   10425 C  CD2  . PHE A 1 57  ? 6.742   19.449  3.041   1.00 0.00 ? 414 PHE A CD2  7  
ATOM   10426 C  CE1  . PHE A 1 57  ? 8.577   21.115  4.255   1.00 0.00 ? 414 PHE A CE1  7  
ATOM   10427 C  CE2  . PHE A 1 57  ? 7.572   20.241  2.269   1.00 0.00 ? 414 PHE A CE2  7  
ATOM   10428 C  CZ   . PHE A 1 57  ? 8.490   21.076  2.877   1.00 0.00 ? 414 PHE A CZ   7  
ATOM   10429 H  H    . PHE A 1 57  ? 6.470   15.948  3.971   1.00 0.00 ? 414 PHE A H    7  
ATOM   10430 H  HA   . PHE A 1 57  ? 7.364   17.428  6.294   1.00 0.00 ? 414 PHE A HA   7  
ATOM   10431 H  HB2  . PHE A 1 57  ? 5.007   18.453  4.702   1.00 0.00 ? 414 PHE A HB2  7  
ATOM   10432 H  HB3  . PHE A 1 57  ? 5.686   19.158  6.166   1.00 0.00 ? 414 PHE A HB3  7  
ATOM   10433 H  HD1  . PHE A 1 57  ? 7.813   20.353  6.099   1.00 0.00 ? 414 PHE A HD1  7  
ATOM   10434 H  HD2  . PHE A 1 57  ? 6.025   18.798  2.564   1.00 0.00 ? 414 PHE A HD2  7  
ATOM   10435 H  HE1  . PHE A 1 57  ? 9.293   21.767  4.733   1.00 0.00 ? 414 PHE A HE1  7  
ATOM   10436 H  HE2  . PHE A 1 57  ? 7.502   20.208  1.192   1.00 0.00 ? 414 PHE A HE2  7  
ATOM   10437 H  HZ   . PHE A 1 57  ? 9.139   21.694  2.277   1.00 0.00 ? 414 PHE A HZ   7  
ATOM   10438 N  N    . ALA A 1 58  ? 5.200   16.740  7.585   1.00 0.00 ? 415 ALA A N    7  
ATOM   10439 C  CA   . ALA A 1 58  ? 4.225   15.995  8.371   1.00 0.00 ? 415 ALA A CA   7  
ATOM   10440 C  C    . ALA A 1 58  ? 2.840   16.624  8.268   1.00 0.00 ? 415 ALA A C    7  
ATOM   10441 O  O    . ALA A 1 58  ? 1.848   15.931  8.044   1.00 0.00 ? 415 ALA A O    7  
ATOM   10442 C  CB   . ALA A 1 58  ? 4.667   15.920  9.825   1.00 0.00 ? 415 ALA A CB   7  
ATOM   10443 H  H    . ALA A 1 58  ? 5.648   17.513  7.987   1.00 0.00 ? 415 ALA A H    7  
ATOM   10444 H  HA   . ALA A 1 58  ? 4.182   14.988  7.981   1.00 0.00 ? 415 ALA A HA   7  
ATOM   10445 H  HB1  . ALA A 1 58  ? 5.693   15.587  9.873   1.00 0.00 ? 415 ALA A HB1  7  
ATOM   10446 H  HB2  . ALA A 1 58  ? 4.584   16.898  10.276  1.00 0.00 ? 415 ALA A HB2  7  
ATOM   10447 H  HB3  . ALA A 1 58  ? 4.036   15.223  10.357  1.00 0.00 ? 415 ALA A HB3  7  
ATOM   10448 N  N    . ARG A 1 59  ? 2.780   17.942  8.434   1.00 0.00 ? 416 ARG A N    7  
ATOM   10449 C  CA   . ARG A 1 59  ? 1.516   18.664  8.362   1.00 0.00 ? 416 ARG A CA   7  
ATOM   10450 C  C    . ARG A 1 59  ? 1.267   19.184  6.949   1.00 0.00 ? 416 ARG A C    7  
ATOM   10451 O  O    . ARG A 1 59  ? 2.207   19.434  6.195   1.00 0.00 ? 416 ARG A O    7  
ATOM   10452 C  CB   . ARG A 1 59  ? 1.512   19.828  9.354   1.00 0.00 ? 416 ARG A CB   7  
ATOM   10453 C  CG   . ARG A 1 59  ? 1.004   19.450  10.736  1.00 0.00 ? 416 ARG A CG   7  
ATOM   10454 C  CD   . ARG A 1 59  ? -0.512  19.540  10.816  1.00 0.00 ? 416 ARG A CD   7  
ATOM   10455 N  NE   . ARG A 1 59  ? -0.987  19.564  12.196  1.00 0.00 ? 416 ARG A NE   7  
ATOM   10456 C  CZ   . ARG A 1 59  ? -1.026  20.664  12.941  1.00 0.00 ? 416 ARG A CZ   7  
ATOM   10457 N  NH1  . ARG A 1 59  ? -0.621  21.822  12.439  1.00 0.00 ? 416 ARG A NH1  7  
ATOM   10458 N  NH2  . ARG A 1 59  ? -1.472  20.606  14.189  1.00 0.00 ? 416 ARG A NH2  7  
ATOM   10459 H  H    . ARG A 1 59  ? 3.606   18.440  8.611   1.00 0.00 ? 416 ARG A H    7  
ATOM   10460 H  HA   . ARG A 1 59  ? 0.725   17.977  8.624   1.00 0.00 ? 416 ARG A HA   7  
ATOM   10461 H  HB2  . ARG A 1 59  ? 2.520   20.203  9.456   1.00 0.00 ? 416 ARG A HB2  7  
ATOM   10462 H  HB3  . ARG A 1 59  ? 0.882   20.614  8.966   1.00 0.00 ? 416 ARG A HB3  7  
ATOM   10463 H  HG2  . ARG A 1 59  ? 1.305   18.436  10.955  1.00 0.00 ? 416 ARG A HG2  7  
ATOM   10464 H  HG3  . ARG A 1 59  ? 1.434   20.121  11.464  1.00 0.00 ? 416 ARG A HG3  7  
ATOM   10465 H  HD2  . ARG A 1 59  ? -0.833  20.444  10.319  1.00 0.00 ? 416 ARG A HD2  7  
ATOM   10466 H  HD3  . ARG A 1 59  ? -0.937  18.684  10.313  1.00 0.00 ? 416 ARG A HD3  7  
ATOM   10467 H  HE   . ARG A 1 59  ? -1.291  18.719  12.587  1.00 0.00 ? 416 ARG A HE   7  
ATOM   10468 H  HH11 . ARG A 1 59  ? -0.286  21.869  11.499  1.00 0.00 ? 416 ARG A HH11 7  
ATOM   10469 H  HH12 . ARG A 1 59  ? -0.653  22.649  13.002  1.00 0.00 ? 416 ARG A HH12 7  
ATOM   10470 H  HH21 . ARG A 1 59  ? -1.778  19.734  14.571  1.00 0.00 ? 416 ARG A HH21 7  
ATOM   10471 H  HH22 . ARG A 1 59  ? -1.501  21.433  14.749  1.00 0.00 ? 416 ARG A HH22 7  
ATOM   10472 N  N    . SER A 1 60  ? -0.005  19.345  6.599   1.00 0.00 ? 417 SER A N    7  
ATOM   10473 C  CA   . SER A 1 60  ? -0.378  19.831  5.276   1.00 0.00 ? 417 SER A CA   7  
ATOM   10474 C  C    . SER A 1 60  ? 0.108   21.262  5.066   1.00 0.00 ? 417 SER A C    7  
ATOM   10475 O  O    . SER A 1 60  ? 0.873   21.541  4.142   1.00 0.00 ? 417 SER A O    7  
ATOM   10476 C  CB   . SER A 1 60  ? -1.895  19.764  5.093   1.00 0.00 ? 417 SER A CB   7  
ATOM   10477 O  OG   . SER A 1 60  ? -2.391  18.476  5.414   1.00 0.00 ? 417 SER A OG   7  
ATOM   10478 H  H    . SER A 1 60  ? -0.710  19.128  7.245   1.00 0.00 ? 417 SER A H    7  
ATOM   10479 H  HA   . SER A 1 60  ? 0.093   19.193  4.543   1.00 0.00 ? 417 SER A HA   7  
ATOM   10480 H  HB2  . SER A 1 60  ? -2.366  20.489  5.740   1.00 0.00 ? 417 SER A HB2  7  
ATOM   10481 H  HB3  . SER A 1 60  ? -2.141  19.985  4.065   1.00 0.00 ? 417 SER A HB3  7  
ATOM   10482 H  HG   . SER A 1 60  ? -3.175  18.561  5.962   1.00 0.00 ? 417 SER A HG   7  
ATOM   10483 N  N    . ASP A 1 61  ? -0.342  22.165  5.930   1.00 0.00 ? 418 ASP A N    7  
ATOM   10484 C  CA   . ASP A 1 61  ? 0.047   23.568  5.842   1.00 0.00 ? 418 ASP A CA   7  
ATOM   10485 C  C    . ASP A 1 61  ? 1.552   23.702  5.628   1.00 0.00 ? 418 ASP A C    7  
ATOM   10486 O  O    . ASP A 1 61  ? 1.998   24.358  4.688   1.00 0.00 ? 418 ASP A O    7  
ATOM   10487 C  CB   . ASP A 1 61  ? -0.369  24.315  7.110   1.00 0.00 ? 418 ASP A CB   7  
ATOM   10488 C  CG   . ASP A 1 61  ? 0.349   25.641  7.262   1.00 0.00 ? 418 ASP A CG   7  
ATOM   10489 O  OD1  . ASP A 1 61  ? 0.068   26.563  6.469   1.00 0.00 ? 418 ASP A OD1  7  
ATOM   10490 O  OD2  . ASP A 1 61  ? 1.194   25.757  8.175   1.00 0.00 ? 418 ASP A OD2  7  
ATOM   10491 H  H    . ASP A 1 61  ? -0.949  21.881  6.645   1.00 0.00 ? 418 ASP A H    7  
ATOM   10492 H  HA   . ASP A 1 61  ? -0.464  24.001  4.995   1.00 0.00 ? 418 ASP A HA   7  
ATOM   10493 H  HB2  . ASP A 1 61  ? -1.432  24.505  7.075   1.00 0.00 ? 418 ASP A HB2  7  
ATOM   10494 H  HB3  . ASP A 1 61  ? -0.145  23.703  7.971   1.00 0.00 ? 418 ASP A HB3  7  
ATOM   10495 N  N    . GLU A 1 62  ? 2.327   23.078  6.509   1.00 0.00 ? 419 GLU A N    7  
ATOM   10496 C  CA   . GLU A 1 62  ? 3.782   23.130  6.417   1.00 0.00 ? 419 GLU A CA   7  
ATOM   10497 C  C    . GLU A 1 62  ? 4.241   22.970  4.970   1.00 0.00 ? 419 GLU A C    7  
ATOM   10498 O  O    . GLU A 1 62  ? 5.130   23.686  4.507   1.00 0.00 ? 419 GLU A O    7  
ATOM   10499 C  CB   . GLU A 1 62  ? 4.410   22.039  7.286   1.00 0.00 ? 419 GLU A CB   7  
ATOM   10500 C  CG   . GLU A 1 62  ? 4.238   22.275  8.777   1.00 0.00 ? 419 GLU A CG   7  
ATOM   10501 C  CD   . GLU A 1 62  ? 5.228   23.284  9.326   1.00 0.00 ? 419 GLU A CD   7  
ATOM   10502 O  OE1  . GLU A 1 62  ? 6.361   23.348  8.803   1.00 0.00 ? 419 GLU A OE1  7  
ATOM   10503 O  OE2  . GLU A 1 62  ? 4.872   24.009  10.278  1.00 0.00 ? 419 GLU A OE2  7  
ATOM   10504 H  H    . GLU A 1 62  ? 1.912   22.570  7.237   1.00 0.00 ? 419 GLU A H    7  
ATOM   10505 H  HA   . GLU A 1 62  ? 4.103   24.095  6.779   1.00 0.00 ? 419 GLU A HA   7  
ATOM   10506 H  HB2  . GLU A 1 62  ? 3.955   21.091  7.037   1.00 0.00 ? 419 GLU A HB2  7  
ATOM   10507 H  HB3  . GLU A 1 62  ? 5.467   21.988  7.070   1.00 0.00 ? 419 GLU A HB3  7  
ATOM   10508 H  HG2  . GLU A 1 62  ? 3.238   22.639  8.959   1.00 0.00 ? 419 GLU A HG2  7  
ATOM   10509 H  HG3  . GLU A 1 62  ? 4.378   21.337  9.295   1.00 0.00 ? 419 GLU A HG3  7  
ATOM   10510 N  N    . LEU A 1 63  ? 3.630   22.027  4.262   1.00 0.00 ? 420 LEU A N    7  
ATOM   10511 C  CA   . LEU A 1 63  ? 3.976   21.772  2.868   1.00 0.00 ? 420 LEU A CA   7  
ATOM   10512 C  C    . LEU A 1 63  ? 3.574   22.948  1.983   1.00 0.00 ? 420 LEU A C    7  
ATOM   10513 O  O    . LEU A 1 63  ? 4.390   23.481  1.231   1.00 0.00 ? 420 LEU A O    7  
ATOM   10514 C  CB   . LEU A 1 63  ? 3.294   20.493  2.379   1.00 0.00 ? 420 LEU A CB   7  
ATOM   10515 C  CG   . LEU A 1 63  ? 3.349   20.238  0.872   1.00 0.00 ? 420 LEU A CG   7  
ATOM   10516 C  CD1  . LEU A 1 63  ? 4.790   20.098  0.406   1.00 0.00 ? 420 LEU A CD1  7  
ATOM   10517 C  CD2  . LEU A 1 63  ? 2.547   18.996  0.512   1.00 0.00 ? 420 LEU A CD2  7  
ATOM   10518 H  H    . LEU A 1 63  ? 2.930   21.489  4.686   1.00 0.00 ? 420 LEU A H    7  
ATOM   10519 H  HA   . LEU A 1 63  ? 5.047   21.644  2.811   1.00 0.00 ? 420 LEU A HA   7  
ATOM   10520 H  HB2  . LEU A 1 63  ? 3.765   19.658  2.873   1.00 0.00 ? 420 LEU A HB2  7  
ATOM   10521 H  HB3  . LEU A 1 63  ? 2.254   20.543  2.669   1.00 0.00 ? 420 LEU A HB3  7  
ATOM   10522 H  HG   . LEU A 1 63  ? 2.912   21.081  0.354   1.00 0.00 ? 420 LEU A HG   7  
ATOM   10523 H  HD11 . LEU A 1 63  ? 5.396   20.856  0.878   1.00 0.00 ? 420 LEU A HD11 7  
ATOM   10524 H  HD12 . LEU A 1 63  ? 4.834   20.217  -0.666  1.00 0.00 ? 420 LEU A HD12 7  
ATOM   10525 H  HD13 . LEU A 1 63  ? 5.161   19.120  0.676   1.00 0.00 ? 420 LEU A HD13 7  
ATOM   10526 H  HD21 . LEU A 1 63  ? 3.027   18.124  0.930   1.00 0.00 ? 420 LEU A HD21 7  
ATOM   10527 H  HD22 . LEU A 1 63  ? 2.496   18.900  -0.562  1.00 0.00 ? 420 LEU A HD22 7  
ATOM   10528 H  HD23 . LEU A 1 63  ? 1.547   19.084  0.913   1.00 0.00 ? 420 LEU A HD23 7  
ATOM   10529 N  N    . THR A 1 64  ? 2.310   23.349  2.080   1.00 0.00 ? 421 THR A N    7  
ATOM   10530 C  CA   . THR A 1 64  ? 1.799   24.462  1.290   1.00 0.00 ? 421 THR A CA   7  
ATOM   10531 C  C    . THR A 1 64  ? 2.754   25.650  1.332   1.00 0.00 ? 421 THR A C    7  
ATOM   10532 O  O    . THR A 1 64  ? 3.096   26.220  0.296   1.00 0.00 ? 421 THR A O    7  
ATOM   10533 C  CB   . THR A 1 64  ? 0.413   24.914  1.787   1.00 0.00 ? 421 THR A CB   7  
ATOM   10534 O  OG1  . THR A 1 64  ? -0.499  23.811  1.764   1.00 0.00 ? 421 THR A OG1  7  
ATOM   10535 C  CG2  . THR A 1 64  ? -0.129  26.045  0.925   1.00 0.00 ? 421 THR A CG2  7  
ATOM   10536 H  H    . THR A 1 64  ? 1.708   22.884  2.698   1.00 0.00 ? 421 THR A H    7  
ATOM   10537 H  HA   . THR A 1 64  ? 1.701   24.128  0.268   1.00 0.00 ? 421 THR A HA   7  
ATOM   10538 H  HB   . THR A 1 64  ? 0.510   25.270  2.803   1.00 0.00 ? 421 THR A HB   7  
ATOM   10539 H  HG1  . THR A 1 64  ? -0.009  22.988  1.831   1.00 0.00 ? 421 THR A HG1  7  
ATOM   10540 H  HG21 . THR A 1 64  ? -1.200  25.946  0.835   1.00 0.00 ? 421 THR A HG21 7  
ATOM   10541 H  HG22 . THR A 1 64  ? 0.321   25.996  -0.056  1.00 0.00 ? 421 THR A HG22 7  
ATOM   10542 H  HG23 . THR A 1 64  ? 0.109   26.993  1.384   1.00 0.00 ? 421 THR A HG23 7  
ATOM   10543 N  N    . ARG A 1 65  ? 3.181   26.018  2.535   1.00 0.00 ? 422 ARG A N    7  
ATOM   10544 C  CA   . ARG A 1 65  ? 4.097   27.139  2.712   1.00 0.00 ? 422 ARG A CA   7  
ATOM   10545 C  C    . ARG A 1 65  ? 5.380   26.923  1.915   1.00 0.00 ? 422 ARG A C    7  
ATOM   10546 O  O    . ARG A 1 65  ? 5.857   27.827  1.229   1.00 0.00 ? 422 ARG A O    7  
ATOM   10547 C  CB   . ARG A 1 65  ? 4.428   27.326  4.193   1.00 0.00 ? 422 ARG A CB   7  
ATOM   10548 C  CG   . ARG A 1 65  ? 5.366   28.490  4.465   1.00 0.00 ? 422 ARG A CG   7  
ATOM   10549 C  CD   . ARG A 1 65  ? 4.598   29.780  4.704   1.00 0.00 ? 422 ARG A CD   7  
ATOM   10550 N  NE   . ARG A 1 65  ? 4.093   29.871  6.072   1.00 0.00 ? 422 ARG A NE   7  
ATOM   10551 C  CZ   . ARG A 1 65  ? 3.588   30.982  6.597   1.00 0.00 ? 422 ARG A CZ   7  
ATOM   10552 N  NH1  . ARG A 1 65  ? 3.520   32.090  5.872   1.00 0.00 ? 422 ARG A NH1  7  
ATOM   10553 N  NH2  . ARG A 1 65  ? 3.149   30.986  7.849   1.00 0.00 ? 422 ARG A NH2  7  
ATOM   10554 H  H    . ARG A 1 65  ? 2.873   25.524  3.324   1.00 0.00 ? 422 ARG A H    7  
ATOM   10555 H  HA   . ARG A 1 65  ? 3.606   28.028  2.347   1.00 0.00 ? 422 ARG A HA   7  
ATOM   10556 H  HB2  . ARG A 1 65  ? 3.511   27.497  4.737   1.00 0.00 ? 422 ARG A HB2  7  
ATOM   10557 H  HB3  . ARG A 1 65  ? 4.893   26.424  4.562   1.00 0.00 ? 422 ARG A HB3  7  
ATOM   10558 H  HG2  . ARG A 1 65  ? 5.957   28.268  5.342   1.00 0.00 ? 422 ARG A HG2  7  
ATOM   10559 H  HG3  . ARG A 1 65  ? 6.018   28.622  3.614   1.00 0.00 ? 422 ARG A HG3  7  
ATOM   10560 H  HD2  . ARG A 1 65  ? 5.256   30.616  4.517   1.00 0.00 ? 422 ARG A HD2  7  
ATOM   10561 H  HD3  . ARG A 1 65  ? 3.764   29.819  4.020   1.00 0.00 ? 422 ARG A HD3  7  
ATOM   10562 H  HE   . ARG A 1 65  ? 4.134   29.064  6.625   1.00 0.00 ? 422 ARG A HE   7  
ATOM   10563 H  HH11 . ARG A 1 65  ? 3.850   32.090  4.928   1.00 0.00 ? 422 ARG A HH11 7  
ATOM   10564 H  HH12 . ARG A 1 65  ? 3.139   32.925  6.269   1.00 0.00 ? 422 ARG A HH12 7  
ATOM   10565 H  HH21 . ARG A 1 65  ? 3.199   30.153  8.398   1.00 0.00 ? 422 ARG A HH21 7  
ATOM   10566 H  HH22 . ARG A 1 65  ? 2.770   31.823  8.243   1.00 0.00 ? 422 ARG A HH22 7  
ATOM   10567 N  N    . HIS A 1 66  ? 5.935   25.719  2.012   1.00 0.00 ? 423 HIS A N    7  
ATOM   10568 C  CA   . HIS A 1 66  ? 7.164   25.384  1.301   1.00 0.00 ? 423 HIS A CA   7  
ATOM   10569 C  C    . HIS A 1 66  ? 6.982   25.548  -0.205  1.00 0.00 ? 423 HIS A C    7  
ATOM   10570 O  O    . HIS A 1 66  ? 7.807   26.168  -0.876  1.00 0.00 ? 423 HIS A O    7  
ATOM   10571 C  CB   . HIS A 1 66  ? 7.589   23.951  1.621   1.00 0.00 ? 423 HIS A CB   7  
ATOM   10572 C  CG   . HIS A 1 66  ? 8.603   23.399  0.667   1.00 0.00 ? 423 HIS A CG   7  
ATOM   10573 N  ND1  . HIS A 1 66  ? 9.963   23.489  0.878   1.00 0.00 ? 423 HIS A ND1  7  
ATOM   10574 C  CD2  . HIS A 1 66  ? 8.449   22.747  -0.509  1.00 0.00 ? 423 HIS A CD2  7  
ATOM   10575 C  CE1  . HIS A 1 66  ? 10.601  22.917  -0.127  1.00 0.00 ? 423 HIS A CE1  7  
ATOM   10576 N  NE2  . HIS A 1 66  ? 9.705   22.458  -0.983  1.00 0.00 ? 423 HIS A NE2  7  
ATOM   10577 H  H    . HIS A 1 66  ? 5.508   25.040  2.575   1.00 0.00 ? 423 HIS A H    7  
ATOM   10578 H  HA   . HIS A 1 66  ? 7.935   26.062  1.633   1.00 0.00 ? 423 HIS A HA   7  
ATOM   10579 H  HB2  . HIS A 1 66  ? 8.018   23.923  2.612   1.00 0.00 ? 423 HIS A HB2  7  
ATOM   10580 H  HB3  . HIS A 1 66  ? 6.721   23.309  1.592   1.00 0.00 ? 423 HIS A HB3  7  
ATOM   10581 H  HD1  . HIS A 1 66  ? 10.395  23.910  1.649   1.00 0.00 ? 423 HIS A HD1  7  
ATOM   10582 H  HD2  . HIS A 1 66  ? 7.511   22.499  -0.988  1.00 0.00 ? 423 HIS A HD2  7  
ATOM   10583 H  HE1  . HIS A 1 66  ? 11.672  22.837  -0.233  1.00 0.00 ? 423 HIS A HE1  7  
ATOM   10584 N  N    . TYR A 1 67  ? 5.897   24.989  -0.729  1.00 0.00 ? 424 TYR A N    7  
ATOM   10585 C  CA   . TYR A 1 67  ? 5.608   25.070  -2.156  1.00 0.00 ? 424 TYR A CA   7  
ATOM   10586 C  C    . TYR A 1 67  ? 5.557   26.523  -2.619  1.00 0.00 ? 424 TYR A C    7  
ATOM   10587 O  O    . TYR A 1 67  ? 6.158   26.886  -3.631  1.00 0.00 ? 424 TYR A O    7  
ATOM   10588 C  CB   . TYR A 1 67  ? 4.282   24.376  -2.470  1.00 0.00 ? 424 TYR A CB   7  
ATOM   10589 C  CG   . TYR A 1 67  ? 4.216   23.801  -3.867  1.00 0.00 ? 424 TYR A CG   7  
ATOM   10590 C  CD1  . TYR A 1 67  ? 4.773   22.562  -4.157  1.00 0.00 ? 424 TYR A CD1  7  
ATOM   10591 C  CD2  . TYR A 1 67  ? 3.594   24.496  -4.897  1.00 0.00 ? 424 TYR A CD2  7  
ATOM   10592 C  CE1  . TYR A 1 67  ? 4.715   22.033  -5.432  1.00 0.00 ? 424 TYR A CE1  7  
ATOM   10593 C  CE2  . TYR A 1 67  ? 3.530   23.975  -6.174  1.00 0.00 ? 424 TYR A CE2  7  
ATOM   10594 C  CZ   . TYR A 1 67  ? 4.093   22.743  -6.437  1.00 0.00 ? 424 TYR A CZ   7  
ATOM   10595 O  OH   . TYR A 1 67  ? 4.032   22.219  -7.708  1.00 0.00 ? 424 TYR A OH   7  
ATOM   10596 H  H    . TYR A 1 67  ? 5.276   24.508  -0.143  1.00 0.00 ? 424 TYR A H    7  
ATOM   10597 H  HA   . TYR A 1 67  ? 6.402   24.564  -2.685  1.00 0.00 ? 424 TYR A HA   7  
ATOM   10598 H  HB2  . TYR A 1 67  ? 4.133   23.567  -1.772  1.00 0.00 ? 424 TYR A HB2  7  
ATOM   10599 H  HB3  . TYR A 1 67  ? 3.477   25.088  -2.366  1.00 0.00 ? 424 TYR A HB3  7  
ATOM   10600 H  HD1  . TYR A 1 67  ? 5.260   22.008  -3.367  1.00 0.00 ? 424 TYR A HD1  7  
ATOM   10601 H  HD2  . TYR A 1 67  ? 3.154   25.461  -4.688  1.00 0.00 ? 424 TYR A HD2  7  
ATOM   10602 H  HE1  . TYR A 1 67  ? 5.155   21.068  -5.637  1.00 0.00 ? 424 TYR A HE1  7  
ATOM   10603 H  HE2  . TYR A 1 67  ? 3.043   24.530  -6.962  1.00 0.00 ? 424 TYR A HE2  7  
ATOM   10604 H  HH   . TYR A 1 67  ? 4.788   22.522  -8.216  1.00 0.00 ? 424 TYR A HH   7  
ATOM   10605 N  N    . ARG A 1 68  ? 4.834   27.350  -1.871  1.00 0.00 ? 425 ARG A N    7  
ATOM   10606 C  CA   . ARG A 1 68  ? 4.702   28.764  -2.204  1.00 0.00 ? 425 ARG A CA   7  
ATOM   10607 C  C    . ARG A 1 68  ? 6.049   29.354  -2.613  1.00 0.00 ? 425 ARG A C    7  
ATOM   10608 O  O    . ARG A 1 68  ? 6.126   30.187  -3.516  1.00 0.00 ? 425 ARG A O    7  
ATOM   10609 C  CB   . ARG A 1 68  ? 4.134   29.539  -1.014  1.00 0.00 ? 425 ARG A CB   7  
ATOM   10610 C  CG   . ARG A 1 68  ? 2.618   29.485  -0.920  1.00 0.00 ? 425 ARG A CG   7  
ATOM   10611 C  CD   . ARG A 1 68  ? 2.083   30.520  0.057   1.00 0.00 ? 425 ARG A CD   7  
ATOM   10612 N  NE   . ARG A 1 68  ? 0.656   30.765  -0.131  1.00 0.00 ? 425 ARG A NE   7  
ATOM   10613 C  CZ   . ARG A 1 68  ? 0.013   31.805  0.389   1.00 0.00 ? 425 ARG A CZ   7  
ATOM   10614 N  NH1  . ARG A 1 68  ? 0.668   32.692  1.125   1.00 0.00 ? 425 ARG A NH1  7  
ATOM   10615 N  NH2  . ARG A 1 68  ? -1.287  31.959  0.173   1.00 0.00 ? 425 ARG A NH2  7  
ATOM   10616 H  H    . ARG A 1 68  ? 4.378   27.002  -1.077  1.00 0.00 ? 425 ARG A H    7  
ATOM   10617 H  HA   . ARG A 1 68  ? 4.019   28.847  -3.036  1.00 0.00 ? 425 ARG A HA   7  
ATOM   10618 H  HB2  . ARG A 1 68  ? 4.544   29.128  -0.103  1.00 0.00 ? 425 ARG A HB2  7  
ATOM   10619 H  HB3  . ARG A 1 68  ? 4.431   30.573  -1.099  1.00 0.00 ? 425 ARG A HB3  7  
ATOM   10620 H  HG2  . ARG A 1 68  ? 2.199   29.678  -1.897  1.00 0.00 ? 425 ARG A HG2  7  
ATOM   10621 H  HG3  . ARG A 1 68  ? 2.322   28.501  -0.587  1.00 0.00 ? 425 ARG A HG3  7  
ATOM   10622 H  HD2  . ARG A 1 68  ? 2.248   30.165  1.063   1.00 0.00 ? 425 ARG A HD2  7  
ATOM   10623 H  HD3  . ARG A 1 68  ? 2.620   31.446  -0.090  1.00 0.00 ? 425 ARG A HD3  7  
ATOM   10624 H  HE   . ARG A 1 68  ? 0.153   30.121  -0.672  1.00 0.00 ? 425 ARG A HE   7  
ATOM   10625 H  HH11 . ARG A 1 68  ? 1.648   32.579  1.289   1.00 0.00 ? 425 ARG A HH11 7  
ATOM   10626 H  HH12 . ARG A 1 68  ? 0.182   33.475  1.514   1.00 0.00 ? 425 ARG A HH12 7  
ATOM   10627 H  HH21 . ARG A 1 68  ? -1.784  31.292  -0.382  1.00 0.00 ? 425 ARG A HH21 7  
ATOM   10628 H  HH22 . ARG A 1 68  ? -1.769  32.741  0.564   1.00 0.00 ? 425 ARG A HH22 7  
ATOM   10629 N  N    . LYS A 1 69  ? 7.109   28.916  -1.942  1.00 0.00 ? 426 LYS A N    7  
ATOM   10630 C  CA   . LYS A 1 69  ? 8.453   29.399  -2.234  1.00 0.00 ? 426 LYS A CA   7  
ATOM   10631 C  C    . LYS A 1 69  ? 8.832   29.110  -3.683  1.00 0.00 ? 426 LYS A C    7  
ATOM   10632 O  O    . LYS A 1 69  ? 9.354   29.977  -4.384  1.00 0.00 ? 426 LYS A O    7  
ATOM   10633 C  CB   . LYS A 1 69  ? 9.468   28.748  -1.291  1.00 0.00 ? 426 LYS A CB   7  
ATOM   10634 C  CG   . LYS A 1 69  ? 9.208   29.040  0.176   1.00 0.00 ? 426 LYS A CG   7  
ATOM   10635 C  CD   . LYS A 1 69  ? 9.704   30.423  0.566   1.00 0.00 ? 426 LYS A CD   7  
ATOM   10636 C  CE   . LYS A 1 69  ? 11.203  30.424  0.825   1.00 0.00 ? 426 LYS A CE   7  
ATOM   10637 N  NZ   . LYS A 1 69  ? 11.805  31.766  0.591   1.00 0.00 ? 426 LYS A NZ   7  
ATOM   10638 H  H    . LYS A 1 69  ? 6.984   28.251  -1.232  1.00 0.00 ? 426 LYS A H    7  
ATOM   10639 H  HA   . LYS A 1 69  ? 8.463   30.467  -2.078  1.00 0.00 ? 426 LYS A HA   7  
ATOM   10640 H  HB2  . LYS A 1 69  ? 9.439   27.678  -1.434  1.00 0.00 ? 426 LYS A HB2  7  
ATOM   10641 H  HB3  . LYS A 1 69  ? 10.455  29.110  -1.540  1.00 0.00 ? 426 LYS A HB3  7  
ATOM   10642 H  HG2  . LYS A 1 69  ? 8.146   28.985  0.363   1.00 0.00 ? 426 LYS A HG2  7  
ATOM   10643 H  HG3  . LYS A 1 69  ? 9.720   28.302  0.777   1.00 0.00 ? 426 LYS A HG3  7  
ATOM   10644 H  HD2  . LYS A 1 69  ? 9.489   31.113  -0.236  1.00 0.00 ? 426 LYS A HD2  7  
ATOM   10645 H  HD3  . LYS A 1 69  ? 9.192   30.740  1.464   1.00 0.00 ? 426 LYS A HD3  7  
ATOM   10646 H  HE2  . LYS A 1 69  ? 11.379  30.135  1.850   1.00 0.00 ? 426 LYS A HE2  7  
ATOM   10647 H  HE3  . LYS A 1 69  ? 11.670  29.709  0.164   1.00 0.00 ? 426 LYS A HE3  7  
ATOM   10648 H  HZ1  . LYS A 1 69  ? 11.067  32.447  0.319   1.00 0.00 ? 426 LYS A HZ1  7  
ATOM   10649 H  HZ2  . LYS A 1 69  ? 12.510  31.713  -0.172  1.00 0.00 ? 426 LYS A HZ2  7  
ATOM   10650 H  HZ3  . LYS A 1 69  ? 12.272  32.104  1.456   1.00 0.00 ? 426 LYS A HZ3  7  
ATOM   10651 N  N    . HIS A 1 70  ? 8.564   27.886  -4.127  1.00 0.00 ? 427 HIS A N    7  
ATOM   10652 C  CA   . HIS A 1 70  ? 8.875   27.483  -5.494  1.00 0.00 ? 427 HIS A CA   7  
ATOM   10653 C  C    . HIS A 1 70  ? 8.228   28.430  -6.500  1.00 0.00 ? 427 HIS A C    7  
ATOM   10654 O  O    . HIS A 1 70  ? 8.894   28.956  -7.393  1.00 0.00 ? 427 HIS A O    7  
ATOM   10655 C  CB   . HIS A 1 70  ? 8.402   26.051  -5.747  1.00 0.00 ? 427 HIS A CB   7  
ATOM   10656 C  CG   . HIS A 1 70  ? 9.277   25.012  -5.116  1.00 0.00 ? 427 HIS A CG   7  
ATOM   10657 N  ND1  . HIS A 1 70  ? 10.631  24.918  -5.360  1.00 0.00 ? 427 HIS A ND1  7  
ATOM   10658 C  CD2  . HIS A 1 70  ? 8.983   24.018  -4.245  1.00 0.00 ? 427 HIS A CD2  7  
ATOM   10659 C  CE1  . HIS A 1 70  ? 11.132  23.911  -4.667  1.00 0.00 ? 427 HIS A CE1  7  
ATOM   10660 N  NE2  . HIS A 1 70  ? 10.153  23.348  -3.982  1.00 0.00 ? 427 HIS A NE2  7  
ATOM   10661 H  H    . HIS A 1 70  ? 8.148   27.238  -3.521  1.00 0.00 ? 427 HIS A H    7  
ATOM   10662 H  HA   . HIS A 1 70  ? 9.947   27.526  -5.617  1.00 0.00 ? 427 HIS A HA   7  
ATOM   10663 H  HB2  . HIS A 1 70  ? 7.406   25.933  -5.348  1.00 0.00 ? 427 HIS A HB2  7  
ATOM   10664 H  HB3  . HIS A 1 70  ? 8.383   25.868  -6.812  1.00 0.00 ? 427 HIS A HB3  7  
ATOM   10665 H  HD1  . HIS A 1 70  ? 11.147  25.502  -5.953  1.00 0.00 ? 427 HIS A HD1  7  
ATOM   10666 H  HD2  . HIS A 1 70  ? 8.009   23.792  -3.833  1.00 0.00 ? 427 HIS A HD2  7  
ATOM   10667 H  HE1  . HIS A 1 70  ? 12.166  23.600  -4.661  1.00 0.00 ? 427 HIS A HE1  7  
ATOM   10668 N  N    . THR A 1 71  ? 6.924   28.644  -6.350  1.00 0.00 ? 428 THR A N    7  
ATOM   10669 C  CA   . THR A 1 71  ? 6.187   29.526  -7.246  1.00 0.00 ? 428 THR A CA   7  
ATOM   10670 C  C    . THR A 1 71  ? 6.497   30.990  -6.955  1.00 0.00 ? 428 THR A C    7  
ATOM   10671 O  O    . THR A 1 71  ? 6.339   31.851  -7.819  1.00 0.00 ? 428 THR A O    7  
ATOM   10672 C  CB   . THR A 1 71  ? 4.667   29.301  -7.129  1.00 0.00 ? 428 THR A CB   7  
ATOM   10673 O  OG1  . THR A 1 71  ? 4.222   29.640  -5.812  1.00 0.00 ? 428 THR A OG1  7  
ATOM   10674 C  CG2  . THR A 1 71  ? 4.309   27.855  -7.435  1.00 0.00 ? 428 THR A CG2  7  
ATOM   10675 H  H    . THR A 1 71  ? 6.449   28.197  -5.620  1.00 0.00 ? 428 THR A H    7  
ATOM   10676 H  HA   . THR A 1 71  ? 6.486   29.299  -8.259  1.00 0.00 ? 428 THR A HA   7  
ATOM   10677 H  HB   . THR A 1 71  ? 4.169   29.939  -7.845  1.00 0.00 ? 428 THR A HB   7  
ATOM   10678 H  HG1  . THR A 1 71  ? 3.461   29.101  -5.582  1.00 0.00 ? 428 THR A HG1  7  
ATOM   10679 H  HG21 . THR A 1 71  ? 4.448   27.255  -6.549  1.00 0.00 ? 428 THR A HG21 7  
ATOM   10680 H  HG22 . THR A 1 71  ? 4.947   27.485  -8.224  1.00 0.00 ? 428 THR A HG22 7  
ATOM   10681 H  HG23 . THR A 1 71  ? 3.277   27.799  -7.750  1.00 0.00 ? 428 THR A HG23 7  
ATOM   10682 N  N    . GLY A 1 72  ? 6.940   31.264  -5.732  1.00 0.00 ? 429 GLY A N    7  
ATOM   10683 C  CA   . GLY A 1 72  ? 7.265   32.626  -5.349  1.00 0.00 ? 429 GLY A CA   7  
ATOM   10684 C  C    . GLY A 1 72  ? 8.531   32.707  -4.519  1.00 0.00 ? 429 GLY A C    7  
ATOM   10685 O  O    . GLY A 1 72  ? 8.475   32.722  -3.289  1.00 0.00 ? 429 GLY A O    7  
ATOM   10686 H  H    . GLY A 1 72  ? 7.046   30.536  -5.084  1.00 0.00 ? 429 GLY A H    7  
ATOM   10687 H  HA2  . GLY A 1 72  ? 7.394   33.218  -6.242  1.00 0.00 ? 429 GLY A HA2  7  
ATOM   10688 H  HA3  . GLY A 1 72  ? 6.445   33.032  -4.775  1.00 0.00 ? 429 GLY A HA3  7  
ATOM   10689 N  N    . ALA A 1 73  ? 9.676   32.759  -5.191  1.00 0.00 ? 430 ALA A N    7  
ATOM   10690 C  CA   . ALA A 1 73  ? 10.961  32.840  -4.508  1.00 0.00 ? 430 ALA A CA   7  
ATOM   10691 C  C    . ALA A 1 73  ? 11.862  33.886  -5.154  1.00 0.00 ? 430 ALA A C    7  
ATOM   10692 O  O    . ALA A 1 73  ? 12.482  33.634  -6.188  1.00 0.00 ? 430 ALA A O    7  
ATOM   10693 C  CB   . ALA A 1 73  ? 11.644  31.480  -4.506  1.00 0.00 ? 430 ALA A CB   7  
ATOM   10694 H  H    . ALA A 1 73  ? 9.656   32.744  -6.171  1.00 0.00 ? 430 ALA A H    7  
ATOM   10695 H  HA   . ALA A 1 73  ? 10.775  33.123  -3.482  1.00 0.00 ? 430 ALA A HA   7  
ATOM   10696 H  HB1  . ALA A 1 73  ? 11.540  31.027  -3.532  1.00 0.00 ? 430 ALA A HB1  7  
ATOM   10697 H  HB2  . ALA A 1 73  ? 11.184  30.846  -5.250  1.00 0.00 ? 430 ALA A HB2  7  
ATOM   10698 H  HB3  . ALA A 1 73  ? 12.692  31.604  -4.736  1.00 0.00 ? 430 ALA A HB3  7  
ATOM   10699 N  N    . LYS A 1 74  ? 11.930  35.063  -4.540  1.00 0.00 ? 431 LYS A N    7  
ATOM   10700 C  CA   . LYS A 1 74  ? 12.755  36.149  -5.055  1.00 0.00 ? 431 LYS A CA   7  
ATOM   10701 C  C    . LYS A 1 74  ? 13.608  36.756  -3.946  1.00 0.00 ? 431 LYS A C    7  
ATOM   10702 O  O    . LYS A 1 74  ? 13.100  37.255  -2.941  1.00 0.00 ? 431 LYS A O    7  
ATOM   10703 C  CB   . LYS A 1 74  ? 11.876  37.230  -5.687  1.00 0.00 ? 431 LYS A CB   7  
ATOM   10704 C  CG   . LYS A 1 74  ? 12.546  37.964  -6.835  1.00 0.00 ? 431 LYS A CG   7  
ATOM   10705 C  CD   . LYS A 1 74  ? 12.409  37.199  -8.141  1.00 0.00 ? 431 LYS A CD   7  
ATOM   10706 C  CE   . LYS A 1 74  ? 11.029  37.384  -8.754  1.00 0.00 ? 431 LYS A CE   7  
ATOM   10707 N  NZ   . LYS A 1 74  ? 10.921  36.724  -10.084 1.00 0.00 ? 431 LYS A NZ   7  
ATOM   10708 H  H    . LYS A 1 74  ? 11.412  35.204  -3.719  1.00 0.00 ? 431 LYS A H    7  
ATOM   10709 H  HA   . LYS A 1 74  ? 13.408  35.740  -5.811  1.00 0.00 ? 431 LYS A HA   7  
ATOM   10710 H  HB2  . LYS A 1 74  ? 10.972  36.770  -6.059  1.00 0.00 ? 431 LYS A HB2  7  
ATOM   10711 H  HB3  . LYS A 1 74  ? 11.615  37.954  -4.928  1.00 0.00 ? 431 LYS A HB3  7  
ATOM   10712 H  HG2  . LYS A 1 74  ? 12.084  38.934  -6.949  1.00 0.00 ? 431 LYS A HG2  7  
ATOM   10713 H  HG3  . LYS A 1 74  ? 13.595  38.087  -6.609  1.00 0.00 ? 431 LYS A HG3  7  
ATOM   10714 H  HD2  . LYS A 1 74  ? 13.151  37.559  -8.838  1.00 0.00 ? 431 LYS A HD2  7  
ATOM   10715 H  HD3  . LYS A 1 74  ? 12.572  36.147  -7.951  1.00 0.00 ? 431 LYS A HD3  7  
ATOM   10716 H  HE2  . LYS A 1 74  ? 10.295  36.956  -8.089  1.00 0.00 ? 431 LYS A HE2  7  
ATOM   10717 H  HE3  . LYS A 1 74  ? 10.840  38.440  -8.869  1.00 0.00 ? 431 LYS A HE3  7  
ATOM   10718 H  HZ1  . LYS A 1 74  ? 11.137  37.405  -10.840 1.00 0.00 ? 431 LYS A HZ1  7  
ATOM   10719 H  HZ2  . LYS A 1 74  ? 9.956   36.360  -10.225 1.00 0.00 ? 431 LYS A HZ2  7  
ATOM   10720 H  HZ3  . LYS A 1 74  ? 11.590  35.930  -10.146 1.00 0.00 ? 431 LYS A HZ3  7  
ATOM   10721 N  N    . PRO A 1 75  ? 14.936  36.716  -4.130  1.00 0.00 ? 432 PRO A N    7  
ATOM   10722 C  CA   . PRO A 1 75  ? 15.888  37.260  -3.157  1.00 0.00 ? 432 PRO A CA   7  
ATOM   10723 C  C    . PRO A 1 75  ? 15.844  38.783  -3.092  1.00 0.00 ? 432 PRO A C    7  
ATOM   10724 O  O    . PRO A 1 75  ? 16.450  39.395  -2.212  1.00 0.00 ? 432 PRO A O    7  
ATOM   10725 C  CB   . PRO A 1 75  ? 17.244  36.785  -3.683  1.00 0.00 ? 432 PRO A CB   7  
ATOM   10726 C  CG   . PRO A 1 75  ? 17.036  36.590  -5.145  1.00 0.00 ? 432 PRO A CG   7  
ATOM   10727 C  CD   . PRO A 1 75  ? 15.611  36.137  -5.304  1.00 0.00 ? 432 PRO A CD   7  
ATOM   10728 H  HA   . PRO A 1 75  ? 15.721  36.854  -2.170  1.00 0.00 ? 432 PRO A HA   7  
ATOM   10729 H  HB2  . PRO A 1 75  ? 17.993  37.540  -3.487  1.00 0.00 ? 432 PRO A HB2  7  
ATOM   10730 H  HB3  . PRO A 1 75  ? 17.520  35.862  -3.197  1.00 0.00 ? 432 PRO A HB3  7  
ATOM   10731 H  HG2  . PRO A 1 75  ? 17.193  37.523  -5.666  1.00 0.00 ? 432 PRO A HG2  7  
ATOM   10732 H  HG3  . PRO A 1 75  ? 17.713  35.834  -5.514  1.00 0.00 ? 432 PRO A HG3  7  
ATOM   10733 H  HD2  . PRO A 1 75  ? 15.192  36.524  -6.220  1.00 0.00 ? 432 PRO A HD2  7  
ATOM   10734 H  HD3  . PRO A 1 75  ? 15.555  35.058  -5.287  1.00 0.00 ? 432 PRO A HD3  7  
ATOM   10735 N  N    . PHE A 1 76  ? 15.124  39.390  -4.030  1.00 0.00 ? 433 PHE A N    7  
ATOM   10736 C  CA   . PHE A 1 76  ? 15.002  40.842  -4.080  1.00 0.00 ? 433 PHE A CA   7  
ATOM   10737 C  C    . PHE A 1 76  ? 13.540  41.268  -3.988  1.00 0.00 ? 433 PHE A C    7  
ATOM   10738 O  O    . PHE A 1 76  ? 12.709  40.845  -4.791  1.00 0.00 ? 433 PHE A O    7  
ATOM   10739 C  CB   . PHE A 1 76  ? 15.623  41.383  -5.370  1.00 0.00 ? 433 PHE A CB   7  
ATOM   10740 C  CG   . PHE A 1 76  ? 17.004  40.856  -5.637  1.00 0.00 ? 433 PHE A CG   7  
ATOM   10741 C  CD1  . PHE A 1 76  ? 18.033  41.083  -4.738  1.00 0.00 ? 433 PHE A CD1  7  
ATOM   10742 C  CD2  . PHE A 1 76  ? 17.273  40.133  -6.788  1.00 0.00 ? 433 PHE A CD2  7  
ATOM   10743 C  CE1  . PHE A 1 76  ? 19.305  40.599  -4.981  1.00 0.00 ? 433 PHE A CE1  7  
ATOM   10744 C  CE2  . PHE A 1 76  ? 18.542  39.646  -7.037  1.00 0.00 ? 433 PHE A CE2  7  
ATOM   10745 C  CZ   . PHE A 1 76  ? 19.560  39.881  -6.132  1.00 0.00 ? 433 PHE A CZ   7  
ATOM   10746 H  H    . PHE A 1 76  ? 14.664  38.848  -4.705  1.00 0.00 ? 433 PHE A H    7  
ATOM   10747 H  HA   . PHE A 1 76  ? 15.537  41.248  -3.235  1.00 0.00 ? 433 PHE A HA   7  
ATOM   10748 H  HB2  . PHE A 1 76  ? 14.997  41.109  -6.205  1.00 0.00 ? 433 PHE A HB2  7  
ATOM   10749 H  HB3  . PHE A 1 76  ? 15.684  42.459  -5.307  1.00 0.00 ? 433 PHE A HB3  7  
ATOM   10750 H  HD1  . PHE A 1 76  ? 17.835  41.646  -3.836  1.00 0.00 ? 433 PHE A HD1  7  
ATOM   10751 H  HD2  . PHE A 1 76  ? 16.478  39.950  -7.497  1.00 0.00 ? 433 PHE A HD2  7  
ATOM   10752 H  HE1  . PHE A 1 76  ? 20.098  40.784  -4.272  1.00 0.00 ? 433 PHE A HE1  7  
ATOM   10753 H  HE2  . PHE A 1 76  ? 18.739  39.085  -7.938  1.00 0.00 ? 433 PHE A HE2  7  
ATOM   10754 H  HZ   . PHE A 1 76  ? 20.552  39.501  -6.324  1.00 0.00 ? 433 PHE A HZ   7  
ATOM   10755 N  N    . GLN A 1 77  ? 13.235  42.108  -3.004  1.00 0.00 ? 434 GLN A N    7  
ATOM   10756 C  CA   . GLN A 1 77  ? 11.874  42.591  -2.807  1.00 0.00 ? 434 GLN A CA   7  
ATOM   10757 C  C    . GLN A 1 77  ? 11.869  44.072  -2.445  1.00 0.00 ? 434 GLN A C    7  
ATOM   10758 O  O    . GLN A 1 77  ? 12.648  44.520  -1.603  1.00 0.00 ? 434 GLN A O    7  
ATOM   10759 C  CB   . GLN A 1 77  ? 11.178  41.784  -1.709  1.00 0.00 ? 434 GLN A CB   7  
ATOM   10760 C  CG   . GLN A 1 77  ? 9.677   42.012  -1.645  1.00 0.00 ? 434 GLN A CG   7  
ATOM   10761 C  CD   . GLN A 1 77  ? 8.916   41.177  -2.657  1.00 0.00 ? 434 GLN A CD   7  
ATOM   10762 O  OE1  . GLN A 1 77  ? 9.489   40.318  -3.327  1.00 0.00 ? 434 GLN A OE1  7  
ATOM   10763 N  NE2  . GLN A 1 77  ? 7.617   41.427  -2.773  1.00 0.00 ? 434 GLN A NE2  7  
ATOM   10764 H  H    . GLN A 1 77  ? 13.942  42.409  -2.397  1.00 0.00 ? 434 GLN A H    7  
ATOM   10765 H  HA   . GLN A 1 77  ? 11.337  42.458  -3.734  1.00 0.00 ? 434 GLN A HA   7  
ATOM   10766 H  HB2  . GLN A 1 77  ? 11.354  40.733  -1.886  1.00 0.00 ? 434 GLN A HB2  7  
ATOM   10767 H  HB3  . GLN A 1 77  ? 11.603  42.056  -0.755  1.00 0.00 ? 434 GLN A HB3  7  
ATOM   10768 H  HG2  . GLN A 1 77  ? 9.328   41.755  -0.656  1.00 0.00 ? 434 GLN A HG2  7  
ATOM   10769 H  HG3  . GLN A 1 77  ? 9.476   43.055  -1.837  1.00 0.00 ? 434 GLN A HG3  7  
ATOM   10770 H  HE21 . GLN A 1 77  ? 7.228   42.127  -2.207  1.00 0.00 ? 434 GLN A HE21 7  
ATOM   10771 H  HE22 . GLN A 1 77  ? 7.101   40.903  -3.420  1.00 0.00 ? 434 GLN A HE22 7  
ATOM   10772 N  N    . CYS A 1 78  ? 10.985  44.830  -3.087  1.00 0.00 ? 435 CYS A N    7  
ATOM   10773 C  CA   . CYS A 1 78  ? 10.879  46.262  -2.834  1.00 0.00 ? 435 CYS A CA   7  
ATOM   10774 C  C    . CYS A 1 78  ? 9.999   46.535  -1.618  1.00 0.00 ? 435 CYS A C    7  
ATOM   10775 O  O    . CYS A 1 78  ? 9.369   45.627  -1.077  1.00 0.00 ? 435 CYS A O    7  
ATOM   10776 C  CB   . CYS A 1 78  ? 10.308  46.976  -4.061  1.00 0.00 ? 435 CYS A CB   7  
ATOM   10777 S  SG   . CYS A 1 78  ? 10.864  48.702  -4.242  1.00 0.00 ? 435 CYS A SG   7  
ATOM   10778 H  H    . CYS A 1 78  ? 10.390  44.416  -3.748  1.00 0.00 ? 435 CYS A H    7  
ATOM   10779 H  HA   . CYS A 1 78  ? 11.870  46.639  -2.638  1.00 0.00 ? 435 CYS A HA   7  
ATOM   10780 H  HB2  . CYS A 1 78  ? 10.606  46.441  -4.951  1.00 0.00 ? 435 CYS A HB2  7  
ATOM   10781 H  HB3  . CYS A 1 78  ? 9.230   46.982  -3.996  1.00 0.00 ? 435 CYS A HB3  7  
ATOM   10782 N  N    . GLY A 1 79  ? 9.961   47.795  -1.193  1.00 0.00 ? 436 GLY A N    7  
ATOM   10783 C  CA   . GLY A 1 79  ? 9.156   48.166  -0.044  1.00 0.00 ? 436 GLY A CA   7  
ATOM   10784 C  C    . GLY A 1 79  ? 7.926   48.963  -0.431  1.00 0.00 ? 436 GLY A C    7  
ATOM   10785 O  O    . GLY A 1 79  ? 6.804   48.599  -0.077  1.00 0.00 ? 436 GLY A O    7  
ATOM   10786 H  H    . GLY A 1 79  ? 10.484  48.477  -1.664  1.00 0.00 ? 436 GLY A H    7  
ATOM   10787 H  HA2  . GLY A 1 79  ? 8.844   47.268  0.468   1.00 0.00 ? 436 GLY A HA2  7  
ATOM   10788 H  HA3  . GLY A 1 79  ? 9.759   48.760  0.627   1.00 0.00 ? 436 GLY A HA3  7  
ATOM   10789 N  N    . VAL A 1 80  ? 8.135   50.055  -1.159  1.00 0.00 ? 437 VAL A N    7  
ATOM   10790 C  CA   . VAL A 1 80  ? 7.034   50.907  -1.594  1.00 0.00 ? 437 VAL A CA   7  
ATOM   10791 C  C    . VAL A 1 80  ? 6.063   50.138  -2.483  1.00 0.00 ? 437 VAL A C    7  
ATOM   10792 O  O    . VAL A 1 80  ? 4.883   49.999  -2.157  1.00 0.00 ? 437 VAL A O    7  
ATOM   10793 C  CB   . VAL A 1 80  ? 7.548   52.140  -2.361  1.00 0.00 ? 437 VAL A CB   7  
ATOM   10794 C  CG1  . VAL A 1 80  ? 6.383   52.958  -2.898  1.00 0.00 ? 437 VAL A CG1  7  
ATOM   10795 C  CG2  . VAL A 1 80  ? 8.439   52.990  -1.467  1.00 0.00 ? 437 VAL A CG2  7  
ATOM   10796 H  H    . VAL A 1 80  ? 9.052   50.294  -1.410  1.00 0.00 ? 437 VAL A H    7  
ATOM   10797 H  HA   . VAL A 1 80  ? 6.509   51.249  -0.714  1.00 0.00 ? 437 VAL A HA   7  
ATOM   10798 H  HB   . VAL A 1 80  ? 8.136   51.798  -3.199  1.00 0.00 ? 437 VAL A HB   7  
ATOM   10799 H  HG11 . VAL A 1 80  ? 6.676   53.995  -2.970  1.00 0.00 ? 437 VAL A HG11 7  
ATOM   10800 H  HG12 . VAL A 1 80  ? 6.107   52.592  -3.876  1.00 0.00 ? 437 VAL A HG12 7  
ATOM   10801 H  HG13 . VAL A 1 80  ? 5.541   52.868  -2.228  1.00 0.00 ? 437 VAL A HG13 7  
ATOM   10802 H  HG21 . VAL A 1 80  ? 9.472   52.843  -1.743  1.00 0.00 ? 437 VAL A HG21 7  
ATOM   10803 H  HG22 . VAL A 1 80  ? 8.178   54.031  -1.585  1.00 0.00 ? 437 VAL A HG22 7  
ATOM   10804 H  HG23 . VAL A 1 80  ? 8.297   52.699  -0.436  1.00 0.00 ? 437 VAL A HG23 7  
ATOM   10805 N  N    . CYS A 1 81  ? 6.566   49.639  -3.607  1.00 0.00 ? 438 CYS A N    7  
ATOM   10806 C  CA   . CYS A 1 81  ? 5.744   48.884  -4.544  1.00 0.00 ? 438 CYS A CA   7  
ATOM   10807 C  C    . CYS A 1 81  ? 5.636   47.422  -4.118  1.00 0.00 ? 438 CYS A C    7  
ATOM   10808 O  O    . CYS A 1 81  ? 4.783   46.684  -4.607  1.00 0.00 ? 438 CYS A O    7  
ATOM   10809 C  CB   . CYS A 1 81  ? 6.329   48.973  -5.955  1.00 0.00 ? 438 CYS A CB   7  
ATOM   10810 S  SG   . CYS A 1 81  ? 7.812   47.947  -6.212  1.00 0.00 ? 438 CYS A SG   7  
ATOM   10811 H  H    . CYS A 1 81  ? 7.514   49.783  -3.812  1.00 0.00 ? 438 CYS A H    7  
ATOM   10812 H  HA   . CYS A 1 81  ? 4.756   49.319  -4.545  1.00 0.00 ? 438 CYS A HA   7  
ATOM   10813 H  HB2  . CYS A 1 81  ? 5.582   48.653  -6.667  1.00 0.00 ? 438 CYS A HB2  7  
ATOM   10814 H  HB3  . CYS A 1 81  ? 6.598   49.999  -6.160  1.00 0.00 ? 438 CYS A HB3  7  
ATOM   10815 N  N    . ASN A 1 82  ? 6.509   47.013  -3.203  1.00 0.00 ? 439 ASN A N    7  
ATOM   10816 C  CA   . ASN A 1 82  ? 6.513   45.640  -2.711  1.00 0.00 ? 439 ASN A CA   7  
ATOM   10817 C  C    . ASN A 1 82  ? 6.465   44.647  -3.868  1.00 0.00 ? 439 ASN A C    7  
ATOM   10818 O  O    . ASN A 1 82  ? 5.691   43.690  -3.845  1.00 0.00 ? 439 ASN A O    7  
ATOM   10819 C  CB   . ASN A 1 82  ? 5.325   45.408  -1.775  1.00 0.00 ? 439 ASN A CB   7  
ATOM   10820 C  CG   . ASN A 1 82  ? 5.583   45.928  -0.374  1.00 0.00 ? 439 ASN A CG   7  
ATOM   10821 O  OD1  . ASN A 1 82  ? 4.866   46.800  0.119   1.00 0.00 ? 439 ASN A OD1  7  
ATOM   10822 N  ND2  . ASN A 1 82  ? 6.610   45.393  0.276   1.00 0.00 ? 439 ASN A ND2  7  
ATOM   10823 H  H    . ASN A 1 82  ? 7.167   47.649  -2.851  1.00 0.00 ? 439 ASN A H    7  
ATOM   10824 H  HA   . ASN A 1 82  ? 7.429   45.488  -2.159  1.00 0.00 ? 439 ASN A HA   7  
ATOM   10825 H  HB2  . ASN A 1 82  ? 4.458   45.916  -2.172  1.00 0.00 ? 439 ASN A HB2  7  
ATOM   10826 H  HB3  . ASN A 1 82  ? 5.122   44.350  -1.715  1.00 0.00 ? 439 ASN A HB3  7  
ATOM   10827 H  HD21 . ASN A 1 82  ? 7.137   44.703  -0.179  1.00 0.00 ? 439 ASN A HD21 7  
ATOM   10828 H  HD22 . ASN A 1 82  ? 6.799   45.710  1.184   1.00 0.00 ? 439 ASN A HD22 7  
ATOM   10829 N  N    . ARG A 1 83  ? 7.296   44.882  -4.877  1.00 0.00 ? 440 ARG A N    7  
ATOM   10830 C  CA   . ARG A 1 83  ? 7.348   44.009  -6.044  1.00 0.00 ? 440 ARG A CA   7  
ATOM   10831 C  C    . ARG A 1 83  ? 8.542   43.063  -5.962  1.00 0.00 ? 440 ARG A C    7  
ATOM   10832 O  O    . ARG A 1 83  ? 9.298   43.084  -4.991  1.00 0.00 ? 440 ARG A O    7  
ATOM   10833 C  CB   . ARG A 1 83  ? 7.429   44.840  -7.326  1.00 0.00 ? 440 ARG A CB   7  
ATOM   10834 C  CG   . ARG A 1 83  ? 6.135   45.562  -7.667  1.00 0.00 ? 440 ARG A CG   7  
ATOM   10835 C  CD   . ARG A 1 83  ? 6.346   46.598  -8.759  1.00 0.00 ? 440 ARG A CD   7  
ATOM   10836 N  NE   . ARG A 1 83  ? 6.293   46.005  -10.093 1.00 0.00 ? 440 ARG A NE   7  
ATOM   10837 C  CZ   . ARG A 1 83  ? 5.162   45.663  -10.701 1.00 0.00 ? 440 ARG A CZ   7  
ATOM   10838 N  NH1  . ARG A 1 83  ? 3.997   45.854  -10.097 1.00 0.00 ? 440 ARG A NH1  7  
ATOM   10839 N  NH2  . ARG A 1 83  ? 5.195   45.129  -11.915 1.00 0.00 ? 440 ARG A NH2  7  
ATOM   10840 H  H    . ARG A 1 83  ? 7.889   45.662  -4.838  1.00 0.00 ? 440 ARG A H    7  
ATOM   10841 H  HA   . ARG A 1 83  ? 6.441   43.424  -6.061  1.00 0.00 ? 440 ARG A HA   7  
ATOM   10842 H  HB2  . ARG A 1 83  ? 8.208   45.579  -7.214  1.00 0.00 ? 440 ARG A HB2  7  
ATOM   10843 H  HB3  . ARG A 1 83  ? 7.678   44.187  -8.148  1.00 0.00 ? 440 ARG A HB3  7  
ATOM   10844 H  HG2  . ARG A 1 83  ? 5.409   44.838  -8.008  1.00 0.00 ? 440 ARG A HG2  7  
ATOM   10845 H  HG3  . ARG A 1 83  ? 5.765   46.055  -6.780  1.00 0.00 ? 440 ARG A HG3  7  
ATOM   10846 H  HD2  . ARG A 1 83  ? 5.575   47.349  -8.679  1.00 0.00 ? 440 ARG A HD2  7  
ATOM   10847 H  HD3  . ARG A 1 83  ? 7.312   47.058  -8.618  1.00 0.00 ? 440 ARG A HD3  7  
ATOM   10848 H  HE   . ARG A 1 83  ? 7.142   45.856  -10.558 1.00 0.00 ? 440 ARG A HE   7  
ATOM   10849 H  HH11 . ARG A 1 83  ? 3.969   46.257  -9.182  1.00 0.00 ? 440 ARG A HH11 7  
ATOM   10850 H  HH12 . ARG A 1 83  ? 3.147   45.596  -10.557 1.00 0.00 ? 440 ARG A HH12 7  
ATOM   10851 H  HH21 . ARG A 1 83  ? 6.071   44.984  -12.373 1.00 0.00 ? 440 ARG A HH21 7  
ATOM   10852 H  HH22 . ARG A 1 83  ? 4.344   44.872  -12.371 1.00 0.00 ? 440 ARG A HH22 7  
ATOM   10853 N  N    . SER A 1 84  ? 8.705   42.234  -6.989  1.00 0.00 ? 441 SER A N    7  
ATOM   10854 C  CA   . SER A 1 84  ? 9.805   41.278  -7.031  1.00 0.00 ? 441 SER A CA   7  
ATOM   10855 C  C    . SER A 1 84  ? 10.637  41.462  -8.297  1.00 0.00 ? 441 SER A C    7  
ATOM   10856 O  O    . SER A 1 84  ? 10.128  41.897  -9.330  1.00 0.00 ? 441 SER A O    7  
ATOM   10857 C  CB   . SER A 1 84  ? 9.267   39.847  -6.965  1.00 0.00 ? 441 SER A CB   7  
ATOM   10858 O  OG   . SER A 1 84  ? 8.490   39.541  -8.110  1.00 0.00 ? 441 SER A OG   7  
ATOM   10859 H  H    . SER A 1 84  ? 8.069   42.266  -7.734  1.00 0.00 ? 441 SER A H    7  
ATOM   10860 H  HA   . SER A 1 84  ? 10.434  41.457  -6.172  1.00 0.00 ? 441 SER A HA   7  
ATOM   10861 H  HB2  . SER A 1 84  ? 10.094  39.156  -6.911  1.00 0.00 ? 441 SER A HB2  7  
ATOM   10862 H  HB3  . SER A 1 84  ? 8.649   39.738  -6.085  1.00 0.00 ? 441 SER A HB3  7  
ATOM   10863 H  HG   . SER A 1 84  ? 7.713   39.042  -7.846  1.00 0.00 ? 441 SER A HG   7  
ATOM   10864 N  N    . PHE A 1 85  ? 11.920  41.128  -8.207  1.00 0.00 ? 442 PHE A N    7  
ATOM   10865 C  CA   . PHE A 1 85  ? 12.825  41.257  -9.344  1.00 0.00 ? 442 PHE A CA   7  
ATOM   10866 C  C    . PHE A 1 85  ? 13.787  40.075  -9.410  1.00 0.00 ? 442 PHE A C    7  
ATOM   10867 O  O    . PHE A 1 85  ? 14.302  39.622  -8.387  1.00 0.00 ? 442 PHE A O    7  
ATOM   10868 C  CB   . PHE A 1 85  ? 13.612  42.566  -9.250  1.00 0.00 ? 442 PHE A CB   7  
ATOM   10869 C  CG   . PHE A 1 85  ? 12.754  43.761  -8.947  1.00 0.00 ? 442 PHE A CG   7  
ATOM   10870 C  CD1  . PHE A 1 85  ? 11.919  44.294  -9.915  1.00 0.00 ? 442 PHE A CD1  7  
ATOM   10871 C  CD2  . PHE A 1 85  ? 12.783  44.351  -7.694  1.00 0.00 ? 442 PHE A CD2  7  
ATOM   10872 C  CE1  . PHE A 1 85  ? 11.128  45.394  -9.640  1.00 0.00 ? 442 PHE A CE1  7  
ATOM   10873 C  CE2  . PHE A 1 85  ? 11.994  45.451  -7.412  1.00 0.00 ? 442 PHE A CE2  7  
ATOM   10874 C  CZ   . PHE A 1 85  ? 11.167  45.973  -8.387  1.00 0.00 ? 442 PHE A CZ   7  
ATOM   10875 H  H    . PHE A 1 85  ? 12.267  40.787  -7.356  1.00 0.00 ? 442 PHE A H    7  
ATOM   10876 H  HA   . PHE A 1 85  ? 12.227  41.270  -10.242 1.00 0.00 ? 442 PHE A HA   7  
ATOM   10877 H  HB2  . PHE A 1 85  ? 14.348  42.479  -8.465  1.00 0.00 ? 442 PHE A HB2  7  
ATOM   10878 H  HB3  . PHE A 1 85  ? 14.112  42.744  -10.189 1.00 0.00 ? 442 PHE A HB3  7  
ATOM   10879 H  HD1  . PHE A 1 85  ? 11.888  43.842  -10.897 1.00 0.00 ? 442 PHE A HD1  7  
ATOM   10880 H  HD2  . PHE A 1 85  ? 13.431  43.945  -6.931  1.00 0.00 ? 442 PHE A HD2  7  
ATOM   10881 H  HE1  . PHE A 1 85  ? 10.482  45.800  -10.404 1.00 0.00 ? 442 PHE A HE1  7  
ATOM   10882 H  HE2  . PHE A 1 85  ? 12.027  45.902  -6.432  1.00 0.00 ? 442 PHE A HE2  7  
ATOM   10883 H  HZ   . PHE A 1 85  ? 10.549  46.832  -8.169  1.00 0.00 ? 442 PHE A HZ   7  
ATOM   10884 N  N    . SER A 1 86  ? 14.025  39.580  -10.620 1.00 0.00 ? 443 SER A N    7  
ATOM   10885 C  CA   . SER A 1 86  ? 14.922  38.448  -10.821 1.00 0.00 ? 443 SER A CA   7  
ATOM   10886 C  C    . SER A 1 86  ? 16.380  38.898  -10.790 1.00 0.00 ? 443 SER A C    7  
ATOM   10887 O  O    . SER A 1 86  ? 17.229  38.244  -10.185 1.00 0.00 ? 443 SER A O    7  
ATOM   10888 C  CB   . SER A 1 86  ? 14.618  37.759  -12.152 1.00 0.00 ? 443 SER A CB   7  
ATOM   10889 O  OG   . SER A 1 86  ? 14.939  36.379  -12.097 1.00 0.00 ? 443 SER A OG   7  
ATOM   10890 H  H    . SER A 1 86  ? 13.585  39.985  -11.397 1.00 0.00 ? 443 SER A H    7  
ATOM   10891 H  HA   . SER A 1 86  ? 14.756  37.748  -10.016 1.00 0.00 ? 443 SER A HA   7  
ATOM   10892 H  HB2  . SER A 1 86  ? 13.567  37.862  -12.376 1.00 0.00 ? 443 SER A HB2  7  
ATOM   10893 H  HB3  . SER A 1 86  ? 15.200  38.221  -12.935 1.00 0.00 ? 443 SER A HB3  7  
ATOM   10894 H  HG   . SER A 1 86  ? 15.760  36.261  -11.614 1.00 0.00 ? 443 SER A HG   7  
ATOM   10895 N  N    . ARG A 1 87  ? 16.661  40.018  -11.446 1.00 0.00 ? 444 ARG A N    7  
ATOM   10896 C  CA   . ARG A 1 87  ? 18.015  40.556  -11.496 1.00 0.00 ? 444 ARG A CA   7  
ATOM   10897 C  C    . ARG A 1 87  ? 18.196  41.668  -10.467 1.00 0.00 ? 444 ARG A C    7  
ATOM   10898 O  O    . ARG A 1 87  ? 17.407  42.611  -10.413 1.00 0.00 ? 444 ARG A O    7  
ATOM   10899 C  CB   . ARG A 1 87  ? 18.325  41.086  -12.897 1.00 0.00 ? 444 ARG A CB   7  
ATOM   10900 C  CG   . ARG A 1 87  ? 18.453  39.995  -13.947 1.00 0.00 ? 444 ARG A CG   7  
ATOM   10901 C  CD   . ARG A 1 87  ? 19.235  40.477  -15.159 1.00 0.00 ? 444 ARG A CD   7  
ATOM   10902 N  NE   . ARG A 1 87  ? 19.033  39.613  -16.319 1.00 0.00 ? 444 ARG A NE   7  
ATOM   10903 C  CZ   . ARG A 1 87  ? 19.882  39.541  -17.338 1.00 0.00 ? 444 ARG A CZ   7  
ATOM   10904 N  NH1  . ARG A 1 87  ? 20.985  40.277  -17.340 1.00 0.00 ? 444 ARG A NH1  7  
ATOM   10905 N  NH2  . ARG A 1 87  ? 19.628  38.731  -18.359 1.00 0.00 ? 444 ARG A NH2  7  
ATOM   10906 H  H    . ARG A 1 87  ? 15.940  40.495  -11.909 1.00 0.00 ? 444 ARG A H    7  
ATOM   10907 H  HA   . ARG A 1 87  ? 18.699  39.753  -11.265 1.00 0.00 ? 444 ARG A HA   7  
ATOM   10908 H  HB2  . ARG A 1 87  ? 17.533  41.755  -13.200 1.00 0.00 ? 444 ARG A HB2  7  
ATOM   10909 H  HB3  . ARG A 1 87  ? 19.255  41.634  -12.863 1.00 0.00 ? 444 ARG A HB3  7  
ATOM   10910 H  HG2  . ARG A 1 87  ? 18.968  39.150  -13.513 1.00 0.00 ? 444 ARG A HG2  7  
ATOM   10911 H  HG3  . ARG A 1 87  ? 17.465  39.694  -14.262 1.00 0.00 ? 444 ARG A HG3  7  
ATOM   10912 H  HD2  . ARG A 1 87  ? 18.911  41.477  -15.405 1.00 0.00 ? 444 ARG A HD2  7  
ATOM   10913 H  HD3  . ARG A 1 87  ? 20.286  40.490  -14.910 1.00 0.00 ? 444 ARG A HD3  7  
ATOM   10914 H  HE   . ARG A 1 87  ? 18.224  39.061  -16.338 1.00 0.00 ? 444 ARG A HE   7  
ATOM   10915 H  HH11 . ARG A 1 87  ? 21.179  40.887  -16.572 1.00 0.00 ? 444 ARG A HH11 7  
ATOM   10916 H  HH12 . ARG A 1 87  ? 21.623  40.220  -18.108 1.00 0.00 ? 444 ARG A HH12 7  
ATOM   10917 H  HH21 . ARG A 1 87  ? 18.798  38.175  -18.361 1.00 0.00 ? 444 ARG A HH21 7  
ATOM   10918 H  HH22 . ARG A 1 87  ? 20.267  38.678  -19.125 1.00 0.00 ? 444 ARG A HH22 7  
ATOM   10919 N  N    . SER A 1 88  ? 19.241  41.551  -9.654  1.00 0.00 ? 445 SER A N    7  
ATOM   10920 C  CA   . SER A 1 88  ? 19.523  42.544  -8.624  1.00 0.00 ? 445 SER A CA   7  
ATOM   10921 C  C    . SER A 1 88  ? 19.598  43.944  -9.225  1.00 0.00 ? 445 SER A C    7  
ATOM   10922 O  O    . SER A 1 88  ? 18.881  44.851  -8.805  1.00 0.00 ? 445 SER A O    7  
ATOM   10923 C  CB   . SER A 1 88  ? 20.836  42.211  -7.912  1.00 0.00 ? 445 SER A CB   7  
ATOM   10924 O  OG   . SER A 1 88  ? 20.992  42.992  -6.739  1.00 0.00 ? 445 SER A OG   7  
ATOM   10925 H  H    . SER A 1 88  ? 19.834  40.776  -9.747  1.00 0.00 ? 445 SER A H    7  
ATOM   10926 H  HA   . SER A 1 88  ? 18.717  42.516  -7.906  1.00 0.00 ? 445 SER A HA   7  
ATOM   10927 H  HB2  . SER A 1 88  ? 20.840  41.167  -7.638  1.00 0.00 ? 445 SER A HB2  7  
ATOM   10928 H  HB3  . SER A 1 88  ? 21.664  42.412  -8.576  1.00 0.00 ? 445 SER A HB3  7  
ATOM   10929 H  HG   . SER A 1 88  ? 21.177  42.416  -5.993  1.00 0.00 ? 445 SER A HG   7  
ATOM   10930 N  N    . ASP A 1 89  ? 20.472  44.111  -10.212 1.00 0.00 ? 446 ASP A N    7  
ATOM   10931 C  CA   . ASP A 1 89  ? 20.642  45.399  -10.873 1.00 0.00 ? 446 ASP A CA   7  
ATOM   10932 C  C    . ASP A 1 89  ? 19.292  46.065  -11.121 1.00 0.00 ? 446 ASP A C    7  
ATOM   10933 O  O    . ASP A 1 89  ? 19.098  47.238  -10.799 1.00 0.00 ? 446 ASP A O    7  
ATOM   10934 C  CB   . ASP A 1 89  ? 21.388  45.223  -12.197 1.00 0.00 ? 446 ASP A CB   7  
ATOM   10935 C  CG   . ASP A 1 89  ? 22.882  45.056  -12.002 1.00 0.00 ? 446 ASP A CG   7  
ATOM   10936 O  OD1  . ASP A 1 89  ? 23.282  44.200  -11.184 1.00 0.00 ? 446 ASP A OD1  7  
ATOM   10937 O  OD2  . ASP A 1 89  ? 23.651  45.780  -12.667 1.00 0.00 ? 446 ASP A OD2  7  
ATOM   10938 H  H    . ASP A 1 89  ? 21.016  43.349  -10.503 1.00 0.00 ? 446 ASP A H    7  
ATOM   10939 H  HA   . ASP A 1 89  ? 21.227  46.032  -10.223 1.00 0.00 ? 446 ASP A HA   7  
ATOM   10940 H  HB2  . ASP A 1 89  ? 21.009  44.346  -12.702 1.00 0.00 ? 446 ASP A HB2  7  
ATOM   10941 H  HB3  . ASP A 1 89  ? 21.218  46.091  -12.816 1.00 0.00 ? 446 ASP A HB3  7  
ATOM   10942 N  N    . HIS A 1 90  ? 18.361  45.309  -11.695 1.00 0.00 ? 447 HIS A N    7  
ATOM   10943 C  CA   . HIS A 1 90  ? 17.029  45.826  -11.986 1.00 0.00 ? 447 HIS A CA   7  
ATOM   10944 C  C    . HIS A 1 90  ? 16.436  46.520  -10.763 1.00 0.00 ? 447 HIS A C    7  
ATOM   10945 O  O    . HIS A 1 90  ? 15.846  47.596  -10.872 1.00 0.00 ? 447 HIS A O    7  
ATOM   10946 C  CB   . HIS A 1 90  ? 16.108  44.693  -12.441 1.00 0.00 ? 447 HIS A CB   7  
ATOM   10947 C  CG   . HIS A 1 90  ? 16.496  44.098  -13.759 1.00 0.00 ? 447 HIS A CG   7  
ATOM   10948 N  ND1  . HIS A 1 90  ? 15.609  43.421  -14.569 1.00 0.00 ? 447 HIS A ND1  7  
ATOM   10949 C  CD2  . HIS A 1 90  ? 17.683  44.084  -14.409 1.00 0.00 ? 447 HIS A CD2  7  
ATOM   10950 C  CE1  . HIS A 1 90  ? 16.235  43.014  -15.659 1.00 0.00 ? 447 HIS A CE1  7  
ATOM   10951 N  NE2  . HIS A 1 90  ? 17.495  43.403  -15.587 1.00 0.00 ? 447 HIS A NE2  7  
ATOM   10952 H  H    . HIS A 1 90  ? 18.576  44.382  -11.928 1.00 0.00 ? 447 HIS A H    7  
ATOM   10953 H  HA   . HIS A 1 90  ? 17.120  46.547  -12.784 1.00 0.00 ? 447 HIS A HA   7  
ATOM   10954 H  HB2  . HIS A 1 90  ? 16.126  43.905  -11.703 1.00 0.00 ? 447 HIS A HB2  7  
ATOM   10955 H  HB3  . HIS A 1 90  ? 15.099  45.072  -12.531 1.00 0.00 ? 447 HIS A HB3  7  
ATOM   10956 H  HD1  . HIS A 1 90  ? 14.663  43.261  -14.374 1.00 0.00 ? 447 HIS A HD1  7  
ATOM   10957 H  HD2  . HIS A 1 90  ? 18.609  44.525  -14.065 1.00 0.00 ? 447 HIS A HD2  7  
ATOM   10958 H  HE1  . HIS A 1 90  ? 15.793  42.457  -16.472 1.00 0.00 ? 447 HIS A HE1  7  
ATOM   10959 N  N    . LEU A 1 91  ? 16.596  45.897  -9.601  1.00 0.00 ? 448 LEU A N    7  
ATOM   10960 C  CA   . LEU A 1 91  ? 16.076  46.454  -8.357  1.00 0.00 ? 448 LEU A CA   7  
ATOM   10961 C  C    . LEU A 1 91  ? 16.748  47.785  -8.033  1.00 0.00 ? 448 LEU A C    7  
ATOM   10962 O  O    . LEU A 1 91  ? 16.087  48.748  -7.647  1.00 0.00 ? 448 LEU A O    7  
ATOM   10963 C  CB   . LEU A 1 91  ? 16.288  45.469  -7.206  1.00 0.00 ? 448 LEU A CB   7  
ATOM   10964 C  CG   . LEU A 1 91  ? 16.098  46.032  -5.797  1.00 0.00 ? 448 LEU A CG   7  
ATOM   10965 C  CD1  . LEU A 1 91  ? 14.622  46.255  -5.505  1.00 0.00 ? 448 LEU A CD1  7  
ATOM   10966 C  CD2  . LEU A 1 91  ? 16.713  45.101  -4.763  1.00 0.00 ? 448 LEU A CD2  7  
ATOM   10967 H  H    . LEU A 1 91  ? 17.074  45.043  -9.577  1.00 0.00 ? 448 LEU A H    7  
ATOM   10968 H  HA   . LEU A 1 91  ? 15.017  46.622  -8.486  1.00 0.00 ? 448 LEU A HA   7  
ATOM   10969 H  HB2  . LEU A 1 91  ? 15.590  44.656  -7.333  1.00 0.00 ? 448 LEU A HB2  7  
ATOM   10970 H  HB3  . LEU A 1 91  ? 17.297  45.090  -7.278  1.00 0.00 ? 448 LEU A HB3  7  
ATOM   10971 H  HG   . LEU A 1 91  ? 16.599  46.988  -5.727  1.00 0.00 ? 448 LEU A HG   7  
ATOM   10972 H  HD11 . LEU A 1 91  ? 14.505  47.136  -4.893  1.00 0.00 ? 448 LEU A HD11 7  
ATOM   10973 H  HD12 . LEU A 1 91  ? 14.225  45.398  -4.983  1.00 0.00 ? 448 LEU A HD12 7  
ATOM   10974 H  HD13 . LEU A 1 91  ? 14.088  46.389  -6.435  1.00 0.00 ? 448 LEU A HD13 7  
ATOM   10975 H  HD21 . LEU A 1 91  ? 17.590  44.629  -5.180  1.00 0.00 ? 448 LEU A HD21 7  
ATOM   10976 H  HD22 . LEU A 1 91  ? 15.993  44.344  -4.487  1.00 0.00 ? 448 LEU A HD22 7  
ATOM   10977 H  HD23 . LEU A 1 91  ? 16.991  45.669  -3.887  1.00 0.00 ? 448 LEU A HD23 7  
ATOM   10978 N  N    . ALA A 1 92  ? 18.066  47.831  -8.195  1.00 0.00 ? 449 ALA A N    7  
ATOM   10979 C  CA   . ALA A 1 92  ? 18.828  49.044  -7.925  1.00 0.00 ? 449 ALA A CA   7  
ATOM   10980 C  C    . ALA A 1 92  ? 18.352  50.197  -8.802  1.00 0.00 ? 449 ALA A C    7  
ATOM   10981 O  O    . ALA A 1 92  ? 18.041  51.281  -8.305  1.00 0.00 ? 449 ALA A O    7  
ATOM   10982 C  CB   . ALA A 1 92  ? 20.313  48.793  -8.138  1.00 0.00 ? 449 ALA A CB   7  
ATOM   10983 H  H    . ALA A 1 92  ? 18.538  47.030  -8.506  1.00 0.00 ? 449 ALA A H    7  
ATOM   10984 H  HA   . ALA A 1 92  ? 18.677  49.308  -6.888  1.00 0.00 ? 449 ALA A HA   7  
ATOM   10985 H  HB1  . ALA A 1 92  ? 20.729  49.587  -8.741  1.00 0.00 ? 449 ALA A HB1  7  
ATOM   10986 H  HB2  . ALA A 1 92  ? 20.814  48.768  -7.181  1.00 0.00 ? 449 ALA A HB2  7  
ATOM   10987 H  HB3  . ALA A 1 92  ? 20.450  47.848  -8.642  1.00 0.00 ? 449 ALA A HB3  7  
ATOM   10988 N  N    . LEU A 1 93  ? 18.299  49.958  -10.107 1.00 0.00 ? 450 LEU A N    7  
ATOM   10989 C  CA   . LEU A 1 93  ? 17.862  50.978  -11.055 1.00 0.00 ? 450 LEU A CA   7  
ATOM   10990 C  C    . LEU A 1 93  ? 16.394  51.330  -10.838 1.00 0.00 ? 450 LEU A C    7  
ATOM   10991 O  O    . LEU A 1 93  ? 16.005  52.495  -10.920 1.00 0.00 ? 450 LEU A O    7  
ATOM   10992 C  CB   . LEU A 1 93  ? 18.076  50.494  -12.490 1.00 0.00 ? 450 LEU A CB   7  
ATOM   10993 C  CG   . LEU A 1 93  ? 19.442  50.801  -13.105 1.00 0.00 ? 450 LEU A CG   7  
ATOM   10994 C  CD1  . LEU A 1 93  ? 20.451  49.729  -12.724 1.00 0.00 ? 450 LEU A CD1  7  
ATOM   10995 C  CD2  . LEU A 1 93  ? 19.331  50.918  -14.618 1.00 0.00 ? 450 LEU A CD2  7  
ATOM   10996 H  H    . LEU A 1 93  ? 18.559  49.076  -10.443 1.00 0.00 ? 450 LEU A H    7  
ATOM   10997 H  HA   . LEU A 1 93  ? 18.460  51.862  -10.889 1.00 0.00 ? 450 LEU A HA   7  
ATOM   10998 H  HB2  . LEU A 1 93  ? 17.941  49.424  -12.501 1.00 0.00 ? 450 LEU A HB2  7  
ATOM   10999 H  HB3  . LEU A 1 93  ? 17.321  50.957  -13.110 1.00 0.00 ? 450 LEU A HB3  7  
ATOM   11000 H  HG   . LEU A 1 93  ? 19.799  51.747  -12.721 1.00 0.00 ? 450 LEU A HG   7  
ATOM   11001 H  HD11 . LEU A 1 93  ? 21.413  49.974  -13.149 1.00 0.00 ? 450 LEU A HD11 7  
ATOM   11002 H  HD12 . LEU A 1 93  ? 20.123  48.774  -13.105 1.00 0.00 ? 450 LEU A HD12 7  
ATOM   11003 H  HD13 . LEU A 1 93  ? 20.534  49.678  -11.649 1.00 0.00 ? 450 LEU A HD13 7  
ATOM   11004 H  HD21 . LEU A 1 93  ? 18.296  51.059  -14.893 1.00 0.00 ? 450 LEU A HD21 7  
ATOM   11005 H  HD22 . LEU A 1 93  ? 19.707  50.016  -15.077 1.00 0.00 ? 450 LEU A HD22 7  
ATOM   11006 H  HD23 . LEU A 1 93  ? 19.912  51.764  -14.957 1.00 0.00 ? 450 LEU A HD23 7  
ATOM   11007 N  N    . HIS A 1 94  ? 15.583  50.314  -10.558 1.00 0.00 ? 451 HIS A N    7  
ATOM   11008 C  CA   . HIS A 1 94  ? 14.157  50.516  -10.326 1.00 0.00 ? 451 HIS A CA   7  
ATOM   11009 C  C    . HIS A 1 94  ? 13.926  51.458  -9.148  1.00 0.00 ? 451 HIS A C    7  
ATOM   11010 O  O    . HIS A 1 94  ? 13.134  52.395  -9.237  1.00 0.00 ? 451 HIS A O    7  
ATOM   11011 C  CB   . HIS A 1 94  ? 13.466  49.177  -10.066 1.00 0.00 ? 451 HIS A CB   7  
ATOM   11012 C  CG   . HIS A 1 94  ? 12.204  49.299  -9.270  1.00 0.00 ? 451 HIS A CG   7  
ATOM   11013 N  ND1  . HIS A 1 94  ? 10.971  49.531  -9.844  1.00 0.00 ? 451 HIS A ND1  7  
ATOM   11014 C  CD2  . HIS A 1 94  ? 11.986  49.218  -7.936  1.00 0.00 ? 451 HIS A CD2  7  
ATOM   11015 C  CE1  . HIS A 1 94  ? 10.051  49.589  -8.898  1.00 0.00 ? 451 HIS A CE1  7  
ATOM   11016 N  NE2  . HIS A 1 94  ? 10.641  49.402  -7.731  1.00 0.00 ? 451 HIS A NE2  7  
ATOM   11017 H  H    . HIS A 1 94  ? 15.952  49.408  -10.506 1.00 0.00 ? 451 HIS A H    7  
ATOM   11018 H  HA   . HIS A 1 94  ? 13.736  50.962  -11.215 1.00 0.00 ? 451 HIS A HA   7  
ATOM   11019 H  HB2  . HIS A 1 94  ? 13.219  48.718  -11.012 1.00 0.00 ? 451 HIS A HB2  7  
ATOM   11020 H  HB3  . HIS A 1 94  ? 14.141  48.531  -9.523  1.00 0.00 ? 451 HIS A HB3  7  
ATOM   11021 H  HD1  . HIS A 1 94  ? 10.798  49.638  -10.802 1.00 0.00 ? 451 HIS A HD1  7  
ATOM   11022 H  HD2  . HIS A 1 94  ? 12.733  49.042  -7.174  1.00 0.00 ? 451 HIS A HD2  7  
ATOM   11023 H  HE1  . HIS A 1 94  ? 8.996   49.760  -9.051  1.00 0.00 ? 451 HIS A HE1  7  
ATOM   11024 N  N    . MET A 1 95  ? 14.623  51.201  -8.046  1.00 0.00 ? 452 MET A N    7  
ATOM   11025 C  CA   . MET A 1 95  ? 14.494  52.026  -6.851  1.00 0.00 ? 452 MET A CA   7  
ATOM   11026 C  C    . MET A 1 95  ? 14.558  53.509  -7.204  1.00 0.00 ? 452 MET A C    7  
ATOM   11027 O  O    . MET A 1 95  ? 13.745  54.306  -6.735  1.00 0.00 ? 452 MET A O    7  
ATOM   11028 C  CB   . MET A 1 95  ? 15.595  51.682  -5.845  1.00 0.00 ? 452 MET A CB   7  
ATOM   11029 C  CG   . MET A 1 95  ? 15.315  50.419  -5.048  1.00 0.00 ? 452 MET A CG   7  
ATOM   11030 S  SD   . MET A 1 95  ? 13.759  50.501  -4.139  1.00 0.00 ? 452 MET A SD   7  
ATOM   11031 C  CE   . MET A 1 95  ? 14.210  51.593  -2.794  1.00 0.00 ? 452 MET A CE   7  
ATOM   11032 H  H    . MET A 1 95  ? 15.239  50.439  -8.036  1.00 0.00 ? 452 MET A H    7  
ATOM   11033 H  HA   . MET A 1 95  ? 13.533  51.816  -6.405  1.00 0.00 ? 452 MET A HA   7  
ATOM   11034 H  HB2  . MET A 1 95  ? 16.523  51.547  -6.379  1.00 0.00 ? 452 MET A HB2  7  
ATOM   11035 H  HB3  . MET A 1 95  ? 15.703  52.503  -5.152  1.00 0.00 ? 452 MET A HB3  7  
ATOM   11036 H  HG2  . MET A 1 95  ? 15.274  49.581  -5.727  1.00 0.00 ? 452 MET A HG2  7  
ATOM   11037 H  HG3  . MET A 1 95  ? 16.120  50.269  -4.343  1.00 0.00 ? 452 MET A HG3  7  
ATOM   11038 H  HE1  . MET A 1 95  ? 13.320  52.053  -2.390  1.00 0.00 ? 452 MET A HE1  7  
ATOM   11039 H  HE2  . MET A 1 95  ? 14.705  51.026  -2.019  1.00 0.00 ? 452 MET A HE2  7  
ATOM   11040 H  HE3  . MET A 1 95  ? 14.877  52.360  -3.160  1.00 0.00 ? 452 MET A HE3  7  
ATOM   11041 N  N    . LYS A 1 96  ? 15.530  53.873  -8.035  1.00 0.00 ? 453 LYS A N    7  
ATOM   11042 C  CA   . LYS A 1 96  ? 15.700  55.259  -8.452  1.00 0.00 ? 453 LYS A CA   7  
ATOM   11043 C  C    . LYS A 1 96  ? 14.350  55.918  -8.715  1.00 0.00 ? 453 LYS A C    7  
ATOM   11044 O  O    . LYS A 1 96  ? 14.094  57.034  -8.261  1.00 0.00 ? 453 LYS A O    7  
ATOM   11045 C  CB   . LYS A 1 96  ? 16.568  55.331  -9.711  1.00 0.00 ? 453 LYS A CB   7  
ATOM   11046 C  CG   . LYS A 1 96  ? 17.954  54.738  -9.528  1.00 0.00 ? 453 LYS A CG   7  
ATOM   11047 C  CD   . LYS A 1 96  ? 18.864  55.674  -8.752  1.00 0.00 ? 453 LYS A CD   7  
ATOM   11048 C  CE   . LYS A 1 96  ? 19.559  56.666  -9.672  1.00 0.00 ? 453 LYS A CE   7  
ATOM   11049 N  NZ   . LYS A 1 96  ? 18.713  57.862  -9.939  1.00 0.00 ? 453 LYS A NZ   7  
ATOM   11050 H  H    . LYS A 1 96  ? 16.147  53.192  -8.375  1.00 0.00 ? 453 LYS A H    7  
ATOM   11051 H  HA   . LYS A 1 96  ? 16.196  55.788  -7.653  1.00 0.00 ? 453 LYS A HA   7  
ATOM   11052 H  HB2  . LYS A 1 96  ? 16.072  54.796  -10.507 1.00 0.00 ? 453 LYS A HB2  7  
ATOM   11053 H  HB3  . LYS A 1 96  ? 16.678  56.367  -9.999  1.00 0.00 ? 453 LYS A HB3  7  
ATOM   11054 H  HG2  . LYS A 1 96  ? 17.869  53.806  -8.988  1.00 0.00 ? 453 LYS A HG2  7  
ATOM   11055 H  HG3  . LYS A 1 96  ? 18.388  54.553  -10.501 1.00 0.00 ? 453 LYS A HG3  7  
ATOM   11056 H  HD2  . LYS A 1 96  ? 18.274  56.221  -8.032  1.00 0.00 ? 453 LYS A HD2  7  
ATOM   11057 H  HD3  . LYS A 1 96  ? 19.613  55.089  -8.236  1.00 0.00 ? 453 LYS A HD3  7  
ATOM   11058 H  HE2  . LYS A 1 96  ? 20.480  56.984  -9.208  1.00 0.00 ? 453 LYS A HE2  7  
ATOM   11059 H  HE3  . LYS A 1 96  ? 19.779  56.175  -10.608 1.00 0.00 ? 453 LYS A HE3  7  
ATOM   11060 H  HZ1  . LYS A 1 96  ? 17.817  57.789  -9.417  1.00 0.00 ? 453 LYS A HZ1  7  
ATOM   11061 H  HZ2  . LYS A 1 96  ? 18.506  57.933  -10.956 1.00 0.00 ? 453 LYS A HZ2  7  
ATOM   11062 H  HZ3  . LYS A 1 96  ? 19.209  58.725  -9.637  1.00 0.00 ? 453 LYS A HZ3  7  
ATOM   11063 N  N    . ARG A 1 97  ? 13.489  55.221  -9.449  1.00 0.00 ? 454 ARG A N    7  
ATOM   11064 C  CA   . ARG A 1 97  ? 12.165  55.739  -9.771  1.00 0.00 ? 454 ARG A CA   7  
ATOM   11065 C  C    . ARG A 1 97  ? 11.427  56.171  -8.507  1.00 0.00 ? 454 ARG A C    7  
ATOM   11066 O  O    . ARG A 1 97  ? 10.808  57.234  -8.470  1.00 0.00 ? 454 ARG A O    7  
ATOM   11067 C  CB   . ARG A 1 97  ? 11.347  54.681  -10.515 1.00 0.00 ? 454 ARG A CB   7  
ATOM   11068 C  CG   . ARG A 1 97  ? 10.004  55.189  -11.014 1.00 0.00 ? 454 ARG A CG   7  
ATOM   11069 C  CD   . ARG A 1 97  ? 10.171  56.164  -12.169 1.00 0.00 ? 454 ARG A CD   7  
ATOM   11070 N  NE   . ARG A 1 97  ? 10.153  55.487  -13.463 1.00 0.00 ? 454 ARG A NE   7  
ATOM   11071 C  CZ   . ARG A 1 97  ? 10.667  56.008  -14.572 1.00 0.00 ? 454 ARG A CZ   7  
ATOM   11072 N  NH1  . ARG A 1 97  ? 11.237  57.205  -14.544 1.00 0.00 ? 454 ARG A NH1  7  
ATOM   11073 N  NH2  . ARG A 1 97  ? 10.612  55.330  -15.712 1.00 0.00 ? 454 ARG A NH2  7  
ATOM   11074 H  H    . ARG A 1 97  ? 13.751  54.337  -9.783  1.00 0.00 ? 454 ARG A H    7  
ATOM   11075 H  HA   . ARG A 1 97  ? 12.292  56.599  -10.411 1.00 0.00 ? 454 ARG A HA   7  
ATOM   11076 H  HB2  . ARG A 1 97  ? 11.916  54.337  -11.367 1.00 0.00 ? 454 ARG A HB2  7  
ATOM   11077 H  HB3  . ARG A 1 97  ? 11.169  53.849  -9.851  1.00 0.00 ? 454 ARG A HB3  7  
ATOM   11078 H  HG2  . ARG A 1 97  ? 9.414   54.349  -11.349 1.00 0.00 ? 454 ARG A HG2  7  
ATOM   11079 H  HG3  . ARG A 1 97  ? 9.495   55.689  -10.203 1.00 0.00 ? 454 ARG A HG3  7  
ATOM   11080 H  HD2  . ARG A 1 97  ? 9.364   56.880  -12.137 1.00 0.00 ? 454 ARG A HD2  7  
ATOM   11081 H  HD3  . ARG A 1 97  ? 11.113  56.678  -12.055 1.00 0.00 ? 454 ARG A HD3  7  
ATOM   11082 H  HE   . ARG A 1 97  ? 9.737   54.601  -13.506 1.00 0.00 ? 454 ARG A HE   7  
ATOM   11083 H  HH11 . ARG A 1 97  ? 11.280  57.717  -13.686 1.00 0.00 ? 454 ARG A HH11 7  
ATOM   11084 H  HH12 . ARG A 1 97  ? 11.624  57.594  -15.380 1.00 0.00 ? 454 ARG A HH12 7  
ATOM   11085 H  HH21 . ARG A 1 97  ? 10.184  54.428  -15.736 1.00 0.00 ? 454 ARG A HH21 7  
ATOM   11086 H  HH22 . ARG A 1 97  ? 10.999  55.723  -16.545 1.00 0.00 ? 454 ARG A HH22 7  
ATOM   11087 N  N    . HIS A 1 98  ? 11.498  55.338  -7.473  1.00 0.00 ? 455 HIS A N    7  
ATOM   11088 C  CA   . HIS A 1 98  ? 10.837  55.634  -6.207  1.00 0.00 ? 455 HIS A CA   7  
ATOM   11089 C  C    . HIS A 1 98  ? 11.413  56.898  -5.576  1.00 0.00 ? 455 HIS A C    7  
ATOM   11090 O  O    . HIS A 1 98  ? 10.727  57.914  -5.466  1.00 0.00 ? 455 HIS A O    7  
ATOM   11091 C  CB   . HIS A 1 98  ? 10.985  54.456  -5.243  1.00 0.00 ? 455 HIS A CB   7  
ATOM   11092 C  CG   . HIS A 1 98  ? 10.042  53.328  -5.526  1.00 0.00 ? 455 HIS A CG   7  
ATOM   11093 N  ND1  . HIS A 1 98  ? 8.719   53.520  -5.865  1.00 0.00 ? 455 HIS A ND1  7  
ATOM   11094 C  CD2  . HIS A 1 98  ? 10.237  51.988  -5.521  1.00 0.00 ? 455 HIS A CD2  7  
ATOM   11095 C  CE1  . HIS A 1 98  ? 8.141   52.348  -6.055  1.00 0.00 ? 455 HIS A CE1  7  
ATOM   11096 N  NE2  . HIS A 1 98  ? 9.040   51.402  -5.853  1.00 0.00 ? 455 HIS A NE2  7  
ATOM   11097 H  H    . HIS A 1 98  ? 12.007  54.506  -7.564  1.00 0.00 ? 455 HIS A H    7  
ATOM   11098 H  HA   . HIS A 1 98  ? 9.789   55.792  -6.409  1.00 0.00 ? 455 HIS A HA   7  
ATOM   11099 H  HB2  . HIS A 1 98  ? 11.992  54.070  -5.309  1.00 0.00 ? 455 HIS A HB2  7  
ATOM   11100 H  HB3  . HIS A 1 98  ? 10.801  54.799  -4.235  1.00 0.00 ? 455 HIS A HB3  7  
ATOM   11101 H  HD1  . HIS A 1 98  ? 8.271   54.387  -5.952  1.00 0.00 ? 455 HIS A HD1  7  
ATOM   11102 H  HD2  . HIS A 1 98  ? 11.161  51.475  -5.298  1.00 0.00 ? 455 HIS A HD2  7  
ATOM   11103 H  HE1  . HIS A 1 98  ? 7.108   52.189  -6.329  1.00 0.00 ? 455 HIS A HE1  7  
ATOM   11104 N  N    . GLN A 1 99  ? 12.674  56.827  -5.164  1.00 0.00 ? 456 GLN A N    7  
ATOM   11105 C  CA   . GLN A 1 99  ? 13.340  57.966  -4.543  1.00 0.00 ? 456 GLN A CA   7  
ATOM   11106 C  C    . GLN A 1 99  ? 13.323  59.177  -5.469  1.00 0.00 ? 456 GLN A C    7  
ATOM   11107 O  O    . GLN A 1 99  ? 13.917  59.156  -6.546  1.00 0.00 ? 456 GLN A O    7  
ATOM   11108 C  CB   . GLN A 1 99  ? 14.782  57.605  -4.182  1.00 0.00 ? 456 GLN A CB   7  
ATOM   11109 C  CG   . GLN A 1 99  ? 15.463  56.716  -5.209  1.00 0.00 ? 456 GLN A CG   7  
ATOM   11110 C  CD   . GLN A 1 99  ? 16.971  56.703  -5.062  1.00 0.00 ? 456 GLN A CD   7  
ATOM   11111 O  OE1  . GLN A 1 99  ? 17.539  55.799  -4.449  1.00 0.00 ? 456 GLN A OE1  7  
ATOM   11112 N  NE2  . GLN A 1 99  ? 17.630  57.709  -5.625  1.00 0.00 ? 456 GLN A NE2  7  
ATOM   11113 H  H    . GLN A 1 99  ? 13.168  55.989  -5.280  1.00 0.00 ? 456 GLN A H    7  
ATOM   11114 H  HA   . GLN A 1 99  ? 12.803  58.211  -3.640  1.00 0.00 ? 456 GLN A HA   7  
ATOM   11115 H  HB2  . GLN A 1 99  ? 15.355  58.516  -4.089  1.00 0.00 ? 456 GLN A HB2  7  
ATOM   11116 H  HB3  . GLN A 1 99  ? 14.784  57.089  -3.233  1.00 0.00 ? 456 GLN A HB3  7  
ATOM   11117 H  HG2  . GLN A 1 99  ? 15.097  55.707  -5.092  1.00 0.00 ? 456 GLN A HG2  7  
ATOM   11118 H  HG3  . GLN A 1 99  ? 15.215  57.075  -6.197  1.00 0.00 ? 456 GLN A HG3  7  
ATOM   11119 H  HE21 . GLN A 1 99  ? 17.111  58.395  -6.097  1.00 0.00 ? 456 GLN A HE21 7  
ATOM   11120 H  HE22 . GLN A 1 99  ? 18.605  57.726  -5.545  1.00 0.00 ? 456 GLN A HE22 7  
ATOM   11121 N  N    . ASN A 1 100 ? 12.637  60.233  -5.042  1.00 0.00 ? 457 ASN A N    7  
ATOM   11122 C  CA   . ASN A 1 100 ? 12.542  61.454  -5.833  1.00 0.00 ? 457 ASN A CA   7  
ATOM   11123 C  C    . ASN A 1 100 ? 13.711  62.388  -5.536  1.00 0.00 ? 457 ASN A C    7  
ATOM   11124 O  O    . ASN A 1 100 ? 13.718  63.544  -5.957  1.00 0.00 ? 457 ASN A O    7  
ATOM   11125 C  CB   . ASN A 1 100 ? 11.219  62.169  -5.549  1.00 0.00 ? 457 ASN A CB   7  
ATOM   11126 C  CG   . ASN A 1 100 ? 10.850  63.156  -6.640  1.00 0.00 ? 457 ASN A CG   7  
ATOM   11127 O  OD1  . ASN A 1 100 ? 10.511  62.766  -7.757  1.00 0.00 ? 457 ASN A OD1  7  
ATOM   11128 N  ND2  . ASN A 1 100 ? 10.914  64.443  -6.319  1.00 0.00 ? 457 ASN A ND2  7  
ATOM   11129 H  H    . ASN A 1 100 ? 12.184  60.190  -4.174  1.00 0.00 ? 457 ASN A H    7  
ATOM   11130 H  HA   . ASN A 1 100 ? 12.574  61.176  -6.876  1.00 0.00 ? 457 ASN A HA   7  
ATOM   11131 H  HB2  . ASN A 1 100 ? 10.430  61.435  -5.4