data_2ECH
# 
_entry.id   2ECH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ECH         
WWPDB D_1000178023 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ECH 
_pdbx_database_status.recvd_initial_deposition_date   1993-04-13 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pelton, J.T.'   1 
'Atkinson, R.A.' 2 
'Saudek, V.'     3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Echistatin: the refined structure of a disintegrin in solution by 1H NMR and restrained molecular dynamics.' 
'Int.J.Pept.Protein Res.' 43  563  572 1994 IJPPC3 DK 0367-8377 0215 ? 7928087 ? 
1       'The Secondary Structure of Echistatin from 1H-NMR, Circular-Dichroism and Raman Spectroscopy'                
Eur.J.Biochem.            202 329  ?   1991 EJBCAI IX 0014-2956 0262 ? ?       ? 
2       'Three-Dimensional Structure of Echistatin, the Smallest Active Rgd Protein'                                  Biochemistry 
30  7369 ?   1991 BICHAW US 0006-2960 0033 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Atkinson, R.A.' 1  
primary 'Saudek, V.'     2  
primary 'Pelton, J.T.'   3  
1       'Saudek, V.'     4  
1       'Atkinson, R.A.' 5  
1       'Lepage, P.'     6  
1       'Pelton, J.T.'   7  
2       'Saudek, V.'     8  
2       'Atkinson, R.A.' 9  
2       'Pelton, J.T.'   10 
# 
_cell.entry_id           2ECH 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2ECH 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           ECHISTATIN 
_entity.formula_weight             5433.197 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       'ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT(NH2)' 
_entity_poly.pdbx_seq_one_letter_code_can   ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPATX 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLU n 
1 2  CYS n 
1 3  GLU n 
1 4  SER n 
1 5  GLY n 
1 6  PRO n 
1 7  CYS n 
1 8  CYS n 
1 9  ARG n 
1 10 ASN n 
1 11 CYS n 
1 12 LYS n 
1 13 PHE n 
1 14 LEU n 
1 15 LYS n 
1 16 GLU n 
1 17 GLY n 
1 18 THR n 
1 19 ILE n 
1 20 CYS n 
1 21 LYS n 
1 22 ARG n 
1 23 ALA n 
1 24 ARG n 
1 25 GLY n 
1 26 ASP n 
1 27 ASP n 
1 28 MET n 
1 29 ASP n 
1 30 ASP n 
1 31 TYR n 
1 32 CYS n 
1 33 ASN n 
1 34 GLY n 
1 35 LYS n 
1 36 THR n 
1 37 CYS n 
1 38 ASP n 
1 39 CYS n 
1 40 PRO n 
1 41 ARG n 
1 42 ASN n 
1 43 PRO n 
1 44 HIS n 
1 45 LYS n 
1 46 GLY n 
1 47 PRO n 
1 48 ALA n 
1 49 THR n 
1 50 NH2 n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'saw-scaled viper' 
_entity_src_gen.gene_src_genus                     Echis 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Echis carinatus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     40353 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DISI_ECHCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P17347 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2ECH 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 49 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P17347 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  49 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       49 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NH2 non-polymer         . 'AMINO GROUP'   ? 'H2 N'           16.023  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
# 
_pdbx_nmr_ensemble.entry_id                             2ECH 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    8 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_exptl.entry_id          2ECH 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2ECH 
_struct.title                     'ECHISTATIN-THE REFINED STRUCTURE OF A DISINTEGRIN IN SOLUTION BY 1H NMR' 
_struct.pdbx_descriptor           'ECHISTATIN (NMR, 8 STRUCTURES)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ECH 
_struct_keywords.pdbx_keywords   'BLOOD COAGULATION INHIBITOR' 
_struct_keywords.text            'BLOOD COAGULATION INHIBITOR' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 2  SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 2  A CYS 11 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf2 disulf ? ? A CYS 7  SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 7  A CYS 32 1_555 ? ? ? ? ? ? ? 2.012 ? 
disulf3 disulf ? ? A CYS 8  SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 8  A CYS 37 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf4 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 20 A CYS 39 1_555 ? ? ? ? ? ? ? 2.043 ? 
covale1 covale ? ? A THR 49 C  ? ? ? 1_555 A NH2 50 N  ? ? A THR 49 A NH2 50 1_555 ? ? ? ? ? ? ? 1.336 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 18 ? ILE A 19 ? THR A 18 ILE A 19 
A 2 TYR A 31 ? CYS A 32 ? TYR A 31 CYS A 32 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   THR 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    18 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    THR 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     18 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   CYS 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    32 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    CYS 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     32 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
RGD Unknown  ? ? ? ? 3 ?                                   
AC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE NH2 A 50' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 RGD 3 ARG A 24 ? ARG A 24 . ? 1_555 ? 
2 RGD 3 GLY A 25 ? GLY A 25 . ? 1_555 ? 
3 RGD 3 ASP A 26 ? ASP A 26 . ? 1_555 ? 
4 AC1 1 THR A 49 ? THR A 49 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2ECH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ECH 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . GLU A 1 1  ? 13.647  10.348  7.196   1.00 0.00 ? 1  GLU A N    1 
ATOM   2    C CA   . GLU A 1 1  ? 13.574  10.057  5.749   1.00 0.00 ? 1  GLU A CA   1 
ATOM   3    C C    . GLU A 1 1  ? 12.239  10.526  5.145   1.00 0.00 ? 1  GLU A C    1 
ATOM   4    O O    . GLU A 1 1  ? 11.212  10.543  5.825   1.00 0.00 ? 1  GLU A O    1 
ATOM   5    C CB   . GLU A 1 1  ? 13.822  8.558   5.487   1.00 0.00 ? 1  GLU A CB   1 
ATOM   6    C CG   . GLU A 1 1  ? 13.929  8.214   3.991   1.00 0.00 ? 1  GLU A CG   1 
ATOM   7    C CD   . GLU A 1 1  ? 14.332  6.755   3.772   1.00 0.00 ? 1  GLU A CD   1 
ATOM   8    O OE1  . GLU A 1 1  ? 13.410  5.913   3.684   1.00 0.00 ? 1  GLU A OE1  1 
ATOM   9    O OE2  . GLU A 1 1  ? 15.555  6.504   3.700   1.00 0.00 ? 1  GLU A OE2  1 
ATOM   10   H H1   . GLU A 1 1  ? 12.908  9.853   7.675   1.00 0.00 ? 1  GLU A H1   1 
ATOM   11   H H2   . GLU A 1 1  ? 13.541  11.341  7.349   1.00 0.00 ? 1  GLU A H2   1 
ATOM   12   H H3   . GLU A 1 1  ? 14.541  10.046  7.556   1.00 0.00 ? 1  GLU A H3   1 
ATOM   13   H HA   . GLU A 1 1  ? 14.388  10.622  5.290   1.00 0.00 ? 1  GLU A HA   1 
ATOM   14   H HB2  . GLU A 1 1  ? 14.759  8.274   5.970   1.00 0.00 ? 1  GLU A HB2  1 
ATOM   15   H HB3  . GLU A 1 1  ? 13.016  7.971   5.933   1.00 0.00 ? 1  GLU A HB3  1 
ATOM   16   H HG2  . GLU A 1 1  ? 12.968  8.380   3.502   1.00 0.00 ? 1  GLU A HG2  1 
ATOM   17   H HG3  . GLU A 1 1  ? 14.667  8.867   3.521   1.00 0.00 ? 1  GLU A HG3  1 
ATOM   18   N N    . CYS A 1 2  ? 12.266  10.878  3.851   1.00 0.00 ? 2  CYS A N    1 
ATOM   19   C CA   . CYS A 1 2  ? 11.100  11.155  3.017   1.00 0.00 ? 2  CYS A CA   1 
ATOM   20   C C    . CYS A 1 2  ? 11.059  10.103  1.910   1.00 0.00 ? 2  CYS A C    1 
ATOM   21   O O    . CYS A 1 2  ? 11.684  10.253  0.860   1.00 0.00 ? 2  CYS A O    1 
ATOM   22   C CB   . CYS A 1 2  ? 11.181  12.570  2.449   1.00 0.00 ? 2  CYS A CB   1 
ATOM   23   S SG   . CYS A 1 2  ? 9.867   13.081  1.307   1.00 0.00 ? 2  CYS A SG   1 
ATOM   24   H H    . CYS A 1 2  ? 13.155  10.836  3.373   1.00 0.00 ? 2  CYS A H    1 
ATOM   25   H HA   . CYS A 1 2  ? 10.183  11.109  3.601   1.00 0.00 ? 2  CYS A HA   1 
ATOM   26   H HB2  . CYS A 1 2  ? 11.225  13.267  3.282   1.00 0.00 ? 2  CYS A HB2  1 
ATOM   27   H HB3  . CYS A 1 2  ? 12.101  12.616  1.888   1.00 0.00 ? 2  CYS A HB3  1 
ATOM   28   N N    . GLU A 1 3  ? 10.305  9.034   2.173   1.00 0.00 ? 3  GLU A N    1 
ATOM   29   C CA   . GLU A 1 3  ? 10.077  7.930   1.246   1.00 0.00 ? 3  GLU A CA   1 
ATOM   30   C C    . GLU A 1 3  ? 8.912   8.316   0.335   1.00 0.00 ? 3  GLU A C    1 
ATOM   31   O O    . GLU A 1 3  ? 7.761   7.942   0.556   1.00 0.00 ? 3  GLU A O    1 
ATOM   32   C CB   . GLU A 1 3  ? 9.869   6.628   2.017   1.00 0.00 ? 3  GLU A CB   1 
ATOM   33   C CG   . GLU A 1 3  ? 9.918   5.383   1.112   1.00 0.00 ? 3  GLU A CG   1 
ATOM   34   C CD   . GLU A 1 3  ? 9.830   4.059   1.882   1.00 0.00 ? 3  GLU A CD   1 
ATOM   35   O OE1  . GLU A 1 3  ? 10.096  4.068   3.104   1.00 0.00 ? 3  GLU A OE1  1 
ATOM   36   O OE2  . GLU A 1 3  ? 9.505   3.043   1.229   1.00 0.00 ? 3  GLU A OE2  1 
ATOM   37   H H    . GLU A 1 3  ? 9.824   9.051   3.058   1.00 0.00 ? 3  GLU A H    1 
ATOM   38   H HA   . GLU A 1 3  ? 10.974  7.773   0.646   1.00 0.00 ? 3  GLU A HA   1 
ATOM   39   H HB2  . GLU A 1 3  ? 10.680  6.564   2.741   1.00 0.00 ? 3  GLU A HB2  1 
ATOM   40   H HB3  . GLU A 1 3  ? 8.920   6.690   2.539   1.00 0.00 ? 3  GLU A HB3  1 
ATOM   41   H HG2  . GLU A 1 3  ? 9.104   5.433   0.388   1.00 0.00 ? 3  GLU A HG2  1 
ATOM   42   H HG3  . GLU A 1 3  ? 10.860  5.381   0.560   1.00 0.00 ? 3  GLU A HG3  1 
ATOM   43   N N    . SER A 1 4  ? 9.250   9.134   -0.664  1.00 0.00 ? 4  SER A N    1 
ATOM   44   C CA   . SER A 1 4  ? 8.321   9.844   -1.534  1.00 0.00 ? 4  SER A CA   1 
ATOM   45   C C    . SER A 1 4  ? 7.746   8.899   -2.595  1.00 0.00 ? 4  SER A C    1 
ATOM   46   O O    . SER A 1 4  ? 8.242   8.812   -3.718  1.00 0.00 ? 4  SER A O    1 
ATOM   47   C CB   . SER A 1 4  ? 9.010   11.074  -2.142  1.00 0.00 ? 4  SER A CB   1 
ATOM   48   O OG   . SER A 1 4  ? 8.075   11.868  -2.844  1.00 0.00 ? 4  SER A OG   1 
ATOM   49   H H    . SER A 1 4  ? 10.233  9.353   -0.707  1.00 0.00 ? 4  SER A H    1 
ATOM   50   H HA   . SER A 1 4  ? 7.501   10.212  -0.909  1.00 0.00 ? 4  SER A HA   1 
ATOM   51   H HB2  . SER A 1 4  ? 9.441   11.686  -1.349  1.00 0.00 ? 4  SER A HB2  1 
ATOM   52   H HB3  . SER A 1 4  ? 9.810   10.773  -2.820  1.00 0.00 ? 4  SER A HB3  1 
ATOM   53   H HG   . SER A 1 4  ? 7.400   12.162  -2.227  1.00 0.00 ? 4  SER A HG   1 
ATOM   54   N N    . GLY A 1 5  ? 6.671   8.212   -2.204  1.00 0.00 ? 5  GLY A N    1 
ATOM   55   C CA   . GLY A 1 5  ? 5.845   7.339   -3.015  1.00 0.00 ? 5  GLY A CA   1 
ATOM   56   C C    . GLY A 1 5  ? 4.410   7.565   -2.542  1.00 0.00 ? 5  GLY A C    1 
ATOM   57   O O    . GLY A 1 5  ? 4.031   6.831   -1.640  1.00 0.00 ? 5  GLY A O    1 
ATOM   58   H H    . GLY A 1 5  ? 6.363   8.363   -1.255  1.00 0.00 ? 5  GLY A H    1 
ATOM   59   H HA2  . GLY A 1 5  ? 5.963   7.494   -4.081  1.00 0.00 ? 5  GLY A HA2  1 
ATOM   60   H HA3  . GLY A 1 5  ? 6.143   6.310   -2.806  1.00 0.00 ? 5  GLY A HA3  1 
ATOM   61   N N    . PRO A 1 6  ? 3.659   8.568   -3.072  1.00 0.00 ? 6  PRO A N    1 
ATOM   62   C CA   . PRO A 1 6  ? 2.438   9.188   -2.504  1.00 0.00 ? 6  PRO A CA   1 
ATOM   63   C C    . PRO A 1 6  ? 1.221   8.296   -2.175  1.00 0.00 ? 6  PRO A C    1 
ATOM   64   O O    . PRO A 1 6  ? 0.141   8.797   -1.869  1.00 0.00 ? 6  PRO A O    1 
ATOM   65   C CB   . PRO A 1 6  ? 2.054   10.325  -3.460  1.00 0.00 ? 6  PRO A CB   1 
ATOM   66   C CG   . PRO A 1 6  ? 3.397   10.735  -4.052  1.00 0.00 ? 6  PRO A CG   1 
ATOM   67   C CD   . PRO A 1 6  ? 4.120   9.395   -4.175  1.00 0.00 ? 6  PRO A CD   1 
ATOM   68   H HA   . PRO A 1 6  ? 2.750   9.652   -1.566  1.00 0.00 ? 6  PRO A HA   1 
ATOM   69   H HB2  . PRO A 1 6  ? 1.416   9.946   -4.261  1.00 0.00 ? 6  PRO A HB2  1 
ATOM   70   H HB3  . PRO A 1 6  ? 1.557   11.152  -2.950  1.00 0.00 ? 6  PRO A HB3  1 
ATOM   71   H HG2  . PRO A 1 6  ? 3.293   11.243  -5.012  1.00 0.00 ? 6  PRO A HG2  1 
ATOM   72   H HG3  . PRO A 1 6  ? 3.926   11.378  -3.344  1.00 0.00 ? 6  PRO A HG3  1 
ATOM   73   H HD2  . PRO A 1 6  ? 3.862   8.904   -5.114  1.00 0.00 ? 6  PRO A HD2  1 
ATOM   74   H HD3  . PRO A 1 6  ? 5.189   9.562   -4.132  1.00 0.00 ? 6  PRO A HD3  1 
ATOM   75   N N    . CYS A 1 7  ? 1.436   6.982   -2.139  1.00 0.00 ? 7  CYS A N    1 
ATOM   76   C CA   . CYS A 1 7  ? 0.991   6.066   -1.079  1.00 0.00 ? 7  CYS A CA   1 
ATOM   77   C C    . CYS A 1 7  ? 1.539   6.442   0.320   1.00 0.00 ? 7  CYS A C    1 
ATOM   78   O O    . CYS A 1 7  ? 1.131   5.878   1.326   1.00 0.00 ? 7  CYS A O    1 
ATOM   79   C CB   . CYS A 1 7  ? 1.459   4.681   -1.544  1.00 0.00 ? 7  CYS A CB   1 
ATOM   80   S SG   . CYS A 1 7  ? 0.994   3.235   -0.580  1.00 0.00 ? 7  CYS A SG   1 
ATOM   81   H H    . CYS A 1 7  ? 2.300   6.703   -2.587  1.00 0.00 ? 7  CYS A H    1 
ATOM   82   H HA   . CYS A 1 7  ? -0.097  6.077   -0.964  1.00 0.00 ? 7  CYS A HA   1 
ATOM   83   H HB2  . CYS A 1 7  ? 1.074   4.529   -2.545  1.00 0.00 ? 7  CYS A HB2  1 
ATOM   84   H HB3  . CYS A 1 7  ? 2.547   4.670   -1.630  1.00 0.00 ? 7  CYS A HB3  1 
ATOM   85   N N    . CYS A 1 8  ? 2.424   7.435   0.395   1.00 0.00 ? 8  CYS A N    1 
ATOM   86   C CA   . CYS A 1 8  ? 2.699   8.294   1.537   1.00 0.00 ? 8  CYS A CA   1 
ATOM   87   C C    . CYS A 1 8  ? 1.779   9.531   1.432   1.00 0.00 ? 8  CYS A C    1 
ATOM   88   O O    . CYS A 1 8  ? 0.806   9.544   0.678   1.00 0.00 ? 8  CYS A O    1 
ATOM   89   C CB   . CYS A 1 8  ? 4.211   8.637   1.510   1.00 0.00 ? 8  CYS A CB   1 
ATOM   90   S SG   . CYS A 1 8  ? 5.256   7.633   2.595   1.00 0.00 ? 8  CYS A SG   1 
ATOM   91   H H    . CYS A 1 8  ? 2.784   7.747   -0.492  1.00 0.00 ? 8  CYS A H    1 
ATOM   92   H HA   . CYS A 1 8  ? 2.462   7.781   2.474   1.00 0.00 ? 8  CYS A HA   1 
ATOM   93   H HB2  . CYS A 1 8  ? 4.608   8.559   0.496   1.00 0.00 ? 8  CYS A HB2  1 
ATOM   94   H HB3  . CYS A 1 8  ? 4.396   9.665   1.816   1.00 0.00 ? 8  CYS A HB3  1 
ATOM   95   N N    . ARG A 1 9  ? 2.088   10.593  2.180   1.00 0.00 ? 9  ARG A N    1 
ATOM   96   C CA   . ARG A 1 9  ? 1.575   11.935  1.944   1.00 0.00 ? 9  ARG A CA   1 
ATOM   97   C C    . ARG A 1 9  ? 2.378   12.502  0.774   1.00 0.00 ? 9  ARG A C    1 
ATOM   98   O O    . ARG A 1 9  ? 1.990   12.399  -0.389  1.00 0.00 ? 9  ARG A O    1 
ATOM   99   C CB   . ARG A 1 9  ? 1.681   12.781  3.229   1.00 0.00 ? 9  ARG A CB   1 
ATOM   100  C CG   . ARG A 1 9  ? 0.479   12.595  4.157   1.00 0.00 ? 9  ARG A CG   1 
ATOM   101  C CD   . ARG A 1 9  ? 0.286   11.149  4.626   1.00 0.00 ? 9  ARG A CD   1 
ATOM   102  N NE   . ARG A 1 9  ? -0.814  11.024  5.597   1.00 0.00 ? 9  ARG A NE   1 
ATOM   103  C CZ   . ARG A 1 9  ? -0.704  10.811  6.923   1.00 0.00 ? 9  ARG A CZ   1 
ATOM   104  N NH1  . ARG A 1 9  ? 0.488   10.744  7.538   1.00 0.00 ? 9  ARG A NH1  1 
ATOM   105  N NH2  . ARG A 1 9  ? -1.819  10.663  7.652   1.00 0.00 ? 9  ARG A NH2  1 
ATOM   106  H H    . ARG A 1 9  ? 2.833   10.494  2.853   1.00 0.00 ? 9  ARG A H    1 
ATOM   107  H HA   . ARG A 1 9  ? 0.532   11.924  1.670   1.00 0.00 ? 9  ARG A HA   1 
ATOM   108  H HB2  . ARG A 1 9  ? 2.603   12.558  3.769   1.00 0.00 ? 9  ARG A HB2  1 
ATOM   109  H HB3  . ARG A 1 9  ? 1.697   13.840  2.960   1.00 0.00 ? 9  ARG A HB3  1 
ATOM   110  H HG2  . ARG A 1 9  ? 0.638   13.240  5.015   1.00 0.00 ? 9  ARG A HG2  1 
ATOM   111  H HG3  . ARG A 1 9  ? -0.410  12.934  3.629   1.00 0.00 ? 9  ARG A HG3  1 
ATOM   112  H HD2  . ARG A 1 9  ? 0.043   10.536  3.761   1.00 0.00 ? 9  ARG A HD2  1 
ATOM   113  H HD3  . ARG A 1 9  ? 1.213   10.776  5.048   1.00 0.00 ? 9  ARG A HD3  1 
ATOM   114  H HE   . ARG A 1 9  ? -1.745  11.077  5.209   1.00 0.00 ? 9  ARG A HE   1 
ATOM   115  H HH11 . ARG A 1 9  ? 1.344   10.862  7.017   1.00 0.00 ? 9  ARG A HH11 1 
ATOM   116  H HH12 . ARG A 1 9  ? 0.530   10.582  8.534   1.00 0.00 ? 9  ARG A HH12 1 
ATOM   117  H HH21 . ARG A 1 9  ? -2.724  10.716  7.207   1.00 0.00 ? 9  ARG A HH21 1 
ATOM   118  H HH22 . ARG A 1 9  ? -1.756  10.503  8.647   1.00 0.00 ? 9  ARG A HH22 1 
ATOM   119  N N    . ASN A 1 10 ? 3.535   13.042  1.140   1.00 0.00 ? 10 ASN A N    1 
ATOM   120  C CA   . ASN A 1 10 ? 4.664   13.443  0.311   1.00 0.00 ? 10 ASN A CA   1 
ATOM   121  C C    . ASN A 1 10 ? 5.938   12.696  0.753   1.00 0.00 ? 10 ASN A C    1 
ATOM   122  O O    . ASN A 1 10 ? 6.873   12.536  -0.029  1.00 0.00 ? 10 ASN A O    1 
ATOM   123  C CB   . ASN A 1 10 ? 4.848   14.959  0.478   1.00 0.00 ? 10 ASN A CB   1 
ATOM   124  C CG   . ASN A 1 10 ? 5.573   15.612  -0.704  1.00 0.00 ? 10 ASN A CG   1 
ATOM   125  O OD1  . ASN A 1 10 ? 4.957   16.324  -1.495  1.00 0.00 ? 10 ASN A OD1  1 
ATOM   126  N ND2  . ASN A 1 10 ? 6.883   15.378  -0.826  1.00 0.00 ? 10 ASN A ND2  1 
ATOM   127  H H    . ASN A 1 10 ? 3.654   13.112  2.138   1.00 0.00 ? 10 ASN A H    1 
ATOM   128  H HA   . ASN A 1 10 ? 4.441   13.204  -0.728  1.00 0.00 ? 10 ASN A HA   1 
ATOM   129  H HB2  . ASN A 1 10 ? 3.865   15.412  0.597   1.00 0.00 ? 10 ASN A HB2  1 
ATOM   130  H HB3  . ASN A 1 10 ? 5.395   15.175  1.399   1.00 0.00 ? 10 ASN A HB3  1 
ATOM   131  H HD21 . ASN A 1 10 ? 7.350   14.772  -0.166  1.00 0.00 ? 10 ASN A HD21 1 
ATOM   132  H HD22 . ASN A 1 10 ? 7.400   15.794  -1.587  1.00 0.00 ? 10 ASN A HD22 1 
ATOM   133  N N    . CYS A 1 11 ? 5.966   12.295  2.032   1.00 0.00 ? 11 CYS A N    1 
ATOM   134  C CA   . CYS A 1 11 ? 7.096   11.810  2.815   1.00 0.00 ? 11 CYS A CA   1 
ATOM   135  C C    . CYS A 1 11 ? 6.621   10.826  3.899   1.00 0.00 ? 11 CYS A C    1 
ATOM   136  O O    . CYS A 1 11 ? 7.416   10.003  4.353   1.00 0.00 ? 11 CYS A O    1 
ATOM   137  C CB   . CYS A 1 11 ? 7.778   13.005  3.508   1.00 0.00 ? 11 CYS A CB   1 
ATOM   138  S SG   . CYS A 1 11 ? 8.603   14.210  2.437   1.00 0.00 ? 11 CYS A SG   1 
ATOM   139  H H    . CYS A 1 11 ? 5.103   12.409  2.546   1.00 0.00 ? 11 CYS A H    1 
ATOM   140  H HA   . CYS A 1 11 ? 7.830   11.317  2.174   1.00 0.00 ? 11 CYS A HA   1 
ATOM   141  H HB2  . CYS A 1 11 ? 7.042   13.548  4.102   1.00 0.00 ? 11 CYS A HB2  1 
ATOM   142  H HB3  . CYS A 1 11 ? 8.537   12.630  4.195   1.00 0.00 ? 11 CYS A HB3  1 
ATOM   143  N N    . LYS A 1 12 ? 5.362   10.956  4.360   1.00 0.00 ? 12 LYS A N    1 
ATOM   144  C CA   . LYS A 1 12 ? 4.863   10.410  5.614   1.00 0.00 ? 12 LYS A CA   1 
ATOM   145  C C    . LYS A 1 12 ? 3.913   9.256   5.302   1.00 0.00 ? 12 LYS A C    1 
ATOM   146  O O    . LYS A 1 12 ? 3.074   9.354   4.414   1.00 0.00 ? 12 LYS A O    1 
ATOM   147  C CB   . LYS A 1 12 ? 4.151   11.504  6.433   1.00 0.00 ? 12 LYS A CB   1 
ATOM   148  C CG   . LYS A 1 12 ? 4.965   12.797  6.619   1.00 0.00 ? 12 LYS A CG   1 
ATOM   149  C CD   . LYS A 1 12 ? 6.338   12.563  7.269   1.00 0.00 ? 12 LYS A CD   1 
ATOM   150  C CE   . LYS A 1 12 ? 7.068   13.894  7.492   1.00 0.00 ? 12 LYS A CE   1 
ATOM   151  N NZ   . LYS A 1 12 ? 8.410   13.687  8.064   1.00 0.00 ? 12 LYS A NZ   1 
ATOM   152  H H    . LYS A 1 12 ? 4.696   11.506  3.833   1.00 0.00 ? 12 LYS A H    1 
ATOM   153  H HA   . LYS A 1 12 ? 5.697   10.039  6.215   1.00 0.00 ? 12 LYS A HA   1 
ATOM   154  H HB2  . LYS A 1 12 ? 3.215   11.776  5.943   1.00 0.00 ? 12 LYS A HB2  1 
ATOM   155  H HB3  . LYS A 1 12 ? 3.905   11.100  7.417   1.00 0.00 ? 12 LYS A HB3  1 
ATOM   156  H HG2  . LYS A 1 12 ? 5.101   13.283  5.652   1.00 0.00 ? 12 LYS A HG2  1 
ATOM   157  H HG3  . LYS A 1 12 ? 4.387   13.473  7.253   1.00 0.00 ? 12 LYS A HG3  1 
ATOM   158  H HD2  . LYS A 1 12 ? 6.202   12.056  8.226   1.00 0.00 ? 12 LYS A HD2  1 
ATOM   159  H HD3  . LYS A 1 12 ? 6.950   11.935  6.621   1.00 0.00 ? 12 LYS A HD3  1 
ATOM   160  H HE2  . LYS A 1 12 ? 7.177   14.417  6.541   1.00 0.00 ? 12 LYS A HE2  1 
ATOM   161  H HE3  . LYS A 1 12 ? 6.490   14.520  8.173   1.00 0.00 ? 12 LYS A HE3  1 
ATOM   162  H HZ1  . LYS A 1 12 ? 8.328   13.217  8.954   1.00 0.00 ? 12 LYS A HZ1  1 
ATOM   163  H HZ2  . LYS A 1 12 ? 8.961   13.121  7.434   1.00 0.00 ? 12 LYS A HZ2  1 
ATOM   164  H HZ3  . LYS A 1 12 ? 8.862   14.581  8.195   1.00 0.00 ? 12 LYS A HZ3  1 
ATOM   165  N N    . PHE A 1 13 ? 4.058   8.148   6.025   1.00 0.00 ? 13 PHE A N    1 
ATOM   166  C CA   . PHE A 1 13 ? 3.354   6.897   5.763   1.00 0.00 ? 13 PHE A CA   1 
ATOM   167  C C    . PHE A 1 13 ? 1.841   7.054   5.973   1.00 0.00 ? 13 PHE A C    1 
ATOM   168  O O    . PHE A 1 13 ? 1.420   7.632   6.976   1.00 0.00 ? 13 PHE A O    1 
ATOM   169  C CB   . PHE A 1 13 ? 3.947   5.790   6.645   1.00 0.00 ? 13 PHE A CB   1 
ATOM   170  C CG   . PHE A 1 13 ? 5.453   5.638   6.497   1.00 0.00 ? 13 PHE A CG   1 
ATOM   171  C CD1  . PHE A 1 13 ? 5.972   5.064   5.319   1.00 0.00 ? 13 PHE A CD1  1 
ATOM   172  C CD2  . PHE A 1 13 ? 6.330   6.254   7.419   1.00 0.00 ? 13 PHE A CD2  1 
ATOM   173  C CE1  . PHE A 1 13 ? 7.342   5.191   5.013   1.00 0.00 ? 13 PHE A CE1  1 
ATOM   174  C CE2  . PHE A 1 13 ? 7.716   6.291   7.159   1.00 0.00 ? 13 PHE A CE2  1 
ATOM   175  C CZ   . PHE A 1 13 ? 8.220   5.774   5.948   1.00 0.00 ? 13 PHE A CZ   1 
ATOM   176  H H    . PHE A 1 13 ? 4.772   8.159   6.736   1.00 0.00 ? 13 PHE A H    1 
ATOM   177  H HA   . PHE A 1 13 ? 3.545   6.619   4.726   1.00 0.00 ? 13 PHE A HA   1 
ATOM   178  H HB2  . PHE A 1 13 ? 3.706   5.996   7.689   1.00 0.00 ? 13 PHE A HB2  1 
ATOM   179  H HB3  . PHE A 1 13 ? 3.481   4.845   6.365   1.00 0.00 ? 13 PHE A HB3  1 
ATOM   180  H HD1  . PHE A 1 13 ? 5.307   4.563   4.636   1.00 0.00 ? 13 PHE A HD1  1 
ATOM   181  H HD2  . PHE A 1 13 ? 5.942   6.716   8.315   1.00 0.00 ? 13 PHE A HD2  1 
ATOM   182  H HE1  . PHE A 1 13 ? 7.719   4.828   4.070   1.00 0.00 ? 13 PHE A HE1  1 
ATOM   183  H HE2  . PHE A 1 13 ? 8.388   6.736   7.879   1.00 0.00 ? 13 PHE A HE2  1 
ATOM   184  H HZ   . PHE A 1 13 ? 9.279   5.814   5.741   1.00 0.00 ? 13 PHE A HZ   1 
ATOM   185  N N    . LEU A 1 14 ? 1.024   6.534   5.038   1.00 0.00 ? 14 LEU A N    1 
ATOM   186  C CA   . LEU A 1 14 ? -0.430  6.514   5.159   1.00 0.00 ? 14 LEU A CA   1 
ATOM   187  C C    . LEU A 1 14 ? -0.874  5.573   6.283   1.00 0.00 ? 14 LEU A C    1 
ATOM   188  O O    . LEU A 1 14 ? -0.079  4.924   6.965   1.00 0.00 ? 14 LEU A O    1 
ATOM   189  C CB   . LEU A 1 14 ? -1.111  6.142   3.816   1.00 0.00 ? 14 LEU A CB   1 
ATOM   190  C CG   . LEU A 1 14 ? -1.054  7.229   2.744   1.00 0.00 ? 14 LEU A CG   1 
ATOM   191  C CD1  . LEU A 1 14 ? -1.563  6.763   1.369   1.00 0.00 ? 14 LEU A CD1  1 
ATOM   192  C CD2  . LEU A 1 14 ? -1.920  8.438   3.130   1.00 0.00 ? 14 LEU A CD2  1 
ATOM   193  H H    . LEU A 1 14 ? 1.411   6.063   4.235   1.00 0.00 ? 14 LEU A H    1 
ATOM   194  H HA   . LEU A 1 14 ? -0.752  7.511   5.457   1.00 0.00 ? 14 LEU A HA   1 
ATOM   195  H HB2  . LEU A 1 14 ? -0.672  5.215   3.465   1.00 0.00 ? 14 LEU A HB2  1 
ATOM   196  H HB3  . LEU A 1 14 ? -2.170  5.971   3.918   1.00 0.00 ? 14 LEU A HB3  1 
ATOM   197  H HG   . LEU A 1 14 ? -0.004  7.476   2.679   1.00 0.00 ? 14 LEU A HG   1 
ATOM   198  H HD11 . LEU A 1 14 ? -1.135  7.403   0.597   1.00 0.00 ? 14 LEU A HD11 1 
ATOM   199  H HD12 . LEU A 1 14 ? -1.303  5.722   1.173   1.00 0.00 ? 14 LEU A HD12 1 
ATOM   200  H HD13 . LEU A 1 14 ? -2.642  6.861   1.293   1.00 0.00 ? 14 LEU A HD13 1 
ATOM   201  H HD21 . LEU A 1 14 ? -2.964  8.144   3.245   1.00 0.00 ? 14 LEU A HD21 1 
ATOM   202  H HD22 . LEU A 1 14 ? -1.585  8.886   4.060   1.00 0.00 ? 14 LEU A HD22 1 
ATOM   203  H HD23 . LEU A 1 14 ? -1.854  9.198   2.350   1.00 0.00 ? 14 LEU A HD23 1 
ATOM   204  N N    . LYS A 1 15 ? -2.191  5.565   6.467   1.00 0.00 ? 15 LYS A N    1 
ATOM   205  C CA   . LYS A 1 15 ? -2.911  4.964   7.578   1.00 0.00 ? 15 LYS A CA   1 
ATOM   206  C C    . LYS A 1 15 ? -2.959  3.441   7.408   1.00 0.00 ? 15 LYS A C    1 
ATOM   207  O O    . LYS A 1 15 ? -3.966  2.906   6.945   1.00 0.00 ? 15 LYS A O    1 
ATOM   208  C CB   . LYS A 1 15 ? -4.303  5.618   7.668   1.00 0.00 ? 15 LYS A CB   1 
ATOM   209  C CG   . LYS A 1 15 ? -4.196  7.072   8.165   1.00 0.00 ? 15 LYS A CG   1 
ATOM   210  C CD   . LYS A 1 15 ? -5.469  7.885   7.871   1.00 0.00 ? 15 LYS A CD   1 
ATOM   211  C CE   . LYS A 1 15 ? -5.326  8.810   6.651   1.00 0.00 ? 15 LYS A CE   1 
ATOM   212  N NZ   . LYS A 1 15 ? -4.997  8.077   5.416   1.00 0.00 ? 15 LYS A NZ   1 
ATOM   213  H H    . LYS A 1 15 ? -2.707  6.101   5.787   1.00 0.00 ? 15 LYS A H    1 
ATOM   214  H HA   . LYS A 1 15 ? -2.385  5.197   8.505   1.00 0.00 ? 15 LYS A HA   1 
ATOM   215  H HB2  . LYS A 1 15 ? -4.784  5.587   6.689   1.00 0.00 ? 15 LYS A HB2  1 
ATOM   216  H HB3  . LYS A 1 15 ? -4.930  5.064   8.371   1.00 0.00 ? 15 LYS A HB3  1 
ATOM   217  H HG2  . LYS A 1 15 ? -4.031  7.043   9.244   1.00 0.00 ? 15 LYS A HG2  1 
ATOM   218  H HG3  . LYS A 1 15 ? -3.339  7.577   7.718   1.00 0.00 ? 15 LYS A HG3  1 
ATOM   219  H HD2  . LYS A 1 15 ? -6.324  7.220   7.738   1.00 0.00 ? 15 LYS A HD2  1 
ATOM   220  H HD3  . LYS A 1 15 ? -5.678  8.521   8.733   1.00 0.00 ? 15 LYS A HD3  1 
ATOM   221  H HE2  . LYS A 1 15 ? -6.264  9.345   6.498   1.00 0.00 ? 15 LYS A HE2  1 
ATOM   222  H HE3  . LYS A 1 15 ? -4.541  9.542   6.841   1.00 0.00 ? 15 LYS A HE3  1 
ATOM   223  H HZ1  . LYS A 1 15 ? -5.726  7.409   5.213   1.00 0.00 ? 15 LYS A HZ1  1 
ATOM   224  H HZ2  . LYS A 1 15 ? -4.917  8.732   4.651   1.00 0.00 ? 15 LYS A HZ2  1 
ATOM   225  H HZ3  . LYS A 1 15 ? -4.118  7.593   5.534   1.00 0.00 ? 15 LYS A HZ3  1 
ATOM   226  N N    . GLU A 1 16 ? -1.847  2.781   7.790   1.00 0.00 ? 16 GLU A N    1 
ATOM   227  C CA   . GLU A 1 16 ? -1.547  1.346   7.784   1.00 0.00 ? 16 GLU A CA   1 
ATOM   228  C C    . GLU A 1 16 ? -2.696  0.482   7.251   1.00 0.00 ? 16 GLU A C    1 
ATOM   229  O O    . GLU A 1 16 ? -3.595  0.108   8.004   1.00 0.00 ? 16 GLU A O    1 
ATOM   230  C CB   . GLU A 1 16 ? -1.078  0.930   9.192   1.00 0.00 ? 16 GLU A CB   1 
ATOM   231  C CG   . GLU A 1 16 ? -0.660  -0.548  9.276   1.00 0.00 ? 16 GLU A CG   1 
ATOM   232  C CD   . GLU A 1 16 ? 0.010   -0.875  10.614  1.00 0.00 ? 16 GLU A CD   1 
ATOM   233  O OE1  . GLU A 1 16 ? -0.663  -0.685  11.651  1.00 0.00 ? 16 GLU A OE1  1 
ATOM   234  O OE2  . GLU A 1 16 ? 1.182   -1.311  10.582  1.00 0.00 ? 16 GLU A OE2  1 
ATOM   235  H H    . GLU A 1 16 ? -1.092  3.364   8.124   1.00 0.00 ? 16 GLU A H    1 
ATOM   236  H HA   . GLU A 1 16 ? -0.697  1.226   7.112   1.00 0.00 ? 16 GLU A HA   1 
ATOM   237  H HB2  . GLU A 1 16 ? -0.219  1.548   9.463   1.00 0.00 ? 16 GLU A HB2  1 
ATOM   238  H HB3  . GLU A 1 16 ? -1.875  1.119   9.915   1.00 0.00 ? 16 GLU A HB3  1 
ATOM   239  H HG2  . GLU A 1 16 ? -1.536  -1.188  9.167   1.00 0.00 ? 16 GLU A HG2  1 
ATOM   240  H HG3  . GLU A 1 16 ? 0.025   -0.774  8.457   1.00 0.00 ? 16 GLU A HG3  1 
ATOM   241  N N    . GLY A 1 17 ? -2.677  0.227   5.935   1.00 0.00 ? 17 GLY A N    1 
ATOM   242  C CA   . GLY A 1 17 ? -3.796  -0.310  5.178   1.00 0.00 ? 17 GLY A CA   1 
ATOM   243  C C    . GLY A 1 17 ? -4.409  0.779   4.286   1.00 0.00 ? 17 GLY A C    1 
ATOM   244  O O    . GLY A 1 17 ? -5.630  0.935   4.285   1.00 0.00 ? 17 GLY A O    1 
ATOM   245  H H    . GLY A 1 17 ? -1.880  0.535   5.392   1.00 0.00 ? 17 GLY A H    1 
ATOM   246  H HA2  . GLY A 1 17 ? -3.441  -1.141  4.573   1.00 0.00 ? 17 GLY A HA2  1 
ATOM   247  H HA3  . GLY A 1 17 ? -4.562  -0.719  5.837   1.00 0.00 ? 17 GLY A HA3  1 
ATOM   248  N N    . THR A 1 18 ? -3.577  1.513   3.519   1.00 0.00 ? 18 THR A N    1 
ATOM   249  C CA   . THR A 1 18 ? -4.008  2.518   2.544   1.00 0.00 ? 18 THR A CA   1 
ATOM   250  C C    . THR A 1 18 ? -3.412  2.259   1.150   1.00 0.00 ? 18 THR A C    1 
ATOM   251  O O    . THR A 1 18 ? -2.227  2.500   0.929   1.00 0.00 ? 18 THR A O    1 
ATOM   252  C CB   . THR A 1 18 ? -3.674  3.927   3.019   1.00 0.00 ? 18 THR A CB   1 
ATOM   253  O OG1  . THR A 1 18 ? -4.163  4.164   4.326   1.00 0.00 ? 18 THR A OG1  1 
ATOM   254  C CG2  . THR A 1 18 ? -4.325  4.924   2.056   1.00 0.00 ? 18 THR A CG2  1 
ATOM   255  H H    . THR A 1 18 ? -2.582  1.377   3.626   1.00 0.00 ? 18 THR A H    1 
ATOM   256  H HA   . THR A 1 18 ? -5.087  2.529   2.478   1.00 0.00 ? 18 THR A HA   1 
ATOM   257  H HB   . THR A 1 18 ? -2.595  4.042   2.998   1.00 0.00 ? 18 THR A HB   1 
ATOM   258  H HG1  . THR A 1 18 ? -3.754  3.540   4.932   1.00 0.00 ? 18 THR A HG1  1 
ATOM   259  H HG21 . THR A 1 18 ? -3.861  4.882   1.070   1.00 0.00 ? 18 THR A HG21 1 
ATOM   260  H HG22 . THR A 1 18 ? -4.229  5.931   2.459   1.00 0.00 ? 18 THR A HG22 1 
ATOM   261  H HG23 . THR A 1 18 ? -5.391  4.716   1.951   1.00 0.00 ? 18 THR A HG23 1 
ATOM   262  N N    . ILE A 1 19 ? -4.258  1.822   0.207   1.00 0.00 ? 19 ILE A N    1 
ATOM   263  C CA   . ILE A 1 19 ? -3.906  1.354   -1.138  1.00 0.00 ? 19 ILE A CA   1 
ATOM   264  C C    . ILE A 1 19 ? -3.120  2.404   -1.946  1.00 0.00 ? 19 ILE A C    1 
ATOM   265  O O    . ILE A 1 19 ? -3.546  3.548   -2.093  1.00 0.00 ? 19 ILE A O    1 
ATOM   266  C CB   . ILE A 1 19 ? -5.158  0.885   -1.908  1.00 0.00 ? 19 ILE A CB   1 
ATOM   267  C CG1  . ILE A 1 19 ? -5.913  -0.232  -1.166  1.00 0.00 ? 19 ILE A CG1  1 
ATOM   268  C CG2  . ILE A 1 19 ? -4.846  0.532   -3.376  1.00 0.00 ? 19 ILE A CG2  1 
ATOM   269  C CD1  . ILE A 1 19 ? -7.325  -0.506  -1.700  1.00 0.00 ? 19 ILE A CD1  1 
ATOM   270  H H    . ILE A 1 19 ? -5.226  1.752   0.481   1.00 0.00 ? 19 ILE A H    1 
ATOM   271  H HA   . ILE A 1 19 ? -3.309  0.454   -1.023  1.00 0.00 ? 19 ILE A HA   1 
ATOM   272  H HB   . ILE A 1 19 ? -5.822  1.718   -1.931  1.00 0.00 ? 19 ILE A HB   1 
ATOM   273  H HG12 . ILE A 1 19 ? -5.310  -1.137  -1.172  1.00 0.00 ? 19 ILE A HG12 1 
ATOM   274  H HG13 . ILE A 1 19 ? -6.061  0.078   -0.134  1.00 0.00 ? 19 ILE A HG13 1 
ATOM   275  H HG21 . ILE A 1 19 ? -4.564  1.428   -3.928  1.00 0.00 ? 19 ILE A HG21 1 
ATOM   276  H HG22 . ILE A 1 19 ? -4.022  -0.177  -3.411  1.00 0.00 ? 19 ILE A HG22 1 
ATOM   277  H HG23 . ILE A 1 19 ? -5.711  0.109   -3.877  1.00 0.00 ? 19 ILE A HG23 1 
ATOM   278  H HD11 . ILE A 1 19 ? -7.930  0.398   -1.630  1.00 0.00 ? 19 ILE A HD11 1 
ATOM   279  H HD12 . ILE A 1 19 ? -7.307  -0.837  -2.733  1.00 0.00 ? 19 ILE A HD12 1 
ATOM   280  H HD13 . ILE A 1 19 ? -7.795  -1.287  -1.100  1.00 0.00 ? 19 ILE A HD13 1 
ATOM   281  N N    . CYS A 1 20 ? -2.003  1.945   -2.521  1.00 0.00 ? 20 CYS A N    1 
ATOM   282  C CA   . CYS A 1 20 ? -1.241  2.568   -3.604  1.00 0.00 ? 20 CYS A CA   1 
ATOM   283  C C    . CYS A 1 20 ? -2.017  2.451   -4.924  1.00 0.00 ? 20 CYS A C    1 
ATOM   284  O O    . CYS A 1 20 ? -2.476  3.448   -5.480  1.00 0.00 ? 20 CYS A O    1 
ATOM   285  C CB   . CYS A 1 20 ? 0.136   1.886   -3.744  1.00 0.00 ? 20 CYS A CB   1 
ATOM   286  S SG   . CYS A 1 20 ? 1.178   2.451   -5.114  1.00 0.00 ? 20 CYS A SG   1 
ATOM   287  H H    . CYS A 1 20 ? -1.753  1.007   -2.249  1.00 0.00 ? 20 CYS A H    1 
ATOM   288  H HA   . CYS A 1 20 ? -1.068  3.612   -3.375  1.00 0.00 ? 20 CYS A HA   1 
ATOM   289  H HB2  . CYS A 1 20 ? 0.717   1.964   -2.834  1.00 0.00 ? 20 CYS A HB2  1 
ATOM   290  H HB3  . CYS A 1 20 ? -0.026  0.830   -3.915  1.00 0.00 ? 20 CYS A HB3  1 
ATOM   291  N N    . LYS A 1 21 ? -2.109  1.210   -5.417  1.00 0.00 ? 21 LYS A N    1 
ATOM   292  C CA   . LYS A 1 21 ? -2.615  0.792   -6.718  1.00 0.00 ? 21 LYS A CA   1 
ATOM   293  C C    . LYS A 1 21 ? -3.766  -0.187  -6.486  1.00 0.00 ? 21 LYS A C    1 
ATOM   294  O O    . LYS A 1 21 ? -3.620  -1.166  -5.754  1.00 0.00 ? 21 LYS A O    1 
ATOM   295  C CB   . LYS A 1 21 ? -1.468  0.137   -7.508  1.00 0.00 ? 21 LYS A CB   1 
ATOM   296  C CG   . LYS A 1 21 ? -1.882  -0.600  -8.793  1.00 0.00 ? 21 LYS A CG   1 
ATOM   297  C CD   . LYS A 1 21 ? -2.537  0.318   -9.836  1.00 0.00 ? 21 LYS A CD   1 
ATOM   298  C CE   . LYS A 1 21 ? -2.795  -0.419  -11.159 1.00 0.00 ? 21 LYS A CE   1 
ATOM   299  N NZ   . LYS A 1 21 ? -3.731  -1.547  -11.000 1.00 0.00 ? 21 LYS A NZ   1 
ATOM   300  H H    . LYS A 1 21 ? -1.730  0.479   -4.836  1.00 0.00 ? 21 LYS A H    1 
ATOM   301  H HA   . LYS A 1 21 ? -2.961  1.664   -7.279  1.00 0.00 ? 21 LYS A HA   1 
ATOM   302  H HB2  . LYS A 1 21 ? -0.738  0.906   -7.761  1.00 0.00 ? 21 LYS A HB2  1 
ATOM   303  H HB3  . LYS A 1 21 ? -0.984  -0.596  -6.864  1.00 0.00 ? 21 LYS A HB3  1 
ATOM   304  H HG2  . LYS A 1 21 ? -0.981  -1.035  -9.231  1.00 0.00 ? 21 LYS A HG2  1 
ATOM   305  H HG3  . LYS A 1 21 ? -2.557  -1.418  -8.540  1.00 0.00 ? 21 LYS A HG3  1 
ATOM   306  H HD2  . LYS A 1 21 ? -3.481  0.708   -9.454  1.00 0.00 ? 21 LYS A HD2  1 
ATOM   307  H HD3  . LYS A 1 21 ? -1.872  1.160   -10.033 1.00 0.00 ? 21 LYS A HD3  1 
ATOM   308  H HE2  . LYS A 1 21 ? -3.220  0.282   -11.879 1.00 0.00 ? 21 LYS A HE2  1 
ATOM   309  H HE3  . LYS A 1 21 ? -1.853  -0.796  -11.559 1.00 0.00 ? 21 LYS A HE3  1 
ATOM   310  H HZ1  . LYS A 1 21 ? -3.340  -2.226  -10.363 1.00 0.00 ? 21 LYS A HZ1  1 
ATOM   311  H HZ2  . LYS A 1 21 ? -4.610  -1.210  -10.634 1.00 0.00 ? 21 LYS A HZ2  1 
ATOM   312  H HZ3  . LYS A 1 21 ? -3.885  -1.984  -11.898 1.00 0.00 ? 21 LYS A HZ3  1 
ATOM   313  N N    . ARG A 1 22 ? -4.904  0.095   -7.127  1.00 0.00 ? 22 ARG A N    1 
ATOM   314  C CA   . ARG A 1 22 ? -6.175  -0.604  -6.979  1.00 0.00 ? 22 ARG A CA   1 
ATOM   315  C C    . ARG A 1 22 ? -6.197  -1.875  -7.843  1.00 0.00 ? 22 ARG A C    1 
ATOM   316  O O    . ARG A 1 22 ? -7.002  -2.008  -8.765  1.00 0.00 ? 22 ARG A O    1 
ATOM   317  C CB   . ARG A 1 22 ? -7.316  0.363   -7.333  1.00 0.00 ? 22 ARG A CB   1 
ATOM   318  C CG   . ARG A 1 22 ? -7.449  1.556   -6.369  1.00 0.00 ? 22 ARG A CG   1 
ATOM   319  C CD   . ARG A 1 22 ? -8.294  1.203   -5.137  1.00 0.00 ? 22 ARG A CD   1 
ATOM   320  N NE   . ARG A 1 22 ? -8.260  2.289   -4.144  1.00 0.00 ? 22 ARG A NE   1 
ATOM   321  C CZ   . ARG A 1 22 ? -9.210  2.570   -3.233  1.00 0.00 ? 22 ARG A CZ   1 
ATOM   322  N NH1  . ARG A 1 22 ? -10.335 1.843   -3.140  1.00 0.00 ? 22 ARG A NH1  1 
ATOM   323  N NH2  . ARG A 1 22 ? -9.029  3.603   -2.399  1.00 0.00 ? 22 ARG A NH2  1 
ATOM   324  H H    . ARG A 1 22 ? -4.889  0.898   -7.734  1.00 0.00 ? 22 ARG A H    1 
ATOM   325  H HA   . ARG A 1 22 ? -6.297  -0.896  -5.938  1.00 0.00 ? 22 ARG A HA   1 
ATOM   326  H HB2  . ARG A 1 22 ? -7.112  0.746   -8.331  1.00 0.00 ? 22 ARG A HB2  1 
ATOM   327  H HB3  . ARG A 1 22 ? -8.260  -0.182  -7.355  1.00 0.00 ? 22 ARG A HB3  1 
ATOM   328  H HG2  . ARG A 1 22 ? -6.462  1.906   -6.063  1.00 0.00 ? 22 ARG A HG2  1 
ATOM   329  H HG3  . ARG A 1 22 ? -7.948  2.374   -6.893  1.00 0.00 ? 22 ARG A HG3  1 
ATOM   330  H HD2  . ARG A 1 22 ? -9.317  1.017   -5.469  1.00 0.00 ? 22 ARG A HD2  1 
ATOM   331  H HD3  . ARG A 1 22 ? -7.913  0.295   -4.674  1.00 0.00 ? 22 ARG A HD3  1 
ATOM   332  H HE   . ARG A 1 22 ? -7.435  2.871   -4.155  1.00 0.00 ? 22 ARG A HE   1 
ATOM   333  H HH11 . ARG A 1 22 ? -10.487 1.058   -3.756  1.00 0.00 ? 22 ARG A HH11 1 
ATOM   334  H HH12 . ARG A 1 22 ? -11.035 2.084   -2.453  1.00 0.00 ? 22 ARG A HH12 1 
ATOM   335  H HH21 . ARG A 1 22 ? -8.188  4.159   -2.457  1.00 0.00 ? 22 ARG A HH21 1 
ATOM   336  H HH22 . ARG A 1 22 ? -9.736  3.831   -1.714  1.00 0.00 ? 22 ARG A HH22 1 
ATOM   337  N N    . ALA A 1 23 ? -5.304  -2.815  -7.515  1.00 0.00 ? 23 ALA A N    1 
ATOM   338  C CA   . ALA A 1 23 ? -5.174  -4.125  -8.140  1.00 0.00 ? 23 ALA A CA   1 
ATOM   339  C C    . ALA A 1 23 ? -6.262  -5.085  -7.634  1.00 0.00 ? 23 ALA A C    1 
ATOM   340  O O    . ALA A 1 23 ? -6.718  -4.975  -6.496  1.00 0.00 ? 23 ALA A O    1 
ATOM   341  C CB   . ALA A 1 23 ? -3.772  -4.681  -7.864  1.00 0.00 ? 23 ALA A CB   1 
ATOM   342  H H    . ALA A 1 23 ? -4.673  -2.594  -6.763  1.00 0.00 ? 23 ALA A H    1 
ATOM   343  H HA   . ALA A 1 23 ? -5.270  -3.991  -9.218  1.00 0.00 ? 23 ALA A HA   1 
ATOM   344  H HB1  . ALA A 1 23 ? -3.626  -4.822  -6.793  1.00 0.00 ? 23 ALA A HB1  1 
ATOM   345  H HB2  . ALA A 1 23 ? -3.642  -5.637  -8.374  1.00 0.00 ? 23 ALA A HB2  1 
ATOM   346  H HB3  . ALA A 1 23 ? -3.014  -3.988  -8.235  1.00 0.00 ? 23 ALA A HB3  1 
ATOM   347  N N    . ARG A 1 24 ? -6.675  -6.032  -8.490  1.00 0.00 ? 24 ARG A N    1 
ATOM   348  C CA   . ARG A 1 24 ? -7.753  -6.983  -8.222  1.00 0.00 ? 24 ARG A CA   1 
ATOM   349  C C    . ARG A 1 24 ? -7.532  -8.272  -9.028  1.00 0.00 ? 24 ARG A C    1 
ATOM   350  O O    . ARG A 1 24 ? -6.979  -8.234  -10.129 1.00 0.00 ? 24 ARG A O    1 
ATOM   351  C CB   . ARG A 1 24 ? -9.102  -6.316  -8.561  1.00 0.00 ? 24 ARG A CB   1 
ATOM   352  C CG   . ARG A 1 24 ? -10.352 -7.152  -8.226  1.00 0.00 ? 24 ARG A CG   1 
ATOM   353  C CD   . ARG A 1 24 ? -10.531 -7.433  -6.726  1.00 0.00 ? 24 ARG A CD   1 
ATOM   354  N NE   . ARG A 1 24 ? -10.679 -6.188  -5.951  1.00 0.00 ? 24 ARG A NE   1 
ATOM   355  C CZ   . ARG A 1 24 ? -9.862  -5.713  -4.991  1.00 0.00 ? 24 ARG A CZ   1 
ATOM   356  N NH1  . ARG A 1 24 ? -8.776  -6.384  -4.578  1.00 0.00 ? 24 ARG A NH1  1 
ATOM   357  N NH2  . ARG A 1 24 ? -10.143 -4.531  -4.426  1.00 0.00 ? 24 ARG A NH2  1 
ATOM   358  H H    . ARG A 1 24 ? -6.249  -6.072  -9.404  1.00 0.00 ? 24 ARG A H    1 
ATOM   359  H HA   . ARG A 1 24 ? -7.730  -7.232  -7.159  1.00 0.00 ? 24 ARG A HA   1 
ATOM   360  H HB2  . ARG A 1 24 ? -9.176  -5.369  -8.025  1.00 0.00 ? 24 ARG A HB2  1 
ATOM   361  H HB3  . ARG A 1 24 ? -9.123  -6.090  -9.630  1.00 0.00 ? 24 ARG A HB3  1 
ATOM   362  H HG2  . ARG A 1 24 ? -11.229 -6.604  -8.578  1.00 0.00 ? 24 ARG A HG2  1 
ATOM   363  H HG3  . ARG A 1 24 ? -10.321 -8.097  -8.769  1.00 0.00 ? 24 ARG A HG3  1 
ATOM   364  H HD2  . ARG A 1 24 ? -11.451 -8.006  -6.597  1.00 0.00 ? 24 ARG A HD2  1 
ATOM   365  H HD3  . ARG A 1 24 ? -9.712  -8.053  -6.365  1.00 0.00 ? 24 ARG A HD3  1 
ATOM   366  H HE   . ARG A 1 24 ? -11.479 -5.622  -6.195  1.00 0.00 ? 24 ARG A HE   1 
ATOM   367  H HH11 . ARG A 1 24 ? -8.537  -7.278  -4.980  1.00 0.00 ? 24 ARG A HH11 1 
ATOM   368  H HH12 . ARG A 1 24 ? -8.184  -5.983  -3.863  1.00 0.00 ? 24 ARG A HH12 1 
ATOM   369  H HH21 . ARG A 1 24 ? -10.957 -4.009  -4.717  1.00 0.00 ? 24 ARG A HH21 1 
ATOM   370  H HH22 . ARG A 1 24 ? -9.532  -4.158  -3.712  1.00 0.00 ? 24 ARG A HH22 1 
ATOM   371  N N    . GLY A 1 25 ? -7.979  -9.410  -8.474  1.00 0.00 ? 25 GLY A N    1 
ATOM   372  C CA   . GLY A 1 25 ? -7.920  -10.729 -9.095  1.00 0.00 ? 25 GLY A CA   1 
ATOM   373  C C    . GLY A 1 25 ? -6.939  -11.641 -8.355  1.00 0.00 ? 25 GLY A C    1 
ATOM   374  O O    . GLY A 1 25 ? -7.346  -12.662 -7.801  1.00 0.00 ? 25 GLY A O    1 
ATOM   375  H H    . GLY A 1 25 ? -8.425  -9.350  -7.570  1.00 0.00 ? 25 GLY A H    1 
ATOM   376  H HA2  . GLY A 1 25 ? -8.922  -11.159 -9.053  1.00 0.00 ? 25 GLY A HA2  1 
ATOM   377  H HA3  . GLY A 1 25 ? -7.629  -10.673 -10.146 1.00 0.00 ? 25 GLY A HA3  1 
ATOM   378  N N    . ASP A 1 26 ? -5.650  -11.272 -8.363  1.00 0.00 ? 26 ASP A N    1 
ATOM   379  C CA   . ASP A 1 26 ? -4.551  -12.006 -7.738  1.00 0.00 ? 26 ASP A CA   1 
ATOM   380  C C    . ASP A 1 26 ? -3.957  -11.146 -6.616  1.00 0.00 ? 26 ASP A C    1 
ATOM   381  O O    . ASP A 1 26 ? -4.143  -11.454 -5.440  1.00 0.00 ? 26 ASP A O    1 
ATOM   382  C CB   . ASP A 1 26 ? -3.514  -12.403 -8.802  1.00 0.00 ? 26 ASP A CB   1 
ATOM   383  C CG   . ASP A 1 26 ? -4.087  -13.393 -9.820  1.00 0.00 ? 26 ASP A CG   1 
ATOM   384  O OD1  . ASP A 1 26 ? -4.117  -14.598 -9.489  1.00 0.00 ? 26 ASP A OD1  1 
ATOM   385  O OD2  . ASP A 1 26 ? -4.498  -12.927 -10.907 1.00 0.00 ? 26 ASP A OD2  1 
ATOM   386  H H    . ASP A 1 26 ? -5.405  -10.420 -8.847  1.00 0.00 ? 26 ASP A H    1 
ATOM   387  H HA   . ASP A 1 26 ? -4.907  -12.935 -7.294  1.00 0.00 ? 26 ASP A HA   1 
ATOM   388  H HB2  . ASP A 1 26 ? -3.171  -11.509 -9.318  1.00 0.00 ? 26 ASP A HB2  1 
ATOM   389  H HB3  . ASP A 1 26 ? -2.649  -12.861 -8.321  1.00 0.00 ? 26 ASP A HB3  1 
ATOM   390  N N    . ASP A 1 27 ? -3.274  -10.054 -6.988  1.00 0.00 ? 27 ASP A N    1 
ATOM   391  C CA   . ASP A 1 27 ? -2.792  -9.007  -6.102  1.00 0.00 ? 27 ASP A CA   1 
ATOM   392  C C    . ASP A 1 27 ? -3.992  -8.144  -5.724  1.00 0.00 ? 27 ASP A C    1 
ATOM   393  O O    . ASP A 1 27 ? -4.562  -7.450  -6.565  1.00 0.00 ? 27 ASP A O    1 
ATOM   394  C CB   . ASP A 1 27 ? -1.700  -8.194  -6.805  1.00 0.00 ? 27 ASP A CB   1 
ATOM   395  C CG   . ASP A 1 27 ? -1.240  -6.958  -6.024  1.00 0.00 ? 27 ASP A CG   1 
ATOM   396  O OD1  . ASP A 1 27 ? -0.919  -7.114  -4.828  1.00 0.00 ? 27 ASP A OD1  1 
ATOM   397  O OD2  . ASP A 1 27 ? -1.199  -5.875  -6.646  1.00 0.00 ? 27 ASP A OD2  1 
ATOM   398  H H    . ASP A 1 27 ? -3.200  -9.853  -7.969  1.00 0.00 ? 27 ASP A H    1 
ATOM   399  H HA   . ASP A 1 27 ? -2.331  -9.456  -5.225  1.00 0.00 ? 27 ASP A HA   1 
ATOM   400  H HB2  . ASP A 1 27 ? -0.839  -8.840  -6.967  1.00 0.00 ? 27 ASP A HB2  1 
ATOM   401  H HB3  . ASP A 1 27 ? -2.097  -7.883  -7.766  1.00 0.00 ? 27 ASP A HB3  1 
ATOM   402  N N    . MET A 1 28 ? -4.373  -8.227  -4.449  1.00 0.00 ? 28 MET A N    1 
ATOM   403  C CA   . MET A 1 28 ? -5.542  -7.557  -3.896  1.00 0.00 ? 28 MET A CA   1 
ATOM   404  C C    . MET A 1 28 ? -5.127  -6.213  -3.294  1.00 0.00 ? 28 MET A C    1 
ATOM   405  O O    . MET A 1 28 ? -5.046  -6.038  -2.080  1.00 0.00 ? 28 MET A O    1 
ATOM   406  C CB   . MET A 1 28 ? -6.243  -8.434  -2.864  1.00 0.00 ? 28 MET A CB   1 
ATOM   407  C CG   . MET A 1 28 ? -6.634  -9.831  -3.359  1.00 0.00 ? 28 MET A CG   1 
ATOM   408  S SD   . MET A 1 28 ? -7.771  -9.884  -4.771  1.00 0.00 ? 28 MET A SD   1 
ATOM   409  C CE   . MET A 1 28 ? -8.101  -11.664 -4.821  1.00 0.00 ? 28 MET A CE   1 
ATOM   410  H H    . MET A 1 28 ? -3.801  -8.814  -3.863  1.00 0.00 ? 28 MET A H    1 
ATOM   411  H HA   . MET A 1 28 ? -6.269  -7.376  -4.689  1.00 0.00 ? 28 MET A HA   1 
ATOM   412  H HB2  . MET A 1 28 ? -5.576  -8.534  -2.015  1.00 0.00 ? 28 MET A HB2  1 
ATOM   413  H HB3  . MET A 1 28 ? -7.136  -7.893  -2.556  1.00 0.00 ? 28 MET A HB3  1 
ATOM   414  H HG2  . MET A 1 28 ? -5.735  -10.390 -3.616  1.00 0.00 ? 28 MET A HG2  1 
ATOM   415  H HG3  . MET A 1 28 ? -7.117  -10.339 -2.528  1.00 0.00 ? 28 MET A HG3  1 
ATOM   416  H HE1  . MET A 1 28 ? -7.172  -12.206 -5.000  1.00 0.00 ? 28 MET A HE1  1 
ATOM   417  H HE2  . MET A 1 28 ? -8.533  -11.986 -3.874  1.00 0.00 ? 28 MET A HE2  1 
ATOM   418  H HE3  . MET A 1 28 ? -8.807  -11.875 -5.624  1.00 0.00 ? 28 MET A HE3  1 
ATOM   419  N N    . ASP A 1 29 ? -4.876  -5.264  -4.192  1.00 0.00 ? 29 ASP A N    1 
ATOM   420  C CA   . ASP A 1 29 ? -4.462  -3.889  -3.915  1.00 0.00 ? 29 ASP A CA   1 
ATOM   421  C C    . ASP A 1 29 ? -3.032  -3.828  -3.339  1.00 0.00 ? 29 ASP A C    1 
ATOM   422  O O    . ASP A 1 29 ? -2.317  -4.829  -3.408  1.00 0.00 ? 29 ASP A O    1 
ATOM   423  C CB   . ASP A 1 29 ? -5.514  -3.167  -3.062  1.00 0.00 ? 29 ASP A CB   1 
ATOM   424  C CG   . ASP A 1 29 ? -6.958  -3.424  -3.513  1.00 0.00 ? 29 ASP A CG   1 
ATOM   425  O OD1  . ASP A 1 29 ? -7.337  -2.872  -4.568  1.00 0.00 ? 29 ASP A OD1  1 
ATOM   426  O OD2  . ASP A 1 29 ? -7.656  -4.175  -2.797  1.00 0.00 ? 29 ASP A OD2  1 
ATOM   427  H H    . ASP A 1 29 ? -5.042  -5.548  -5.142  1.00 0.00 ? 29 ASP A H    1 
ATOM   428  H HA   . ASP A 1 29 ? -4.427  -3.385  -4.876  1.00 0.00 ? 29 ASP A HA   1 
ATOM   429  H HB2  . ASP A 1 29 ? -5.396  -3.462  -2.022  1.00 0.00 ? 29 ASP A HB2  1 
ATOM   430  H HB3  . ASP A 1 29 ? -5.321  -2.103  -3.141  1.00 0.00 ? 29 ASP A HB3  1 
ATOM   431  N N    . ASP A 1 30 ? -2.579  -2.665  -2.823  1.00 0.00 ? 30 ASP A N    1 
ATOM   432  C CA   . ASP A 1 30 ? -1.155  -2.458  -2.500  1.00 0.00 ? 30 ASP A CA   1 
ATOM   433  C C    . ASP A 1 30 ? -0.934  -1.366  -1.437  1.00 0.00 ? 30 ASP A C    1 
ATOM   434  O O    . ASP A 1 30 ? -0.480  -0.265  -1.728  1.00 0.00 ? 30 ASP A O    1 
ATOM   435  C CB   . ASP A 1 30 ? -0.378  -2.109  -3.777  1.00 0.00 ? 30 ASP A CB   1 
ATOM   436  C CG   . ASP A 1 30 ? -0.311  -3.228  -4.820  1.00 0.00 ? 30 ASP A CG   1 
ATOM   437  O OD1  . ASP A 1 30 ? 0.481   -4.170  -4.600  1.00 0.00 ? 30 ASP A OD1  1 
ATOM   438  O OD2  . ASP A 1 30 ? -1.056  -3.121  -5.819  1.00 0.00 ? 30 ASP A OD2  1 
ATOM   439  H H    . ASP A 1 30 ? -3.210  -1.871  -2.748  1.00 0.00 ? 30 ASP A H    1 
ATOM   440  H HA   . ASP A 1 30 ? -0.735  -3.382  -2.094  1.00 0.00 ? 30 ASP A HA   1 
ATOM   441  H HB2  . ASP A 1 30 ? -0.836  -1.230  -4.223  1.00 0.00 ? 30 ASP A HB2  1 
ATOM   442  H HB3  . ASP A 1 30 ? 0.642   -1.855  -3.488  1.00 0.00 ? 30 ASP A HB3  1 
ATOM   443  N N    . TYR A 1 31 ? -1.214  -1.696  -0.180  1.00 0.00 ? 31 TYR A N    1 
ATOM   444  C CA   . TYR A 1 31 ? -1.350  -0.755  0.937   1.00 0.00 ? 31 TYR A CA   1 
ATOM   445  C C    . TYR A 1 31 ? -0.001  -0.268  1.493   1.00 0.00 ? 31 TYR A C    1 
ATOM   446  O O    . TYR A 1 31 ? 0.892   -1.080  1.726   1.00 0.00 ? 31 TYR A O    1 
ATOM   447  C CB   . TYR A 1 31 ? -2.154  -1.419  2.068   1.00 0.00 ? 31 TYR A CB   1 
ATOM   448  C CG   . TYR A 1 31 ? -3.423  -2.145  1.644   1.00 0.00 ? 31 TYR A CG   1 
ATOM   449  C CD1  . TYR A 1 31 ? -3.351  -3.482  1.185   1.00 0.00 ? 31 TYR A CD1  1 
ATOM   450  C CD2  . TYR A 1 31 ? -4.674  -1.493  1.688   1.00 0.00 ? 31 TYR A CD2  1 
ATOM   451  C CE1  . TYR A 1 31 ? -4.497  -4.114  0.665   1.00 0.00 ? 31 TYR A CE1  1 
ATOM   452  C CE2  . TYR A 1 31 ? -5.838  -2.167  1.270   1.00 0.00 ? 31 TYR A CE2  1 
ATOM   453  C CZ   . TYR A 1 31 ? -5.733  -3.433  0.660   1.00 0.00 ? 31 TYR A CZ   1 
ATOM   454  O OH   . TYR A 1 31 ? -6.854  -4.053  0.190   1.00 0.00 ? 31 TYR A OH   1 
ATOM   455  H H    . TYR A 1 31 ? -1.480  -2.656  -0.048  1.00 0.00 ? 31 TYR A H    1 
ATOM   456  H HA   . TYR A 1 31 ? -1.923  0.112   0.592   1.00 0.00 ? 31 TYR A HA   1 
ATOM   457  H HB2  . TYR A 1 31 ? -1.528  -2.122  2.621   1.00 0.00 ? 31 TYR A HB2  1 
ATOM   458  H HB3  . TYR A 1 31 ? -2.403  -0.628  2.765   1.00 0.00 ? 31 TYR A HB3  1 
ATOM   459  H HD1  . TYR A 1 31 ? -2.410  -4.014  1.196   1.00 0.00 ? 31 TYR A HD1  1 
ATOM   460  H HD2  . TYR A 1 31 ? -4.746  -0.465  1.997   1.00 0.00 ? 31 TYR A HD2  1 
ATOM   461  H HE1  . TYR A 1 31 ? -4.431  -5.126  0.297   1.00 0.00 ? 31 TYR A HE1  1 
ATOM   462  H HE2  . TYR A 1 31 ? -6.799  -1.676  1.337   1.00 0.00 ? 31 TYR A HE2  1 
ATOM   463  H HH   . TYR A 1 31 ? -6.688  -4.933  -0.156  1.00 0.00 ? 31 TYR A HH   1 
ATOM   464  N N    . CYS A 1 32 ? 0.113   1.043   1.778   1.00 0.00 ? 32 CYS A N    1 
ATOM   465  C CA   . CYS A 1 32 ? 1.161   1.626   2.624   1.00 0.00 ? 32 CYS A CA   1 
ATOM   466  C C    . CYS A 1 32 ? 0.885   1.331   4.093   1.00 0.00 ? 32 CYS A C    1 
ATOM   467  O O    . CYS A 1 32 ? -0.250  1.428   4.563   1.00 0.00 ? 32 CYS A O    1 
ATOM   468  C CB   . CYS A 1 32 ? 1.397   3.125   2.354   1.00 0.00 ? 32 CYS A CB   1 
ATOM   469  S SG   . CYS A 1 32 ? 2.392   3.270   0.866   1.00 0.00 ? 32 CYS A SG   1 
ATOM   470  H H    . CYS A 1 32 ? -0.637  1.649   1.486   1.00 0.00 ? 32 CYS A H    1 
ATOM   471  H HA   . CYS A 1 32 ? 2.088   1.113   2.360   1.00 0.00 ? 32 CYS A HA   1 
ATOM   472  H HB2  . CYS A 1 32 ? 0.465   3.677   2.246   1.00 0.00 ? 32 CYS A HB2  1 
ATOM   473  H HB3  . CYS A 1 32 ? 1.944   3.632   3.155   1.00 0.00 ? 32 CYS A HB3  1 
ATOM   474  N N    . ASN A 1 33 ? 1.953   0.895   4.772   1.00 0.00 ? 33 ASN A N    1 
ATOM   475  C CA   . ASN A 1 33 ? 1.881   0.087   5.990   1.00 0.00 ? 33 ASN A CA   1 
ATOM   476  C C    . ASN A 1 33 ? 2.248   0.851   7.272   1.00 0.00 ? 33 ASN A C    1 
ATOM   477  O O    . ASN A 1 33 ? 2.571   0.215   8.275   1.00 0.00 ? 33 ASN A O    1 
ATOM   478  C CB   . ASN A 1 33 ? 2.799   -1.133  5.802   1.00 0.00 ? 33 ASN A CB   1 
ATOM   479  C CG   . ASN A 1 33 ? 2.377   -2.000  4.617   1.00 0.00 ? 33 ASN A CG   1 
ATOM   480  O OD1  . ASN A 1 33 ? 1.194   -2.251  4.395   1.00 0.00 ? 33 ASN A OD1  1 
ATOM   481  N ND2  . ASN A 1 33 ? 3.368   -2.457  3.860   1.00 0.00 ? 33 ASN A ND2  1 
ATOM   482  H H    . ASN A 1 33 ? 2.829   0.905   4.255   1.00 0.00 ? 33 ASN A H    1 
ATOM   483  H HA   . ASN A 1 33 ? 0.875   -0.311  6.114   1.00 0.00 ? 33 ASN A HA   1 
ATOM   484  H HB2  . ASN A 1 33 ? 3.825   -0.777  5.676   1.00 0.00 ? 33 ASN A HB2  1 
ATOM   485  H HB3  . ASN A 1 33 ? 2.783   -1.788  6.670   1.00 0.00 ? 33 ASN A HB3  1 
ATOM   486  H HD21 . ASN A 1 33 ? 4.312   -2.222  4.124   1.00 0.00 ? 33 ASN A HD21 1 
ATOM   487  H HD22 . ASN A 1 33 ? 3.174   -3.039  3.064   1.00 0.00 ? 33 ASN A HD22 1 
ATOM   488  N N    . GLY A 1 34 ? 2.258   2.195   7.259   1.00 0.00 ? 34 GLY A N    1 
ATOM   489  C CA   . GLY A 1 34 ? 2.790   2.986   8.368   1.00 0.00 ? 34 GLY A CA   1 
ATOM   490  C C    . GLY A 1 34 ? 4.332   2.997   8.427   1.00 0.00 ? 34 GLY A C    1 
ATOM   491  O O    . GLY A 1 34 ? 4.906   3.895   9.041   1.00 0.00 ? 34 GLY A O    1 
ATOM   492  H H    . GLY A 1 34 ? 1.985   2.687   6.420   1.00 0.00 ? 34 GLY A H    1 
ATOM   493  H HA2  . GLY A 1 34 ? 2.418   4.005   8.265   1.00 0.00 ? 34 GLY A HA2  1 
ATOM   494  H HA3  . GLY A 1 34 ? 2.407   2.601   9.315   1.00 0.00 ? 34 GLY A HA3  1 
ATOM   495  N N    . LYS A 1 35 ? 4.996   2.000   7.817   1.00 0.00 ? 35 LYS A N    1 
ATOM   496  C CA   . LYS A 1 35 ? 6.436   1.763   7.831   1.00 0.00 ? 35 LYS A CA   1 
ATOM   497  C C    . LYS A 1 35 ? 7.095   2.118   6.494   1.00 0.00 ? 35 LYS A C    1 
ATOM   498  O O    . LYS A 1 35 ? 8.175   2.708   6.496   1.00 0.00 ? 35 LYS A O    1 
ATOM   499  C CB   . LYS A 1 35 ? 6.698   0.289   8.155   1.00 0.00 ? 35 LYS A CB   1 
ATOM   500  C CG   . LYS A 1 35 ? 6.249   -0.052  9.581   1.00 0.00 ? 35 LYS A CG   1 
ATOM   501  C CD   . LYS A 1 35 ? 6.586   -1.515  9.857   1.00 0.00 ? 35 LYS A CD   1 
ATOM   502  C CE   . LYS A 1 35 ? 6.241   -1.902  11.301  1.00 0.00 ? 35 LYS A CE   1 
ATOM   503  N NZ   . LYS A 1 35 ? 6.576   -3.310  11.575  1.00 0.00 ? 35 LYS A NZ   1 
ATOM   504  H H    . LYS A 1 35 ? 4.456   1.275   7.370   1.00 0.00 ? 35 LYS A H    1 
ATOM   505  H HA   . LYS A 1 35 ? 6.916   2.342   8.619   1.00 0.00 ? 35 LYS A HA   1 
ATOM   506  H HB2  . LYS A 1 35 ? 6.174   -0.353  7.443   1.00 0.00 ? 35 LYS A HB2  1 
ATOM   507  H HB3  . LYS A 1 35 ? 7.769   0.091   8.075   1.00 0.00 ? 35 LYS A HB3  1 
ATOM   508  H HG2  . LYS A 1 35 ? 6.776   0.586   10.293  1.00 0.00 ? 35 LYS A HG2  1 
ATOM   509  H HG3  . LYS A 1 35 ? 5.174   0.101   9.693   1.00 0.00 ? 35 LYS A HG3  1 
ATOM   510  H HD2  . LYS A 1 35 ? 6.026   -2.151  9.168   1.00 0.00 ? 35 LYS A HD2  1 
ATOM   511  H HD3  . LYS A 1 35 ? 7.654   -1.677  9.695   1.00 0.00 ? 35 LYS A HD3  1 
ATOM   512  H HE2  . LYS A 1 35 ? 6.803   -1.272  11.992  1.00 0.00 ? 35 LYS A HE2  1 
ATOM   513  H HE3  . LYS A 1 35 ? 5.175   -1.755  11.476  1.00 0.00 ? 35 LYS A HE3  1 
ATOM   514  H HZ1  . LYS A 1 35 ? 6.048   -3.908  10.955  1.00 0.00 ? 35 LYS A HZ1  1 
ATOM   515  H HZ2  . LYS A 1 35 ? 7.564   -3.457  11.421  1.00 0.00 ? 35 LYS A HZ2  1 
ATOM   516  H HZ3  . LYS A 1 35 ? 6.348   -3.532  12.533  1.00 0.00 ? 35 LYS A HZ3  1 
ATOM   517  N N    . THR A 1 36 ? 6.478   1.716   5.369   1.00 0.00 ? 36 THR A N    1 
ATOM   518  C CA   . THR A 1 36 ? 7.043   1.830   4.022   1.00 0.00 ? 36 THR A CA   1 
ATOM   519  C C    . THR A 1 36 ? 6.050   2.404   2.996   1.00 0.00 ? 36 THR A C    1 
ATOM   520  O O    . THR A 1 36 ? 4.834   2.233   3.106   1.00 0.00 ? 36 THR A O    1 
ATOM   521  C CB   . THR A 1 36 ? 7.651   0.485   3.570   1.00 0.00 ? 36 THR A CB   1 
ATOM   522  O OG1  . THR A 1 36 ? 8.073   0.537   2.219   1.00 0.00 ? 36 THR A OG1  1 
ATOM   523  C CG2  . THR A 1 36 ? 6.705   -0.712  3.764   1.00 0.00 ? 36 THR A CG2  1 
ATOM   524  H H    . THR A 1 36 ? 5.608   1.209   5.468   1.00 0.00 ? 36 THR A H    1 
ATOM   525  H HA   . THR A 1 36 ? 7.882   2.526   4.073   1.00 0.00 ? 36 THR A HA   1 
ATOM   526  H HB   . THR A 1 36 ? 8.549   0.325   4.163   1.00 0.00 ? 36 THR A HB   1 
ATOM   527  H HG1  . THR A 1 36 ? 8.668   1.283   2.110   1.00 0.00 ? 36 THR A HG1  1 
ATOM   528  H HG21 . THR A 1 36 ? 5.756   -0.526  3.268   1.00 0.00 ? 36 THR A HG21 1 
ATOM   529  H HG22 . THR A 1 36 ? 6.517   -0.882  4.825   1.00 0.00 ? 36 THR A HG22 1 
ATOM   530  H HG23 . THR A 1 36 ? 7.153   -1.616  3.349   1.00 0.00 ? 36 THR A HG23 1 
ATOM   531  N N    . CYS A 1 37 ? 6.638   3.075   1.991   1.00 0.00 ? 37 CYS A N    1 
ATOM   532  C CA   . CYS A 1 37 ? 6.026   3.648   0.790   1.00 0.00 ? 37 CYS A CA   1 
ATOM   533  C C    . CYS A 1 37 ? 6.846   3.257   -0.444  1.00 0.00 ? 37 CYS A C    1 
ATOM   534  O O    . CYS A 1 37 ? 7.179   4.104   -1.273  1.00 0.00 ? 37 CYS A O    1 
ATOM   535  C CB   . CYS A 1 37 ? 5.897   5.177   0.924   1.00 0.00 ? 37 CYS A CB   1 
ATOM   536  S SG   . CYS A 1 37 ? 4.730   5.709   2.196   1.00 0.00 ? 37 CYS A SG   1 
ATOM   537  H H    . CYS A 1 37 ? 7.648   3.079   2.022   1.00 0.00 ? 37 CYS A H    1 
ATOM   538  H HA   . CYS A 1 37 ? 5.035   3.230   0.631   1.00 0.00 ? 37 CYS A HA   1 
ATOM   539  H HB2  . CYS A 1 37 ? 6.876   5.586   1.171   1.00 0.00 ? 37 CYS A HB2  1 
ATOM   540  H HB3  . CYS A 1 37 ? 5.566   5.615   -0.015  1.00 0.00 ? 37 CYS A HB3  1 
ATOM   541  N N    . ASP A 1 38 ? 7.123   1.952   -0.585  1.00 0.00 ? 38 ASP A N    1 
ATOM   542  C CA   . ASP A 1 38 ? 7.609   1.342   -1.819  1.00 0.00 ? 38 ASP A CA   1 
ATOM   543  C C    . ASP A 1 38 ? 6.417   0.700   -2.553  1.00 0.00 ? 38 ASP A C    1 
ATOM   544  O O    . ASP A 1 38 ? 6.539   -0.399  -3.093  1.00 0.00 ? 38 ASP A O    1 
ATOM   545  C CB   . ASP A 1 38 ? 8.728   0.343   -1.459  1.00 0.00 ? 38 ASP A CB   1 
ATOM   546  C CG   . ASP A 1 38 ? 9.479   -0.182  -2.688  1.00 0.00 ? 38 ASP A CG   1 
ATOM   547  O OD1  . ASP A 1 38 ? 10.122  0.651   -3.363  1.00 0.00 ? 38 ASP A OD1  1 
ATOM   548  O OD2  . ASP A 1 38 ? 9.399   -1.406  -2.932  1.00 0.00 ? 38 ASP A OD2  1 
ATOM   549  H H    . ASP A 1 38 ? 6.844   1.321   0.154   1.00 0.00 ? 38 ASP A H    1 
ATOM   550  H HA   . ASP A 1 38 ? 8.028   2.106   -2.477  1.00 0.00 ? 38 ASP A HA   1 
ATOM   551  H HB2  . ASP A 1 38 ? 9.459   0.840   -0.816  1.00 0.00 ? 38 ASP A HB2  1 
ATOM   552  H HB3  . ASP A 1 38 ? 8.305   -0.488  -0.890  1.00 0.00 ? 38 ASP A HB3  1 
ATOM   553  N N    . CYS A 1 39 ? 5.257   1.390   -2.549  1.00 0.00 ? 39 CYS A N    1 
ATOM   554  C CA   . CYS A 1 39 ? 3.958   0.932   -3.043  1.00 0.00 ? 39 CYS A CA   1 
ATOM   555  C C    . CYS A 1 39 ? 3.725   -0.540  -2.646  1.00 0.00 ? 39 CYS A C    1 
ATOM   556  O O    . CYS A 1 39 ? 3.677   -1.401  -3.526  1.00 0.00 ? 39 CYS A O    1 
ATOM   557  C CB   . CYS A 1 39 ? 3.929   1.198   -4.561  1.00 0.00 ? 39 CYS A CB   1 
ATOM   558  S SG   . CYS A 1 39 ? 2.402   0.857   -5.480  1.00 0.00 ? 39 CYS A SG   1 
ATOM   559  H H    . CYS A 1 39 ? 5.270   2.313   -2.143  1.00 0.00 ? 39 CYS A H    1 
ATOM   560  H HA   . CYS A 1 39 ? 3.182   1.533   -2.564  1.00 0.00 ? 39 CYS A HA   1 
ATOM   561  H HB2  . CYS A 1 39 ? 4.171   2.248   -4.740  1.00 0.00 ? 39 CYS A HB2  1 
ATOM   562  H HB3  . CYS A 1 39 ? 4.720   0.606   -5.021  1.00 0.00 ? 39 CYS A HB3  1 
ATOM   563  N N    . PRO A 1 40 ? 3.677   -0.858  -1.333  1.00 0.00 ? 40 PRO A N    1 
ATOM   564  C CA   . PRO A 1 40 ? 3.982   -2.198  -0.830  1.00 0.00 ? 40 PRO A CA   1 
ATOM   565  C C    . PRO A 1 40 ? 3.051   -3.299  -1.351  1.00 0.00 ? 40 PRO A C    1 
ATOM   566  O O    . PRO A 1 40 ? 1.852   -3.080  -1.521  1.00 0.00 ? 40 PRO A O    1 
ATOM   567  C CB   . PRO A 1 40 ? 3.940   -2.111  0.698   1.00 0.00 ? 40 PRO A CB   1 
ATOM   568  C CG   . PRO A 1 40 ? 4.231   -0.638  0.970   1.00 0.00 ? 40 PRO A CG   1 
ATOM   569  C CD   . PRO A 1 40 ? 3.566   0.070   -0.209  1.00 0.00 ? 40 PRO A CD   1 
ATOM   570  H HA   . PRO A 1 40 ? 5.014   -2.411  -1.125  1.00 0.00 ? 40 PRO A HA   1 
ATOM   571  H HB2  . PRO A 1 40 ? 2.943   -2.357  1.062   1.00 0.00 ? 40 PRO A HB2  1 
ATOM   572  H HB3  . PRO A 1 40 ? 4.673   -2.768  1.170   1.00 0.00 ? 40 PRO A HB3  1 
ATOM   573  H HG2  . PRO A 1 40 ? 3.840   -0.307  1.931   1.00 0.00 ? 40 PRO A HG2  1 
ATOM   574  H HG3  . PRO A 1 40 ? 5.309   -0.470  0.925   1.00 0.00 ? 40 PRO A HG3  1 
ATOM   575  H HD2  . PRO A 1 40 ? 2.508   0.235   -0.012  1.00 0.00 ? 40 PRO A HD2  1 
ATOM   576  H HD3  . PRO A 1 40 ? 4.045   1.038   -0.324  1.00 0.00 ? 40 PRO A HD3  1 
ATOM   577  N N    . ARG A 1 41 ? 3.625   -4.485  -1.593  1.00 0.00 ? 41 ARG A N    1 
ATOM   578  C CA   . ARG A 1 41 ? 2.954   -5.642  -2.175  1.00 0.00 ? 41 ARG A CA   1 
ATOM   579  C C    . ARG A 1 41 ? 2.035   -6.325  -1.147  1.00 0.00 ? 41 ARG A C    1 
ATOM   580  O O    . ARG A 1 41 ? 2.363   -6.408  0.037   1.00 0.00 ? 41 ARG A O    1 
ATOM   581  C CB   . ARG A 1 41 ? 4.026   -6.601  -2.729  1.00 0.00 ? 41 ARG A CB   1 
ATOM   582  C CG   . ARG A 1 41 ? 3.484   -7.786  -3.549  1.00 0.00 ? 41 ARG A CG   1 
ATOM   583  C CD   . ARG A 1 41 ? 2.588   -7.403  -4.737  1.00 0.00 ? 41 ARG A CD   1 
ATOM   584  N NE   . ARG A 1 41 ? 3.220   -6.418  -5.629  1.00 0.00 ? 41 ARG A NE   1 
ATOM   585  C CZ   . ARG A 1 41 ? 2.754   -6.042  -6.834  1.00 0.00 ? 41 ARG A CZ   1 
ATOM   586  N NH1  . ARG A 1 41 ? 1.673   -6.621  -7.377  1.00 0.00 ? 41 ARG A NH1  1 
ATOM   587  N NH2  . ARG A 1 41 ? 3.384   -5.069  -7.507  1.00 0.00 ? 41 ARG A NH2  1 
ATOM   588  H H    . ARG A 1 41 ? 4.612   -4.580  -1.400  1.00 0.00 ? 41 ARG A H    1 
ATOM   589  H HA   . ARG A 1 41 ? 2.363   -5.274  -3.014  1.00 0.00 ? 41 ARG A HA   1 
ATOM   590  H HB2  . ARG A 1 41 ? 4.711   -6.036  -3.363  1.00 0.00 ? 41 ARG A HB2  1 
ATOM   591  H HB3  . ARG A 1 41 ? 4.611   -7.000  -1.897  1.00 0.00 ? 41 ARG A HB3  1 
ATOM   592  H HG2  . ARG A 1 41 ? 4.338   -8.350  -3.929  1.00 0.00 ? 41 ARG A HG2  1 
ATOM   593  H HG3  . ARG A 1 41 ? 2.918   -8.449  -2.894  1.00 0.00 ? 41 ARG A HG3  1 
ATOM   594  H HD2  . ARG A 1 41 ? 2.361   -8.313  -5.297  1.00 0.00 ? 41 ARG A HD2  1 
ATOM   595  H HD3  . ARG A 1 41 ? 1.651   -6.989  -4.372  1.00 0.00 ? 41 ARG A HD3  1 
ATOM   596  H HE   . ARG A 1 41 ? 4.051   -5.961  -5.283  1.00 0.00 ? 41 ARG A HE   1 
ATOM   597  H HH11 . ARG A 1 41 ? 1.187   -7.354  -6.881  1.00 0.00 ? 41 ARG A HH11 1 
ATOM   598  H HH12 . ARG A 1 41 ? 1.338   -6.321  -8.281  1.00 0.00 ? 41 ARG A HH12 1 
ATOM   599  H HH21 . ARG A 1 41 ? 4.197   -4.622  -7.109  1.00 0.00 ? 41 ARG A HH21 1 
ATOM   600  H HH22 . ARG A 1 41 ? 3.042   -4.778  -8.412  1.00 0.00 ? 41 ARG A HH22 1 
ATOM   601  N N    . ASN A 1 42 ? 0.884   -6.819  -1.623  1.00 0.00 ? 42 ASN A N    1 
ATOM   602  C CA   . ASN A 1 42 ? -0.124  -7.565  -0.881  1.00 0.00 ? 42 ASN A CA   1 
ATOM   603  C C    . ASN A 1 42 ? -0.520  -8.753  -1.774  1.00 0.00 ? 42 ASN A C    1 
ATOM   604  O O    . ASN A 1 42 ? -1.439  -8.627  -2.583  1.00 0.00 ? 42 ASN A O    1 
ATOM   605  C CB   . ASN A 1 42 ? -1.298  -6.627  -0.542  1.00 0.00 ? 42 ASN A CB   1 
ATOM   606  C CG   . ASN A 1 42 ? -2.483  -7.331  0.116   1.00 0.00 ? 42 ASN A CG   1 
ATOM   607  O OD1  . ASN A 1 42 ? -2.627  -7.322  1.337   1.00 0.00 ? 42 ASN A OD1  1 
ATOM   608  N ND2  . ASN A 1 42 ? -3.343  -7.933  -0.705  1.00 0.00 ? 42 ASN A ND2  1 
ATOM   609  H H    . ASN A 1 42 ? 0.707   -6.722  -2.610  1.00 0.00 ? 42 ASN A H    1 
ATOM   610  H HA   . ASN A 1 42 ? 0.266   -7.938  0.069   1.00 0.00 ? 42 ASN A HA   1 
ATOM   611  H HB2  . ASN A 1 42 ? -0.958  -5.853  0.142   1.00 0.00 ? 42 ASN A HB2  1 
ATOM   612  H HB3  . ASN A 1 42 ? -1.640  -6.137  -1.449  1.00 0.00 ? 42 ASN A HB3  1 
ATOM   613  H HD21 . ASN A 1 42 ? -3.175  -7.914  -1.702  1.00 0.00 ? 42 ASN A HD21 1 
ATOM   614  H HD22 . ASN A 1 42 ? -4.148  -8.410  -0.345  1.00 0.00 ? 42 ASN A HD22 1 
ATOM   615  N N    . PRO A 1 43 ? 0.183   -9.896  -1.659  1.00 0.00 ? 43 PRO A N    1 
ATOM   616  C CA   . PRO A 1 43 ? -0.070  -11.114 -2.423  1.00 0.00 ? 43 PRO A CA   1 
ATOM   617  C C    . PRO A 1 43 ? -1.541  -11.550 -2.384  1.00 0.00 ? 43 PRO A C    1 
ATOM   618  O O    . PRO A 1 43 ? -2.280  -11.280 -3.329  1.00 0.00 ? 43 PRO A O    1 
ATOM   619  C CB   . PRO A 1 43 ? 0.929   -12.161 -1.896  1.00 0.00 ? 43 PRO A CB   1 
ATOM   620  C CG   . PRO A 1 43 ? 2.084   -11.300 -1.387  1.00 0.00 ? 43 PRO A CG   1 
ATOM   621  C CD   . PRO A 1 43 ? 1.372   -10.061 -0.840  1.00 0.00 ? 43 PRO A CD   1 
ATOM   622  H HA   . PRO A 1 43 ? 0.191   -10.914 -3.458  1.00 0.00 ? 43 PRO A HA   1 
ATOM   623  H HB2  . PRO A 1 43 ? 0.540   -12.725 -1.048  1.00 0.00 ? 43 PRO A HB2  1 
ATOM   624  H HB3  . PRO A 1 43 ? 1.250   -12.857 -2.673  1.00 0.00 ? 43 PRO A HB3  1 
ATOM   625  H HG2  . PRO A 1 43 ? 2.681   -11.806 -0.627  1.00 0.00 ? 43 PRO A HG2  1 
ATOM   626  H HG3  . PRO A 1 43 ? 2.719   -11.015 -2.228  1.00 0.00 ? 43 PRO A HG3  1 
ATOM   627  H HD2  . PRO A 1 43 ? 1.051   -10.207 0.189   1.00 0.00 ? 43 PRO A HD2  1 
ATOM   628  H HD3  . PRO A 1 43 ? 2.048   -9.207  -0.884  1.00 0.00 ? 43 PRO A HD3  1 
ATOM   629  N N    . HIS A 1 44 ? -1.946  -12.216 -1.295  1.00 0.00 ? 44 HIS A N    1 
ATOM   630  C CA   . HIS A 1 44 ? -3.277  -12.754 -1.011  1.00 0.00 ? 44 HIS A CA   1 
ATOM   631  C C    . HIS A 1 44 ? -4.035  -13.247 -2.255  1.00 0.00 ? 44 HIS A C    1 
ATOM   632  O O    . HIS A 1 44 ? -5.179  -12.860 -2.497  1.00 0.00 ? 44 HIS A O    1 
ATOM   633  C CB   . HIS A 1 44 ? -4.070  -11.740 -0.181  1.00 0.00 ? 44 HIS A CB   1 
ATOM   634  C CG   . HIS A 1 44 ? -3.383  -11.367 1.111   1.00 0.00 ? 44 HIS A CG   1 
ATOM   635  N ND1  . HIS A 1 44 ? -2.421  -10.396 1.267   1.00 0.00 ? 44 HIS A ND1  1 
ATOM   636  C CD2  . HIS A 1 44 ? -3.448  -12.073 2.281   1.00 0.00 ? 44 HIS A CD2  1 
ATOM   637  C CE1  . HIS A 1 44 ? -1.942  -10.499 2.518   1.00 0.00 ? 44 HIS A CE1  1 
ATOM   638  N NE2  . HIS A 1 44 ? -2.536  -11.508 3.177   1.00 0.00 ? 44 HIS A NE2  1 
ATOM   639  H H    . HIS A 1 44 ? -1.276  -12.293 -0.548  1.00 0.00 ? 44 HIS A H    1 
ATOM   640  H HA   . HIS A 1 44 ? -3.122  -13.633 -0.381  1.00 0.00 ? 44 HIS A HA   1 
ATOM   641  H HB2  . HIS A 1 44 ? -4.232  -10.843 -0.775  1.00 0.00 ? 44 HIS A HB2  1 
ATOM   642  H HB3  . HIS A 1 44 ? -5.039  -12.176 0.057   1.00 0.00 ? 44 HIS A HB3  1 
ATOM   643  H HD1  . HIS A 1 44 ? -2.103  -9.751  0.558   1.00 0.00 ? 44 HIS A HD1  1 
ATOM   644  H HD2  . HIS A 1 44 ? -4.045  -12.955 2.443   1.00 0.00 ? 44 HIS A HD2  1 
ATOM   645  H HE1  . HIS A 1 44 ? -1.164  -9.872  2.929   1.00 0.00 ? 44 HIS A HE1  1 
ATOM   646  N N    . LYS A 1 45 ? -3.392  -14.151 -3.006  1.00 0.00 ? 45 LYS A N    1 
ATOM   647  C CA   . LYS A 1 45 ? -3.953  -14.834 -4.165  1.00 0.00 ? 45 LYS A CA   1 
ATOM   648  C C    . LYS A 1 45 ? -5.015  -15.838 -3.695  1.00 0.00 ? 45 LYS A C    1 
ATOM   649  O O    . LYS A 1 45 ? -4.691  -16.971 -3.338  1.00 0.00 ? 45 LYS A O    1 
ATOM   650  C CB   . LYS A 1 45 ? -2.855  -15.526 -4.998  1.00 0.00 ? 45 LYS A CB   1 
ATOM   651  C CG   . LYS A 1 45 ? -1.938  -14.555 -5.765  1.00 0.00 ? 45 LYS A CG   1 
ATOM   652  C CD   . LYS A 1 45 ? -0.736  -14.058 -4.946  1.00 0.00 ? 45 LYS A CD   1 
ATOM   653  C CE   . LYS A 1 45 ? 0.132   -13.068 -5.739  1.00 0.00 ? 45 LYS A CE   1 
ATOM   654  N NZ   . LYS A 1 45 ? -0.590  -11.824 -6.063  1.00 0.00 ? 45 LYS A NZ   1 
ATOM   655  H H    . LYS A 1 45 ? -2.445  -14.364 -2.739  1.00 0.00 ? 45 LYS A H    1 
ATOM   656  H HA   . LYS A 1 45 ? -4.423  -14.091 -4.808  1.00 0.00 ? 45 LYS A HA   1 
ATOM   657  H HB2  . LYS A 1 45 ? -2.256  -16.194 -4.376  1.00 0.00 ? 45 LYS A HB2  1 
ATOM   658  H HB3  . LYS A 1 45 ? -3.358  -16.137 -5.751  1.00 0.00 ? 45 LYS A HB3  1 
ATOM   659  H HG2  . LYS A 1 45 ? -1.543  -15.077 -6.640  1.00 0.00 ? 45 LYS A HG2  1 
ATOM   660  H HG3  . LYS A 1 45 ? -2.531  -13.713 -6.117  1.00 0.00 ? 45 LYS A HG3  1 
ATOM   661  H HD2  . LYS A 1 45 ? -1.072  -13.578 -4.033  1.00 0.00 ? 45 LYS A HD2  1 
ATOM   662  H HD3  . LYS A 1 45 ? -0.121  -14.915 -4.670  1.00 0.00 ? 45 LYS A HD3  1 
ATOM   663  H HE2  . LYS A 1 45 ? 1.008   -12.808 -5.145  1.00 0.00 ? 45 LYS A HE2  1 
ATOM   664  H HE3  . LYS A 1 45 ? 0.470   -13.533 -6.666  1.00 0.00 ? 45 LYS A HE3  1 
ATOM   665  H HZ1  . LYS A 1 45 ? 0.036   -11.180 -6.526  1.00 0.00 ? 45 LYS A HZ1  1 
ATOM   666  H HZ2  . LYS A 1 45 ? -1.367  -12.031 -6.673  1.00 0.00 ? 45 LYS A HZ2  1 
ATOM   667  H HZ3  . LYS A 1 45 ? -0.937  -11.403 -5.212  1.00 0.00 ? 45 LYS A HZ3  1 
ATOM   668  N N    . GLY A 1 46 ? -6.281  -15.400 -3.695  1.00 0.00 ? 46 GLY A N    1 
ATOM   669  C CA   . GLY A 1 46 ? -7.443  -16.174 -3.284  1.00 0.00 ? 46 GLY A CA   1 
ATOM   670  C C    . GLY A 1 46 ? -8.443  -15.258 -2.570  1.00 0.00 ? 46 GLY A C    1 
ATOM   671  O O    . GLY A 1 46 ? -9.372  -14.769 -3.212  1.00 0.00 ? 46 GLY A O    1 
ATOM   672  H H    . GLY A 1 46 ? -6.441  -14.452 -4.003  1.00 0.00 ? 46 GLY A H    1 
ATOM   673  H HA2  . GLY A 1 46 ? -7.906  -16.584 -4.183  1.00 0.00 ? 46 GLY A HA2  1 
ATOM   674  H HA3  . GLY A 1 46 ? -7.169  -17.013 -2.643  1.00 0.00 ? 46 GLY A HA3  1 
ATOM   675  N N    . PRO A 1 47 ? -8.270  -15.016 -1.255  1.00 0.00 ? 47 PRO A N    1 
ATOM   676  C CA   . PRO A 1 47 ? -9.168  -14.188 -0.454  1.00 0.00 ? 47 PRO A CA   1 
ATOM   677  C C    . PRO A 1 47 ? -8.959  -12.696 -0.757  1.00 0.00 ? 47 PRO A C    1 
ATOM   678  O O    . PRO A 1 47 ? -7.832  -12.256 -0.991  1.00 0.00 ? 47 PRO A O    1 
ATOM   679  C CB   . PRO A 1 47 ? -8.824  -14.521 1.003   1.00 0.00 ? 47 PRO A CB   1 
ATOM   680  C CG   . PRO A 1 47 ? -7.333  -14.857 0.934   1.00 0.00 ? 47 PRO A CG   1 
ATOM   681  C CD   . PRO A 1 47 ? -7.205  -15.559 -0.422  1.00 0.00 ? 47 PRO A CD   1 
ATOM   682  H HA   . PRO A 1 47 ? -10.206 -14.470 -0.646  1.00 0.00 ? 47 PRO A HA   1 
ATOM   683  H HB2  . PRO A 1 47 ? -9.037  -13.704 1.696   1.00 0.00 ? 47 PRO A HB2  1 
ATOM   684  H HB3  . PRO A 1 47 ? -9.376  -15.412 1.311   1.00 0.00 ? 47 PRO A HB3  1 
ATOM   685  H HG2  . PRO A 1 47 ? -6.751  -13.933 0.930   1.00 0.00 ? 47 PRO A HG2  1 
ATOM   686  H HG3  . PRO A 1 47 ? -7.013  -15.491 1.762   1.00 0.00 ? 47 PRO A HG3  1 
ATOM   687  H HD2  . PRO A 1 47 ? -6.217  -15.380 -0.847  1.00 0.00 ? 47 PRO A HD2  1 
ATOM   688  H HD3  . PRO A 1 47 ? -7.365  -16.630 -0.290  1.00 0.00 ? 47 PRO A HD3  1 
ATOM   689  N N    . ALA A 1 48 ? -10.055 -11.923 -0.743  1.00 0.00 ? 48 ALA A N    1 
ATOM   690  C CA   . ALA A 1 48 ? -10.067 -10.490 -1.024  1.00 0.00 ? 48 ALA A CA   1 
ATOM   691  C C    . ALA A 1 48 ? -9.325  -9.693  0.061   1.00 0.00 ? 48 ALA A C    1 
ATOM   692  O O    . ALA A 1 48 ? -9.386  -10.037 1.241   1.00 0.00 ? 48 ALA A O    1 
ATOM   693  C CB   . ALA A 1 48 ? -11.516 -10.003 -1.157  1.00 0.00 ? 48 ALA A CB   1 
ATOM   694  H H    . ALA A 1 48 ? -10.943 -12.356 -0.532  1.00 0.00 ? 48 ALA A H    1 
ATOM   695  H HA   . ALA A 1 48 ? -9.581  -10.337 -1.991  1.00 0.00 ? 48 ALA A HA   1 
ATOM   696  H HB1  . ALA A 1 48 ? -11.531 -8.942  -1.412  1.00 0.00 ? 48 ALA A HB1  1 
ATOM   697  H HB2  . ALA A 1 48 ? -12.027 -10.556 -1.947  1.00 0.00 ? 48 ALA A HB2  1 
ATOM   698  H HB3  . ALA A 1 48 ? -12.055 -10.147 -0.219  1.00 0.00 ? 48 ALA A HB3  1 
ATOM   699  N N    . THR A 1 49 ? -8.642  -8.617  -0.359  1.00 0.00 ? 49 THR A N    1 
ATOM   700  C CA   . THR A 1 49 ? -7.904  -7.666  0.475   1.00 0.00 ? 49 THR A CA   1 
ATOM   701  C C    . THR A 1 49 ? -6.932  -8.362  1.448   1.00 0.00 ? 49 THR A C    1 
ATOM   702  O O    . THR A 1 49 ? -6.992  -8.159  2.659   1.00 0.00 ? 49 THR A O    1 
ATOM   703  C CB   . THR A 1 49 ? -8.865  -6.662  1.156   1.00 0.00 ? 49 THR A CB   1 
ATOM   704  O OG1  . THR A 1 49 ? -9.711  -7.296  2.097   1.00 0.00 ? 49 THR A OG1  1 
ATOM   705  C CG2  . THR A 1 49 ? -9.725  -5.904  0.133   1.00 0.00 ? 49 THR A CG2  1 
ATOM   706  H H    . THR A 1 49 ? -8.668  -8.413  -1.347  1.00 0.00 ? 49 THR A H    1 
ATOM   707  H HA   . THR A 1 49 ? -7.281  -7.082  -0.205  1.00 0.00 ? 49 THR A HA   1 
ATOM   708  H HB   . THR A 1 49 ? -8.268  -5.926  1.698   1.00 0.00 ? 49 THR A HB   1 
ATOM   709  H HG1  . THR A 1 49 ? -10.214 -7.980  1.648   1.00 0.00 ? 49 THR A HG1  1 
ATOM   710  H HG21 . THR A 1 49 ? -10.313 -5.139  0.641   1.00 0.00 ? 49 THR A HG21 1 
ATOM   711  H HG22 . THR A 1 49 ? -10.406 -6.585  -0.378  1.00 0.00 ? 49 THR A HG22 1 
ATOM   712  H HG23 . THR A 1 49 ? -9.088  -5.421  -0.608  1.00 0.00 ? 49 THR A HG23 1 
HETATM 713  N N    . NH2 A 1 50 ? -6.015  -9.176  0.917   1.00 0.00 ? 50 NH2 A N    1 
HETATM 714  H HN1  . NH2 A 1 50 ? -5.350  -9.644  1.516   1.00 0.00 ? 50 NH2 A HN1  1 
HETATM 715  H HN2  . NH2 A 1 50 ? -5.987  -9.323  -0.082  1.00 0.00 ? 50 NH2 A HN2  1 
ATOM   716  N N    . GLU A 1 1  ? 14.714  11.949  7.225   1.00 0.00 ? 1  GLU A N    2 
ATOM   717  C CA   . GLU A 1 1  ? 14.382  11.712  5.806   1.00 0.00 ? 1  GLU A CA   2 
ATOM   718  C C    . GLU A 1 1  ? 13.229  10.704  5.657   1.00 0.00 ? 1  GLU A C    2 
ATOM   719  O O    . GLU A 1 1  ? 12.875  10.002  6.607   1.00 0.00 ? 1  GLU A O    2 
ATOM   720  C CB   . GLU A 1 1  ? 15.610  11.246  4.994   1.00 0.00 ? 1  GLU A CB   2 
ATOM   721  C CG   . GLU A 1 1  ? 16.738  12.290  4.888   1.00 0.00 ? 1  GLU A CG   2 
ATOM   722  C CD   . GLU A 1 1  ? 17.519  12.474  6.193   1.00 0.00 ? 1  GLU A CD   2 
ATOM   723  O OE1  . GLU A 1 1  ? 18.273  11.539  6.544   1.00 0.00 ? 1  GLU A OE1  2 
ATOM   724  O OE2  . GLU A 1 1  ? 17.341  13.541  6.822   1.00 0.00 ? 1  GLU A OE2  2 
ATOM   725  H H1   . GLU A 1 1  ? 13.884  12.235  7.722   1.00 0.00 ? 1  GLU A H1   2 
ATOM   726  H H2   . GLU A 1 1  ? 15.411  12.677  7.295   1.00 0.00 ? 1  GLU A H2   2 
ATOM   727  H H3   . GLU A 1 1  ? 15.072  11.098  7.632   1.00 0.00 ? 1  GLU A H3   2 
ATOM   728  H HA   . GLU A 1 1  ? 14.046  12.669  5.400   1.00 0.00 ? 1  GLU A HA   2 
ATOM   729  H HB2  . GLU A 1 1  ? 16.003  10.317  5.412   1.00 0.00 ? 1  GLU A HB2  2 
ATOM   730  H HB3  . GLU A 1 1  ? 15.287  11.037  3.972   1.00 0.00 ? 1  GLU A HB3  2 
ATOM   731  H HG2  . GLU A 1 1  ? 17.443  11.956  4.122   1.00 0.00 ? 1  GLU A HG2  2 
ATOM   732  H HG3  . GLU A 1 1  ? 16.320  13.243  4.555   1.00 0.00 ? 1  GLU A HG3  2 
ATOM   733  N N    . CYS A 1 2  ? 12.649  10.637  4.449   1.00 0.00 ? 2  CYS A N    2 
ATOM   734  C CA   . CYS A 1 2  ? 11.549  9.763   4.078   1.00 0.00 ? 2  CYS A CA   2 
ATOM   735  C C    . CYS A 1 2  ? 11.794  9.165   2.688   1.00 0.00 ? 2  CYS A C    2 
ATOM   736  O O    . CYS A 1 2  ? 11.984  9.896   1.715   1.00 0.00 ? 2  CYS A O    2 
ATOM   737  C CB   . CYS A 1 2  ? 10.238  10.563  4.106   1.00 0.00 ? 2  CYS A CB   2 
ATOM   738  S SG   . CYS A 1 2  ? 10.217  12.150  3.217   1.00 0.00 ? 2  CYS A SG   2 
ATOM   739  H H    . CYS A 1 2  ? 12.940  11.274  3.727   1.00 0.00 ? 2  CYS A H    2 
ATOM   740  H HA   . CYS A 1 2  ? 11.455  8.951   4.802   1.00 0.00 ? 2  CYS A HA   2 
ATOM   741  H HB2  . CYS A 1 2  ? 9.452   9.940   3.696   1.00 0.00 ? 2  CYS A HB2  2 
ATOM   742  H HB3  . CYS A 1 2  ? 10.005  10.765  5.150   1.00 0.00 ? 2  CYS A HB3  2 
ATOM   743  N N    . GLU A 1 3  ? 11.718  7.830   2.595   1.00 0.00 ? 3  GLU A N    2 
ATOM   744  C CA   . GLU A 1 3  ? 11.476  7.117   1.345   1.00 0.00 ? 3  GLU A CA   2 
ATOM   745  C C    . GLU A 1 3  ? 10.016  7.377   0.970   1.00 0.00 ? 3  GLU A C    2 
ATOM   746  O O    . GLU A 1 3  ? 9.118   7.099   1.759   1.00 0.00 ? 3  GLU A O    2 
ATOM   747  C CB   . GLU A 1 3  ? 11.793  5.627   1.515   1.00 0.00 ? 3  GLU A CB   2 
ATOM   748  C CG   . GLU A 1 3  ? 11.530  4.757   0.271   1.00 0.00 ? 3  GLU A CG   2 
ATOM   749  C CD   . GLU A 1 3  ? 10.059  4.354   0.102   1.00 0.00 ? 3  GLU A CD   2 
ATOM   750  O OE1  . GLU A 1 3  ? 9.528   3.715   1.036   1.00 0.00 ? 3  GLU A OE1  2 
ATOM   751  O OE2  . GLU A 1 3  ? 9.493   4.677   -0.967  1.00 0.00 ? 3  GLU A OE2  2 
ATOM   752  H H    . GLU A 1 3  ? 11.577  7.310   3.449   1.00 0.00 ? 3  GLU A H    2 
ATOM   753  H HA   . GLU A 1 3  ? 12.152  7.494   0.578   1.00 0.00 ? 3  GLU A HA   2 
ATOM   754  H HB2  . GLU A 1 3  ? 12.855  5.555   1.746   1.00 0.00 ? 3  GLU A HB2  2 
ATOM   755  H HB3  . GLU A 1 3  ? 11.230  5.247   2.360   1.00 0.00 ? 3  GLU A HB3  2 
ATOM   756  H HG2  . GLU A 1 3  ? 11.894  5.275   -0.618  1.00 0.00 ? 3  GLU A HG2  2 
ATOM   757  H HG3  . GLU A 1 3  ? 12.103  3.833   0.373   1.00 0.00 ? 3  GLU A HG3  2 
ATOM   758  N N    . SER A 1 4  ? 9.805   7.979   -0.203  1.00 0.00 ? 4  SER A N    2 
ATOM   759  C CA   . SER A 1 4  ? 8.541   8.588   -0.619  1.00 0.00 ? 4  SER A CA   2 
ATOM   760  C C    . SER A 1 4  ? 7.823   7.727   -1.665  1.00 0.00 ? 4  SER A C    2 
ATOM   761  O O    . SER A 1 4  ? 8.457   7.018   -2.447  1.00 0.00 ? 4  SER A O    2 
ATOM   762  C CB   . SER A 1 4  ? 8.812   9.995   -1.178  1.00 0.00 ? 4  SER A CB   2 
ATOM   763  O OG   . SER A 1 4  ? 9.365   10.836  -0.185  1.00 0.00 ? 4  SER A OG   2 
ATOM   764  H H    . SER A 1 4  ? 10.615  8.109   -0.789  1.00 0.00 ? 4  SER A H    2 
ATOM   765  H HA   . SER A 1 4  ? 7.881   8.703   0.248   1.00 0.00 ? 4  SER A HA   2 
ATOM   766  H HB2  . SER A 1 4  ? 9.506   9.939   -2.019  1.00 0.00 ? 4  SER A HB2  2 
ATOM   767  H HB3  . SER A 1 4  ? 7.880   10.441  -1.527  1.00 0.00 ? 4  SER A HB3  2 
ATOM   768  H HG   . SER A 1 4  ? 8.734   10.918  0.533   1.00 0.00 ? 4  SER A HG   2 
ATOM   769  N N    . GLY A 1 5  ? 6.486   7.819   -1.684  1.00 0.00 ? 5  GLY A N    2 
ATOM   770  C CA   . GLY A 1 5  ? 5.634   7.121   -2.632  1.00 0.00 ? 5  GLY A CA   2 
ATOM   771  C C    . GLY A 1 5  ? 4.163   7.474   -2.372  1.00 0.00 ? 5  GLY A C    2 
ATOM   772  O O    . GLY A 1 5  ? 3.564   6.781   -1.556  1.00 0.00 ? 5  GLY A O    2 
ATOM   773  H H    . GLY A 1 5  ? 6.035   8.410   -1.001  1.00 0.00 ? 5  GLY A H    2 
ATOM   774  H HA2  . GLY A 1 5  ? 5.945   7.338   -3.651  1.00 0.00 ? 5  GLY A HA2  2 
ATOM   775  H HA3  . GLY A 1 5  ? 5.770   6.051   -2.489  1.00 0.00 ? 5  GLY A HA3  2 
ATOM   776  N N    . PRO A 1 6  ? 3.609   8.525   -3.031  1.00 0.00 ? 6  PRO A N    2 
ATOM   777  C CA   . PRO A 1 6  ? 2.264   9.105   -2.933  1.00 0.00 ? 6  PRO A CA   2 
ATOM   778  C C    . PRO A 1 6  ? 1.118   8.173   -2.526  1.00 0.00 ? 6  PRO A C    2 
ATOM   779  O O    . PRO A 1 6  ? 0.252   7.779   -3.304  1.00 0.00 ? 6  PRO A O    2 
ATOM   780  C CB   . PRO A 1 6  ? 2.045   9.855   -4.246  1.00 0.00 ? 6  PRO A CB   2 
ATOM   781  C CG   . PRO A 1 6  ? 3.429   10.470  -4.443  1.00 0.00 ? 6  PRO A CG   2 
ATOM   782  C CD   . PRO A 1 6  ? 4.373   9.383   -3.915  1.00 0.00 ? 6  PRO A CD   2 
ATOM   783  H HA   . PRO A 1 6  ? 2.343   9.857   -2.144  1.00 0.00 ? 6  PRO A HA   2 
ATOM   784  H HB2  . PRO A 1 6  ? 1.829   9.156   -5.057  1.00 0.00 ? 6  PRO A HB2  2 
ATOM   785  H HB3  . PRO A 1 6  ? 1.260   10.610  -4.175  1.00 0.00 ? 6  PRO A HB3  2 
ATOM   786  H HG2  . PRO A 1 6  ? 3.624   10.719  -5.488  1.00 0.00 ? 6  PRO A HG2  2 
ATOM   787  H HG3  . PRO A 1 6  ? 3.518   11.367  -3.828  1.00 0.00 ? 6  PRO A HG3  2 
ATOM   788  H HD2  . PRO A 1 6  ? 4.735   8.786   -4.745  1.00 0.00 ? 6  PRO A HD2  2 
ATOM   789  H HD3  . PRO A 1 6  ? 5.187   9.827   -3.345  1.00 0.00 ? 6  PRO A HD3  2 
ATOM   790  N N    . CYS A 1 7  ? 1.187   7.876   -1.234  1.00 0.00 ? 7  CYS A N    2 
ATOM   791  C CA   . CYS A 1 7  ? 0.465   6.915   -0.417  1.00 0.00 ? 7  CYS A CA   2 
ATOM   792  C C    . CYS A 1 7  ? 0.901   7.281   0.993   1.00 0.00 ? 7  CYS A C    2 
ATOM   793  O O    . CYS A 1 7  ? 0.112   7.836   1.752   1.00 0.00 ? 7  CYS A O    2 
ATOM   794  C CB   . CYS A 1 7  ? 0.869   5.497   -0.871  1.00 0.00 ? 7  CYS A CB   2 
ATOM   795  S SG   . CYS A 1 7  ? -0.250  4.143   -0.455  1.00 0.00 ? 7  CYS A SG   2 
ATOM   796  H H    . CYS A 1 7  ? 2.088   8.162   -0.871  1.00 0.00 ? 7  CYS A H    2 
ATOM   797  H HA   . CYS A 1 7  ? -0.616  7.065   -0.386  1.00 0.00 ? 7  CYS A HA   2 
ATOM   798  H HB2  . CYS A 1 7  ? 0.966   5.489   -1.953  1.00 0.00 ? 7  CYS A HB2  2 
ATOM   799  H HB3  . CYS A 1 7  ? 1.855   5.252   -0.483  1.00 0.00 ? 7  CYS A HB3  2 
ATOM   800  N N    . CYS A 1 8  ? 2.210   7.176   1.256   1.00 0.00 ? 8  CYS A N    2 
ATOM   801  C CA   . CYS A 1 8  ? 2.839   8.115   2.168   1.00 0.00 ? 8  CYS A CA   2 
ATOM   802  C C    . CYS A 1 8  ? 2.693   9.498   1.528   1.00 0.00 ? 8  CYS A C    2 
ATOM   803  O O    . CYS A 1 8  ? 3.258   9.727   0.458   1.00 0.00 ? 8  CYS A O    2 
ATOM   804  C CB   . CYS A 1 8  ? 4.306   7.785   2.371   1.00 0.00 ? 8  CYS A CB   2 
ATOM   805  S SG   . CYS A 1 8  ? 4.595   6.183   3.145   1.00 0.00 ? 8  CYS A SG   2 
ATOM   806  H H    . CYS A 1 8  ? 2.782   6.819   0.506   1.00 0.00 ? 8  CYS A H    2 
ATOM   807  H HA   . CYS A 1 8  ? 2.338   8.013   3.128   1.00 0.00 ? 8  CYS A HA   2 
ATOM   808  H HB2  . CYS A 1 8  ? 4.801   7.812   1.401   1.00 0.00 ? 8  CYS A HB2  2 
ATOM   809  H HB3  . CYS A 1 8  ? 4.755   8.559   2.996   1.00 0.00 ? 8  CYS A HB3  2 
ATOM   810  N N    . ARG A 1 9  ? 1.868   10.348  2.156   1.00 0.00 ? 9  ARG A N    2 
ATOM   811  C CA   . ARG A 1 9  ? 1.211   11.552  1.618   1.00 0.00 ? 9  ARG A CA   2 
ATOM   812  C C    . ARG A 1 9  ? 1.938   12.112  0.398   1.00 0.00 ? 9  ARG A C    2 
ATOM   813  O O    . ARG A 1 9  ? 1.527   11.948  -0.749  1.00 0.00 ? 9  ARG A O    2 
ATOM   814  C CB   . ARG A 1 9  ? 1.081   12.627  2.715   1.00 0.00 ? 9  ARG A CB   2 
ATOM   815  C CG   . ARG A 1 9  ? -0.176  12.468  3.570   1.00 0.00 ? 9  ARG A CG   2 
ATOM   816  C CD   . ARG A 1 9  ? -0.340  11.076  4.190   1.00 0.00 ? 9  ARG A CD   2 
ATOM   817  N NE   . ARG A 1 9  ? -1.463  11.016  5.137   1.00 0.00 ? 9  ARG A NE   2 
ATOM   818  C CZ   . ARG A 1 9  ? -1.398  11.282  6.456   1.00 0.00 ? 9  ARG A CZ   2 
ATOM   819  N NH1  . ARG A 1 9  ? -0.258  11.691  7.036   1.00 0.00 ? 9  ARG A NH1  2 
ATOM   820  N NH2  . ARG A 1 9  ? -2.497  11.137  7.209   1.00 0.00 ? 9  ARG A NH2  2 
ATOM   821  H H    . ARG A 1 9  ? 1.600   10.042  3.080   1.00 0.00 ? 9  ARG A H    2 
ATOM   822  H HA   . ARG A 1 9  ? 0.209   11.286  1.312   1.00 0.00 ? 9  ARG A HA   2 
ATOM   823  H HB2  . ARG A 1 9  ? 1.969   12.626  3.346   1.00 0.00 ? 9  ARG A HB2  2 
ATOM   824  H HB3  . ARG A 1 9  ? 1.006   13.616  2.258   1.00 0.00 ? 9  ARG A HB3  2 
ATOM   825  H HG2  . ARG A 1 9  ? -0.114  13.219  4.349   1.00 0.00 ? 9  ARG A HG2  2 
ATOM   826  H HG3  . ARG A 1 9  ? -1.033  12.688  2.937   1.00 0.00 ? 9  ARG A HG3  2 
ATOM   827  H HD2  . ARG A 1 9  ? -0.531  10.369  3.384   1.00 0.00 ? 9  ARG A HD2  2 
ATOM   828  H HD3  . ARG A 1 9  ? 0.575   10.779  4.694   1.00 0.00 ? 9  ARG A HD3  2 
ATOM   829  H HE   . ARG A 1 9  ? -2.351  10.723  4.756   1.00 0.00 ? 9  ARG A HE   2 
ATOM   830  H HH11 . ARG A 1 9  ? 0.579   11.816  6.484   1.00 0.00 ? 9  ARG A HH11 2 
ATOM   831  H HH12 . ARG A 1 9  ? -0.236  11.882  8.027   1.00 0.00 ? 9  ARG A HH12 2 
ATOM   832  H HH21 . ARG A 1 9  ? -3.363  10.830  6.789   1.00 0.00 ? 9  ARG A HH21 2 
ATOM   833  H HH22 . ARG A 1 9  ? -2.461  11.335  8.199   1.00 0.00 ? 9  ARG A HH22 2 
ATOM   834  N N    . ASN A 1 10 ? 3.078   12.710  0.722   1.00 0.00 ? 10 ASN A N    2 
ATOM   835  C CA   . ASN A 1 10 ? 4.217   12.986  -0.137  1.00 0.00 ? 10 ASN A CA   2 
ATOM   836  C C    . ASN A 1 10 ? 5.509   12.344  0.413   1.00 0.00 ? 10 ASN A C    2 
ATOM   837  O O    . ASN A 1 10 ? 6.546   12.411  -0.246  1.00 0.00 ? 10 ASN A O    2 
ATOM   838  C CB   . ASN A 1 10 ? 4.373   14.512  -0.240  1.00 0.00 ? 10 ASN A CB   2 
ATOM   839  C CG   . ASN A 1 10 ? 3.388   15.124  -1.241  1.00 0.00 ? 10 ASN A CG   2 
ATOM   840  O OD1  . ASN A 1 10 ? 3.753   15.407  -2.380  1.00 0.00 ? 10 ASN A OD1  2 
ATOM   841  N ND2  . ASN A 1 10 ? 2.135   15.328  -0.822  1.00 0.00 ? 10 ASN A ND2  2 
ATOM   842  H H    . ASN A 1 10 ? 3.197   12.831  1.716   1.00 0.00 ? 10 ASN A H    2 
ATOM   843  H HA   . ASN A 1 10 ? 4.048   12.561  -1.127  1.00 0.00 ? 10 ASN A HA   2 
ATOM   844  H HB2  . ASN A 1 10 ? 4.240   14.976  0.740   1.00 0.00 ? 10 ASN A HB2  2 
ATOM   845  H HB3  . ASN A 1 10 ? 5.393   14.734  -0.542  1.00 0.00 ? 10 ASN A HB3  2 
ATOM   846  H HD21 . ASN A 1 10 ? 1.871   15.081  0.121   1.00 0.00 ? 10 ASN A HD21 2 
ATOM   847  H HD22 . ASN A 1 10 ? 1.452   15.725  -1.450  1.00 0.00 ? 10 ASN A HD22 2 
ATOM   848  N N    . CYS A 1 11 ? 5.466   11.782  1.631   1.00 0.00 ? 11 CYS A N    2 
ATOM   849  C CA   . CYS A 1 11 ? 6.607   11.629  2.535   1.00 0.00 ? 11 CYS A CA   2 
ATOM   850  C C    . CYS A 1 11 ? 6.145   11.067  3.888   1.00 0.00 ? 11 CYS A C    2 
ATOM   851  O O    . CYS A 1 11 ? 6.877   10.303  4.516   1.00 0.00 ? 11 CYS A O    2 
ATOM   852  C CB   . CYS A 1 11 ? 7.288   13.001  2.737   1.00 0.00 ? 11 CYS A CB   2 
ATOM   853  S SG   . CYS A 1 11 ? 8.609   13.149  3.977   1.00 0.00 ? 11 CYS A SG   2 
ATOM   854  H H    . CYS A 1 11 ? 4.550   11.641  2.039   1.00 0.00 ? 11 CYS A H    2 
ATOM   855  H HA   . CYS A 1 11 ? 7.317   10.931  2.091   1.00 0.00 ? 11 CYS A HA   2 
ATOM   856  H HB2  . CYS A 1 11 ? 7.715   13.345  1.795   1.00 0.00 ? 11 CYS A HB2  2 
ATOM   857  H HB3  . CYS A 1 11 ? 6.523   13.721  3.033   1.00 0.00 ? 11 CYS A HB3  2 
ATOM   858  N N    . LYS A 1 12 ? 4.948   11.470  4.348   1.00 0.00 ? 12 LYS A N    2 
ATOM   859  C CA   . LYS A 1 12 ? 4.425   11.163  5.672   1.00 0.00 ? 12 LYS A CA   2 
ATOM   860  C C    . LYS A 1 12 ? 3.743   9.799   5.614   1.00 0.00 ? 12 LYS A C    2 
ATOM   861  O O    . LYS A 1 12 ? 2.735   9.647   4.930   1.00 0.00 ? 12 LYS A O    2 
ATOM   862  C CB   . LYS A 1 12 ? 3.430   12.244  6.135   1.00 0.00 ? 12 LYS A CB   2 
ATOM   863  C CG   . LYS A 1 12 ? 4.042   13.645  6.304   1.00 0.00 ? 12 LYS A CG   2 
ATOM   864  C CD   . LYS A 1 12 ? 4.967   13.732  7.528   1.00 0.00 ? 12 LYS A CD   2 
ATOM   865  C CE   . LYS A 1 12 ? 5.395   15.184  7.792   1.00 0.00 ? 12 LYS A CE   2 
ATOM   866  N NZ   . LYS A 1 12 ? 6.205   15.296  9.017   1.00 0.00 ? 12 LYS A NZ   2 
ATOM   867  H H    . LYS A 1 12 ? 4.336   11.965  3.714   1.00 0.00 ? 12 LYS A H    2 
ATOM   868  H HA   . LYS A 1 12 ? 5.246   11.138  6.393   1.00 0.00 ? 12 LYS A HA   2 
ATOM   869  H HB2  . LYS A 1 12 ? 2.615   12.313  5.417   1.00 0.00 ? 12 LYS A HB2  2 
ATOM   870  H HB3  . LYS A 1 12 ? 2.994   11.943  7.090   1.00 0.00 ? 12 LYS A HB3  2 
ATOM   871  H HG2  . LYS A 1 12 ? 4.586   13.933  5.403   1.00 0.00 ? 12 LYS A HG2  2 
ATOM   872  H HG3  . LYS A 1 12 ? 3.221   14.350  6.445   1.00 0.00 ? 12 LYS A HG3  2 
ATOM   873  H HD2  . LYS A 1 12 ? 4.434   13.357  8.404   1.00 0.00 ? 12 LYS A HD2  2 
ATOM   874  H HD3  . LYS A 1 12 ? 5.856   13.121  7.368   1.00 0.00 ? 12 LYS A HD3  2 
ATOM   875  H HE2  . LYS A 1 12 ? 5.979   15.552  6.947   1.00 0.00 ? 12 LYS A HE2  2 
ATOM   876  H HE3  . LYS A 1 12 ? 4.510   15.810  7.910   1.00 0.00 ? 12 LYS A HE3  2 
ATOM   877  H HZ1  . LYS A 1 12 ? 6.465   16.261  9.163   1.00 0.00 ? 12 LYS A HZ1  2 
ATOM   878  H HZ2  . LYS A 1 12 ? 5.665   14.972  9.808   1.00 0.00 ? 12 LYS A HZ2  2 
ATOM   879  H HZ3  . LYS A 1 12 ? 7.038   14.733  8.927   1.00 0.00 ? 12 LYS A HZ3  2 
ATOM   880  N N    . PHE A 1 13 ? 4.289   8.821   6.347   1.00 0.00 ? 13 PHE A N    2 
ATOM   881  C CA   . PHE A 1 13 ? 3.731   7.480   6.509   1.00 0.00 ? 13 PHE A CA   2 
ATOM   882  C C    . PHE A 1 13 ? 2.267   7.572   6.961   1.00 0.00 ? 13 PHE A C    2 
ATOM   883  O O    . PHE A 1 13 ? 2.004   8.000   8.085   1.00 0.00 ? 13 PHE A O    2 
ATOM   884  C CB   . PHE A 1 13 ? 4.580   6.661   7.494   1.00 0.00 ? 13 PHE A CB   2 
ATOM   885  C CG   . PHE A 1 13 ? 6.024   6.447   7.057   1.00 0.00 ? 13 PHE A CG   2 
ATOM   886  C CD1  . PHE A 1 13 ? 6.374   5.348   6.239   1.00 0.00 ? 13 PHE A CD1  2 
ATOM   887  C CD2  . PHE A 1 13 ? 7.020   7.377   7.442   1.00 0.00 ? 13 PHE A CD2  2 
ATOM   888  C CE1  . PHE A 1 13 ? 7.710   5.180   5.824   1.00 0.00 ? 13 PHE A CE1  2 
ATOM   889  C CE2  . PHE A 1 13 ? 8.354   7.206   7.019   1.00 0.00 ? 13 PHE A CE2  2 
ATOM   890  C CZ   . PHE A 1 13 ? 8.698   6.102   6.212   1.00 0.00 ? 13 PHE A CZ   2 
ATOM   891  H H    . PHE A 1 13 ? 5.137   9.047   6.843   1.00 0.00 ? 13 PHE A H    2 
ATOM   892  H HA   . PHE A 1 13 ? 3.790   6.970   5.552   1.00 0.00 ? 13 PHE A HA   2 
ATOM   893  H HB2  . PHE A 1 13 ? 4.572   7.142   8.475   1.00 0.00 ? 13 PHE A HB2  2 
ATOM   894  H HB3  . PHE A 1 13 ? 4.099   5.691   7.612   1.00 0.00 ? 13 PHE A HB3  2 
ATOM   895  H HD1  . PHE A 1 13 ? 5.621   4.641   5.920   1.00 0.00 ? 13 PHE A HD1  2 
ATOM   896  H HD2  . PHE A 1 13 ? 6.765   8.224   8.061   1.00 0.00 ? 13 PHE A HD2  2 
ATOM   897  H HE1  . PHE A 1 13 ? 7.986   4.368   5.180   1.00 0.00 ? 13 PHE A HE1  2 
ATOM   898  H HE2  . PHE A 1 13 ? 9.112   7.915   7.317   1.00 0.00 ? 13 PHE A HE2  2 
ATOM   899  H HZ   . PHE A 1 13 ? 9.720   5.967   5.889   1.00 0.00 ? 13 PHE A HZ   2 
ATOM   900  N N    . LEU A 1 14 ? 1.320   7.229   6.069   1.00 0.00 ? 14 LEU A N    2 
ATOM   901  C CA   . LEU A 1 14 ? -0.103  7.491   6.256   1.00 0.00 ? 14 LEU A CA   2 
ATOM   902  C C    . LEU A 1 14 ? -0.740  6.557   7.296   1.00 0.00 ? 14 LEU A C    2 
ATOM   903  O O    . LEU A 1 14 ? -0.059  5.907   8.090   1.00 0.00 ? 14 LEU A O    2 
ATOM   904  C CB   . LEU A 1 14 ? -0.834  7.543   4.888   1.00 0.00 ? 14 LEU A CB   2 
ATOM   905  C CG   . LEU A 1 14 ? -0.990  6.281   4.017   1.00 0.00 ? 14 LEU A CG   2 
ATOM   906  C CD1  . LEU A 1 14 ? -1.222  4.956   4.757   1.00 0.00 ? 14 LEU A CD1  2 
ATOM   907  C CD2  . LEU A 1 14 ? -2.178  6.545   3.064   1.00 0.00 ? 14 LEU A CD2  2 
ATOM   908  H H    . LEU A 1 14 ? 1.590   6.863   5.169   1.00 0.00 ? 14 LEU A H    2 
ATOM   909  H HA   . LEU A 1 14 ? -0.193  8.499   6.669   1.00 0.00 ? 14 LEU A HA   2 
ATOM   910  H HB2  . LEU A 1 14 ? -1.823  7.973   4.982   1.00 0.00 ? 14 LEU A HB2  2 
ATOM   911  H HB3  . LEU A 1 14 ? -0.306  8.264   4.277   1.00 0.00 ? 14 LEU A HB3  2 
ATOM   912  H HG   . LEU A 1 14 ? -0.063  6.180   3.455   1.00 0.00 ? 14 LEU A HG   2 
ATOM   913  H HD11 . LEU A 1 14 ? -1.259  4.126   4.057   1.00 0.00 ? 14 LEU A HD11 2 
ATOM   914  H HD12 . LEU A 1 14 ? -0.411  4.751   5.455   1.00 0.00 ? 14 LEU A HD12 2 
ATOM   915  H HD13 . LEU A 1 14 ? -2.180  4.977   5.267   1.00 0.00 ? 14 LEU A HD13 2 
ATOM   916  H HD21 . LEU A 1 14 ? -3.119  6.433   3.605   1.00 0.00 ? 14 LEU A HD21 2 
ATOM   917  H HD22 . LEU A 1 14 ? -2.150  7.561   2.667   1.00 0.00 ? 14 LEU A HD22 2 
ATOM   918  H HD23 . LEU A 1 14 ? -2.177  5.864   2.219   1.00 0.00 ? 14 LEU A HD23 2 
ATOM   919  N N    . LYS A 1 15 ? -2.073  6.508   7.264   1.00 0.00 ? 15 LYS A N    2 
ATOM   920  C CA   . LYS A 1 15 ? -2.925  5.680   8.112   1.00 0.00 ? 15 LYS A CA   2 
ATOM   921  C C    . LYS A 1 15 ? -2.914  4.199   7.675   1.00 0.00 ? 15 LYS A C    2 
ATOM   922  O O    . LYS A 1 15 ? -3.933  3.681   7.222   1.00 0.00 ? 15 LYS A O    2 
ATOM   923  C CB   . LYS A 1 15 ? -4.325  6.314   8.206   1.00 0.00 ? 15 LYS A CB   2 
ATOM   924  C CG   . LYS A 1 15 ? -5.065  6.454   6.865   1.00 0.00 ? 15 LYS A CG   2 
ATOM   925  C CD   . LYS A 1 15 ? -6.243  7.417   7.031   1.00 0.00 ? 15 LYS A CD   2 
ATOM   926  C CE   . LYS A 1 15 ? -7.070  7.490   5.741   1.00 0.00 ? 15 LYS A CE   2 
ATOM   927  N NZ   . LYS A 1 15 ? -8.185  8.446   5.864   1.00 0.00 ? 15 LYS A NZ   2 
ATOM   928  H H    . LYS A 1 15 ? -2.499  7.070   6.545   1.00 0.00 ? 15 LYS A H    2 
ATOM   929  H HA   . LYS A 1 15 ? -2.537  5.735   9.126   1.00 0.00 ? 15 LYS A HA   2 
ATOM   930  H HB2  . LYS A 1 15 ? -4.941  5.733   8.894   1.00 0.00 ? 15 LYS A HB2  2 
ATOM   931  H HB3  . LYS A 1 15 ? -4.202  7.310   8.638   1.00 0.00 ? 15 LYS A HB3  2 
ATOM   932  H HG2  . LYS A 1 15 ? -4.406  6.850   6.092   1.00 0.00 ? 15 LYS A HG2  2 
ATOM   933  H HG3  . LYS A 1 15 ? -5.444  5.487   6.537   1.00 0.00 ? 15 LYS A HG3  2 
ATOM   934  H HD2  . LYS A 1 15 ? -6.881  7.072   7.848   1.00 0.00 ? 15 LYS A HD2  2 
ATOM   935  H HD3  . LYS A 1 15 ? -5.864  8.411   7.276   1.00 0.00 ? 15 LYS A HD3  2 
ATOM   936  H HE2  . LYS A 1 15 ? -6.432  7.804   4.913   1.00 0.00 ? 15 LYS A HE2  2 
ATOM   937  H HE3  . LYS A 1 15 ? -7.480  6.504   5.516   1.00 0.00 ? 15 LYS A HE3  2 
ATOM   938  H HZ1  . LYS A 1 15 ? -8.784  8.169   6.629   1.00 0.00 ? 15 LYS A HZ1  2 
ATOM   939  H HZ2  . LYS A 1 15 ? -7.818  9.369   6.041   1.00 0.00 ? 15 LYS A HZ2  2 
ATOM   940  H HZ3  . LYS A 1 15 ? -8.718  8.455   5.006   1.00 0.00 ? 15 LYS A HZ3  2 
ATOM   941  N N    . GLU A 1 16 ? -1.747  3.540   7.825   1.00 0.00 ? 16 GLU A N    2 
ATOM   942  C CA   . GLU A 1 16 ? -1.403  2.132   7.581   1.00 0.00 ? 16 GLU A CA   2 
ATOM   943  C C    . GLU A 1 16 ? -2.551  1.248   7.067   1.00 0.00 ? 16 GLU A C    2 
ATOM   944  O O    . GLU A 1 16 ? -3.501  0.984   7.803   1.00 0.00 ? 16 GLU A O    2 
ATOM   945  C CB   . GLU A 1 16 ? -0.787  1.558   8.874   1.00 0.00 ? 16 GLU A CB   2 
ATOM   946  C CG   . GLU A 1 16 ? -0.452  0.057   8.794   1.00 0.00 ? 16 GLU A CG   2 
ATOM   947  C CD   . GLU A 1 16 ? 0.365   -0.425  9.995   1.00 0.00 ? 16 GLU A CD   2 
ATOM   948  O OE1  . GLU A 1 16 ? -0.071  -0.147  11.134  1.00 0.00 ? 16 GLU A OE1  2 
ATOM   949  O OE2  . GLU A 1 16 ? 1.409   -1.073  9.762   1.00 0.00 ? 16 GLU A OE2  2 
ATOM   950  H H    . GLU A 1 16 ? -0.976  4.092   8.177   1.00 0.00 ? 16 GLU A H    2 
ATOM   951  H HA   . GLU A 1 16 ? -0.623  2.144   6.815   1.00 0.00 ? 16 GLU A HA   2 
ATOM   952  H HB2  . GLU A 1 16 ? 0.127   2.113   9.093   1.00 0.00 ? 16 GLU A HB2  2 
ATOM   953  H HB3  . GLU A 1 16 ? -1.481  1.710   9.705   1.00 0.00 ? 16 GLU A HB3  2 
ATOM   954  H HG2  . GLU A 1 16 ? -1.373  -0.526  8.758   1.00 0.00 ? 16 GLU A HG2  2 
ATOM   955  H HG3  . GLU A 1 16 ? 0.098   -0.135  7.875   1.00 0.00 ? 16 GLU A HG3  2 
ATOM   956  N N    . GLY A 1 17 ? -2.438  0.772   5.816   1.00 0.00 ? 17 GLY A N    2 
ATOM   957  C CA   . GLY A 1 17 ? -3.421  -0.087  5.171   1.00 0.00 ? 17 GLY A CA   2 
ATOM   958  C C    . GLY A 1 17 ? -4.282  0.713   4.189   1.00 0.00 ? 17 GLY A C    2 
ATOM   959  O O    . GLY A 1 17 ? -5.506  0.600   4.216   1.00 0.00 ? 17 GLY A O    2 
ATOM   960  H H    . GLY A 1 17 ? -1.629  1.017   5.256   1.00 0.00 ? 17 GLY A H    2 
ATOM   961  H HA2  . GLY A 1 17 ? -2.885  -0.865  4.632   1.00 0.00 ? 17 GLY A HA2  2 
ATOM   962  H HA3  . GLY A 1 17 ? -4.056  -0.589  5.902   1.00 0.00 ? 17 GLY A HA3  2 
ATOM   963  N N    . THR A 1 18 ? -3.634  1.500   3.313   1.00 0.00 ? 18 THR A N    2 
ATOM   964  C CA   . THR A 1 18 ? -4.263  2.251   2.226   1.00 0.00 ? 18 THR A CA   2 
ATOM   965  C C    . THR A 1 18 ? -3.522  1.990   0.911   1.00 0.00 ? 18 THR A C    2 
ATOM   966  O O    . THR A 1 18 ? -2.302  2.100   0.872   1.00 0.00 ? 18 THR A O    2 
ATOM   967  C CB   . THR A 1 18 ? -4.247  3.745   2.548   1.00 0.00 ? 18 THR A CB   2 
ATOM   968  O OG1  . THR A 1 18 ? -5.090  4.028   3.649   1.00 0.00 ? 18 THR A OG1  2 
ATOM   969  C CG2  . THR A 1 18 ? -4.657  4.583   1.330   1.00 0.00 ? 18 THR A CG2  2 
ATOM   970  H H    . THR A 1 18 ? -2.629  1.577   3.401   1.00 0.00 ? 18 THR A H    2 
ATOM   971  H HA   . THR A 1 18 ? -5.300  1.948   2.117   1.00 0.00 ? 18 THR A HA   2 
ATOM   972  H HB   . THR A 1 18 ? -3.231  4.003   2.818   1.00 0.00 ? 18 THR A HB   2 
ATOM   973  H HG1  . THR A 1 18 ? -4.997  4.956   3.875   1.00 0.00 ? 18 THR A HG1  2 
ATOM   974  H HG21 . THR A 1 18 ? -5.622  4.246   0.948   1.00 0.00 ? 18 THR A HG21 2 
ATOM   975  H HG22 . THR A 1 18 ? -3.913  4.525   0.534   1.00 0.00 ? 18 THR A HG22 2 
ATOM   976  H HG23 . THR A 1 18 ? -4.747  5.630   1.621   1.00 0.00 ? 18 THR A HG23 2 
ATOM   977  N N    . ILE A 1 19 ? -4.262  1.693   -0.166  1.00 0.00 ? 19 ILE A N    2 
ATOM   978  C CA   . ILE A 1 19 ? -3.723  1.155   -1.414  1.00 0.00 ? 19 ILE A CA   2 
ATOM   979  C C    . ILE A 1 19 ? -3.181  2.243   -2.351  1.00 0.00 ? 19 ILE A C    2 
ATOM   980  O O    . ILE A 1 19 ? -3.827  3.267   -2.576  1.00 0.00 ? 19 ILE A O    2 
ATOM   981  C CB   . ILE A 1 19 ? -4.739  0.242   -2.118  1.00 0.00 ? 19 ILE A CB   2 
ATOM   982  C CG1  . ILE A 1 19 ? -5.294  -0.850  -1.198  1.00 0.00 ? 19 ILE A CG1  2 
ATOM   983  C CG2  . ILE A 1 19 ? -4.165  -0.334  -3.418  1.00 0.00 ? 19 ILE A CG2  2 
ATOM   984  C CD1  . ILE A 1 19 ? -6.656  -1.358  -1.686  1.00 0.00 ? 19 ILE A CD1  2 
ATOM   985  H H    . ILE A 1 19 ? -5.265  1.717   -0.064  1.00 0.00 ? 19 ILE A H    2 
ATOM   986  H HA   . ILE A 1 19 ? -2.926  0.476   -1.157  1.00 0.00 ? 19 ILE A HA   2 
ATOM   987  H HB   . ILE A 1 19 ? -5.581  0.835   -2.390  1.00 0.00 ? 19 ILE A HB   2 
ATOM   988  H HG12 . ILE A 1 19 ? -4.551  -1.639  -1.108  1.00 0.00 ? 19 ILE A HG12 2 
ATOM   989  H HG13 . ILE A 1 19 ? -5.489  -0.439  -0.211  1.00 0.00 ? 19 ILE A HG13 2 
ATOM   990  H HG21 . ILE A 1 19 ? -4.058  0.475   -4.138  1.00 0.00 ? 19 ILE A HG21 2 
ATOM   991  H HG22 . ILE A 1 19 ? -3.193  -0.791  -3.248  1.00 0.00 ? 19 ILE A HG22 2 
ATOM   992  H HG23 . ILE A 1 19 ? -4.834  -1.074  -3.841  1.00 0.00 ? 19 ILE A HG23 2 
ATOM   993  H HD11 . ILE A 1 19 ? -7.034  -2.106  -0.992  1.00 0.00 ? 19 ILE A HD11 2 
ATOM   994  H HD12 . ILE A 1 19 ? -7.365  -0.531  -1.692  1.00 0.00 ? 19 ILE A HD12 2 
ATOM   995  H HD13 . ILE A 1 19 ? -6.615  -1.766  -2.687  1.00 0.00 ? 19 ILE A HD13 2 
ATOM   996  N N    . CYS A 1 20 ? -2.004  1.963   -2.929  1.00 0.00 ? 20 CYS A N    2 
ATOM   997  C CA   . CYS A 1 20 ? -1.363  2.722   -4.006  1.00 0.00 ? 20 CYS A CA   2 
ATOM   998  C C    . CYS A 1 20 ? -2.012  2.473   -5.381  1.00 0.00 ? 20 CYS A C    2 
ATOM   999  O O    . CYS A 1 20 ? -2.390  3.431   -6.054  1.00 0.00 ? 20 CYS A O    2 
ATOM   1000 C CB   . CYS A 1 20 ? 0.162   2.475   -4.046  1.00 0.00 ? 20 CYS A CB   2 
ATOM   1001 S SG   . CYS A 1 20 ? 0.721   0.752   -4.214  1.00 0.00 ? 20 CYS A SG   2 
ATOM   1002 H H    . CYS A 1 20 ? -1.559  1.116   -2.605  1.00 0.00 ? 20 CYS A H    2 
ATOM   1003 H HA   . CYS A 1 20 ? -1.493  3.777   -3.778  1.00 0.00 ? 20 CYS A HA   2 
ATOM   1004 H HB2  . CYS A 1 20 ? 0.582   3.055   -4.869  1.00 0.00 ? 20 CYS A HB2  2 
ATOM   1005 H HB3  . CYS A 1 20 ? 0.604   2.859   -3.126  1.00 0.00 ? 20 CYS A HB3  2 
ATOM   1006 N N    . LYS A 1 21 ? -2.092  1.204   -5.817  1.00 0.00 ? 21 LYS A N    2 
ATOM   1007 C CA   . LYS A 1 21 ? -2.415  0.802   -7.196  1.00 0.00 ? 21 LYS A CA   2 
ATOM   1008 C C    . LYS A 1 21 ? -3.203  -0.527  -7.204  1.00 0.00 ? 21 LYS A C    2 
ATOM   1009 O O    . LYS A 1 21 ? -3.879  -0.849  -6.230  1.00 0.00 ? 21 LYS A O    2 
ATOM   1010 C CB   . LYS A 1 21 ? -1.108  0.704   -8.010  1.00 0.00 ? 21 LYS A CB   2 
ATOM   1011 C CG   . LYS A 1 21 ? -0.364  2.039   -8.141  1.00 0.00 ? 21 LYS A CG   2 
ATOM   1012 C CD   . LYS A 1 21 ? 0.744   1.895   -9.188  1.00 0.00 ? 21 LYS A CD   2 
ATOM   1013 C CE   . LYS A 1 21 ? 1.504   3.213   -9.384  1.00 0.00 ? 21 LYS A CE   2 
ATOM   1014 N NZ   . LYS A 1 21 ? 2.500   3.106   -10.465 1.00 0.00 ? 21 LYS A NZ   2 
ATOM   1015 H H    . LYS A 1 21 ? -1.849  0.474   -5.161  1.00 0.00 ? 21 LYS A H    2 
ATOM   1016 H HA   . LYS A 1 21 ? -3.030  1.559   -7.685  1.00 0.00 ? 21 LYS A HA   2 
ATOM   1017 H HB2  . LYS A 1 21 ? -0.445  -0.043  -7.567  1.00 0.00 ? 21 LYS A HB2  2 
ATOM   1018 H HB3  . LYS A 1 21 ? -1.343  0.394   -9.028  1.00 0.00 ? 21 LYS A HB3  2 
ATOM   1019 H HG2  . LYS A 1 21 ? -1.059  2.815   -8.465  1.00 0.00 ? 21 LYS A HG2  2 
ATOM   1020 H HG3  . LYS A 1 21 ? 0.076   2.326   -7.185  1.00 0.00 ? 21 LYS A HG3  2 
ATOM   1021 H HD2  . LYS A 1 21 ? 1.444   1.116   -8.875  1.00 0.00 ? 21 LYS A HD2  2 
ATOM   1022 H HD3  . LYS A 1 21 ? 0.300   1.603   -10.141 1.00 0.00 ? 21 LYS A HD3  2 
ATOM   1023 H HE2  . LYS A 1 21 ? 0.802   4.006   -9.643  1.00 0.00 ? 21 LYS A HE2  2 
ATOM   1024 H HE3  . LYS A 1 21 ? 2.016   3.483   -8.460  1.00 0.00 ? 21 LYS A HE3  2 
ATOM   1025 H HZ1  . LYS A 1 21 ? 2.031   2.877   -11.331 1.00 0.00 ? 21 LYS A HZ1  2 
ATOM   1026 H HZ2  . LYS A 1 21 ? 2.982   3.987   -10.570 1.00 0.00 ? 21 LYS A HZ2  2 
ATOM   1027 H HZ3  . LYS A 1 21 ? 3.166   2.381   -10.243 1.00 0.00 ? 21 LYS A HZ3  2 
ATOM   1028 N N    . ARG A 1 22 ? -3.086  -1.326  -8.279  1.00 0.00 ? 22 ARG A N    2 
ATOM   1029 C CA   . ARG A 1 22 ? -3.211  -2.779  -8.266  1.00 0.00 ? 22 ARG A CA   2 
ATOM   1030 C C    . ARG A 1 22 ? -4.663  -3.283  -8.305  1.00 0.00 ? 22 ARG A C    2 
ATOM   1031 O O    . ARG A 1 22 ? -5.076  -3.894  -9.292  1.00 0.00 ? 22 ARG A O    2 
ATOM   1032 C CB   . ARG A 1 22 ? -2.363  -3.362  -7.122  1.00 0.00 ? 22 ARG A CB   2 
ATOM   1033 C CG   . ARG A 1 22 ? -2.305  -4.895  -7.168  1.00 0.00 ? 22 ARG A CG   2 
ATOM   1034 C CD   . ARG A 1 22 ? -3.011  -5.450  -5.929  1.00 0.00 ? 22 ARG A CD   2 
ATOM   1035 N NE   . ARG A 1 22 ? -3.135  -6.916  -5.954  1.00 0.00 ? 22 ARG A NE   2 
ATOM   1036 C CZ   . ARG A 1 22 ? -2.155  -7.801  -5.692  1.00 0.00 ? 22 ARG A CZ   2 
ATOM   1037 N NH1  . ARG A 1 22 ? -0.885  -7.415  -5.503  1.00 0.00 ? 22 ARG A NH1  2 
ATOM   1038 N NH2  . ARG A 1 22 ? -2.455  -9.102  -5.610  1.00 0.00 ? 22 ARG A NH2  2 
ATOM   1039 H H    . ARG A 1 22 ? -2.623  -0.965  -9.095  1.00 0.00 ? 22 ARG A H    2 
ATOM   1040 H HA   . ARG A 1 22 ? -2.727  -3.124  -9.178  1.00 0.00 ? 22 ARG A HA   2 
ATOM   1041 H HB2  . ARG A 1 22 ? -1.352  -2.965  -7.211  1.00 0.00 ? 22 ARG A HB2  2 
ATOM   1042 H HB3  . ARG A 1 22 ? -2.744  -3.035  -6.154  1.00 0.00 ? 22 ARG A HB3  2 
ATOM   1043 H HG2  . ARG A 1 22 ? -2.789  -5.274  -8.065  1.00 0.00 ? 22 ARG A HG2  2 
ATOM   1044 H HG3  . ARG A 1 22 ? -1.266  -5.226  -7.181  1.00 0.00 ? 22 ARG A HG3  2 
ATOM   1045 H HD2  . ARG A 1 22 ? -2.457  -5.143  -5.042  1.00 0.00 ? 22 ARG A HD2  2 
ATOM   1046 H HD3  . ARG A 1 22 ? -4.009  -5.025  -5.876  1.00 0.00 ? 22 ARG A HD3  2 
ATOM   1047 H HE   . ARG A 1 22 ? -4.065  -7.279  -6.108  1.00 0.00 ? 22 ARG A HE   2 
ATOM   1048 H HH11 . ARG A 1 22 ? -0.638  -6.435  -5.527  1.00 0.00 ? 22 ARG A HH11 2 
ATOM   1049 H HH12 . ARG A 1 22 ? -0.175  -8.105  -5.294  1.00 0.00 ? 22 ARG A HH12 2 
ATOM   1050 H HH21 . ARG A 1 22 ? -3.407  -9.413  -5.745  1.00 0.00 ? 22 ARG A HH21 2 
ATOM   1051 H HH22 . ARG A 1 22 ? -1.732  -9.774  -5.393  1.00 0.00 ? 22 ARG A HH22 2 
ATOM   1052 N N    . ALA A 1 23 ? -5.419  -3.056  -7.223  1.00 0.00 ? 23 ALA A N    2 
ATOM   1053 C CA   . ALA A 1 23 ? -6.790  -3.521  -7.023  1.00 0.00 ? 23 ALA A CA   2 
ATOM   1054 C C    . ALA A 1 23 ? -7.444  -2.778  -5.848  1.00 0.00 ? 23 ALA A C    2 
ATOM   1055 O O    . ALA A 1 23 ? -6.780  -2.043  -5.120  1.00 0.00 ? 23 ALA A O    2 
ATOM   1056 C CB   . ALA A 1 23 ? -6.809  -5.049  -6.800  1.00 0.00 ? 23 ALA A CB   2 
ATOM   1057 H H    . ALA A 1 23 ? -5.012  -2.509  -6.479  1.00 0.00 ? 23 ALA A H    2 
ATOM   1058 H HA   . ALA A 1 23 ? -7.362  -3.287  -7.921  1.00 0.00 ? 23 ALA A HA   2 
ATOM   1059 H HB1  . ALA A 1 23 ? -7.817  -5.391  -6.562  1.00 0.00 ? 23 ALA A HB1  2 
ATOM   1060 H HB2  . ALA A 1 23 ? -6.489  -5.554  -7.711  1.00 0.00 ? 23 ALA A HB2  2 
ATOM   1061 H HB3  . ALA A 1 23 ? -6.135  -5.339  -6.001  1.00 0.00 ? 23 ALA A HB3  2 
ATOM   1062 N N    . ARG A 1 24 ? -8.754  -2.991  -5.662  1.00 0.00 ? 24 ARG A N    2 
ATOM   1063 C CA   . ARG A 1 24 ? -9.515  -2.595  -4.479  1.00 0.00 ? 24 ARG A CA   2 
ATOM   1064 C C    . ARG A 1 24 ? -10.813 -3.407  -4.452  1.00 0.00 ? 24 ARG A C    2 
ATOM   1065 O O    . ARG A 1 24 ? -11.603 -3.360  -5.395  1.00 0.00 ? 24 ARG A O    2 
ATOM   1066 C CB   . ARG A 1 24 ? -9.780  -1.085  -4.429  1.00 0.00 ? 24 ARG A CB   2 
ATOM   1067 C CG   . ARG A 1 24 ? -10.599 -0.715  -3.179  1.00 0.00 ? 24 ARG A CG   2 
ATOM   1068 C CD   . ARG A 1 24 ? -10.614 0.796   -2.931  1.00 0.00 ? 24 ARG A CD   2 
ATOM   1069 N NE   . ARG A 1 24 ? -9.358  1.267   -2.322  1.00 0.00 ? 24 ARG A NE   2 
ATOM   1070 C CZ   . ARG A 1 24 ? -8.642  2.361   -2.646  1.00 0.00 ? 24 ARG A CZ   2 
ATOM   1071 N NH1  . ARG A 1 24 ? -8.981  3.152   -3.677  1.00 0.00 ? 24 ARG A NH1  2 
ATOM   1072 N NH2  . ARG A 1 24 ? -7.562  2.673   -1.915  1.00 0.00 ? 24 ARG A NH2  2 
ATOM   1073 H H    . ARG A 1 24 ? -9.234  -3.577  -6.330  1.00 0.00 ? 24 ARG A H    2 
ATOM   1074 H HA   . ARG A 1 24 ? -8.922  -2.815  -3.592  1.00 0.00 ? 24 ARG A HA   2 
ATOM   1075 H HB2  . ARG A 1 24 ? -8.825  -0.564  -4.388  1.00 0.00 ? 24 ARG A HB2  2 
ATOM   1076 H HB3  . ARG A 1 24 ? -10.323 -0.775  -5.321  1.00 0.00 ? 24 ARG A HB3  2 
ATOM   1077 H HG2  . ARG A 1 24 ? -11.628 -1.051  -3.321  1.00 0.00 ? 24 ARG A HG2  2 
ATOM   1078 H HG3  . ARG A 1 24 ? -10.196 -1.218  -2.297  1.00 0.00 ? 24 ARG A HG3  2 
ATOM   1079 H HD2  . ARG A 1 24 ? -10.846 1.308   -3.866  1.00 0.00 ? 24 ARG A HD2  2 
ATOM   1080 H HD3  . ARG A 1 24 ? -11.412 1.019   -2.220  1.00 0.00 ? 24 ARG A HD3  2 
ATOM   1081 H HE   . ARG A 1 24 ? -9.036  0.726   -1.532  1.00 0.00 ? 24 ARG A HE   2 
ATOM   1082 H HH11 . ARG A 1 24 ? -9.790  2.942   -4.243  1.00 0.00 ? 24 ARG A HH11 2 
ATOM   1083 H HH12 . ARG A 1 24 ? -8.421  3.966   -3.890  1.00 0.00 ? 24 ARG A HH12 2 
ATOM   1084 H HH21 . ARG A 1 24 ? -7.295  2.091   -1.133  1.00 0.00 ? 24 ARG A HH21 2 
ATOM   1085 H HH22 . ARG A 1 24 ? -7.015  3.491   -2.142  1.00 0.00 ? 24 ARG A HH22 2 
ATOM   1086 N N    . GLY A 1 25 ? -11.014 -4.148  -3.357  1.00 0.00 ? 25 GLY A N    2 
ATOM   1087 C CA   . GLY A 1 25 ? -12.163 -5.015  -3.120  1.00 0.00 ? 25 GLY A CA   2 
ATOM   1088 C C    . GLY A 1 25 ? -12.356 -6.066  -4.224  1.00 0.00 ? 25 GLY A C    2 
ATOM   1089 O O    . GLY A 1 25 ? -13.442 -6.159  -4.795  1.00 0.00 ? 25 GLY A O    2 
ATOM   1090 H H    . GLY A 1 25 ? -10.320 -4.072  -2.628  1.00 0.00 ? 25 GLY A H    2 
ATOM   1091 H HA2  . GLY A 1 25 ? -12.010 -5.530  -2.170  1.00 0.00 ? 25 GLY A HA2  2 
ATOM   1092 H HA3  . GLY A 1 25 ? -13.057 -4.396  -3.029  1.00 0.00 ? 25 GLY A HA3  2 
ATOM   1093 N N    . ASP A 1 26 ? -11.307 -6.854  -4.507  1.00 0.00 ? 26 ASP A N    2 
ATOM   1094 C CA   . ASP A 1 26 ? -11.319 -7.974  -5.448  1.00 0.00 ? 26 ASP A CA   2 
ATOM   1095 C C    . ASP A 1 26 ? -10.574 -9.144  -4.790  1.00 0.00 ? 26 ASP A C    2 
ATOM   1096 O O    . ASP A 1 26 ? -11.199 -9.973  -4.130  1.00 0.00 ? 26 ASP A O    2 
ATOM   1097 C CB   . ASP A 1 26 ? -10.740 -7.538  -6.807  1.00 0.00 ? 26 ASP A CB   2 
ATOM   1098 C CG   . ASP A 1 26 ? -10.671 -8.692  -7.815  1.00 0.00 ? 26 ASP A CG   2 
ATOM   1099 O OD1  . ASP A 1 26 ? -11.733 -9.003  -8.398  1.00 0.00 ? 26 ASP A OD1  2 
ATOM   1100 O OD2  . ASP A 1 26 ? -9.563  -9.248  -7.985  1.00 0.00 ? 26 ASP A OD2  2 
ATOM   1101 H H    . ASP A 1 26 ? -10.445 -6.693  -4.005  1.00 0.00 ? 26 ASP A H    2 
ATOM   1102 H HA   . ASP A 1 26 ? -12.342 -8.295  -5.633  1.00 0.00 ? 26 ASP A HA   2 
ATOM   1103 H HB2  . ASP A 1 26 ? -11.367 -6.747  -7.223  1.00 0.00 ? 26 ASP A HB2  2 
ATOM   1104 H HB3  . ASP A 1 26 ? -9.748  -7.118  -6.656  1.00 0.00 ? 26 ASP A HB3  2 
ATOM   1105 N N    . ASP A 1 27 ? -9.240  -9.182  -4.934  1.00 0.00 ? 27 ASP A N    2 
ATOM   1106 C CA   . ASP A 1 27 ? -8.330  -10.052 -4.209  1.00 0.00 ? 27 ASP A CA   2 
ATOM   1107 C C    . ASP A 1 27 ? -7.956  -9.349  -2.893  1.00 0.00 ? 27 ASP A C    2 
ATOM   1108 O O    . ASP A 1 27 ? -8.851  -8.947  -2.145  1.00 0.00 ? 27 ASP A O    2 
ATOM   1109 C CB   . ASP A 1 27 ? -7.151  -10.420 -5.139  1.00 0.00 ? 27 ASP A CB   2 
ATOM   1110 C CG   . ASP A 1 27 ? -6.321  -9.255  -5.711  1.00 0.00 ? 27 ASP A CG   2 
ATOM   1111 O OD1  . ASP A 1 27 ? -6.715  -8.085  -5.517  1.00 0.00 ? 27 ASP A OD1  2 
ATOM   1112 O OD2  . ASP A 1 27 ? -5.291  -9.565  -6.351  1.00 0.00 ? 27 ASP A OD2  2 
ATOM   1113 H H    . ASP A 1 27 ? -8.781  -8.492  -5.508  1.00 0.00 ? 27 ASP A H    2 
ATOM   1114 H HA   . ASP A 1 27 ? -8.827  -10.986 -3.945  1.00 0.00 ? 27 ASP A HA   2 
ATOM   1115 H HB2  . ASP A 1 27 ? -6.489  -11.080 -4.586  1.00 0.00 ? 27 ASP A HB2  2 
ATOM   1116 H HB3  . ASP A 1 27 ? -7.547  -10.986 -5.984  1.00 0.00 ? 27 ASP A HB3  2 
ATOM   1117 N N    . MET A 1 28 ? -6.659  -9.155  -2.620  1.00 0.00 ? 28 MET A N    2 
ATOM   1118 C CA   . MET A 1 28 ? -6.148  -8.177  -1.680  1.00 0.00 ? 28 MET A CA   2 
ATOM   1119 C C    . MET A 1 28 ? -5.011  -7.416  -2.371  1.00 0.00 ? 28 MET A C    2 
ATOM   1120 O O    . MET A 1 28 ? -4.465  -7.844  -3.391  1.00 0.00 ? 28 MET A O    2 
ATOM   1121 C CB   . MET A 1 28 ? -5.720  -8.850  -0.364  1.00 0.00 ? 28 MET A CB   2 
ATOM   1122 C CG   . MET A 1 28 ? -6.920  -9.425  0.399   1.00 0.00 ? 28 MET A CG   2 
ATOM   1123 S SD   . MET A 1 28 ? -6.554  -10.105 2.041   1.00 0.00 ? 28 MET A SD   2 
ATOM   1124 C CE   . MET A 1 28 ? -6.138  -8.597  2.959   1.00 0.00 ? 28 MET A CE   2 
ATOM   1125 H H    . MET A 1 28 ? -5.944  -9.511  -3.231  1.00 0.00 ? 28 MET A H    2 
ATOM   1126 H HA   . MET A 1 28 ? -6.927  -7.435  -1.478  1.00 0.00 ? 28 MET A HA   2 
ATOM   1127 H HB2  . MET A 1 28 ? -5.026  -9.666  -0.565  1.00 0.00 ? 28 MET A HB2  2 
ATOM   1128 H HB3  . MET A 1 28 ? -5.222  -8.108  0.261   1.00 0.00 ? 28 MET A HB3  2 
ATOM   1129 H HG2  . MET A 1 28 ? -7.677  -8.649  0.502   1.00 0.00 ? 28 MET A HG2  2 
ATOM   1130 H HG3  . MET A 1 28 ? -7.349  -10.238 -0.188  1.00 0.00 ? 28 MET A HG3  2 
ATOM   1131 H HE1  . MET A 1 28 ? -5.223  -8.157  2.566   1.00 0.00 ? 28 MET A HE1  2 
ATOM   1132 H HE2  . MET A 1 28 ? -6.955  -7.880  2.878   1.00 0.00 ? 28 MET A HE2  2 
ATOM   1133 H HE3  . MET A 1 28 ? -5.987  -8.850  4.008   1.00 0.00 ? 28 MET A HE3  2 
ATOM   1134 N N    . ASP A 1 29 ? -4.723  -6.231  -1.834  1.00 0.00 ? 29 ASP A N    2 
ATOM   1135 C CA   . ASP A 1 29 ? -4.244  -5.090  -2.605  1.00 0.00 ? 29 ASP A CA   2 
ATOM   1136 C C    . ASP A 1 29 ? -2.856  -4.601  -2.133  1.00 0.00 ? 29 ASP A C    2 
ATOM   1137 O O    . ASP A 1 29 ? -2.171  -5.341  -1.432  1.00 0.00 ? 29 ASP A O    2 
ATOM   1138 C CB   . ASP A 1 29 ? -5.350  -4.029  -2.579  1.00 0.00 ? 29 ASP A CB   2 
ATOM   1139 C CG   . ASP A 1 29 ? -6.774  -4.594  -2.766  1.00 0.00 ? 29 ASP A CG   2 
ATOM   1140 O OD1  . ASP A 1 29 ? -7.001  -5.273  -3.786  1.00 0.00 ? 29 ASP A OD1  2 
ATOM   1141 O OD2  . ASP A 1 29 ? -7.610  -4.376  -1.861  1.00 0.00 ? 29 ASP A OD2  2 
ATOM   1142 H H    . ASP A 1 29 ? -5.251  -6.005  -1.009  1.00 0.00 ? 29 ASP A H    2 
ATOM   1143 H HA   . ASP A 1 29 ? -4.136  -5.373  -3.644  1.00 0.00 ? 29 ASP A HA   2 
ATOM   1144 H HB2  . ASP A 1 29 ? -5.298  -3.557  -1.607  1.00 0.00 ? 29 ASP A HB2  2 
ATOM   1145 H HB3  . ASP A 1 29 ? -5.142  -3.297  -3.357  1.00 0.00 ? 29 ASP A HB3  2 
ATOM   1146 N N    . ASP A 1 30 ? -2.404  -3.397  -2.537  1.00 0.00 ? 30 ASP A N    2 
ATOM   1147 C CA   . ASP A 1 30 ? -1.005  -2.958  -2.411  1.00 0.00 ? 30 ASP A CA   2 
ATOM   1148 C C    . ASP A 1 30 ? -0.921  -1.686  -1.567  1.00 0.00 ? 30 ASP A C    2 
ATOM   1149 O O    . ASP A 1 30 ? -0.905  -0.576  -2.087  1.00 0.00 ? 30 ASP A O    2 
ATOM   1150 C CB   . ASP A 1 30 ? -0.378  -2.730  -3.799  1.00 0.00 ? 30 ASP A CB   2 
ATOM   1151 C CG   . ASP A 1 30 ? 0.054   -4.004  -4.533  1.00 0.00 ? 30 ASP A CG   2 
ATOM   1152 O OD1  . ASP A 1 30 ? -0.088  -5.103  -3.954  1.00 0.00 ? 30 ASP A OD1  2 
ATOM   1153 O OD2  . ASP A 1 30 ? 0.561   -3.853  -5.666  1.00 0.00 ? 30 ASP A OD2  2 
ATOM   1154 H H    . ASP A 1 30 ? -3.041  -2.741  -2.974  1.00 0.00 ? 30 ASP A H    2 
ATOM   1155 H HA   . ASP A 1 30 ? -0.396  -3.713  -1.904  1.00 0.00 ? 30 ASP A HA   2 
ATOM   1156 H HB2  . ASP A 1 30 ? -1.068  -2.152  -4.411  1.00 0.00 ? 30 ASP A HB2  2 
ATOM   1157 H HB3  . ASP A 1 30 ? 0.529   -2.142  -3.659  1.00 0.00 ? 30 ASP A HB3  2 
ATOM   1158 N N    . TYR A 1 31 ? -0.857  -1.871  -0.251  1.00 0.00 ? 31 TYR A N    2 
ATOM   1159 C CA   . TYR A 1 31 ? -1.005  -0.829  0.767   1.00 0.00 ? 31 TYR A CA   2 
ATOM   1160 C C    . TYR A 1 31 ? 0.339   -0.219  1.202   1.00 0.00 ? 31 TYR A C    2 
ATOM   1161 O O    . TYR A 1 31 ? 1.255   -0.960  1.553   1.00 0.00 ? 31 TYR A O    2 
ATOM   1162 C CB   . TYR A 1 31 ? -1.753  -1.379  2.002   1.00 0.00 ? 31 TYR A CB   2 
ATOM   1163 C CG   . TYR A 1 31 ? -2.922  -2.322  1.723   1.00 0.00 ? 31 TYR A CG   2 
ATOM   1164 C CD1  . TYR A 1 31 ? -2.676  -3.692  1.468   1.00 0.00 ? 31 TYR A CD1  2 
ATOM   1165 C CD2  . TYR A 1 31 ? -4.250  -1.845  1.717   1.00 0.00 ? 31 TYR A CD2  2 
ATOM   1166 C CE1  . TYR A 1 31 ? -3.734  -4.546  1.094   1.00 0.00 ? 31 TYR A CE1  2 
ATOM   1167 C CE2  . TYR A 1 31 ? -5.312  -2.708  1.374   1.00 0.00 ? 31 TYR A CE2  2 
ATOM   1168 C CZ   . TYR A 1 31 ? -5.045  -4.039  0.987   1.00 0.00 ? 31 TYR A CZ   2 
ATOM   1169 O OH   . TYR A 1 31 ? -6.071  -4.885  0.675   1.00 0.00 ? 31 TYR A OH   2 
ATOM   1170 H H    . TYR A 1 31 ? -0.884  -2.839  0.017   1.00 0.00 ? 31 TYR A H    2 
ATOM   1171 H HA   . TYR A 1 31 ? -1.625  -0.039  0.342   1.00 0.00 ? 31 TYR A HA   2 
ATOM   1172 H HB2  . TYR A 1 31 ? -1.065  -1.893  2.676   1.00 0.00 ? 31 TYR A HB2  2 
ATOM   1173 H HB3  . TYR A 1 31 ? -2.112  -0.514  2.553   1.00 0.00 ? 31 TYR A HB3  2 
ATOM   1174 H HD1  . TYR A 1 31 ? -1.673  -4.088  1.530   1.00 0.00 ? 31 TYR A HD1  2 
ATOM   1175 H HD2  . TYR A 1 31 ? -4.457  -0.807  1.914   1.00 0.00 ? 31 TYR A HD2  2 
ATOM   1176 H HE1  . TYR A 1 31 ? -3.539  -5.593  0.909   1.00 0.00 ? 31 TYR A HE1  2 
ATOM   1177 H HE2  . TYR A 1 31 ? -6.328  -2.337  1.377   1.00 0.00 ? 31 TYR A HE2  2 
ATOM   1178 H HH   . TYR A 1 31 ? -6.937  -4.472  0.703   1.00 0.00 ? 31 TYR A HH   2 
ATOM   1179 N N    . CYS A 1 32 ? 0.412   1.126   1.282   1.00 0.00 ? 32 CYS A N    2 
ATOM   1180 C CA   . CYS A 1 32 ? 1.369   1.836   2.147   1.00 0.00 ? 32 CYS A CA   2 
ATOM   1181 C C    . CYS A 1 32 ? 1.029   1.415   3.578   1.00 0.00 ? 32 CYS A C    2 
ATOM   1182 O O    . CYS A 1 32 ? -0.075  1.683   4.061   1.00 0.00 ? 32 CYS A O    2 
ATOM   1183 C CB   . CYS A 1 32 ? 1.346   3.383   2.020   1.00 0.00 ? 32 CYS A CB   2 
ATOM   1184 S SG   . CYS A 1 32 ? -0.212  4.171   1.567   1.00 0.00 ? 32 CYS A SG   2 
ATOM   1185 H H    . CYS A 1 32 ? -0.412  1.630   1.002   1.00 0.00 ? 32 CYS A H    2 
ATOM   1186 H HA   . CYS A 1 32 ? 2.378   1.508   1.884   1.00 0.00 ? 32 CYS A HA   2 
ATOM   1187 H HB2  . CYS A 1 32 ? 1.632   3.823   2.978   1.00 0.00 ? 32 CYS A HB2  2 
ATOM   1188 H HB3  . CYS A 1 32 ? 2.102   3.751   1.328   1.00 0.00 ? 32 CYS A HB3  2 
ATOM   1189 N N    . ASN A 1 33 ? 1.963   0.687   4.201   1.00 0.00 ? 33 ASN A N    2 
ATOM   1190 C CA   . ASN A 1 33 ? 1.713   -0.111  5.401   1.00 0.00 ? 33 ASN A CA   2 
ATOM   1191 C C    . ASN A 1 33 ? 2.449   0.420   6.638   1.00 0.00 ? 33 ASN A C    2 
ATOM   1192 O O    . ASN A 1 33 ? 2.980   -0.369  7.418   1.00 0.00 ? 33 ASN A O    2 
ATOM   1193 C CB   . ASN A 1 33 ? 1.966   -1.593  5.094   1.00 0.00 ? 33 ASN A CB   2 
ATOM   1194 C CG   . ASN A 1 33 ? 3.333   -1.843  4.477   1.00 0.00 ? 33 ASN A CG   2 
ATOM   1195 O OD1  . ASN A 1 33 ? 4.343   -1.285  4.899   1.00 0.00 ? 33 ASN A OD1  2 
ATOM   1196 N ND2  . ASN A 1 33 ? 3.338   -2.674  3.442   1.00 0.00 ? 33 ASN A ND2  2 
ATOM   1197 H H    . ASN A 1 33 ? 2.841   0.547   3.712   1.00 0.00 ? 33 ASN A H    2 
ATOM   1198 H HA   . ASN A 1 33 ? 0.660   -0.092  5.640   1.00 0.00 ? 33 ASN A HA   2 
ATOM   1199 H HB2  . ASN A 1 33 ? 1.876   -2.223  5.976   1.00 0.00 ? 33 ASN A HB2  2 
ATOM   1200 H HB3  . ASN A 1 33 ? 1.185   -1.916  4.399   1.00 0.00 ? 33 ASN A HB3  2 
ATOM   1201 H HD21 . ASN A 1 33 ? 2.472   -3.103  3.156   1.00 0.00 ? 33 ASN A HD21 2 
ATOM   1202 H HD22 . ASN A 1 33 ? 4.194   -2.836  2.950   1.00 0.00 ? 33 ASN A HD22 2 
ATOM   1203 N N    . GLY A 1 34 ? 2.442   1.750   6.841   1.00 0.00 ? 34 GLY A N    2 
ATOM   1204 C CA   . GLY A 1 34 ? 2.959   2.408   8.038   1.00 0.00 ? 34 GLY A CA   2 
ATOM   1205 C C    . GLY A 1 34 ? 4.493   2.494   8.084   1.00 0.00 ? 34 GLY A C    2 
ATOM   1206 O O    . GLY A 1 34 ? 5.039   3.525   8.472   1.00 0.00 ? 34 GLY A O    2 
ATOM   1207 H H    . GLY A 1 34 ? 1.986   2.336   6.156   1.00 0.00 ? 34 GLY A H    2 
ATOM   1208 H HA2  . GLY A 1 34 ? 2.540   3.414   8.069   1.00 0.00 ? 34 GLY A HA2  2 
ATOM   1209 H HA3  . GLY A 1 34 ? 2.616   1.876   8.926   1.00 0.00 ? 34 GLY A HA3  2 
ATOM   1210 N N    . LYS A 1 35 ? 5.183   1.401   7.730   1.00 0.00 ? 35 LYS A N    2 
ATOM   1211 C CA   . LYS A 1 35 ? 6.636   1.250   7.782   1.00 0.00 ? 35 LYS A CA   2 
ATOM   1212 C C    . LYS A 1 35 ? 7.302   1.630   6.451   1.00 0.00 ? 35 LYS A C    2 
ATOM   1213 O O    . LYS A 1 35 ? 8.460   2.048   6.469   1.00 0.00 ? 35 LYS A O    2 
ATOM   1214 C CB   . LYS A 1 35 ? 6.996   -0.191  8.195   1.00 0.00 ? 35 LYS A CB   2 
ATOM   1215 C CG   . LYS A 1 35 ? 6.931   -0.432  9.714   1.00 0.00 ? 35 LYS A CG   2 
ATOM   1216 C CD   . LYS A 1 35 ? 5.555   -0.145  10.338  1.00 0.00 ? 35 LYS A CD   2 
ATOM   1217 C CE   . LYS A 1 35 ? 5.478   -0.599  11.804  1.00 0.00 ? 35 LYS A CE   2 
ATOM   1218 N NZ   . LYS A 1 35 ? 6.431   0.124   12.667  1.00 0.00 ? 35 LYS A NZ   2 
ATOM   1219 H H    . LYS A 1 35 ? 4.658   0.595   7.421   1.00 0.00 ? 35 LYS A H    2 
ATOM   1220 H HA   . LYS A 1 35 ? 7.047   1.921   8.539   1.00 0.00 ? 35 LYS A HA   2 
ATOM   1221 H HB2  . LYS A 1 35 ? 6.351   -0.905  7.677   1.00 0.00 ? 35 LYS A HB2  2 
ATOM   1222 H HB3  . LYS A 1 35 ? 8.024   -0.403  7.895   1.00 0.00 ? 35 LYS A HB3  2 
ATOM   1223 H HG2  . LYS A 1 35 ? 7.189   -1.477  9.899   1.00 0.00 ? 35 LYS A HG2  2 
ATOM   1224 H HG3  . LYS A 1 35 ? 7.682   0.194   10.198  1.00 0.00 ? 35 LYS A HG3  2 
ATOM   1225 H HD2  . LYS A 1 35 ? 5.346   0.925   10.302  1.00 0.00 ? 35 LYS A HD2  2 
ATOM   1226 H HD3  . LYS A 1 35 ? 4.787   -0.673  9.772   1.00 0.00 ? 35 LYS A HD3  2 
ATOM   1227 H HE2  . LYS A 1 35 ? 4.472   -0.417  12.180  1.00 0.00 ? 35 LYS A HE2  2 
ATOM   1228 H HE3  . LYS A 1 35 ? 5.684   -1.669  11.869  1.00 0.00 ? 35 LYS A HE3  2 
ATOM   1229 H HZ1  . LYS A 1 35 ? 6.328   -0.190  13.621  1.00 0.00 ? 35 LYS A HZ1  2 
ATOM   1230 H HZ2  . LYS A 1 35 ? 7.374   -0.056  12.356  1.00 0.00 ? 35 LYS A HZ2  2 
ATOM   1231 H HZ3  . LYS A 1 35 ? 6.244   1.115   12.619  1.00 0.00 ? 35 LYS A HZ3  2 
ATOM   1232 N N    . THR A 1 36 ? 6.604   1.480   5.312   1.00 0.00 ? 36 THR A N    2 
ATOM   1233 C CA   . THR A 1 36 ? 7.144   1.777   3.984   1.00 0.00 ? 36 THR A CA   2 
ATOM   1234 C C    . THR A 1 36 ? 6.086   2.297   3.001   1.00 0.00 ? 36 THR A C    2 
ATOM   1235 O O    . THR A 1 36 ? 4.884   2.068   3.147   1.00 0.00 ? 36 THR A O    2 
ATOM   1236 C CB   . THR A 1 36 ? 7.957   0.592   3.433   1.00 0.00 ? 36 THR A CB   2 
ATOM   1237 O OG1  . THR A 1 36 ? 8.452   0.859   2.133   1.00 0.00 ? 36 THR A OG1  2 
ATOM   1238 C CG2  . THR A 1 36 ? 7.157   -0.717  3.417   1.00 0.00 ? 36 THR A CG2  2 
ATOM   1239 H H    . THR A 1 36 ? 5.660   1.124   5.366   1.00 0.00 ? 36 THR A H    2 
ATOM   1240 H HA   . THR A 1 36 ? 7.872   2.580   4.094   1.00 0.00 ? 36 THR A HA   2 
ATOM   1241 H HB   . THR A 1 36 ? 8.828   0.486   4.078   1.00 0.00 ? 36 THR A HB   2 
ATOM   1242 H HG1  . THR A 1 36 ? 8.952   1.678   2.155   1.00 0.00 ? 36 THR A HG1  2 
ATOM   1243 H HG21 . THR A 1 36 ? 6.237   -0.590  2.847   1.00 0.00 ? 36 THR A HG21 2 
ATOM   1244 H HG22 . THR A 1 36 ? 6.913   -1.019  4.436   1.00 0.00 ? 36 THR A HG22 2 
ATOM   1245 H HG23 . THR A 1 36 ? 7.752   -1.508  2.960   1.00 0.00 ? 36 THR A HG23 2 
ATOM   1246 N N    . CYS A 1 37 ? 6.609   3.027   2.005   1.00 0.00 ? 37 CYS A N    2 
ATOM   1247 C CA   . CYS A 1 37 ? 5.916   3.802   0.977   1.00 0.00 ? 37 CYS A CA   2 
ATOM   1248 C C    . CYS A 1 37 ? 6.137   3.264   -0.442  1.00 0.00 ? 37 CYS A C    2 
ATOM   1249 O O    . CYS A 1 37 ? 5.602   3.836   -1.389  1.00 0.00 ? 37 CYS A O    2 
ATOM   1250 C CB   . CYS A 1 37 ? 6.435   5.250   1.044   1.00 0.00 ? 37 CYS A CB   2 
ATOM   1251 S SG   . CYS A 1 37 ? 6.540   5.934   2.717   1.00 0.00 ? 37 CYS A SG   2 
ATOM   1252 H H    . CYS A 1 37 ? 7.616   3.115   2.027   1.00 0.00 ? 37 CYS A H    2 
ATOM   1253 H HA   . CYS A 1 37 ? 4.843   3.775   1.153   1.00 0.00 ? 37 CYS A HA   2 
ATOM   1254 H HB2  . CYS A 1 37 ? 7.437   5.300   0.623   1.00 0.00 ? 37 CYS A HB2  2 
ATOM   1255 H HB3  . CYS A 1 37 ? 5.797   5.892   0.437   1.00 0.00 ? 37 CYS A HB3  2 
ATOM   1256 N N    . ASP A 1 38 ? 6.938   2.202   -0.590  1.00 0.00 ? 38 ASP A N    2 
ATOM   1257 C CA   . ASP A 1 38 ? 7.446   1.693   -1.862  1.00 0.00 ? 38 ASP A CA   2 
ATOM   1258 C C    . ASP A 1 38 ? 6.388   0.809   -2.547  1.00 0.00 ? 38 ASP A C    2 
ATOM   1259 O O    . ASP A 1 38 ? 6.647   -0.364  -2.819  1.00 0.00 ? 38 ASP A O    2 
ATOM   1260 C CB   . ASP A 1 38 ? 8.778   0.961   -1.583  1.00 0.00 ? 38 ASP A CB   2 
ATOM   1261 C CG   . ASP A 1 38 ? 9.505   0.529   -2.859  1.00 0.00 ? 38 ASP A CG   2 
ATOM   1262 O OD1  . ASP A 1 38 ? 9.903   1.434   -3.624  1.00 0.00 ? 38 ASP A OD1  2 
ATOM   1263 O OD2  . ASP A 1 38 ? 9.654   -0.699  -3.049  1.00 0.00 ? 38 ASP A OD2  2 
ATOM   1264 H H    . ASP A 1 38 ? 7.277   1.774   0.257   1.00 0.00 ? 38 ASP A H    2 
ATOM   1265 H HA   . ASP A 1 38 ? 7.662   2.539   -2.518  1.00 0.00 ? 38 ASP A HA   2 
ATOM   1266 H HB2  . ASP A 1 38 ? 9.446   1.628   -1.035  1.00 0.00 ? 38 ASP A HB2  2 
ATOM   1267 H HB3  . ASP A 1 38 ? 8.589   0.094   -0.946  1.00 0.00 ? 38 ASP A HB3  2 
ATOM   1268 N N    . CYS A 1 39 ? 5.198   1.391   -2.804  1.00 0.00 ? 39 CYS A N    2 
ATOM   1269 C CA   . CYS A 1 39 ? 3.956   0.786   -3.298  1.00 0.00 ? 39 CYS A CA   2 
ATOM   1270 C C    . CYS A 1 39 ? 3.923   -0.741  -3.089  1.00 0.00 ? 39 CYS A C    2 
ATOM   1271 O O    . CYS A 1 39 ? 4.026   -1.489  -4.060  1.00 0.00 ? 39 CYS A O    2 
ATOM   1272 C CB   . CYS A 1 39 ? 3.728   1.250   -4.750  1.00 0.00 ? 39 CYS A CB   2 
ATOM   1273 S SG   . CYS A 1 39 ? 2.215   0.712   -5.603  1.00 0.00 ? 39 CYS A SG   2 
ATOM   1274 H H    . CYS A 1 39 ? 5.124   2.371   -2.571  1.00 0.00 ? 39 CYS A H    2 
ATOM   1275 H HA   . CYS A 1 39 ? 3.148   1.218   -2.705  1.00 0.00 ? 39 CYS A HA   2 
ATOM   1276 H HB2  . CYS A 1 39 ? 3.705   2.341   -4.751  1.00 0.00 ? 39 CYS A HB2  2 
ATOM   1277 H HB3  . CYS A 1 39 ? 4.573   0.939   -5.365  1.00 0.00 ? 39 CYS A HB3  2 
ATOM   1278 N N    . PRO A 1 40 ? 3.865   -1.203  -1.820  1.00 0.00 ? 40 PRO A N    2 
ATOM   1279 C CA   . PRO A 1 40 ? 4.227   -2.565  -1.426  1.00 0.00 ? 40 PRO A CA   2 
ATOM   1280 C C    . PRO A 1 40 ? 3.460   -3.673  -2.159  1.00 0.00 ? 40 PRO A C    2 
ATOM   1281 O O    . PRO A 1 40 ? 2.253   -3.567  -2.365  1.00 0.00 ? 40 PRO A O    2 
ATOM   1282 C CB   . PRO A 1 40 ? 4.006   -2.637  0.089   1.00 0.00 ? 40 PRO A CB   2 
ATOM   1283 C CG   . PRO A 1 40 ? 4.277   -1.197  0.522   1.00 0.00 ? 40 PRO A CG   2 
ATOM   1284 C CD   . PRO A 1 40 ? 3.666   -0.391  -0.622  1.00 0.00 ? 40 PRO A CD   2 
ATOM   1285 H HA   . PRO A 1 40 ? 5.299   -2.667  -1.613  1.00 0.00 ? 40 PRO A HA   2 
ATOM   1286 H HB2  . PRO A 1 40 ? 2.969   -2.897  0.307   1.00 0.00 ? 40 PRO A HB2  2 
ATOM   1287 H HB3  . PRO A 1 40 ? 4.675   -3.350  0.572   1.00 0.00 ? 40 PRO A HB3  2 
ATOM   1288 H HG2  . PRO A 1 40 ? 3.842   -0.941  1.486   1.00 0.00 ? 40 PRO A HG2  2 
ATOM   1289 H HG3  . PRO A 1 40 ? 5.355   -1.028  0.549   1.00 0.00 ? 40 PRO A HG3  2 
ATOM   1290 H HD2  . PRO A 1 40 ? 2.594   -0.269  -0.476  1.00 0.00 ? 40 PRO A HD2  2 
ATOM   1291 H HD3  . PRO A 1 40 ? 4.128   0.594   -0.623  1.00 0.00 ? 40 PRO A HD3  2 
ATOM   1292 N N    . ARG A 1 41 ? 4.179   -4.742  -2.529  1.00 0.00 ? 41 ARG A N    2 
ATOM   1293 C CA   . ARG A 1 41 ? 3.649   -5.917  -3.215  1.00 0.00 ? 41 ARG A CA   2 
ATOM   1294 C C    . ARG A 1 41 ? 2.924   -6.834  -2.222  1.00 0.00 ? 41 ARG A C    2 
ATOM   1295 O O    . ARG A 1 41 ? 3.379   -7.025  -1.093  1.00 0.00 ? 41 ARG A O    2 
ATOM   1296 C CB   . ARG A 1 41 ? 4.791   -6.650  -3.945  1.00 0.00 ? 41 ARG A CB   2 
ATOM   1297 C CG   . ARG A 1 41 ? 4.323   -7.956  -4.613  1.00 0.00 ? 41 ARG A CG   2 
ATOM   1298 C CD   . ARG A 1 41 ? 5.374   -8.531  -5.574  1.00 0.00 ? 41 ARG A CD   2 
ATOM   1299 N NE   . ARG A 1 41 ? 5.424   -7.774  -6.837  1.00 0.00 ? 41 ARG A NE   2 
ATOM   1300 C CZ   . ARG A 1 41 ? 6.409   -6.968  -7.277  1.00 0.00 ? 41 ARG A CZ   2 
ATOM   1301 N NH1  . ARG A 1 41 ? 7.522   -6.744  -6.560  1.00 0.00 ? 41 ARG A NH1  2 
ATOM   1302 N NH2  . ARG A 1 41 ? 6.274   -6.373  -8.470  1.00 0.00 ? 41 ARG A NH2  2 
ATOM   1303 H H    . ARG A 1 41 ? 5.159   -4.755  -2.281  1.00 0.00 ? 41 ARG A H    2 
ATOM   1304 H HA   . ARG A 1 41 ? 2.945   -5.575  -3.979  1.00 0.00 ? 41 ARG A HA   2 
ATOM   1305 H HB2  . ARG A 1 41 ? 5.194   -5.979  -4.705  1.00 0.00 ? 41 ARG A HB2  2 
ATOM   1306 H HB3  . ARG A 1 41 ? 5.591   -6.887  -3.241  1.00 0.00 ? 41 ARG A HB3  2 
ATOM   1307 H HG2  . ARG A 1 41 ? 4.129   -8.697  -3.836  1.00 0.00 ? 41 ARG A HG2  2 
ATOM   1308 H HG3  . ARG A 1 41 ? 3.393   -7.784  -5.159  1.00 0.00 ? 41 ARG A HG3  2 
ATOM   1309 H HD2  . ARG A 1 41 ? 6.343   -8.580  -5.077  1.00 0.00 ? 41 ARG A HD2  2 
ATOM   1310 H HD3  . ARG A 1 41 ? 5.082   -9.550  -5.828  1.00 0.00 ? 41 ARG A HD3  2 
ATOM   1311 H HE   . ARG A 1 41 ? 4.617   -7.883  -7.436  1.00 0.00 ? 41 ARG A HE   2 
ATOM   1312 H HH11 . ARG A 1 41 ? 7.646   -7.175  -5.655  1.00 0.00 ? 41 ARG A HH11 2 
ATOM   1313 H HH12 . ARG A 1 41 ? 8.241   -6.138  -6.927  1.00 0.00 ? 41 ARG A HH12 2 
ATOM   1314 H HH21 . ARG A 1 41 ? 5.441   -6.530  -9.022  1.00 0.00 ? 41 ARG A HH21 2 
ATOM   1315 H HH22 . ARG A 1 41 ? 7.002   -5.767  -8.821  1.00 0.00 ? 41 ARG A HH22 2 
ATOM   1316 N N    . ASN A 1 42 ? 1.798   -7.408  -2.669  1.00 0.00 ? 42 ASN A N    2 
ATOM   1317 C CA   . ASN A 1 42 ? 0.955   -8.341  -1.945  1.00 0.00 ? 42 ASN A CA   2 
ATOM   1318 C C    . ASN A 1 42 ? 0.863   -9.639  -2.773  1.00 0.00 ? 42 ASN A C    2 
ATOM   1319 O O    . ASN A 1 42 ? 0.223   -9.634  -3.825  1.00 0.00 ? 42 ASN A O    2 
ATOM   1320 C CB   . ASN A 1 42 ? -0.414  -7.693  -1.712  1.00 0.00 ? 42 ASN A CB   2 
ATOM   1321 C CG   . ASN A 1 42 ? -1.369  -8.607  -0.949  1.00 0.00 ? 42 ASN A CG   2 
ATOM   1322 O OD1  . ASN A 1 42 ? -1.049  -9.072  0.142   1.00 0.00 ? 42 ASN A OD1  2 
ATOM   1323 N ND2  . ASN A 1 42 ? -2.546  -8.861  -1.519  1.00 0.00 ? 42 ASN A ND2  2 
ATOM   1324 H H    . ASN A 1 42 ? 1.500   -7.207  -3.607  1.00 0.00 ? 42 ASN A H    2 
ATOM   1325 H HA   . ASN A 1 42 ? 1.364   -8.509  -0.950  1.00 0.00 ? 42 ASN A HA   2 
ATOM   1326 H HB2  . ASN A 1 42 ? -0.265  -6.810  -1.094  1.00 0.00 ? 42 ASN A HB2  2 
ATOM   1327 H HB3  . ASN A 1 42 ? -0.852  -7.384  -2.663  1.00 0.00 ? 42 ASN A HB3  2 
ATOM   1328 H HD21 . ASN A 1 42 ? -2.808  -8.415  -2.387  1.00 0.00 ? 42 ASN A HD21 2 
ATOM   1329 H HD22 . ASN A 1 42 ? -3.210  -9.455  -1.052  1.00 0.00 ? 42 ASN A HD22 2 
ATOM   1330 N N    . PRO A 1 43 ? 1.496   -10.737 -2.312  1.00 0.00 ? 43 PRO A N    2 
ATOM   1331 C CA   . PRO A 1 43 ? 1.523   -12.068 -2.927  1.00 0.00 ? 43 PRO A CA   2 
ATOM   1332 C C    . PRO A 1 43 ? 0.215   -12.645 -3.497  1.00 0.00 ? 43 PRO A C    2 
ATOM   1333 O O    . PRO A 1 43 ? 0.270   -13.571 -4.305  1.00 0.00 ? 43 PRO A O    2 
ATOM   1334 C CB   . PRO A 1 43 ? 2.068   -12.994 -1.836  1.00 0.00 ? 43 PRO A CB   2 
ATOM   1335 C CG   . PRO A 1 43 ? 3.051   -12.094 -1.094  1.00 0.00 ? 43 PRO A CG   2 
ATOM   1336 C CD   . PRO A 1 43 ? 2.367   -10.728 -1.145  1.00 0.00 ? 43 PRO A CD   2 
ATOM   1337 H HA   . PRO A 1 43 ? 2.252   -12.022 -3.731  1.00 0.00 ? 43 PRO A HA   2 
ATOM   1338 H HB2  . PRO A 1 43 ? 1.269   -13.289 -1.151  1.00 0.00 ? 43 PRO A HB2  2 
ATOM   1339 H HB3  . PRO A 1 43 ? 2.548   -13.882 -2.249  1.00 0.00 ? 43 PRO A HB3  2 
ATOM   1340 H HG2  . PRO A 1 43 ? 3.235   -12.430 -0.072  1.00 0.00 ? 43 PRO A HG2  2 
ATOM   1341 H HG3  . PRO A 1 43 ? 3.992   -12.055 -1.648  1.00 0.00 ? 43 PRO A HG3  2 
ATOM   1342 H HD2  . PRO A 1 43 ? 1.748   -10.566 -0.264  1.00 0.00 ? 43 PRO A HD2  2 
ATOM   1343 H HD3  . PRO A 1 43 ? 3.126   -9.947  -1.210  1.00 0.00 ? 43 PRO A HD3  2 
ATOM   1344 N N    . HIS A 1 44 ? -0.945  -12.145 -3.052  1.00 0.00 ? 44 HIS A N    2 
ATOM   1345 C CA   . HIS A 1 44 ? -2.264  -12.739 -3.276  1.00 0.00 ? 44 HIS A CA   2 
ATOM   1346 C C    . HIS A 1 44 ? -2.849  -12.259 -4.608  1.00 0.00 ? 44 HIS A C    2 
ATOM   1347 O O    . HIS A 1 44 ? -3.895  -11.613 -4.654  1.00 0.00 ? 44 HIS A O    2 
ATOM   1348 C CB   . HIS A 1 44 ? -3.188  -12.436 -2.084  1.00 0.00 ? 44 HIS A CB   2 
ATOM   1349 C CG   . HIS A 1 44 ? -2.559  -12.711 -0.742  1.00 0.00 ? 44 HIS A CG   2 
ATOM   1350 N ND1  . HIS A 1 44 ? -2.156  -11.756 0.162   1.00 0.00 ? 44 HIS A ND1  2 
ATOM   1351 C CD2  . HIS A 1 44 ? -2.017  -13.904 -0.345  1.00 0.00 ? 44 HIS A CD2  2 
ATOM   1352 C CE1  . HIS A 1 44 ? -1.392  -12.366 1.083   1.00 0.00 ? 44 HIS A CE1  2 
ATOM   1353 N NE2  . HIS A 1 44 ? -1.281  -13.678 0.820   1.00 0.00 ? 44 HIS A NE2  2 
ATOM   1354 H H    . HIS A 1 44 ? -0.891  -11.355 -2.436  1.00 0.00 ? 44 HIS A H    2 
ATOM   1355 H HA   . HIS A 1 44 ? -2.160  -13.825 -3.325  1.00 0.00 ? 44 HIS A HA   2 
ATOM   1356 H HB2  . HIS A 1 44 ? -3.468  -11.386 -2.116  1.00 0.00 ? 44 HIS A HB2  2 
ATOM   1357 H HB3  . HIS A 1 44 ? -4.094  -13.033 -2.185  1.00 0.00 ? 44 HIS A HB3  2 
ATOM   1358 H HD1  . HIS A 1 44 ? -2.332  -10.763 0.104   1.00 0.00 ? 44 HIS A HD1  2 
ATOM   1359 H HD2  . HIS A 1 44 ? -2.066  -14.825 -0.903  1.00 0.00 ? 44 HIS A HD2  2 
ATOM   1360 H HE1  . HIS A 1 44 ? -0.899  -11.854 1.895   1.00 0.00 ? 44 HIS A HE1  2 
ATOM   1361 N N    . LYS A 1 45 ? -2.175  -12.645 -5.697  1.00 0.00 ? 45 LYS A N    2 
ATOM   1362 C CA   . LYS A 1 45 ? -2.549  -12.356 -7.078  1.00 0.00 ? 45 LYS A CA   2 
ATOM   1363 C C    . LYS A 1 45 ? -3.916  -12.971 -7.433  1.00 0.00 ? 45 LYS A C    2 
ATOM   1364 O O    . LYS A 1 45 ? -4.337  -13.959 -6.828  1.00 0.00 ? 45 LYS A O    2 
ATOM   1365 C CB   . LYS A 1 45 ? -1.463  -12.848 -8.055  1.00 0.00 ? 45 LYS A CB   2 
ATOM   1366 C CG   . LYS A 1 45 ? -0.009  -12.485 -7.696  1.00 0.00 ? 45 LYS A CG   2 
ATOM   1367 C CD   . LYS A 1 45 ? 0.180   -11.043 -7.193  1.00 0.00 ? 45 LYS A CD   2 
ATOM   1368 C CE   . LYS A 1 45 ? 1.642   -10.580 -7.273  1.00 0.00 ? 45 LYS A CE   2 
ATOM   1369 N NZ   . LYS A 1 45 ? 2.559   -11.491 -6.566  1.00 0.00 ? 45 LYS A NZ   2 
ATOM   1370 H H    . LYS A 1 45 ? -1.311  -13.132 -5.519  1.00 0.00 ? 45 LYS A H    2 
ATOM   1371 H HA   . LYS A 1 45 ? -2.618  -11.273 -7.173  1.00 0.00 ? 45 LYS A HA   2 
ATOM   1372 H HB2  . LYS A 1 45 ? -1.519  -13.934 -8.144  1.00 0.00 ? 45 LYS A HB2  2 
ATOM   1373 H HB3  . LYS A 1 45 ? -1.682  -12.426 -9.037  1.00 0.00 ? 45 LYS A HB3  2 
ATOM   1374 H HG2  . LYS A 1 45 ? 0.353   -13.174 -6.931  1.00 0.00 ? 45 LYS A HG2  2 
ATOM   1375 H HG3  . LYS A 1 45 ? 0.598   -12.637 -8.590  1.00 0.00 ? 45 LYS A HG3  2 
ATOM   1376 H HD2  . LYS A 1 45 ? -0.416  -10.368 -7.806  1.00 0.00 ? 45 LYS A HD2  2 
ATOM   1377 H HD3  . LYS A 1 45 ? -0.161  -10.968 -6.161  1.00 0.00 ? 45 LYS A HD3  2 
ATOM   1378 H HE2  . LYS A 1 45 ? 1.950   -10.520 -8.317  1.00 0.00 ? 45 LYS A HE2  2 
ATOM   1379 H HE3  . LYS A 1 45 ? 1.727   -9.588  -6.827  1.00 0.00 ? 45 LYS A HE3  2 
ATOM   1380 H HZ1  . LYS A 1 45 ? 2.268   -11.575 -5.605  1.00 0.00 ? 45 LYS A HZ1  2 
ATOM   1381 H HZ2  . LYS A 1 45 ? 2.535   -12.401 -7.005  1.00 0.00 ? 45 LYS A HZ2  2 
ATOM   1382 H HZ3  . LYS A 1 45 ? 3.499   -11.124 -6.606  1.00 0.00 ? 45 LYS A HZ3  2 
ATOM   1383 N N    . GLY A 1 46 ? -4.604  -12.383 -8.421  1.00 0.00 ? 46 GLY A N    2 
ATOM   1384 C CA   . GLY A 1 46 ? -5.924  -12.822 -8.860  1.00 0.00 ? 46 GLY A CA   2 
ATOM   1385 C C    . GLY A 1 46 ? -6.345  -12.151 -10.174 1.00 0.00 ? 46 GLY A C    2 
ATOM   1386 O O    . GLY A 1 46 ? -5.487  -11.691 -10.929 1.00 0.00 ? 46 GLY A O    2 
ATOM   1387 H H    . GLY A 1 46 ? -4.200  -11.585 -8.891  1.00 0.00 ? 46 GLY A H    2 
ATOM   1388 H HA2  . GLY A 1 46 ? -5.923  -13.903 -9.013  1.00 0.00 ? 46 GLY A HA2  2 
ATOM   1389 H HA3  . GLY A 1 46 ? -6.631  -12.575 -8.066  1.00 0.00 ? 46 GLY A HA3  2 
ATOM   1390 N N    . PRO A 1 47 ? -7.662  -12.098 -10.465 1.00 0.00 ? 47 PRO A N    2 
ATOM   1391 C CA   . PRO A 1 47 ? -8.231  -11.483 -11.664 1.00 0.00 ? 47 PRO A CA   2 
ATOM   1392 C C    . PRO A 1 47 ? -7.715  -10.062 -11.922 1.00 0.00 ? 47 PRO A C    2 
ATOM   1393 O O    . PRO A 1 47 ? -7.192  -9.776  -12.999 1.00 0.00 ? 47 PRO A O    2 
ATOM   1394 C CB   . PRO A 1 47 ? -9.754  -11.535 -11.478 1.00 0.00 ? 47 PRO A CB   2 
ATOM   1395 C CG   . PRO A 1 47 ? -9.941  -12.767 -10.591 1.00 0.00 ? 47 PRO A CG   2 
ATOM   1396 C CD   . PRO A 1 47 ? -8.721  -12.705 -9.671  1.00 0.00 ? 47 PRO A CD   2 
ATOM   1397 H HA   . PRO A 1 47 ? -7.967  -12.115 -12.510 1.00 0.00 ? 47 PRO A HA   2 
ATOM   1398 H HB2  . PRO A 1 47 ? -10.116 -10.659 -10.936 1.00 0.00 ? 47 PRO A HB2  2 
ATOM   1399 H HB3  . PRO A 1 47 ? -10.285 -11.625 -12.428 1.00 0.00 ? 47 PRO A HB3  2 
ATOM   1400 H HG2  . PRO A 1 47 ? -10.881 -12.743 -10.039 1.00 0.00 ? 47 PRO A HG2  2 
ATOM   1401 H HG3  . PRO A 1 47 ? -9.893  -13.668 -11.207 1.00 0.00 ? 47 PRO A HG3  2 
ATOM   1402 H HD2  . PRO A 1 47 ? -8.935  -12.063 -8.815  1.00 0.00 ? 47 PRO A HD2  2 
ATOM   1403 H HD3  . PRO A 1 47 ? -8.460  -13.708 -9.328  1.00 0.00 ? 47 PRO A HD3  2 
ATOM   1404 N N    . ALA A 1 48 ? -7.846  -9.194  -10.910 1.00 0.00 ? 48 ALA A N    2 
ATOM   1405 C CA   . ALA A 1 48 ? -7.335  -7.828  -10.897 1.00 0.00 ? 48 ALA A CA   2 
ATOM   1406 C C    . ALA A 1 48 ? -6.018  -7.798  -10.113 1.00 0.00 ? 48 ALA A C    2 
ATOM   1407 O O    . ALA A 1 48 ? -6.024  -7.928  -8.888  1.00 0.00 ? 48 ALA A O    2 
ATOM   1408 C CB   . ALA A 1 48 ? -8.379  -6.884  -10.284 1.00 0.00 ? 48 ALA A CB   2 
ATOM   1409 H H    . ALA A 1 48 ? -8.283  -9.541  -10.070 1.00 0.00 ? 48 ALA A H    2 
ATOM   1410 H HA   . ALA A 1 48 ? -7.167  -7.480  -11.919 1.00 0.00 ? 48 ALA A HA   2 
ATOM   1411 H HB1  . ALA A 1 48 ? -8.580  -7.147  -9.246  1.00 0.00 ? 48 ALA A HB1  2 
ATOM   1412 H HB2  . ALA A 1 48 ? -8.011  -5.857  -10.318 1.00 0.00 ? 48 ALA A HB2  2 
ATOM   1413 H HB3  . ALA A 1 48 ? -9.310  -6.940  -10.850 1.00 0.00 ? 48 ALA A HB3  2 
ATOM   1414 N N    . THR A 1 49 ? -4.894  -7.625  -10.824 1.00 0.00 ? 49 THR A N    2 
ATOM   1415 C CA   . THR A 1 49 ? -3.563  -7.470  -10.244 1.00 0.00 ? 49 THR A CA   2 
ATOM   1416 C C    . THR A 1 49 ? -2.696  -6.621  -11.187 1.00 0.00 ? 49 THR A C    2 
ATOM   1417 O O    . THR A 1 49 ? -2.085  -7.130  -12.124 1.00 0.00 ? 49 THR A O    2 
ATOM   1418 C CB   . THR A 1 49 ? -2.957  -8.841  -9.866  1.00 0.00 ? 49 THR A CB   2 
ATOM   1419 O OG1  . THR A 1 49 ? -1.709  -8.648  -9.230  1.00 0.00 ? 49 THR A OG1  2 
ATOM   1420 C CG2  . THR A 1 49 ? -2.788  -9.830  -11.033 1.00 0.00 ? 49 THR A CG2  2 
ATOM   1421 H H    . THR A 1 49 ? -4.967  -7.551  -11.828 1.00 0.00 ? 49 THR A H    2 
ATOM   1422 H HA   . THR A 1 49 ? -3.671  -6.920  -9.308  1.00 0.00 ? 49 THR A HA   2 
ATOM   1423 H HB   . THR A 1 49 ? -3.618  -9.311  -9.135  1.00 0.00 ? 49 THR A HB   2 
ATOM   1424 H HG1  . THR A 1 49 ? -1.837  -8.075  -8.471  1.00 0.00 ? 49 THR A HG1  2 
ATOM   1425 H HG21 . THR A 1 49 ? -2.573  -10.822 -10.637 1.00 0.00 ? 49 THR A HG21 2 
ATOM   1426 H HG22 . THR A 1 49 ? -1.962  -9.543  -11.683 1.00 0.00 ? 49 THR A HG22 2 
ATOM   1427 H HG23 . THR A 1 49 ? -3.702  -9.883  -11.625 1.00 0.00 ? 49 THR A HG23 2 
HETATM 1428 N N    . NH2 A 1 50 ? -2.698  -5.300  -10.988 1.00 0.00 ? 50 NH2 A N    2 
HETATM 1429 H HN1  . NH2 A 1 50 ? -2.161  -4.699  -11.596 1.00 0.00 ? 50 NH2 A HN1  2 
HETATM 1430 H HN2  . NH2 A 1 50 ? -3.243  -4.904  -10.234 1.00 0.00 ? 50 NH2 A HN2  2 
ATOM   1431 N N    . GLU A 1 1  ? 16.533  12.672  4.416   1.00 0.00 ? 1  GLU A N    3 
ATOM   1432 C CA   . GLU A 1 1  ? 15.736  12.205  3.263   1.00 0.00 ? 1  GLU A CA   3 
ATOM   1433 C C    . GLU A 1 1  ? 14.537  11.350  3.710   1.00 0.00 ? 1  GLU A C    3 
ATOM   1434 O O    . GLU A 1 1  ? 14.403  11.012  4.888   1.00 0.00 ? 1  GLU A O    3 
ATOM   1435 C CB   . GLU A 1 1  ? 16.617  11.461  2.241   1.00 0.00 ? 1  GLU A CB   3 
ATOM   1436 C CG   . GLU A 1 1  ? 17.709  12.368  1.646   1.00 0.00 ? 1  GLU A CG   3 
ATOM   1437 C CD   . GLU A 1 1  ? 18.503  11.652  0.551   1.00 0.00 ? 1  GLU A CD   3 
ATOM   1438 O OE1  . GLU A 1 1  ? 17.965  11.556  -0.574  1.00 0.00 ? 1  GLU A OE1  3 
ATOM   1439 O OE2  . GLU A 1 1  ? 19.632  11.209  0.855   1.00 0.00 ? 1  GLU A OE2  3 
ATOM   1440 H H1   . GLU A 1 1  ? 17.265  13.292  4.098   1.00 0.00 ? 1  GLU A H1   3 
ATOM   1441 H H2   . GLU A 1 1  ? 16.945  11.877  4.883   1.00 0.00 ? 1  GLU A H2   3 
ATOM   1442 H H3   . GLU A 1 1  ? 15.935  13.166  5.063   1.00 0.00 ? 1  GLU A H3   3 
ATOM   1443 H HA   . GLU A 1 1  ? 15.332  13.097  2.779   1.00 0.00 ? 1  GLU A HA   3 
ATOM   1444 H HB2  . GLU A 1 1  ? 17.084  10.597  2.719   1.00 0.00 ? 1  GLU A HB2  3 
ATOM   1445 H HB3  . GLU A 1 1  ? 15.992  11.102  1.422   1.00 0.00 ? 1  GLU A HB3  3 
ATOM   1446 H HG2  . GLU A 1 1  ? 17.242  13.258  1.217   1.00 0.00 ? 1  GLU A HG2  3 
ATOM   1447 H HG3  . GLU A 1 1  ? 18.392  12.691  2.434   1.00 0.00 ? 1  GLU A HG3  3 
ATOM   1448 N N    . CYS A 1 2  ? 13.652  11.011  2.757   1.00 0.00 ? 2  CYS A N    3 
ATOM   1449 C CA   . CYS A 1 2  ? 12.427  10.249  2.990   1.00 0.00 ? 2  CYS A CA   3 
ATOM   1450 C C    . CYS A 1 2  ? 12.066  9.425   1.752   1.00 0.00 ? 2  CYS A C    3 
ATOM   1451 O O    . CYS A 1 2  ? 12.119  9.932   0.630   1.00 0.00 ? 2  CYS A O    3 
ATOM   1452 C CB   . CYS A 1 2  ? 11.278  11.198  3.347   1.00 0.00 ? 2  CYS A CB   3 
ATOM   1453 S SG   . CYS A 1 2  ? 9.828   10.436  4.110   1.00 0.00 ? 2  CYS A SG   3 
ATOM   1454 H H    . CYS A 1 2  ? 13.823  11.313  1.809   1.00 0.00 ? 2  CYS A H    3 
ATOM   1455 H HA   . CYS A 1 2  ? 12.579  9.584   3.840   1.00 0.00 ? 2  CYS A HA   3 
ATOM   1456 H HB2  . CYS A 1 2  ? 11.619  11.920  4.077   1.00 0.00 ? 2  CYS A HB2  3 
ATOM   1457 H HB3  . CYS A 1 2  ? 10.970  11.744  2.459   1.00 0.00 ? 2  CYS A HB3  3 
ATOM   1458 N N    . GLU A 1 3  ? 11.644  8.170   1.969   1.00 0.00 ? 3  GLU A N    3 
ATOM   1459 C CA   . GLU A 1 3  ? 11.032  7.343   0.934   1.00 0.00 ? 3  GLU A CA   3 
ATOM   1460 C C    . GLU A 1 3  ? 9.605   7.855   0.709   1.00 0.00 ? 3  GLU A C    3 
ATOM   1461 O O    . GLU A 1 3  ? 8.805   7.907   1.644   1.00 0.00 ? 3  GLU A O    3 
ATOM   1462 C CB   . GLU A 1 3  ? 11.060  5.860   1.314   1.00 0.00 ? 3  GLU A CB   3 
ATOM   1463 C CG   . GLU A 1 3  ? 10.669  4.960   0.128   1.00 0.00 ? 3  GLU A CG   3 
ATOM   1464 C CD   . GLU A 1 3  ? 10.581  3.489   0.540   1.00 0.00 ? 3  GLU A CD   3 
ATOM   1465 O OE1  . GLU A 1 3  ? 9.488   3.087   0.994   1.00 0.00 ? 3  GLU A OE1  3 
ATOM   1466 O OE2  . GLU A 1 3  ? 11.610  2.791   0.402   1.00 0.00 ? 3  GLU A OE2  3 
ATOM   1467 H H    . GLU A 1 3  ? 11.613  7.843   2.922   1.00 0.00 ? 3  GLU A H    3 
ATOM   1468 H HA   . GLU A 1 3  ? 11.628  7.433   0.027   1.00 0.00 ? 3  GLU A HA   3 
ATOM   1469 H HB2  . GLU A 1 3  ? 12.072  5.599   1.618   1.00 0.00 ? 3  GLU A HB2  3 
ATOM   1470 H HB3  . GLU A 1 3  ? 10.380  5.702   2.147   1.00 0.00 ? 3  GLU A HB3  3 
ATOM   1471 H HG2  . GLU A 1 3  ? 9.707   5.273   -0.276  1.00 0.00 ? 3  GLU A HG2  3 
ATOM   1472 H HG3  . GLU A 1 3  ? 11.411  5.072   -0.664  1.00 0.00 ? 3  GLU A HG3  3 
ATOM   1473 N N    . SER A 1 4  ? 9.330   8.285   -0.526  1.00 0.00 ? 4  SER A N    3 
ATOM   1474 C CA   . SER A 1 4  ? 8.174   9.102   -0.883  1.00 0.00 ? 4  SER A CA   3 
ATOM   1475 C C    . SER A 1 4  ? 7.460   8.500   -2.099  1.00 0.00 ? 4  SER A C    3 
ATOM   1476 O O    . SER A 1 4  ? 7.748   8.847   -3.244  1.00 0.00 ? 4  SER A O    3 
ATOM   1477 C CB   . SER A 1 4  ? 8.619   10.552  -1.130  1.00 0.00 ? 4  SER A CB   3 
ATOM   1478 O OG   . SER A 1 4  ? 9.190   11.114  0.036   1.00 0.00 ? 4  SER A OG   3 
ATOM   1479 H H    . SER A 1 4  ? 10.049  8.145   -1.220  1.00 0.00 ? 4  SER A H    3 
ATOM   1480 H HA   . SER A 1 4  ? 7.457   9.136   -0.054  1.00 0.00 ? 4  SER A HA   3 
ATOM   1481 H HB2  . SER A 1 4  ? 9.356   10.595  -1.935  1.00 0.00 ? 4  SER A HB2  3 
ATOM   1482 H HB3  . SER A 1 4  ? 7.756   11.156  -1.411  1.00 0.00 ? 4  SER A HB3  3 
ATOM   1483 H HG   . SER A 1 4  ? 9.983   10.620  0.261   1.00 0.00 ? 4  SER A HG   3 
ATOM   1484 N N    . GLY A 1 5  ? 6.488   7.629   -1.813  1.00 0.00 ? 5  GLY A N    3 
ATOM   1485 C CA   . GLY A 1 5  ? 5.405   7.221   -2.688  1.00 0.00 ? 5  GLY A CA   3 
ATOM   1486 C C    . GLY A 1 5  ? 4.175   7.995   -2.199  1.00 0.00 ? 5  GLY A C    3 
ATOM   1487 O O    . GLY A 1 5  ? 3.835   7.823   -1.037  1.00 0.00 ? 5  GLY A O    3 
ATOM   1488 H H    . GLY A 1 5  ? 6.320   7.447   -0.838  1.00 0.00 ? 5  GLY A H    3 
ATOM   1489 H HA2  . GLY A 1 5  ? 5.654   7.355   -3.737  1.00 0.00 ? 5  GLY A HA2  3 
ATOM   1490 H HA3  . GLY A 1 5  ? 5.224   6.158   -2.532  1.00 0.00 ? 5  GLY A HA3  3 
ATOM   1491 N N    . PRO A 1 6  ? 3.536   8.867   -3.005  1.00 0.00 ? 6  PRO A N    3 
ATOM   1492 C CA   . PRO A 1 6  ? 2.474   9.797   -2.605  1.00 0.00 ? 6  PRO A CA   3 
ATOM   1493 C C    . PRO A 1 6  ? 1.279   9.248   -1.810  1.00 0.00 ? 6  PRO A C    3 
ATOM   1494 O O    . PRO A 1 6  ? 0.529   10.040  -1.239  1.00 0.00 ? 6  PRO A O    3 
ATOM   1495 C CB   . PRO A 1 6  ? 2.017   10.482  -3.896  1.00 0.00 ? 6  PRO A CB   3 
ATOM   1496 C CG   . PRO A 1 6  ? 3.299   10.510  -4.722  1.00 0.00 ? 6  PRO A CG   3 
ATOM   1497 C CD   . PRO A 1 6  ? 3.982   9.193   -4.342  1.00 0.00 ? 6  PRO A CD   3 
ATOM   1498 H HA   . PRO A 1 6  ? 2.961   10.530  -1.960  1.00 0.00 ? 6  PRO A HA   3 
ATOM   1499 H HB2  . PRO A 1 6  ? 1.273   9.868   -4.410  1.00 0.00 ? 6  PRO A HB2  3 
ATOM   1500 H HB3  . PRO A 1 6  ? 1.616   11.481  -3.719  1.00 0.00 ? 6  PRO A HB3  3 
ATOM   1501 H HG2  . PRO A 1 6  ? 3.104   10.583  -5.793  1.00 0.00 ? 6  PRO A HG2  3 
ATOM   1502 H HG3  . PRO A 1 6  ? 3.916   11.352  -4.399  1.00 0.00 ? 6  PRO A HG3  3 
ATOM   1503 H HD2  . PRO A 1 6  ? 3.708   8.371   -5.001  1.00 0.00 ? 6  PRO A HD2  3 
ATOM   1504 H HD3  . PRO A 1 6  ? 5.055   9.334   -4.359  1.00 0.00 ? 6  PRO A HD3  3 
ATOM   1505 N N    . CYS A 1 7  ? 1.127   7.918   -1.716  1.00 0.00 ? 7  CYS A N    3 
ATOM   1506 C CA   . CYS A 1 7  ? 0.382   7.263   -0.645  1.00 0.00 ? 7  CYS A CA   3 
ATOM   1507 C C    . CYS A 1 7  ? 0.848   7.804   0.710   1.00 0.00 ? 7  CYS A C    3 
ATOM   1508 O O    . CYS A 1 7  ? 0.095   8.494   1.393   1.00 0.00 ? 7  CYS A O    3 
ATOM   1509 C CB   . CYS A 1 7  ? 0.531   5.740   -0.790  1.00 0.00 ? 7  CYS A CB   3 
ATOM   1510 S SG   . CYS A 1 7  ? 2.194   5.006   -0.830  1.00 0.00 ? 7  CYS A SG   3 
ATOM   1511 H H    . CYS A 1 7  ? 1.776   7.331   -2.220  1.00 0.00 ? 7  CYS A H    3 
ATOM   1512 H HA   . CYS A 1 7  ? -0.680  7.500   -0.680  1.00 0.00 ? 7  CYS A HA   3 
ATOM   1513 H HB2  . CYS A 1 7  ? 0.041   5.307   0.066   1.00 0.00 ? 7  CYS A HB2  3 
ATOM   1514 H HB3  . CYS A 1 7  ? 0.002   5.412   -1.684  1.00 0.00 ? 7  CYS A HB3  3 
ATOM   1515 N N    . CYS A 1 8  ? 2.125   7.587   1.032   1.00 0.00 ? 8  CYS A N    3 
ATOM   1516 C CA   . CYS A 1 8  ? 2.829   8.292   2.080   1.00 0.00 ? 8  CYS A CA   3 
ATOM   1517 C C    . CYS A 1 8  ? 2.862   9.765   1.657   1.00 0.00 ? 8  CYS A C    3 
ATOM   1518 O O    . CYS A 1 8  ? 3.560   10.106  0.702   1.00 0.00 ? 8  CYS A O    3 
ATOM   1519 C CB   . CYS A 1 8  ? 4.253   7.770   2.225   1.00 0.00 ? 8  CYS A CB   3 
ATOM   1520 S SG   . CYS A 1 8  ? 4.417   6.031   2.680   1.00 0.00 ? 8  CYS A SG   3 
ATOM   1521 H H    . CYS A 1 8  ? 2.697   7.176   0.317   1.00 0.00 ? 8  CYS A H    3 
ATOM   1522 H HA   . CYS A 1 8  ? 2.297   8.075   3.008   1.00 0.00 ? 8  CYS A HA   3 
ATOM   1523 H HB2  . CYS A 1 8  ? 4.797   7.932   1.298   1.00 0.00 ? 8  CYS A HB2  3 
ATOM   1524 H HB3  . CYS A 1 8  ? 4.737   8.367   2.994   1.00 0.00 ? 8  CYS A HB3  3 
ATOM   1525 N N    . ARG A 1 9  ? 2.046   10.584  2.327   1.00 0.00 ? 9  ARG A N    3 
ATOM   1526 C CA   . ARG A 1 9  ? 1.512   11.888  1.900   1.00 0.00 ? 9  ARG A CA   3 
ATOM   1527 C C    . ARG A 1 9  ? 2.330   12.547  0.798   1.00 0.00 ? 9  ARG A C    3 
ATOM   1528 O O    . ARG A 1 9  ? 1.951   12.566  -0.372  1.00 0.00 ? 9  ARG A O    3 
ATOM   1529 C CB   . ARG A 1 9  ? 1.359   12.819  3.113   1.00 0.00 ? 9  ARG A CB   3 
ATOM   1530 C CG   . ARG A 1 9  ? -0.015  12.689  3.769   1.00 0.00 ? 9  ARG A CG   3 
ATOM   1531 C CD   . ARG A 1 9  ? -0.421  11.243  4.101   1.00 0.00 ? 9  ARG A CD   3 
ATOM   1532 N NE   . ARG A 1 9  ? -1.765  11.144  4.694   1.00 0.00 ? 9  ARG A NE   3 
ATOM   1533 C CZ   . ARG A 1 9  ? -2.930  11.374  4.056   1.00 0.00 ? 9  ARG A CZ   3 
ATOM   1534 N NH1  . ARG A 1 9  ? -2.964  11.726  2.761   1.00 0.00 ? 9  ARG A NH1  3 
ATOM   1535 N NH2  . ARG A 1 9  ? -4.085  11.249  4.723   1.00 0.00 ? 9  ARG A NH2  3 
ATOM   1536 H H    . ARG A 1 9  ? 1.678   10.180  3.175   1.00 0.00 ? 9  ARG A H    3 
ATOM   1537 H HA   . ARG A 1 9  ? 0.527   11.723  1.484   1.00 0.00 ? 9  ARG A HA   3 
ATOM   1538 H HB2  . ARG A 1 9  ? 2.151   12.623  3.832   1.00 0.00 ? 9  ARG A HB2  3 
ATOM   1539 H HB3  . ARG A 1 9  ? 1.451   13.863  2.808   1.00 0.00 ? 9  ARG A HB3  3 
ATOM   1540 H HG2  . ARG A 1 9  ? 0.015   13.284  4.674   1.00 0.00 ? 9  ARG A HG2  3 
ATOM   1541 H HG3  . ARG A 1 9  ? -0.725  13.138  3.079   1.00 0.00 ? 9  ARG A HG3  3 
ATOM   1542 H HD2  . ARG A 1 9  ? -0.406  10.635  3.199   1.00 0.00 ? 9  ARG A HD2  3 
ATOM   1543 H HD3  . ARG A 1 9  ? 0.301   10.834  4.804   1.00 0.00 ? 9  ARG A HD3  3 
ATOM   1544 H HE   . ARG A 1 9  ? -1.805  10.819  5.649   1.00 0.00 ? 9  ARG A HE   3 
ATOM   1545 H HH11 . ARG A 1 9  ? -2.107  11.811  2.233   1.00 0.00 ? 9  ARG A HH11 3 
ATOM   1546 H HH12 . ARG A 1 9  ? -3.850  11.906  2.310   1.00 0.00 ? 9  ARG A HH12 3 
ATOM   1547 H HH21 . ARG A 1 9  ? -4.084  10.973  5.694   1.00 0.00 ? 9  ARG A HH21 3 
ATOM   1548 H HH22 . ARG A 1 9  ? -4.961  11.433  4.254   1.00 0.00 ? 9  ARG A HH22 3 
ATOM   1549 N N    . ASN A 1 10 ? 3.494   13.026  1.225   1.00 0.00 ? 10 ASN A N    3 
ATOM   1550 C CA   . ASN A 1 10 ? 4.620   13.375  0.366   1.00 0.00 ? 10 ASN A CA   3 
ATOM   1551 C C    . ASN A 1 10 ? 5.950   12.879  0.961   1.00 0.00 ? 10 ASN A C    3 
ATOM   1552 O O    . ASN A 1 10 ? 7.000   13.459  0.688   1.00 0.00 ? 10 ASN A O    3 
ATOM   1553 C CB   . ASN A 1 10 ? 4.597   14.895  0.141   1.00 0.00 ? 10 ASN A CB   3 
ATOM   1554 C CG   . ASN A 1 10 ? 5.341   15.324  -1.130  1.00 0.00 ? 10 ASN A CG   3 
ATOM   1555 O OD1  . ASN A 1 10 ? 5.050   14.831  -2.217  1.00 0.00 ? 10 ASN A OD1  3 
ATOM   1556 N ND2  . ASN A 1 10 ? 6.297   16.249  -1.000  1.00 0.00 ? 10 ASN A ND2  3 
ATOM   1557 H H    . ASN A 1 10 ? 3.600   12.993  2.229   1.00 0.00 ? 10 ASN A H    3 
ATOM   1558 H HA   . ASN A 1 10 ? 4.491   12.856  -0.585  1.00 0.00 ? 10 ASN A HA   3 
ATOM   1559 H HB2  . ASN A 1 10 ? 3.558   15.206  0.053   1.00 0.00 ? 10 ASN A HB2  3 
ATOM   1560 H HB3  . ASN A 1 10 ? 5.002   15.396  1.023   1.00 0.00 ? 10 ASN A HB3  3 
ATOM   1561 H HD21 . ASN A 1 10 ? 6.507   16.638  -0.092  1.00 0.00 ? 10 ASN A HD21 3 
ATOM   1562 H HD22 . ASN A 1 10 ? 6.807   16.562  -1.814  1.00 0.00 ? 10 ASN A HD22 3 
ATOM   1563 N N    . CYS A 1 11 ? 5.879   11.822  1.786   1.00 0.00 ? 11 CYS A N    3 
ATOM   1564 C CA   . CYS A 1 11 ? 6.880   11.361  2.752   1.00 0.00 ? 11 CYS A CA   3 
ATOM   1565 C C    . CYS A 1 11 ? 6.159   10.627  3.892   1.00 0.00 ? 11 CYS A C    3 
ATOM   1566 O O    . CYS A 1 11 ? 6.660   9.607   4.370   1.00 0.00 ? 11 CYS A O    3 
ATOM   1567 C CB   . CYS A 1 11 ? 7.724   12.512  3.345   1.00 0.00 ? 11 CYS A CB   3 
ATOM   1568 S SG   . CYS A 1 11 ? 8.764   12.053  4.763   1.00 0.00 ? 11 CYS A SG   3 
ATOM   1569 H H    . CYS A 1 11 ? 4.965   11.387  1.865   1.00 0.00 ? 11 CYS A H    3 
ATOM   1570 H HA   . CYS A 1 11 ? 7.584   10.683  2.264   1.00 0.00 ? 11 CYS A HA   3 
ATOM   1571 H HB2  . CYS A 1 11 ? 8.404   12.899  2.587   1.00 0.00 ? 11 CYS A HB2  3 
ATOM   1572 H HB3  . CYS A 1 11 ? 7.069   13.322  3.670   1.00 0.00 ? 11 CYS A HB3  3 
ATOM   1573 N N    . LYS A 1 12 ? 5.033   11.180  4.380   1.00 0.00 ? 12 LYS A N    3 
ATOM   1574 C CA   . LYS A 1 12 ? 4.508   10.848  5.700   1.00 0.00 ? 12 LYS A CA   3 
ATOM   1575 C C    . LYS A 1 12 ? 3.635   9.605   5.579   1.00 0.00 ? 12 LYS A C    3 
ATOM   1576 O O    . LYS A 1 12 ? 2.521   9.675   5.066   1.00 0.00 ? 12 LYS A O    3 
ATOM   1577 C CB   . LYS A 1 12 ? 3.757   12.028  6.348   1.00 0.00 ? 12 LYS A CB   3 
ATOM   1578 C CG   . LYS A 1 12 ? 4.572   13.329  6.425   1.00 0.00 ? 12 LYS A CG   3 
ATOM   1579 C CD   . LYS A 1 12 ? 5.858   13.171  7.254   1.00 0.00 ? 12 LYS A CD   3 
ATOM   1580 C CE   . LYS A 1 12 ? 6.575   14.516  7.422   1.00 0.00 ? 12 LYS A CE   3 
ATOM   1581 N NZ   . LYS A 1 12 ? 7.825   14.368  8.188   1.00 0.00 ? 12 LYS A NZ   3 
ATOM   1582 H H    . LYS A 1 12 ? 4.534   11.868  3.828   1.00 0.00 ? 12 LYS A H    3 
ATOM   1583 H HA   . LYS A 1 12 ? 5.345   10.629  6.367   1.00 0.00 ? 12 LYS A HA   3 
ATOM   1584 H HB2  . LYS A 1 12 ? 2.833   12.230  5.812   1.00 0.00 ? 12 LYS A HB2  3 
ATOM   1585 H HB3  . LYS A 1 12 ? 3.479   11.739  7.364   1.00 0.00 ? 12 LYS A HB3  3 
ATOM   1586 H HG2  . LYS A 1 12 ? 4.825   13.668  5.418   1.00 0.00 ? 12 LYS A HG2  3 
ATOM   1587 H HG3  . LYS A 1 12 ? 3.947   14.092  6.893   1.00 0.00 ? 12 LYS A HG3  3 
ATOM   1588 H HD2  . LYS A 1 12 ? 5.605   12.771  8.238   1.00 0.00 ? 12 LYS A HD2  3 
ATOM   1589 H HD3  . LYS A 1 12 ? 6.533   12.477  6.754   1.00 0.00 ? 12 LYS A HD3  3 
ATOM   1590 H HE2  . LYS A 1 12 ? 6.817   14.927  6.441   1.00 0.00 ? 12 LYS A HE2  3 
ATOM   1591 H HE3  . LYS A 1 12 ? 5.925   15.215  7.948   1.00 0.00 ? 12 LYS A HE3  3 
ATOM   1592 H HZ1  . LYS A 1 12 ? 8.445   13.735  7.703   1.00 0.00 ? 12 LYS A HZ1  3 
ATOM   1593 H HZ2  . LYS A 1 12 ? 8.271   15.269  8.284   1.00 0.00 ? 12 LYS A HZ2  3 
ATOM   1594 H HZ3  . LYS A 1 12 ? 7.617   13.996  9.105   1.00 0.00 ? 12 LYS A HZ3  3 
ATOM   1595 N N    . PHE A 1 13 ? 4.178   8.477   6.058   1.00 0.00 ? 13 PHE A N    3 
ATOM   1596 C CA   . PHE A 1 13 ? 3.564   7.154   6.099   1.00 0.00 ? 13 PHE A CA   3 
ATOM   1597 C C    . PHE A 1 13 ? 2.096   7.267   6.532   1.00 0.00 ? 13 PHE A C    3 
ATOM   1598 O O    . PHE A 1 13 ? 1.823   7.588   7.689   1.00 0.00 ? 13 PHE A O    3 
ATOM   1599 C CB   . PHE A 1 13 ? 4.369   6.224   7.020   1.00 0.00 ? 13 PHE A CB   3 
ATOM   1600 C CG   . PHE A 1 13 ? 5.848   6.096   6.680   1.00 0.00 ? 13 PHE A CG   3 
ATOM   1601 C CD1  . PHE A 1 13 ? 6.774   7.027   7.209   1.00 0.00 ? 13 PHE A CD1  3 
ATOM   1602 C CD2  . PHE A 1 13 ? 6.300   5.082   5.808   1.00 0.00 ? 13 PHE A CD2  3 
ATOM   1603 C CE1  . PHE A 1 13 ? 8.135   6.962   6.846   1.00 0.00 ? 13 PHE A CE1  3 
ATOM   1604 C CE2  . PHE A 1 13 ? 7.660   5.026   5.442   1.00 0.00 ? 13 PHE A CE2  3 
ATOM   1605 C CZ   . PHE A 1 13 ? 8.577   5.956   5.965   1.00 0.00 ? 13 PHE A CZ   3 
ATOM   1606 H H    . PHE A 1 13 ? 5.118   8.556   6.410   1.00 0.00 ? 13 PHE A H    3 
ATOM   1607 H HA   . PHE A 1 13 ? 3.631   6.733   5.103   1.00 0.00 ? 13 PHE A HA   3 
ATOM   1608 H HB2  . PHE A 1 13 ? 4.279   6.560   8.055   1.00 0.00 ? 13 PHE A HB2  3 
ATOM   1609 H HB3  . PHE A 1 13 ? 3.917   5.236   6.957   1.00 0.00 ? 13 PHE A HB3  3 
ATOM   1610 H HD1  . PHE A 1 13 ? 6.442   7.811   7.873   1.00 0.00 ? 13 PHE A HD1  3 
ATOM   1611 H HD2  . PHE A 1 13 ? 5.605   4.364   5.397   1.00 0.00 ? 13 PHE A HD2  3 
ATOM   1612 H HE1  . PHE A 1 13 ? 8.834   7.688   7.234   1.00 0.00 ? 13 PHE A HE1  3 
ATOM   1613 H HE2  . PHE A 1 13 ? 8.008   4.309   4.724   1.00 0.00 ? 13 PHE A HE2  3 
ATOM   1614 H HZ   . PHE A 1 13 ? 9.619   5.903   5.685   1.00 0.00 ? 13 PHE A HZ   3 
ATOM   1615 N N    . LEU A 1 14 ? 1.166   7.076   5.581   1.00 0.00 ? 14 LEU A N    3 
ATOM   1616 C CA   . LEU A 1 14 ? -0.249  7.395   5.730   1.00 0.00 ? 14 LEU A CA   3 
ATOM   1617 C C    . LEU A 1 14 ? -0.960  6.436   6.699   1.00 0.00 ? 14 LEU A C    3 
ATOM   1618 O O    . LEU A 1 14 ? -0.340  5.809   7.560   1.00 0.00 ? 14 LEU A O    3 
ATOM   1619 C CB   . LEU A 1 14 ? -0.909  7.519   4.330   1.00 0.00 ? 14 LEU A CB   3 
ATOM   1620 C CG   . LEU A 1 14 ? -0.842  6.314   3.375   1.00 0.00 ? 14 LEU A CG   3 
ATOM   1621 C CD1  . LEU A 1 14 ? -0.925  4.940   4.042   1.00 0.00 ? 14 LEU A CD1  3 
ATOM   1622 C CD2  . LEU A 1 14 ? -1.979  6.409   2.339   1.00 0.00 ? 14 LEU A CD2  3 
ATOM   1623 H H    . LEU A 1 14 ? 1.459   6.792   4.659   1.00 0.00 ? 14 LEU A H    3 
ATOM   1624 H HA   . LEU A 1 14 ? -0.328  8.385   6.184   1.00 0.00 ? 14 LEU A HA   3 
ATOM   1625 H HB2  . LEU A 1 14 ? -1.944  7.835   4.378   1.00 0.00 ? 14 LEU A HB2  3 
ATOM   1626 H HB3  . LEU A 1 14 ? -0.421  8.351   3.839   1.00 0.00 ? 14 LEU A HB3  3 
ATOM   1627 H HG   . LEU A 1 14 ? 0.114   6.362   2.860   1.00 0.00 ? 14 LEU A HG   3 
ATOM   1628 H HD11 . LEU A 1 14 ? -0.871  4.185   3.264   1.00 0.00 ? 14 LEU A HD11 3 
ATOM   1629 H HD12 . LEU A 1 14 ? -0.096  4.781   4.732   1.00 0.00 ? 14 LEU A HD12 3 
ATOM   1630 H HD13 . LEU A 1 14 ? -1.874  4.813   4.556   1.00 0.00 ? 14 LEU A HD13 3 
ATOM   1631 H HD21 . LEU A 1 14 ? -2.936  6.256   2.839   1.00 0.00 ? 14 LEU A HD21 3 
ATOM   1632 H HD22 . LEU A 1 14 ? -2.010  7.387   1.864   1.00 0.00 ? 14 LEU A HD22 3 
ATOM   1633 H HD23 . LEU A 1 14 ? -1.851  5.650   1.566   1.00 0.00 ? 14 LEU A HD23 3 
ATOM   1634 N N    . LYS A 1 15 ? -2.280  6.348   6.546   1.00 0.00 ? 15 LYS A N    3 
ATOM   1635 C CA   . LYS A 1 15 ? -3.184  5.521   7.334   1.00 0.00 ? 15 LYS A CA   3 
ATOM   1636 C C    . LYS A 1 15 ? -2.946  4.036   7.002   1.00 0.00 ? 15 LYS A C    3 
ATOM   1637 O O    . LYS A 1 15 ? -3.684  3.459   6.204   1.00 0.00 ? 15 LYS A O    3 
ATOM   1638 C CB   . LYS A 1 15 ? -4.639  5.972   7.080   1.00 0.00 ? 15 LYS A CB   3 
ATOM   1639 C CG   . LYS A 1 15 ? -5.046  7.257   7.830   1.00 0.00 ? 15 LYS A CG   3 
ATOM   1640 C CD   . LYS A 1 15 ? -4.113  8.462   7.613   1.00 0.00 ? 15 LYS A CD   3 
ATOM   1641 C CE   . LYS A 1 15 ? -4.690  9.730   8.256   1.00 0.00 ? 15 LYS A CE   3 
ATOM   1642 N NZ   . LYS A 1 15 ? -3.726  10.845  8.226   1.00 0.00 ? 15 LYS A NZ   3 
ATOM   1643 H H    . LYS A 1 15 ? -2.665  6.897   5.795   1.00 0.00 ? 15 LYS A H    3 
ATOM   1644 H HA   . LYS A 1 15 ? -2.974  5.680   8.393   1.00 0.00 ? 15 LYS A HA   3 
ATOM   1645 H HB2  . LYS A 1 15 ? -4.802  6.110   6.009   1.00 0.00 ? 15 LYS A HB2  3 
ATOM   1646 H HB3  . LYS A 1 15 ? -5.319  5.188   7.419   1.00 0.00 ? 15 LYS A HB3  3 
ATOM   1647 H HG2  . LYS A 1 15 ? -6.052  7.529   7.505   1.00 0.00 ? 15 LYS A HG2  3 
ATOM   1648 H HG3  . LYS A 1 15 ? -5.085  7.040   8.899   1.00 0.00 ? 15 LYS A HG3  3 
ATOM   1649 H HD2  . LYS A 1 15 ? -3.148  8.253   8.075   1.00 0.00 ? 15 LYS A HD2  3 
ATOM   1650 H HD3  . LYS A 1 15 ? -3.973  8.632   6.544   1.00 0.00 ? 15 LYS A HD3  3 
ATOM   1651 H HE2  . LYS A 1 15 ? -5.595  10.031  7.725   1.00 0.00 ? 15 LYS A HE2  3 
ATOM   1652 H HE3  . LYS A 1 15 ? -4.944  9.531   9.299   1.00 0.00 ? 15 LYS A HE3  3 
ATOM   1653 H HZ1  . LYS A 1 15 ? -2.903  10.590  8.754   1.00 0.00 ? 15 LYS A HZ1  3 
ATOM   1654 H HZ2  . LYS A 1 15 ? -3.462  11.043  7.272   1.00 0.00 ? 15 LYS A HZ2  3 
ATOM   1655 H HZ3  . LYS A 1 15 ? -4.147  11.666  8.637   1.00 0.00 ? 15 LYS A HZ3  3 
ATOM   1656 N N    . GLU A 1 16 ? -1.903  3.445   7.619   1.00 0.00 ? 16 GLU A N    3 
ATOM   1657 C CA   . GLU A 1 16 ? -1.430  2.063   7.526   1.00 0.00 ? 16 GLU A CA   3 
ATOM   1658 C C    . GLU A 1 16 ? -2.514  1.077   7.078   1.00 0.00 ? 16 GLU A C    3 
ATOM   1659 O O    . GLU A 1 16 ? -3.479  0.844   7.806   1.00 0.00 ? 16 GLU A O    3 
ATOM   1660 C CB   . GLU A 1 16 ? -0.817  1.663   8.885   1.00 0.00 ? 16 GLU A CB   3 
ATOM   1661 C CG   . GLU A 1 16 ? -0.441  0.172   8.980   1.00 0.00 ? 16 GLU A CG   3 
ATOM   1662 C CD   . GLU A 1 16 ? 0.484   -0.143  10.161  1.00 0.00 ? 16 GLU A CD   3 
ATOM   1663 O OE1  . GLU A 1 16 ? 0.360   0.546   11.199  1.00 0.00 ? 16 GLU A OE1  3 
ATOM   1664 O OE2  . GLU A 1 16 ? 1.298   -1.081  10.013  1.00 0.00 ? 16 GLU A OE2  3 
ATOM   1665 H H    . GLU A 1 16 ? -1.321  4.039   8.193   1.00 0.00 ? 16 GLU A H    3 
ATOM   1666 H HA   . GLU A 1 16 ? -0.628  2.068   6.784   1.00 0.00 ? 16 GLU A HA   3 
ATOM   1667 H HB2  . GLU A 1 16 ? 0.075   2.273   9.043   1.00 0.00 ? 16 GLU A HB2  3 
ATOM   1668 H HB3  . GLU A 1 16 ? -1.525  1.887   9.686   1.00 0.00 ? 16 GLU A HB3  3 
ATOM   1669 H HG2  . GLU A 1 16 ? -1.348  -0.423  9.096   1.00 0.00 ? 16 GLU A HG2  3 
ATOM   1670 H HG3  . GLU A 1 16 ? 0.041   -0.136  8.055   1.00 0.00 ? 16 GLU A HG3  3 
ATOM   1671 N N    . GLY A 1 17 ? -2.353  0.526   5.865   1.00 0.00 ? 17 GLY A N    3 
ATOM   1672 C CA   . GLY A 1 17 ? -3.349  -0.300  5.207   1.00 0.00 ? 17 GLY A CA   3 
ATOM   1673 C C    . GLY A 1 17 ? -4.183  0.545   4.240   1.00 0.00 ? 17 GLY A C    3 
ATOM   1674 O O    . GLY A 1 17 ? -5.411  0.459   4.269   1.00 0.00 ? 17 GLY A O    3 
ATOM   1675 H H    . GLY A 1 17 ? -1.541  0.770   5.310   1.00 0.00 ? 17 GLY A H    3 
ATOM   1676 H HA2  . GLY A 1 17 ? -2.837  -1.087  4.659   1.00 0.00 ? 17 GLY A HA2  3 
ATOM   1677 H HA3  . GLY A 1 17 ? -3.998  -0.791  5.933   1.00 0.00 ? 17 GLY A HA3  3 
ATOM   1678 N N    . THR A 1 18 ? -3.522  1.336   3.372   1.00 0.00 ? 18 THR A N    3 
ATOM   1679 C CA   . THR A 1 18 ? -4.149  2.064   2.270   1.00 0.00 ? 18 THR A CA   3 
ATOM   1680 C C    . THR A 1 18 ? -3.464  1.724   0.943   1.00 0.00 ? 18 THR A C    3 
ATOM   1681 O O    . THR A 1 18 ? -2.284  2.019   0.764   1.00 0.00 ? 18 THR A O    3 
ATOM   1682 C CB   . THR A 1 18 ? -4.098  3.575   2.503   1.00 0.00 ? 18 THR A CB   3 
ATOM   1683 O OG1  . THR A 1 18 ? -4.864  3.934   3.636   1.00 0.00 ? 18 THR A OG1  3 
ATOM   1684 C CG2  . THR A 1 18 ? -4.616  4.328   1.269   1.00 0.00 ? 18 THR A CG2  3 
ATOM   1685 H H    . THR A 1 18 ? -2.516  1.400   3.443   1.00 0.00 ? 18 THR A H    3 
ATOM   1686 H HA   . THR A 1 18 ? -5.200  1.799   2.210   1.00 0.00 ? 18 THR A HA   3 
ATOM   1687 H HB   . THR A 1 18 ? -3.062  3.845   2.665   1.00 0.00 ? 18 THR A HB   3 
ATOM   1688 H HG1  . THR A 1 18 ? -4.496  3.496   4.407   1.00 0.00 ? 18 THR A HG1  3 
ATOM   1689 H HG21 . THR A 1 18 ? -3.932  4.234   0.427   1.00 0.00 ? 18 THR A HG21 3 
ATOM   1690 H HG22 . THR A 1 18 ? -4.717  5.389   1.500   1.00 0.00 ? 18 THR A HG22 3 
ATOM   1691 H HG23 . THR A 1 18 ? -5.598  3.947   0.980   1.00 0.00 ? 18 THR A HG23 3 
ATOM   1692 N N    . ILE A 1 19 ? -4.249  1.183   0.002   1.00 0.00 ? 19 ILE A N    3 
ATOM   1693 C CA   . ILE A 1 19 ? -3.842  0.750   -1.332  1.00 0.00 ? 19 ILE A CA   3 
ATOM   1694 C C    . ILE A 1 19 ? -3.207  1.905   -2.121  1.00 0.00 ? 19 ILE A C    3 
ATOM   1695 O O    . ILE A 1 19 ? -3.812  2.960   -2.310  1.00 0.00 ? 19 ILE A O    3 
ATOM   1696 C CB   . ILE A 1 19 ? -5.035  0.145   -2.098  1.00 0.00 ? 19 ILE A CB   3 
ATOM   1697 C CG1  . ILE A 1 19 ? -5.683  -1.021  -1.336  1.00 0.00 ? 19 ILE A CG1  3 
ATOM   1698 C CG2  . ILE A 1 19 ? -4.682  -0.250  -3.543  1.00 0.00 ? 19 ILE A CG2  3 
ATOM   1699 C CD1  . ILE A 1 19 ? -6.940  -1.585  -2.012  1.00 0.00 ? 19 ILE A CD1  3 
ATOM   1700 H H    . ILE A 1 19 ? -5.222  1.067   0.245   1.00 0.00 ? 19 ILE A H    3 
ATOM   1701 H HA   . ILE A 1 19 ? -3.136  -0.068  -1.215  1.00 0.00 ? 19 ILE A HA   3 
ATOM   1702 H HB   . ILE A 1 19 ? -5.773  0.915   -2.154  1.00 0.00 ? 19 ILE A HB   3 
ATOM   1703 H HG12 . ILE A 1 19 ? -4.932  -1.796  -1.205  1.00 0.00 ? 19 ILE A HG12 3 
ATOM   1704 H HG13 . ILE A 1 19 ? -6.000  -0.666  -0.358  1.00 0.00 ? 19 ILE A HG13 3 
ATOM   1705 H HG21 . ILE A 1 19 ? -4.263  0.595   -4.088  1.00 0.00 ? 19 ILE A HG21 3 
ATOM   1706 H HG22 . ILE A 1 19 ? -3.965  -1.064  -3.535  1.00 0.00 ? 19 ILE A HG22 3 
ATOM   1707 H HG23 . ILE A 1 19 ? -5.580  -0.549  -4.076  1.00 0.00 ? 19 ILE A HG23 3 
ATOM   1708 H HD11 . ILE A 1 19 ? -7.660  -0.786  -2.190  1.00 0.00 ? 19 ILE A HD11 3 
ATOM   1709 H HD12 . ILE A 1 19 ? -6.692  -2.061  -2.959  1.00 0.00 ? 19 ILE A HD12 3 
ATOM   1710 H HD13 . ILE A 1 19 ? -7.399  -2.331  -1.361  1.00 0.00 ? 19 ILE A HD13 3 
ATOM   1711 N N    . CYS A 1 20 ? -2.000  1.638   -2.626  1.00 0.00 ? 20 CYS A N    3 
ATOM   1712 C CA   . CYS A 1 20 ? -1.316  2.369   -3.687  1.00 0.00 ? 20 CYS A CA   3 
ATOM   1713 C C    . CYS A 1 20 ? -1.881  1.918   -5.041  1.00 0.00 ? 20 CYS A C    3 
ATOM   1714 O O    . CYS A 1 20 ? -2.504  2.715   -5.744  1.00 0.00 ? 20 CYS A O    3 
ATOM   1715 C CB   . CYS A 1 20 ? 0.212   2.184   -3.565  1.00 0.00 ? 20 CYS A CB   3 
ATOM   1716 S SG   . CYS A 1 20 ? 1.194   2.337   -5.086  1.00 0.00 ? 20 CYS A SG   3 
ATOM   1717 H H    . CYS A 1 20 ? -1.627  0.738   -2.372  1.00 0.00 ? 20 CYS A H    3 
ATOM   1718 H HA   . CYS A 1 20 ? -1.506  3.431   -3.580  1.00 0.00 ? 20 CYS A HA   3 
ATOM   1719 H HB2  . CYS A 1 20 ? 0.587   2.921   -2.857  1.00 0.00 ? 20 CYS A HB2  3 
ATOM   1720 H HB3  . CYS A 1 20 ? 0.426   1.205   -3.151  1.00 0.00 ? 20 CYS A HB3  3 
ATOM   1721 N N    . LYS A 1 21 ? -1.656  0.644   -5.393  1.00 0.00 ? 21 LYS A N    3 
ATOM   1722 C CA   . LYS A 1 21 ? -2.084  0.033   -6.651  1.00 0.00 ? 21 LYS A CA   3 
ATOM   1723 C C    . LYS A 1 21 ? -3.167  -1.013  -6.384  1.00 0.00 ? 21 LYS A C    3 
ATOM   1724 O O    . LYS A 1 21 ? -2.936  -1.997  -5.680  1.00 0.00 ? 21 LYS A O    3 
ATOM   1725 C CB   . LYS A 1 21 ? -0.892  -0.580  -7.392  1.00 0.00 ? 21 LYS A CB   3 
ATOM   1726 C CG   . LYS A 1 21 ? -1.271  -0.941  -8.835  1.00 0.00 ? 21 LYS A CG   3 
ATOM   1727 C CD   . LYS A 1 21 ? -0.209  -1.778  -9.557  1.00 0.00 ? 21 LYS A CD   3 
ATOM   1728 C CE   . LYS A 1 21 ? 1.179   -1.122  -9.649  1.00 0.00 ? 21 LYS A CE   3 
ATOM   1729 N NZ   . LYS A 1 21 ? 1.995   -1.355  -8.444  1.00 0.00 ? 21 LYS A NZ   3 
ATOM   1730 H H    . LYS A 1 21 ? -1.157  0.070   -4.731  1.00 0.00 ? 21 LYS A H    3 
ATOM   1731 H HA   . LYS A 1 21 ? -2.463  0.800   -7.331  1.00 0.00 ? 21 LYS A HA   3 
ATOM   1732 H HB2  . LYS A 1 21 ? -0.106  0.170   -7.432  1.00 0.00 ? 21 LYS A HB2  3 
ATOM   1733 H HB3  . LYS A 1 21 ? -0.539  -1.463  -6.858  1.00 0.00 ? 21 LYS A HB3  3 
ATOM   1734 H HG2  . LYS A 1 21 ? -2.198  -1.515  -8.841  1.00 0.00 ? 21 LYS A HG2  3 
ATOM   1735 H HG3  . LYS A 1 21 ? -1.445  -0.021  -9.399  1.00 0.00 ? 21 LYS A HG3  3 
ATOM   1736 H HD2  . LYS A 1 21 ? -0.119  -2.756  -9.079  1.00 0.00 ? 21 LYS A HD2  3 
ATOM   1737 H HD3  . LYS A 1 21 ? -0.571  -1.942  -10.575 1.00 0.00 ? 21 LYS A HD3  3 
ATOM   1738 H HE2  . LYS A 1 21 ? 1.716   -1.565  -10.489 1.00 0.00 ? 21 LYS A HE2  3 
ATOM   1739 H HE3  . LYS A 1 21 ? 1.079   -0.051  -9.831  1.00 0.00 ? 21 LYS A HE3  3 
ATOM   1740 H HZ1  . LYS A 1 21 ? 2.099   -2.349  -8.299  1.00 0.00 ? 21 LYS A HZ1  3 
ATOM   1741 H HZ2  . LYS A 1 21 ? 2.907   -0.939  -8.571  1.00 0.00 ? 21 LYS A HZ2  3 
ATOM   1742 H HZ3  . LYS A 1 21 ? 1.551   -0.945  -7.636  1.00 0.00 ? 21 LYS A HZ3  3 
ATOM   1743 N N    . ARG A 1 22 ? -4.341  -0.797  -6.988  1.00 0.00 ? 22 ARG A N    3 
ATOM   1744 C CA   . ARG A 1 22 ? -5.498  -1.682  -6.938  1.00 0.00 ? 22 ARG A CA   3 
ATOM   1745 C C    . ARG A 1 22 ? -5.150  -3.056  -7.522  1.00 0.00 ? 22 ARG A C    3 
ATOM   1746 O O    . ARG A 1 22 ? -5.331  -4.059  -6.838  1.00 0.00 ? 22 ARG A O    3 
ATOM   1747 C CB   . ARG A 1 22 ? -6.696  -1.015  -7.637  1.00 0.00 ? 22 ARG A CB   3 
ATOM   1748 C CG   . ARG A 1 22 ? -7.960  -1.890  -7.724  1.00 0.00 ? 22 ARG A CG   3 
ATOM   1749 C CD   . ARG A 1 22 ? -8.476  -2.331  -6.346  1.00 0.00 ? 22 ARG A CD   3 
ATOM   1750 N NE   . ARG A 1 22 ? -9.749  -3.060  -6.455  1.00 0.00 ? 22 ARG A NE   3 
ATOM   1751 C CZ   . ARG A 1 22 ? -10.414 -3.638  -5.437  1.00 0.00 ? 22 ARG A CZ   3 
ATOM   1752 N NH1  . ARG A 1 22 ? -9.930  -3.621  -4.184  1.00 0.00 ? 22 ARG A NH1  3 
ATOM   1753 N NH2  . ARG A 1 22 ? -11.585 -4.245  -5.677  1.00 0.00 ? 22 ARG A NH2  3 
ATOM   1754 H H    . ARG A 1 22 ? -4.400  0.023   -7.572  1.00 0.00 ? 22 ARG A H    3 
ATOM   1755 H HA   . ARG A 1 22 ? -5.759  -1.812  -5.889  1.00 0.00 ? 22 ARG A HA   3 
ATOM   1756 H HB2  . ARG A 1 22 ? -6.948  -0.098  -7.100  1.00 0.00 ? 22 ARG A HB2  3 
ATOM   1757 H HB3  . ARG A 1 22 ? -6.402  -0.734  -8.648  1.00 0.00 ? 22 ARG A HB3  3 
ATOM   1758 H HG2  . ARG A 1 22 ? -8.739  -1.309  -8.220  1.00 0.00 ? 22 ARG A HG2  3 
ATOM   1759 H HG3  . ARG A 1 22 ? -7.758  -2.773  -8.333  1.00 0.00 ? 22 ARG A HG3  3 
ATOM   1760 H HD2  . ARG A 1 22 ? -7.738  -2.985  -5.886  1.00 0.00 ? 22 ARG A HD2  3 
ATOM   1761 H HD3  . ARG A 1 22 ? -8.619  -1.453  -5.713  1.00 0.00 ? 22 ARG A HD3  3 
ATOM   1762 H HE   . ARG A 1 22 ? -10.160 -3.108  -7.376  1.00 0.00 ? 22 ARG A HE   3 
ATOM   1763 H HH11 . ARG A 1 22 ? -9.035  -3.195  -3.991  1.00 0.00 ? 22 ARG A HH11 3 
ATOM   1764 H HH12 . ARG A 1 22 ? -10.448 -4.059  -3.437  1.00 0.00 ? 22 ARG A HH12 3 
ATOM   1765 H HH21 . ARG A 1 22 ? -11.964 -4.260  -6.614  1.00 0.00 ? 22 ARG A HH21 3 
ATOM   1766 H HH22 . ARG A 1 22 ? -12.093 -4.679  -4.921  1.00 0.00 ? 22 ARG A HH22 3 
ATOM   1767 N N    . ALA A 1 23 ? -4.640  -3.098  -8.765  1.00 0.00 ? 23 ALA A N    3 
ATOM   1768 C CA   . ALA A 1 23 ? -4.111  -4.294  -9.427  1.00 0.00 ? 23 ALA A CA   3 
ATOM   1769 C C    . ALA A 1 23 ? -5.147  -5.425  -9.575  1.00 0.00 ? 23 ALA A C    3 
ATOM   1770 O O    . ALA A 1 23 ? -6.256  -5.334  -9.056  1.00 0.00 ? 23 ALA A O    3 
ATOM   1771 C CB   . ALA A 1 23 ? -2.829  -4.761  -8.715  1.00 0.00 ? 23 ALA A CB   3 
ATOM   1772 H H    . ALA A 1 23 ? -4.538  -2.223  -9.261  1.00 0.00 ? 23 ALA A H    3 
ATOM   1773 H HA   . ALA A 1 23 ? -3.827  -3.981  -10.434 1.00 0.00 ? 23 ALA A HA   3 
ATOM   1774 H HB1  . ALA A 1 23 ? -3.039  -5.088  -7.699  1.00 0.00 ? 23 ALA A HB1  3 
ATOM   1775 H HB2  . ALA A 1 23 ? -2.369  -5.584  -9.264  1.00 0.00 ? 23 ALA A HB2  3 
ATOM   1776 H HB3  . ALA A 1 23 ? -2.111  -3.943  -8.668  1.00 0.00 ? 23 ALA A HB3  3 
ATOM   1777 N N    . ARG A 1 24 ? -4.777  -6.494  -10.297 1.00 0.00 ? 24 ARG A N    3 
ATOM   1778 C CA   . ARG A 1 24 ? -5.589  -7.691  -10.539 1.00 0.00 ? 24 ARG A CA   3 
ATOM   1779 C C    . ARG A 1 24 ? -4.687  -8.933  -10.673 1.00 0.00 ? 24 ARG A C    3 
ATOM   1780 O O    . ARG A 1 24 ? -3.470  -8.829  -10.836 1.00 0.00 ? 24 ARG A O    3 
ATOM   1781 C CB   . ARG A 1 24 ? -6.434  -7.522  -11.822 1.00 0.00 ? 24 ARG A CB   3 
ATOM   1782 C CG   . ARG A 1 24 ? -7.641  -6.568  -11.746 1.00 0.00 ? 24 ARG A CG   3 
ATOM   1783 C CD   . ARG A 1 24 ? -8.805  -7.076  -10.873 1.00 0.00 ? 24 ARG A CD   3 
ATOM   1784 N NE   . ARG A 1 24 ? -8.617  -6.755  -9.449  1.00 0.00 ? 24 ARG A NE   3 
ATOM   1785 C CZ   . ARG A 1 24 ? -9.537  -6.851  -8.474  1.00 0.00 ? 24 ARG A CZ   3 
ATOM   1786 N NH1  . ARG A 1 24 ? -10.740 -7.400  -8.701  1.00 0.00 ? 24 ARG A NH1  3 
ATOM   1787 N NH2  . ARG A 1 24 ? -9.246  -6.383  -7.252  1.00 0.00 ? 24 ARG A NH2  3 
ATOM   1788 H H    . ARG A 1 24 ? -3.848  -6.496  -10.694 1.00 0.00 ? 24 ARG A H    3 
ATOM   1789 H HA   . ARG A 1 24 ? -6.249  -7.868  -9.690  1.00 0.00 ? 24 ARG A HA   3 
ATOM   1790 H HB2  . ARG A 1 24 ? -5.776  -7.179  -12.624 1.00 0.00 ? 24 ARG A HB2  3 
ATOM   1791 H HB3  . ARG A 1 24 ? -6.827  -8.493  -12.129 1.00 0.00 ? 24 ARG A HB3  3 
ATOM   1792 H HG2  . ARG A 1 24 ? -7.330  -5.569  -11.441 1.00 0.00 ? 24 ARG A HG2  3 
ATOM   1793 H HG3  . ARG A 1 24 ? -8.026  -6.483  -12.765 1.00 0.00 ? 24 ARG A HG3  3 
ATOM   1794 H HD2  . ARG A 1 24 ? -9.718  -6.581  -11.209 1.00 0.00 ? 24 ARG A HD2  3 
ATOM   1795 H HD3  . ARG A 1 24 ? -8.929  -8.152  -10.998 1.00 0.00 ? 24 ARG A HD3  3 
ATOM   1796 H HE   . ARG A 1 24 ? -7.721  -6.364  -9.203  1.00 0.00 ? 24 ARG A HE   3 
ATOM   1797 H HH11 . ARG A 1 24 ? -10.969 -7.758  -9.618  1.00 0.00 ? 24 ARG A HH11 3 
ATOM   1798 H HH12 . ARG A 1 24 ? -11.418 -7.459  -7.955  1.00 0.00 ? 24 ARG A HH12 3 
ATOM   1799 H HH21 . ARG A 1 24 ? -8.350  -5.949  -7.078  1.00 0.00 ? 24 ARG A HH21 3 
ATOM   1800 H HH22 . ARG A 1 24 ? -9.928  -6.441  -6.510  1.00 0.00 ? 24 ARG A HH22 3 
ATOM   1801 N N    . GLY A 1 25 ? -5.317  -10.118 -10.647 1.00 0.00 ? 25 GLY A N    3 
ATOM   1802 C CA   . GLY A 1 25 ? -4.723  -11.394 -11.027 1.00 0.00 ? 25 GLY A CA   3 
ATOM   1803 C C    . GLY A 1 25 ? -3.856  -11.991 -9.917  1.00 0.00 ? 25 GLY A C    3 
ATOM   1804 O O    . GLY A 1 25 ? -4.379  -12.607 -8.989  1.00 0.00 ? 25 GLY A O    3 
ATOM   1805 H H    . GLY A 1 25 ? -6.312  -10.118 -10.478 1.00 0.00 ? 25 GLY A H    3 
ATOM   1806 H HA2  . GLY A 1 25 ? -5.539  -12.085 -11.239 1.00 0.00 ? 25 GLY A HA2  3 
ATOM   1807 H HA3  . GLY A 1 25 ? -4.148  -11.275 -11.948 1.00 0.00 ? 25 GLY A HA3  3 
ATOM   1808 N N    . ASP A 1 26 ? -2.529  -11.834 -10.040 1.00 0.00 ? 26 ASP A N    3 
ATOM   1809 C CA   . ASP A 1 26 ? -1.527  -12.445 -9.166  1.00 0.00 ? 26 ASP A CA   3 
ATOM   1810 C C    . ASP A 1 26 ? -1.624  -11.875 -7.744  1.00 0.00 ? 26 ASP A C    3 
ATOM   1811 O O    . ASP A 1 26 ? -1.832  -12.621 -6.787  1.00 0.00 ? 26 ASP A O    3 
ATOM   1812 C CB   . ASP A 1 26 ? -0.129  -12.256 -9.779  1.00 0.00 ? 26 ASP A CB   3 
ATOM   1813 C CG   . ASP A 1 26 ? 0.962   -13.019 -9.018  1.00 0.00 ? 26 ASP A CG   3 
ATOM   1814 O OD1  . ASP A 1 26 ? 1.313   -12.565 -7.907  1.00 0.00 ? 26 ASP A OD1  3 
ATOM   1815 O OD2  . ASP A 1 26 ? 1.430   -14.044 -9.561  1.00 0.00 ? 26 ASP A OD2  3 
ATOM   1816 H H    . ASP A 1 26 ? -2.184  -11.293 -10.820 1.00 0.00 ? 26 ASP A H    3 
ATOM   1817 H HA   . ASP A 1 26 ? -1.715  -13.518 -9.139  1.00 0.00 ? 26 ASP A HA   3 
ATOM   1818 H HB2  . ASP A 1 26 ? -0.144  -12.598 -10.816 1.00 0.00 ? 26 ASP A HB2  3 
ATOM   1819 H HB3  . ASP A 1 26 ? 0.115   -11.196 -9.786  1.00 0.00 ? 26 ASP A HB3  3 
ATOM   1820 N N    . ASP A 1 27 ? -1.477  -10.549 -7.628  1.00 0.00 ? 27 ASP A N    3 
ATOM   1821 C CA   . ASP A 1 27 ? -1.635  -9.762  -6.420  1.00 0.00 ? 27 ASP A CA   3 
ATOM   1822 C C    . ASP A 1 27 ? -2.635  -8.648  -6.744  1.00 0.00 ? 27 ASP A C    3 
ATOM   1823 O O    . ASP A 1 27 ? -2.593  -8.056  -7.825  1.00 0.00 ? 27 ASP A O    3 
ATOM   1824 C CB   . ASP A 1 27 ? -0.273  -9.221  -5.964  1.00 0.00 ? 27 ASP A CB   3 
ATOM   1825 C CG   . ASP A 1 27 ? -0.339  -8.500  -4.614  1.00 0.00 ? 27 ASP A CG   3 
ATOM   1826 O OD1  . ASP A 1 27 ? -0.905  -7.386  -4.592  1.00 0.00 ? 27 ASP A OD1  3 
ATOM   1827 O OD2  . ASP A 1 27 ? 0.178   -9.071  -3.628  1.00 0.00 ? 27 ASP A OD2  3 
ATOM   1828 H H    . ASP A 1 27 ? -1.359  -10.001 -8.463  1.00 0.00 ? 27 ASP A H    3 
ATOM   1829 H HA   . ASP A 1 27 ? -2.022  -10.390 -5.622  1.00 0.00 ? 27 ASP A HA   3 
ATOM   1830 H HB2  . ASP A 1 27 ? 0.422   -10.058 -5.880  1.00 0.00 ? 27 ASP A HB2  3 
ATOM   1831 H HB3  . ASP A 1 27 ? 0.109   -8.537  -6.718  1.00 0.00 ? 27 ASP A HB3  3 
ATOM   1832 N N    . MET A 1 28 ? -3.539  -8.380  -5.798  1.00 0.00 ? 28 MET A N    3 
ATOM   1833 C CA   . MET A 1 28 ? -4.586  -7.378  -5.915  1.00 0.00 ? 28 MET A CA   3 
ATOM   1834 C C    . MET A 1 28 ? -4.743  -6.677  -4.571  1.00 0.00 ? 28 MET A C    3 
ATOM   1835 O O    . MET A 1 28 ? -5.085  -7.304  -3.571  1.00 0.00 ? 28 MET A O    3 
ATOM   1836 C CB   . MET A 1 28 ? -5.887  -7.971  -6.470  1.00 0.00 ? 28 MET A CB   3 
ATOM   1837 C CG   . MET A 1 28 ? -6.537  -9.044  -5.586  1.00 0.00 ? 28 MET A CG   3 
ATOM   1838 S SD   . MET A 1 28 ? -7.878  -9.971  -6.381  1.00 0.00 ? 28 MET A SD   3 
ATOM   1839 C CE   . MET A 1 28 ? -6.911  -11.108 -7.410  1.00 0.00 ? 28 MET A CE   3 
ATOM   1840 H H    . MET A 1 28 ? -3.451  -8.866  -4.918  1.00 0.00 ? 28 MET A H    3 
ATOM   1841 H HA   . MET A 1 28 ? -4.283  -6.645  -6.661  1.00 0.00 ? 28 MET A HA   3 
ATOM   1842 H HB2  . MET A 1 28 ? -6.604  -7.164  -6.626  1.00 0.00 ? 28 MET A HB2  3 
ATOM   1843 H HB3  . MET A 1 28 ? -5.642  -8.383  -7.445  1.00 0.00 ? 28 MET A HB3  3 
ATOM   1844 H HG2  . MET A 1 28 ? -5.785  -9.755  -5.243  1.00 0.00 ? 28 MET A HG2  3 
ATOM   1845 H HG3  . MET A 1 28 ? -6.964  -8.549  -4.715  1.00 0.00 ? 28 MET A HG3  3 
ATOM   1846 H HE1  . MET A 1 28 ? -6.305  -11.751 -6.771  1.00 0.00 ? 28 MET A HE1  3 
ATOM   1847 H HE2  . MET A 1 28 ? -7.587  -11.726 -8.000  1.00 0.00 ? 28 MET A HE2  3 
ATOM   1848 H HE3  . MET A 1 28 ? -6.261  -10.548 -8.078  1.00 0.00 ? 28 MET A HE3  3 
ATOM   1849 N N    . ASP A 1 29 ? -4.443  -5.375  -4.588  1.00 0.00 ? 29 ASP A N    3 
ATOM   1850 C CA   . ASP A 1 29 ? -4.333  -4.426  -3.488  1.00 0.00 ? 29 ASP A CA   3 
ATOM   1851 C C    . ASP A 1 29 ? -2.883  -4.413  -2.986  1.00 0.00 ? 29 ASP A C    3 
ATOM   1852 O O    . ASP A 1 29 ? -2.235  -5.459  -2.978  1.00 0.00 ? 29 ASP A O    3 
ATOM   1853 C CB   . ASP A 1 29 ? -5.339  -4.699  -2.362  1.00 0.00 ? 29 ASP A CB   3 
ATOM   1854 C CG   . ASP A 1 29 ? -6.790  -4.922  -2.816  1.00 0.00 ? 29 ASP A CG   3 
ATOM   1855 O OD1  . ASP A 1 29 ? -7.130  -4.476  -3.930  1.00 0.00 ? 29 ASP A OD1  3 
ATOM   1856 O OD2  . ASP A 1 29 ? -7.539  -5.548  -2.032  1.00 0.00 ? 29 ASP A OD2  3 
ATOM   1857 H H    . ASP A 1 29 ? -4.209  -5.015  -5.497  1.00 0.00 ? 29 ASP A H    3 
ATOM   1858 H HA   . ASP A 1 29 ? -4.564  -3.451  -3.922  1.00 0.00 ? 29 ASP A HA   3 
ATOM   1859 H HB2  . ASP A 1 29 ? -4.999  -5.553  -1.782  1.00 0.00 ? 29 ASP A HB2  3 
ATOM   1860 H HB3  . ASP A 1 29 ? -5.321  -3.832  -1.716  1.00 0.00 ? 29 ASP A HB3  3 
ATOM   1861 N N    . ASP A 1 30 ? -2.351  -3.238  -2.609  1.00 0.00 ? 30 ASP A N    3 
ATOM   1862 C CA   . ASP A 1 30 ? -0.917  -3.052  -2.360  1.00 0.00 ? 30 ASP A CA   3 
ATOM   1863 C C    . ASP A 1 30 ? -0.716  -1.825  -1.472  1.00 0.00 ? 30 ASP A C    3 
ATOM   1864 O O    . ASP A 1 30 ? -0.525  -0.714  -1.957  1.00 0.00 ? 30 ASP A O    3 
ATOM   1865 C CB   . ASP A 1 30 ? -0.149  -2.873  -3.679  1.00 0.00 ? 30 ASP A CB   3 
ATOM   1866 C CG   . ASP A 1 30 ? -0.067  -4.142  -4.531  1.00 0.00 ? 30 ASP A CG   3 
ATOM   1867 O OD1  . ASP A 1 30 ? 0.775   -5.001  -4.187  1.00 0.00 ? 30 ASP A OD1  3 
ATOM   1868 O OD2  . ASP A 1 30 ? -0.846  -4.235  -5.507  1.00 0.00 ? 30 ASP A OD2  3 
ATOM   1869 H H    . ASP A 1 30 ? -2.960  -2.428  -2.532  1.00 0.00 ? 30 ASP A H    3 
ATOM   1870 H HA   . ASP A 1 30 ? -0.503  -3.927  -1.847  1.00 0.00 ? 30 ASP A HA   3 
ATOM   1871 H HB2  . ASP A 1 30 ? -0.601  -2.061  -4.249  1.00 0.00 ? 30 ASP A HB2  3 
ATOM   1872 H HB3  . ASP A 1 30 ? 0.871   -2.576  -3.432  1.00 0.00 ? 30 ASP A HB3  3 
ATOM   1873 N N    . TYR A 1 31 ? -0.775  -2.037  -0.160  1.00 0.00 ? 31 TYR A N    3 
ATOM   1874 C CA   . TYR A 1 31 ? -1.020  -1.002  0.843   1.00 0.00 ? 31 TYR A CA   3 
ATOM   1875 C C    . TYR A 1 31 ? 0.287   -0.383  1.353   1.00 0.00 ? 31 TYR A C    3 
ATOM   1876 O O    . TYR A 1 31 ? 1.190   -1.110  1.766   1.00 0.00 ? 31 TYR A O    3 
ATOM   1877 C CB   . TYR A 1 31 ? -1.820  -1.590  2.017   1.00 0.00 ? 31 TYR A CB   3 
ATOM   1878 C CG   . TYR A 1 31 ? -3.038  -2.424  1.638   1.00 0.00 ? 31 TYR A CG   3 
ATOM   1879 C CD1  . TYR A 1 31 ? -2.883  -3.769  1.227   1.00 0.00 ? 31 TYR A CD1  3 
ATOM   1880 C CD2  . TYR A 1 31 ? -4.332  -1.863  1.696   1.00 0.00 ? 31 TYR A CD2  3 
ATOM   1881 C CE1  . TYR A 1 31 ? -4.005  -4.522  0.825   1.00 0.00 ? 31 TYR A CE1  3 
ATOM   1882 C CE2  . TYR A 1 31 ? -5.460  -2.642  1.374   1.00 0.00 ? 31 TYR A CE2  3 
ATOM   1883 C CZ   . TYR A 1 31 ? -5.291  -3.946  0.871   1.00 0.00 ? 31 TYR A CZ   3 
ATOM   1884 O OH   . TYR A 1 31 ? -6.386  -4.704  0.573   1.00 0.00 ? 31 TYR A OH   3 
ATOM   1885 H H    . TYR A 1 31 ? -0.848  -3.000  0.113   1.00 0.00 ? 31 TYR A H    3 
ATOM   1886 H HA   . TYR A 1 31 ? -1.642  -0.224  0.390   1.00 0.00 ? 31 TYR A HA   3 
ATOM   1887 H HB2  . TYR A 1 31 ? -1.179  -2.189  2.663   1.00 0.00 ? 31 TYR A HB2  3 
ATOM   1888 H HB3  . TYR A 1 31 ? -2.139  -0.745  2.616   1.00 0.00 ? 31 TYR A HB3  3 
ATOM   1889 H HD1  . TYR A 1 31 ? -1.908  -4.232  1.218   1.00 0.00 ? 31 TYR A HD1  3 
ATOM   1890 H HD2  . TYR A 1 31 ? -4.471  -0.834  1.978   1.00 0.00 ? 31 TYR A HD2  3 
ATOM   1891 H HE1  . TYR A 1 31 ? -3.880  -5.543  0.504   1.00 0.00 ? 31 TYR A HE1  3 
ATOM   1892 H HE2  . TYR A 1 31 ? -6.449  -2.217  1.467   1.00 0.00 ? 31 TYR A HE2  3 
ATOM   1893 H HH   . TYR A 1 31 ? -7.212  -4.220  0.622   1.00 0.00 ? 31 TYR A HH   3 
ATOM   1894 N N    . CYS A 1 32 ? 0.355   0.960   1.386   1.00 0.00 ? 32 CYS A N    3 
ATOM   1895 C CA   . CYS A 1 32 ? 1.387   1.722   2.089   1.00 0.00 ? 32 CYS A CA   3 
ATOM   1896 C C    . CYS A 1 32 ? 1.034   1.642   3.572   1.00 0.00 ? 32 CYS A C    3 
ATOM   1897 O O    . CYS A 1 32 ? -0.072  1.996   3.985   1.00 0.00 ? 32 CYS A O    3 
ATOM   1898 C CB   . CYS A 1 32 ? 1.556   3.148   1.526   1.00 0.00 ? 32 CYS A CB   3 
ATOM   1899 S SG   . CYS A 1 32 ? 1.867   3.088   -0.267  1.00 0.00 ? 32 CYS A SG   3 
ATOM   1900 H H    . CYS A 1 32 ? -0.455  1.475   1.082   1.00 0.00 ? 32 CYS A H    3 
ATOM   1901 H HA   . CYS A 1 32 ? 2.346   1.235   1.916   1.00 0.00 ? 32 CYS A HA   3 
ATOM   1902 H HB2  . CYS A 1 32 ? 0.698   3.782   1.739   1.00 0.00 ? 32 CYS A HB2  3 
ATOM   1903 H HB3  . CYS A 1 32 ? 2.403   3.647   2.008   1.00 0.00 ? 32 CYS A HB3  3 
ATOM   1904 N N    . ASN A 1 33 ? 1.934   1.012   4.329   1.00 0.00 ? 33 ASN A N    3 
ATOM   1905 C CA   . ASN A 1 33 ? 1.578   0.263   5.534   1.00 0.00 ? 33 ASN A CA   3 
ATOM   1906 C C    . ASN A 1 33 ? 2.263   0.794   6.795   1.00 0.00 ? 33 ASN A C    3 
ATOM   1907 O O    . ASN A 1 33 ? 2.687   0.004   7.637   1.00 0.00 ? 33 ASN A O    3 
ATOM   1908 C CB   . ASN A 1 33 ? 1.782   -1.237  5.291   1.00 0.00 ? 33 ASN A CB   3 
ATOM   1909 C CG   . ASN A 1 33 ? 3.176   -1.580  4.783   1.00 0.00 ? 33 ASN A CG   3 
ATOM   1910 O OD1  . ASN A 1 33 ? 4.164   -0.920  5.097   1.00 0.00 ? 33 ASN A OD1  3 
ATOM   1911 N ND2  . ASN A 1 33 ? 3.226   -2.621  3.961   1.00 0.00 ? 33 ASN A ND2  3 
ATOM   1912 H H    . ASN A 1 33 ? 2.826   0.814   3.890   1.00 0.00 ? 33 ASN A H    3 
ATOM   1913 H HA   . ASN A 1 33 ? 0.514   0.314   5.709   1.00 0.00 ? 33 ASN A HA   3 
ATOM   1914 H HB2  . ASN A 1 33 ? 1.591   -1.821  6.190   1.00 0.00 ? 33 ASN A HB2  3 
ATOM   1915 H HB3  . ASN A 1 33 ? 1.045   -1.547  4.546   1.00 0.00 ? 33 ASN A HB3  3 
ATOM   1916 H HD21 . ASN A 1 33 ? 2.376   -3.120  3.744   1.00 0.00 ? 33 ASN A HD21 3 
ATOM   1917 H HD22 . ASN A 1 33 ? 4.104   -2.873  3.551   1.00 0.00 ? 33 ASN A HD22 3 
ATOM   1918 N N    . GLY A 1 34 ? 2.362   2.125   6.943   1.00 0.00 ? 34 GLY A N    3 
ATOM   1919 C CA   . GLY A 1 34 ? 2.950   2.763   8.119   1.00 0.00 ? 34 GLY A CA   3 
ATOM   1920 C C    . GLY A 1 34 ? 4.491   2.716   8.134   1.00 0.00 ? 34 GLY A C    3 
ATOM   1921 O O    . GLY A 1 34 ? 5.119   3.614   8.693   1.00 0.00 ? 34 GLY A O    3 
ATOM   1922 H H    . GLY A 1 34 ? 2.018   2.724   6.207   1.00 0.00 ? 34 GLY A H    3 
ATOM   1923 H HA2  . GLY A 1 34 ? 2.608   3.797   8.147   1.00 0.00 ? 34 GLY A HA2  3 
ATOM   1924 H HA3  . GLY A 1 34 ? 2.583   2.274   9.023   1.00 0.00 ? 34 GLY A HA3  3 
ATOM   1925 N N    . LYS A 1 35 ? 5.093   1.661   7.559   1.00 0.00 ? 35 LYS A N    3 
ATOM   1926 C CA   . LYS A 1 35 ? 6.515   1.328   7.618   1.00 0.00 ? 35 LYS A CA   3 
ATOM   1927 C C    . LYS A 1 35 ? 7.235   1.659   6.307   1.00 0.00 ? 35 LYS A C    3 
ATOM   1928 O O    . LYS A 1 35 ? 8.384   2.099   6.343   1.00 0.00 ? 35 LYS A O    3 
ATOM   1929 C CB   . LYS A 1 35 ? 6.683   -0.167  7.956   1.00 0.00 ? 35 LYS A CB   3 
ATOM   1930 C CG   . LYS A 1 35 ? 5.841   -0.645  9.151   1.00 0.00 ? 35 LYS A CG   3 
ATOM   1931 C CD   . LYS A 1 35 ? 6.130   0.140   10.438  1.00 0.00 ? 35 LYS A CD   3 
ATOM   1932 C CE   . LYS A 1 35 ? 5.141   -0.216  11.557  1.00 0.00 ? 35 LYS A CE   3 
ATOM   1933 N NZ   . LYS A 1 35 ? 3.792   0.321   11.293  1.00 0.00 ? 35 LYS A NZ   3 
ATOM   1934 H H    . LYS A 1 35 ? 4.507   0.969   7.114   1.00 0.00 ? 35 LYS A H    3 
ATOM   1935 H HA   . LYS A 1 35 ? 7.001   1.912   8.401   1.00 0.00 ? 35 LYS A HA   3 
ATOM   1936 H HB2  . LYS A 1 35 ? 6.389   -0.767  7.092   1.00 0.00 ? 35 LYS A HB2  3 
ATOM   1937 H HB3  . LYS A 1 35 ? 7.736   -0.369  8.162   1.00 0.00 ? 35 LYS A HB3  3 
ATOM   1938 H HG2  . LYS A 1 35 ? 4.786   -0.563  8.901   1.00 0.00 ? 35 LYS A HG2  3 
ATOM   1939 H HG3  . LYS A 1 35 ? 6.053   -1.701  9.328   1.00 0.00 ? 35 LYS A HG3  3 
ATOM   1940 H HD2  . LYS A 1 35 ? 7.143   -0.098  10.768  1.00 0.00 ? 35 LYS A HD2  3 
ATOM   1941 H HD3  . LYS A 1 35 ? 6.070   1.215   10.270  1.00 0.00 ? 35 LYS A HD3  3 
ATOM   1942 H HE2  . LYS A 1 35 ? 5.081   -1.299  11.675  1.00 0.00 ? 35 LYS A HE2  3 
ATOM   1943 H HE3  . LYS A 1 35 ? 5.496   0.216   12.494  1.00 0.00 ? 35 LYS A HE3  3 
ATOM   1944 H HZ1  . LYS A 1 35 ? 3.182   0.102   12.067  1.00 0.00 ? 35 LYS A HZ1  3 
ATOM   1945 H HZ2  . LYS A 1 35 ? 3.847   1.324   11.183  1.00 0.00 ? 35 LYS A HZ2  3 
ATOM   1946 H HZ3  . LYS A 1 35 ? 3.418   -0.088  10.449  1.00 0.00 ? 35 LYS A HZ3  3 
ATOM   1947 N N    . THR A 1 36 ? 6.577   1.421   5.160   1.00 0.00 ? 36 THR A N    3 
ATOM   1948 C CA   . THR A 1 36 ? 7.150   1.615   3.826   1.00 0.00 ? 36 THR A CA   3 
ATOM   1949 C C    . THR A 1 36 ? 6.131   2.167   2.816   1.00 0.00 ? 36 THR A C    3 
ATOM   1950 O O    . THR A 1 36 ? 4.916   2.055   2.990   1.00 0.00 ? 36 THR A O    3 
ATOM   1951 C CB   . THR A 1 36 ? 7.907   0.356   3.351   1.00 0.00 ? 36 THR A CB   3 
ATOM   1952 O OG1  . THR A 1 36 ? 8.320   0.472   2.002   1.00 0.00 ? 36 THR A OG1  3 
ATOM   1953 C CG2  . THR A 1 36 ? 7.128   -0.953  3.536   1.00 0.00 ? 36 THR A CG2  3 
ATOM   1954 H H    . THR A 1 36 ? 5.636   1.056   5.227   1.00 0.00 ? 36 THR A H    3 
ATOM   1955 H HA   . THR A 1 36 ? 7.923   2.376   3.906   1.00 0.00 ? 36 THR A HA   3 
ATOM   1956 H HB   . THR A 1 36 ? 8.819   0.314   3.947   1.00 0.00 ? 36 THR A HB   3 
ATOM   1957 H HG1  . THR A 1 36 ? 8.885   -0.274  1.787   1.00 0.00 ? 36 THR A HG1  3 
ATOM   1958 H HG21 . THR A 1 36 ? 7.693   -1.786  3.116   1.00 0.00 ? 36 THR A HG21 3 
ATOM   1959 H HG22 . THR A 1 36 ? 6.162   -0.892  3.043   1.00 0.00 ? 36 THR A HG22 3 
ATOM   1960 H HG23 . THR A 1 36 ? 6.970   -1.151  4.597   1.00 0.00 ? 36 THR A HG23 3 
ATOM   1961 N N    . CYS A 1 37 ? 6.690   2.805   1.776   1.00 0.00 ? 37 CYS A N    3 
ATOM   1962 C CA   . CYS A 1 37 ? 6.026   3.563   0.711   1.00 0.00 ? 37 CYS A CA   3 
ATOM   1963 C C    . CYS A 1 37 ? 6.342   3.024   -0.692  1.00 0.00 ? 37 CYS A C    3 
ATOM   1964 O O    . CYS A 1 37 ? 6.013   3.678   -1.681  1.00 0.00 ? 37 CYS A O    3 
ATOM   1965 C CB   . CYS A 1 37 ? 6.494   5.029   0.798   1.00 0.00 ? 37 CYS A CB   3 
ATOM   1966 S SG   . CYS A 1 37 ? 6.406   5.759   2.447   1.00 0.00 ? 37 CYS A SG   3 
ATOM   1967 H H    . CYS A 1 37 ? 7.701   2.812   1.766   1.00 0.00 ? 37 CYS A H    3 
ATOM   1968 H HA   . CYS A 1 37 ? 4.945   3.505   0.833   1.00 0.00 ? 37 CYS A HA   3 
ATOM   1969 H HB2  . CYS A 1 37 ? 7.537   5.089   0.489   1.00 0.00 ? 37 CYS A HB2  3 
ATOM   1970 H HB3  . CYS A 1 37 ? 5.903   5.642   0.118   1.00 0.00 ? 37 CYS A HB3  3 
ATOM   1971 N N    . ASP A 1 38 ? 6.980   1.848   -0.789  1.00 0.00 ? 38 ASP A N    3 
ATOM   1972 C CA   . ASP A 1 38 ? 7.444   1.244   -2.038  1.00 0.00 ? 38 ASP A CA   3 
ATOM   1973 C C    . ASP A 1 38 ? 6.300   0.449   -2.691  1.00 0.00 ? 38 ASP A C    3 
ATOM   1974 O O    . ASP A 1 38 ? 6.478   -0.715  -3.054  1.00 0.00 ? 38 ASP A O    3 
ATOM   1975 C CB   . ASP A 1 38 ? 8.688   0.384   -1.726  1.00 0.00 ? 38 ASP A CB   3 
ATOM   1976 C CG   . ASP A 1 38 ? 9.382   -0.171  -2.976  1.00 0.00 ? 38 ASP A CG   3 
ATOM   1977 O OD1  . ASP A 1 38 ? 9.557   0.613   -3.936  1.00 0.00 ? 38 ASP A OD1  3 
ATOM   1978 O OD2  . ASP A 1 38 ? 9.729   -1.372  -2.953  1.00 0.00 ? 38 ASP A OD2  3 
ATOM   1979 H H    . ASP A 1 38 ? 7.160   1.352   0.071   1.00 0.00 ? 38 ASP A H    3 
ATOM   1980 H HA   . ASP A 1 38 ? 7.744   2.038   -2.725  1.00 0.00 ? 38 ASP A HA   3 
ATOM   1981 H HB2  . ASP A 1 38 ? 9.418   0.990   -1.186  1.00 0.00 ? 38 ASP A HB2  3 
ATOM   1982 H HB3  . ASP A 1 38 ? 8.396   -0.439  -1.070  1.00 0.00 ? 38 ASP A HB3  3 
ATOM   1983 N N    . CYS A 1 39 ? 5.119   1.084   -2.807  1.00 0.00 ? 39 CYS A N    3 
ATOM   1984 C CA   . CYS A 1 39 ? 3.827   0.502   -3.164  1.00 0.00 ? 39 CYS A CA   3 
ATOM   1985 C C    . CYS A 1 39 ? 3.703   -0.932  -2.609  1.00 0.00 ? 39 CYS A C    3 
ATOM   1986 O O    . CYS A 1 39 ? 3.607   -1.880  -3.389  1.00 0.00 ? 39 CYS A O    3 
ATOM   1987 C CB   . CYS A 1 39 ? 3.672   0.613   -4.691  1.00 0.00 ? 39 CYS A CB   3 
ATOM   1988 S SG   . CYS A 1 39 ? 1.998   0.475   -5.372  1.00 0.00 ? 39 CYS A SG   3 
ATOM   1989 H H    . CYS A 1 39 ? 5.094   2.061   -2.563  1.00 0.00 ? 39 CYS A H    3 
ATOM   1990 H HA   . CYS A 1 39 ? 3.053   1.113   -2.692  1.00 0.00 ? 39 CYS A HA   3 
ATOM   1991 H HB2  . CYS A 1 39 ? 4.041   1.586   -5.022  1.00 0.00 ? 39 CYS A HB2  3 
ATOM   1992 H HB3  . CYS A 1 39 ? 4.311   -0.134  -5.158  1.00 0.00 ? 39 CYS A HB3  3 
ATOM   1993 N N    . PRO A 1 40 ? 3.811   -1.109  -1.273  1.00 0.00 ? 40 PRO A N    3 
ATOM   1994 C CA   . PRO A 1 40 ? 4.257   -2.358  -0.655  1.00 0.00 ? 40 PRO A CA   3 
ATOM   1995 C C    . PRO A 1 40 ? 3.374   -3.570  -0.960  1.00 0.00 ? 40 PRO A C    3 
ATOM   1996 O O    . PRO A 1 40 ? 2.175   -3.428  -1.204  1.00 0.00 ? 40 PRO A O    3 
ATOM   1997 C CB   . PRO A 1 40 ? 4.310   -2.099  0.854   1.00 0.00 ? 40 PRO A CB   3 
ATOM   1998 C CG   . PRO A 1 40 ? 4.496   -0.588  0.945   1.00 0.00 ? 40 PRO A CG   3 
ATOM   1999 C CD   . PRO A 1 40 ? 3.713   -0.068  -0.258  1.00 0.00 ? 40 PRO A CD   3 
ATOM   2000 H HA   . PRO A 1 40 ? 5.276   -2.541  -1.007  1.00 0.00 ? 40 PRO A HA   3 
ATOM   2001 H HB2  . PRO A 1 40 ? 3.359   -2.366  1.315   1.00 0.00 ? 40 PRO A HB2  3 
ATOM   2002 H HB3  . PRO A 1 40 ? 5.119   -2.645  1.343   1.00 0.00 ? 40 PRO A HB3  3 
ATOM   2003 H HG2  . PRO A 1 40 ? 4.133   -0.193  1.892   1.00 0.00 ? 40 PRO A HG2  3 
ATOM   2004 H HG3  . PRO A 1 40 ? 5.553   -0.345  0.816   1.00 0.00 ? 40 PRO A HG3  3 
ATOM   2005 H HD2  . PRO A 1 40 ? 2.658   0.044   -0.031  1.00 0.00 ? 40 PRO A HD2  3 
ATOM   2006 H HD3  . PRO A 1 40 ? 4.105   0.912   -0.516  1.00 0.00 ? 40 PRO A HD3  3 
ATOM   2007 N N    . ARG A 1 41 ? 3.981   -4.766  -0.920  1.00 0.00 ? 41 ARG A N    3 
ATOM   2008 C CA   . ARG A 1 41 ? 3.336   -6.029  -1.220  1.00 0.00 ? 41 ARG A CA   3 
ATOM   2009 C C    . ARG A 1 41 ? 2.200   -6.356  -0.235  1.00 0.00 ? 41 ARG A C    3 
ATOM   2010 O O    . ARG A 1 41 ? 2.076   -5.752  0.832   1.00 0.00 ? 41 ARG A O    3 
ATOM   2011 C CB   . ARG A 1 41 ? 4.407   -7.135  -1.334  1.00 0.00 ? 41 ARG A CB   3 
ATOM   2012 C CG   . ARG A 1 41 ? 4.621   -7.989  -0.073  1.00 0.00 ? 41 ARG A CG   3 
ATOM   2013 C CD   . ARG A 1 41 ? 5.669   -9.085  -0.318  1.00 0.00 ? 41 ARG A CD   3 
ATOM   2014 N NE   . ARG A 1 41 ? 5.697   -10.074 0.773   1.00 0.00 ? 41 ARG A NE   3 
ATOM   2015 C CZ   . ARG A 1 41 ? 4.802   -11.062 0.965   1.00 0.00 ? 41 ARG A CZ   3 
ATOM   2016 N NH1  . ARG A 1 41 ? 3.742   -11.221 0.155   1.00 0.00 ? 41 ARG A NH1  3 
ATOM   2017 N NH2  . ARG A 1 41 ? 4.968   -11.908 1.993   1.00 0.00 ? 41 ARG A NH2  3 
ATOM   2018 H H    . ARG A 1 41 ? 4.971   -4.831  -0.743  1.00 0.00 ? 41 ARG A H    3 
ATOM   2019 H HA   . ARG A 1 41 ? 2.894   -5.905  -2.213  1.00 0.00 ? 41 ARG A HA   3 
ATOM   2020 H HB2  . ARG A 1 41 ? 4.089   -7.792  -2.134  1.00 0.00 ? 41 ARG A HB2  3 
ATOM   2021 H HB3  . ARG A 1 41 ? 5.366   -6.713  -1.645  1.00 0.00 ? 41 ARG A HB3  3 
ATOM   2022 H HG2  . ARG A 1 41 ? 4.930   -7.356  0.761   1.00 0.00 ? 41 ARG A HG2  3 
ATOM   2023 H HG3  . ARG A 1 41 ? 3.681   -8.477  0.184   1.00 0.00 ? 41 ARG A HG3  3 
ATOM   2024 H HD2  . ARG A 1 41 ? 5.460   -9.596  -1.259  1.00 0.00 ? 41 ARG A HD2  3 
ATOM   2025 H HD3  . ARG A 1 41 ? 6.655   -8.624  -0.396  1.00 0.00 ? 41 ARG A HD3  3 
ATOM   2026 H HE   . ARG A 1 41 ? 6.468   -10.000 1.421   1.00 0.00 ? 41 ARG A HE   3 
ATOM   2027 H HH11 . ARG A 1 41 ? 3.600   -10.594 -0.624  1.00 0.00 ? 41 ARG A HH11 3 
ATOM   2028 H HH12 . ARG A 1 41 ? 3.083   -11.967 0.325   1.00 0.00 ? 41 ARG A HH12 3 
ATOM   2029 H HH21 . ARG A 1 41 ? 5.757   -11.800 2.614   1.00 0.00 ? 41 ARG A HH21 3 
ATOM   2030 H HH22 . ARG A 1 41 ? 4.300   -12.648 2.151   1.00 0.00 ? 41 ARG A HH22 3 
ATOM   2031 N N    . ASN A 1 42 ? 1.367   -7.322  -0.632  1.00 0.00 ? 42 ASN A N    3 
ATOM   2032 C CA   . ASN A 1 42 ? 0.122   -7.693  0.012   1.00 0.00 ? 42 ASN A CA   3 
ATOM   2033 C C    . ASN A 1 42 ? 0.089   -9.212  0.209   1.00 0.00 ? 42 ASN A C    3 
ATOM   2034 O O    . ASN A 1 42 ? -0.396  -9.936  -0.661  1.00 0.00 ? 42 ASN A O    3 
ATOM   2035 C CB   . ASN A 1 42 ? -1.028  -7.154  -0.853  1.00 0.00 ? 42 ASN A CB   3 
ATOM   2036 C CG   . ASN A 1 42 ? -2.412  -7.700  -0.508  1.00 0.00 ? 42 ASN A CG   3 
ATOM   2037 O OD1  . ASN A 1 42 ? -2.708  -8.016  0.644   1.00 0.00 ? 42 ASN A OD1  3 
ATOM   2038 N ND2  . ASN A 1 42 ? -3.255  -7.811  -1.535  1.00 0.00 ? 42 ASN A ND2  3 
ATOM   2039 H H    . ASN A 1 42 ? 1.556   -7.773  -1.511  1.00 0.00 ? 42 ASN A H    3 
ATOM   2040 H HA   . ASN A 1 42 ? 0.004   -7.225  0.986   1.00 0.00 ? 42 ASN A HA   3 
ATOM   2041 H HB2  . ASN A 1 42 ? -1.065  -6.069  -0.752  1.00 0.00 ? 42 ASN A HB2  3 
ATOM   2042 H HB3  . ASN A 1 42 ? -0.809  -7.393  -1.893  1.00 0.00 ? 42 ASN A HB3  3 
ATOM   2043 H HD21 . ASN A 1 42 ? -2.958  -7.504  -2.452  1.00 0.00 ? 42 ASN A HD21 3 
ATOM   2044 H HD22 . ASN A 1 42 ? -4.179  -8.195  -1.427  1.00 0.00 ? 42 ASN A HD22 3 
ATOM   2045 N N    . PRO A 1 43 ? 0.530   -9.692  1.388   1.00 0.00 ? 43 PRO A N    3 
ATOM   2046 C CA   . PRO A 1 43 ? 0.059   -10.937 1.968   1.00 0.00 ? 43 PRO A CA   3 
ATOM   2047 C C    . PRO A 1 43 ? -1.457  -10.802 2.179   1.00 0.00 ? 43 PRO A C    3 
ATOM   2048 O O    . PRO A 1 43 ? -1.904  -10.170 3.132   1.00 0.00 ? 43 PRO A O    3 
ATOM   2049 C CB   . PRO A 1 43 ? 0.823   -11.136 3.292   1.00 0.00 ? 43 PRO A CB   3 
ATOM   2050 C CG   . PRO A 1 43 ? 1.868   -10.020 3.314   1.00 0.00 ? 43 PRO A CG   3 
ATOM   2051 C CD   . PRO A 1 43 ? 1.328   -8.963  2.352   1.00 0.00 ? 43 PRO A CD   3 
ATOM   2052 H HA   . PRO A 1 43 ? 0.306   -11.758 1.291   1.00 0.00 ? 43 PRO A HA   3 
ATOM   2053 H HB2  . PRO A 1 43 ? 0.179   -11.036 4.166   1.00 0.00 ? 43 PRO A HB2  3 
ATOM   2054 H HB3  . PRO A 1 43 ? 1.304   -12.115 3.326   1.00 0.00 ? 43 PRO A HB3  3 
ATOM   2055 H HG2  . PRO A 1 43 ? 2.023   -9.618  4.316   1.00 0.00 ? 43 PRO A HG2  3 
ATOM   2056 H HG3  . PRO A 1 43 ? 2.813   -10.404 2.928   1.00 0.00 ? 43 PRO A HG3  3 
ATOM   2057 H HD2  . PRO A 1 43 ? 0.688   -8.256  2.874   1.00 0.00 ? 43 PRO A HD2  3 
ATOM   2058 H HD3  . PRO A 1 43 ? 2.155   -8.435  1.883   1.00 0.00 ? 43 PRO A HD3  3 
ATOM   2059 N N    . HIS A 1 44 ? -2.233  -11.357 1.243   1.00 0.00 ? 44 HIS A N    3 
ATOM   2060 C CA   . HIS A 1 44 ? -3.699  -11.327 1.194   1.00 0.00 ? 44 HIS A CA   3 
ATOM   2061 C C    . HIS A 1 44 ? -4.369  -11.767 2.509   1.00 0.00 ? 44 HIS A C    3 
ATOM   2062 O O    . HIS A 1 44 ? -5.436  -11.264 2.858   1.00 0.00 ? 44 HIS A O    3 
ATOM   2063 C CB   . HIS A 1 44 ? -4.183  -12.179 0.007   1.00 0.00 ? 44 HIS A CB   3 
ATOM   2064 C CG   . HIS A 1 44 ? -3.583  -11.766 -1.318  1.00 0.00 ? 44 HIS A CG   3 
ATOM   2065 N ND1  . HIS A 1 44 ? -2.386  -12.199 -1.843  1.00 0.00 ? 44 HIS A ND1  3 
ATOM   2066 C CD2  . HIS A 1 44 ? -4.048  -10.768 -2.127  1.00 0.00 ? 44 HIS A CD2  3 
ATOM   2067 C CE1  . HIS A 1 44 ? -2.146  -11.475 -2.950  1.00 0.00 ? 44 HIS A CE1  3 
ATOM   2068 N NE2  . HIS A 1 44 ? -3.130  -10.587 -3.165  1.00 0.00 ? 44 HIS A NE2  3 
ATOM   2069 H H    . HIS A 1 44 ? -1.754  -11.742 0.446   1.00 0.00 ? 44 HIS A H    3 
ATOM   2070 H HA   . HIS A 1 44 ? -3.991  -10.296 1.011   1.00 0.00 ? 44 HIS A HA   3 
ATOM   2071 H HB2  . HIS A 1 44 ? -3.938  -13.225 0.181   1.00 0.00 ? 44 HIS A HB2  3 
ATOM   2072 H HB3  . HIS A 1 44 ? -5.269  -12.101 -0.066  1.00 0.00 ? 44 HIS A HB3  3 
ATOM   2073 H HD1  . HIS A 1 44 ? -1.777  -12.900 -1.444  1.00 0.00 ? 44 HIS A HD1  3 
ATOM   2074 H HD2  . HIS A 1 44 ? -4.930  -10.182 -1.936  1.00 0.00 ? 44 HIS A HD2  3 
ATOM   2075 H HE1  . HIS A 1 44 ? -1.266  -11.580 -3.569  1.00 0.00 ? 44 HIS A HE1  3 
ATOM   2076 N N    . LYS A 1 45 ? -3.682  -12.628 3.271   1.00 0.00 ? 45 LYS A N    3 
ATOM   2077 C CA   . LYS A 1 45 ? -4.015  -13.079 4.618   1.00 0.00 ? 45 LYS A CA   3 
ATOM   2078 C C    . LYS A 1 45 ? -4.121  -11.897 5.598   1.00 0.00 ? 45 LYS A C    3 
ATOM   2079 O O    . LYS A 1 45 ? -5.098  -11.795 6.338   1.00 0.00 ? 45 LYS A O    3 
ATOM   2080 C CB   . LYS A 1 45 ? -2.962  -14.107 5.083   1.00 0.00 ? 45 LYS A CB   3 
ATOM   2081 C CG   . LYS A 1 45 ? -3.170  -15.526 4.516   1.00 0.00 ? 45 LYS A CG   3 
ATOM   2082 C CD   . LYS A 1 45 ? -3.187  -15.664 2.983   1.00 0.00 ? 45 LYS A CD   3 
ATOM   2083 C CE   . LYS A 1 45 ? -1.836  -15.362 2.320   1.00 0.00 ? 45 LYS A CE   3 
ATOM   2084 N NZ   . LYS A 1 45 ? -1.923  -15.489 0.854   1.00 0.00 ? 45 LYS A NZ   3 
ATOM   2085 H H    . LYS A 1 45 ? -2.806  -12.947 2.898   1.00 0.00 ? 45 LYS A H    3 
ATOM   2086 H HA   . LYS A 1 45 ? -4.983  -13.569 4.577   1.00 0.00 ? 45 LYS A HA   3 
ATOM   2087 H HB2  . LYS A 1 45 ? -1.957  -13.754 4.844   1.00 0.00 ? 45 LYS A HB2  3 
ATOM   2088 H HB3  . LYS A 1 45 ? -3.021  -14.200 6.169   1.00 0.00 ? 45 LYS A HB3  3 
ATOM   2089 H HG2  . LYS A 1 45 ? -2.382  -16.171 4.912   1.00 0.00 ? 45 LYS A HG2  3 
ATOM   2090 H HG3  . LYS A 1 45 ? -4.122  -15.901 4.897   1.00 0.00 ? 45 LYS A HG3  3 
ATOM   2091 H HD2  . LYS A 1 45 ? -3.445  -16.701 2.753   1.00 0.00 ? 45 LYS A HD2  3 
ATOM   2092 H HD3  . LYS A 1 45 ? -3.973  -15.041 2.558   1.00 0.00 ? 45 LYS A HD3  3 
ATOM   2093 H HE2  . LYS A 1 45 ? -1.504  -14.352 2.556   1.00 0.00 ? 45 LYS A HE2  3 
ATOM   2094 H HE3  . LYS A 1 45 ? -1.088  -16.066 2.685   1.00 0.00 ? 45 LYS A HE3  3 
ATOM   2095 H HZ1  . LYS A 1 45 ? -2.206  -16.429 0.614   1.00 0.00 ? 45 LYS A HZ1  3 
ATOM   2096 H HZ2  . LYS A 1 45 ? -2.605  -14.834 0.500   1.00 0.00 ? 45 LYS A HZ2  3 
ATOM   2097 H HZ3  . LYS A 1 45 ? -1.022  -15.293 0.440   1.00 0.00 ? 45 LYS A HZ3  3 
ATOM   2098 N N    . GLY A 1 46 ? -3.111  -11.017 5.589   1.00 0.00 ? 46 GLY A N    3 
ATOM   2099 C CA   . GLY A 1 46 ? -3.002  -9.815  6.408   1.00 0.00 ? 46 GLY A CA   3 
ATOM   2100 C C    . GLY A 1 46 ? -2.971  -8.563  5.519   1.00 0.00 ? 46 GLY A C    3 
ATOM   2101 O O    . GLY A 1 46 ? -1.883  -8.070  5.218   1.00 0.00 ? 46 GLY A O    3 
ATOM   2102 H H    . GLY A 1 46 ? -2.373  -11.189 4.922   1.00 0.00 ? 46 GLY A H    3 
ATOM   2103 H HA2  . GLY A 1 46 ? -3.793  -9.751  7.155   1.00 0.00 ? 46 GLY A HA2  3 
ATOM   2104 H HA3  . GLY A 1 46 ? -2.059  -9.883  6.953   1.00 0.00 ? 46 GLY A HA3  3 
ATOM   2105 N N    . PRO A 1 47 ? -4.135  -8.034  5.090   1.00 0.00 ? 47 PRO A N    3 
ATOM   2106 C CA   . PRO A 1 47 ? -4.230  -6.888  4.182   1.00 0.00 ? 47 PRO A CA   3 
ATOM   2107 C C    . PRO A 1 47 ? -3.810  -5.543  4.808   1.00 0.00 ? 47 PRO A C    3 
ATOM   2108 O O    . PRO A 1 47 ? -3.699  -4.553  4.085   1.00 0.00 ? 47 PRO A O    3 
ATOM   2109 C CB   . PRO A 1 47 ? -5.688  -6.869  3.706   1.00 0.00 ? 47 PRO A CB   3 
ATOM   2110 C CG   . PRO A 1 47 ? -6.440  -7.457  4.901   1.00 0.00 ? 47 PRO A CG   3 
ATOM   2111 C CD   . PRO A 1 47 ? -5.468  -8.517  5.424   1.00 0.00 ? 47 PRO A CD   3 
ATOM   2112 H HA   . PRO A 1 47 ? -3.583  -7.060  3.322   1.00 0.00 ? 47 PRO A HA   3 
ATOM   2113 H HB2  . PRO A 1 47 ? -6.048  -5.874  3.438   1.00 0.00 ? 47 PRO A HB2  3 
ATOM   2114 H HB3  . PRO A 1 47 ? -5.801  -7.539  2.851   1.00 0.00 ? 47 PRO A HB3  3 
ATOM   2115 H HG2  . PRO A 1 47 ? -6.581  -6.680  5.655   1.00 0.00 ? 47 PRO A HG2  3 
ATOM   2116 H HG3  . PRO A 1 47 ? -7.406  -7.879  4.618   1.00 0.00 ? 47 PRO A HG3  3 
ATOM   2117 H HD2  . PRO A 1 47 ? -5.613  -8.645  6.498   1.00 0.00 ? 47 PRO A HD2  3 
ATOM   2118 H HD3  . PRO A 1 47 ? -5.648  -9.461  4.910   1.00 0.00 ? 47 PRO A HD3  3 
ATOM   2119 N N    . ALA A 1 48 ? -3.539  -5.504  6.122   1.00 0.00 ? 48 ALA A N    3 
ATOM   2120 C CA   . ALA A 1 48 ? -2.896  -4.382  6.806   1.00 0.00 ? 48 ALA A CA   3 
ATOM   2121 C C    . ALA A 1 48 ? -1.517  -4.098  6.189   1.00 0.00 ? 48 ALA A C    3 
ATOM   2122 O O    . ALA A 1 48 ? -1.220  -2.959  5.831   1.00 0.00 ? 48 ALA A O    3 
ATOM   2123 C CB   . ALA A 1 48 ? -2.785  -4.684  8.307   1.00 0.00 ? 48 ALA A CB   3 
ATOM   2124 H H    . ALA A 1 48 ? -3.667  -6.353  6.652   1.00 0.00 ? 48 ALA A H    3 
ATOM   2125 H HA   . ALA A 1 48 ? -3.531  -3.499  6.690   1.00 0.00 ? 48 ALA A HA   3 
ATOM   2126 H HB1  . ALA A 1 48 ? -2.322  -3.841  8.823   1.00 0.00 ? 48 ALA A HB1  3 
ATOM   2127 H HB2  . ALA A 1 48 ? -3.777  -4.847  8.729   1.00 0.00 ? 48 ALA A HB2  3 
ATOM   2128 H HB3  . ALA A 1 48 ? -2.180  -5.577  8.475   1.00 0.00 ? 48 ALA A HB3  3 
ATOM   2129 N N    . THR A 1 49 ? -0.703  -5.154  6.024   1.00 0.00 ? 49 THR A N    3 
ATOM   2130 C CA   . THR A 1 49 ? 0.526   -5.145  5.234   1.00 0.00 ? 49 THR A CA   3 
ATOM   2131 C C    . THR A 1 49 ? 0.175   -5.014  3.741   1.00 0.00 ? 49 THR A C    3 
ATOM   2132 O O    . THR A 1 49 ? 0.691   -4.133  3.056   1.00 0.00 ? 49 THR A O    3 
ATOM   2133 C CB   . THR A 1 49 ? 1.345   -6.422  5.521   1.00 0.00 ? 49 THR A CB   3 
ATOM   2134 O OG1  . THR A 1 49 ? 1.625   -6.520  6.905   1.00 0.00 ? 49 THR A OG1  3 
ATOM   2135 C CG2  . THR A 1 49 ? 2.673   -6.439  4.748   1.00 0.00 ? 49 THR A CG2  3 
ATOM   2136 H H    . THR A 1 49 ? -1.019  -6.053  6.356   1.00 0.00 ? 49 THR A H    3 
ATOM   2137 H HA   . THR A 1 49 ? 1.128   -4.286  5.537   1.00 0.00 ? 49 THR A HA   3 
ATOM   2138 H HB   . THR A 1 49 ? 0.767   -7.303  5.238   1.00 0.00 ? 49 THR A HB   3 
ATOM   2139 H HG1  . THR A 1 49 ? 2.139   -5.752  7.169   1.00 0.00 ? 49 THR A HG1  3 
ATOM   2140 H HG21 . THR A 1 49 ? 3.271   -5.565  5.007   1.00 0.00 ? 49 THR A HG21 3 
ATOM   2141 H HG22 . THR A 1 49 ? 2.491   -6.440  3.674   1.00 0.00 ? 49 THR A HG22 3 
ATOM   2142 H HG23 . THR A 1 49 ? 3.235   -7.339  5.002   1.00 0.00 ? 49 THR A HG23 3 
HETATM 2143 N N    . NH2 A 1 50 ? -0.716  -5.878  3.241   1.00 0.00 ? 50 NH2 A N    3 
HETATM 2144 H HN1  . NH2 A 1 50 ? -0.983  -5.822  2.269   1.00 0.00 ? 50 NH2 A HN1  3 
HETATM 2145 H HN2  . NH2 A 1 50 ? -1.128  -6.583  3.838   1.00 0.00 ? 50 NH2 A HN2  3 
ATOM   2146 N N    . GLU A 1 1  ? 15.241  10.488  6.929   1.00 0.00 ? 1  GLU A N    4 
ATOM   2147 C CA   . GLU A 1 1  ? 14.132  11.115  6.180   1.00 0.00 ? 1  GLU A CA   4 
ATOM   2148 C C    . GLU A 1 1  ? 13.171  10.060  5.606   1.00 0.00 ? 1  GLU A C    4 
ATOM   2149 O O    . GLU A 1 1  ? 13.460  8.862   5.597   1.00 0.00 ? 1  GLU A O    4 
ATOM   2150 C CB   . GLU A 1 1  ? 14.644  12.053  5.064   1.00 0.00 ? 1  GLU A CB   4 
ATOM   2151 C CG   . GLU A 1 1  ? 15.391  13.304  5.562   1.00 0.00 ? 1  GLU A CG   4 
ATOM   2152 C CD   . GLU A 1 1  ? 16.754  12.994  6.184   1.00 0.00 ? 1  GLU A CD   4 
ATOM   2153 O OE1  . GLU A 1 1  ? 17.643  12.553  5.423   1.00 0.00 ? 1  GLU A OE1  4 
ATOM   2154 O OE2  . GLU A 1 1  ? 16.883  13.191  7.413   1.00 0.00 ? 1  GLU A OE2  4 
ATOM   2155 H H1   . GLU A 1 1  ? 15.790  11.198  7.388   1.00 0.00 ? 1  GLU A H1   4 
ATOM   2156 H H2   . GLU A 1 1  ? 15.825  9.970   6.287   1.00 0.00 ? 1  GLU A H2   4 
ATOM   2157 H H3   . GLU A 1 1  ? 14.865  9.858   7.623   1.00 0.00 ? 1  GLU A H3   4 
ATOM   2158 H HA   . GLU A 1 1  ? 13.572  11.717  6.900   1.00 0.00 ? 1  GLU A HA   4 
ATOM   2159 H HB2  . GLU A 1 1  ? 15.277  11.495  4.372   1.00 0.00 ? 1  GLU A HB2  4 
ATOM   2160 H HB3  . GLU A 1 1  ? 13.785  12.420  4.498   1.00 0.00 ? 1  GLU A HB3  4 
ATOM   2161 H HG2  . GLU A 1 1  ? 15.558  13.965  4.709   1.00 0.00 ? 1  GLU A HG2  4 
ATOM   2162 H HG3  . GLU A 1 1  ? 14.760  13.840  6.274   1.00 0.00 ? 1  GLU A HG3  4 
ATOM   2163 N N    . CYS A 1 2  ? 12.017  10.530  5.112   1.00 0.00 ? 2  CYS A N    4 
ATOM   2164 C CA   . CYS A 1 2  ? 10.975  9.748   4.471   1.00 0.00 ? 2  CYS A CA   4 
ATOM   2165 C C    . CYS A 1 2  ? 11.417  9.250   3.089   1.00 0.00 ? 2  CYS A C    4 
ATOM   2166 O O    . CYS A 1 2  ? 12.063  9.975   2.330   1.00 0.00 ? 2  CYS A O    4 
ATOM   2167 C CB   . CYS A 1 2  ? 9.692   10.592  4.391   1.00 0.00 ? 2  CYS A CB   4 
ATOM   2168 S SG   . CYS A 1 2  ? 9.841   12.221  3.592   1.00 0.00 ? 2  CYS A SG   4 
ATOM   2169 H H    . CYS A 1 2  ? 11.845  11.518  5.155   1.00 0.00 ? 2  CYS A H    4 
ATOM   2170 H HA   . CYS A 1 2  ? 10.768  8.893   5.115   1.00 0.00 ? 2  CYS A HA   4 
ATOM   2171 H HB2  . CYS A 1 2  ? 8.932   10.022  3.866   1.00 0.00 ? 2  CYS A HB2  4 
ATOM   2172 H HB3  . CYS A 1 2  ? 9.343   10.758  5.412   1.00 0.00 ? 2  CYS A HB3  4 
ATOM   2173 N N    . GLU A 1 3  ? 11.045  8.001   2.775   1.00 0.00 ? 3  GLU A N    4 
ATOM   2174 C CA   . GLU A 1 3  ? 11.327  7.294   1.528   1.00 0.00 ? 3  GLU A CA   4 
ATOM   2175 C C    . GLU A 1 3  ? 10.331  7.726   0.437   1.00 0.00 ? 3  GLU A C    4 
ATOM   2176 O O    . GLU A 1 3  ? 9.615   6.905   -0.135  1.00 0.00 ? 3  GLU A O    4 
ATOM   2177 C CB   . GLU A 1 3  ? 11.233  5.791   1.799   1.00 0.00 ? 3  GLU A CB   4 
ATOM   2178 C CG   . GLU A 1 3  ? 12.203  5.269   2.871   1.00 0.00 ? 3  GLU A CG   4 
ATOM   2179 C CD   . GLU A 1 3  ? 11.967  3.781   3.141   1.00 0.00 ? 3  GLU A CD   4 
ATOM   2180 O OE1  . GLU A 1 3  ? 11.061  3.484   3.951   1.00 0.00 ? 3  GLU A OE1  4 
ATOM   2181 O OE2  . GLU A 1 3  ? 12.686  2.964   2.525   1.00 0.00 ? 3  GLU A OE2  4 
ATOM   2182 H H    . GLU A 1 3  ? 10.529  7.485   3.471   1.00 0.00 ? 3  GLU A H    4 
ATOM   2183 H HA   . GLU A 1 3  ? 12.342  7.507   1.196   1.00 0.00 ? 3  GLU A HA   4 
ATOM   2184 H HB2  . GLU A 1 3  ? 10.211  5.583   2.106   1.00 0.00 ? 3  GLU A HB2  4 
ATOM   2185 H HB3  . GLU A 1 3  ? 11.429  5.279   0.862   1.00 0.00 ? 3  GLU A HB3  4 
ATOM   2186 H HG2  . GLU A 1 3  ? 13.229  5.431   2.537   1.00 0.00 ? 3  GLU A HG2  4 
ATOM   2187 H HG3  . GLU A 1 3  ? 12.061  5.816   3.804   1.00 0.00 ? 3  GLU A HG3  4 
ATOM   2188 N N    . SER A 1 4  ? 10.279  9.037   0.189   1.00 0.00 ? 4  SER A N    4 
ATOM   2189 C CA   . SER A 1 4  ? 9.159   9.774   -0.391  1.00 0.00 ? 4  SER A CA   4 
ATOM   2190 C C    . SER A 1 4  ? 8.602   9.150   -1.680  1.00 0.00 ? 4  SER A C    4 
ATOM   2191 O O    . SER A 1 4  ? 9.228   9.215   -2.737  1.00 0.00 ? 4  SER A O    4 
ATOM   2192 C CB   . SER A 1 4  ? 9.577   11.232  -0.653  1.00 0.00 ? 4  SER A CB   4 
ATOM   2193 O OG   . SER A 1 4  ? 10.036  11.859  0.524   1.00 0.00 ? 4  SER A OG   4 
ATOM   2194 H H    . SER A 1 4  ? 10.969  9.578   0.683   1.00 0.00 ? 4  SER A H    4 
ATOM   2195 H HA   . SER A 1 4  ? 8.373   9.791   0.377   1.00 0.00 ? 4  SER A HA   4 
ATOM   2196 H HB2  . SER A 1 4  ? 10.374  11.271  -1.398  1.00 0.00 ? 4  SER A HB2  4 
ATOM   2197 H HB3  . SER A 1 4  ? 8.720   11.795  -1.026  1.00 0.00 ? 4  SER A HB3  4 
ATOM   2198 H HG   . SER A 1 4  ? 10.804  11.383  0.849   1.00 0.00 ? 4  SER A HG   4 
ATOM   2199 N N    . GLY A 1 5  ? 7.382   8.609   -1.576  1.00 0.00 ? 5  GLY A N    4 
ATOM   2200 C CA   . GLY A 1 5  ? 6.422   8.422   -2.648  1.00 0.00 ? 5  GLY A CA   4 
ATOM   2201 C C    . GLY A 1 5  ? 5.073   8.973   -2.152  1.00 0.00 ? 5  GLY A C    4 
ATOM   2202 O O    . GLY A 1 5  ? 4.874   9.053   -0.943  1.00 0.00 ? 5  GLY A O    4 
ATOM   2203 H H    . GLY A 1 5  ? 6.959   8.572   -0.662  1.00 0.00 ? 5  GLY A H    4 
ATOM   2204 H HA2  . GLY A 1 5  ? 6.768   8.921   -3.549  1.00 0.00 ? 5  GLY A HA2  4 
ATOM   2205 H HA3  . GLY A 1 5  ? 6.318   7.355   -2.853  1.00 0.00 ? 5  GLY A HA3  4 
ATOM   2206 N N    . PRO A 1 6  ? 4.121   9.329   -3.031  1.00 0.00 ? 6  PRO A N    4 
ATOM   2207 C CA   . PRO A 1 6  ? 2.725   9.620   -2.682  1.00 0.00 ? 6  PRO A CA   4 
ATOM   2208 C C    . PRO A 1 6  ? 2.053   8.524   -1.826  1.00 0.00 ? 6  PRO A C    4 
ATOM   2209 O O    . PRO A 1 6  ? 1.135   8.816   -1.062  1.00 0.00 ? 6  PRO A O    4 
ATOM   2210 C CB   . PRO A 1 6  ? 1.995   9.818   -4.016  1.00 0.00 ? 6  PRO A CB   4 
ATOM   2211 C CG   . PRO A 1 6  ? 3.118   10.261  -4.954  1.00 0.00 ? 6  PRO A CG   4 
ATOM   2212 C CD   . PRO A 1 6  ? 4.315   9.448   -4.458  1.00 0.00 ? 6  PRO A CD   4 
ATOM   2213 H HA   . PRO A 1 6  ? 2.712   10.565  -2.132  1.00 0.00 ? 6  PRO A HA   4 
ATOM   2214 H HB2  . PRO A 1 6  ? 1.590   8.871   -4.378  1.00 0.00 ? 6  PRO A HB2  4 
ATOM   2215 H HB3  . PRO A 1 6  ? 1.197   10.560  -3.948  1.00 0.00 ? 6  PRO A HB3  4 
ATOM   2216 H HG2  . PRO A 1 6  ? 2.887   10.061  -6.002  1.00 0.00 ? 6  PRO A HG2  4 
ATOM   2217 H HG3  . PRO A 1 6  ? 3.312   11.327  -4.813  1.00 0.00 ? 6  PRO A HG3  4 
ATOM   2218 H HD2  . PRO A 1 6  ? 4.336   8.439   -4.870  1.00 0.00 ? 6  PRO A HD2  4 
ATOM   2219 H HD3  . PRO A 1 6  ? 5.240   9.964   -4.700  1.00 0.00 ? 6  PRO A HD3  4 
ATOM   2220 N N    . CYS A 1 7  ? 2.575   7.287   -1.909  1.00 0.00 ? 7  CYS A N    4 
ATOM   2221 C CA   . CYS A 1 7  ? 2.333   6.155   -1.002  1.00 0.00 ? 7  CYS A CA   4 
ATOM   2222 C C    . CYS A 1 7  ? 2.936   6.350   0.403   1.00 0.00 ? 7  CYS A C    4 
ATOM   2223 O O    . CYS A 1 7  ? 3.072   5.413   1.179   1.00 0.00 ? 7  CYS A O    4 
ATOM   2224 C CB   . CYS A 1 7  ? 2.907   4.911   -1.692  1.00 0.00 ? 7  CYS A CB   4 
ATOM   2225 S SG   . CYS A 1 7  ? 2.646   3.270   -0.952  1.00 0.00 ? 7  CYS A SG   4 
ATOM   2226 H H    . CYS A 1 7  ? 3.322   7.167   -2.579  1.00 0.00 ? 7  CYS A H    4 
ATOM   2227 H HA   . CYS A 1 7  ? 1.254   6.044   -0.862  1.00 0.00 ? 7  CYS A HA   4 
ATOM   2228 H HB2  . CYS A 1 7  ? 2.458   4.892   -2.680  1.00 0.00 ? 7  CYS A HB2  4 
ATOM   2229 H HB3  . CYS A 1 7  ? 3.979   5.053   -1.824  1.00 0.00 ? 7  CYS A HB3  4 
ATOM   2230 N N    . CYS A 1 8  ? 3.256   7.589   0.745   1.00 0.00 ? 8  CYS A N    4 
ATOM   2231 C CA   . CYS A 1 8  ? 3.516   8.123   2.065   1.00 0.00 ? 8  CYS A CA   4 
ATOM   2232 C C    . CYS A 1 8  ? 3.155   9.596   1.945   1.00 0.00 ? 8  CYS A C    4 
ATOM   2233 O O    . CYS A 1 8  ? 3.683   10.281  1.074   1.00 0.00 ? 8  CYS A O    4 
ATOM   2234 C CB   . CYS A 1 8  ? 4.998   7.973   2.397   1.00 0.00 ? 8  CYS A CB   4 
ATOM   2235 S SG   . CYS A 1 8  ? 5.555   6.298   2.787   1.00 0.00 ? 8  CYS A SG   4 
ATOM   2236 H H    . CYS A 1 8  ? 3.272   8.254   -0.011  1.00 0.00 ? 8  CYS A H    4 
ATOM   2237 H HA   . CYS A 1 8  ? 2.859   7.634   2.793   1.00 0.00 ? 8  CYS A HA   4 
ATOM   2238 H HB2  . CYS A 1 8  ? 5.573   8.353   1.554   1.00 0.00 ? 8  CYS A HB2  4 
ATOM   2239 H HB3  . CYS A 1 8  ? 5.246   8.618   3.237   1.00 0.00 ? 8  CYS A HB3  4 
ATOM   2240 N N    . ARG A 1 9  ? 2.195   10.053  2.747   1.00 0.00 ? 9  ARG A N    4 
ATOM   2241 C CA   . ARG A 1 9  ? 1.315   11.135  2.364   1.00 0.00 ? 9  ARG A CA   4 
ATOM   2242 C C    . ARG A 1 9  ? 2.061   12.454  2.188   1.00 0.00 ? 9  ARG A C    4 
ATOM   2243 O O    . ARG A 1 9  ? 2.345   13.167  3.149   1.00 0.00 ? 9  ARG A O    4 
ATOM   2244 C CB   . ARG A 1 9  ? 0.142   11.232  3.324   1.00 0.00 ? 9  ARG A CB   4 
ATOM   2245 C CG   . ARG A 1 9  ? -0.882  12.200  2.746   1.00 0.00 ? 9  ARG A CG   4 
ATOM   2246 C CD   . ARG A 1 9  ? -1.295  11.928  1.290   1.00 0.00 ? 9  ARG A CD   4 
ATOM   2247 N NE   . ARG A 1 9  ? -2.586  12.545  0.953   1.00 0.00 ? 9  ARG A NE   4 
ATOM   2248 C CZ   . ARG A 1 9  ? -2.819  13.859  0.776   1.00 0.00 ? 9  ARG A CZ   4 
ATOM   2249 N NH1  . ARG A 1 9  ? -1.836  14.768  0.897   1.00 0.00 ? 9  ARG A NH1  4 
ATOM   2250 N NH2  . ARG A 1 9  ? -4.056  14.271  0.472   1.00 0.00 ? 9  ARG A NH2  4 
ATOM   2251 H H    . ARG A 1 9  ? 1.893   9.479   3.517   1.00 0.00 ? 9  ARG A H    4 
ATOM   2252 H HA   . ARG A 1 9  ? 0.905   10.812  1.408   1.00 0.00 ? 9  ARG A HA   4 
ATOM   2253 H HB2  . ARG A 1 9  ? -0.317  10.251  3.433   1.00 0.00 ? 9  ARG A HB2  4 
ATOM   2254 H HB3  . ARG A 1 9  ? 0.462   11.572  4.309   1.00 0.00 ? 9  ARG A HB3  4 
ATOM   2255 H HG2  . ARG A 1 9  ? -1.747  12.080  3.369   1.00 0.00 ? 9  ARG A HG2  4 
ATOM   2256 H HG3  . ARG A 1 9  ? -0.508  13.216  2.850   1.00 0.00 ? 9  ARG A HG3  4 
ATOM   2257 H HD2  . ARG A 1 9  ? -0.536  12.291  0.596   1.00 0.00 ? 9  ARG A HD2  4 
ATOM   2258 H HD3  . ARG A 1 9  ? -1.416  10.854  1.144   1.00 0.00 ? 9  ARG A HD3  4 
ATOM   2259 H HE   . ARG A 1 9  ? -3.356  11.900  0.845   1.00 0.00 ? 9  ARG A HE   4 
ATOM   2260 H HH11 . ARG A 1 9  ? -0.897  14.474  1.124   1.00 0.00 ? 9  ARG A HH11 4 
ATOM   2261 H HH12 . ARG A 1 9  ? -2.036  15.747  0.760   1.00 0.00 ? 9  ARG A HH12 4 
ATOM   2262 H HH21 . ARG A 1 9  ? -4.805  13.600  0.377   1.00 0.00 ? 9  ARG A HH21 4 
ATOM   2263 H HH22 . ARG A 1 9  ? -4.244  15.255  0.337   1.00 0.00 ? 9  ARG A HH22 4 
ATOM   2264 N N    . ASN A 1 10 ? 2.409   12.709  0.926   1.00 0.00 ? 10 ASN A N    4 
ATOM   2265 C CA   . ASN A 1 10 ? 3.508   13.548  0.469   1.00 0.00 ? 10 ASN A CA   4 
ATOM   2266 C C    . ASN A 1 10 ? 4.643   13.652  1.509   1.00 0.00 ? 10 ASN A C    4 
ATOM   2267 O O    . ASN A 1 10 ? 4.874   14.734  2.045   1.00 0.00 ? 10 ASN A O    4 
ATOM   2268 C CB   . ASN A 1 10 ? 2.953   14.909  0.042   1.00 0.00 ? 10 ASN A CB   4 
ATOM   2269 C CG   . ASN A 1 10 ? 2.082   14.838  -1.217  1.00 0.00 ? 10 ASN A CG   4 
ATOM   2270 O OD1  . ASN A 1 10 ? 2.548   15.136  -2.315  1.00 0.00 ? 10 ASN A OD1  4 
ATOM   2271 N ND2  . ASN A 1 10 ? 0.814   14.445  -1.062  1.00 0.00 ? 10 ASN A ND2  4 
ATOM   2272 H H    . ASN A 1 10 ? 1.941   12.143  0.236   1.00 0.00 ? 10 ASN A H    4 
ATOM   2273 H HA   . ASN A 1 10 ? 3.934   13.070  -0.417  1.00 0.00 ? 10 ASN A HA   4 
ATOM   2274 H HB2  . ASN A 1 10 ? 2.389   15.354  0.866   1.00 0.00 ? 10 ASN A HB2  4 
ATOM   2275 H HB3  . ASN A 1 10 ? 3.814   15.541  -0.144  1.00 0.00 ? 10 ASN A HB3  4 
ATOM   2276 H HD21 . ASN A 1 10 ? 0.470   14.205  -0.143  1.00 0.00 ? 10 ASN A HD21 4 
ATOM   2277 H HD22 . ASN A 1 10 ? 0.202   14.383  -1.863  1.00 0.00 ? 10 ASN A HD22 4 
ATOM   2278 N N    . CYS A 1 11 ? 5.303   12.511  1.787   1.00 0.00 ? 11 CYS A N    4 
ATOM   2279 C CA   . CYS A 1 11 ? 6.339   12.254  2.802   1.00 0.00 ? 11 CYS A CA   4 
ATOM   2280 C C    . CYS A 1 11 ? 5.799   11.455  4.000   1.00 0.00 ? 11 CYS A C    4 
ATOM   2281 O O    . CYS A 1 11 ? 6.561   10.717  4.624   1.00 0.00 ? 11 CYS A O    4 
ATOM   2282 C CB   . CYS A 1 11 ? 7.052   13.535  3.289   1.00 0.00 ? 11 CYS A CB   4 
ATOM   2283 S SG   . CYS A 1 11 ? 8.415   13.377  4.479   1.00 0.00 ? 11 CYS A SG   4 
ATOM   2284 H H    . CYS A 1 11 ? 4.980   11.693  1.288   1.00 0.00 ? 11 CYS A H    4 
ATOM   2285 H HA   . CYS A 1 11 ? 7.088   11.636  2.305   1.00 0.00 ? 11 CYS A HA   4 
ATOM   2286 H HB2  . CYS A 1 11 ? 7.439   14.079  2.425   1.00 0.00 ? 11 CYS A HB2  4 
ATOM   2287 H HB3  . CYS A 1 11 ? 6.335   14.165  3.813   1.00 0.00 ? 11 CYS A HB3  4 
ATOM   2288 N N    . LYS A 1 12 ? 4.519   11.631  4.369   1.00 0.00 ? 12 LYS A N    4 
ATOM   2289 C CA   . LYS A 1 12 ? 4.029   11.288  5.707   1.00 0.00 ? 12 LYS A CA   4 
ATOM   2290 C C    . LYS A 1 12 ? 3.356   9.914   5.696   1.00 0.00 ? 12 LYS A C    4 
ATOM   2291 O O    . LYS A 1 12 ? 2.138   9.830   5.538   1.00 0.00 ? 12 LYS A O    4 
ATOM   2292 C CB   . LYS A 1 12 ? 3.108   12.397  6.254   1.00 0.00 ? 12 LYS A CB   4 
ATOM   2293 C CG   . LYS A 1 12 ? 3.786   13.775  6.360   1.00 0.00 ? 12 LYS A CG   4 
ATOM   2294 C CD   . LYS A 1 12 ? 5.016   13.763  7.284   1.00 0.00 ? 12 LYS A CD   4 
ATOM   2295 C CE   . LYS A 1 12 ? 5.493   15.178  7.644   1.00 0.00 ? 12 LYS A CE   4 
ATOM   2296 N NZ   . LYS A 1 12 ? 5.925   15.940  6.460   1.00 0.00 ? 12 LYS A NZ   4 
ATOM   2297 H H    . LYS A 1 12 ? 3.879   12.080  3.717   1.00 0.00 ? 12 LYS A H    4 
ATOM   2298 H HA   . LYS A 1 12 ? 4.864   11.227  6.408   1.00 0.00 ? 12 LYS A HA   4 
ATOM   2299 H HB2  . LYS A 1 12 ? 2.227   12.494  5.620   1.00 0.00 ? 12 LYS A HB2  4 
ATOM   2300 H HB3  . LYS A 1 12 ? 2.768   12.107  7.250   1.00 0.00 ? 12 LYS A HB3  4 
ATOM   2301 H HG2  . LYS A 1 12 ? 4.074   14.123  5.367   1.00 0.00 ? 12 LYS A HG2  4 
ATOM   2302 H HG3  . LYS A 1 12 ? 3.051   14.474  6.763   1.00 0.00 ? 12 LYS A HG3  4 
ATOM   2303 H HD2  . LYS A 1 12 ? 4.760   13.248  8.211   1.00 0.00 ? 12 LYS A HD2  4 
ATOM   2304 H HD3  . LYS A 1 12 ? 5.837   13.227  6.805   1.00 0.00 ? 12 LYS A HD3  4 
ATOM   2305 H HE2  . LYS A 1 12 ? 4.689   15.721  8.142   1.00 0.00 ? 12 LYS A HE2  4 
ATOM   2306 H HE3  . LYS A 1 12 ? 6.337   15.104  8.331   1.00 0.00 ? 12 LYS A HE3  4 
ATOM   2307 H HZ1  . LYS A 1 12 ? 6.679   15.450  5.999   1.00 0.00 ? 12 LYS A HZ1  4 
ATOM   2308 H HZ2  . LYS A 1 12 ? 5.149   16.042  5.822   1.00 0.00 ? 12 LYS A HZ2  4 
ATOM   2309 H HZ3  . LYS A 1 12 ? 6.244   16.854  6.747   1.00 0.00 ? 12 LYS A HZ3  4 
ATOM   2310 N N    . PHE A 1 13 ? 4.171   8.859   5.876   1.00 0.00 ? 13 PHE A N    4 
ATOM   2311 C CA   . PHE A 1 13 ? 3.837   7.432   5.870   1.00 0.00 ? 13 PHE A CA   4 
ATOM   2312 C C    . PHE A 1 13 ? 2.355   7.143   6.149   1.00 0.00 ? 13 PHE A C    4 
ATOM   2313 O O    . PHE A 1 13 ? 1.856   7.467   7.227   1.00 0.00 ? 13 PHE A O    4 
ATOM   2314 C CB   . PHE A 1 13 ? 4.748   6.659   6.837   1.00 0.00 ? 13 PHE A CB   4 
ATOM   2315 C CG   . PHE A 1 13 ? 6.231   6.667   6.482   1.00 0.00 ? 13 PHE A CG   4 
ATOM   2316 C CD1  . PHE A 1 13 ? 7.053   7.733   6.916   1.00 0.00 ? 13 PHE A CD1  4 
ATOM   2317 C CD2  . PHE A 1 13 ? 6.797   5.613   5.727   1.00 0.00 ? 13 PHE A CD2  4 
ATOM   2318 C CE1  . PHE A 1 13 ? 8.423   7.754   6.582   1.00 0.00 ? 13 PHE A CE1  4 
ATOM   2319 C CE2  . PHE A 1 13 ? 8.161   5.655   5.367   1.00 0.00 ? 13 PHE A CE2  4 
ATOM   2320 C CZ   . PHE A 1 13 ? 8.973   6.714   5.804   1.00 0.00 ? 13 PHE A CZ   4 
ATOM   2321 H H    . PHE A 1 13 ? 5.152   9.071   5.988   1.00 0.00 ? 13 PHE A H    4 
ATOM   2322 H HA   . PHE A 1 13 ? 4.080   7.071   4.875   1.00 0.00 ? 13 PHE A HA   4 
ATOM   2323 H HB2  . PHE A 1 13 ? 4.616   7.044   7.850   1.00 0.00 ? 13 PHE A HB2  4 
ATOM   2324 H HB3  . PHE A 1 13 ? 4.406   5.627   6.836   1.00 0.00 ? 13 PHE A HB3  4 
ATOM   2325 H HD1  . PHE A 1 13 ? 6.640   8.532   7.517   1.00 0.00 ? 13 PHE A HD1  4 
ATOM   2326 H HD2  . PHE A 1 13 ? 6.183   4.787   5.397   1.00 0.00 ? 13 PHE A HD2  4 
ATOM   2327 H HE1  . PHE A 1 13 ? 9.052   8.558   6.937   1.00 0.00 ? 13 PHE A HE1  4 
ATOM   2328 H HE2  . PHE A 1 13 ? 8.606   4.887   4.762   1.00 0.00 ? 13 PHE A HE2  4 
ATOM   2329 H HZ   . PHE A 1 13 ? 10.026  6.712   5.563   1.00 0.00 ? 13 PHE A HZ   4 
ATOM   2330 N N    . LEU A 1 14 ? 1.658   6.572   5.153   1.00 0.00 ? 14 LEU A N    4 
ATOM   2331 C CA   . LEU A 1 14 ? 0.210   6.429   5.102   1.00 0.00 ? 14 LEU A CA   4 
ATOM   2332 C C    . LEU A 1 14 ? -0.364  5.565   6.227   1.00 0.00 ? 14 LEU A C    4 
ATOM   2333 O O    . LEU A 1 14 ? 0.337   5.020   7.080   1.00 0.00 ? 14 LEU A O    4 
ATOM   2334 C CB   . LEU A 1 14 ? -0.220  5.906   3.712   1.00 0.00 ? 14 LEU A CB   4 
ATOM   2335 C CG   . LEU A 1 14 ? -0.368  6.997   2.646   1.00 0.00 ? 14 LEU A CG   4 
ATOM   2336 C CD1  . LEU A 1 14 ? -0.487  6.420   1.239   1.00 0.00 ? 14 LEU A CD1  4 
ATOM   2337 C CD2  . LEU A 1 14 ? -1.581  7.908   2.909   1.00 0.00 ? 14 LEU A CD2  4 
ATOM   2338 H H    . LEU A 1 14 ? 2.143   6.304   4.313   1.00 0.00 ? 14 LEU A H    4 
ATOM   2339 H HA   . LEU A 1 14 ? -0.199  7.429   5.256   1.00 0.00 ? 14 LEU A HA   4 
ATOM   2340 H HB2  . LEU A 1 14 ? 0.515   5.170   3.425   1.00 0.00 ? 14 LEU A HB2  4 
ATOM   2341 H HB3  . LEU A 1 14 ? -1.170  5.392   3.704   1.00 0.00 ? 14 LEU A HB3  4 
ATOM   2342 H HG   . LEU A 1 14 ? 0.560   7.538   2.655   1.00 0.00 ? 14 LEU A HG   4 
ATOM   2343 H HD11 . LEU A 1 14 ? -0.505  7.219   0.498   1.00 0.00 ? 14 LEU A HD11 4 
ATOM   2344 H HD12 . LEU A 1 14 ? 0.378   5.792   1.070   1.00 0.00 ? 14 LEU A HD12 4 
ATOM   2345 H HD13 . LEU A 1 14 ? -1.378  5.811   1.132   1.00 0.00 ? 14 LEU A HD13 4 
ATOM   2346 H HD21 . LEU A 1 14 ? -1.651  8.663   2.127   1.00 0.00 ? 14 LEU A HD21 4 
ATOM   2347 H HD22 . LEU A 1 14 ? -2.497  7.322   2.908   1.00 0.00 ? 14 LEU A HD22 4 
ATOM   2348 H HD23 . LEU A 1 14 ? -1.508  8.411   3.870   1.00 0.00 ? 14 LEU A HD23 4 
ATOM   2349 N N    . LYS A 1 15 ? -1.695  5.522   6.209   1.00 0.00 ? 15 LYS A N    4 
ATOM   2350 C CA   . LYS A 1 15 ? -2.565  5.232   7.340   1.00 0.00 ? 15 LYS A CA   4 
ATOM   2351 C C    . LYS A 1 15 ? -2.799  3.724   7.530   1.00 0.00 ? 15 LYS A C    4 
ATOM   2352 O O    . LYS A 1 15 ? -3.919  3.313   7.833   1.00 0.00 ? 15 LYS A O    4 
ATOM   2353 C CB   . LYS A 1 15 ? -3.881  6.015   7.146   1.00 0.00 ? 15 LYS A CB   4 
ATOM   2354 C CG   . LYS A 1 15 ? -3.638  7.528   6.987   1.00 0.00 ? 15 LYS A CG   4 
ATOM   2355 C CD   . LYS A 1 15 ? -4.933  8.324   6.780   1.00 0.00 ? 15 LYS A CD   4 
ATOM   2356 C CE   . LYS A 1 15 ? -5.603  8.043   5.426   1.00 0.00 ? 15 LYS A CE   4 
ATOM   2357 N NZ   . LYS A 1 15 ? -6.756  8.932   5.200   1.00 0.00 ? 15 LYS A NZ   4 
ATOM   2358 H H    . LYS A 1 15 ? -2.103  5.952   5.392   1.00 0.00 ? 15 LYS A H    4 
ATOM   2359 H HA   . LYS A 1 15 ? -2.085  5.605   8.245   1.00 0.00 ? 15 LYS A HA   4 
ATOM   2360 H HB2  . LYS A 1 15 ? -4.388  5.630   6.259   1.00 0.00 ? 15 LYS A HB2  4 
ATOM   2361 H HB3  . LYS A 1 15 ? -4.529  5.861   8.011   1.00 0.00 ? 15 LYS A HB3  4 
ATOM   2362 H HG2  . LYS A 1 15 ? -3.147  7.895   7.890   1.00 0.00 ? 15 LYS A HG2  4 
ATOM   2363 H HG3  . LYS A 1 15 ? -2.983  7.730   6.138   1.00 0.00 ? 15 LYS A HG3  4 
ATOM   2364 H HD2  . LYS A 1 15 ? -5.631  8.102   7.590   1.00 0.00 ? 15 LYS A HD2  4 
ATOM   2365 H HD3  . LYS A 1 15 ? -4.682  9.385   6.828   1.00 0.00 ? 15 LYS A HD3  4 
ATOM   2366 H HE2  . LYS A 1 15 ? -4.884  8.201   4.620   1.00 0.00 ? 15 LYS A HE2  4 
ATOM   2367 H HE3  . LYS A 1 15 ? -5.959  7.014   5.386   1.00 0.00 ? 15 LYS A HE3  4 
ATOM   2368 H HZ1  . LYS A 1 15 ? -7.175  8.724   4.304   1.00 0.00 ? 15 LYS A HZ1  4 
ATOM   2369 H HZ2  . LYS A 1 15 ? -7.440  8.791   5.930   1.00 0.00 ? 15 LYS A HZ2  4 
ATOM   2370 H HZ3  . LYS A 1 15 ? -6.448  9.893   5.210   1.00 0.00 ? 15 LYS A HZ3  4 
ATOM   2371 N N    . GLU A 1 16 ? -1.735  2.916   7.369   1.00 0.00 ? 16 GLU A N    4 
ATOM   2372 C CA   . GLU A 1 16 ? -1.696  1.459   7.470   1.00 0.00 ? 16 GLU A CA   4 
ATOM   2373 C C    . GLU A 1 16 ? -2.979  0.794   6.952   1.00 0.00 ? 16 GLU A C    4 
ATOM   2374 O O    . GLU A 1 16 ? -3.849  0.408   7.733   1.00 0.00 ? 16 GLU A O    4 
ATOM   2375 C CB   . GLU A 1 16 ? -1.293  1.038   8.898   1.00 0.00 ? 16 GLU A CB   4 
ATOM   2376 C CG   . GLU A 1 16 ? -1.205  -0.483  9.122   1.00 0.00 ? 16 GLU A CG   4 
ATOM   2377 C CD   . GLU A 1 16 ? -0.287  -1.203  8.134   1.00 0.00 ? 16 GLU A CD   4 
ATOM   2378 O OE1  . GLU A 1 16 ? -0.781  -1.541  7.036   1.00 0.00 ? 16 GLU A OE1  4 
ATOM   2379 O OE2  . GLU A 1 16 ? 0.888   -1.419  8.501   1.00 0.00 ? 16 GLU A OE2  4 
ATOM   2380 H H    . GLU A 1 16 ? -0.853  3.362   7.158   1.00 0.00 ? 16 GLU A H    4 
ATOM   2381 H HA   . GLU A 1 16 ? -0.892  1.163   6.802   1.00 0.00 ? 16 GLU A HA   4 
ATOM   2382 H HB2  . GLU A 1 16 ? -0.317  1.473   9.125   1.00 0.00 ? 16 GLU A HB2  4 
ATOM   2383 H HB3  . GLU A 1 16 ? -2.014  1.445   9.609   1.00 0.00 ? 16 GLU A HB3  4 
ATOM   2384 H HG2  . GLU A 1 16 ? -0.840  -0.653  10.137  1.00 0.00 ? 16 GLU A HG2  4 
ATOM   2385 H HG3  . GLU A 1 16 ? -2.198  -0.929  9.068   1.00 0.00 ? 16 GLU A HG3  4 
ATOM   2386 N N    . GLY A 1 17 ? -3.092  0.702   5.622   1.00 0.00 ? 17 GLY A N    4 
ATOM   2387 C CA   . GLY A 1 17 ? -4.276  0.229   4.921   1.00 0.00 ? 17 GLY A CA   4 
ATOM   2388 C C    . GLY A 1 17 ? -4.739  1.226   3.852   1.00 0.00 ? 17 GLY A C    4 
ATOM   2389 O O    . GLY A 1 17 ? -5.943  1.315   3.608   1.00 0.00 ? 17 GLY A O    4 
ATOM   2390 H H    . GLY A 1 17 ? -2.324  1.029   5.049   1.00 0.00 ? 17 GLY A H    4 
ATOM   2391 H HA2  . GLY A 1 17 ? -4.049  -0.731  4.463   1.00 0.00 ? 17 GLY A HA2  4 
ATOM   2392 H HA3  . GLY A 1 17 ? -5.102  0.061   5.611   1.00 0.00 ? 17 GLY A HA3  4 
ATOM   2393 N N    . THR A 1 18 ? -3.808  1.955   3.204   1.00 0.00 ? 18 THR A N    4 
ATOM   2394 C CA   . THR A 1 18 ? -4.106  2.858   2.094   1.00 0.00 ? 18 THR A CA   4 
ATOM   2395 C C    . THR A 1 18 ? -3.660  2.242   0.765   1.00 0.00 ? 18 THR A C    4 
ATOM   2396 O O    . THR A 1 18 ? -2.479  2.274   0.421   1.00 0.00 ? 18 THR A O    4 
ATOM   2397 C CB   . THR A 1 18 ? -3.486  4.242   2.290   1.00 0.00 ? 18 THR A CB   4 
ATOM   2398 O OG1  . THR A 1 18 ? -3.927  4.814   3.508   1.00 0.00 ? 18 THR A OG1  4 
ATOM   2399 C CG2  . THR A 1 18 ? -3.902  5.125   1.104   1.00 0.00 ? 18 THR A CG2  4 
ATOM   2400 H H    . THR A 1 18 ? -2.837  1.860   3.473   1.00 0.00 ? 18 THR A H    4 
ATOM   2401 H HA   . THR A 1 18 ? -5.175  3.044   2.063   1.00 0.00 ? 18 THR A HA   4 
ATOM   2402 H HB   . THR A 1 18 ? -2.404  4.150   2.308   1.00 0.00 ? 18 THR A HB   4 
ATOM   2403 H HG1  . THR A 1 18 ? -3.481  5.655   3.633   1.00 0.00 ? 18 THR A HG1  4 
ATOM   2404 H HG21 . THR A 1 18 ? -3.618  6.161   1.284   1.00 0.00 ? 18 THR A HG21 4 
ATOM   2405 H HG22 . THR A 1 18 ? -4.984  5.100   0.973   1.00 0.00 ? 18 THR A HG22 4 
ATOM   2406 H HG23 . THR A 1 18 ? -3.427  4.801   0.178   1.00 0.00 ? 18 THR A HG23 4 
ATOM   2407 N N    . ILE A 1 19 ? -4.629  1.719   0.010   1.00 0.00 ? 19 ILE A N    4 
ATOM   2408 C CA   . ILE A 1 19 ? -4.449  0.931   -1.193  1.00 0.00 ? 19 ILE A CA   4 
ATOM   2409 C C    . ILE A 1 19 ? -3.830  1.756   -2.331  1.00 0.00 ? 19 ILE A C    4 
ATOM   2410 O O    . ILE A 1 19 ? -4.328  2.825   -2.685  1.00 0.00 ? 19 ILE A O    4 
ATOM   2411 C CB   . ILE A 1 19 ? -5.805  0.284   -1.541  1.00 0.00 ? 19 ILE A CB   4 
ATOM   2412 C CG1  . ILE A 1 19 ? -5.684  -1.129  -2.101  1.00 0.00 ? 19 ILE A CG1  4 
ATOM   2413 C CG2  . ILE A 1 19 ? -6.765  1.169   -2.361  1.00 0.00 ? 19 ILE A CG2  4 
ATOM   2414 C CD1  . ILE A 1 19 ? -4.881  -1.190  -3.392  1.00 0.00 ? 19 ILE A CD1  4 
ATOM   2415 H H    . ILE A 1 19 ? -5.568  1.726   0.372   1.00 0.00 ? 19 ILE A H    4 
ATOM   2416 H HA   . ILE A 1 19 ? -3.782  0.113   -0.926  1.00 0.00 ? 19 ILE A HA   4 
ATOM   2417 H HB   . ILE A 1 19 ? -6.289  0.075   -0.595  1.00 0.00 ? 19 ILE A HB   4 
ATOM   2418 H HG12 . ILE A 1 19 ? -5.218  -1.761  -1.348  1.00 0.00 ? 19 ILE A HG12 4 
ATOM   2419 H HG13 . ILE A 1 19 ? -6.700  -1.478  -2.265  1.00 0.00 ? 19 ILE A HG13 4 
ATOM   2420 H HG21 . ILE A 1 19 ? -6.376  1.379   -3.356  1.00 0.00 ? 19 ILE A HG21 4 
ATOM   2421 H HG22 . ILE A 1 19 ? -7.735  0.679   -2.447  1.00 0.00 ? 19 ILE A HG22 4 
ATOM   2422 H HG23 . ILE A 1 19 ? -6.912  2.117   -1.842  1.00 0.00 ? 19 ILE A HG23 4 
ATOM   2423 H HD11 . ILE A 1 19 ? -5.137  -2.078  -3.963  1.00 0.00 ? 19 ILE A HD11 4 
ATOM   2424 H HD12 . ILE A 1 19 ? -5.119  -0.312  -3.975  1.00 0.00 ? 19 ILE A HD12 4 
ATOM   2425 H HD13 . ILE A 1 19 ? -3.815  -1.199  -3.178  1.00 0.00 ? 19 ILE A HD13 4 
ATOM   2426 N N    . CYS A 1 20 ? -2.736  1.235   -2.898  1.00 0.00 ? 20 CYS A N    4 
ATOM   2427 C CA   . CYS A 1 20 ? -2.108  1.741   -4.121  1.00 0.00 ? 20 CYS A CA   4 
ATOM   2428 C C    . CYS A 1 20 ? -3.024  1.559   -5.338  1.00 0.00 ? 20 CYS A C    4 
ATOM   2429 O O    . CYS A 1 20 ? -3.389  2.538   -5.989  1.00 0.00 ? 20 CYS A O    4 
ATOM   2430 C CB   . CYS A 1 20 ? -0.733  1.101   -4.380  1.00 0.00 ? 20 CYS A CB   4 
ATOM   2431 S SG   . CYS A 1 20 ? 0.662   1.809   -3.468  1.00 0.00 ? 20 CYS A SG   4 
ATOM   2432 H H    . CYS A 1 20 ? -2.391  0.386   -2.468  1.00 0.00 ? 20 CYS A H    4 
ATOM   2433 H HA   . CYS A 1 20 ? -1.944  2.803   -3.993  1.00 0.00 ? 20 CYS A HA   4 
ATOM   2434 H HB2  . CYS A 1 20 ? -0.781  0.030   -4.197  1.00 0.00 ? 20 CYS A HB2  4 
ATOM   2435 H HB3  . CYS A 1 20 ? -0.489  1.245   -5.433  1.00 0.00 ? 20 CYS A HB3  4 
ATOM   2436 N N    . LYS A 1 21 ? -3.370  0.301   -5.643  1.00 0.00 ? 21 LYS A N    4 
ATOM   2437 C CA   . LYS A 1 21 ? -4.241  -0.095  -6.749  1.00 0.00 ? 21 LYS A CA   4 
ATOM   2438 C C    . LYS A 1 21 ? -5.699  0.296   -6.423  1.00 0.00 ? 21 LYS A C    4 
ATOM   2439 O O    . LYS A 1 21 ? -6.020  1.483   -6.465  1.00 0.00 ? 21 LYS A O    4 
ATOM   2440 C CB   . LYS A 1 21 ? -4.036  -1.594  -7.063  1.00 0.00 ? 21 LYS A CB   4 
ATOM   2441 C CG   . LYS A 1 21 ? -2.580  -1.985  -7.379  1.00 0.00 ? 21 LYS A CG   4 
ATOM   2442 C CD   . LYS A 1 21 ? -2.043  -1.341  -8.667  1.00 0.00 ? 21 LYS A CD   4 
ATOM   2443 C CE   . LYS A 1 21 ? -0.608  -1.812  -8.949  1.00 0.00 ? 21 LYS A CE   4 
ATOM   2444 N NZ   . LYS A 1 21 ? -0.090  -1.253  -10.210 1.00 0.00 ? 21 LYS A NZ   4 
ATOM   2445 H H    . LYS A 1 21 ? -3.039  -0.421  -5.017  1.00 0.00 ? 21 LYS A H    4 
ATOM   2446 H HA   . LYS A 1 21 ? -3.956  0.469   -7.639  1.00 0.00 ? 21 LYS A HA   4 
ATOM   2447 H HB2  . LYS A 1 21 ? -4.341  -2.192  -6.202  1.00 0.00 ? 21 LYS A HB2  4 
ATOM   2448 H HB3  . LYS A 1 21 ? -4.667  -1.874  -7.910  1.00 0.00 ? 21 LYS A HB3  4 
ATOM   2449 H HG2  . LYS A 1 21 ? -1.933  -1.717  -6.542  1.00 0.00 ? 21 LYS A HG2  4 
ATOM   2450 H HG3  . LYS A 1 21 ? -2.542  -3.069  -7.495  1.00 0.00 ? 21 LYS A HG3  4 
ATOM   2451 H HD2  . LYS A 1 21 ? -2.688  -1.620  -9.502  1.00 0.00 ? 21 LYS A HD2  4 
ATOM   2452 H HD3  . LYS A 1 21 ? -2.039  -0.255  -8.569  1.00 0.00 ? 21 LYS A HD3  4 
ATOM   2453 H HE2  . LYS A 1 21 ? 0.045   -1.497  -8.134  1.00 0.00 ? 21 LYS A HE2  4 
ATOM   2454 H HE3  . LYS A 1 21 ? -0.585  -2.900  -9.019  1.00 0.00 ? 21 LYS A HE3  4 
ATOM   2455 H HZ1  . LYS A 1 21 ? -0.106  -0.244  -10.164 1.00 0.00 ? 21 LYS A HZ1  4 
ATOM   2456 H HZ2  . LYS A 1 21 ? 0.858   -1.568  -10.354 1.00 0.00 ? 21 LYS A HZ2  4 
ATOM   2457 H HZ3  . LYS A 1 21 ? -0.668  -1.562  -10.978 1.00 0.00 ? 21 LYS A HZ3  4 
ATOM   2458 N N    . ARG A 1 22 ? -6.565  -0.669  -6.062  1.00 0.00 ? 22 ARG A N    4 
ATOM   2459 C CA   . ARG A 1 22 ? -7.910  -0.437  -5.537  1.00 0.00 ? 22 ARG A CA   4 
ATOM   2460 C C    . ARG A 1 22 ? -8.520  -1.734  -4.979  1.00 0.00 ? 22 ARG A C    4 
ATOM   2461 O O    . ARG A 1 22 ? -9.023  -1.740  -3.856  1.00 0.00 ? 22 ARG A O    4 
ATOM   2462 C CB   . ARG A 1 22 ? -8.813  0.169   -6.625  1.00 0.00 ? 22 ARG A CB   4 
ATOM   2463 C CG   . ARG A 1 22 ? -10.264 0.388   -6.175  1.00 0.00 ? 22 ARG A CG   4 
ATOM   2464 C CD   . ARG A 1 22 ? -10.378 1.420   -5.042  1.00 0.00 ? 22 ARG A CD   4 
ATOM   2465 N NE   . ARG A 1 22 ? -11.785 1.734   -4.747  1.00 0.00 ? 22 ARG A NE   4 
ATOM   2466 C CZ   . ARG A 1 22 ? -12.600 1.046   -3.926  1.00 0.00 ? 22 ARG A CZ   4 
ATOM   2467 N NH1  . ARG A 1 22 ? -12.160 -0.010  -3.224  1.00 0.00 ? 22 ARG A NH1  4 
ATOM   2468 N NH2  . ARG A 1 22 ? -13.880 1.423   -3.806  1.00 0.00 ? 22 ARG A NH2  4 
ATOM   2469 H H    . ARG A 1 22 ? -6.263  -1.627  -6.070  1.00 0.00 ? 22 ARG A H    4 
ATOM   2470 H HA   . ARG A 1 22 ? -7.822  0.283   -4.728  1.00 0.00 ? 22 ARG A HA   4 
ATOM   2471 H HB2  . ARG A 1 22 ? -8.421  1.127   -6.966  1.00 0.00 ? 22 ARG A HB2  4 
ATOM   2472 H HB3  . ARG A 1 22 ? -8.811  -0.513  -7.469  1.00 0.00 ? 22 ARG A HB3  4 
ATOM   2473 H HG2  . ARG A 1 22 ? -10.825 0.756   -7.036  1.00 0.00 ? 22 ARG A HG2  4 
ATOM   2474 H HG3  . ARG A 1 22 ? -10.717 -0.555  -5.864  1.00 0.00 ? 22 ARG A HG3  4 
ATOM   2475 H HD2  . ARG A 1 22 ? -9.876  1.062   -4.143  1.00 0.00 ? 22 ARG A HD2  4 
ATOM   2476 H HD3  . ARG A 1 22 ? -9.891  2.345   -5.354  1.00 0.00 ? 22 ARG A HD3  4 
ATOM   2477 H HE   . ARG A 1 22 ? -12.173 2.525   -5.241  1.00 0.00 ? 22 ARG A HE   4 
ATOM   2478 H HH11 . ARG A 1 22 ? -11.202 -0.318  -3.307  1.00 0.00 ? 22 ARG A HH11 4 
ATOM   2479 H HH12 . ARG A 1 22 ? -12.794 -0.502  -2.611  1.00 0.00 ? 22 ARG A HH12 4 
ATOM   2480 H HH21 . ARG A 1 22 ? -14.227 2.212   -4.334  1.00 0.00 ? 22 ARG A HH21 4 
ATOM   2481 H HH22 . ARG A 1 22 ? -14.504 0.913   -3.197  1.00 0.00 ? 22 ARG A HH22 4 
ATOM   2482 N N    . ALA A 1 23 ? -8.519  -2.795  -5.803  1.00 0.00 ? 23 ALA A N    4 
ATOM   2483 C CA   . ALA A 1 23 ? -9.287  -4.035  -5.683  1.00 0.00 ? 23 ALA A CA   4 
ATOM   2484 C C    . ALA A 1 23 ? -9.477  -4.545  -4.247  1.00 0.00 ? 23 ALA A C    4 
ATOM   2485 O O    . ALA A 1 23 ? -8.524  -5.016  -3.630  1.00 0.00 ? 23 ALA A O    4 
ATOM   2486 C CB   . ALA A 1 23 ? -8.619  -5.117  -6.545  1.00 0.00 ? 23 ALA A CB   4 
ATOM   2487 H H    . ALA A 1 23 ? -8.043  -2.674  -6.686  1.00 0.00 ? 23 ALA A H    4 
ATOM   2488 H HA   . ALA A 1 23 ? -10.265 -3.838  -6.127  1.00 0.00 ? 23 ALA A HA   4 
ATOM   2489 H HB1  . ALA A 1 23 ? -7.604  -5.308  -6.194  1.00 0.00 ? 23 ALA A HB1  4 
ATOM   2490 H HB2  . ALA A 1 23 ? -9.204  -6.037  -6.500  1.00 0.00 ? 23 ALA A HB2  4 
ATOM   2491 H HB3  . ALA A 1 23 ? -8.574  -4.790  -7.585  1.00 0.00 ? 23 ALA A HB3  4 
ATOM   2492 N N    . ARG A 1 24 ? -10.722 -4.497  -3.745  1.00 0.00 ? 24 ARG A N    4 
ATOM   2493 C CA   . ARG A 1 24 ? -11.136 -5.139  -2.500  1.00 0.00 ? 24 ARG A CA   4 
ATOM   2494 C C    . ARG A 1 24 ? -11.122 -6.663  -2.693  1.00 0.00 ? 24 ARG A C    4 
ATOM   2495 O O    . ARG A 1 24 ? -11.712 -7.174  -3.646  1.00 0.00 ? 24 ARG A O    4 
ATOM   2496 C CB   . ARG A 1 24 ? -12.547 -4.681  -2.091  1.00 0.00 ? 24 ARG A CB   4 
ATOM   2497 C CG   . ARG A 1 24 ? -12.693 -3.163  -1.881  1.00 0.00 ? 24 ARG A CG   4 
ATOM   2498 C CD   . ARG A 1 24 ? -11.925 -2.611  -0.669  1.00 0.00 ? 24 ARG A CD   4 
ATOM   2499 N NE   . ARG A 1 24 ? -12.420 -3.174  0.600   1.00 0.00 ? 24 ARG A NE   4 
ATOM   2500 C CZ   . ARG A 1 24 ? -12.236 -2.645  1.823   1.00 0.00 ? 24 ARG A CZ   4 
ATOM   2501 N NH1  . ARG A 1 24 ? -11.512 -1.529  2.004   1.00 0.00 ? 24 ARG A NH1  4 
ATOM   2502 N NH2  . ARG A 1 24 ? -12.794 -3.240  2.887   1.00 0.00 ? 24 ARG A NH2  4 
ATOM   2503 H H    . ARG A 1 24 ? -11.451 -4.084  -4.310  1.00 0.00 ? 24 ARG A H    4 
ATOM   2504 H HA   . ARG A 1 24 ? -10.443 -4.851  -1.709  1.00 0.00 ? 24 ARG A HA   4 
ATOM   2505 H HB2  . ARG A 1 24 ? -13.244 -4.984  -2.873  1.00 0.00 ? 24 ARG A HB2  4 
ATOM   2506 H HB3  . ARG A 1 24 ? -12.842 -5.199  -1.176  1.00 0.00 ? 24 ARG A HB3  4 
ATOM   2507 H HG2  . ARG A 1 24 ? -12.355 -2.651  -2.781  1.00 0.00 ? 24 ARG A HG2  4 
ATOM   2508 H HG3  . ARG A 1 24 ? -13.752 -2.934  -1.748  1.00 0.00 ? 24 ARG A HG3  4 
ATOM   2509 H HD2  . ARG A 1 24 ? -10.859 -2.817  -0.768  1.00 0.00 ? 24 ARG A HD2  4 
ATOM   2510 H HD3  . ARG A 1 24 ? -12.064 -1.528  -0.659  1.00 0.00 ? 24 ARG A HD3  4 
ATOM   2511 H HE   . ARG A 1 24 ? -12.968 -4.020  0.531   1.00 0.00 ? 24 ARG A HE   4 
ATOM   2512 H HH11 . ARG A 1 24 ? -11.085 -1.067  1.216   1.00 0.00 ? 24 ARG A HH11 4 
ATOM   2513 H HH12 . ARG A 1 24 ? -11.398 -1.148  2.933   1.00 0.00 ? 24 ARG A HH12 4 
ATOM   2514 H HH21 . ARG A 1 24 ? -13.350 -4.074  2.764   1.00 0.00 ? 24 ARG A HH21 4 
ATOM   2515 H HH22 . ARG A 1 24 ? -12.660 -2.858  3.811   1.00 0.00 ? 24 ARG A HH22 4 
ATOM   2516 N N    . GLY A 1 25 ? -10.448 -7.382  -1.787  1.00 0.00 ? 25 GLY A N    4 
ATOM   2517 C CA   . GLY A 1 25 ? -10.328 -8.834  -1.824  1.00 0.00 ? 25 GLY A CA   4 
ATOM   2518 C C    . GLY A 1 25 ? -9.182  -9.338  -0.943  1.00 0.00 ? 25 GLY A C    4 
ATOM   2519 O O    . GLY A 1 25 ? -8.679  -8.614  -0.083  1.00 0.00 ? 25 GLY A O    4 
ATOM   2520 H H    . GLY A 1 25 ? -9.994  -6.892  -1.030  1.00 0.00 ? 25 GLY A H    4 
ATOM   2521 H HA2  . GLY A 1 25 ? -11.262 -9.275  -1.473  1.00 0.00 ? 25 GLY A HA2  4 
ATOM   2522 H HA3  . GLY A 1 25 ? -10.150 -9.158  -2.851  1.00 0.00 ? 25 GLY A HA3  4 
ATOM   2523 N N    . ASP A 1 26 ? -8.780  -10.600 -1.163  1.00 0.00 ? 26 ASP A N    4 
ATOM   2524 C CA   . ASP A 1 26 ? -7.736  -11.274 -0.401  1.00 0.00 ? 26 ASP A CA   4 
ATOM   2525 C C    . ASP A 1 26 ? -6.361  -10.689 -0.755  1.00 0.00 ? 26 ASP A C    4 
ATOM   2526 O O    . ASP A 1 26 ? -5.875  -9.811  -0.044  1.00 0.00 ? 26 ASP A O    4 
ATOM   2527 C CB   . ASP A 1 26 ? -7.838  -12.797 -0.587  1.00 0.00 ? 26 ASP A CB   4 
ATOM   2528 C CG   . ASP A 1 26 ? -6.782  -13.548 0.233   1.00 0.00 ? 26 ASP A CG   4 
ATOM   2529 O OD1  . ASP A 1 26 ? -6.974  -13.635 1.466   1.00 0.00 ? 26 ASP A OD1  4 
ATOM   2530 O OD2  . ASP A 1 26 ? -5.796  -14.009 -0.382  1.00 0.00 ? 26 ASP A OD2  4 
ATOM   2531 H H    . ASP A 1 26 ? -9.240  -11.131 -1.888  1.00 0.00 ? 26 ASP A H    4 
ATOM   2532 H HA   . ASP A 1 26 ? -7.931  -11.100 0.653   1.00 0.00 ? 26 ASP A HA   4 
ATOM   2533 H HB2  . ASP A 1 26 ? -8.827  -13.132 -0.268  1.00 0.00 ? 26 ASP A HB2  4 
ATOM   2534 H HB3  . ASP A 1 26 ? -7.736  -13.039 -1.642  1.00 0.00 ? 26 ASP A HB3  4 
ATOM   2535 N N    . ASP A 1 27 ? -5.749  -11.171 -1.848  1.00 0.00 ? 27 ASP A N    4 
ATOM   2536 C CA   . ASP A 1 27 ? -4.440  -10.747 -2.346  1.00 0.00 ? 27 ASP A CA   4 
ATOM   2537 C C    . ASP A 1 27 ? -4.616  -10.033 -3.689  1.00 0.00 ? 27 ASP A C    4 
ATOM   2538 O O    . ASP A 1 27 ? -4.082  -10.443 -4.719  1.00 0.00 ? 27 ASP A O    4 
ATOM   2539 C CB   . ASP A 1 27 ? -3.522  -11.968 -2.424  1.00 0.00 ? 27 ASP A CB   4 
ATOM   2540 C CG   . ASP A 1 27 ? -2.072  -11.649 -2.815  1.00 0.00 ? 27 ASP A CG   4 
ATOM   2541 O OD1  . ASP A 1 27 ? -1.632  -10.506 -2.559  1.00 0.00 ? 27 ASP A OD1  4 
ATOM   2542 O OD2  . ASP A 1 27 ? -1.420  -12.567 -3.359  1.00 0.00 ? 27 ASP A OD2  4 
ATOM   2543 H H    . ASP A 1 27 ? -6.220  -11.885 -2.382  1.00 0.00 ? 27 ASP A H    4 
ATOM   2544 H HA   . ASP A 1 27 ? -3.980  -10.050 -1.650  1.00 0.00 ? 27 ASP A HA   4 
ATOM   2545 H HB2  . ASP A 1 27 ? -3.522  -12.438 -1.444  1.00 0.00 ? 27 ASP A HB2  4 
ATOM   2546 H HB3  . ASP A 1 27 ? -3.961  -12.651 -3.145  1.00 0.00 ? 27 ASP A HB3  4 
ATOM   2547 N N    . MET A 1 28 ? -5.398  -8.955  -3.639  1.00 0.00 ? 28 MET A N    4 
ATOM   2548 C CA   . MET A 1 28 ? -5.798  -8.110  -4.758  1.00 0.00 ? 28 MET A CA   4 
ATOM   2549 C C    . MET A 1 28 ? -5.360  -6.669  -4.491  1.00 0.00 ? 28 MET A C    4 
ATOM   2550 O O    . MET A 1 28 ? -4.687  -6.040  -5.308  1.00 0.00 ? 28 MET A O    4 
ATOM   2551 C CB   . MET A 1 28 ? -7.317  -8.223  -4.969  1.00 0.00 ? 28 MET A CB   4 
ATOM   2552 C CG   . MET A 1 28 ? -7.758  -9.663  -5.271  1.00 0.00 ? 28 MET A CG   4 
ATOM   2553 S SD   . MET A 1 28 ? -9.505  -9.832  -5.719  1.00 0.00 ? 28 MET A SD   4 
ATOM   2554 C CE   . MET A 1 28 ? -9.563  -11.616 -6.024  1.00 0.00 ? 28 MET A CE   4 
ATOM   2555 H H    . MET A 1 28 ? -5.787  -8.752  -2.732  1.00 0.00 ? 28 MET A H    4 
ATOM   2556 H HA   . MET A 1 28 ? -5.301  -8.427  -5.664  1.00 0.00 ? 28 MET A HA   4 
ATOM   2557 H HB2  . MET A 1 28 ? -7.857  -7.863  -4.089  1.00 0.00 ? 28 MET A HB2  4 
ATOM   2558 H HB3  . MET A 1 28 ? -7.589  -7.606  -5.823  1.00 0.00 ? 28 MET A HB3  4 
ATOM   2559 H HG2  . MET A 1 28 ? -7.160  -10.045 -6.100  1.00 0.00 ? 28 MET A HG2  4 
ATOM   2560 H HG3  . MET A 1 28 ? -7.577  -10.289 -4.396  1.00 0.00 ? 28 MET A HG3  4 
ATOM   2561 H HE1  . MET A 1 28 ? -10.572 -11.900 -6.325  1.00 0.00 ? 28 MET A HE1  4 
ATOM   2562 H HE2  . MET A 1 28 ? -8.864  -11.876 -6.819  1.00 0.00 ? 28 MET A HE2  4 
ATOM   2563 H HE3  . MET A 1 28 ? -9.294  -12.152 -5.113  1.00 0.00 ? 28 MET A HE3  4 
ATOM   2564 N N    . ASP A 1 29 ? -5.736  -6.186  -3.307  1.00 0.00 ? 29 ASP A N    4 
ATOM   2565 C CA   . ASP A 1 29 ? -5.301  -4.928  -2.706  1.00 0.00 ? 29 ASP A CA   4 
ATOM   2566 C C    . ASP A 1 29 ? -3.821  -4.972  -2.293  1.00 0.00 ? 29 ASP A C    4 
ATOM   2567 O O    . ASP A 1 29 ? -3.224  -6.045  -2.219  1.00 0.00 ? 29 ASP A O    4 
ATOM   2568 C CB   . ASP A 1 29 ? -6.208  -4.524  -1.526  1.00 0.00 ? 29 ASP A CB   4 
ATOM   2569 C CG   . ASP A 1 29 ? -6.904  -5.686  -0.797  1.00 0.00 ? 29 ASP A CG   4 
ATOM   2570 O OD1  . ASP A 1 29 ? -6.178  -6.528  -0.226  1.00 0.00 ? 29 ASP A OD1  4 
ATOM   2571 O OD2  . ASP A 1 29 ? -8.153  -5.714  -0.816  1.00 0.00 ? 29 ASP A OD2  4 
ATOM   2572 H H    . ASP A 1 29 ? -6.278  -6.828  -2.754  1.00 0.00 ? 29 ASP A H    4 
ATOM   2573 H HA   . ASP A 1 29 ? -5.404  -4.164  -3.477  1.00 0.00 ? 29 ASP A HA   4 
ATOM   2574 H HB2  . ASP A 1 29 ? -5.618  -3.977  -0.797  1.00 0.00 ? 29 ASP A HB2  4 
ATOM   2575 H HB3  . ASP A 1 29 ? -6.943  -3.819  -1.903  1.00 0.00 ? 29 ASP A HB3  4 
ATOM   2576 N N    . ASP A 1 30 ? -3.236  -3.786  -2.042  1.00 0.00 ? 30 ASP A N    4 
ATOM   2577 C CA   . ASP A 1 30 ? -1.805  -3.584  -1.793  1.00 0.00 ? 30 ASP A CA   4 
ATOM   2578 C C    . ASP A 1 30 ? -1.595  -2.199  -1.165  1.00 0.00 ? 30 ASP A C    4 
ATOM   2579 O O    . ASP A 1 30 ? -1.518  -1.191  -1.864  1.00 0.00 ? 30 ASP A O    4 
ATOM   2580 C CB   . ASP A 1 30 ? -1.001  -3.675  -3.099  1.00 0.00 ? 30 ASP A CB   4 
ATOM   2581 C CG   . ASP A 1 30 ? -0.924  -5.085  -3.688  1.00 0.00 ? 30 ASP A CG   4 
ATOM   2582 O OD1  . ASP A 1 30 ? -0.211  -5.916  -3.085  1.00 0.00 ? 30 ASP A OD1  4 
ATOM   2583 O OD2  . ASP A 1 30 ? -1.585  -5.310  -4.727  1.00 0.00 ? 30 ASP A OD2  4 
ATOM   2584 H H    . ASP A 1 30 ? -3.833  -2.964  -2.038  1.00 0.00 ? 30 ASP A H    4 
ATOM   2585 H HA   . ASP A 1 30 ? -1.442  -4.354  -1.106  1.00 0.00 ? 30 ASP A HA   4 
ATOM   2586 H HB2  . ASP A 1 30 ? -1.430  -2.985  -3.825  1.00 0.00 ? 30 ASP A HB2  4 
ATOM   2587 H HB3  . ASP A 1 30 ? 0.021   -3.349  -2.898  1.00 0.00 ? 30 ASP A HB3  4 
ATOM   2588 N N    . TYR A 1 31 ? -1.506  -2.168  0.165   1.00 0.00 ? 31 TYR A N    4 
ATOM   2589 C CA   . TYR A 1 31 ? -1.615  -0.971  0.999   1.00 0.00 ? 31 TYR A CA   4 
ATOM   2590 C C    . TYR A 1 31 ? -0.244  -0.422  1.426   1.00 0.00 ? 31 TYR A C    4 
ATOM   2591 O O    . TYR A 1 31 ? 0.629   -1.180  1.843   1.00 0.00 ? 31 TYR A O    4 
ATOM   2592 C CB   . TYR A 1 31 ? -2.443  -1.319  2.247   1.00 0.00 ? 31 TYR A CB   4 
ATOM   2593 C CG   . TYR A 1 31 ? -3.754  -2.056  1.981   1.00 0.00 ? 31 TYR A CG   4 
ATOM   2594 C CD1  . TYR A 1 31 ? -4.930  -1.337  1.682   1.00 0.00 ? 31 TYR A CD1  4 
ATOM   2595 C CD2  . TYR A 1 31 ? -3.802  -3.469  2.037   1.00 0.00 ? 31 TYR A CD2  4 
ATOM   2596 C CE1  . TYR A 1 31 ? -6.158  -2.010  1.527   1.00 0.00 ? 31 TYR A CE1  4 
ATOM   2597 C CE2  . TYR A 1 31 ? -5.030  -4.145  1.887   1.00 0.00 ? 31 TYR A CE2  4 
ATOM   2598 C CZ   . TYR A 1 31 ? -6.214  -3.412  1.668   1.00 0.00 ? 31 TYR A CZ   4 
ATOM   2599 O OH   . TYR A 1 31 ? -7.421  -4.051  1.621   1.00 0.00 ? 31 TYR A OH   4 
ATOM   2600 H H    . TYR A 1 31 ? -1.566  -3.065  0.618   1.00 0.00 ? 31 TYR A H    4 
ATOM   2601 H HA   . TYR A 1 31 ? -2.155  -0.181  0.460   1.00 0.00 ? 31 TYR A HA   4 
ATOM   2602 H HB2  . TYR A 1 31 ? -1.851  -1.922  2.939   1.00 0.00 ? 31 TYR A HB2  4 
ATOM   2603 H HB3  . TYR A 1 31 ? -2.644  -0.381  2.758   1.00 0.00 ? 31 TYR A HB3  4 
ATOM   2604 H HD1  . TYR A 1 31 ? -4.904  -0.265  1.610   1.00 0.00 ? 31 TYR A HD1  4 
ATOM   2605 H HD2  . TYR A 1 31 ? -2.904  -4.041  2.210   1.00 0.00 ? 31 TYR A HD2  4 
ATOM   2606 H HE1  . TYR A 1 31 ? -7.057  -1.444  1.329   1.00 0.00 ? 31 TYR A HE1  4 
ATOM   2607 H HE2  . TYR A 1 31 ? -5.062  -5.222  1.950   1.00 0.00 ? 31 TYR A HE2  4 
ATOM   2608 H HH   . TYR A 1 31 ? -7.352  -5.010  1.648   1.00 0.00 ? 31 TYR A HH   4 
ATOM   2609 N N    . CYS A 1 32 ? -0.103  0.912   1.386   1.00 0.00 ? 32 CYS A N    4 
ATOM   2610 C CA   . CYS A 1 32 ? 0.954   1.702   2.017   1.00 0.00 ? 32 CYS A CA   4 
ATOM   2611 C C    . CYS A 1 32 ? 0.803   1.560   3.535   1.00 0.00 ? 32 CYS A C    4 
ATOM   2612 O O    . CYS A 1 32 ? -0.291  1.765   4.071   1.00 0.00 ? 32 CYS A O    4 
ATOM   2613 C CB   . CYS A 1 32 ? 0.883   3.169   1.554   1.00 0.00 ? 32 CYS A CB   4 
ATOM   2614 S SG   . CYS A 1 32 ? 0.738   3.340   -0.254  1.00 0.00 ? 32 CYS A SG   4 
ATOM   2615 H H    . CYS A 1 32 ? -0.862  1.437   0.992   1.00 0.00 ? 32 CYS A H    4 
ATOM   2616 H HA   . CYS A 1 32 ? 1.918   1.308   1.690   1.00 0.00 ? 32 CYS A HA   4 
ATOM   2617 H HB2  . CYS A 1 32 ? 0.030   3.681   1.991   1.00 0.00 ? 32 CYS A HB2  4 
ATOM   2618 H HB3  . CYS A 1 32 ? 1.749   3.700   1.938   1.00 0.00 ? 32 CYS A HB3  4 
ATOM   2619 N N    . ASN A 1 33 ? 1.884   1.113   4.192   1.00 0.00 ? 33 ASN A N    4 
ATOM   2620 C CA   . ASN A 1 33 ? 1.805   0.339   5.437   1.00 0.00 ? 33 ASN A CA   4 
ATOM   2621 C C    . ASN A 1 33 ? 2.570   0.947   6.620   1.00 0.00 ? 33 ASN A C    4 
ATOM   2622 O O    . ASN A 1 33 ? 3.020   0.207   7.494   1.00 0.00 ? 33 ASN A O    4 
ATOM   2623 C CB   . ASN A 1 33 ? 2.146   -1.146  5.168   1.00 0.00 ? 33 ASN A CB   4 
ATOM   2624 C CG   . ASN A 1 33 ? 3.609   -1.501  4.960   1.00 0.00 ? 33 ASN A CG   4 
ATOM   2625 O OD1  . ASN A 1 33 ? 4.023   -2.642  5.156   1.00 0.00 ? 33 ASN A OD1  4 
ATOM   2626 N ND2  . ASN A 1 33 ? 4.389   -0.514  4.557   1.00 0.00 ? 33 ASN A ND2  4 
ATOM   2627 H H    . ASN A 1 33 ? 2.760   1.101   3.683   1.00 0.00 ? 33 ASN A H    4 
ATOM   2628 H HA   . ASN A 1 33 ? 0.777   0.308   5.778   1.00 0.00 ? 33 ASN A HA   4 
ATOM   2629 H HB2  . ASN A 1 33 ? 1.845   -1.721  6.029   1.00 0.00 ? 33 ASN A HB2  4 
ATOM   2630 H HB3  . ASN A 1 33 ? 1.602   -1.490  4.292   1.00 0.00 ? 33 ASN A HB3  4 
ATOM   2631 H HD21 . ASN A 1 33 ? 3.965   0.384   4.427   1.00 0.00 ? 33 ASN A HD21 4 
ATOM   2632 H HD22 . ASN A 1 33 ? 5.362   -0.674  4.388   1.00 0.00 ? 33 ASN A HD22 4 
ATOM   2633 N N    . GLY A 1 34 ? 2.711   2.282   6.673   1.00 0.00 ? 34 GLY A N    4 
ATOM   2634 C CA   . GLY A 1 34 ? 3.351   2.982   7.786   1.00 0.00 ? 34 GLY A CA   4 
ATOM   2635 C C    . GLY A 1 34 ? 4.888   2.892   7.770   1.00 0.00 ? 34 GLY A C    4 
ATOM   2636 O O    . GLY A 1 34 ? 5.560   3.836   8.186   1.00 0.00 ? 34 GLY A O    4 
ATOM   2637 H H    . GLY A 1 34 ? 2.333   2.843   5.923   1.00 0.00 ? 34 GLY A H    4 
ATOM   2638 H HA2  . GLY A 1 34 ? 3.043   4.026   7.741   1.00 0.00 ? 34 GLY A HA2  4 
ATOM   2639 H HA3  . GLY A 1 34 ? 2.989   2.575   8.732   1.00 0.00 ? 34 GLY A HA3  4 
ATOM   2640 N N    . LYS A 1 35 ? 5.443   1.756   7.322   1.00 0.00 ? 35 LYS A N    4 
ATOM   2641 C CA   . LYS A 1 35 ? 6.872   1.464   7.284   1.00 0.00 ? 35 LYS A CA   4 
ATOM   2642 C C    . LYS A 1 35 ? 7.524   1.998   6.008   1.00 0.00 ? 35 LYS A C    4 
ATOM   2643 O O    . LYS A 1 35 ? 8.613   2.567   6.082   1.00 0.00 ? 35 LYS A O    4 
ATOM   2644 C CB   . LYS A 1 35 ? 7.102   -0.051  7.427   1.00 0.00 ? 35 LYS A CB   4 
ATOM   2645 C CG   . LYS A 1 35 ? 6.500   -0.645  8.713   1.00 0.00 ? 35 LYS A CG   4 
ATOM   2646 C CD   . LYS A 1 35 ? 6.969   0.103   9.969   1.00 0.00 ? 35 LYS A CD   4 
ATOM   2647 C CE   . LYS A 1 35 ? 6.541   -0.627  11.249  1.00 0.00 ? 35 LYS A CE   4 
ATOM   2648 N NZ   . LYS A 1 35 ? 6.979   0.097   12.456  1.00 0.00 ? 35 LYS A NZ   4 
ATOM   2649 H H    . LYS A 1 35 ? 4.831   1.016   7.010   1.00 0.00 ? 35 LYS A H    4 
ATOM   2650 H HA   . LYS A 1 35 ? 7.368   1.963   8.116   1.00 0.00 ? 35 LYS A HA   4 
ATOM   2651 H HB2  . LYS A 1 35 ? 6.671   -0.574  6.571   1.00 0.00 ? 35 LYS A HB2  4 
ATOM   2652 H HB3  . LYS A 1 35 ? 8.178   -0.242  7.433   1.00 0.00 ? 35 LYS A HB3  4 
ATOM   2653 H HG2  . LYS A 1 35 ? 5.410   -0.614  8.663   1.00 0.00 ? 35 LYS A HG2  4 
ATOM   2654 H HG3  . LYS A 1 35 ? 6.807   -1.690  8.779   1.00 0.00 ? 35 LYS A HG3  4 
ATOM   2655 H HD2  . LYS A 1 35 ? 8.058   0.186   9.954   1.00 0.00 ? 35 LYS A HD2  4 
ATOM   2656 H HD3  . LYS A 1 35 ? 6.535   1.104   9.988   1.00 0.00 ? 35 LYS A HD3  4 
ATOM   2657 H HE2  . LYS A 1 35 ? 5.454   -0.717  11.272  1.00 0.00 ? 35 LYS A HE2  4 
ATOM   2658 H HE3  . LYS A 1 35 ? 6.979   -1.626  11.266  1.00 0.00 ? 35 LYS A HE3  4 
ATOM   2659 H HZ1  . LYS A 1 35 ? 6.685   -0.407  13.280  1.00 0.00 ? 35 LYS A HZ1  4 
ATOM   2660 H HZ2  . LYS A 1 35 ? 7.985   0.179   12.453  1.00 0.00 ? 35 LYS A HZ2  4 
ATOM   2661 H HZ3  . LYS A 1 35 ? 6.568   1.020   12.462  1.00 0.00 ? 35 LYS A HZ3  4 
ATOM   2662 N N    . THR A 1 36 ? 6.878   1.803   4.847   1.00 0.00 ? 36 THR A N    4 
ATOM   2663 C CA   . THR A 1 36 ? 7.428   2.211   3.555   1.00 0.00 ? 36 THR A CA   4 
ATOM   2664 C C    . THR A 1 36 ? 6.370   2.520   2.486   1.00 0.00 ? 36 THR A C    4 
ATOM   2665 O O    . THR A 1 36 ? 5.179   2.214   2.625   1.00 0.00 ? 36 THR A O    4 
ATOM   2666 C CB   . THR A 1 36 ? 8.519   1.225   3.089   1.00 0.00 ? 36 THR A CB   4 
ATOM   2667 O OG1  . THR A 1 36 ? 9.252   1.731   1.990   1.00 0.00 ? 36 THR A OG1  4 
ATOM   2668 C CG2  . THR A 1 36 ? 7.963   -0.162  2.746   1.00 0.00 ? 36 THR A CG2  4 
ATOM   2669 H H    . THR A 1 36 ? 5.984   1.332   4.874   1.00 0.00 ? 36 THR A H    4 
ATOM   2670 H HA   . THR A 1 36 ? 7.937   3.157   3.724   1.00 0.00 ? 36 THR A HA   4 
ATOM   2671 H HB   . THR A 1 36 ? 9.246   1.136   3.894   1.00 0.00 ? 36 THR A HB   4 
ATOM   2672 H HG1  . THR A 1 36 ? 8.714   1.671   1.198   1.00 0.00 ? 36 THR A HG1  4 
ATOM   2673 H HG21 . THR A 1 36 ? 7.437   -0.582  3.603   1.00 0.00 ? 36 THR A HG21 4 
ATOM   2674 H HG22 . THR A 1 36 ? 8.781   -0.831  2.477   1.00 0.00 ? 36 THR A HG22 4 
ATOM   2675 H HG23 . THR A 1 36 ? 7.275   -0.093  1.902   1.00 0.00 ? 36 THR A HG23 4 
ATOM   2676 N N    . CYS A 1 37 ? 6.882   3.184   1.435   1.00 0.00 ? 37 CYS A N    4 
ATOM   2677 C CA   . CYS A 1 37 ? 6.183   3.861   0.342   1.00 0.00 ? 37 CYS A CA   4 
ATOM   2678 C C    . CYS A 1 37 ? 6.324   3.131   -1.006  1.00 0.00 ? 37 CYS A C    4 
ATOM   2679 O O    . CYS A 1 37 ? 6.105   3.737   -2.055  1.00 0.00 ? 37 CYS A O    4 
ATOM   2680 C CB   . CYS A 1 37 ? 6.739   5.300   0.209   1.00 0.00 ? 37 CYS A CB   4 
ATOM   2681 S SG   . CYS A 1 37 ? 7.272   6.125   1.739   1.00 0.00 ? 37 CYS A SG   4 
ATOM   2682 H H    . CYS A 1 37 ? 7.881   3.329   1.484   1.00 0.00 ? 37 CYS A H    4 
ATOM   2683 H HA   . CYS A 1 37 ? 5.126   3.890   0.587   1.00 0.00 ? 37 CYS A HA   4 
ATOM   2684 H HB2  . CYS A 1 37 ? 7.628   5.271   -0.422  1.00 0.00 ? 37 CYS A HB2  4 
ATOM   2685 H HB3  . CYS A 1 37 ? 6.000   5.929   -0.289  1.00 0.00 ? 37 CYS A HB3  4 
ATOM   2686 N N    . ASP A 1 38 ? 6.714   1.850   -0.990  1.00 0.00 ? 38 ASP A N    4 
ATOM   2687 C CA   . ASP A 1 38 ? 7.062   1.070   -2.177  1.00 0.00 ? 38 ASP A CA   4 
ATOM   2688 C C    . ASP A 1 38 ? 5.970   0.022   -2.419  1.00 0.00 ? 38 ASP A C    4 
ATOM   2689 O O    . ASP A 1 38 ? 6.252   -1.176  -2.368  1.00 0.00 ? 38 ASP A O    4 
ATOM   2690 C CB   . ASP A 1 38 ? 8.463   0.454   -1.975  1.00 0.00 ? 38 ASP A CB   4 
ATOM   2691 C CG   . ASP A 1 38 ? 9.555   1.527   -1.909  1.00 0.00 ? 38 ASP A CG   4 
ATOM   2692 O OD1  . ASP A 1 38 ? 9.981   1.975   -2.997  1.00 0.00 ? 38 ASP A OD1  4 
ATOM   2693 O OD2  . ASP A 1 38 ? 9.938   1.892   -0.777  1.00 0.00 ? 38 ASP A OD2  4 
ATOM   2694 H H    . ASP A 1 38 ? 6.827   1.413   -0.088  1.00 0.00 ? 38 ASP A H    4 
ATOM   2695 H HA   . ASP A 1 38 ? 7.109   1.698   -3.069  1.00 0.00 ? 38 ASP A HA   4 
ATOM   2696 H HB2  . ASP A 1 38 ? 8.477   -0.142  -1.059  1.00 0.00 ? 38 ASP A HB2  4 
ATOM   2697 H HB3  . ASP A 1 38 ? 8.691   -0.216  -2.806  1.00 0.00 ? 38 ASP A HB3  4 
ATOM   2698 N N    . CYS A 1 39 ? 4.730   0.496   -2.661  1.00 0.00 ? 39 CYS A N    4 
ATOM   2699 C CA   . CYS A 1 39 ? 3.467   -0.238  -2.710  1.00 0.00 ? 39 CYS A CA   4 
ATOM   2700 C C    . CYS A 1 39 ? 3.558   -1.649  -2.108  1.00 0.00 ? 39 CYS A C    4 
ATOM   2701 O O    . CYS A 1 39 ? 3.620   -2.629  -2.853  1.00 0.00 ? 39 CYS A O    4 
ATOM   2702 C CB   . CYS A 1 39 ? 2.890   -0.191  -4.127  1.00 0.00 ? 39 CYS A CB   4 
ATOM   2703 S SG   . CYS A 1 39 ? 2.296   1.443   -4.651  1.00 0.00 ? 39 CYS A SG   4 
ATOM   2704 H H    . CYS A 1 39 ? 4.619   1.491   -2.767  1.00 0.00 ? 39 CYS A H    4 
ATOM   2705 H HA   . CYS A 1 39 ? 2.753   0.320   -2.111  1.00 0.00 ? 39 CYS A HA   4 
ATOM   2706 H HB2  . CYS A 1 39 ? 3.644   -0.539  -4.830  1.00 0.00 ? 39 CYS A HB2  4 
ATOM   2707 H HB3  . CYS A 1 39 ? 2.039   -0.859  -4.172  1.00 0.00 ? 39 CYS A HB3  4 
ATOM   2708 N N    . PRO A 1 40 ? 3.612   -1.744  -0.763  1.00 0.00 ? 40 PRO A N    4 
ATOM   2709 C CA   . PRO A 1 40 ? 3.826   -2.977  -0.013  1.00 0.00 ? 40 PRO A CA   4 
ATOM   2710 C C    . PRO A 1 40 ? 2.875   -4.101  -0.440  1.00 0.00 ? 40 PRO A C    4 
ATOM   2711 O O    . PRO A 1 40 ? 1.724   -3.840  -0.796  1.00 0.00 ? 40 PRO A O    4 
ATOM   2712 C CB   . PRO A 1 40 ? 3.655   -2.613  1.470   1.00 0.00 ? 40 PRO A CB   4 
ATOM   2713 C CG   . PRO A 1 40 ? 3.943   -1.114  1.507   1.00 0.00 ? 40 PRO A CG   4 
ATOM   2714 C CD   . PRO A 1 40 ? 3.506   -0.610  0.139   1.00 0.00 ? 40 PRO A CD   4 
ATOM   2715 H HA   . PRO A 1 40 ? 4.864   -3.274  -0.182  1.00 0.00 ? 40 PRO A HA   4 
ATOM   2716 H HB2  . PRO A 1 40 ? 2.633   -2.778  1.807   1.00 0.00 ? 40 PRO A HB2  4 
ATOM   2717 H HB3  . PRO A 1 40 ? 4.336   -3.172  2.114   1.00 0.00 ? 40 PRO A HB3  4 
ATOM   2718 H HG2  . PRO A 1 40 ? 3.380   -0.603  2.284   1.00 0.00 ? 40 PRO A HG2  4 
ATOM   2719 H HG3  . PRO A 1 40 ? 5.015   -0.950  1.638   1.00 0.00 ? 40 PRO A HG3  4 
ATOM   2720 H HD2  . PRO A 1 40 ? 2.462   -0.300  0.166   1.00 0.00 ? 40 PRO A HD2  4 
ATOM   2721 H HD3  . PRO A 1 40 ? 4.132   0.235   -0.142  1.00 0.00 ? 40 PRO A HD3  4 
ATOM   2722 N N    . ARG A 1 41 ? 3.375   -5.344  -0.415  1.00 0.00 ? 41 ARG A N    4 
ATOM   2723 C CA   . ARG A 1 41 ? 2.708   -6.544  -0.886  1.00 0.00 ? 41 ARG A CA   4 
ATOM   2724 C C    . ARG A 1 41 ? 1.639   -7.066  0.094   1.00 0.00 ? 41 ARG A C    4 
ATOM   2725 O O    . ARG A 1 41 ? 1.573   -8.263  0.366   1.00 0.00 ? 41 ARG A O    4 
ATOM   2726 C CB   . ARG A 1 41 ? 3.788   -7.576  -1.278  1.00 0.00 ? 41 ARG A CB   4 
ATOM   2727 C CG   . ARG A 1 41 ? 4.967   -7.841  -0.316  1.00 0.00 ? 41 ARG A CG   4 
ATOM   2728 C CD   . ARG A 1 41 ? 4.596   -8.367  1.078   1.00 0.00 ? 41 ARG A CD   4 
ATOM   2729 N NE   . ARG A 1 41 ? 4.060   -7.306  1.946   1.00 0.00 ? 41 ARG A NE   4 
ATOM   2730 C CZ   . ARG A 1 41 ? 3.587   -7.471  3.194   1.00 0.00 ? 41 ARG A CZ   4 
ATOM   2731 N NH1  . ARG A 1 41 ? 3.545   -8.680  3.773   1.00 0.00 ? 41 ARG A NH1  4 
ATOM   2732 N NH2  . ARG A 1 41 ? 3.156   -6.399  3.871   1.00 0.00 ? 41 ARG A NH2  4 
ATOM   2733 H H    . ARG A 1 41 ? 4.325   -5.491  -0.121  1.00 0.00 ? 41 ARG A H    4 
ATOM   2734 H HA   . ARG A 1 41 ? 2.174   -6.299  -1.806  1.00 0.00 ? 41 ARG A HA   4 
ATOM   2735 H HB2  . ARG A 1 41 ? 3.298   -8.517  -1.481  1.00 0.00 ? 41 ARG A HB2  4 
ATOM   2736 H HB3  . ARG A 1 41 ? 4.231   -7.238  -2.218  1.00 0.00 ? 41 ARG A HB3  4 
ATOM   2737 H HG2  . ARG A 1 41 ? 5.588   -8.604  -0.790  1.00 0.00 ? 41 ARG A HG2  4 
ATOM   2738 H HG3  . ARG A 1 41 ? 5.589   -6.950  -0.218  1.00 0.00 ? 41 ARG A HG3  4 
ATOM   2739 H HD2  . ARG A 1 41 ? 3.887   -9.191  0.986   1.00 0.00 ? 41 ARG A HD2  4 
ATOM   2740 H HD3  . ARG A 1 41 ? 5.503   -8.750  1.548   1.00 0.00 ? 41 ARG A HD3  4 
ATOM   2741 H HE   . ARG A 1 41 ? 4.076   -6.370  1.572   1.00 0.00 ? 41 ARG A HE   4 
ATOM   2742 H HH11 . ARG A 1 41 ? 3.879   -9.493  3.274   1.00 0.00 ? 41 ARG A HH11 4 
ATOM   2743 H HH12 . ARG A 1 41 ? 3.195   -8.780  4.715   1.00 0.00 ? 41 ARG A HH12 4 
ATOM   2744 H HH21 . ARG A 1 41 ? 3.171   -5.486  3.439   1.00 0.00 ? 41 ARG A HH21 4 
ATOM   2745 H HH22 . ARG A 1 41 ? 2.820   -6.501  4.818   1.00 0.00 ? 41 ARG A HH22 4 
ATOM   2746 N N    . ASN A 1 42 ? 0.766   -6.166  0.574   1.00 0.00 ? 42 ASN A N    4 
ATOM   2747 C CA   . ASN A 1 42 ? -0.475  -6.465  1.275   1.00 0.00 ? 42 ASN A CA   4 
ATOM   2748 C C    . ASN A 1 42 ? -0.220  -7.099  2.650   1.00 0.00 ? 42 ASN A C    4 
ATOM   2749 O O    . ASN A 1 42 ? -0.102  -8.320  2.727   1.00 0.00 ? 42 ASN A O    4 
ATOM   2750 C CB   . ASN A 1 42 ? -1.401  -7.286  0.357   1.00 0.00 ? 42 ASN A CB   4 
ATOM   2751 C CG   . ASN A 1 42 ? -2.842  -7.404  0.856   1.00 0.00 ? 42 ASN A CG   4 
ATOM   2752 O OD1  . ASN A 1 42 ? -3.154  -7.083  2.001   1.00 0.00 ? 42 ASN A OD1  4 
ATOM   2753 N ND2  . ASN A 1 42 ? -3.727  -7.879  -0.023  1.00 0.00 ? 42 ASN A ND2  4 
ATOM   2754 H H    . ASN A 1 42 ? 0.894   -5.199  0.311   1.00 0.00 ? 42 ASN A H    4 
ATOM   2755 H HA   . ASN A 1 42 ? -0.985  -5.520  1.432   1.00 0.00 ? 42 ASN A HA   4 
ATOM   2756 H HB2  . ASN A 1 42 ? -1.421  -6.801  -0.619  1.00 0.00 ? 42 ASN A HB2  4 
ATOM   2757 H HB3  . ASN A 1 42 ? -1.003  -8.286  0.212   1.00 0.00 ? 42 ASN A HB3  4 
ATOM   2758 H HD21 . ASN A 1 42 ? -3.430  -8.099  -0.962  1.00 0.00 ? 42 ASN A HD21 4 
ATOM   2759 H HD22 . ASN A 1 42 ? -4.700  -7.986  0.234   1.00 0.00 ? 42 ASN A HD22 4 
ATOM   2760 N N    . PRO A 1 43 ? -0.161  -6.281  3.726   1.00 0.00 ? 43 PRO A N    4 
ATOM   2761 C CA   . PRO A 1 43 ? -0.105  -6.701  5.124   1.00 0.00 ? 43 PRO A CA   4 
ATOM   2762 C C    . PRO A 1 43 ? -1.151  -7.763  5.498   1.00 0.00 ? 43 PRO A C    4 
ATOM   2763 O O    . PRO A 1 43 ? -2.238  -7.458  5.989   1.00 0.00 ? 43 PRO A O    4 
ATOM   2764 C CB   . PRO A 1 43 ? -0.226  -5.414  5.952   1.00 0.00 ? 43 PRO A CB   4 
ATOM   2765 C CG   . PRO A 1 43 ? 0.423   -4.379  5.038   1.00 0.00 ? 43 PRO A CG   4 
ATOM   2766 C CD   . PRO A 1 43 ? -0.047  -4.830  3.656   1.00 0.00 ? 43 PRO A CD   4 
ATOM   2767 H HA   . PRO A 1 43 ? 0.891   -7.110  5.305   1.00 0.00 ? 43 PRO A HA   4 
ATOM   2768 H HB2  . PRO A 1 43 ? -1.270  -5.132  6.098   1.00 0.00 ? 43 PRO A HB2  4 
ATOM   2769 H HB3  . PRO A 1 43 ? 0.276   -5.490  6.918   1.00 0.00 ? 43 PRO A HB3  4 
ATOM   2770 H HG2  . PRO A 1 43 ? 0.103   -3.363  5.268   1.00 0.00 ? 43 PRO A HG2  4 
ATOM   2771 H HG3  . PRO A 1 43 ? 1.510   -4.453  5.110   1.00 0.00 ? 43 PRO A HG3  4 
ATOM   2772 H HD2  . PRO A 1 43 ? -1.028  -4.404  3.455   1.00 0.00 ? 43 PRO A HD2  4 
ATOM   2773 H HD3  . PRO A 1 43 ? 0.665   -4.501  2.896   1.00 0.00 ? 43 PRO A HD3  4 
ATOM   2774 N N    . HIS A 1 44 ? -0.765  -9.025  5.281   1.00 0.00 ? 44 HIS A N    4 
ATOM   2775 C CA   . HIS A 1 44 ? -1.430  -10.247 5.725   1.00 0.00 ? 44 HIS A CA   4 
ATOM   2776 C C    . HIS A 1 44 ? -2.798  -10.493 5.071   1.00 0.00 ? 44 HIS A C    4 
ATOM   2777 O O    . HIS A 1 44 ? -3.580  -11.300 5.572   1.00 0.00 ? 44 HIS A O    4 
ATOM   2778 C CB   . HIS A 1 44 ? -1.487  -10.295 7.261   1.00 0.00 ? 44 HIS A CB   4 
ATOM   2779 C CG   . HIS A 1 44 ? -0.160  -9.989  7.912   1.00 0.00 ? 44 HIS A CG   4 
ATOM   2780 N ND1  . HIS A 1 44 ? 0.321   -8.725  8.167   1.00 0.00 ? 44 HIS A ND1  4 
ATOM   2781 C CD2  . HIS A 1 44 ? 0.898   -10.853 7.986   1.00 0.00 ? 44 HIS A CD2  4 
ATOM   2782 C CE1  . HIS A 1 44 ? 1.640   -8.832  8.388   1.00 0.00 ? 44 HIS A CE1  4 
ATOM   2783 N NE2  . HIS A 1 44 ? 2.041   -10.111 8.298   1.00 0.00 ? 44 HIS A NE2  4 
ATOM   2784 H H    . HIS A 1 44 ? 0.128   -9.133  4.825   1.00 0.00 ? 44 HIS A H    4 
ATOM   2785 H HA   . HIS A 1 44 ? -0.788  -11.067 5.399   1.00 0.00 ? 44 HIS A HA   4 
ATOM   2786 H HB2  . HIS A 1 44 ? -2.230  -9.593  7.638   1.00 0.00 ? 44 HIS A HB2  4 
ATOM   2787 H HB3  . HIS A 1 44 ? -1.796  -11.298 7.539   1.00 0.00 ? 44 HIS A HB3  4 
ATOM   2788 H HD1  . HIS A 1 44 ? -0.202  -7.863  8.093   1.00 0.00 ? 44 HIS A HD1  4 
ATOM   2789 H HD2  . HIS A 1 44 ? 0.871   -11.895 7.710   1.00 0.00 ? 44 HIS A HD2  4 
ATOM   2790 H HE1  . HIS A 1 44 ? 2.298   -7.993  8.545   1.00 0.00 ? 44 HIS A HE1  4 
ATOM   2791 N N    . LYS A 1 45 ? -3.012  -9.920  3.878   1.00 0.00 ? 45 LYS A N    4 
ATOM   2792 C CA   . LYS A 1 45 ? -4.139  -10.184 2.984   1.00 0.00 ? 45 LYS A CA   4 
ATOM   2793 C C    . LYS A 1 45 ? -5.491  -9.783  3.599   1.00 0.00 ? 45 LYS A C    4 
ATOM   2794 O O    . LYS A 1 45 ? -5.563  -9.314  4.736   1.00 0.00 ? 45 LYS A O    4 
ATOM   2795 C CB   . LYS A 1 45 ? -4.113  -11.640 2.470   1.00 0.00 ? 45 LYS A CB   4 
ATOM   2796 C CG   . LYS A 1 45 ? -2.725  -12.147 2.033   1.00 0.00 ? 45 LYS A CG   4 
ATOM   2797 C CD   . LYS A 1 45 ? -1.983  -11.192 1.083   1.00 0.00 ? 45 LYS A CD   4 
ATOM   2798 C CE   . LYS A 1 45 ? -0.666  -11.821 0.606   1.00 0.00 ? 45 LYS A CE   4 
ATOM   2799 N NZ   . LYS A 1 45 ? 0.122   -10.887 -0.218  1.00 0.00 ? 45 LYS A NZ   4 
ATOM   2800 H H    . LYS A 1 45 ? -2.295  -9.297  3.537   1.00 0.00 ? 45 LYS A H    4 
ATOM   2801 H HA   . LYS A 1 45 ? -3.996  -9.546  2.117   1.00 0.00 ? 45 LYS A HA   4 
ATOM   2802 H HB2  . LYS A 1 45 ? -4.490  -12.311 3.245   1.00 0.00 ? 45 LYS A HB2  4 
ATOM   2803 H HB3  . LYS A 1 45 ? -4.783  -11.719 1.613   1.00 0.00 ? 45 LYS A HB3  4 
ATOM   2804 H HG2  . LYS A 1 45 ? -2.107  -12.312 2.917   1.00 0.00 ? 45 LYS A HG2  4 
ATOM   2805 H HG3  . LYS A 1 45 ? -2.859  -13.109 1.536   1.00 0.00 ? 45 LYS A HG3  4 
ATOM   2806 H HD2  . LYS A 1 45 ? -2.616  -10.965 0.225   1.00 0.00 ? 45 LYS A HD2  4 
ATOM   2807 H HD3  . LYS A 1 45 ? -1.753  -10.260 1.600   1.00 0.00 ? 45 LYS A HD3  4 
ATOM   2808 H HE2  . LYS A 1 45 ? -0.063  -12.106 1.469   1.00 0.00 ? 45 LYS A HE2  4 
ATOM   2809 H HE3  . LYS A 1 45 ? -0.880  -12.712 0.015   1.00 0.00 ? 45 LYS A HE3  4 
ATOM   2810 H HZ1  . LYS A 1 45 ? -0.423  -10.609 -1.023  1.00 0.00 ? 45 LYS A HZ1  4 
ATOM   2811 H HZ2  . LYS A 1 45 ? 0.360   -10.069 0.325   1.00 0.00 ? 45 LYS A HZ2  4 
ATOM   2812 H HZ3  . LYS A 1 45 ? 0.969   -11.342 -0.527  1.00 0.00 ? 45 LYS A HZ3  4 
ATOM   2813 N N    . GLY A 1 46 ? -6.573  -9.961  2.828   1.00 0.00 ? 46 GLY A N    4 
ATOM   2814 C CA   . GLY A 1 46 ? -7.938  -9.658  3.244   1.00 0.00 ? 46 GLY A CA   4 
ATOM   2815 C C    . GLY A 1 46 ? -8.336  -8.203  2.954   1.00 0.00 ? 46 GLY A C    4 
ATOM   2816 O O    . GLY A 1 46 ? -7.493  -7.376  2.598   1.00 0.00 ? 46 GLY A O    4 
ATOM   2817 H H    . GLY A 1 46 ? -6.442  -10.319 1.893   1.00 0.00 ? 46 GLY A H    4 
ATOM   2818 H HA2  . GLY A 1 46 ? -8.599  -10.330 2.699   1.00 0.00 ? 46 GLY A HA2  4 
ATOM   2819 H HA3  . GLY A 1 46 ? -8.058  -9.861  4.309   1.00 0.00 ? 46 GLY A HA3  4 
ATOM   2820 N N    . PRO A 1 47 ? -9.634  -7.879  3.113   1.00 0.00 ? 47 PRO A N    4 
ATOM   2821 C CA   . PRO A 1 47 ? -10.186 -6.546  2.896   1.00 0.00 ? 47 PRO A CA   4 
ATOM   2822 C C    . PRO A 1 47 ? -9.734  -5.565  3.991   1.00 0.00 ? 47 PRO A C    4 
ATOM   2823 O O    . PRO A 1 47 ? -9.387  -5.982  5.097   1.00 0.00 ? 47 PRO A O    4 
ATOM   2824 C CB   . PRO A 1 47 ? -11.708 -6.745  2.906   1.00 0.00 ? 47 PRO A CB   4 
ATOM   2825 C CG   . PRO A 1 47 ? -11.897 -7.930  3.855   1.00 0.00 ? 47 PRO A CG   4 
ATOM   2826 C CD   . PRO A 1 47 ? -10.679 -8.800  3.544   1.00 0.00 ? 47 PRO A CD   4 
ATOM   2827 H HA   . PRO A 1 47 ? -9.880  -6.172  1.915   1.00 0.00 ? 47 PRO A HA   4 
ATOM   2828 H HB2  . PRO A 1 47 ? -12.262 -5.868  3.242   1.00 0.00 ? 47 PRO A HB2  4 
ATOM   2829 H HB3  . PRO A 1 47 ? -12.047 -7.031  1.908   1.00 0.00 ? 47 PRO A HB3  4 
ATOM   2830 H HG2  . PRO A 1 47 ? -11.847 -7.581  4.888   1.00 0.00 ? 47 PRO A HG2  4 
ATOM   2831 H HG3  . PRO A 1 47 ? -12.838 -8.455  3.686   1.00 0.00 ? 47 PRO A HG3  4 
ATOM   2832 H HD2  . PRO A 1 47 ? -10.394 -9.371  4.431   1.00 0.00 ? 47 PRO A HD2  4 
ATOM   2833 H HD3  . PRO A 1 47 ? -10.914 -9.481  2.725   1.00 0.00 ? 47 PRO A HD3  4 
ATOM   2834 N N    . ALA A 1 48 ? -9.745  -4.262  3.664   1.00 0.00 ? 48 ALA A N    4 
ATOM   2835 C CA   . ALA A 1 48 ? -9.373  -3.135  4.525   1.00 0.00 ? 48 ALA A CA   4 
ATOM   2836 C C    . ALA A 1 48 ? -7.851  -3.007  4.705   1.00 0.00 ? 48 ALA A C    4 
ATOM   2837 O O    . ALA A 1 48 ? -7.285  -1.953  4.414   1.00 0.00 ? 48 ALA A O    4 
ATOM   2838 C CB   . ALA A 1 48 ? -10.127 -3.157  5.867   1.00 0.00 ? 48 ALA A CB   4 
ATOM   2839 H H    . ALA A 1 48 ? -10.042 -4.024  2.729   1.00 0.00 ? 48 ALA A H    4 
ATOM   2840 H HA   . ALA A 1 48 ? -9.716  -2.244  3.999   1.00 0.00 ? 48 ALA A HA   4 
ATOM   2841 H HB1  . ALA A 1 48 ? -9.781  -3.963  6.512   1.00 0.00 ? 48 ALA A HB1  4 
ATOM   2842 H HB2  . ALA A 1 48 ? -9.963  -2.213  6.388   1.00 0.00 ? 48 ALA A HB2  4 
ATOM   2843 H HB3  . ALA A 1 48 ? -11.197 -3.273  5.694   1.00 0.00 ? 48 ALA A HB3  4 
ATOM   2844 N N    . THR A 1 49 ? -7.199  -4.072  5.194   1.00 0.00 ? 49 THR A N    4 
ATOM   2845 C CA   . THR A 1 49 ? -5.759  -4.152  5.447   1.00 0.00 ? 49 THR A CA   4 
ATOM   2846 C C    . THR A 1 49 ? -5.270  -5.585  5.180   1.00 0.00 ? 49 THR A C    4 
ATOM   2847 O O    . THR A 1 49 ? -4.280  -5.784  4.479   1.00 0.00 ? 49 THR A O    4 
ATOM   2848 C CB   . THR A 1 49 ? -5.440  -3.693  6.887   1.00 0.00 ? 49 THR A CB   4 
ATOM   2849 O OG1  . THR A 1 49 ? -5.924  -2.381  7.108   1.00 0.00 ? 49 THR A OG1  4 
ATOM   2850 C CG2  . THR A 1 49 ? -3.930  -3.701  7.168   1.00 0.00 ? 49 THR A CG2  4 
ATOM   2851 H H    . THR A 1 49 ? -7.745  -4.892  5.417   1.00 0.00 ? 49 THR A H    4 
ATOM   2852 H HA   . THR A 1 49 ? -5.238  -3.485  4.757   1.00 0.00 ? 49 THR A HA   4 
ATOM   2853 H HB   . THR A 1 49 ? -5.935  -4.354  7.602   1.00 0.00 ? 49 THR A HB   4 
ATOM   2854 H HG1  . THR A 1 49 ? -5.533  -1.798  6.453   1.00 0.00 ? 49 THR A HG1  4 
ATOM   2855 H HG21 . THR A 1 49 ? -3.738  -3.324  8.174   1.00 0.00 ? 49 THR A HG21 4 
ATOM   2856 H HG22 . THR A 1 49 ? -3.408  -3.070  6.448   1.00 0.00 ? 49 THR A HG22 4 
ATOM   2857 H HG23 . THR A 1 49 ? -3.539  -4.717  7.104   1.00 0.00 ? 49 THR A HG23 4 
HETATM 2858 N N    . NH2 A 1 50 ? -5.929  -6.587  5.773   1.00 0.00 ? 50 NH2 A N    4 
HETATM 2859 H HN1  . NH2 A 1 50 ? -5.633  -7.541  5.621   1.00 0.00 ? 50 NH2 A HN1  4 
HETATM 2860 H HN2  . NH2 A 1 50 ? -6.731  -6.392  6.353   1.00 0.00 ? 50 NH2 A HN2  4 
ATOM   2861 N N    . GLU A 1 1  ? 15.353  10.978  6.786   1.00 0.00 ? 1  GLU A N    5 
ATOM   2862 C CA   . GLU A 1 1  ? 14.798  11.001  5.416   1.00 0.00 ? 1  GLU A CA   5 
ATOM   2863 C C    . GLU A 1 1  ? 13.695  9.940   5.243   1.00 0.00 ? 1  GLU A C    5 
ATOM   2864 O O    . GLU A 1 1  ? 13.663  8.945   5.971   1.00 0.00 ? 1  GLU A O    5 
ATOM   2865 C CB   . GLU A 1 1  ? 15.929  10.857  4.381   1.00 0.00 ? 1  GLU A CB   5 
ATOM   2866 C CG   . GLU A 1 1  ? 15.484  11.171  2.942   1.00 0.00 ? 1  GLU A CG   5 
ATOM   2867 C CD   . GLU A 1 1  ? 16.679  11.215  1.985   1.00 0.00 ? 1  GLU A CD   5 
ATOM   2868 O OE1  . GLU A 1 1  ? 17.304  12.294  1.899   1.00 0.00 ? 1  GLU A OE1  5 
ATOM   2869 O OE2  . GLU A 1 1  ? 16.954  10.165  1.362   1.00 0.00 ? 1  GLU A OE2  5 
ATOM   2870 H H1   . GLU A 1 1  ? 16.038  11.714  6.886   1.00 0.00 ? 1  GLU A H1   5 
ATOM   2871 H H2   . GLU A 1 1  ? 15.796  10.084  6.952   1.00 0.00 ? 1  GLU A H2   5 
ATOM   2872 H H3   . GLU A 1 1  ? 14.611  11.114  7.458   1.00 0.00 ? 1  GLU A H3   5 
ATOM   2873 H HA   . GLU A 1 1  ? 14.351  11.990  5.298   1.00 0.00 ? 1  GLU A HA   5 
ATOM   2874 H HB2  . GLU A 1 1  ? 16.722  11.561  4.645   1.00 0.00 ? 1  GLU A HB2  5 
ATOM   2875 H HB3  . GLU A 1 1  ? 16.342  9.848   4.423   1.00 0.00 ? 1  GLU A HB3  5 
ATOM   2876 H HG2  . GLU A 1 1  ? 14.782  10.414  2.595   1.00 0.00 ? 1  GLU A HG2  5 
ATOM   2877 H HG3  . GLU A 1 1  ? 14.981  12.140  2.923   1.00 0.00 ? 1  GLU A HG3  5 
ATOM   2878 N N    . CYS A 1 2  ? 12.781  10.165  4.285   1.00 0.00 ? 2  CYS A N    5 
ATOM   2879 C CA   . CYS A 1 2  ? 11.604  9.353   4.008   1.00 0.00 ? 2  CYS A CA   5 
ATOM   2880 C C    . CYS A 1 2  ? 11.724  8.674   2.639   1.00 0.00 ? 2  CYS A C    5 
ATOM   2881 O O    . CYS A 1 2  ? 11.887  9.344   1.618   1.00 0.00 ? 2  CYS A O    5 
ATOM   2882 C CB   . CYS A 1 2  ? 10.342  10.230  4.092   1.00 0.00 ? 2  CYS A CB   5 
ATOM   2883 S SG   . CYS A 1 2  ? 10.348  11.809  3.189   1.00 0.00 ? 2  CYS A SG   5 
ATOM   2884 H H    . CYS A 1 2  ? 12.877  10.983  3.706   1.00 0.00 ? 2  CYS A H    5 
ATOM   2885 H HA   . CYS A 1 2  ? 11.494  8.584   4.778   1.00 0.00 ? 2  CYS A HA   5 
ATOM   2886 H HB2  . CYS A 1 2  ? 9.499   9.649   3.737   1.00 0.00 ? 2  CYS A HB2  5 
ATOM   2887 H HB3  . CYS A 1 2  ? 10.173  10.455  5.145   1.00 0.00 ? 2  CYS A HB3  5 
ATOM   2888 N N    . GLU A 1 3  ? 11.590  7.339   2.630   1.00 0.00 ? 3  GLU A N    5 
ATOM   2889 C CA   . GLU A 1 3  ? 11.406  6.526   1.431   1.00 0.00 ? 3  GLU A CA   5 
ATOM   2890 C C    . GLU A 1 3  ? 9.995   6.795   0.901   1.00 0.00 ? 3  GLU A C    5 
ATOM   2891 O O    . GLU A 1 3  ? 8.998   6.437   1.530   1.00 0.00 ? 3  GLU A O    5 
ATOM   2892 C CB   . GLU A 1 3  ? 11.660  5.049   1.750   1.00 0.00 ? 3  GLU A CB   5 
ATOM   2893 C CG   . GLU A 1 3  ? 11.550  4.097   0.543   1.00 0.00 ? 3  GLU A CG   5 
ATOM   2894 C CD   . GLU A 1 3  ? 10.104  3.792   0.139   1.00 0.00 ? 3  GLU A CD   5 
ATOM   2895 O OE1  . GLU A 1 3  ? 9.383   3.227   0.991   1.00 0.00 ? 3  GLU A OE1  5 
ATOM   2896 O OE2  . GLU A 1 3  ? 9.745   4.124   -1.011  1.00 0.00 ? 3  GLU A OE2  5 
ATOM   2897 H H    . GLU A 1 3  ? 11.477  6.882   3.523   1.00 0.00 ? 3  GLU A H    5 
ATOM   2898 H HA   . GLU A 1 3  ? 12.160  6.808   0.697   1.00 0.00 ? 3  GLU A HA   5 
ATOM   2899 H HB2  . GLU A 1 3  ? 12.679  4.980   2.126   1.00 0.00 ? 3  GLU A HB2  5 
ATOM   2900 H HB3  . GLU A 1 3  ? 10.974  4.744   2.533   1.00 0.00 ? 3  GLU A HB3  5 
ATOM   2901 H HG2  . GLU A 1 3  ? 12.105  4.514   -0.299  1.00 0.00 ? 3  GLU A HG2  5 
ATOM   2902 H HG3  . GLU A 1 3  ? 12.018  3.149   0.812   1.00 0.00 ? 3  GLU A HG3  5 
ATOM   2903 N N    . SER A 1 4  ? 9.946   7.500   -0.232  1.00 0.00 ? 4  SER A N    5 
ATOM   2904 C CA   . SER A 1 4  ? 8.776   8.223   -0.721  1.00 0.00 ? 4  SER A CA   5 
ATOM   2905 C C    . SER A 1 4  ? 7.958   7.402   -1.728  1.00 0.00 ? 4  SER A C    5 
ATOM   2906 O O    . SER A 1 4  ? 8.460   6.499   -2.398  1.00 0.00 ? 4  SER A O    5 
ATOM   2907 C CB   . SER A 1 4  ? 9.234   9.566   -1.319  1.00 0.00 ? 4  SER A CB   5 
ATOM   2908 O OG   . SER A 1 4  ? 8.132   10.393  -1.636  1.00 0.00 ? 4  SER A OG   5 
ATOM   2909 H H    . SER A 1 4  ? 10.835  7.674   -0.673  1.00 0.00 ? 4  SER A H    5 
ATOM   2910 H HA   . SER A 1 4  ? 8.137   8.458   0.139   1.00 0.00 ? 4  SER A HA   5 
ATOM   2911 H HB2  . SER A 1 4  ? 9.848   10.101  -0.592  1.00 0.00 ? 4  SER A HB2  5 
ATOM   2912 H HB3  . SER A 1 4  ? 9.825   9.398   -2.220  1.00 0.00 ? 4  SER A HB3  5 
ATOM   2913 H HG   . SER A 1 4  ? 7.621   9.974   -2.333  1.00 0.00 ? 4  SER A HG   5 
ATOM   2914 N N    . GLY A 1 5  ? 6.676   7.766   -1.816  1.00 0.00 ? 5  GLY A N    5 
ATOM   2915 C CA   . GLY A 1 5  ? 5.633   7.202   -2.652  1.00 0.00 ? 5  GLY A CA   5 
ATOM   2916 C C    . GLY A 1 5  ? 4.346   7.879   -2.172  1.00 0.00 ? 5  GLY A C    5 
ATOM   2917 O O    . GLY A 1 5  ? 4.023   7.654   -1.016  1.00 0.00 ? 5  GLY A O    5 
ATOM   2918 H H    . GLY A 1 5  ? 6.373   8.497   -1.189  1.00 0.00 ? 5  GLY A H    5 
ATOM   2919 H HA2  . GLY A 1 5  ? 5.855   7.346   -3.704  1.00 0.00 ? 5  GLY A HA2  5 
ATOM   2920 H HA3  . GLY A 1 5  ? 5.556   6.130   -2.467  1.00 0.00 ? 5  GLY A HA3  5 
ATOM   2921 N N    . PRO A 1 6  ? 3.641   8.726   -2.954  1.00 0.00 ? 6  PRO A N    5 
ATOM   2922 C CA   . PRO A 1 6  ? 2.523   9.573   -2.502  1.00 0.00 ? 6  PRO A CA   5 
ATOM   2923 C C    . PRO A 1 6  ? 1.390   8.903   -1.698  1.00 0.00 ? 6  PRO A C    5 
ATOM   2924 O O    . PRO A 1 6  ? 0.585   9.594   -1.073  1.00 0.00 ? 6  PRO A O    5 
ATOM   2925 C CB   . PRO A 1 6  ? 2.004   10.284  -3.754  1.00 0.00 ? 6  PRO A CB   5 
ATOM   2926 C CG   . PRO A 1 6  ? 3.278   10.422  -4.587  1.00 0.00 ? 6  PRO A CG   5 
ATOM   2927 C CD   . PRO A 1 6  ? 4.008   9.104   -4.306  1.00 0.00 ? 6  PRO A CD   5 
ATOM   2928 H HA   . PRO A 1 6  ? 2.975   10.322  -1.855  1.00 0.00 ? 6  PRO A HA   5 
ATOM   2929 H HB2  . PRO A 1 6  ? 1.293   9.649   -4.285  1.00 0.00 ? 6  PRO A HB2  5 
ATOM   2930 H HB3  . PRO A 1 6  ? 1.550   11.250  -3.528  1.00 0.00 ? 6  PRO A HB3  5 
ATOM   2931 H HG2  . PRO A 1 6  ? 3.068   10.562  -5.648  1.00 0.00 ? 6  PRO A HG2  5 
ATOM   2932 H HG3  . PRO A 1 6  ? 3.869   11.259  -4.210  1.00 0.00 ? 6  PRO A HG3  5 
ATOM   2933 H HD2  . PRO A 1 6  ? 3.680   8.324   -4.992  1.00 0.00 ? 6  PRO A HD2  5 
ATOM   2934 H HD3  . PRO A 1 6  ? 5.077   9.253   -4.396  1.00 0.00 ? 6  PRO A HD3  5 
ATOM   2935 N N    . CYS A 1 7  ? 1.381   7.566   -1.665  1.00 0.00 ? 7  CYS A N    5 
ATOM   2936 C CA   . CYS A 1 7  ? 0.786   6.706   -0.639  1.00 0.00 ? 7  CYS A CA   5 
ATOM   2937 C C    . CYS A 1 7  ? 1.154   7.235   0.758   1.00 0.00 ? 7  CYS A C    5 
ATOM   2938 O O    . CYS A 1 7  ? 0.284   7.750   1.456   1.00 0.00 ? 7  CYS A O    5 
ATOM   2939 C CB   . CYS A 1 7  ? 1.258   5.263   -0.952  1.00 0.00 ? 7  CYS A CB   5 
ATOM   2940 S SG   . CYS A 1 7  ? 0.058   3.928   -0.761  1.00 0.00 ? 7  CYS A SG   5 
ATOM   2941 H H    . CYS A 1 7  ? 2.091   7.127   -2.237  1.00 0.00 ? 7  CYS A H    5 
ATOM   2942 H HA   . CYS A 1 7  ? -0.305  6.766   -0.633  1.00 0.00 ? 7  CYS A HA   5 
ATOM   2943 H HB2  . CYS A 1 7  ? 1.531   5.183   -2.005  1.00 0.00 ? 7  CYS A HB2  5 
ATOM   2944 H HB3  . CYS A 1 7  ? 2.156   5.027   -0.382  1.00 0.00 ? 7  CYS A HB3  5 
ATOM   2945 N N    . CYS A 1 8  ? 2.447   7.257   1.103   1.00 0.00 ? 8  CYS A N    5 
ATOM   2946 C CA   . CYS A 1 8  ? 2.983   8.198   2.090   1.00 0.00 ? 8  CYS A CA   5 
ATOM   2947 C C    . CYS A 1 8  ? 2.649   9.604   1.583   1.00 0.00 ? 8  CYS A C    5 
ATOM   2948 O O    . CYS A 1 8  ? 3.169   9.973   0.532   1.00 0.00 ? 8  CYS A O    5 
ATOM   2949 C CB   . CYS A 1 8  ? 4.519   8.140   2.199   1.00 0.00 ? 8  CYS A CB   5 
ATOM   2950 S SG   . CYS A 1 8  ? 5.281   6.825   3.156   1.00 0.00 ? 8  CYS A SG   5 
ATOM   2951 H H    . CYS A 1 8  ? 3.085   6.899   0.410   1.00 0.00 ? 8  CYS A H    5 
ATOM   2952 H HA   . CYS A 1 8  ? 2.529   7.948   3.053   1.00 0.00 ? 8  CYS A HA   5 
ATOM   2953 H HB2  . CYS A 1 8  ? 4.961   8.138   1.208   1.00 0.00 ? 8  CYS A HB2  5 
ATOM   2954 H HB3  . CYS A 1 8  ? 4.855   9.053   2.688   1.00 0.00 ? 8  CYS A HB3  5 
ATOM   2955 N N    . ARG A 1 9  ? 1.806   10.352  2.311   1.00 0.00 ? 9  ARG A N    5 
ATOM   2956 C CA   . ARG A 1 9  ? 1.209   11.655  1.953   1.00 0.00 ? 9  ARG A CA   5 
ATOM   2957 C C    . ARG A 1 9  ? 1.932   12.341  0.794   1.00 0.00 ? 9  ARG A C    5 
ATOM   2958 O O    . ARG A 1 9  ? 1.476   12.372  -0.349  1.00 0.00 ? 9  ARG A O    5 
ATOM   2959 C CB   . ARG A 1 9  ? 1.184   12.584  3.182   1.00 0.00 ? 9  ARG A CB   5 
ATOM   2960 C CG   . ARG A 1 9  ? -0.124  12.510  3.960   1.00 0.00 ? 9  ARG A CG   5 
ATOM   2961 C CD   . ARG A 1 9  ? -0.446  11.111  4.495   1.00 0.00 ? 9  ARG A CD   5 
ATOM   2962 N NE   . ARG A 1 9  ? -1.664  11.125  5.320   1.00 0.00 ? 9  ARG A NE   5 
ATOM   2963 C CZ   . ARG A 1 9  ? -1.752  11.598  6.578   1.00 0.00 ? 9  ARG A CZ   5 
ATOM   2964 N NH1  . ARG A 1 9  ? -0.662  11.992  7.256   1.00 0.00 ? 9  ARG A NH1  5 
ATOM   2965 N NH2  . ARG A 1 9  ? -2.952  11.687  7.166   1.00 0.00 ? 9  ARG A NH2  5 
ATOM   2966 H H    . ARG A 1 9  ? 1.585   9.963   3.215   1.00 0.00 ? 9  ARG A H    5 
ATOM   2967 H HA   . ARG A 1 9  ? 0.188   11.488  1.645   1.00 0.00 ? 9  ARG A HA   5 
ATOM   2968 H HB2  . ARG A 1 9  ? 2.029   12.372  3.836   1.00 0.00 ? 9  ARG A HB2  5 
ATOM   2969 H HB3  . ARG A 1 9  ? 1.270   13.628  2.870   1.00 0.00 ? 9  ARG A HB3  5 
ATOM   2970 H HG2  . ARG A 1 9  ? -0.032  13.214  4.781   1.00 0.00 ? 9  ARG A HG2  5 
ATOM   2971 H HG3  . ARG A 1 9  ? -0.922  12.848  3.301   1.00 0.00 ? 9  ARG A HG3  5 
ATOM   2972 H HD2  . ARG A 1 9  ? -0.611  10.456  3.641   1.00 0.00 ? 9  ARG A HD2  5 
ATOM   2973 H HD3  . ARG A 1 9  ? 0.392   10.722  5.070   1.00 0.00 ? 9  ARG A HD3  5 
ATOM   2974 H HE   . ARG A 1 9  ? -2.512  10.814  4.869   1.00 0.00 ? 9  ARG A HE   5 
ATOM   2975 H HH11 . ARG A 1 9  ? 0.251   11.941  6.828   1.00 0.00 ? 9  ARG A HH11 5 
ATOM   2976 H HH12 . ARG A 1 9  ? -0.756  12.351  8.196   1.00 0.00 ? 9  ARG A HH12 5 
ATOM   2977 H HH21 . ARG A 1 9  ? -3.784  11.412  6.664   1.00 0.00 ? 9  ARG A HH21 5 
ATOM   2978 H HH22 . ARG A 1 9  ? -3.030  12.045  8.107   1.00 0.00 ? 9  ARG A HH22 5 
ATOM   2979 N N    . ASN A 1 10 ? 3.119   12.815  1.155   1.00 0.00 ? 10 ASN A N    5 
ATOM   2980 C CA   . ASN A 1 10 ? 4.237   13.184  0.304   1.00 0.00 ? 10 ASN A CA   5 
ATOM   2981 C C    . ASN A 1 10 ? 5.528   12.443  0.706   1.00 0.00 ? 10 ASN A C    5 
ATOM   2982 O O    . ASN A 1 10 ? 6.520   12.509  -0.019  1.00 0.00 ? 10 ASN A O    5 
ATOM   2983 C CB   . ASN A 1 10 ? 4.445   14.697  0.447   1.00 0.00 ? 10 ASN A CB   5 
ATOM   2984 C CG   . ASN A 1 10 ? 3.306   15.509  -0.176  1.00 0.00 ? 10 ASN A CG   5 
ATOM   2985 O OD1  . ASN A 1 10 ? 2.502   16.105  0.539   1.00 0.00 ? 10 ASN A OD1  5 
ATOM   2986 N ND2  . ASN A 1 10 ? 3.228   15.528  -1.509  1.00 0.00 ? 10 ASN A ND2  5 
ATOM   2987 H H    . ASN A 1 10 ? 3.274   12.781  2.152   1.00 0.00 ? 10 ASN A H    5 
ATOM   2988 H HA   . ASN A 1 10 ? 4.017   12.930  -0.732  1.00 0.00 ? 10 ASN A HA   5 
ATOM   2989 H HB2  . ASN A 1 10 ? 4.532   14.951  1.505   1.00 0.00 ? 10 ASN A HB2  5 
ATOM   2990 H HB3  . ASN A 1 10 ? 5.393   14.965  -0.010  1.00 0.00 ? 10 ASN A HB3  5 
ATOM   2991 H HD21 . ASN A 1 10 ? 3.903   15.020  -2.062  1.00 0.00 ? 10 ASN A HD21 5 
ATOM   2992 H HD22 . ASN A 1 10 ? 2.489   16.046  -1.962  1.00 0.00 ? 10 ASN A HD22 5 
ATOM   2993 N N    . CYS A 1 11 ? 5.534   11.804  1.887   1.00 0.00 ? 11 CYS A N    5 
ATOM   2994 C CA   . CYS A 1 11 ? 6.710   11.564  2.728   1.00 0.00 ? 11 CYS A CA   5 
ATOM   2995 C C    . CYS A 1 11 ? 6.285   10.959  4.077   1.00 0.00 ? 11 CYS A C    5 
ATOM   2996 O O    . CYS A 1 11 ? 7.051   10.201  4.672   1.00 0.00 ? 11 CYS A O    5 
ATOM   2997 C CB   . CYS A 1 11 ? 7.462   12.894  2.956   1.00 0.00 ? 11 CYS A CB   5 
ATOM   2998 S SG   . CYS A 1 11 ? 8.884   12.915  4.087   1.00 0.00 ? 11 CYS A SG   5 
ATOM   2999 H H    . CYS A 1 11 ? 4.634   11.664  2.325   1.00 0.00 ? 11 CYS A H    5 
ATOM   3000 H HA   . CYS A 1 11 ? 7.368   10.860  2.217   1.00 0.00 ? 11 CYS A HA   5 
ATOM   3001 H HB2  . CYS A 1 11 ? 7.832   13.277  2.004   1.00 0.00 ? 11 CYS A HB2  5 
ATOM   3002 H HB3  . CYS A 1 11 ? 6.753   13.626  3.350   1.00 0.00 ? 11 CYS A HB3  5 
ATOM   3003 N N    . LYS A 1 12 ? 5.078   11.300  4.566   1.00 0.00 ? 12 LYS A N    5 
ATOM   3004 C CA   . LYS A 1 12 ? 4.559   10.881  5.860   1.00 0.00 ? 12 LYS A CA   5 
ATOM   3005 C C    . LYS A 1 12 ? 3.742   9.608   5.646   1.00 0.00 ? 12 LYS A C    5 
ATOM   3006 O O    . LYS A 1 12 ? 2.703   9.644   4.989   1.00 0.00 ? 12 LYS A O    5 
ATOM   3007 C CB   . LYS A 1 12 ? 3.693   11.987  6.497   1.00 0.00 ? 12 LYS A CB   5 
ATOM   3008 C CG   . LYS A 1 12 ? 4.429   13.319  6.718   1.00 0.00 ? 12 LYS A CG   5 
ATOM   3009 C CD   . LYS A 1 12 ? 5.524   13.215  7.792   1.00 0.00 ? 12 LYS A CD   5 
ATOM   3010 C CE   . LYS A 1 12 ? 6.141   14.584  8.115   1.00 0.00 ? 12 LYS A CE   5 
ATOM   3011 N NZ   . LYS A 1 12 ? 6.889   15.140  6.973   1.00 0.00 ? 12 LYS A NZ   5 
ATOM   3012 H H    . LYS A 1 12 ? 4.442   11.806  3.961   1.00 0.00 ? 12 LYS A H    5 
ATOM   3013 H HA   . LYS A 1 12 ? 5.383   10.678  6.547   1.00 0.00 ? 12 LYS A HA   5 
ATOM   3014 H HB2  . LYS A 1 12 ? 2.828   12.184  5.866   1.00 0.00 ? 12 LYS A HB2  5 
ATOM   3015 H HB3  . LYS A 1 12 ? 3.319   11.633  7.459   1.00 0.00 ? 12 LYS A HB3  5 
ATOM   3016 H HG2  . LYS A 1 12 ? 4.855   13.666  5.776   1.00 0.00 ? 12 LYS A HG2  5 
ATOM   3017 H HG3  . LYS A 1 12 ? 3.693   14.055  7.046   1.00 0.00 ? 12 LYS A HG3  5 
ATOM   3018 H HD2  . LYS A 1 12 ? 5.082   12.817  8.706   1.00 0.00 ? 12 LYS A HD2  5 
ATOM   3019 H HD3  . LYS A 1 12 ? 6.313   12.538  7.464   1.00 0.00 ? 12 LYS A HD3  5 
ATOM   3020 H HE2  . LYS A 1 12 ? 5.355   15.285  8.402   1.00 0.00 ? 12 LYS A HE2  5 
ATOM   3021 H HE3  . LYS A 1 12 ? 6.829   14.475  8.954   1.00 0.00 ? 12 LYS A HE3  5 
ATOM   3022 H HZ1  . LYS A 1 12 ? 6.266   15.268  6.189   1.00 0.00 ? 12 LYS A HZ1  5 
ATOM   3023 H HZ2  . LYS A 1 12 ? 7.287   16.031  7.235   1.00 0.00 ? 12 LYS A HZ2  5 
ATOM   3024 H HZ3  . LYS A 1 12 ? 7.630   14.504  6.716   1.00 0.00 ? 12 LYS A HZ3  5 
ATOM   3025 N N    . PHE A 1 13 ? 4.219   8.492   6.214   1.00 0.00 ? 13 PHE A N    5 
ATOM   3026 C CA   . PHE A 1 13 ? 3.559   7.189   6.208   1.00 0.00 ? 13 PHE A CA   5 
ATOM   3027 C C    . PHE A 1 13 ? 2.099   7.342   6.658   1.00 0.00 ? 13 PHE A C    5 
ATOM   3028 O O    . PHE A 1 13 ? 1.855   7.753   7.793   1.00 0.00 ? 13 PHE A O    5 
ATOM   3029 C CB   . PHE A 1 13 ? 4.330   6.192   7.089   1.00 0.00 ? 13 PHE A CB   5 
ATOM   3030 C CG   . PHE A 1 13 ? 5.813   6.054   6.779   1.00 0.00 ? 13 PHE A CG   5 
ATOM   3031 C CD1  . PHE A 1 13 ? 6.246   5.203   5.739   1.00 0.00 ? 13 PHE A CD1  5 
ATOM   3032 C CD2  . PHE A 1 13 ? 6.759   6.843   7.473   1.00 0.00 ? 13 PHE A CD2  5 
ATOM   3033 C CE1  . PHE A 1 13 ? 7.595   5.215   5.332   1.00 0.00 ? 13 PHE A CE1  5 
ATOM   3034 C CE2  . PHE A 1 13 ? 8.124   6.785   7.123   1.00 0.00 ? 13 PHE A CE2  5 
ATOM   3035 C CZ   . PHE A 1 13 ? 8.540   5.974   6.047   1.00 0.00 ? 13 PHE A CZ   5 
ATOM   3036 H H    . PHE A 1 13 ? 5.097   8.571   6.700   1.00 0.00 ? 13 PHE A H    5 
ATOM   3037 H HA   . PHE A 1 13 ? 3.590   6.794   5.195   1.00 0.00 ? 13 PHE A HA   5 
ATOM   3038 H HB2  . PHE A 1 13 ? 4.212   6.461   8.141   1.00 0.00 ? 13 PHE A HB2  5 
ATOM   3039 H HB3  . PHE A 1 13 ? 3.867   5.220   6.938   1.00 0.00 ? 13 PHE A HB3  5 
ATOM   3040 H HD1  . PHE A 1 13 ? 5.533   4.611   5.189   1.00 0.00 ? 13 PHE A HD1  5 
ATOM   3041 H HD2  . PHE A 1 13 ? 6.439   7.517   8.254   1.00 0.00 ? 13 PHE A HD2  5 
ATOM   3042 H HE1  . PHE A 1 13 ? 7.907   4.672   4.457   1.00 0.00 ? 13 PHE A HE1  5 
ATOM   3043 H HE2  . PHE A 1 13 ? 8.847   7.380   7.660   1.00 0.00 ? 13 PHE A HE2  5 
ATOM   3044 H HZ   . PHE A 1 13 ? 9.583   5.940   5.768   1.00 0.00 ? 13 PHE A HZ   5 
ATOM   3045 N N    . LEU A 1 14 ? 1.141   7.082   5.751   1.00 0.00 ? 14 LEU A N    5 
ATOM   3046 C CA   . LEU A 1 14 ? -0.266  7.430   5.925   1.00 0.00 ? 14 LEU A CA   5 
ATOM   3047 C C    . LEU A 1 14 ? -0.963  6.545   6.970   1.00 0.00 ? 14 LEU A C    5 
ATOM   3048 O O    . LEU A 1 14 ? -0.323  5.936   7.829   1.00 0.00 ? 14 LEU A O    5 
ATOM   3049 C CB   . LEU A 1 14 ? -0.966  7.504   4.541   1.00 0.00 ? 14 LEU A CB   5 
ATOM   3050 C CG   . LEU A 1 14 ? -1.127  6.244   3.671   1.00 0.00 ? 14 LEU A CG   5 
ATOM   3051 C CD1  . LEU A 1 14 ? -1.420  4.935   4.413   1.00 0.00 ? 14 LEU A CD1  5 
ATOM   3052 C CD2  . LEU A 1 14 ? -2.271  6.540   2.674   1.00 0.00 ? 14 LEU A CD2  5 
ATOM   3053 H H    . LEU A 1 14 ? 1.400   6.724   4.845   1.00 0.00 ? 14 LEU A H    5 
ATOM   3054 H HA   . LEU A 1 14 ? -0.310  8.445   6.325   1.00 0.00 ? 14 LEU A HA   5 
ATOM   3055 H HB2  . LEU A 1 14 ? -1.944  7.960   4.609   1.00 0.00 ? 14 LEU A HB2  5 
ATOM   3056 H HB3  . LEU A 1 14 ? -0.404  8.208   3.940   1.00 0.00 ? 14 LEU A HB3  5 
ATOM   3057 H HG   . LEU A 1 14 ? -0.183  6.116   3.148   1.00 0.00 ? 14 LEU A HG   5 
ATOM   3058 H HD11 . LEU A 1 14 ? -0.666  4.735   5.173   1.00 0.00 ? 14 LEU A HD11 5 
ATOM   3059 H HD12 . LEU A 1 14 ? -2.414  4.978   4.846   1.00 0.00 ? 14 LEU A HD12 5 
ATOM   3060 H HD13 . LEU A 1 14 ? -1.407  4.089   3.732   1.00 0.00 ? 14 LEU A HD13 5 
ATOM   3061 H HD21 . LEU A 1 14 ? -3.222  6.586   3.206   1.00 0.00 ? 14 LEU A HD21 5 
ATOM   3062 H HD22 . LEU A 1 14 ? -2.116  7.499   2.179   1.00 0.00 ? 14 LEU A HD22 5 
ATOM   3063 H HD23 . LEU A 1 14 ? -2.357  5.779   1.905   1.00 0.00 ? 14 LEU A HD23 5 
ATOM   3064 N N    . LYS A 1 15 ? -2.292  6.478   6.875   1.00 0.00 ? 15 LYS A N    5 
ATOM   3065 C CA   . LYS A 1 15 ? -3.153  5.638   7.701   1.00 0.00 ? 15 LYS A CA   5 
ATOM   3066 C C    . LYS A 1 15 ? -3.003  4.162   7.275   1.00 0.00 ? 15 LYS A C    5 
ATOM   3067 O O    . LYS A 1 15 ? -3.856  3.645   6.553   1.00 0.00 ? 15 LYS A O    5 
ATOM   3068 C CB   . LYS A 1 15 ? -4.618  6.118   7.622   1.00 0.00 ? 15 LYS A CB   5 
ATOM   3069 C CG   . LYS A 1 15 ? -4.890  7.499   8.251   1.00 0.00 ? 15 LYS A CG   5 
ATOM   3070 C CD   . LYS A 1 15 ? -4.369  8.724   7.473   1.00 0.00 ? 15 LYS A CD   5 
ATOM   3071 C CE   . LYS A 1 15 ? -4.863  8.815   6.019   1.00 0.00 ? 15 LYS A CE   5 
ATOM   3072 N NZ   . LYS A 1 15 ? -6.333  8.863   5.931   1.00 0.00 ? 15 LYS A NZ   5 
ATOM   3073 H H    . LYS A 1 15 ? -2.695  6.999   6.112   1.00 0.00 ? 15 LYS A H    5 
ATOM   3074 H HA   . LYS A 1 15 ? -2.839  5.739   8.740   1.00 0.00 ? 15 LYS A HA   5 
ATOM   3075 H HB2  . LYS A 1 15 ? -4.973  6.097   6.591   1.00 0.00 ? 15 LYS A HB2  5 
ATOM   3076 H HB3  . LYS A 1 15 ? -5.223  5.403   8.184   1.00 0.00 ? 15 LYS A HB3  5 
ATOM   3077 H HG2  . LYS A 1 15 ? -5.970  7.608   8.359   1.00 0.00 ? 15 LYS A HG2  5 
ATOM   3078 H HG3  . LYS A 1 15 ? -4.460  7.518   9.254   1.00 0.00 ? 15 LYS A HG3  5 
ATOM   3079 H HD2  . LYS A 1 15 ? -4.704  9.618   8.004   1.00 0.00 ? 15 LYS A HD2  5 
ATOM   3080 H HD3  . LYS A 1 15 ? -3.281  8.738   7.483   1.00 0.00 ? 15 LYS A HD3  5 
ATOM   3081 H HE2  . LYS A 1 15 ? -4.468  9.724   5.566   1.00 0.00 ? 15 LYS A HE2  5 
ATOM   3082 H HE3  . LYS A 1 15 ? -4.499  7.969   5.437   1.00 0.00 ? 15 LYS A HE3  5 
ATOM   3083 H HZ1  . LYS A 1 15 ? -6.724  8.016   6.317   1.00 0.00 ? 15 LYS A HZ1  5 
ATOM   3084 H HZ2  . LYS A 1 15 ? -6.675  9.659   6.450   1.00 0.00 ? 15 LYS A HZ2  5 
ATOM   3085 H HZ3  . LYS A 1 15 ? -6.610  8.950   4.963   1.00 0.00 ? 15 LYS A HZ3  5 
ATOM   3086 N N    . GLU A 1 16 ? -1.905  3.515   7.716   1.00 0.00 ? 16 GLU A N    5 
ATOM   3087 C CA   . GLU A 1 16 ? -1.473  2.134   7.466   1.00 0.00 ? 16 GLU A CA   5 
ATOM   3088 C C    . GLU A 1 16 ? -2.600  1.194   7.022   1.00 0.00 ? 16 GLU A C    5 
ATOM   3089 O O    . GLU A 1 16 ? -3.580  1.012   7.747   1.00 0.00 ? 16 GLU A O    5 
ATOM   3090 C CB   . GLU A 1 16 ? -0.778  1.601   8.736   1.00 0.00 ? 16 GLU A CB   5 
ATOM   3091 C CG   . GLU A 1 16 ? -0.254  0.163   8.581   1.00 0.00 ? 16 GLU A CG   5 
ATOM   3092 C CD   . GLU A 1 16 ? 0.508   -0.303  9.823   1.00 0.00 ? 16 GLU A CD   5 
ATOM   3093 O OE1  . GLU A 1 16 ? 1.668   0.136   9.981   1.00 0.00 ? 16 GLU A OE1  5 
ATOM   3094 O OE2  . GLU A 1 16 ? -0.081  -1.090  10.596  1.00 0.00 ? 16 GLU A OE2  5 
ATOM   3095 H H    . GLU A 1 16 ? -1.239  4.059   8.246   1.00 0.00 ? 16 GLU A H    5 
ATOM   3096 H HA   . GLU A 1 16 ? -0.728  2.191   6.666   1.00 0.00 ? 16 GLU A HA   5 
ATOM   3097 H HB2  . GLU A 1 16 ? 0.059   2.258   8.979   1.00 0.00 ? 16 GLU A HB2  5 
ATOM   3098 H HB3  . GLU A 1 16 ? -1.482  1.627   9.571   1.00 0.00 ? 16 GLU A HB3  5 
ATOM   3099 H HG2  . GLU A 1 16 ? -1.088  -0.516  8.397   1.00 0.00 ? 16 GLU A HG2  5 
ATOM   3100 H HG3  . GLU A 1 16 ? 0.413   0.110   7.722   1.00 0.00 ? 16 GLU A HG3  5 
ATOM   3101 N N    . GLY A 1 17 ? -2.445  0.601   5.830   1.00 0.00 ? 17 GLY A N    5 
ATOM   3102 C CA   . GLY A 1 17 ? -3.433  -0.257  5.201   1.00 0.00 ? 17 GLY A CA   5 
ATOM   3103 C C    . GLY A 1 17 ? -4.306  0.551   4.238   1.00 0.00 ? 17 GLY A C    5 
ATOM   3104 O O    . GLY A 1 17 ? -5.531  0.496   4.339   1.00 0.00 ? 17 GLY A O    5 
ATOM   3105 H H    . GLY A 1 17 ? -1.609  0.791   5.292   1.00 0.00 ? 17 GLY A H    5 
ATOM   3106 H HA2  . GLY A 1 17 ? -2.909  -1.041  4.660   1.00 0.00 ? 17 GLY A HA2  5 
ATOM   3107 H HA3  . GLY A 1 17 ? -4.055  -0.753  5.948   1.00 0.00 ? 17 GLY A HA3  5 
ATOM   3108 N N    . THR A 1 18 ? -3.679  1.283   3.297   1.00 0.00 ? 18 THR A N    5 
ATOM   3109 C CA   . THR A 1 18 ? -4.361  2.014   2.227   1.00 0.00 ? 18 THR A CA   5 
ATOM   3110 C C    . THR A 1 18 ? -3.757  1.677   0.858   1.00 0.00 ? 18 THR A C    5 
ATOM   3111 O O    . THR A 1 18 ? -2.630  2.069   0.571   1.00 0.00 ? 18 THR A O    5 
ATOM   3112 C CB   . THR A 1 18 ? -4.295  3.522   2.476   1.00 0.00 ? 18 THR A CB   5 
ATOM   3113 O OG1  . THR A 1 18 ? -4.935  3.870   3.690   1.00 0.00 ? 18 THR A OG1  5 
ATOM   3114 C CG2  . THR A 1 18 ? -4.918  4.303   1.311   1.00 0.00 ? 18 THR A CG2  5 
ATOM   3115 H H    . THR A 1 18 ? -2.668  1.323   3.320   1.00 0.00 ? 18 THR A H    5 
ATOM   3116 H HA   . THR A 1 18 ? -5.415  1.752   2.220   1.00 0.00 ? 18 THR A HA   5 
ATOM   3117 H HB   . THR A 1 18 ? -3.250  3.788   2.540   1.00 0.00 ? 18 THR A HB   5 
ATOM   3118 H HG1  . THR A 1 18 ? -4.470  3.448   4.418   1.00 0.00 ? 18 THR A HG1  5 
ATOM   3119 H HG21 . THR A 1 18 ? -5.940  3.964   1.136   1.00 0.00 ? 18 THR A HG21 5 
ATOM   3120 H HG22 . THR A 1 18 ? -4.339  4.183   0.394   1.00 0.00 ? 18 THR A HG22 5 
ATOM   3121 H HG23 . THR A 1 18 ? -4.940  5.365   1.553   1.00 0.00 ? 18 THR A HG23 5 
ATOM   3122 N N    . ILE A 1 19 ? -4.540  1.010   0.000   1.00 0.00 ? 19 ILE A N    5 
ATOM   3123 C CA   . ILE A 1 19 ? -4.180  0.526   -1.337  1.00 0.00 ? 19 ILE A CA   5 
ATOM   3124 C C    . ILE A 1 19 ? -3.496  1.616   -2.184  1.00 0.00 ? 19 ILE A C    5 
ATOM   3125 O O    . ILE A 1 19 ? -4.043  2.701   -2.374  1.00 0.00 ? 19 ILE A O    5 
ATOM   3126 C CB   . ILE A 1 19 ? -5.428  -0.035  -2.050  1.00 0.00 ? 19 ILE A CB   5 
ATOM   3127 C CG1  . ILE A 1 19 ? -6.070  -1.203  -1.279  1.00 0.00 ? 19 ILE A CG1  5 
ATOM   3128 C CG2  . ILE A 1 19 ? -5.176  -0.365  -3.529  1.00 0.00 ? 19 ILE A CG2  5 
ATOM   3129 C CD1  . ILE A 1 19 ? -7.443  -1.645  -1.810  1.00 0.00 ? 19 ILE A CD1  5 
ATOM   3130 H H    . ILE A 1 19 ? -5.476  0.819   0.323   1.00 0.00 ? 19 ILE A H    5 
ATOM   3131 H HA   . ILE A 1 19 ? -3.518  -0.329  -1.221  1.00 0.00 ? 19 ILE A HA   5 
ATOM   3132 H HB   . ILE A 1 19 ? -6.139  0.760   -2.043  1.00 0.00 ? 19 ILE A HB   5 
ATOM   3133 H HG12 . ILE A 1 19 ? -5.376  -2.040  -1.259  1.00 0.00 ? 19 ILE A HG12 5 
ATOM   3134 H HG13 . ILE A 1 19 ? -6.251  -0.883  -0.256  1.00 0.00 ? 19 ILE A HG13 5 
ATOM   3135 H HG21 . ILE A 1 19 ? -4.377  -1.094  -3.611  1.00 0.00 ? 19 ILE A HG21 5 
ATOM   3136 H HG22 . ILE A 1 19 ? -6.074  -0.752  -4.002  1.00 0.00 ? 19 ILE A HG22 5 
ATOM   3137 H HG23 . ILE A 1 19 ? -4.899  0.533   -4.078  1.00 0.00 ? 19 ILE A HG23 5 
ATOM   3138 H HD11 . ILE A 1 19 ? -8.150  -0.818  -1.746  1.00 0.00 ? 19 ILE A HD11 5 
ATOM   3139 H HD12 . ILE A 1 19 ? -7.397  -1.986  -2.841  1.00 0.00 ? 19 ILE A HD12 5 
ATOM   3140 H HD13 . ILE A 1 19 ? -7.807  -2.474  -1.203  1.00 0.00 ? 19 ILE A HD13 5 
ATOM   3141 N N    . CYS A 1 20 ? -2.320  1.276   -2.728  1.00 0.00 ? 20 CYS A N    5 
ATOM   3142 C CA   . CYS A 1 20 ? -1.614  2.011   -3.782  1.00 0.00 ? 20 CYS A CA   5 
ATOM   3143 C C    . CYS A 1 20 ? -2.370  1.885   -5.112  1.00 0.00 ? 20 CYS A C    5 
ATOM   3144 O O    . CYS A 1 20 ? -2.727  2.896   -5.717  1.00 0.00 ? 20 CYS A O    5 
ATOM   3145 C CB   . CYS A 1 20 ? -0.161  1.520   -3.918  1.00 0.00 ? 20 CYS A CB   5 
ATOM   3146 S SG   . CYS A 1 20 ? 0.843   2.330   -5.197  1.00 0.00 ? 20 CYS A SG   5 
ATOM   3147 H H    . CYS A 1 20 ? -1.961  0.375   -2.455  1.00 0.00 ? 20 CYS A H    5 
ATOM   3148 H HA   . CYS A 1 20 ? -1.565  3.056   -3.501  1.00 0.00 ? 20 CYS A HA   5 
ATOM   3149 H HB2  . CYS A 1 20 ? 0.363   1.632   -2.967  1.00 0.00 ? 20 CYS A HB2  5 
ATOM   3150 H HB3  . CYS A 1 20 ? -0.195  0.468   -4.179  1.00 0.00 ? 20 CYS A HB3  5 
ATOM   3151 N N    . LYS A 1 21 ? -2.601  0.639   -5.557  1.00 0.00 ? 21 LYS A N    5 
ATOM   3152 C CA   . LYS A 1 21 ? -3.302  0.293   -6.793  1.00 0.00 ? 21 LYS A CA   5 
ATOM   3153 C C    . LYS A 1 21 ? -4.220  -0.922  -6.583  1.00 0.00 ? 21 LYS A C    5 
ATOM   3154 O O    . LYS A 1 21 ? -3.825  -1.917  -5.974  1.00 0.00 ? 21 LYS A O    5 
ATOM   3155 C CB   . LYS A 1 21 ? -2.296  0.064   -7.928  1.00 0.00 ? 21 LYS A CB   5 
ATOM   3156 C CG   . LYS A 1 21 ? -3.020  -0.078  -9.275  1.00 0.00 ? 21 LYS A CG   5 
ATOM   3157 C CD   . LYS A 1 21 ? -2.015  -0.038  -10.431 1.00 0.00 ? 21 LYS A CD   5 
ATOM   3158 C CE   . LYS A 1 21 ? -2.709  -0.055  -11.801 1.00 0.00 ? 21 LYS A CE   5 
ATOM   3159 N NZ   . LYS A 1 21 ? -3.435  -1.315  -12.047 1.00 0.00 ? 21 LYS A NZ   5 
ATOM   3160 H H    . LYS A 1 21 ? -2.274  -0.116  -4.976  1.00 0.00 ? 21 LYS A H    5 
ATOM   3161 H HA   . LYS A 1 21 ? -3.911  1.146   -7.100  1.00 0.00 ? 21 LYS A HA   5 
ATOM   3162 H HB2  . LYS A 1 21 ? -1.640  0.935   -7.980  1.00 0.00 ? 21 LYS A HB2  5 
ATOM   3163 H HB3  . LYS A 1 21 ? -1.693  -0.823  -7.732  1.00 0.00 ? 21 LYS A HB3  5 
ATOM   3164 H HG2  . LYS A 1 21 ? -3.572  -1.019  -9.297  1.00 0.00 ? 21 LYS A HG2  5 
ATOM   3165 H HG3  . LYS A 1 21 ? -3.724  0.747   -9.399  1.00 0.00 ? 21 LYS A HG3  5 
ATOM   3166 H HD2  . LYS A 1 21 ? -1.433  0.883   -10.362 1.00 0.00 ? 21 LYS A HD2  5 
ATOM   3167 H HD3  . LYS A 1 21 ? -1.331  -0.884  -10.353 1.00 0.00 ? 21 LYS A HD3  5 
ATOM   3168 H HE2  . LYS A 1 21 ? -3.411  0.777   -11.870 1.00 0.00 ? 21 LYS A HE2  5 
ATOM   3169 H HE3  . LYS A 1 21 ? -1.957  0.063   -12.582 1.00 0.00 ? 21 LYS A HE3  5 
ATOM   3170 H HZ1  . LYS A 1 21 ? -3.860  -1.284  -12.963 1.00 0.00 ? 21 LYS A HZ1  5 
ATOM   3171 H HZ2  . LYS A 1 21 ? -2.790  -2.090  -12.002 1.00 0.00 ? 21 LYS A HZ2  5 
ATOM   3172 H HZ3  . LYS A 1 21 ? -4.154  -1.434  -11.348 1.00 0.00 ? 21 LYS A HZ3  5 
ATOM   3173 N N    . ARG A 1 22 ? -5.455  -0.812  -7.094  1.00 0.00 ? 22 ARG A N    5 
ATOM   3174 C CA   . ARG A 1 22 ? -6.577  -1.713  -6.872  1.00 0.00 ? 22 ARG A CA   5 
ATOM   3175 C C    . ARG A 1 22 ? -6.505  -2.899  -7.837  1.00 0.00 ? 22 ARG A C    5 
ATOM   3176 O O    . ARG A 1 22 ? -7.044  -2.866  -8.943  1.00 0.00 ? 22 ARG A O    5 
ATOM   3177 C CB   . ARG A 1 22 ? -7.884  -0.916  -7.002  1.00 0.00 ? 22 ARG A CB   5 
ATOM   3178 C CG   . ARG A 1 22 ? -9.174  -1.705  -6.714  1.00 0.00 ? 22 ARG A CG   5 
ATOM   3179 C CD   . ARG A 1 22 ? -9.272  -2.182  -5.257  1.00 0.00 ? 22 ARG A CD   5 
ATOM   3180 N NE   . ARG A 1 22 ? -10.626 -2.665  -4.942  1.00 0.00 ? 22 ARG A NE   5 
ATOM   3181 C CZ   . ARG A 1 22 ? -11.016 -3.236  -3.786  1.00 0.00 ? 22 ARG A CZ   5 
ATOM   3182 N NH1  . ARG A 1 22 ? -10.139 -3.519  -2.812  1.00 0.00 ? 22 ARG A NH1  5 
ATOM   3183 N NH2  . ARG A 1 22 ? -12.312 -3.525  -3.602  1.00 0.00 ? 22 ARG A NH2  5 
ATOM   3184 H H    . ARG A 1 22 ? -5.656  0.014   -7.628  1.00 0.00 ? 22 ARG A H    5 
ATOM   3185 H HA   . ARG A 1 22 ? -6.525  -2.071  -5.844  1.00 0.00 ? 22 ARG A HA   5 
ATOM   3186 H HB2  . ARG A 1 22 ? -7.837  -0.076  -6.308  1.00 0.00 ? 22 ARG A HB2  5 
ATOM   3187 H HB3  . ARG A 1 22 ? -7.940  -0.517  -8.014  1.00 0.00 ? 22 ARG A HB3  5 
ATOM   3188 H HG2  . ARG A 1 22 ? -10.013 -1.037  -6.917  1.00 0.00 ? 22 ARG A HG2  5 
ATOM   3189 H HG3  . ARG A 1 22 ? -9.255  -2.561  -7.385  1.00 0.00 ? 22 ARG A HG3  5 
ATOM   3190 H HD2  . ARG A 1 22 ? -8.552  -2.982  -5.092  1.00 0.00 ? 22 ARG A HD2  5 
ATOM   3191 H HD3  . ARG A 1 22 ? -9.042  -1.350  -4.591  1.00 0.00 ? 22 ARG A HD3  5 
ATOM   3192 H HE   . ARG A 1 22 ? -11.332 -2.496  -5.644  1.00 0.00 ? 22 ARG A HE   5 
ATOM   3193 H HH11 . ARG A 1 22 ? -9.154  -3.335  -2.944  1.00 0.00 ? 22 ARG A HH11 5 
ATOM   3194 H HH12 . ARG A 1 22 ? -10.456 -3.948  -1.955  1.00 0.00 ? 22 ARG A HH12 5 
ATOM   3195 H HH21 . ARG A 1 22 ? -12.986 -3.309  -4.323  1.00 0.00 ? 22 ARG A HH21 5 
ATOM   3196 H HH22 . ARG A 1 22 ? -12.619 -3.947  -2.738  1.00 0.00 ? 22 ARG A HH22 5 
ATOM   3197 N N    . ALA A 1 23 ? -5.845  -3.957  -7.364  1.00 0.00 ? 23 ALA A N    5 
ATOM   3198 C CA   . ALA A 1 23 ? -5.768  -5.278  -7.982  1.00 0.00 ? 23 ALA A CA   5 
ATOM   3199 C C    . ALA A 1 23 ? -7.113  -6.030  -7.904  1.00 0.00 ? 23 ALA A C    5 
ATOM   3200 O O    . ALA A 1 23 ? -8.115  -5.495  -7.424  1.00 0.00 ? 23 ALA A O    5 
ATOM   3201 C CB   . ALA A 1 23 ? -4.640  -6.070  -7.304  1.00 0.00 ? 23 ALA A CB   5 
ATOM   3202 H H    . ALA A 1 23 ? -5.423  -3.823  -6.460  1.00 0.00 ? 23 ALA A H    5 
ATOM   3203 H HA   . ALA A 1 23 ? -5.502  -5.141  -9.030  1.00 0.00 ? 23 ALA A HA   5 
ATOM   3204 H HB1  . ALA A 1 23 ? -3.708  -5.503  -7.333  1.00 0.00 ? 23 ALA A HB1  5 
ATOM   3205 H HB2  . ALA A 1 23 ? -4.909  -6.261  -6.269  1.00 0.00 ? 23 ALA A HB2  5 
ATOM   3206 H HB3  . ALA A 1 23 ? -4.481  -7.017  -7.819  1.00 0.00 ? 23 ALA A HB3  5 
ATOM   3207 N N    . ARG A 1 24 ? -7.135  -7.285  -8.381  1.00 0.00 ? 24 ARG A N    5 
ATOM   3208 C CA   . ARG A 1 24 ? -8.323  -8.137  -8.404  1.00 0.00 ? 24 ARG A CA   5 
ATOM   3209 C C    . ARG A 1 24 ? -8.633  -8.645  -6.988  1.00 0.00 ? 24 ARG A C    5 
ATOM   3210 O O    . ARG A 1 24 ? -7.738  -9.100  -6.275  1.00 0.00 ? 24 ARG A O    5 
ATOM   3211 C CB   . ARG A 1 24 ? -8.141  -9.330  -9.360  1.00 0.00 ? 24 ARG A CB   5 
ATOM   3212 C CG   . ARG A 1 24 ? -8.110  -8.979  -10.860 1.00 0.00 ? 24 ARG A CG   5 
ATOM   3213 C CD   . ARG A 1 24 ? -6.913  -8.130  -11.315 1.00 0.00 ? 24 ARG A CD   5 
ATOM   3214 N NE   . ARG A 1 24 ? -5.633  -8.719  -10.889 1.00 0.00 ? 24 ARG A NE   5 
ATOM   3215 C CZ   . ARG A 1 24 ? -4.463  -8.067  -10.762 1.00 0.00 ? 24 ARG A CZ   5 
ATOM   3216 N NH1  . ARG A 1 24 ? -4.345  -6.769  -11.084 1.00 0.00 ? 24 ARG A NH1  5 
ATOM   3217 N NH2  . ARG A 1 24 ? -3.392  -8.730  -10.304 1.00 0.00 ? 24 ARG A NH2  5 
ATOM   3218 H H    . ARG A 1 24 ? -6.281  -7.675  -8.752  1.00 0.00 ? 24 ARG A H    5 
ATOM   3219 H HA   . ARG A 1 24 ? -9.164  -7.545  -8.776  1.00 0.00 ? 24 ARG A HA   5 
ATOM   3220 H HB2  . ARG A 1 24 ? -7.245  -9.885  -9.083  1.00 0.00 ? 24 ARG A HB2  5 
ATOM   3221 H HB3  . ARG A 1 24 ? -8.990  -10.003 -9.221  1.00 0.00 ? 24 ARG A HB3  5 
ATOM   3222 H HG2  . ARG A 1 24 ? -8.087  -9.916  -11.420 1.00 0.00 ? 24 ARG A HG2  5 
ATOM   3223 H HG3  . ARG A 1 24 ? -9.032  -8.458  -11.124 1.00 0.00 ? 24 ARG A HG3  5 
ATOM   3224 H HD2  . ARG A 1 24 ? -6.921  -8.073  -12.404 1.00 0.00 ? 24 ARG A HD2  5 
ATOM   3225 H HD3  . ARG A 1 24 ? -7.025  -7.116  -10.930 1.00 0.00 ? 24 ARG A HD3  5 
ATOM   3226 H HE   . ARG A 1 24 ? -5.654  -9.699  -10.649 1.00 0.00 ? 24 ARG A HE   5 
ATOM   3227 H HH11 . ARG A 1 24 ? -5.142  -6.259  -11.435 1.00 0.00 ? 24 ARG A HH11 5 
ATOM   3228 H HH12 . ARG A 1 24 ? -3.456  -6.302  -10.979 1.00 0.00 ? 24 ARG A HH12 5 
ATOM   3229 H HH21 . ARG A 1 24 ? -3.468  -9.706  -10.059 1.00 0.00 ? 24 ARG A HH21 5 
ATOM   3230 H HH22 . ARG A 1 24 ? -2.507  -8.254  -10.206 1.00 0.00 ? 24 ARG A HH22 5 
ATOM   3231 N N    . GLY A 1 25 ? -9.914  -8.586  -6.602  1.00 0.00 ? 25 GLY A N    5 
ATOM   3232 C CA   . GLY A 1 25 ? -10.420 -9.075  -5.325  1.00 0.00 ? 25 GLY A CA   5 
ATOM   3233 C C    . GLY A 1 25 ? -10.036 -8.188  -4.134  1.00 0.00 ? 25 GLY A C    5 
ATOM   3234 O O    . GLY A 1 25 ? -9.437  -7.122  -4.288  1.00 0.00 ? 25 GLY A O    5 
ATOM   3235 H H    . GLY A 1 25 ? -10.588 -8.218  -7.257  1.00 0.00 ? 25 GLY A H    5 
ATOM   3236 H HA2  . GLY A 1 25 ? -11.508 -9.118  -5.391  1.00 0.00 ? 25 GLY A HA2  5 
ATOM   3237 H HA3  . GLY A 1 25 ? -10.050 -10.089 -5.158  1.00 0.00 ? 25 GLY A HA3  5 
ATOM   3238 N N    . ASP A 1 26 ? -10.396 -8.658  -2.931  1.00 0.00 ? 26 ASP A N    5 
ATOM   3239 C CA   . ASP A 1 26 ? -10.110 -8.021  -1.646  1.00 0.00 ? 26 ASP A CA   5 
ATOM   3240 C C    . ASP A 1 26 ? -8.614  -8.116  -1.291  1.00 0.00 ? 26 ASP A C    5 
ATOM   3241 O O    . ASP A 1 26 ? -8.060  -7.188  -0.702  1.00 0.00 ? 26 ASP A O    5 
ATOM   3242 C CB   . ASP A 1 26 ? -11.009 -8.652  -0.570  1.00 0.00 ? 26 ASP A CB   5 
ATOM   3243 C CG   . ASP A 1 26 ? -11.064 -7.830  0.719   1.00 0.00 ? 26 ASP A CG   5 
ATOM   3244 O OD1  . ASP A 1 26 ? -11.632 -6.718  0.659   1.00 0.00 ? 26 ASP A OD1  5 
ATOM   3245 O OD2  . ASP A 1 26 ? -10.557 -8.331  1.746   1.00 0.00 ? 26 ASP A OD2  5 
ATOM   3246 H H    . ASP A 1 26 ? -10.885 -9.542  -2.898  1.00 0.00 ? 26 ASP A H    5 
ATOM   3247 H HA   . ASP A 1 26 ? -10.390 -6.972  -1.729  1.00 0.00 ? 26 ASP A HA   5 
ATOM   3248 H HB2  . ASP A 1 26 ? -12.032 -8.729  -0.948  1.00 0.00 ? 26 ASP A HB2  5 
ATOM   3249 H HB3  . ASP A 1 26 ? -10.654 -9.659  -0.366  1.00 0.00 ? 26 ASP A HB3  5 
ATOM   3250 N N    . ASP A 1 27 ? -7.960  -9.222  -1.678  1.00 0.00 ? 27 ASP A N    5 
ATOM   3251 C CA   . ASP A 1 27 ? -6.524  -9.426  -1.689  1.00 0.00 ? 27 ASP A CA   5 
ATOM   3252 C C    . ASP A 1 27 ? -5.892  -8.768  -2.929  1.00 0.00 ? 27 ASP A C    5 
ATOM   3253 O O    . ASP A 1 27 ? -6.564  -8.090  -3.708  1.00 0.00 ? 27 ASP A O    5 
ATOM   3254 C CB   . ASP A 1 27 ? -6.262  -10.947 -1.641  1.00 0.00 ? 27 ASP A CB   5 
ATOM   3255 C CG   . ASP A 1 27 ? -6.690  -11.733 -2.891  1.00 0.00 ? 27 ASP A CG   5 
ATOM   3256 O OD1  . ASP A 1 27 ? -7.636  -11.287 -3.577  1.00 0.00 ? 27 ASP A OD1  5 
ATOM   3257 O OD2  . ASP A 1 27 ? -6.059  -12.784 -3.138  1.00 0.00 ? 27 ASP A OD2  5 
ATOM   3258 H H    . ASP A 1 27 ? -8.449  -9.956  -2.160  1.00 0.00 ? 27 ASP A H    5 
ATOM   3259 H HA   . ASP A 1 27 ? -6.087  -8.976  -0.796  1.00 0.00 ? 27 ASP A HA   5 
ATOM   3260 H HB2  . ASP A 1 27 ? -5.198  -11.097 -1.496  1.00 0.00 ? 27 ASP A HB2  5 
ATOM   3261 H HB3  . ASP A 1 27 ? -6.771  -11.380 -0.778  1.00 0.00 ? 27 ASP A HB3  5 
ATOM   3262 N N    . MET A 1 28 ? -4.579  -8.975  -3.088  1.00 0.00 ? 28 MET A N    5 
ATOM   3263 C CA   . MET A 1 28 ? -3.727  -8.529  -4.195  1.00 0.00 ? 28 MET A CA   5 
ATOM   3264 C C    . MET A 1 28 ? -3.372  -7.037  -4.158  1.00 0.00 ? 28 MET A C    5 
ATOM   3265 O O    . MET A 1 28 ? -2.288  -6.644  -4.587  1.00 0.00 ? 28 MET A O    5 
ATOM   3266 C CB   . MET A 1 28 ? -4.264  -8.965  -5.567  1.00 0.00 ? 28 MET A CB   5 
ATOM   3267 C CG   . MET A 1 28 ? -4.389  -10.486 -5.709  1.00 0.00 ? 28 MET A CG   5 
ATOM   3268 S SD   . MET A 1 28 ? -4.957  -11.027 -7.345  1.00 0.00 ? 28 MET A SD   5 
ATOM   3269 C CE   . MET A 1 28 ? -4.937  -12.822 -7.097  1.00 0.00 ? 28 MET A CE   5 
ATOM   3270 H H    . MET A 1 28 ? -4.139  -9.528  -2.373  1.00 0.00 ? 28 MET A H    5 
ATOM   3271 H HA   . MET A 1 28 ? -2.788  -9.041  -4.051  1.00 0.00 ? 28 MET A HA   5 
ATOM   3272 H HB2  . MET A 1 28 ? -5.229  -8.504  -5.770  1.00 0.00 ? 28 MET A HB2  5 
ATOM   3273 H HB3  . MET A 1 28 ? -3.559  -8.616  -6.320  1.00 0.00 ? 28 MET A HB3  5 
ATOM   3274 H HG2  . MET A 1 28 ? -3.418  -10.943 -5.518  1.00 0.00 ? 28 MET A HG2  5 
ATOM   3275 H HG3  . MET A 1 28 ? -5.098  -10.859 -4.973  1.00 0.00 ? 28 MET A HG3  5 
ATOM   3276 H HE1  . MET A 1 28 ? -5.613  -13.089 -6.285  1.00 0.00 ? 28 MET A HE1  5 
ATOM   3277 H HE2  . MET A 1 28 ? -5.262  -13.315 -8.013  1.00 0.00 ? 28 MET A HE2  5 
ATOM   3278 H HE3  . MET A 1 28 ? -3.926  -13.148 -6.852  1.00 0.00 ? 28 MET A HE3  5 
ATOM   3279 N N    . ASP A 1 29 ? -4.297  -6.220  -3.649  1.00 0.00 ? 29 ASP A N    5 
ATOM   3280 C CA   . ASP A 1 29 ? -4.205  -4.768  -3.511  1.00 0.00 ? 29 ASP A CA   5 
ATOM   3281 C C    . ASP A 1 29 ? -3.013  -4.376  -2.619  1.00 0.00 ? 29 ASP A C    5 
ATOM   3282 O O    . ASP A 1 29 ? -2.495  -5.219  -1.890  1.00 0.00 ? 29 ASP A O    5 
ATOM   3283 C CB   . ASP A 1 29 ? -5.526  -4.205  -2.966  1.00 0.00 ? 29 ASP A CB   5 
ATOM   3284 C CG   . ASP A 1 29 ? -6.795  -4.822  -3.565  1.00 0.00 ? 29 ASP A CG   5 
ATOM   3285 O OD1  . ASP A 1 29 ? -6.839  -4.962  -4.805  1.00 0.00 ? 29 ASP A OD1  5 
ATOM   3286 O OD2  . ASP A 1 29 ? -7.701  -5.150  -2.768  1.00 0.00 ? 29 ASP A OD2  5 
ATOM   3287 H H    . ASP A 1 29 ? -5.143  -6.674  -3.355  1.00 0.00 ? 29 ASP A H    5 
ATOM   3288 H HA   . ASP A 1 29 ? -4.047  -4.362  -4.513  1.00 0.00 ? 29 ASP A HA   5 
ATOM   3289 H HB2  . ASP A 1 29 ? -5.548  -4.340  -1.885  1.00 0.00 ? 29 ASP A HB2  5 
ATOM   3290 H HB3  . ASP A 1 29 ? -5.532  -3.142  -3.193  1.00 0.00 ? 29 ASP A HB3  5 
ATOM   3291 N N    . ASP A 1 30 ? -2.530  -3.127  -2.717  1.00 0.00 ? 30 ASP A N    5 
ATOM   3292 C CA   . ASP A 1 30 ? -1.097  -2.844  -2.573  1.00 0.00 ? 30 ASP A CA   5 
ATOM   3293 C C    . ASP A 1 30 ? -0.836  -1.693  -1.599  1.00 0.00 ? 30 ASP A C    5 
ATOM   3294 O O    . ASP A 1 30 ? -0.347  -0.627  -1.961  1.00 0.00 ? 30 ASP A O    5 
ATOM   3295 C CB   . ASP A 1 30 ? -0.511  -2.570  -3.960  1.00 0.00 ? 30 ASP A CB   5 
ATOM   3296 C CG   . ASP A 1 30 ? -0.568  -3.799  -4.874  1.00 0.00 ? 30 ASP A CG   5 
ATOM   3297 O OD1  . ASP A 1 30 ? 0.239   -4.724  -4.635  1.00 0.00 ? 30 ASP A OD1  5 
ATOM   3298 O OD2  . ASP A 1 30 ? -1.423  -3.797  -5.787  1.00 0.00 ? 30 ASP A OD2  5 
ATOM   3299 H H    . ASP A 1 30 ? -3.108  -2.397  -3.115  1.00 0.00 ? 30 ASP A H    5 
ATOM   3300 H HA   . ASP A 1 30 ? -0.564  -3.709  -2.168  1.00 0.00 ? 30 ASP A HA   5 
ATOM   3301 H HB2  . ASP A 1 30 ? -1.046  -1.736  -4.414  1.00 0.00 ? 30 ASP A HB2  5 
ATOM   3302 H HB3  . ASP A 1 30 ? 0.529   -2.280  -3.825  1.00 0.00 ? 30 ASP A HB3  5 
ATOM   3303 N N    . TYR A 1 31 ? -1.163  -1.945  -0.338  1.00 0.00 ? 31 TYR A N    5 
ATOM   3304 C CA   . TYR A 1 31 ? -1.319  -0.947  0.717   1.00 0.00 ? 31 TYR A CA   5 
ATOM   3305 C C    . TYR A 1 31 ? 0.005   -0.273  1.103   1.00 0.00 ? 31 TYR A C    5 
ATOM   3306 O O    . TYR A 1 31 ? 1.004   -0.961  1.312   1.00 0.00 ? 31 TYR A O    5 
ATOM   3307 C CB   . TYR A 1 31 ? -1.982  -1.571  1.961   1.00 0.00 ? 31 TYR A CB   5 
ATOM   3308 C CG   . TYR A 1 31 ? -3.173  -2.483  1.692   1.00 0.00 ? 31 TYR A CG   5 
ATOM   3309 C CD1  . TYR A 1 31 ? -2.956  -3.827  1.311   1.00 0.00 ? 31 TYR A CD1  5 
ATOM   3310 C CD2  . TYR A 1 31 ? -4.494  -1.985  1.753   1.00 0.00 ? 31 TYR A CD2  5 
ATOM   3311 C CE1  . TYR A 1 31 ? -4.032  -4.614  0.853   1.00 0.00 ? 31 TYR A CE1  5 
ATOM   3312 C CE2  . TYR A 1 31 ? -5.581  -2.816  1.418   1.00 0.00 ? 31 TYR A CE2  5 
ATOM   3313 C CZ   . TYR A 1 31 ? -5.342  -4.100  0.886   1.00 0.00 ? 31 TYR A CZ   5 
ATOM   3314 O OH   . TYR A 1 31 ? -6.383  -4.915  0.555   1.00 0.00 ? 31 TYR A OH   5 
ATOM   3315 H H    . TYR A 1 31 ? -1.493  -2.882  -0.191  1.00 0.00 ? 31 TYR A H    5 
ATOM   3316 H HA   . TYR A 1 31 ? -2.002  -0.192  0.332   1.00 0.00 ? 31 TYR A HA   5 
ATOM   3317 H HB2  . TYR A 1 31 ? -1.251  -2.119  2.559   1.00 0.00 ? 31 TYR A HB2  5 
ATOM   3318 H HB3  . TYR A 1 31 ? -2.300  -0.742  2.580   1.00 0.00 ? 31 TYR A HB3  5 
ATOM   3319 H HD1  . TYR A 1 31 ? -1.958  -4.241  1.302   1.00 0.00 ? 31 TYR A HD1  5 
ATOM   3320 H HD2  . TYR A 1 31 ? -4.683  -0.961  2.031   1.00 0.00 ? 31 TYR A HD2  5 
ATOM   3321 H HE1  . TYR A 1 31 ? -3.856  -5.626  0.518   1.00 0.00 ? 31 TYR A HE1  5 
ATOM   3322 H HE2  . TYR A 1 31 ? -6.592  -2.445  1.508   1.00 0.00 ? 31 TYR A HE2  5 
ATOM   3323 H HH   . TYR A 1 31 ? -7.246  -4.523  0.711   1.00 0.00 ? 31 TYR A HH   5 
ATOM   3324 N N    . CYS A 1 32 ? -0.014  1.062   1.281   1.00 0.00 ? 32 CYS A N    5 
ATOM   3325 C CA   . CYS A 1 32 ? 1.018   1.784   2.034   1.00 0.00 ? 32 CYS A CA   5 
ATOM   3326 C C    . CYS A 1 32 ? 0.997   1.261   3.462   1.00 0.00 ? 32 CYS A C    5 
ATOM   3327 O O    . CYS A 1 32 ? -0.063  0.970   4.028   1.00 0.00 ? 32 CYS A O    5 
ATOM   3328 C CB   . CYS A 1 32 ? 0.908   3.333   2.074   1.00 0.00 ? 32 CYS A CB   5 
ATOM   3329 S SG   . CYS A 1 32 ? -0.451  4.106   1.175   1.00 0.00 ? 32 CYS A SG   5 
ATOM   3330 H H    . CYS A 1 32 ? -0.886  1.530   1.106   1.00 0.00 ? 32 CYS A H    5 
ATOM   3331 H HA   . CYS A 1 32 ? 1.974   1.543   1.562   1.00 0.00 ? 32 CYS A HA   5 
ATOM   3332 H HB2  . CYS A 1 32 ? 0.857   3.724   3.094   1.00 0.00 ? 32 CYS A HB2  5 
ATOM   3333 H HB3  . CYS A 1 32 ? 1.827   3.774   1.680   1.00 0.00 ? 32 CYS A HB3  5 
ATOM   3334 N N    . ASN A 1 33 ? 2.202   1.179   4.015   1.00 0.00 ? 33 ASN A N    5 
ATOM   3335 C CA   . ASN A 1 33 ? 2.497   0.746   5.346   1.00 0.00 ? 33 ASN A CA   5 
ATOM   3336 C C    . ASN A 1 33 ? 3.073   1.965   6.055   1.00 0.00 ? 33 ASN A C    5 
ATOM   3337 O O    . ASN A 1 33 ? 4.002   2.613   5.580   1.00 0.00 ? 33 ASN A O    5 
ATOM   3338 C CB   . ASN A 1 33 ? 3.478   -0.431  5.294   1.00 0.00 ? 33 ASN A CB   5 
ATOM   3339 C CG   . ASN A 1 33 ? 2.878   -1.621  4.548   1.00 0.00 ? 33 ASN A CG   5 
ATOM   3340 O OD1  . ASN A 1 33 ? 1.762   -2.056  4.828   1.00 0.00 ? 33 ASN A OD1  5 
ATOM   3341 N ND2  . ASN A 1 33 ? 3.631   -2.134  3.583   1.00 0.00 ? 33 ASN A ND2  5 
ATOM   3342 H H    . ASN A 1 33 ? 2.998   1.528   3.508   1.00 0.00 ? 33 ASN A H    5 
ATOM   3343 H HA   . ASN A 1 33 ? 1.592   0.383   5.833   1.00 0.00 ? 33 ASN A HA   5 
ATOM   3344 H HB2  . ASN A 1 33 ? 4.400   -0.101  4.814   1.00 0.00 ? 33 ASN A HB2  5 
ATOM   3345 H HB3  . ASN A 1 33 ? 3.738   -0.781  6.288   1.00 0.00 ? 33 ASN A HB3  5 
ATOM   3346 H HD21 . ASN A 1 33 ? 4.543   -1.732  3.439   1.00 0.00 ? 33 ASN A HD21 5 
ATOM   3347 H HD22 . ASN A 1 33 ? 3.315   -2.922  3.045   1.00 0.00 ? 33 ASN A HD22 5 
ATOM   3348 N N    . GLY A 1 34 ? 2.509   2.234   7.224   1.00 0.00 ? 34 GLY A N    5 
ATOM   3349 C CA   . GLY A 1 34 ? 3.071   2.983   8.351   1.00 0.00 ? 34 GLY A CA   5 
ATOM   3350 C C    . GLY A 1 34 ? 4.616   2.962   8.462   1.00 0.00 ? 34 GLY A C    5 
ATOM   3351 O O    . GLY A 1 34 ? 5.191   3.878   9.050   1.00 0.00 ? 34 GLY A O    5 
ATOM   3352 H H    . GLY A 1 34 ? 1.626   1.772   7.306   1.00 0.00 ? 34 GLY A H    5 
ATOM   3353 H HA2  . GLY A 1 34 ? 2.696   4.005   8.316   1.00 0.00 ? 34 GLY A HA2  5 
ATOM   3354 H HA3  . GLY A 1 34 ? 2.680   2.533   9.262   1.00 0.00 ? 34 GLY A HA3  5 
ATOM   3355 N N    . LYS A 1 35 ? 5.278   1.928   7.910   1.00 0.00 ? 35 LYS A N    5 
ATOM   3356 C CA   . LYS A 1 35 ? 6.722   1.699   7.888   1.00 0.00 ? 35 LYS A CA   5 
ATOM   3357 C C    . LYS A 1 35 ? 7.355   1.977   6.513   1.00 0.00 ? 35 LYS A C    5 
ATOM   3358 O O    . LYS A 1 35 ? 8.502   2.422   6.466   1.00 0.00 ? 35 LYS A O    5 
ATOM   3359 C CB   . LYS A 1 35 ? 7.012   0.246   8.307   1.00 0.00 ? 35 LYS A CB   5 
ATOM   3360 C CG   . LYS A 1 35 ? 6.324   -0.183  9.614   1.00 0.00 ? 35 LYS A CG   5 
ATOM   3361 C CD   . LYS A 1 35 ? 6.707   0.718   10.796  1.00 0.00 ? 35 LYS A CD   5 
ATOM   3362 C CE   . LYS A 1 35 ? 6.017   0.292   12.101  1.00 0.00 ? 35 LYS A CE   5 
ATOM   3363 N NZ   . LYS A 1 35 ? 6.417   -1.057  12.538  1.00 0.00 ? 35 LYS A NZ   5 
ATOM   3364 H H    . LYS A 1 35 ? 4.730   1.236   7.420   1.00 0.00 ? 35 LYS A H    5 
ATOM   3365 H HA   . LYS A 1 35 ? 7.213   2.365   8.597   1.00 0.00 ? 35 LYS A HA   5 
ATOM   3366 H HB2  . LYS A 1 35 ? 6.674   -0.430  7.517   1.00 0.00 ? 35 LYS A HB2  5 
ATOM   3367 H HB3  . LYS A 1 35 ? 8.091   0.119   8.420   1.00 0.00 ? 35 LYS A HB3  5 
ATOM   3368 H HG2  . LYS A 1 35 ? 5.241   -0.172  9.486   1.00 0.00 ? 35 LYS A HG2  5 
ATOM   3369 H HG3  . LYS A 1 35 ? 6.627   -1.210  9.828   1.00 0.00 ? 35 LYS A HG3  5 
ATOM   3370 H HD2  . LYS A 1 35 ? 7.790   0.700   10.934  1.00 0.00 ? 35 LYS A HD2  5 
ATOM   3371 H HD3  . LYS A 1 35 ? 6.402   1.745   10.594  1.00 0.00 ? 35 LYS A HD3  5 
ATOM   3372 H HE2  . LYS A 1 35 ? 6.285   0.998   12.890  1.00 0.00 ? 35 LYS A HE2  5 
ATOM   3373 H HE3  . LYS A 1 35 ? 4.935   0.316   11.969  1.00 0.00 ? 35 LYS A HE3  5 
ATOM   3374 H HZ1  . LYS A 1 35 ? 5.959   -1.278  13.411  1.00 0.00 ? 35 LYS A HZ1  5 
ATOM   3375 H HZ2  . LYS A 1 35 ? 6.145   -1.734  11.839  1.00 0.00 ? 35 LYS A HZ2  5 
ATOM   3376 H HZ3  . LYS A 1 35 ? 7.418   -1.089  12.665  1.00 0.00 ? 35 LYS A HZ3  5 
ATOM   3377 N N    . THR A 1 36 ? 6.646   1.686   5.406   1.00 0.00 ? 36 THR A N    5 
ATOM   3378 C CA   . THR A 1 36 ? 7.179   1.777   4.036   1.00 0.00 ? 36 THR A CA   5 
ATOM   3379 C C    . THR A 1 36 ? 6.135   2.177   2.980   1.00 0.00 ? 36 THR A C    5 
ATOM   3380 O O    . THR A 1 36 ? 4.948   1.888   3.109   1.00 0.00 ? 36 THR A O    5 
ATOM   3381 C CB   . THR A 1 36 ? 7.933   0.493   3.642   1.00 0.00 ? 36 THR A CB   5 
ATOM   3382 O OG1  . THR A 1 36 ? 8.484   0.602   2.341   1.00 0.00 ? 36 THR A OG1  5 
ATOM   3383 C CG2  . THR A 1 36 ? 7.060   -0.767  3.712   1.00 0.00 ? 36 THR A CG2  5 
ATOM   3384 H H    . THR A 1 36 ? 5.690   1.375   5.545   1.00 0.00 ? 36 THR A H    5 
ATOM   3385 H HA   . THR A 1 36 ? 7.937   2.562   4.039   1.00 0.00 ? 36 THR A HA   5 
ATOM   3386 H HB   . THR A 1 36 ? 8.776   0.398   4.322   1.00 0.00 ? 36 THR A HB   5 
ATOM   3387 H HG1  . THR A 1 36 ? 9.011   1.403   2.294   1.00 0.00 ? 36 THR A HG1  5 
ATOM   3388 H HG21 . THR A 1 36 ? 6.681   -0.915  4.723   1.00 0.00 ? 36 THR A HG21 5 
ATOM   3389 H HG22 . THR A 1 36 ? 7.654   -1.643  3.438   1.00 0.00 ? 36 THR A HG22 5 
ATOM   3390 H HG23 . THR A 1 36 ? 6.225   -0.681  3.018   1.00 0.00 ? 36 THR A HG23 5 
ATOM   3391 N N    . CYS A 1 37 ? 6.623   2.827   1.909   1.00 0.00 ? 37 CYS A N    5 
ATOM   3392 C CA   . CYS A 1 37 ? 5.848   3.321   0.766   1.00 0.00 ? 37 CYS A CA   5 
ATOM   3393 C C    . CYS A 1 37 ? 6.605   3.094   -0.547  1.00 0.00 ? 37 CYS A C    5 
ATOM   3394 O O    . CYS A 1 37 ? 6.778   4.020   -1.338  1.00 0.00 ? 37 CYS A O    5 
ATOM   3395 C CB   . CYS A 1 37 ? 5.501   4.805   0.957   1.00 0.00 ? 37 CYS A CB   5 
ATOM   3396 S SG   . CYS A 1 37 ? 4.481   5.121   2.416   1.00 0.00 ? 37 CYS A SG   5 
ATOM   3397 H H    . CYS A 1 37 ? 7.629   2.937   1.883   1.00 0.00 ? 37 CYS A H    5 
ATOM   3398 H HA   . CYS A 1 37 ? 4.909   2.769   0.689   1.00 0.00 ? 37 CYS A HA   5 
ATOM   3399 H HB2  . CYS A 1 37 ? 6.427   5.380   1.034   1.00 0.00 ? 37 CYS A HB2  5 
ATOM   3400 H HB3  . CYS A 1 37 ? 4.951   5.185   0.094   1.00 0.00 ? 37 CYS A HB3  5 
ATOM   3401 N N    . ASP A 1 38 ? 7.016   1.843   -0.799  1.00 0.00 ? 38 ASP A N    5 
ATOM   3402 C CA   . ASP A 1 38 ? 7.541   1.400   -2.089  1.00 0.00 ? 38 ASP A CA   5 
ATOM   3403 C C    . ASP A 1 38 ? 6.385   0.831   -2.938  1.00 0.00 ? 38 ASP A C    5 
ATOM   3404 O O    . ASP A 1 38 ? 6.534   -0.223  -3.554  1.00 0.00 ? 38 ASP A O    5 
ATOM   3405 C CB   . ASP A 1 38 ? 8.672   0.384   -1.820  1.00 0.00 ? 38 ASP A CB   5 
ATOM   3406 C CG   . ASP A 1 38 ? 9.473   0.031   -3.077  1.00 0.00 ? 38 ASP A CG   5 
ATOM   3407 O OD1  . ASP A 1 38 ? 10.142  0.948   -3.602  1.00 0.00 ? 38 ASP A OD1  5 
ATOM   3408 O OD2  . ASP A 1 38 ? 9.408   -1.147  -3.491  1.00 0.00 ? 38 ASP A OD2  5 
ATOM   3409 H H    . ASP A 1 38 ? 6.868   1.138   -0.091  1.00 0.00 ? 38 ASP A H    5 
ATOM   3410 H HA   . ASP A 1 38 ? 7.969   2.247   -2.629  1.00 0.00 ? 38 ASP A HA   5 
ATOM   3411 H HB2  . ASP A 1 38 ? 9.370   0.809   -1.094  1.00 0.00 ? 38 ASP A HB2  5 
ATOM   3412 H HB3  . ASP A 1 38 ? 8.250   -0.520  -1.375  1.00 0.00 ? 38 ASP A HB3  5 
ATOM   3413 N N    . CYS A 1 39 ? 5.223   1.520   -2.937  1.00 0.00 ? 39 CYS A N    5 
ATOM   3414 C CA   . CYS A 1 39 ? 3.916   1.041   -3.402  1.00 0.00 ? 39 CYS A CA   5 
ATOM   3415 C C    . CYS A 1 39 ? 3.747   -0.451  -3.050  1.00 0.00 ? 39 CYS A C    5 
ATOM   3416 O O    . CYS A 1 39 ? 3.739   -1.291  -3.949  1.00 0.00 ? 39 CYS A O    5 
ATOM   3417 C CB   . CYS A 1 39 ? 3.783   1.364   -4.902  1.00 0.00 ? 39 CYS A CB   5 
ATOM   3418 S SG   . CYS A 1 39 ? 2.231   0.928   -5.745  1.00 0.00 ? 39 CYS A SG   5 
ATOM   3419 H H    . CYS A 1 39 ? 5.219   2.417   -2.478  1.00 0.00 ? 39 CYS A H    5 
ATOM   3420 H HA   . CYS A 1 39 ? 3.140   1.602   -2.877  1.00 0.00 ? 39 CYS A HA   5 
ATOM   3421 H HB2  . CYS A 1 39 ? 3.933   2.435   -5.047  1.00 0.00 ? 39 CYS A HB2  5 
ATOM   3422 H HB3  . CYS A 1 39 ? 4.590   0.852   -5.425  1.00 0.00 ? 39 CYS A HB3  5 
ATOM   3423 N N    . PRO A 1 40 ? 3.722   -0.795  -1.743  1.00 0.00 ? 40 PRO A N    5 
ATOM   3424 C CA   . PRO A 1 40 ? 4.126   -2.110  -1.249  1.00 0.00 ? 40 PRO A CA   5 
ATOM   3425 C C    . PRO A 1 40 ? 3.328   -3.281  -1.831  1.00 0.00 ? 40 PRO A C    5 
ATOM   3426 O O    . PRO A 1 40 ? 2.106   -3.208  -1.954  1.00 0.00 ? 40 PRO A O    5 
ATOM   3427 C CB   . PRO A 1 40 ? 4.007   -2.055  0.277   1.00 0.00 ? 40 PRO A CB   5 
ATOM   3428 C CG   . PRO A 1 40 ? 4.190   -0.569  0.585   1.00 0.00 ? 40 PRO A CG   5 
ATOM   3429 C CD   . PRO A 1 40 ? 3.549   0.121   -0.620  1.00 0.00 ? 40 PRO A CD   5 
ATOM   3430 H HA   . PRO A 1 40 ? 5.186   -2.218  -1.497  1.00 0.00 ? 40 PRO A HA   5 
ATOM   3431 H HB2  . PRO A 1 40 ? 3.013   -2.377  0.588   1.00 0.00 ? 40 PRO A HB2  5 
ATOM   3432 H HB3  . PRO A 1 40 ? 4.759   -2.675  0.767   1.00 0.00 ? 40 PRO A HB3  5 
ATOM   3433 H HG2  . PRO A 1 40 ? 3.727   -0.272  1.527   1.00 0.00 ? 40 PRO A HG2  5 
ATOM   3434 H HG3  . PRO A 1 40 ? 5.258   -0.339  0.610   1.00 0.00 ? 40 PRO A HG3  5 
ATOM   3435 H HD2  . PRO A 1 40 ? 2.480   0.258   -0.469  1.00 0.00 ? 40 PRO A HD2  5 
ATOM   3436 H HD3  . PRO A 1 40 ? 4.007   1.099   -0.742  1.00 0.00 ? 40 PRO A HD3  5 
ATOM   3437 N N    . ARG A 1 41 ? 4.040   -4.365  -2.170  1.00 0.00 ? 41 ARG A N    5 
ATOM   3438 C CA   . ARG A 1 41 ? 3.483   -5.595  -2.721  1.00 0.00 ? 41 ARG A CA   5 
ATOM   3439 C C    . ARG A 1 41 ? 2.824   -6.420  -1.605  1.00 0.00 ? 41 ARG A C    5 
ATOM   3440 O O    . ARG A 1 41 ? 3.340   -6.497  -0.489  1.00 0.00 ? 41 ARG A O    5 
ATOM   3441 C CB   . ARG A 1 41 ? 4.588   -6.380  -3.454  1.00 0.00 ? 41 ARG A CB   5 
ATOM   3442 C CG   . ARG A 1 41 ? 4.032   -7.598  -4.208  1.00 0.00 ? 41 ARG A CG   5 
ATOM   3443 C CD   . ARG A 1 41 ? 5.136   -8.316  -4.995  1.00 0.00 ? 41 ARG A CD   5 
ATOM   3444 N NE   . ARG A 1 41 ? 4.620   -9.523  -5.660  1.00 0.00 ? 41 ARG A NE   5 
ATOM   3445 C CZ   . ARG A 1 41 ? 5.343   -10.374 -6.411  1.00 0.00 ? 41 ARG A CZ   5 
ATOM   3446 N NH1  . ARG A 1 41 ? 6.649   -10.166 -6.639  1.00 0.00 ? 41 ARG A NH1  5 
ATOM   3447 N NH2  . ARG A 1 41 ? 4.748   -11.451 -6.942  1.00 0.00 ? 41 ARG A NH2  5 
ATOM   3448 H H    . ARG A 1 41 ? 5.036   -4.344  -2.000  1.00 0.00 ? 41 ARG A H    5 
ATOM   3449 H HA   . ARG A 1 41 ? 2.735   -5.315  -3.468  1.00 0.00 ? 41 ARG A HA   5 
ATOM   3450 H HB2  . ARG A 1 41 ? 5.065   -5.719  -4.180  1.00 0.00 ? 41 ARG A HB2  5 
ATOM   3451 H HB3  . ARG A 1 41 ? 5.343   -6.708  -2.738  1.00 0.00 ? 41 ARG A HB3  5 
ATOM   3452 H HG2  . ARG A 1 41 ? 3.600   -8.301  -3.496  1.00 0.00 ? 41 ARG A HG2  5 
ATOM   3453 H HG3  . ARG A 1 41 ? 3.251   -7.275  -4.898  1.00 0.00 ? 41 ARG A HG3  5 
ATOM   3454 H HD2  . ARG A 1 41 ? 5.542   -7.636  -5.747  1.00 0.00 ? 41 ARG A HD2  5 
ATOM   3455 H HD3  . ARG A 1 41 ? 5.936   -8.603  -4.309  1.00 0.00 ? 41 ARG A HD3  5 
ATOM   3456 H HE   . ARG A 1 41 ? 3.639   -9.724  -5.525  1.00 0.00 ? 41 ARG A HE   5 
ATOM   3457 H HH11 . ARG A 1 41 ? 7.110   -9.357  -6.247  1.00 0.00 ? 41 ARG A HH11 5 
ATOM   3458 H HH12 . ARG A 1 41 ? 7.174   -10.817 -7.205  1.00 0.00 ? 41 ARG A HH12 5 
ATOM   3459 H HH21 . ARG A 1 41 ? 3.765   -11.619 -6.777  1.00 0.00 ? 41 ARG A HH21 5 
ATOM   3460 H HH22 . ARG A 1 41 ? 5.281   -12.098 -7.506  1.00 0.00 ? 41 ARG A HH22 5 
ATOM   3461 N N    . ASN A 1 42 ? 1.670   -7.022  -1.917  1.00 0.00 ? 42 ASN A N    5 
ATOM   3462 C CA   . ASN A 1 42 ? 0.818   -7.762  -0.995  1.00 0.00 ? 42 ASN A CA   5 
ATOM   3463 C C    . ASN A 1 42 ? 0.010   -8.759  -1.839  1.00 0.00 ? 42 ASN A C    5 
ATOM   3464 O O    . ASN A 1 42 ? -1.050  -8.403  -2.352  1.00 0.00 ? 42 ASN A O    5 
ATOM   3465 C CB   . ASN A 1 42 ? -0.060  -6.763  -0.214  1.00 0.00 ? 42 ASN A CB   5 
ATOM   3466 C CG   . ASN A 1 42 ? -1.137  -7.403  0.668   1.00 0.00 ? 42 ASN A CG   5 
ATOM   3467 O OD1  . ASN A 1 42 ? -0.972  -7.487  1.882   1.00 0.00 ? 42 ASN A OD1  5 
ATOM   3468 N ND2  . ASN A 1 42 ? -2.254  -7.822  0.068   1.00 0.00 ? 42 ASN A ND2  5 
ATOM   3469 H H    . ASN A 1 42 ? 1.333   -6.937  -2.865  1.00 0.00 ? 42 ASN A H    5 
ATOM   3470 H HA   . ASN A 1 42 ? 1.420   -8.298  -0.258  1.00 0.00 ? 42 ASN A HA   5 
ATOM   3471 H HB2  . ASN A 1 42 ? 0.572   -6.166  0.438   1.00 0.00 ? 42 ASN A HB2  5 
ATOM   3472 H HB3  . ASN A 1 42 ? -0.520  -6.080  -0.919  1.00 0.00 ? 42 ASN A HB3  5 
ATOM   3473 H HD21 . ASN A 1 42 ? -2.351  -7.727  -0.934  1.00 0.00 ? 42 ASN A HD21 5 
ATOM   3474 H HD22 . ASN A 1 42 ? -2.989  -8.245  0.609   1.00 0.00 ? 42 ASN A HD22 5 
ATOM   3475 N N    . PRO A 1 43 ? 0.504   -10.000 -2.010  1.00 0.00 ? 43 PRO A N    5 
ATOM   3476 C CA   . PRO A 1 43 ? -0.201  -11.094 -2.671  1.00 0.00 ? 43 PRO A CA   5 
ATOM   3477 C C    . PRO A 1 43 ? -1.570  -11.378 -2.044  1.00 0.00 ? 43 PRO A C    5 
ATOM   3478 O O    . PRO A 1 43 ? -2.607  -11.229 -2.688  1.00 0.00 ? 43 PRO A O    5 
ATOM   3479 C CB   . PRO A 1 43 ? 0.754   -12.300 -2.625  1.00 0.00 ? 43 PRO A CB   5 
ATOM   3480 C CG   . PRO A 1 43 ? 2.133   -11.649 -2.520  1.00 0.00 ? 43 PRO A CG   5 
ATOM   3481 C CD   . PRO A 1 43 ? 1.859   -10.404 -1.675  1.00 0.00 ? 43 PRO A CD   5 
ATOM   3482 H HA   . PRO A 1 43 ? -0.350  -10.798 -3.698  1.00 0.00 ? 43 PRO A HA   5 
ATOM   3483 H HB2  . PRO A 1 43 ? 0.601   -12.904 -1.729  1.00 0.00 ? 43 PRO A HB2  5 
ATOM   3484 H HB3  . PRO A 1 43 ? 0.663   -12.934 -3.509  1.00 0.00 ? 43 PRO A HB3  5 
ATOM   3485 H HG2  . PRO A 1 43 ? 2.874   -12.307 -2.062  1.00 0.00 ? 43 PRO A HG2  5 
ATOM   3486 H HG3  . PRO A 1 43 ? 2.469   -11.348 -3.515  1.00 0.00 ? 43 PRO A HG3  5 
ATOM   3487 H HD2  . PRO A 1 43 ? 1.888   -10.633 -0.613  1.00 0.00 ? 43 PRO A HD2  5 
ATOM   3488 H HD3  . PRO A 1 43 ? 2.600   -9.638  -1.898  1.00 0.00 ? 43 PRO A HD3  5 
ATOM   3489 N N    . HIS A 1 44 ? -1.547  -11.773 -0.770  1.00 0.00 ? 44 HIS A N    5 
ATOM   3490 C CA   . HIS A 1 44 ? -2.702  -11.996 0.096   1.00 0.00 ? 44 HIS A CA   5 
ATOM   3491 C C    . HIS A 1 44 ? -2.301  -11.858 1.573   1.00 0.00 ? 44 HIS A C    5 
ATOM   3492 O O    . HIS A 1 44 ? -2.889  -12.488 2.452   1.00 0.00 ? 44 HIS A O    5 
ATOM   3493 C CB   . HIS A 1 44 ? -3.337  -13.355 -0.222  1.00 0.00 ? 44 HIS A CB   5 
ATOM   3494 C CG   . HIS A 1 44 ? -2.333  -14.471 -0.354  1.00 0.00 ? 44 HIS A CG   5 
ATOM   3495 N ND1  . HIS A 1 44 ? -1.560  -14.984 0.662   1.00 0.00 ? 44 HIS A ND1  5 
ATOM   3496 C CD2  . HIS A 1 44 ? -1.739  -14.816 -1.535  1.00 0.00 ? 44 HIS A CD2  5 
ATOM   3497 C CE1  . HIS A 1 44 ? -0.536  -15.643 0.093   1.00 0.00 ? 44 HIS A CE1  5 
ATOM   3498 N NE2  . HIS A 1 44 ? -0.601  -15.571 -1.247  1.00 0.00 ? 44 HIS A NE2  5 
ATOM   3499 H H    . HIS A 1 44 ? -0.642  -11.942 -0.363  1.00 0.00 ? 44 HIS A H    5 
ATOM   3500 H HA   . HIS A 1 44 ? -3.439  -11.227 -0.115  1.00 0.00 ? 44 HIS A HA   5 
ATOM   3501 H HB2  . HIS A 1 44 ? -4.067  -13.609 0.541   1.00 0.00 ? 44 HIS A HB2  5 
ATOM   3502 H HB3  . HIS A 1 44 ? -3.865  -13.249 -1.167  1.00 0.00 ? 44 HIS A HB3  5 
ATOM   3503 H HD1  . HIS A 1 44 ? -1.686  -14.814 1.650   1.00 0.00 ? 44 HIS A HD1  5 
ATOM   3504 H HD2  . HIS A 1 44 ? -2.014  -14.392 -2.490  1.00 0.00 ? 44 HIS A HD2  5 
ATOM   3505 H HE1  . HIS A 1 44 ? 0.267   -16.109 0.641   1.00 0.00 ? 44 HIS A HE1  5 
ATOM   3506 N N    . LYS A 1 45 ? -1.293  -11.016 1.835   1.00 0.00 ? 45 LYS A N    5 
ATOM   3507 C CA   . LYS A 1 45 ? -0.706  -10.783 3.153   1.00 0.00 ? 45 LYS A CA   5 
ATOM   3508 C C    . LYS A 1 45 ? -1.521  -9.815  4.034   1.00 0.00 ? 45 LYS A C    5 
ATOM   3509 O O    . LYS A 1 45 ? -1.146  -9.591  5.186   1.00 0.00 ? 45 LYS A O    5 
ATOM   3510 C CB   . LYS A 1 45 ? 0.750   -10.306 2.989   1.00 0.00 ? 45 LYS A CB   5 
ATOM   3511 C CG   . LYS A 1 45 ? 1.641   -11.379 2.338   1.00 0.00 ? 45 LYS A CG   5 
ATOM   3512 C CD   . LYS A 1 45 ? 3.066   -10.847 2.126   1.00 0.00 ? 45 LYS A CD   5 
ATOM   3513 C CE   . LYS A 1 45 ? 3.953   -11.901 1.447   1.00 0.00 ? 45 LYS A CE   5 
ATOM   3514 N NZ   . LYS A 1 45 ? 5.305   -11.382 1.183   1.00 0.00 ? 45 LYS A NZ   5 
ATOM   3515 H H    . LYS A 1 45 ? -0.872  -10.577 1.027   1.00 0.00 ? 45 LYS A H    5 
ATOM   3516 H HA   . LYS A 1 45 ? -0.679  -11.736 3.677   1.00 0.00 ? 45 LYS A HA   5 
ATOM   3517 H HB2  . LYS A 1 45 ? 0.774   -9.400  2.382   1.00 0.00 ? 45 LYS A HB2  5 
ATOM   3518 H HB3  . LYS A 1 45 ? 1.170   -10.072 3.969   1.00 0.00 ? 45 LYS A HB3  5 
ATOM   3519 H HG2  . LYS A 1 45 ? 1.676   -12.259 2.983   1.00 0.00 ? 45 LYS A HG2  5 
ATOM   3520 H HG3  . LYS A 1 45 ? 1.223   -11.673 1.375   1.00 0.00 ? 45 LYS A HG3  5 
ATOM   3521 H HD2  . LYS A 1 45 ? 3.025   -9.953  1.501   1.00 0.00 ? 45 LYS A HD2  5 
ATOM   3522 H HD3  . LYS A 1 45 ? 3.499   -10.578 3.091   1.00 0.00 ? 45 LYS A HD3  5 
ATOM   3523 H HE2  . LYS A 1 45 ? 4.033   -12.778 2.088   1.00 0.00 ? 45 LYS A HE2  5 
ATOM   3524 H HE3  . LYS A 1 45 ? 3.508   -12.200 0.497   1.00 0.00 ? 45 LYS A HE3  5 
ATOM   3525 H HZ1  . LYS A 1 45 ? 5.244   -10.574 0.578   1.00 0.00 ? 45 LYS A HZ1  5 
ATOM   3526 H HZ2  . LYS A 1 45 ? 5.741   -11.116 2.054   1.00 0.00 ? 45 LYS A HZ2  5 
ATOM   3527 H HZ3  . LYS A 1 45 ? 5.860   -12.096 0.734   1.00 0.00 ? 45 LYS A HZ3  5 
ATOM   3528 N N    . GLY A 1 46 ? -2.624  -9.248  3.520   1.00 0.00 ? 46 GLY A N    5 
ATOM   3529 C CA   . GLY A 1 46 ? -3.459  -8.286  4.226   1.00 0.00 ? 46 GLY A CA   5 
ATOM   3530 C C    . GLY A 1 46 ? -4.688  -7.923  3.385   1.00 0.00 ? 46 GLY A C    5 
ATOM   3531 O O    . GLY A 1 46 ? -4.749  -6.810  2.862   1.00 0.00 ? 46 GLY A O    5 
ATOM   3532 H H    . GLY A 1 46 ? -2.880  -9.478  2.572   1.00 0.00 ? 46 GLY A H    5 
ATOM   3533 H HA2  . GLY A 1 46 ? -3.766  -8.683  5.195   1.00 0.00 ? 46 GLY A HA2  5 
ATOM   3534 H HA3  . GLY A 1 46 ? -2.867  -7.386  4.407   1.00 0.00 ? 46 GLY A HA3  5 
ATOM   3535 N N    . PRO A 1 47 ? -5.669  -8.835  3.244   1.00 0.00 ? 47 PRO A N    5 
ATOM   3536 C CA   . PRO A 1 47 ? -6.858  -8.634  2.420   1.00 0.00 ? 47 PRO A CA   5 
ATOM   3537 C C    . PRO A 1 47 ? -7.818  -7.635  3.087   1.00 0.00 ? 47 PRO A C    5 
ATOM   3538 O O    . PRO A 1 47 ? -8.235  -7.846  4.226   1.00 0.00 ? 47 PRO A O    5 
ATOM   3539 C CB   . PRO A 1 47 ? -7.479  -10.030 2.271   1.00 0.00 ? 47 PRO A CB   5 
ATOM   3540 C CG   . PRO A 1 47 ? -7.073  -10.739 3.564   1.00 0.00 ? 47 PRO A CG   5 
ATOM   3541 C CD   . PRO A 1 47 ? -5.679  -10.165 3.839   1.00 0.00 ? 47 PRO A CD   5 
ATOM   3542 H HA   . PRO A 1 47 ? -6.567  -8.274  1.431   1.00 0.00 ? 47 PRO A HA   5 
ATOM   3543 H HB2  . PRO A 1 47 ? -8.559  -10.016 2.129   1.00 0.00 ? 47 PRO A HB2  5 
ATOM   3544 H HB3  . PRO A 1 47 ? -7.010  -10.544 1.432   1.00 0.00 ? 47 PRO A HB3  5 
ATOM   3545 H HG2  . PRO A 1 47 ? -7.754  -10.458 4.369   1.00 0.00 ? 47 PRO A HG2  5 
ATOM   3546 H HG3  . PRO A 1 47 ? -7.060  -11.825 3.457   1.00 0.00 ? 47 PRO A HG3  5 
ATOM   3547 H HD2  . PRO A 1 47 ? -5.495  -10.144 4.914   1.00 0.00 ? 47 PRO A HD2  5 
ATOM   3548 H HD3  . PRO A 1 47 ? -4.929  -10.786 3.347   1.00 0.00 ? 47 PRO A HD3  5 
ATOM   3549 N N    . ALA A 1 48 ? -8.161  -6.548  2.376   1.00 0.00 ? 48 ALA A N    5 
ATOM   3550 C CA   . ALA A 1 48 ? -9.041  -5.484  2.859   1.00 0.00 ? 48 ALA A CA   5 
ATOM   3551 C C    . ALA A 1 48 ? -9.629  -4.666  1.697   1.00 0.00 ? 48 ALA A C    5 
ATOM   3552 O O    . ALA A 1 48 ? -9.181  -4.768  0.554   1.00 0.00 ? 48 ALA A O    5 
ATOM   3553 C CB   . ALA A 1 48 ? -8.269  -4.577  3.830   1.00 0.00 ? 48 ALA A CB   5 
ATOM   3554 H H    . ALA A 1 48 ? -7.784  -6.441  1.443   1.00 0.00 ? 48 ALA A H    5 
ATOM   3555 H HA   . ALA A 1 48 ? -9.875  -5.939  3.399   1.00 0.00 ? 48 ALA A HA   5 
ATOM   3556 H HB1  . ALA A 1 48 ? -8.926  -3.798  4.221   1.00 0.00 ? 48 ALA A HB1  5 
ATOM   3557 H HB2  . ALA A 1 48 ? -7.888  -5.156  4.672   1.00 0.00 ? 48 ALA A HB2  5 
ATOM   3558 H HB3  . ALA A 1 48 ? -7.427  -4.105  3.321   1.00 0.00 ? 48 ALA A HB3  5 
ATOM   3559 N N    . THR A 1 49 ? -10.640 -3.838  2.005   1.00 0.00 ? 49 THR A N    5 
ATOM   3560 C CA   . THR A 1 49 ? -11.265 -2.901  1.073   1.00 0.00 ? 49 THR A CA   5 
ATOM   3561 C C    . THR A 1 49 ? -10.640 -1.516  1.305   1.00 0.00 ? 49 THR A C    5 
ATOM   3562 O O    . THR A 1 49 ? -11.255 -0.627  1.892   1.00 0.00 ? 49 THR A O    5 
ATOM   3563 C CB   . THR A 1 49 ? -12.800 -2.923  1.244   1.00 0.00 ? 49 THR A CB   5 
ATOM   3564 O OG1  . THR A 1 49 ? -13.286 -4.250  1.150   1.00 0.00 ? 49 THR A OG1  5 
ATOM   3565 C CG2  . THR A 1 49 ? -13.508 -2.079  0.172   1.00 0.00 ? 49 THR A CG2  5 
ATOM   3566 H H    . THR A 1 49 ? -10.963 -3.815  2.962   1.00 0.00 ? 49 THR A H    5 
ATOM   3567 H HA   . THR A 1 49 ? -11.059 -3.199  0.043   1.00 0.00 ? 49 THR A HA   5 
ATOM   3568 H HB   . THR A 1 49 ? -13.070 -2.544  2.233   1.00 0.00 ? 49 THR A HB   5 
ATOM   3569 H HG1  . THR A 1 49 ? -13.013 -4.618  0.306   1.00 0.00 ? 49 THR A HG1  5 
ATOM   3570 H HG21 . THR A 1 49 ? -13.211 -1.033  0.240   1.00 0.00 ? 49 THR A HG21 5 
ATOM   3571 H HG22 . THR A 1 49 ? -14.589 -2.137  0.311   1.00 0.00 ? 49 THR A HG22 5 
ATOM   3572 H HG23 . THR A 1 49 ? -13.262 -2.451  -0.823  1.00 0.00 ? 49 THR A HG23 5 
HETATM 3573 N N    . NH2 A 1 50 ? -9.373  -1.353  0.911   1.00 0.00 ? 50 NH2 A N    5 
HETATM 3574 H HN1  . NH2 A 1 50 ? -8.902  -0.473  1.066   1.00 0.00 ? 50 NH2 A HN1  5 
HETATM 3575 H HN2  . NH2 A 1 50 ? -8.881  -2.123  0.480   1.00 0.00 ? 50 NH2 A HN2  5 
ATOM   3576 N N    . GLU A 1 1  ? 16.527  14.927  0.908   1.00 0.00 ? 1  GLU A N    6 
ATOM   3577 C CA   . GLU A 1 1  ? 15.482  14.125  0.235   1.00 0.00 ? 1  GLU A CA   6 
ATOM   3578 C C    . GLU A 1 1  ? 14.634  13.340  1.255   1.00 0.00 ? 1  GLU A C    6 
ATOM   3579 O O    . GLU A 1 1  ? 15.047  13.150  2.400   1.00 0.00 ? 1  GLU A O    6 
ATOM   3580 C CB   . GLU A 1 1  ? 16.126  13.215  -0.831  1.00 0.00 ? 1  GLU A CB   6 
ATOM   3581 C CG   . GLU A 1 1  ? 15.115  12.517  -1.756  1.00 0.00 ? 1  GLU A CG   6 
ATOM   3582 C CD   . GLU A 1 1  ? 15.807  11.841  -2.942  1.00 0.00 ? 1  GLU A CD   6 
ATOM   3583 O OE1  . GLU A 1 1  ? 16.193  10.663  -2.785  1.00 0.00 ? 1  GLU A OE1  6 
ATOM   3584 O OE2  . GLU A 1 1  ? 15.946  12.517  -3.986  1.00 0.00 ? 1  GLU A OE2  6 
ATOM   3585 H H1   . GLU A 1 1  ? 17.161  14.307  1.390   1.00 0.00 ? 1  GLU A H1   6 
ATOM   3586 H H2   . GLU A 1 1  ? 16.101  15.556  1.574   1.00 0.00 ? 1  GLU A H2   6 
ATOM   3587 H H3   . GLU A 1 1  ? 17.039  15.461  0.220   1.00 0.00 ? 1  GLU A H3   6 
ATOM   3588 H HA   . GLU A 1 1  ? 14.836  14.842  -0.275  1.00 0.00 ? 1  GLU A HA   6 
ATOM   3589 H HB2  . GLU A 1 1  ? 16.774  13.836  -1.455  1.00 0.00 ? 1  GLU A HB2  6 
ATOM   3590 H HB3  . GLU A 1 1  ? 16.748  12.460  -0.344  1.00 0.00 ? 1  GLU A HB3  6 
ATOM   3591 H HG2  . GLU A 1 1  ? 14.569  11.754  -1.201  1.00 0.00 ? 1  GLU A HG2  6 
ATOM   3592 H HG3  . GLU A 1 1  ? 14.398  13.250  -2.129  1.00 0.00 ? 1  GLU A HG3  6 
ATOM   3593 N N    . CYS A 1 2  ? 13.447  12.879  0.828   1.00 0.00 ? 2  CYS A N    6 
ATOM   3594 C CA   . CYS A 1 2  ? 12.557  11.998  1.582   1.00 0.00 ? 2  CYS A CA   6 
ATOM   3595 C C    . CYS A 1 2  ? 12.072  10.852  0.685   1.00 0.00 ? 2  CYS A C    6 
ATOM   3596 O O    . CYS A 1 2  ? 11.918  11.023  -0.525  1.00 0.00 ? 2  CYS A O    6 
ATOM   3597 C CB   . CYS A 1 2  ? 11.362  12.785  2.138   1.00 0.00 ? 2  CYS A CB   6 
ATOM   3598 S SG   . CYS A 1 2  ? 10.364  11.896  3.363   1.00 0.00 ? 2  CYS A SG   6 
ATOM   3599 H H    . CYS A 1 2  ? 13.177  13.063  -0.126  1.00 0.00 ? 2  CYS A H    6 
ATOM   3600 H HA   . CYS A 1 2  ? 13.093  11.578  2.432   1.00 0.00 ? 2  CYS A HA   6 
ATOM   3601 H HB2  . CYS A 1 2  ? 11.709  13.685  2.634   1.00 0.00 ? 2  CYS A HB2  6 
ATOM   3602 H HB3  . CYS A 1 2  ? 10.721  13.086  1.311   1.00 0.00 ? 2  CYS A HB3  6 
ATOM   3603 N N    . GLU A 1 3  ? 11.783  9.696   1.300   1.00 0.00 ? 3  GLU A N    6 
ATOM   3604 C CA   . GLU A 1 3  ? 11.067  8.595   0.666   1.00 0.00 ? 3  GLU A CA   6 
ATOM   3605 C C    . GLU A 1 3  ? 9.617   9.035   0.444   1.00 0.00 ? 3  GLU A C    6 
ATOM   3606 O O    . GLU A 1 3  ? 8.813   9.073   1.377   1.00 0.00 ? 3  GLU A O    6 
ATOM   3607 C CB   . GLU A 1 3  ? 11.157  7.322   1.508   1.00 0.00 ? 3  GLU A CB   6 
ATOM   3608 C CG   . GLU A 1 3  ? 10.458  6.130   0.828   1.00 0.00 ? 3  GLU A CG   6 
ATOM   3609 C CD   . GLU A 1 3  ? 10.445  4.869   1.699   1.00 0.00 ? 3  GLU A CD   6 
ATOM   3610 O OE1  . GLU A 1 3  ? 10.026  4.985   2.872   1.00 0.00 ? 3  GLU A OE1  6 
ATOM   3611 O OE2  . GLU A 1 3  ? 10.836  3.804   1.174   1.00 0.00 ? 3  GLU A OE2  6 
ATOM   3612 H H    . GLU A 1 3  ? 11.950  9.638   2.294   1.00 0.00 ? 3  GLU A H    6 
ATOM   3613 H HA   . GLU A 1 3  ? 11.554  8.362   -0.282  1.00 0.00 ? 3  GLU A HA   6 
ATOM   3614 H HB2  . GLU A 1 3  ? 12.208  7.081   1.651   1.00 0.00 ? 3  GLU A HB2  6 
ATOM   3615 H HB3  . GLU A 1 3  ? 10.694  7.531   2.467   1.00 0.00 ? 3  GLU A HB3  6 
ATOM   3616 H HG2  . GLU A 1 3  ? 9.425   6.393   0.605   1.00 0.00 ? 3  GLU A HG2  6 
ATOM   3617 H HG3  . GLU A 1 3  ? 10.961  5.923   -0.119  1.00 0.00 ? 3  GLU A HG3  6 
ATOM   3618 N N    . SER A 1 4  ? 9.326   9.387   -0.810  1.00 0.00 ? 4  SER A N    6 
ATOM   3619 C CA   . SER A 1 4  ? 8.072   9.968   -1.266  1.00 0.00 ? 4  SER A CA   6 
ATOM   3620 C C    . SER A 1 4  ? 7.496   9.103   -2.392  1.00 0.00 ? 4  SER A C    6 
ATOM   3621 O O    . SER A 1 4  ? 7.671   9.392   -3.576  1.00 0.00 ? 4  SER A O    6 
ATOM   3622 C CB   . SER A 1 4  ? 8.304   11.423  -1.701  1.00 0.00 ? 4  SER A CB   6 
ATOM   3623 O OG   . SER A 1 4  ? 7.096   12.011  -2.139  1.00 0.00 ? 4  SER A OG   6 
ATOM   3624 H H    . SER A 1 4  ? 10.074  9.269   -1.474  1.00 0.00 ? 4  SER A H    6 
ATOM   3625 H HA   . SER A 1 4  ? 7.344   9.994   -0.446  1.00 0.00 ? 4  SER A HA   6 
ATOM   3626 H HB2  . SER A 1 4  ? 8.684   12.001  -0.856  1.00 0.00 ? 4  SER A HB2  6 
ATOM   3627 H HB3  . SER A 1 4  ? 9.036   11.470  -2.510  1.00 0.00 ? 4  SER A HB3  6 
ATOM   3628 H HG   . SER A 1 4  ? 7.265   12.929  -2.363  1.00 0.00 ? 4  SER A HG   6 
ATOM   3629 N N    . GLY A 1 5  ? 6.761   8.065   -1.982  1.00 0.00 ? 5  GLY A N    6 
ATOM   3630 C CA   . GLY A 1 5  ? 5.708   7.424   -2.741  1.00 0.00 ? 5  GLY A CA   6 
ATOM   3631 C C    . GLY A 1 5  ? 4.419   8.053   -2.205  1.00 0.00 ? 5  GLY A C    6 
ATOM   3632 O O    . GLY A 1 5  ? 4.076   7.722   -1.080  1.00 0.00 ? 5  GLY A O    6 
ATOM   3633 H H    . GLY A 1 5  ? 6.698   7.933   -0.987  1.00 0.00 ? 5  GLY A H    6 
ATOM   3634 H HA2  . GLY A 1 5  ? 5.845   7.506   -3.816  1.00 0.00 ? 5  GLY A HA2  6 
ATOM   3635 H HA3  . GLY A 1 5  ? 5.714   6.361   -2.494  1.00 0.00 ? 5  GLY A HA3  6 
ATOM   3636 N N    . PRO A 1 6  ? 3.749   8.981   -2.922  1.00 0.00 ? 6  PRO A N    6 
ATOM   3637 C CA   . PRO A 1 6  ? 2.658   9.842   -2.436  1.00 0.00 ? 6  PRO A CA   6 
ATOM   3638 C C    . PRO A 1 6  ? 1.499   9.185   -1.671  1.00 0.00 ? 6  PRO A C    6 
ATOM   3639 O O    . PRO A 1 6  ? 0.729   9.880   -1.008  1.00 0.00 ? 6  PRO A O    6 
ATOM   3640 C CB   . PRO A 1 6  ? 2.153   10.604  -3.665  1.00 0.00 ? 6  PRO A CB   6 
ATOM   3641 C CG   . PRO A 1 6  ? 3.415   10.731  -4.513  1.00 0.00 ? 6  PRO A CG   6 
ATOM   3642 C CD   . PRO A 1 6  ? 4.138   9.407   -4.250  1.00 0.00 ? 6  PRO A CD   6 
ATOM   3643 H HA   . PRO A 1 6  ? 3.129   10.546  -1.751  1.00 0.00 ? 6  PRO A HA   6 
ATOM   3644 H HB2  . PRO A 1 6  ? 1.416   10.006  -4.207  1.00 0.00 ? 6  PRO A HB2  6 
ATOM   3645 H HB3  . PRO A 1 6  ? 1.727   11.575  -3.407  1.00 0.00 ? 6  PRO A HB3  6 
ATOM   3646 H HG2  . PRO A 1 6  ? 3.194   10.881  -5.570  1.00 0.00 ? 6  PRO A HG2  6 
ATOM   3647 H HG3  . PRO A 1 6  ? 4.018   11.560  -4.137  1.00 0.00 ? 6  PRO A HG3  6 
ATOM   3648 H HD2  . PRO A 1 6  ? 3.841   8.633   -4.954  1.00 0.00 ? 6  PRO A HD2  6 
ATOM   3649 H HD3  . PRO A 1 6  ? 5.207   9.564   -4.313  1.00 0.00 ? 6  PRO A HD3  6 
ATOM   3650 N N    . CYS A 1 7  ? 1.414   7.851   -1.716  1.00 0.00 ? 7  CYS A N    6 
ATOM   3651 C CA   . CYS A 1 7  ? 0.759   7.004   -0.717  1.00 0.00 ? 7  CYS A CA   6 
ATOM   3652 C C    . CYS A 1 7  ? 1.151   7.472   0.686   1.00 0.00 ? 7  CYS A C    6 
ATOM   3653 O O    . CYS A 1 7  ? 0.329   8.047   1.395   1.00 0.00 ? 7  CYS A O    6 
ATOM   3654 C CB   . CYS A 1 7  ? 1.176   5.553   -1.007  1.00 0.00 ? 7  CYS A CB   6 
ATOM   3655 S SG   . CYS A 1 7  ? -0.002  4.280   -0.531  1.00 0.00 ? 7  CYS A SG   6 
ATOM   3656 H H    . CYS A 1 7  ? 2.096   7.399   -2.311  1.00 0.00 ? 7  CYS A H    6 
ATOM   3657 H HA   . CYS A 1 7  ? -0.326  7.095   -0.733  1.00 0.00 ? 7  CYS A HA   6 
ATOM   3658 H HB2  . CYS A 1 7  ? 1.317   5.406   -2.079  1.00 0.00 ? 7  CYS A HB2  6 
ATOM   3659 H HB3  . CYS A 1 7  ? 2.138   5.341   -0.544  1.00 0.00 ? 7  CYS A HB3  6 
ATOM   3660 N N    . CYS A 1 8  ? 2.439   7.355   1.022   1.00 0.00 ? 8  CYS A N    6 
ATOM   3661 C CA   . CYS A 1 8  ? 3.051   8.142   2.077   1.00 0.00 ? 8  CYS A CA   6 
ATOM   3662 C C    . CYS A 1 8  ? 2.890   9.619   1.684   1.00 0.00 ? 8  CYS A C    6 
ATOM   3663 O O    . CYS A 1 8  ? 3.494   10.049  0.701   1.00 0.00 ? 8  CYS A O    6 
ATOM   3664 C CB   . CYS A 1 8  ? 4.544   7.846   2.210   1.00 0.00 ? 8  CYS A CB   6 
ATOM   3665 S SG   . CYS A 1 8  ? 4.967   6.261   2.953   1.00 0.00 ? 8  CYS A SG   6 
ATOM   3666 H H    . CYS A 1 8  ? 3.046   6.982   0.309   1.00 0.00 ? 8  CYS A H    6 
ATOM   3667 H HA   . CYS A 1 8  ? 2.547   7.824   2.995   1.00 0.00 ? 8  CYS A HA   6 
ATOM   3668 H HB2  . CYS A 1 8  ? 5.007   7.911   1.229   1.00 0.00 ? 8  CYS A HB2  6 
ATOM   3669 H HB3  . CYS A 1 8  ? 5.002   8.623   2.823   1.00 0.00 ? 8  CYS A HB3  6 
ATOM   3670 N N    . ARG A 1 9  ? 2.058   10.349  2.435   1.00 0.00 ? 9  ARG A N    6 
ATOM   3671 C CA   . ARG A 1 9  ? 1.495   11.685  2.184   1.00 0.00 ? 9  ARG A CA   6 
ATOM   3672 C C    . ARG A 1 9  ? 2.143   12.415  1.010   1.00 0.00 ? 9  ARG A C    6 
ATOM   3673 O O    . ARG A 1 9  ? 1.623   12.451  -0.104  1.00 0.00 ? 9  ARG A O    6 
ATOM   3674 C CB   . ARG A 1 9  ? 1.551   12.536  3.469   1.00 0.00 ? 9  ARG A CB   6 
ATOM   3675 C CG   . ARG A 1 9  ? 0.316   12.366  4.352   1.00 0.00 ? 9  ARG A CG   6 
ATOM   3676 C CD   . ARG A 1 9  ? 0.059   10.915  4.771   1.00 0.00 ? 9  ARG A CD   6 
ATOM   3677 N NE   . ARG A 1 9  ? -1.077  10.796  5.697   1.00 0.00 ? 9  ARG A NE   6 
ATOM   3678 C CZ   . ARG A 1 9  ? -1.035  11.005  7.026   1.00 0.00 ? 9  ARG A CZ   6 
ATOM   3679 N NH1  . ARG A 1 9  ? 0.089   11.410  7.637   1.00 0.00 ? 9  ARG A NH1  6 
ATOM   3680 N NH2  . ARG A 1 9  ? -2.141  10.800  7.757   1.00 0.00 ? 9  ARG A NH2  6 
ATOM   3681 H H    . ARG A 1 9  ? 1.807   9.895   3.300   1.00 0.00 ? 9  ARG A H    6 
ATOM   3682 H HA   . ARG A 1 9  ? 0.453   11.560  1.933   1.00 0.00 ? 9  ARG A HA   6 
ATOM   3683 H HB2  . ARG A 1 9  ? 2.454   12.305  4.031   1.00 0.00 ? 9  ARG A HB2  6 
ATOM   3684 H HB3  . ARG A 1 9  ? 1.581   13.598  3.215   1.00 0.00 ? 9  ARG A HB3  6 
ATOM   3685 H HG2  . ARG A 1 9  ? 0.475   12.987  5.227   1.00 0.00 ? 9  ARG A HG2  6 
ATOM   3686 H HG3  . ARG A 1 9  ? -0.541  12.749  3.801   1.00 0.00 ? 9  ARG A HG3  6 
ATOM   3687 H HD2  . ARG A 1 9  ? -0.174  10.342  3.877   1.00 0.00 ? 9  ARG A HD2  6 
ATOM   3688 H HD3  . ARG A 1 9  ? 0.953   10.491  5.228   1.00 0.00 ? 9  ARG A HD3  6 
ATOM   3689 H HE   . ARG A 1 9  ? -1.950  10.489  5.292   1.00 0.00 ? 9  ARG A HE   6 
ATOM   3690 H HH11 . ARG A 1 9  ? 0.929   11.573  7.102   1.00 0.00 ? 9  ARG A HH11 6 
ATOM   3691 H HH12 . ARG A 1 9  ? 0.094   11.561  8.636   1.00 0.00 ? 9  ARG A HH12 6 
ATOM   3692 H HH21 . ARG A 1 9  ? -2.993  10.491  7.311   1.00 0.00 ? 9  ARG A HH21 6 
ATOM   3693 H HH22 . ARG A 1 9  ? -2.124  10.954  8.755   1.00 0.00 ? 9  ARG A HH22 6 
ATOM   3694 N N    . ASN A 1 10 ? 3.312   12.967  1.314   1.00 0.00 ? 10 ASN A N    6 
ATOM   3695 C CA   . ASN A 1 10 ? 4.269   13.556  0.387   1.00 0.00 ? 10 ASN A CA   6 
ATOM   3696 C C    . ASN A 1 10 ? 5.716   13.172  0.746   1.00 0.00 ? 10 ASN A C    6 
ATOM   3697 O O    . ASN A 1 10 ? 6.653   13.722  0.171   1.00 0.00 ? 10 ASN A O    6 
ATOM   3698 C CB   . ASN A 1 10 ? 4.073   15.081  0.426   1.00 0.00 ? 10 ASN A CB   6 
ATOM   3699 C CG   . ASN A 1 10 ? 4.659   15.803  -0.795  1.00 0.00 ? 10 ASN A CG   6 
ATOM   3700 O OD1  . ASN A 1 10 ? 4.464   15.371  -1.929  1.00 0.00 ? 10 ASN A OD1  6 
ATOM   3701 N ND2  . ASN A 1 10 ? 5.378   16.906  -0.568  1.00 0.00 ? 10 ASN A ND2  6 
ATOM   3702 H H    . ASN A 1 10 ? 3.546   12.911  2.294   1.00 0.00 ? 10 ASN A H    6 
ATOM   3703 H HA   . ASN A 1 10 ? 4.060   13.169  -0.610  1.00 0.00 ? 10 ASN A HA   6 
ATOM   3704 H HB2  . ASN A 1 10 ? 3.006   15.287  0.473   1.00 0.00 ? 10 ASN A HB2  6 
ATOM   3705 H HB3  . ASN A 1 10 ? 4.510   15.471  1.348   1.00 0.00 ? 10 ASN A HB3  6 
ATOM   3706 H HD21 . ASN A 1 10 ? 5.517   17.232  0.379   1.00 0.00 ? 10 ASN A HD21 6 
ATOM   3707 H HD22 . ASN A 1 10 ? 5.780   17.413  -1.342  1.00 0.00 ? 10 ASN A HD22 6 
ATOM   3708 N N    . CYS A 1 11 ? 5.884   12.266  1.724   1.00 0.00 ? 11 CYS A N    6 
ATOM   3709 C CA   . CYS A 1 11 ? 7.083   12.059  2.537   1.00 0.00 ? 11 CYS A CA   6 
ATOM   3710 C C    . CYS A 1 11 ? 6.723   11.237  3.789   1.00 0.00 ? 11 CYS A C    6 
ATOM   3711 O O    . CYS A 1 11 ? 7.570   10.493  4.283   1.00 0.00 ? 11 CYS A O    6 
ATOM   3712 C CB   . CYS A 1 11 ? 7.728   13.401  2.955   1.00 0.00 ? 11 CYS A CB   6 
ATOM   3713 S SG   . CYS A 1 11 ? 9.107   13.310  4.134   1.00 0.00 ? 11 CYS A SG   6 
ATOM   3714 H H    . CYS A 1 11 ? 5.044   11.799  2.047   1.00 0.00 ? 11 CYS A H    6 
ATOM   3715 H HA   . CYS A 1 11 ? 7.828   11.524  1.945   1.00 0.00 ? 11 CYS A HA   6 
ATOM   3716 H HB2  . CYS A 1 11 ? 8.134   13.904  2.078   1.00 0.00 ? 11 CYS A HB2  6 
ATOM   3717 H HB3  . CYS A 1 11 ? 6.968   14.049  3.395   1.00 0.00 ? 11 CYS A HB3  6 
ATOM   3718 N N    . LYS A 1 12 ? 5.502   11.402  4.336   1.00 0.00 ? 12 LYS A N    6 
ATOM   3719 C CA   . LYS A 1 12 ? 5.149   10.984  5.688   1.00 0.00 ? 12 LYS A CA   6 
ATOM   3720 C C    . LYS A 1 12 ? 4.241   9.762   5.592   1.00 0.00 ? 12 LYS A C    6 
ATOM   3721 O O    . LYS A 1 12 ? 3.286   9.752   4.825   1.00 0.00 ? 12 LYS A O    6 
ATOM   3722 C CB   . LYS A 1 12 ? 4.460   12.131  6.455   1.00 0.00 ? 12 LYS A CB   6 
ATOM   3723 C CG   . LYS A 1 12 ? 5.299   13.416  6.564   1.00 0.00 ? 12 LYS A CG   6 
ATOM   3724 C CD   . LYS A 1 12 ? 6.597   13.209  7.360   1.00 0.00 ? 12 LYS A CD   6 
ATOM   3725 C CE   . LYS A 1 12 ? 7.313   14.546  7.598   1.00 0.00 ? 12 LYS A CE   6 
ATOM   3726 N NZ   . LYS A 1 12 ? 8.535   14.371  8.401   1.00 0.00 ? 12 LYS A NZ   6 
ATOM   3727 H H    . LYS A 1 12 ? 4.746   11.801  3.791   1.00 0.00 ? 12 LYS A H    6 
ATOM   3728 H HA   . LYS A 1 12 ? 6.048   10.717  6.249   1.00 0.00 ? 12 LYS A HA   6 
ATOM   3729 H HB2  . LYS A 1 12 ? 3.518   12.384  5.969   1.00 0.00 ? 12 LYS A HB2  6 
ATOM   3730 H HB3  . LYS A 1 12 ? 4.223   11.786  7.463   1.00 0.00 ? 12 LYS A HB3  6 
ATOM   3731 H HG2  . LYS A 1 12 ? 5.535   13.794  5.569   1.00 0.00 ? 12 LYS A HG2  6 
ATOM   3732 H HG3  . LYS A 1 12 ? 4.693   14.165  7.075   1.00 0.00 ? 12 LYS A HG3  6 
ATOM   3733 H HD2  . LYS A 1 12 ? 6.357   12.755  8.323   1.00 0.00 ? 12 LYS A HD2  6 
ATOM   3734 H HD3  . LYS A 1 12 ? 7.266   12.544  6.811   1.00 0.00 ? 12 LYS A HD3  6 
ATOM   3735 H HE2  . LYS A 1 12 ? 7.584   14.993  6.640   1.00 0.00 ? 12 LYS A HE2  6 
ATOM   3736 H HE3  . LYS A 1 12 ? 6.648   15.229  8.129   1.00 0.00 ? 12 LYS A HE3  6 
ATOM   3737 H HZ1  . LYS A 1 12 ? 9.170   13.750  7.921   1.00 0.00 ? 12 LYS A HZ1  6 
ATOM   3738 H HZ2  . LYS A 1 12 ? 8.980   15.267  8.539   1.00 0.00 ? 12 LYS A HZ2  6 
ATOM   3739 H HZ3  . LYS A 1 12 ? 8.293   13.976  9.299   1.00 0.00 ? 12 LYS A HZ3  6 
ATOM   3740 N N    . PHE A 1 13 ? 4.556   8.726   6.371   1.00 0.00 ? 13 PHE A N    6 
ATOM   3741 C CA   . PHE A 1 13 ? 3.869   7.442   6.347   1.00 0.00 ? 13 PHE A CA   6 
ATOM   3742 C C    . PHE A 1 13 ? 2.368   7.610   6.631   1.00 0.00 ? 13 PHE A C    6 
ATOM   3743 O O    . PHE A 1 13 ? 2.006   8.188   7.657   1.00 0.00 ? 13 PHE A O    6 
ATOM   3744 C CB   . PHE A 1 13 ? 4.530   6.480   7.338   1.00 0.00 ? 13 PHE A CB   6 
ATOM   3745 C CG   . PHE A 1 13 ? 6.011   6.234   7.098   1.00 0.00 ? 13 PHE A CG   6 
ATOM   3746 C CD1  . PHE A 1 13 ? 6.431   5.388   6.048   1.00 0.00 ? 13 PHE A CD1  6 
ATOM   3747 C CD2  . PHE A 1 13 ? 6.976   6.910   7.882   1.00 0.00 ? 13 PHE A CD2  6 
ATOM   3748 C CE1  . PHE A 1 13 ? 7.805   5.254   5.758   1.00 0.00 ? 13 PHE A CE1  6 
ATOM   3749 C CE2  . PHE A 1 13 ? 8.351   6.718   7.633   1.00 0.00 ? 13 PHE A CE2  6 
ATOM   3750 C CZ   . PHE A 1 13 ? 8.763   5.890   6.569   1.00 0.00 ? 13 PHE A CZ   6 
ATOM   3751 H H    . PHE A 1 13 ? 5.365   8.826   6.964   1.00 0.00 ? 13 PHE A H    6 
ATOM   3752 H HA   . PHE A 1 13 ? 4.013   7.016   5.356   1.00 0.00 ? 13 PHE A HA   6 
ATOM   3753 H HB2  . PHE A 1 13 ? 4.373   6.834   8.359   1.00 0.00 ? 13 PHE A HB2  6 
ATOM   3754 H HB3  . PHE A 1 13 ? 4.007   5.535   7.232   1.00 0.00 ? 13 PHE A HB3  6 
ATOM   3755 H HD1  . PHE A 1 13 ? 5.704   4.851   5.455   1.00 0.00 ? 13 PHE A HD1  6 
ATOM   3756 H HD2  . PHE A 1 13 ? 6.668   7.579   8.672   1.00 0.00 ? 13 PHE A HD2  6 
ATOM   3757 H HE1  . PHE A 1 13 ? 8.133   4.668   4.916   1.00 0.00 ? 13 PHE A HE1  6 
ATOM   3758 H HE2  . PHE A 1 13 ? 9.088   7.214   8.247   1.00 0.00 ? 13 PHE A HE2  6 
ATOM   3759 H HZ   . PHE A 1 13 ? 9.816   5.745   6.372   1.00 0.00 ? 13 PHE A HZ   6 
ATOM   3760 N N    . LEU A 1 14 ? 1.502   7.130   5.720   1.00 0.00 ? 14 LEU A N    6 
ATOM   3761 C CA   . LEU A 1 14 ? 0.058   7.314   5.803   1.00 0.00 ? 14 LEU A CA   6 
ATOM   3762 C C    . LEU A 1 14 ? -0.589  6.410   6.865   1.00 0.00 ? 14 LEU A C    6 
ATOM   3763 O O    . LEU A 1 14 ? 0.077   5.845   7.732   1.00 0.00 ? 14 LEU A O    6 
ATOM   3764 C CB   . LEU A 1 14 ? -0.594  7.259   4.395   1.00 0.00 ? 14 LEU A CB   6 
ATOM   3765 C CG   . LEU A 1 14 ? -0.520  5.966   3.562   1.00 0.00 ? 14 LEU A CG   6 
ATOM   3766 C CD1  . LEU A 1 14 ? -0.636  4.670   4.376   1.00 0.00 ? 14 LEU A CD1  6 
ATOM   3767 C CD2  . LEU A 1 14 ? -1.655  5.975   2.525   1.00 0.00 ? 14 LEU A CD2  6 
ATOM   3768 H H    . LEU A 1 14 ? 1.847   6.646   4.907   1.00 0.00 ? 14 LEU A H    6 
ATOM   3769 H HA   . LEU A 1 14 ? -0.117  8.330   6.158   1.00 0.00 ? 14 LEU A HA   6 
ATOM   3770 H HB2  . LEU A 1 14 ? -1.637  7.556   4.417   1.00 0.00 ? 14 LEU A HB2  6 
ATOM   3771 H HB3  . LEU A 1 14 ? -0.128  8.044   3.816   1.00 0.00 ? 14 LEU A HB3  6 
ATOM   3772 H HG   . LEU A 1 14 ? 0.428   5.968   3.030   1.00 0.00 ? 14 LEU A HG   6 
ATOM   3773 H HD11 . LEU A 1 14 ? -1.589  4.638   4.897   1.00 0.00 ? 14 LEU A HD11 6 
ATOM   3774 H HD12 . LEU A 1 14 ? -0.616  3.814   3.709   1.00 0.00 ? 14 LEU A HD12 6 
ATOM   3775 H HD13 . LEU A 1 14 ? 0.192   4.573   5.078   1.00 0.00 ? 14 LEU A HD13 6 
ATOM   3776 H HD21 . LEU A 1 14 ? -1.695  6.911   1.971   1.00 0.00 ? 14 LEU A HD21 6 
ATOM   3777 H HD22 . LEU A 1 14 ? -1.518  5.161   1.815   1.00 0.00 ? 14 LEU A HD22 6 
ATOM   3778 H HD23 . LEU A 1 14 ? -2.610  5.862   3.036   1.00 0.00 ? 14 LEU A HD23 6 
ATOM   3779 N N    . LYS A 1 15 ? -1.917  6.313   6.789   1.00 0.00 ? 15 LYS A N    6 
ATOM   3780 C CA   . LYS A 1 15 ? -2.806  5.726   7.792   1.00 0.00 ? 15 LYS A CA   6 
ATOM   3781 C C    . LYS A 1 15 ? -2.738  4.194   7.966   1.00 0.00 ? 15 LYS A C    6 
ATOM   3782 O O    . LYS A 1 15 ? -3.577  3.645   8.682   1.00 0.00 ? 15 LYS A O    6 
ATOM   3783 C CB   . LYS A 1 15 ? -4.240  6.205   7.521   1.00 0.00 ? 15 LYS A CB   6 
ATOM   3784 C CG   . LYS A 1 15 ? -4.770  5.664   6.185   1.00 0.00 ? 15 LYS A CG   6 
ATOM   3785 C CD   . LYS A 1 15 ? -6.140  6.254   5.843   1.00 0.00 ? 15 LYS A CD   6 
ATOM   3786 C CE   . LYS A 1 15 ? -7.266  5.679   6.716   1.00 0.00 ? 15 LYS A CE   6 
ATOM   3787 N NZ   . LYS A 1 15 ? -8.584  6.196   6.306   1.00 0.00 ? 15 LYS A NZ   6 
ATOM   3788 H H    . LYS A 1 15 ? -2.330  6.782   5.996   1.00 0.00 ? 15 LYS A H    6 
ATOM   3789 H HA   . LYS A 1 15 ? -2.514  6.151   8.743   1.00 0.00 ? 15 LYS A HA   6 
ATOM   3790 H HB2  . LYS A 1 15 ? -4.890  5.884   8.337   1.00 0.00 ? 15 LYS A HB2  6 
ATOM   3791 H HB3  . LYS A 1 15 ? -4.250  7.297   7.497   1.00 0.00 ? 15 LYS A HB3  6 
ATOM   3792 H HG2  . LYS A 1 15 ? -4.087  5.940   5.381   1.00 0.00 ? 15 LYS A HG2  6 
ATOM   3793 H HG3  . LYS A 1 15 ? -4.840  4.575   6.221   1.00 0.00 ? 15 LYS A HG3  6 
ATOM   3794 H HD2  . LYS A 1 15 ? -6.110  7.341   5.939   1.00 0.00 ? 15 LYS A HD2  6 
ATOM   3795 H HD3  . LYS A 1 15 ? -6.359  6.012   4.802   1.00 0.00 ? 15 LYS A HD3  6 
ATOM   3796 H HE2  . LYS A 1 15 ? -7.280  4.591   6.623   1.00 0.00 ? 15 LYS A HE2  6 
ATOM   3797 H HE3  . LYS A 1 15 ? -7.108  5.942   7.761   1.00 0.00 ? 15 LYS A HE3  6 
ATOM   3798 H HZ1  . LYS A 1 15 ? -9.302  5.786   6.885   1.00 0.00 ? 15 LYS A HZ1  6 
ATOM   3799 H HZ2  . LYS A 1 15 ? -8.599  7.200   6.411   1.00 0.00 ? 15 LYS A HZ2  6 
ATOM   3800 H HZ3  . LYS A 1 15 ? -8.754  5.956   5.340   1.00 0.00 ? 15 LYS A HZ3  6 
ATOM   3801 N N    . GLU A 1 16 ? -1.764  3.515   7.339   1.00 0.00 ? 16 GLU A N    6 
ATOM   3802 C CA   . GLU A 1 16 ? -1.573  2.059   7.296   1.00 0.00 ? 16 GLU A CA   6 
ATOM   3803 C C    . GLU A 1 16 ? -2.752  1.320   6.642   1.00 0.00 ? 16 GLU A C    6 
ATOM   3804 O O    . GLU A 1 16 ? -3.910  1.547   6.995   1.00 0.00 ? 16 GLU A O    6 
ATOM   3805 C CB   . GLU A 1 16 ? -1.236  1.502   8.696   1.00 0.00 ? 16 GLU A CB   6 
ATOM   3806 C CG   . GLU A 1 16 ? -1.132  -0.034  8.723   1.00 0.00 ? 16 GLU A CG   6 
ATOM   3807 C CD   . GLU A 1 16 ? -0.648  -0.547  10.082  1.00 0.00 ? 16 GLU A CD   6 
ATOM   3808 O OE1  . GLU A 1 16 ? -1.469  -0.520  11.026  1.00 0.00 ? 16 GLU A OE1  6 
ATOM   3809 O OE2  . GLU A 1 16 ? 0.530   -0.959  10.160  1.00 0.00 ? 16 GLU A OE2  6 
ATOM   3810 H H    . GLU A 1 16 ? -1.074  4.080   6.867   1.00 0.00 ? 16 GLU A H    6 
ATOM   3811 H HA   . GLU A 1 16 ? -0.702  1.902   6.657   1.00 0.00 ? 16 GLU A HA   6 
ATOM   3812 H HB2  . GLU A 1 16 ? -0.286  1.932   9.019   1.00 0.00 ? 16 GLU A HB2  6 
ATOM   3813 H HB3  . GLU A 1 16 ? -2.002  1.795   9.415   1.00 0.00 ? 16 GLU A HB3  6 
ATOM   3814 H HG2  . GLU A 1 16 ? -2.113  -0.470  8.530   1.00 0.00 ? 16 GLU A HG2  6 
ATOM   3815 H HG3  . GLU A 1 16 ? -0.460  -0.372  7.935   1.00 0.00 ? 16 GLU A HG3  6 
ATOM   3816 N N    . GLY A 1 17 ? -2.462  0.401   5.706   1.00 0.00 ? 17 GLY A N    6 
ATOM   3817 C CA   . GLY A 1 17 ? -3.477  -0.407  5.052   1.00 0.00 ? 17 GLY A CA   6 
ATOM   3818 C C    . GLY A 1 17 ? -4.285  0.439   4.066   1.00 0.00 ? 17 GLY A C    6 
ATOM   3819 O O    . GLY A 1 17 ? -5.515  0.430   4.120   1.00 0.00 ? 17 GLY A O    6 
ATOM   3820 H H    . GLY A 1 17 ? -1.512  0.265   5.384   1.00 0.00 ? 17 GLY A H    6 
ATOM   3821 H HA2  . GLY A 1 17 ? -2.983  -1.225  4.532   1.00 0.00 ? 17 GLY A HA2  6 
ATOM   3822 H HA3  . GLY A 1 17 ? -4.136  -0.850  5.800   1.00 0.00 ? 17 GLY A HA3  6 
ATOM   3823 N N    . THR A 1 18 ? -3.590  1.163   3.171   1.00 0.00 ? 18 THR A N    6 
ATOM   3824 C CA   . THR A 1 18 ? -4.182  1.990   2.123   1.00 0.00 ? 18 THR A CA   6 
ATOM   3825 C C    . THR A 1 18 ? -3.562  1.672   0.761   1.00 0.00 ? 18 THR A C    6 
ATOM   3826 O O    . THR A 1 18 ? -2.349  1.783   0.592   1.00 0.00 ? 18 THR A O    6 
ATOM   3827 C CB   . THR A 1 18 ? -3.988  3.469   2.451   1.00 0.00 ? 18 THR A CB   6 
ATOM   3828 O OG1  . THR A 1 18 ? -4.740  3.820   3.596   1.00 0.00 ? 18 THR A OG1  6 
ATOM   3829 C CG2  . THR A 1 18 ? -4.397  4.349   1.262   1.00 0.00 ? 18 THR A CG2  6 
ATOM   3830 H H    . THR A 1 18 ? -2.581  1.162   3.240   1.00 0.00 ? 18 THR A H    6 
ATOM   3831 H HA   . THR A 1 18 ? -5.252  1.812   2.079   1.00 0.00 ? 18 THR A HA   6 
ATOM   3832 H HB   . THR A 1 18 ? -2.935  3.616   2.660   1.00 0.00 ? 18 THR A HB   6 
ATOM   3833 H HG1  . THR A 1 18 ? -4.446  3.281   4.333   1.00 0.00 ? 18 THR A HG1  6 
ATOM   3834 H HG21 . THR A 1 18 ? -5.400  4.084   0.927   1.00 0.00 ? 18 THR A HG21 6 
ATOM   3835 H HG22 . THR A 1 18 ? -3.700  4.245   0.430   1.00 0.00 ? 18 THR A HG22 6 
ATOM   3836 H HG23 . THR A 1 18 ? -4.403  5.398   1.562   1.00 0.00 ? 18 THR A HG23 6 
ATOM   3837 N N    . ILE A 1 19 ? -4.416  1.344   -0.219  1.00 0.00 ? 19 ILE A N    6 
ATOM   3838 C CA   . ILE A 1 19 ? -4.023  0.794   -1.510  1.00 0.00 ? 19 ILE A CA   6 
ATOM   3839 C C    . ILE A 1 19 ? -3.377  1.852   -2.420  1.00 0.00 ? 19 ILE A C    6 
ATOM   3840 O O    . ILE A 1 19 ? -3.983  2.880   -2.717  1.00 0.00 ? 19 ILE A O    6 
ATOM   3841 C CB   . ILE A 1 19 ? -5.190  0.086   -2.225  1.00 0.00 ? 19 ILE A CB   6 
ATOM   3842 C CG1  . ILE A 1 19 ? -5.947  -0.912  -1.337  1.00 0.00 ? 19 ILE A CG1  6 
ATOM   3843 C CG2  . ILE A 1 19 ? -4.694  -0.565  -3.525  1.00 0.00 ? 19 ILE A CG2  6 
ATOM   3844 C CD1  . ILE A 1 19 ? -7.336  -1.280  -1.883  1.00 0.00 ? 19 ILE A CD1  6 
ATOM   3845 H H    . ILE A 1 19 ? -5.401  1.390   -0.008  1.00 0.00 ? 19 ILE A H    6 
ATOM   3846 H HA   . ILE A 1 19 ? -3.329  -0.003  -1.287  1.00 0.00 ? 19 ILE A HA   6 
ATOM   3847 H HB   . ILE A 1 19 ? -5.893  0.841   -2.508  1.00 0.00 ? 19 ILE A HB   6 
ATOM   3848 H HG12 . ILE A 1 19 ? -5.322  -1.793  -1.220  1.00 0.00 ? 19 ILE A HG12 6 
ATOM   3849 H HG13 . ILE A 1 19 ? -6.125  -0.474  -0.358  1.00 0.00 ? 19 ILE A HG13 6 
ATOM   3850 H HG21 . ILE A 1 19 ? -4.517  0.214   -4.264  1.00 0.00 ? 19 ILE A HG21 6 
ATOM   3851 H HG22 . ILE A 1 19 ? -3.766  -1.104  -3.359  1.00 0.00 ? 19 ILE A HG22 6 
ATOM   3852 H HG23 . ILE A 1 19 ? -5.426  -1.260  -3.923  1.00 0.00 ? 19 ILE A HG23 6 
ATOM   3853 H HD11 . ILE A 1 19 ? -7.966  -0.390  -1.918  1.00 0.00 ? 19 ILE A HD11 6 
ATOM   3854 H HD12 . ILE A 1 19 ? -7.281  -1.703  -2.882  1.00 0.00 ? 19 ILE A HD12 6 
ATOM   3855 H HD13 . ILE A 1 19 ? -7.807  -2.008  -1.221  1.00 0.00 ? 19 ILE A HD13 6 
ATOM   3856 N N    . CYS A 1 20 ? -2.168  1.540   -2.903  1.00 0.00 ? 20 CYS A N    6 
ATOM   3857 C CA   . CYS A 1 20 ? -1.482  2.212   -4.009  1.00 0.00 ? 20 CYS A CA   6 
ATOM   3858 C C    . CYS A 1 20 ? -2.114  1.875   -5.373  1.00 0.00 ? 20 CYS A C    6 
ATOM   3859 O O    . CYS A 1 20 ? -2.449  2.787   -6.129  1.00 0.00 ? 20 CYS A O    6 
ATOM   3860 C CB   . CYS A 1 20 ? 0.038   1.939   -3.994  1.00 0.00 ? 20 CYS A CB   6 
ATOM   3861 S SG   . CYS A 1 20 ? 0.577   0.204   -3.919  1.00 0.00 ? 20 CYS A SG   6 
ATOM   3862 H H    . CYS A 1 20 ? -1.760  0.699   -2.524  1.00 0.00 ? 20 CYS A H    6 
ATOM   3863 H HA   . CYS A 1 20 ? -1.600  3.283   -3.862  1.00 0.00 ? 20 CYS A HA   6 
ATOM   3864 H HB2  . CYS A 1 20 ? 0.480   2.399   -4.879  1.00 0.00 ? 20 CYS A HB2  6 
ATOM   3865 H HB3  . CYS A 1 20 ? 0.471   2.437   -3.126  1.00 0.00 ? 20 CYS A HB3  6 
ATOM   3866 N N    . LYS A 1 21 ? -2.257  0.580   -5.699  1.00 0.00 ? 21 LYS A N    6 
ATOM   3867 C CA   . LYS A 1 21 ? -2.717  0.097   -7.006  1.00 0.00 ? 21 LYS A CA   6 
ATOM   3868 C C    . LYS A 1 21 ? -4.246  0.207   -7.144  1.00 0.00 ? 21 LYS A C    6 
ATOM   3869 O O    . LYS A 1 21 ? -4.733  1.199   -7.682  1.00 0.00 ? 21 LYS A O    6 
ATOM   3870 C CB   . LYS A 1 21 ? -2.221  -1.344  -7.265  1.00 0.00 ? 21 LYS A CB   6 
ATOM   3871 C CG   . LYS A 1 21 ? -0.711  -1.463  -7.523  1.00 0.00 ? 21 LYS A CG   6 
ATOM   3872 C CD   . LYS A 1 21 ? -0.274  -0.783  -8.831  1.00 0.00 ? 21 LYS A CD   6 
ATOM   3873 C CE   . LYS A 1 21 ? 1.172   -1.148  -9.191  1.00 0.00 ? 21 LYS A CE   6 
ATOM   3874 N NZ   . LYS A 1 21 ? 1.592   -0.508  -10.450 1.00 0.00 ? 21 LYS A NZ   6 
ATOM   3875 H H    . LYS A 1 21 ? -2.002  -0.103  -5.000  1.00 0.00 ? 21 LYS A H    6 
ATOM   3876 H HA   . LYS A 1 21 ? -2.291  0.733   -7.780  1.00 0.00 ? 21 LYS A HA   6 
ATOM   3877 H HB2  . LYS A 1 21 ? -2.470  -1.974  -6.408  1.00 0.00 ? 21 LYS A HB2  6 
ATOM   3878 H HB3  . LYS A 1 21 ? -2.736  -1.751  -8.138  1.00 0.00 ? 21 LYS A HB3  6 
ATOM   3879 H HG2  . LYS A 1 21 ? -0.167  -1.040  -6.683  1.00 0.00 ? 21 LYS A HG2  6 
ATOM   3880 H HG3  . LYS A 1 21 ? -0.470  -2.525  -7.588  1.00 0.00 ? 21 LYS A HG3  6 
ATOM   3881 H HD2  . LYS A 1 21 ? -0.932  -1.103  -9.641  1.00 0.00 ? 21 LYS A HD2  6 
ATOM   3882 H HD3  . LYS A 1 21 ? -0.344  0.302   -8.727  1.00 0.00 ? 21 LYS A HD3  6 
ATOM   3883 H HE2  . LYS A 1 21 ? 1.842   -0.825  -8.394  1.00 0.00 ? 21 LYS A HE2  6 
ATOM   3884 H HE3  . LYS A 1 21 ? 1.258   -2.229  -9.308  1.00 0.00 ? 21 LYS A HE3  6 
ATOM   3885 H HZ1  . LYS A 1 21 ? 0.984   -0.805  -11.199 1.00 0.00 ? 21 LYS A HZ1  6 
ATOM   3886 H HZ2  . LYS A 1 21 ? 1.539   0.496   -10.353 1.00 0.00 ? 21 LYS A HZ2  6 
ATOM   3887 H HZ3  . LYS A 1 21 ? 2.543   -0.775  -10.664 1.00 0.00 ? 21 LYS A HZ3  6 
ATOM   3888 N N    . ARG A 1 22 ? -4.969  -0.830  -6.686  1.00 0.00 ? 22 ARG A N    6 
ATOM   3889 C CA   . ARG A 1 22 ? -6.403  -1.083  -6.752  1.00 0.00 ? 22 ARG A CA   6 
ATOM   3890 C C    . ARG A 1 22 ? -6.708  -2.160  -7.803  1.00 0.00 ? 22 ARG A C    6 
ATOM   3891 O O    . ARG A 1 22 ? -6.323  -2.032  -8.966  1.00 0.00 ? 22 ARG A O    6 
ATOM   3892 C CB   . ARG A 1 22 ? -7.267  0.177   -6.919  1.00 0.00 ? 22 ARG A CB   6 
ATOM   3893 C CG   . ARG A 1 22 ? -8.769  -0.115  -6.773  1.00 0.00 ? 22 ARG A CG   6 
ATOM   3894 C CD   . ARG A 1 22 ? -9.156  -0.673  -5.395  1.00 0.00 ? 22 ARG A CD   6 
ATOM   3895 N NE   . ARG A 1 22 ? -10.610 -0.857  -5.276  1.00 0.00 ? 22 ARG A NE   6 
ATOM   3896 C CZ   . ARG A 1 22 ? -11.230 -1.534  -4.290  1.00 0.00 ? 22 ARG A CZ   6 
ATOM   3897 N NH1  . ARG A 1 22 ? -10.537 -2.081  -3.279  1.00 0.00 ? 22 ARG A NH1  6 
ATOM   3898 N NH2  . ARG A 1 22 ? -12.563 -1.665  -4.322  1.00 0.00 ? 22 ARG A NH2  6 
ATOM   3899 H H    . ARG A 1 22 ? -4.461  -1.572  -6.237  1.00 0.00 ? 22 ARG A H    6 
ATOM   3900 H HA   . ARG A 1 22 ? -6.618  -1.492  -5.768  1.00 0.00 ? 22 ARG A HA   6 
ATOM   3901 H HB2  . ARG A 1 22 ? -6.984  0.920   -6.171  1.00 0.00 ? 22 ARG A HB2  6 
ATOM   3902 H HB3  . ARG A 1 22 ? -7.109  0.598   -7.913  1.00 0.00 ? 22 ARG A HB3  6 
ATOM   3903 H HG2  . ARG A 1 22 ? -9.307  0.822   -6.930  1.00 0.00 ? 22 ARG A HG2  6 
ATOM   3904 H HG3  . ARG A 1 22 ? -9.085  -0.815  -7.548  1.00 0.00 ? 22 ARG A HG3  6 
ATOM   3905 H HD2  . ARG A 1 22 ? -8.688  -1.645  -5.244  1.00 0.00 ? 22 ARG A HD2  6 
ATOM   3906 H HD3  . ARG A 1 22 ? -8.818  0.013   -4.616  1.00 0.00 ? 22 ARG A HD3  6 
ATOM   3907 H HE   . ARG A 1 22 ? -11.177 -0.453  -6.008  1.00 0.00 ? 22 ARG A HE   6 
ATOM   3908 H HH11 . ARG A 1 22 ? -9.531  -1.989  -3.246  1.00 0.00 ? 22 ARG A HH11 6 
ATOM   3909 H HH12 . ARG A 1 22 ? -11.015 -2.611  -2.564  1.00 0.00 ? 22 ARG A HH12 6 
ATOM   3910 H HH21 . ARG A 1 22 ? -13.093 -1.258  -5.080  1.00 0.00 ? 22 ARG A HH21 6 
ATOM   3911 H HH22 . ARG A 1 22 ? -13.040 -2.169  -3.589  1.00 0.00 ? 22 ARG A HH22 6 
ATOM   3912 N N    . ALA A 1 23 ? -7.412  -3.212  -7.368  1.00 0.00 ? 23 ALA A N    6 
ATOM   3913 C CA   . ALA A 1 23 ? -7.867  -4.355  -8.143  1.00 0.00 ? 23 ALA A CA   6 
ATOM   3914 C C    . ALA A 1 23 ? -9.321  -4.638  -7.739  1.00 0.00 ? 23 ALA A C    6 
ATOM   3915 O O    . ALA A 1 23 ? -10.182 -3.774  -7.904  1.00 0.00 ? 23 ALA A O    6 
ATOM   3916 C CB   . ALA A 1 23 ? -6.888  -5.525  -7.936  1.00 0.00 ? 23 ALA A CB   6 
ATOM   3917 H H    . ALA A 1 23 ? -7.671  -3.229  -6.394  1.00 0.00 ? 23 ALA A H    6 
ATOM   3918 H HA   . ALA A 1 23 ? -7.887  -4.129  -9.201  1.00 0.00 ? 23 ALA A HA   6 
ATOM   3919 H HB1  . ALA A 1 23 ? -7.206  -6.391  -8.519  1.00 0.00 ? 23 ALA A HB1  6 
ATOM   3920 H HB2  . ALA A 1 23 ? -5.890  -5.235  -8.269  1.00 0.00 ? 23 ALA A HB2  6 
ATOM   3921 H HB3  . ALA A 1 23 ? -6.836  -5.799  -6.882  1.00 0.00 ? 23 ALA A HB3  6 
ATOM   3922 N N    . ARG A 1 24 ? -9.589  -5.826  -7.184  1.00 0.00 ? 24 ARG A N    6 
ATOM   3923 C CA   . ARG A 1 24 ? -10.872 -6.199  -6.584  1.00 0.00 ? 24 ARG A CA   6 
ATOM   3924 C C    . ARG A 1 24 ? -11.052 -5.516  -5.213  1.00 0.00 ? 24 ARG A C    6 
ATOM   3925 O O    . ARG A 1 24 ? -10.258 -4.656  -4.826  1.00 0.00 ? 24 ARG A O    6 
ATOM   3926 C CB   . ARG A 1 24 ? -10.977 -7.736  -6.485  1.00 0.00 ? 24 ARG A CB   6 
ATOM   3927 C CG   . ARG A 1 24 ? -10.669 -8.490  -7.795  1.00 0.00 ? 24 ARG A CG   6 
ATOM   3928 C CD   . ARG A 1 24 ? -11.543 -8.059  -8.983  1.00 0.00 ? 24 ARG A CD   6 
ATOM   3929 N NE   . ARG A 1 24 ? -12.981 -8.205  -8.703  1.00 0.00 ? 24 ARG A NE   6 
ATOM   3930 C CZ   . ARG A 1 24 ? -13.698 -9.341  -8.791  1.00 0.00 ? 24 ARG A CZ   6 
ATOM   3931 N NH1  . ARG A 1 24 ? -13.136 -10.499 -9.170  1.00 0.00 ? 24 ARG A NH1  6 
ATOM   3932 N NH2  . ARG A 1 24 ? -15.006 -9.315  -8.494  1.00 0.00 ? 24 ARG A NH2  6 
ATOM   3933 H H    . ARG A 1 24 ? -8.828  -6.484  -7.126  1.00 0.00 ? 24 ARG A H    6 
ATOM   3934 H HA   . ARG A 1 24 ? -11.681 -5.849  -7.229  1.00 0.00 ? 24 ARG A HA   6 
ATOM   3935 H HB2  . ARG A 1 24 ? -10.286 -8.087  -5.720  1.00 0.00 ? 24 ARG A HB2  6 
ATOM   3936 H HB3  . ARG A 1 24 ? -11.985 -8.008  -6.169  1.00 0.00 ? 24 ARG A HB3  6 
ATOM   3937 H HG2  . ARG A 1 24 ? -9.620  -8.344  -8.061  1.00 0.00 ? 24 ARG A HG2  6 
ATOM   3938 H HG3  . ARG A 1 24 ? -10.814 -9.557  -7.618  1.00 0.00 ? 24 ARG A HG3  6 
ATOM   3939 H HD2  . ARG A 1 24 ? -11.345 -7.013  -9.222  1.00 0.00 ? 24 ARG A HD2  6 
ATOM   3940 H HD3  . ARG A 1 24 ? -11.271 -8.646  -9.862  1.00 0.00 ? 24 ARG A HD3  6 
ATOM   3941 H HE   . ARG A 1 24 ? -13.463 -7.367  -8.410  1.00 0.00 ? 24 ARG A HE   6 
ATOM   3942 H HH11 . ARG A 1 24 ? -12.153 -10.538 -9.396  1.00 0.00 ? 24 ARG A HH11 6 
ATOM   3943 H HH12 . ARG A 1 24 ? -13.698 -11.336 -9.233  1.00 0.00 ? 24 ARG A HH12 6 
ATOM   3944 H HH21 . ARG A 1 24 ? -15.442 -8.451  -8.205  1.00 0.00 ? 24 ARG A HH21 6 
ATOM   3945 H HH22 . ARG A 1 24 ? -15.555 -10.160 -8.558  1.00 0.00 ? 24 ARG A HH22 6 
ATOM   3946 N N    . GLY A 1 25 ? -12.105 -5.897  -4.473  1.00 0.00 ? 25 GLY A N    6 
ATOM   3947 C CA   . GLY A 1 25 ? -12.440 -5.371  -3.150  1.00 0.00 ? 25 GLY A CA   6 
ATOM   3948 C C    . GLY A 1 25 ? -11.271 -5.446  -2.157  1.00 0.00 ? 25 GLY A C    6 
ATOM   3949 O O    . GLY A 1 25 ? -10.935 -4.444  -1.527  1.00 0.00 ? 25 GLY A O    6 
ATOM   3950 H H    . GLY A 1 25 ? -12.727 -6.596  -4.851  1.00 0.00 ? 25 GLY A H    6 
ATOM   3951 H HA2  . GLY A 1 25 ? -12.774 -4.338  -3.258  1.00 0.00 ? 25 GLY A HA2  6 
ATOM   3952 H HA3  . GLY A 1 25 ? -13.272 -5.953  -2.752  1.00 0.00 ? 25 GLY A HA3  6 
ATOM   3953 N N    . ASP A 1 26 ? -10.661 -6.635  -2.030  1.00 0.00 ? 26 ASP A N    6 
ATOM   3954 C CA   . ASP A 1 26 ? -9.505  -6.921  -1.179  1.00 0.00 ? 26 ASP A CA   6 
ATOM   3955 C C    . ASP A 1 26 ? -8.396  -7.626  -1.981  1.00 0.00 ? 26 ASP A C    6 
ATOM   3956 O O    . ASP A 1 26 ? -7.218  -7.309  -1.817  1.00 0.00 ? 26 ASP A O    6 
ATOM   3957 C CB   . ASP A 1 26 ? -9.951  -7.757  0.032   1.00 0.00 ? 26 ASP A CB   6 
ATOM   3958 C CG   . ASP A 1 26 ? -8.803  -8.053  1.006   1.00 0.00 ? 26 ASP A CG   6 
ATOM   3959 O OD1  . ASP A 1 26 ? -8.174  -7.072  1.461   1.00 0.00 ? 26 ASP A OD1  6 
ATOM   3960 O OD2  . ASP A 1 26 ? -8.571  -9.251  1.279   1.00 0.00 ? 26 ASP A OD2  6 
ATOM   3961 H H    . ASP A 1 26 ? -11.016 -7.402  -2.581  1.00 0.00 ? 26 ASP A H    6 
ATOM   3962 H HA   . ASP A 1 26 ? -9.103  -5.992  -0.782  1.00 0.00 ? 26 ASP A HA   6 
ATOM   3963 H HB2  . ASP A 1 26 ? -10.727 -7.218  0.578   1.00 0.00 ? 26 ASP A HB2  6 
ATOM   3964 H HB3  . ASP A 1 26 ? -10.380 -8.689  -0.332  1.00 0.00 ? 26 ASP A HB3  6 
ATOM   3965 N N    . ASP A 1 27 ? -8.779  -8.594  -2.828  1.00 0.00 ? 27 ASP A N    6 
ATOM   3966 C CA   . ASP A 1 27 ? -7.907  -9.451  -3.610  1.00 0.00 ? 27 ASP A CA   6 
ATOM   3967 C C    . ASP A 1 27 ? -7.138  -8.644  -4.667  1.00 0.00 ? 27 ASP A C    6 
ATOM   3968 O O    . ASP A 1 27 ? -7.708  -7.846  -5.409  1.00 0.00 ? 27 ASP A O    6 
ATOM   3969 C CB   . ASP A 1 27 ? -8.741  -10.583 -4.231  1.00 0.00 ? 27 ASP A CB   6 
ATOM   3970 C CG   . ASP A 1 27 ? -7.913  -11.604 -5.017  1.00 0.00 ? 27 ASP A CG   6 
ATOM   3971 O OD1  . ASP A 1 27 ? -6.923  -12.105 -4.442  1.00 0.00 ? 27 ASP A OD1  6 
ATOM   3972 O OD2  . ASP A 1 27 ? -8.290  -11.873 -6.178  1.00 0.00 ? 27 ASP A OD2  6 
ATOM   3973 H H    . ASP A 1 27 ? -9.756  -8.797  -2.917  1.00 0.00 ? 27 ASP A H    6 
ATOM   3974 H HA   . ASP A 1 27 ? -7.221  -9.921  -2.906  1.00 0.00 ? 27 ASP A HA   6 
ATOM   3975 H HB2  . ASP A 1 27 ? -9.262  -11.120 -3.437  1.00 0.00 ? 27 ASP A HB2  6 
ATOM   3976 H HB3  . ASP A 1 27 ? -9.486  -10.136 -4.884  1.00 0.00 ? 27 ASP A HB3  6 
ATOM   3977 N N    . MET A 1 28 ? -5.826  -8.893  -4.696  1.00 0.00 ? 28 MET A N    6 
ATOM   3978 C CA   . MET A 1 28 ? -4.818  -8.365  -5.622  1.00 0.00 ? 28 MET A CA   6 
ATOM   3979 C C    . MET A 1 28 ? -4.545  -6.854  -5.516  1.00 0.00 ? 28 MET A C    6 
ATOM   3980 O O    . MET A 1 28 ? -3.878  -6.273  -6.371  1.00 0.00 ? 28 MET A O    6 
ATOM   3981 C CB   . MET A 1 28 ? -5.130  -8.782  -7.064  1.00 0.00 ? 28 MET A CB   6 
ATOM   3982 C CG   . MET A 1 28 ? -5.113  -10.304 -7.262  1.00 0.00 ? 28 MET A CG   6 
ATOM   3983 S SD   . MET A 1 28 ? -5.294  -10.873 -8.976  1.00 0.00 ? 28 MET A SD   6 
ATOM   3984 C CE   . MET A 1 28 ? -6.924  -10.197 -9.392  1.00 0.00 ? 28 MET A CE   6 
ATOM   3985 H H    . MET A 1 28 ? -5.526  -9.547  -3.994  1.00 0.00 ? 28 MET A H    6 
ATOM   3986 H HA   . MET A 1 28 ? -3.882  -8.832  -5.321  1.00 0.00 ? 28 MET A HA   6 
ATOM   3987 H HB2  . MET A 1 28 ? -6.094  -8.370  -7.355  1.00 0.00 ? 28 MET A HB2  6 
ATOM   3988 H HB3  . MET A 1 28 ? -4.365  -8.343  -7.695  1.00 0.00 ? 28 MET A HB3  6 
ATOM   3989 H HG2  . MET A 1 28 ? -4.167  -10.697 -6.889  1.00 0.00 ? 28 MET A HG2  6 
ATOM   3990 H HG3  . MET A 1 28 ? -5.914  -10.751 -6.677  1.00 0.00 ? 28 MET A HG3  6 
ATOM   3991 H HE1  . MET A 1 28 ? -6.881  -9.109  -9.419  1.00 0.00 ? 28 MET A HE1  6 
ATOM   3992 H HE2  . MET A 1 28 ? -7.220  -10.562 -10.375 1.00 0.00 ? 28 MET A HE2  6 
ATOM   3993 H HE3  . MET A 1 28 ? -7.659  -10.517 -8.653  1.00 0.00 ? 28 MET A HE3  6 
ATOM   3994 N N    . ASP A 1 29 ? -5.011  -6.238  -4.431  1.00 0.00 ? 29 ASP A N    6 
ATOM   3995 C CA   . ASP A 1 29 ? -4.676  -4.881  -3.998  1.00 0.00 ? 29 ASP A CA   6 
ATOM   3996 C C    . ASP A 1 29 ? -3.233  -4.832  -3.448  1.00 0.00 ? 29 ASP A C    6 
ATOM   3997 O O    . ASP A 1 29 ? -2.516  -5.826  -3.540  1.00 0.00 ? 29 ASP A O    6 
ATOM   3998 C CB   . ASP A 1 29 ? -5.726  -4.440  -2.968  1.00 0.00 ? 29 ASP A CB   6 
ATOM   3999 C CG   . ASP A 1 29 ? -7.161  -4.377  -3.510  1.00 0.00 ? 29 ASP A CG   6 
ATOM   4000 O OD1  . ASP A 1 29 ? -7.318  -4.224  -4.739  1.00 0.00 ? 29 ASP A OD1  6 
ATOM   4001 O OD2  . ASP A 1 29 ? -8.088  -4.460  -2.677  1.00 0.00 ? 29 ASP A OD2  6 
ATOM   4002 H H    . ASP A 1 29 ? -5.550  -6.826  -3.820  1.00 0.00 ? 29 ASP A H    6 
ATOM   4003 H HA   . ASP A 1 29 ? -4.718  -4.199  -4.851  1.00 0.00 ? 29 ASP A HA   6 
ATOM   4004 H HB2  . ASP A 1 29 ? -5.696  -5.145  -2.139  1.00 0.00 ? 29 ASP A HB2  6 
ATOM   4005 H HB3  . ASP A 1 29 ? -5.468  -3.453  -2.599  1.00 0.00 ? 29 ASP A HB3  6 
ATOM   4006 N N    . ASP A 1 30 ? -2.774  -3.681  -2.917  1.00 0.00 ? 30 ASP A N    6 
ATOM   4007 C CA   . ASP A 1 30 ? -1.369  -3.456  -2.550  1.00 0.00 ? 30 ASP A CA   6 
ATOM   4008 C C    . ASP A 1 30 ? -1.292  -2.205  -1.668  1.00 0.00 ? 30 ASP A C    6 
ATOM   4009 O O    . ASP A 1 30 ? -1.440  -1.105  -2.179  1.00 0.00 ? 30 ASP A O    6 
ATOM   4010 C CB   . ASP A 1 30 ? -0.509  -3.227  -3.810  1.00 0.00 ? 30 ASP A CB   6 
ATOM   4011 C CG   . ASP A 1 30 ? -0.232  -4.493  -4.624  1.00 0.00 ? 30 ASP A CG   6 
ATOM   4012 O OD1  . ASP A 1 30 ? 0.573   -5.316  -4.137  1.00 0.00 ? 30 ASP A OD1  6 
ATOM   4013 O OD2  . ASP A 1 30 ? -0.831  -4.620  -5.716  1.00 0.00 ? 30 ASP A OD2  6 
ATOM   4014 H H    . ASP A 1 30 ? -3.400  -2.891  -2.793  1.00 0.00 ? 30 ASP A H    6 
ATOM   4015 H HA   . ASP A 1 30 ? -0.981  -4.317  -1.997  1.00 0.00 ? 30 ASP A HA   6 
ATOM   4016 H HB2  . ASP A 1 30 ? -0.994  -2.478  -4.434  1.00 0.00 ? 30 ASP A HB2  6 
ATOM   4017 H HB3  . ASP A 1 30 ? 0.459   -2.823  -3.516  1.00 0.00 ? 30 ASP A HB3  6 
ATOM   4018 N N    . TYR A 1 31 ? -1.074  -2.370  -0.361  1.00 0.00 ? 31 TYR A N    6 
ATOM   4019 C CA   . TYR A 1 31 ? -1.295  -1.343  0.665   1.00 0.00 ? 31 TYR A CA   6 
ATOM   4020 C C    . TYR A 1 31 ? 0.021   -0.817  1.272   1.00 0.00 ? 31 TYR A C    6 
ATOM   4021 O O    . TYR A 1 31 ? 0.900   -1.606  1.612   1.00 0.00 ? 31 TYR A O    6 
ATOM   4022 C CB   . TYR A 1 31 ? -2.199  -1.907  1.780   1.00 0.00 ? 31 TYR A CB   6 
ATOM   4023 C CG   . TYR A 1 31 ? -3.480  -2.612  1.338   1.00 0.00 ? 31 TYR A CG   6 
ATOM   4024 C CD1  . TYR A 1 31 ? -3.428  -3.897  0.748   1.00 0.00 ? 31 TYR A CD1  6 
ATOM   4025 C CD2  . TYR A 1 31 ? -4.739  -2.010  1.557   1.00 0.00 ? 31 TYR A CD2  6 
ATOM   4026 C CE1  . TYR A 1 31 ? -4.607  -4.531  0.309   1.00 0.00 ? 31 TYR A CE1  6 
ATOM   4027 C CE2  . TYR A 1 31 ? -5.926  -2.686  1.206   1.00 0.00 ? 31 TYR A CE2  6 
ATOM   4028 C CZ   . TYR A 1 31 ? -5.857  -3.909  0.508   1.00 0.00 ? 31 TYR A CZ   6 
ATOM   4029 O OH   . TYR A 1 31 ? -7.007  -4.524  0.104   1.00 0.00 ? 31 TYR A OH   6 
ATOM   4030 H H    . TYR A 1 31 ? -0.958  -3.324  -0.066  1.00 0.00 ? 31 TYR A H    6 
ATOM   4031 H HA   . TYR A 1 31 ? -1.836  -0.499  0.223   1.00 0.00 ? 31 TYR A HA   6 
ATOM   4032 H HB2  . TYR A 1 31 ? -1.635  -2.578  2.434   1.00 0.00 ? 31 TYR A HB2  6 
ATOM   4033 H HB3  . TYR A 1 31 ? -2.462  -1.054  2.398   1.00 0.00 ? 31 TYR A HB3  6 
ATOM   4034 H HD1  . TYR A 1 31 ? -2.488  -4.405  0.616   1.00 0.00 ? 31 TYR A HD1  6 
ATOM   4035 H HD2  . TYR A 1 31 ? -4.808  -1.005  1.934   1.00 0.00 ? 31 TYR A HD2  6 
ATOM   4036 H HE1  . TYR A 1 31 ? -4.548  -5.501  -0.160  1.00 0.00 ? 31 TYR A HE1  6 
ATOM   4037 H HE2  . TYR A 1 31 ? -6.882  -2.207  1.368   1.00 0.00 ? 31 TYR A HE2  6 
ATOM   4038 H HH   . TYR A 1 31 ? -6.863  -5.346  -0.375  1.00 0.00 ? 31 TYR A HH   6 
ATOM   4039 N N    . CYS A 1 32 ? 0.124   0.513   1.454   1.00 0.00 ? 32 CYS A N    6 
ATOM   4040 C CA   . CYS A 1 32 ? 1.223   1.223   2.126   1.00 0.00 ? 32 CYS A CA   6 
ATOM   4041 C C    . CYS A 1 32 ? 0.987   1.110   3.635   1.00 0.00 ? 32 CYS A C    6 
ATOM   4042 O O    . CYS A 1 32 ? -0.128  1.327   4.114   1.00 0.00 ? 32 CYS A O    6 
ATOM   4043 C CB   . CYS A 1 32 ? 1.377   2.677   1.611   1.00 0.00 ? 32 CYS A CB   6 
ATOM   4044 S SG   . CYS A 1 32 ? 1.247   2.721   -0.200  1.00 0.00 ? 32 CYS A SG   6 
ATOM   4045 H H    . CYS A 1 32 ? -0.658  1.075   1.167   1.00 0.00 ? 32 CYS A H    6 
ATOM   4046 H HA   . CYS A 1 32 ? 2.151   0.717   1.864   1.00 0.00 ? 32 CYS A HA   6 
ATOM   4047 H HB2  . CYS A 1 32 ? 0.630   3.352   2.029   1.00 0.00 ? 32 CYS A HB2  6 
ATOM   4048 H HB3  . CYS A 1 32 ? 2.328   3.132   1.913   1.00 0.00 ? 32 CYS A HB3  6 
ATOM   4049 N N    . ASN A 1 33 ? 2.020   0.653   4.354   1.00 0.00 ? 33 ASN A N    6 
ATOM   4050 C CA   . ASN A 1 33 ? 1.871   -0.059  5.626   1.00 0.00 ? 33 ASN A CA   6 
ATOM   4051 C C    . ASN A 1 33 ? 2.030   0.818   6.874   1.00 0.00 ? 33 ASN A C    6 
ATOM   4052 O O    . ASN A 1 33 ? 2.031   0.277   7.979   1.00 0.00 ? 33 ASN A O    6 
ATOM   4053 C CB   . ASN A 1 33 ? 2.903   -1.195  5.667   1.00 0.00 ? 33 ASN A CB   6 
ATOM   4054 C CG   . ASN A 1 33 ? 2.710   -2.203  4.541   1.00 0.00 ? 33 ASN A CG   6 
ATOM   4055 O OD1  . ASN A 1 33 ? 1.604   -2.671  4.275   1.00 0.00 ? 33 ASN A OD1  6 
ATOM   4056 N ND2  . ASN A 1 33 ? 3.815   -2.540  3.888   1.00 0.00 ? 33 ASN A ND2  6 
ATOM   4057 H H    . ASN A 1 33 ? 2.910   0.564   3.878   1.00 0.00 ? 33 ASN A H    6 
ATOM   4058 H HA   . ASN A 1 33 ? 0.889   -0.531  5.669   1.00 0.00 ? 33 ASN A HA   6 
ATOM   4059 H HB2  . ASN A 1 33 ? 3.903   -0.754  5.627   1.00 0.00 ? 33 ASN A HB2  6 
ATOM   4060 H HB3  . ASN A 1 33 ? 2.841   -1.769  6.588   1.00 0.00 ? 33 ASN A HB3  6 
ATOM   4061 H HD21 . ASN A 1 33 ? 4.686   -2.130  4.188   1.00 0.00 ? 33 ASN A HD21 6 
ATOM   4062 H HD22 . ASN A 1 33 ? 3.782   -3.225  3.151   1.00 0.00 ? 33 ASN A HD22 6 
ATOM   4063 N N    . GLY A 1 34 ? 2.251   2.136   6.738   1.00 0.00 ? 34 GLY A N    6 
ATOM   4064 C CA   . GLY A 1 34 ? 2.731   2.958   7.846   1.00 0.00 ? 34 GLY A CA   6 
ATOM   4065 C C    . GLY A 1 34 ? 4.244   2.779   8.088   1.00 0.00 ? 34 GLY A C    6 
ATOM   4066 O O    . GLY A 1 34 ? 4.903   3.698   8.568   1.00 0.00 ? 34 GLY A O    6 
ATOM   4067 H H    . GLY A 1 34 ? 2.237   2.551   5.818   1.00 0.00 ? 34 GLY A H    6 
ATOM   4068 H HA2  . GLY A 1 34 ? 2.504   3.995   7.603   1.00 0.00 ? 34 GLY A HA2  6 
ATOM   4069 H HA3  . GLY A 1 34 ? 2.196   2.716   8.765   1.00 0.00 ? 34 GLY A HA3  6 
ATOM   4070 N N    . LYS A 1 35 ? 4.796   1.597   7.769   1.00 0.00 ? 35 LYS A N    6 
ATOM   4071 C CA   . LYS A 1 35 ? 6.203   1.255   7.847   1.00 0.00 ? 35 LYS A CA   6 
ATOM   4072 C C    . LYS A 1 35 ? 6.972   1.736   6.609   1.00 0.00 ? 35 LYS A C    6 
ATOM   4073 O O    . LYS A 1 35 ? 8.039   2.332   6.757   1.00 0.00 ? 35 LYS A O    6 
ATOM   4074 C CB   . LYS A 1 35 ? 6.295   -0.261  8.025   1.00 0.00 ? 35 LYS A CB   6 
ATOM   4075 C CG   . LYS A 1 35 ? 7.706   -0.685  8.430   1.00 0.00 ? 35 LYS A CG   6 
ATOM   4076 C CD   . LYS A 1 35 ? 7.666   -2.170  8.776   1.00 0.00 ? 35 LYS A CD   6 
ATOM   4077 C CE   . LYS A 1 35 ? 9.034   -2.641  9.287   1.00 0.00 ? 35 LYS A CE   6 
ATOM   4078 N NZ   . LYS A 1 35 ? 9.016   -4.068  9.650   1.00 0.00 ? 35 LYS A NZ   6 
ATOM   4079 H H    . LYS A 1 35 ? 4.208   0.830   7.480   1.00 0.00 ? 35 LYS A H    6 
ATOM   4080 H HA   . LYS A 1 35 ? 6.640   1.707   8.736   1.00 0.00 ? 35 LYS A HA   6 
ATOM   4081 H HB2  . LYS A 1 35 ? 5.609   -0.560  8.821   1.00 0.00 ? 35 LYS A HB2  6 
ATOM   4082 H HB3  . LYS A 1 35 ? 6.000   -0.776  7.107   1.00 0.00 ? 35 LYS A HB3  6 
ATOM   4083 H HG2  . LYS A 1 35 ? 8.407   -0.507  7.613   1.00 0.00 ? 35 LYS A HG2  6 
ATOM   4084 H HG3  . LYS A 1 35 ? 8.023   -0.118  9.307   1.00 0.00 ? 35 LYS A HG3  6 
ATOM   4085 H HD2  . LYS A 1 35 ? 6.921   -2.347  9.556   1.00 0.00 ? 35 LYS A HD2  6 
ATOM   4086 H HD3  . LYS A 1 35 ? 7.391   -2.744  7.890   1.00 0.00 ? 35 LYS A HD3  6 
ATOM   4087 H HE2  . LYS A 1 35 ? 9.789   -2.485  8.515   1.00 0.00 ? 35 LYS A HE2  6 
ATOM   4088 H HE3  . LYS A 1 35 ? 9.311   -2.064  10.173  1.00 0.00 ? 35 LYS A HE3  6 
ATOM   4089 H HZ1  . LYS A 1 35 ? 9.926   -4.340  9.995   1.00 0.00 ? 35 LYS A HZ1  6 
ATOM   4090 H HZ2  . LYS A 1 35 ? 8.325   -4.223  10.370  1.00 0.00 ? 35 LYS A HZ2  6 
ATOM   4091 H HZ3  . LYS A 1 35 ? 8.784   -4.620  8.837   1.00 0.00 ? 35 LYS A HZ3  6 
ATOM   4092 N N    . THR A 1 36 ? 6.447   1.461   5.400   1.00 0.00 ? 36 THR A N    6 
ATOM   4093 C CA   . THR A 1 36 ? 7.088   1.788   4.124   1.00 0.00 ? 36 THR A CA   6 
ATOM   4094 C C    . THR A 1 36 ? 6.089   2.275   3.059   1.00 0.00 ? 36 THR A C    6 
ATOM   4095 O O    . THR A 1 36 ? 4.882   2.036   3.141   1.00 0.00 ? 36 THR A O    6 
ATOM   4096 C CB   . THR A 1 36 ? 7.979   0.625   3.644   1.00 0.00 ? 36 THR A CB   6 
ATOM   4097 O OG1  . THR A 1 36 ? 8.625   0.933   2.423   1.00 0.00 ? 36 THR A OG1  6 
ATOM   4098 C CG2  . THR A 1 36 ? 7.220   -0.701  3.504   1.00 0.00 ? 36 THR A CG2  6 
ATOM   4099 H H    . THR A 1 36 ? 5.575   0.955   5.361   1.00 0.00 ? 36 THR A H    6 
ATOM   4100 H HA   . THR A 1 36 ? 7.766   2.620   4.306   1.00 0.00 ? 36 THR A HA   6 
ATOM   4101 H HB   . THR A 1 36 ? 8.774   0.507   4.378   1.00 0.00 ? 36 THR A HB   6 
ATOM   4102 H HG1  . THR A 1 36 ? 7.968   0.955   1.723   1.00 0.00 ? 36 THR A HG1  6 
ATOM   4103 H HG21 . THR A 1 36 ? 6.390   -0.585  2.811   1.00 0.00 ? 36 THR A HG21 6 
ATOM   4104 H HG22 . THR A 1 36 ? 6.832   -1.020  4.471   1.00 0.00 ? 36 THR A HG22 6 
ATOM   4105 H HG23 . THR A 1 36 ? 7.891   -1.475  3.130   1.00 0.00 ? 36 THR A HG23 6 
ATOM   4106 N N    . CYS A 1 37 ? 6.650   2.986   2.071   1.00 0.00 ? 37 CYS A N    6 
ATOM   4107 C CA   . CYS A 1 37 ? 5.982   3.738   1.002   1.00 0.00 ? 37 CYS A CA   6 
ATOM   4108 C C    . CYS A 1 37 ? 5.976   3.035   -0.356  1.00 0.00 ? 37 CYS A C    6 
ATOM   4109 O O    . CYS A 1 37 ? 5.198   3.417   -1.230  1.00 0.00 ? 37 CYS A O    6 
ATOM   4110 C CB   . CYS A 1 37 ? 6.682   5.100   0.836   1.00 0.00 ? 37 CYS A CB   6 
ATOM   4111 S SG   . CYS A 1 37 ? 6.893   6.029   2.375   1.00 0.00 ? 37 CYS A SG   6 
ATOM   4112 H H    . CYS A 1 37 ? 7.657   3.065   2.123   1.00 0.00 ? 37 CYS A H    6 
ATOM   4113 H HA   . CYS A 1 37 ? 4.941   3.886   1.269   1.00 0.00 ? 37 CYS A HA   6 
ATOM   4114 H HB2  . CYS A 1 37 ? 7.673   4.936   0.413   1.00 0.00 ? 37 CYS A HB2  6 
ATOM   4115 H HB3  . CYS A 1 37 ? 6.114   5.720   0.140   1.00 0.00 ? 37 CYS A HB3  6 
ATOM   4116 N N    . ASP A 1 38 ? 6.885   2.072   -0.544  1.00 0.00 ? 38 ASP A N    6 
ATOM   4117 C CA   . ASP A 1 38 ? 7.279   1.506   -1.830  1.00 0.00 ? 38 ASP A CA   6 
ATOM   4118 C C    . ASP A 1 38 ? 6.238   0.485   -2.320  1.00 0.00 ? 38 ASP A C    6 
ATOM   4119 O O    . ASP A 1 38 ? 6.528   -0.708  -2.398  1.00 0.00 ? 38 ASP A O    6 
ATOM   4120 C CB   . ASP A 1 38 ? 8.698   0.919   -1.692  1.00 0.00 ? 38 ASP A CB   6 
ATOM   4121 C CG   . ASP A 1 38 ? 9.326   0.597   -3.051  1.00 0.00 ? 38 ASP A CG   6 
ATOM   4122 O OD1  . ASP A 1 38 ? 9.805   1.554   -3.698  1.00 0.00 ? 38 ASP A OD1  6 
ATOM   4123 O OD2  . ASP A 1 38 ? 9.316   -0.597  -3.424  1.00 0.00 ? 38 ASP A OD2  6 
ATOM   4124 H H    . ASP A 1 38 ? 7.433   1.829   0.266   1.00 0.00 ? 38 ASP A H    6 
ATOM   4125 H HA   . ASP A 1 38 ? 7.330   2.323   -2.556  1.00 0.00 ? 38 ASP A HA   6 
ATOM   4126 H HB2  . ASP A 1 38 ? 9.339   1.643   -1.183  1.00 0.00 ? 38 ASP A HB2  6 
ATOM   4127 H HB3  . ASP A 1 38 ? 8.672   0.024   -1.066  1.00 0.00 ? 38 ASP A HB3  6 
ATOM   4128 N N    . CYS A 1 39 ? 5.030   0.986   -2.639  1.00 0.00 ? 39 CYS A N    6 
ATOM   4129 C CA   . CYS A 1 39 ? 3.811   0.288   -3.053  1.00 0.00 ? 39 CYS A CA   6 
ATOM   4130 C C    . CYS A 1 39 ? 3.811   -1.209  -2.677  1.00 0.00 ? 39 CYS A C    6 
ATOM   4131 O O    . CYS A 1 39 ? 3.944   -2.060  -3.557  1.00 0.00 ? 39 CYS A O    6 
ATOM   4132 C CB   . CYS A 1 39 ? 3.574   0.584   -4.546  1.00 0.00 ? 39 CYS A CB   6 
ATOM   4133 S SG   . CYS A 1 39 ? 2.054   -0.047  -5.304  1.00 0.00 ? 39 CYS A SG   6 
ATOM   4134 H H    . CYS A 1 39 ? 4.930   1.988   -2.548  1.00 0.00 ? 39 CYS A H    6 
ATOM   4135 H HA   . CYS A 1 39 ? 2.991   0.762   -2.513  1.00 0.00 ? 39 CYS A HA   6 
ATOM   4136 H HB2  . CYS A 1 39 ? 3.546   1.668   -4.673  1.00 0.00 ? 39 CYS A HB2  6 
ATOM   4137 H HB3  . CYS A 1 39 ? 4.414   0.205   -5.129  1.00 0.00 ? 39 CYS A HB3  6 
ATOM   4138 N N    . PRO A 1 40 ? 3.728   -1.531  -1.369  1.00 0.00 ? 40 PRO A N    6 
ATOM   4139 C CA   . PRO A 1 40 ? 4.059   -2.849  -0.817  1.00 0.00 ? 40 PRO A CA   6 
ATOM   4140 C C    . PRO A 1 40 ? 3.174   -4.005  -1.306  1.00 0.00 ? 40 PRO A C    6 
ATOM   4141 O O    . PRO A 1 40 ? 2.061   -3.788  -1.784  1.00 0.00 ? 40 PRO A O    6 
ATOM   4142 C CB   . PRO A 1 40 ? 3.979   -2.700  0.706   1.00 0.00 ? 40 PRO A CB   6 
ATOM   4143 C CG   . PRO A 1 40 ? 4.241   -1.212  0.920   1.00 0.00 ? 40 PRO A CG   6 
ATOM   4144 C CD   . PRO A 1 40 ? 3.539   -0.584  -0.277  1.00 0.00 ? 40 PRO A CD   6 
ATOM   4145 H HA   . PRO A 1 40 ? 5.099   -3.052  -1.088  1.00 0.00 ? 40 PRO A HA   6 
ATOM   4146 H HB2  . PRO A 1 40 ? 2.979   -2.948  1.065   1.00 0.00 ? 40 PRO A HB2  6 
ATOM   4147 H HB3  . PRO A 1 40 ? 4.714   -3.317  1.219   1.00 0.00 ? 40 PRO A HB3  6 
ATOM   4148 H HG2  . PRO A 1 40 ? 3.862   -0.840  1.870   1.00 0.00 ? 40 PRO A HG2  6 
ATOM   4149 H HG3  . PRO A 1 40 ? 5.312   -1.022  0.843   1.00 0.00 ? 40 PRO A HG3  6 
ATOM   4150 H HD2  . PRO A 1 40 ? 2.469   -0.493  -0.105  1.00 0.00 ? 40 PRO A HD2  6 
ATOM   4151 H HD3  . PRO A 1 40 ? 3.952   0.412   -0.422  1.00 0.00 ? 40 PRO A HD3  6 
ATOM   4152 N N    . ARG A 1 41 ? 3.688   -5.237  -1.167  1.00 0.00 ? 41 ARG A N    6 
ATOM   4153 C CA   . ARG A 1 41 ? 3.098   -6.460  -1.708  1.00 0.00 ? 41 ARG A CA   6 
ATOM   4154 C C    . ARG A 1 41 ? 2.080   -7.071  -0.729  1.00 0.00 ? 41 ARG A C    6 
ATOM   4155 O O    . ARG A 1 41 ? 2.234   -8.210  -0.296  1.00 0.00 ? 41 ARG A O    6 
ATOM   4156 C CB   . ARG A 1 41 ? 4.238   -7.419  -2.111  1.00 0.00 ? 41 ARG A CB   6 
ATOM   4157 C CG   . ARG A 1 41 ? 3.831   -8.734  -2.809  1.00 0.00 ? 41 ARG A CG   6 
ATOM   4158 C CD   . ARG A 1 41 ? 3.015   -8.560  -4.100  1.00 0.00 ? 41 ARG A CD   6 
ATOM   4159 N NE   . ARG A 1 41 ? 1.577   -8.350  -3.847  1.00 0.00 ? 41 ARG A NE   6 
ATOM   4160 C CZ   . ARG A 1 41 ? 0.602   -8.446  -4.773  1.00 0.00 ? 41 ARG A CZ   6 
ATOM   4161 N NH1  . ARG A 1 41 ? 0.884   -8.733  -6.053  1.00 0.00 ? 41 ARG A NH1  6 
ATOM   4162 N NH2  . ARG A 1 41 ? -0.677  -8.254  -4.419  1.00 0.00 ? 41 ARG A NH2  6 
ATOM   4163 H H    . ARG A 1 41 ? 4.592   -5.327  -0.724  1.00 0.00 ? 41 ARG A H    6 
ATOM   4164 H HA   . ARG A 1 41 ? 2.569   -6.205  -2.626  1.00 0.00 ? 41 ARG A HA   6 
ATOM   4165 H HB2  . ARG A 1 41 ? 4.902   -6.885  -2.795  1.00 0.00 ? 41 ARG A HB2  6 
ATOM   4166 H HB3  . ARG A 1 41 ? 4.821   -7.670  -1.223  1.00 0.00 ? 41 ARG A HB3  6 
ATOM   4167 H HG2  . ARG A 1 41 ? 4.762   -9.237  -3.078  1.00 0.00 ? 41 ARG A HG2  6 
ATOM   4168 H HG3  . ARG A 1 41 ? 3.303   -9.402  -2.129  1.00 0.00 ? 41 ARG A HG3  6 
ATOM   4169 H HD2  . ARG A 1 41 ? 3.414   -7.729  -4.683  1.00 0.00 ? 41 ARG A HD2  6 
ATOM   4170 H HD3  . ARG A 1 41 ? 3.127   -9.477  -4.683  1.00 0.00 ? 41 ARG A HD3  6 
ATOM   4171 H HE   . ARG A 1 41 ? 1.312   -8.127  -2.898  1.00 0.00 ? 41 ARG A HE   6 
ATOM   4172 H HH11 . ARG A 1 41 ? 1.840   -8.885  -6.341  1.00 0.00 ? 41 ARG A HH11 6 
ATOM   4173 H HH12 . ARG A 1 41 ? 0.139   -8.808  -6.729  1.00 0.00 ? 41 ARG A HH12 6 
ATOM   4174 H HH21 . ARG A 1 41 ? -0.912  -8.039  -3.462  1.00 0.00 ? 41 ARG A HH21 6 
ATOM   4175 H HH22 . ARG A 1 41 ? -1.408  -8.320  -5.112  1.00 0.00 ? 41 ARG A HH22 6 
ATOM   4176 N N    . ASN A 1 42 ? 1.010   -6.315  -0.437  1.00 0.00 ? 42 ASN A N    6 
ATOM   4177 C CA   . ASN A 1 42 ? -0.273  -6.779  0.089   1.00 0.00 ? 42 ASN A CA   6 
ATOM   4178 C C    . ASN A 1 42 ? -0.175  -7.688  1.337   1.00 0.00 ? 42 ASN A C    6 
ATOM   4179 O O    . ASN A 1 42 ? 0.042   -8.891  1.192   1.00 0.00 ? 42 ASN A O    6 
ATOM   4180 C CB   . ASN A 1 42 ? -1.079  -7.428  -1.050  1.00 0.00 ? 42 ASN A CB   6 
ATOM   4181 C CG   . ASN A 1 42 ? -2.560  -7.647  -0.714  1.00 0.00 ? 42 ASN A CG   6 
ATOM   4182 O OD1  . ASN A 1 42 ? -2.953  -7.621  0.449   1.00 0.00 ? 42 ASN A OD1  6 
ATOM   4183 N ND2  . ASN A 1 42 ? -3.391  -7.874  -1.734  1.00 0.00 ? 42 ASN A ND2  6 
ATOM   4184 H H    . ASN A 1 42 ? 1.009   -5.372  -0.800  1.00 0.00 ? 42 ASN A H    6 
ATOM   4185 H HA   . ASN A 1 42 ? -0.813  -5.866  0.333   1.00 0.00 ? 42 ASN A HA   6 
ATOM   4186 H HB2  . ASN A 1 42 ? -1.014  -6.763  -1.909  1.00 0.00 ? 42 ASN A HB2  6 
ATOM   4187 H HB3  . ASN A 1 42 ? -0.630  -8.378  -1.336  1.00 0.00 ? 42 ASN A HB3  6 
ATOM   4188 H HD21 . ASN A 1 42 ? -3.045  -7.878  -2.683  1.00 0.00 ? 42 ASN A HD21 6 
ATOM   4189 H HD22 . ASN A 1 42 ? -4.373  -8.030  -1.555  1.00 0.00 ? 42 ASN A HD22 6 
ATOM   4190 N N    . PRO A 1 43 ? -0.402  -7.147  2.552   1.00 0.00 ? 43 PRO A N    6 
ATOM   4191 C CA   . PRO A 1 43 ? -0.444  -7.889  3.813   1.00 0.00 ? 43 PRO A CA   6 
ATOM   4192 C C    . PRO A 1 43 ? -1.277  -9.183  3.822   1.00 0.00 ? 43 PRO A C    6 
ATOM   4193 O O    . PRO A 1 43 ? -0.936  -10.113 4.552   1.00 0.00 ? 43 PRO A O    6 
ATOM   4194 C CB   . PRO A 1 43 ? -0.961  -6.893  4.858   1.00 0.00 ? 43 PRO A CB   6 
ATOM   4195 C CG   . PRO A 1 43 ? -0.458  -5.552  4.327   1.00 0.00 ? 43 PRO A CG   6 
ATOM   4196 C CD   . PRO A 1 43 ? -0.603  -5.726  2.815   1.00 0.00 ? 43 PRO A CD   6 
ATOM   4197 H HA   . PRO A 1 43 ? 0.582   -8.151  4.054   1.00 0.00 ? 43 PRO A HA   6 
ATOM   4198 H HB2  . PRO A 1 43 ? -2.054  -6.879  4.867   1.00 0.00 ? 43 PRO A HB2  6 
ATOM   4199 H HB3  . PRO A 1 43 ? -0.586  -7.108  5.860   1.00 0.00 ? 43 PRO A HB3  6 
ATOM   4200 H HG2  . PRO A 1 43 ? -1.038  -4.709  4.705   1.00 0.00 ? 43 PRO A HG2  6 
ATOM   4201 H HG3  . PRO A 1 43 ? 0.594   -5.426  4.586   1.00 0.00 ? 43 PRO A HG3  6 
ATOM   4202 H HD2  . PRO A 1 43 ? -1.617  -5.453  2.520   1.00 0.00 ? 43 PRO A HD2  6 
ATOM   4203 H HD3  . PRO A 1 43 ? 0.123   -5.096  2.298   1.00 0.00 ? 43 PRO A HD3  6 
ATOM   4204 N N    . HIS A 1 44 ? -2.367  -9.240  3.042   1.00 0.00 ? 44 HIS A N    6 
ATOM   4205 C CA   . HIS A 1 44 ? -3.324  -10.346 3.034   1.00 0.00 ? 44 HIS A CA   6 
ATOM   4206 C C    . HIS A 1 44 ? -2.736  -11.636 2.447   1.00 0.00 ? 44 HIS A C    6 
ATOM   4207 O O    . HIS A 1 44 ? -3.181  -12.728 2.801   1.00 0.00 ? 44 HIS A O    6 
ATOM   4208 C CB   . HIS A 1 44 ? -4.604  -9.926  2.286   1.00 0.00 ? 44 HIS A CB   6 
ATOM   4209 C CG   . HIS A 1 44 ? -5.220  -8.656  2.821   1.00 0.00 ? 44 HIS A CG   6 
ATOM   4210 N ND1  . HIS A 1 44 ? -5.108  -7.401  2.268   1.00 0.00 ? 44 HIS A ND1  6 
ATOM   4211 C CD2  . HIS A 1 44 ? -5.760  -8.506  4.068   1.00 0.00 ? 44 HIS A CD2  6 
ATOM   4212 C CE1  . HIS A 1 44 ? -5.578  -6.519  3.165   1.00 0.00 ? 44 HIS A CE1  6 
ATOM   4213 N NE2  . HIS A 1 44 ? -5.995  -7.144  4.278   1.00 0.00 ? 44 HIS A NE2  6 
ATOM   4214 H H    . HIS A 1 44 ? -2.553  -8.480  2.406   1.00 0.00 ? 44 HIS A H    6 
ATOM   4215 H HA   . HIS A 1 44 ? -3.593  -10.555 4.068   1.00 0.00 ? 44 HIS A HA   6 
ATOM   4216 H HB2  . HIS A 1 44 ? -4.381  -9.783  1.229   1.00 0.00 ? 44 HIS A HB2  6 
ATOM   4217 H HB3  . HIS A 1 44 ? -5.343  -10.726 2.364   1.00 0.00 ? 44 HIS A HB3  6 
ATOM   4218 H HD1  . HIS A 1 44 ? -4.677  -7.180  1.380   1.00 0.00 ? 44 HIS A HD1  6 
ATOM   4219 H HD2  . HIS A 1 44 ? -5.877  -9.298  4.788   1.00 0.00 ? 44 HIS A HD2  6 
ATOM   4220 H HE1  . HIS A 1 44 ? -5.583  -5.450  3.024   1.00 0.00 ? 44 HIS A HE1  6 
ATOM   4221 N N    . LYS A 1 45 ? -1.800  -11.505 1.498   1.00 0.00 ? 45 LYS A N    6 
ATOM   4222 C CA   . LYS A 1 45 ? -1.270  -12.594 0.688   1.00 0.00 ? 45 LYS A CA   6 
ATOM   4223 C C    . LYS A 1 45 ? -0.139  -13.328 1.410   1.00 0.00 ? 45 LYS A C    6 
ATOM   4224 O O    . LYS A 1 45 ? -0.228  -14.535 1.638   1.00 0.00 ? 45 LYS A O    6 
ATOM   4225 C CB   . LYS A 1 45 ? -0.842  -12.068 -0.694  1.00 0.00 ? 45 LYS A CB   6 
ATOM   4226 C CG   . LYS A 1 45 ? -1.941  -11.259 -1.408  1.00 0.00 ? 45 LYS A CG   6 
ATOM   4227 C CD   . LYS A 1 45 ? -3.307  -11.964 -1.392  1.00 0.00 ? 45 LYS A CD   6 
ATOM   4228 C CE   . LYS A 1 45 ? -4.324  -11.347 -2.363  1.00 0.00 ? 45 LYS A CE   6 
ATOM   4229 N NZ   . LYS A 1 45 ? -3.933  -11.528 -3.772  1.00 0.00 ? 45 LYS A NZ   6 
ATOM   4230 H H    . LYS A 1 45 ? -1.488  -10.572 1.275   1.00 0.00 ? 45 LYS A H    6 
ATOM   4231 H HA   . LYS A 1 45 ? -2.066  -13.313 0.526   1.00 0.00 ? 45 LYS A HA   6 
ATOM   4232 H HB2  . LYS A 1 45 ? 0.039   -11.431 -0.597  1.00 0.00 ? 45 LYS A HB2  6 
ATOM   4233 H HB3  . LYS A 1 45 ? -0.574  -12.922 -1.320  1.00 0.00 ? 45 LYS A HB3  6 
ATOM   4234 H HG2  . LYS A 1 45 ? -2.049  -10.293 -0.920  1.00 0.00 ? 45 LYS A HG2  6 
ATOM   4235 H HG3  . LYS A 1 45 ? -1.614  -11.087 -2.435  1.00 0.00 ? 45 LYS A HG3  6 
ATOM   4236 H HD2  . LYS A 1 45 ? -3.174  -13.014 -1.658  1.00 0.00 ? 45 LYS A HD2  6 
ATOM   4237 H HD3  . LYS A 1 45 ? -3.732  -11.916 -0.389  1.00 0.00 ? 45 LYS A HD3  6 
ATOM   4238 H HE2  . LYS A 1 45 ? -5.287  -11.837 -2.215  1.00 0.00 ? 45 LYS A HE2  6 
ATOM   4239 H HE3  . LYS A 1 45 ? -4.445  -10.286 -2.153  1.00 0.00 ? 45 LYS A HE3  6 
ATOM   4240 H HZ1  . LYS A 1 45 ? -3.805  -12.512 -3.962  1.00 0.00 ? 45 LYS A HZ1  6 
ATOM   4241 H HZ2  . LYS A 1 45 ? -4.660  -11.165 -4.373  1.00 0.00 ? 45 LYS A HZ2  6 
ATOM   4242 H HZ3  . LYS A 1 45 ? -3.070  -11.036 -3.955  1.00 0.00 ? 45 LYS A HZ3  6 
ATOM   4243 N N    . GLY A 1 46 ? 0.922   -12.592 1.763   1.00 0.00 ? 46 GLY A N    6 
ATOM   4244 C CA   . GLY A 1 46 ? 2.094   -13.121 2.446   1.00 0.00 ? 46 GLY A CA   6 
ATOM   4245 C C    . GLY A 1 46 ? 2.842   -11.994 3.164   1.00 0.00 ? 46 GLY A C    6 
ATOM   4246 O O    . GLY A 1 46 ? 2.617   -11.793 4.358   1.00 0.00 ? 46 GLY A O    6 
ATOM   4247 H H    . GLY A 1 46 ? 0.900   -11.611 1.531   1.00 0.00 ? 46 GLY A H    6 
ATOM   4248 H HA2  . GLY A 1 46 ? 1.787   -13.860 3.189   1.00 0.00 ? 46 GLY A HA2  6 
ATOM   4249 H HA3  . GLY A 1 46 ? 2.739   -13.626 1.726   1.00 0.00 ? 46 GLY A HA3  6 
ATOM   4250 N N    . PRO A 1 47 ? 3.735   -11.264 2.469   1.00 0.00 ? 47 PRO A N    6 
ATOM   4251 C CA   . PRO A 1 47 ? 4.583   -10.240 3.068   1.00 0.00 ? 47 PRO A CA   6 
ATOM   4252 C C    . PRO A 1 47 ? 3.800   -8.943  3.322   1.00 0.00 ? 47 PRO A C    6 
ATOM   4253 O O    . PRO A 1 47 ? 2.900   -8.587  2.560   1.00 0.00 ? 47 PRO A O    6 
ATOM   4254 C CB   . PRO A 1 47 ? 5.714   -10.020 2.057   1.00 0.00 ? 47 PRO A CB   6 
ATOM   4255 C CG   . PRO A 1 47 ? 5.022   -10.282 0.719   1.00 0.00 ? 47 PRO A CG   6 
ATOM   4256 C CD   . PRO A 1 47 ? 4.051   -11.418 1.054   1.00 0.00 ? 47 PRO A CD   6 
ATOM   4257 H HA   . PRO A 1 47 ? 5.013   -10.609 4.003   1.00 0.00 ? 47 PRO A HA   6 
ATOM   4258 H HB2  . PRO A 1 47 ? 6.157   -9.022  2.111   1.00 0.00 ? 47 PRO A HB2  6 
ATOM   4259 H HB3  . PRO A 1 47 ? 6.492   -10.771 2.208   1.00 0.00 ? 47 PRO A HB3  6 
ATOM   4260 H HG2  . PRO A 1 47 ? 4.465   -9.392  0.425   1.00 0.00 ? 47 PRO A HG2  6 
ATOM   4261 H HG3  . PRO A 1 47 ? 5.726   -10.552 -0.070  1.00 0.00 ? 47 PRO A HG3  6 
ATOM   4262 H HD2  . PRO A 1 47 ? 3.160   -11.354 0.428   1.00 0.00 ? 47 PRO A HD2  6 
ATOM   4263 H HD3  . PRO A 1 47 ? 4.550   -12.375 0.897   1.00 0.00 ? 47 PRO A HD3  6 
ATOM   4264 N N    . ALA A 1 48 ? 4.183   -8.220  4.384   1.00 0.00 ? 48 ALA A N    6 
ATOM   4265 C CA   . ALA A 1 48 ? 3.719   -6.866  4.664   1.00 0.00 ? 48 ALA A CA   6 
ATOM   4266 C C    . ALA A 1 48 ? 4.430   -5.891  3.717   1.00 0.00 ? 48 ALA A C    6 
ATOM   4267 O O    . ALA A 1 48 ? 3.779   -5.237  2.903   1.00 0.00 ? 48 ALA A O    6 
ATOM   4268 C CB   . ALA A 1 48 ? 3.969   -6.523  6.140   1.00 0.00 ? 48 ALA A CB   6 
ATOM   4269 H H    . ALA A 1 48 ? 4.923   -8.582  4.969   1.00 0.00 ? 48 ALA A H    6 
ATOM   4270 H HA   . ALA A 1 48 ? 2.642   -6.812  4.497   1.00 0.00 ? 48 ALA A HA   6 
ATOM   4271 H HB1  . ALA A 1 48 ? 5.030   -6.601  6.385   1.00 0.00 ? 48 ALA A HB1  6 
ATOM   4272 H HB2  . ALA A 1 48 ? 3.633   -5.506  6.347   1.00 0.00 ? 48 ALA A HB2  6 
ATOM   4273 H HB3  . ALA A 1 48 ? 3.413   -7.211  6.780   1.00 0.00 ? 48 ALA A HB3  6 
ATOM   4274 N N    . THR A 1 49 ? 5.769   -5.828  3.817   1.00 0.00 ? 49 THR A N    6 
ATOM   4275 C CA   . THR A 1 49 ? 6.654   -4.971  3.029   1.00 0.00 ? 49 THR A CA   6 
ATOM   4276 C C    . THR A 1 49 ? 6.610   -5.303  1.524   1.00 0.00 ? 49 THR A C    6 
ATOM   4277 O O    . THR A 1 49 ? 6.079   -6.332  1.105   1.00 0.00 ? 49 THR A O    6 
ATOM   4278 C CB   . THR A 1 49 ? 8.095   -5.066  3.580   1.00 0.00 ? 49 THR A CB   6 
ATOM   4279 O OG1  . THR A 1 49 ? 8.601   -6.381  3.443   1.00 0.00 ? 49 THR A OG1  6 
ATOM   4280 C CG2  . THR A 1 49 ? 8.197   -4.631  5.051   1.00 0.00 ? 49 THR A CG2  6 
ATOM   4281 H H    . THR A 1 49 ? 6.214   -6.428  4.496   1.00 0.00 ? 49 THR A H    6 
ATOM   4282 H HA   . THR A 1 49 ? 6.317   -3.941  3.161   1.00 0.00 ? 49 THR A HA   6 
ATOM   4283 H HB   . THR A 1 49 ? 8.739   -4.402  2.999   1.00 0.00 ? 49 THR A HB   6 
ATOM   4284 H HG1  . THR A 1 49 ? 8.055   -6.978  3.960   1.00 0.00 ? 49 THR A HG1  6 
ATOM   4285 H HG21 . THR A 1 49 ? 9.241   -4.648  5.367   1.00 0.00 ? 49 THR A HG21 6 
ATOM   4286 H HG22 . THR A 1 49 ? 7.629   -5.303  5.695   1.00 0.00 ? 49 THR A HG22 6 
ATOM   4287 H HG23 . THR A 1 49 ? 7.813   -3.618  5.168   1.00 0.00 ? 49 THR A HG23 6 
HETATM 4288 N N    . NH2 A 1 50 ? 7.168   -4.412  0.698   1.00 0.00 ? 50 NH2 A N    6 
HETATM 4289 H HN1  . NH2 A 1 50 ? 7.162   -4.577  -0.299  1.00 0.00 ? 50 NH2 A HN1  6 
HETATM 4290 H HN2  . NH2 A 1 50 ? 7.593   -3.576  1.071   1.00 0.00 ? 50 NH2 A HN2  6 
ATOM   4291 N N    . GLU A 1 1  ? 13.614  10.540  7.292   1.00 0.00 ? 1  GLU A N    7 
ATOM   4292 C CA   . GLU A 1 1  ? 12.605  11.024  6.325   1.00 0.00 ? 1  GLU A CA   7 
ATOM   4293 C C    . GLU A 1 1  ? 11.937  9.858   5.574   1.00 0.00 ? 1  GLU A C    7 
ATOM   4294 O O    . GLU A 1 1  ? 12.308  8.696   5.748   1.00 0.00 ? 1  GLU A O    7 
ATOM   4295 C CB   . GLU A 1 1  ? 13.218  12.049  5.348   1.00 0.00 ? 1  GLU A CB   7 
ATOM   4296 C CG   . GLU A 1 1  ? 13.842  13.256  6.069   1.00 0.00 ? 1  GLU A CG   7 
ATOM   4297 C CD   . GLU A 1 1  ? 14.339  14.310  5.075   1.00 0.00 ? 1  GLU A CD   7 
ATOM   4298 O OE1  . GLU A 1 1  ? 15.435  14.095  4.515   1.00 0.00 ? 1  GLU A OE1  7 
ATOM   4299 O OE2  . GLU A 1 1  ? 13.610  15.311  4.888   1.00 0.00 ? 1  GLU A OE2  7 
ATOM   4300 H H1   . GLU A 1 1  ? 14.369  10.093  6.791   1.00 0.00 ? 1  GLU A H1   7 
ATOM   4301 H H2   . GLU A 1 1  ? 13.186  9.873   7.918   1.00 0.00 ? 1  GLU A H2   7 
ATOM   4302 H H3   . GLU A 1 1  ? 13.977  11.316  7.826   1.00 0.00 ? 1  GLU A H3   7 
ATOM   4303 H HA   . GLU A 1 1  ? 11.831  11.528  6.905   1.00 0.00 ? 1  GLU A HA   7 
ATOM   4304 H HB2  . GLU A 1 1  ? 13.979  11.559  4.738   1.00 0.00 ? 1  GLU A HB2  7 
ATOM   4305 H HB3  . GLU A 1 1  ? 12.434  12.421  4.685   1.00 0.00 ? 1  GLU A HB3  7 
ATOM   4306 H HG2  . GLU A 1 1  ? 13.100  13.701  6.733   1.00 0.00 ? 1  GLU A HG2  7 
ATOM   4307 H HG3  . GLU A 1 1  ? 14.688  12.929  6.676   1.00 0.00 ? 1  GLU A HG3  7 
ATOM   4308 N N    . CYS A 1 2  ? 10.937  10.173  4.735   1.00 0.00 ? 2  CYS A N    7 
ATOM   4309 C CA   . CYS A 1 2  ? 10.186  9.217   3.939   1.00 0.00 ? 2  CYS A CA   7 
ATOM   4310 C C    . CYS A 1 2  ? 11.070  8.550   2.878   1.00 0.00 ? 2  CYS A C    7 
ATOM   4311 O O    . CYS A 1 2  ? 11.899  9.201   2.241   1.00 0.00 ? 2  CYS A O    7 
ATOM   4312 C CB   . CYS A 1 2  ? 8.969   9.914   3.306   1.00 0.00 ? 2  CYS A CB   7 
ATOM   4313 S SG   . CYS A 1 2  ? 9.326   11.203  2.069   1.00 0.00 ? 2  CYS A SG   7 
ATOM   4314 H H    . CYS A 1 2  ? 10.657  11.132  4.622   1.00 0.00 ? 2  CYS A H    7 
ATOM   4315 H HA   . CYS A 1 2  ? 9.807   8.455   4.621   1.00 0.00 ? 2  CYS A HA   7 
ATOM   4316 H HB2  . CYS A 1 2  ? 8.366   9.155   2.815   1.00 0.00 ? 2  CYS A HB2  7 
ATOM   4317 H HB3  . CYS A 1 2  ? 8.358   10.338  4.103   1.00 0.00 ? 2  CYS A HB3  7 
ATOM   4318 N N    . GLU A 1 3  ? 10.836  7.249   2.664   1.00 0.00 ? 3  GLU A N    7 
ATOM   4319 C CA   . GLU A 1 3  ? 11.296  6.497   1.497   1.00 0.00 ? 3  GLU A CA   7 
ATOM   4320 C C    . GLU A 1 3  ? 10.711  7.049   0.180   1.00 0.00 ? 3  GLU A C    7 
ATOM   4321 O O    . GLU A 1 3  ? 11.285  6.847   -0.890  1.00 0.00 ? 3  GLU A O    7 
ATOM   4322 C CB   . GLU A 1 3  ? 10.976  5.009   1.690   1.00 0.00 ? 3  GLU A CB   7 
ATOM   4323 C CG   . GLU A 1 3  ? 11.692  4.369   2.893   1.00 0.00 ? 3  GLU A CG   7 
ATOM   4324 C CD   . GLU A 1 3  ? 11.174  2.958   3.197   1.00 0.00 ? 3  GLU A CD   7 
ATOM   4325 O OE1  . GLU A 1 3  ? 10.875  2.226   2.227   1.00 0.00 ? 3  GLU A OE1  7 
ATOM   4326 O OE2  . GLU A 1 3  ? 11.085  2.629   4.400   1.00 0.00 ? 3  GLU A OE2  7 
ATOM   4327 H H    . GLU A 1 3  ? 10.154  6.797   3.250   1.00 0.00 ? 3  GLU A H    7 
ATOM   4328 H HA   . GLU A 1 3  ? 12.368  6.606   1.438   1.00 0.00 ? 3  GLU A HA   7 
ATOM   4329 H HB2  . GLU A 1 3  ? 9.908   4.903   1.833   1.00 0.00 ? 3  GLU A HB2  7 
ATOM   4330 H HB3  . GLU A 1 3  ? 11.252  4.471   0.787   1.00 0.00 ? 3  GLU A HB3  7 
ATOM   4331 H HG2  . GLU A 1 3  ? 12.762  4.318   2.688   1.00 0.00 ? 3  GLU A HG2  7 
ATOM   4332 H HG3  . GLU A 1 3  ? 11.543  4.991   3.777   1.00 0.00 ? 3  GLU A HG3  7 
ATOM   4333 N N    . SER A 1 4  ? 9.596   7.781   0.290   1.00 0.00 ? 4  SER A N    7 
ATOM   4334 C CA   . SER A 1 4  ? 9.003   8.688   -0.682  1.00 0.00 ? 4  SER A CA   7 
ATOM   4335 C C    . SER A 1 4  ? 8.255   7.959   -1.805  1.00 0.00 ? 4  SER A C    7 
ATOM   4336 O O    . SER A 1 4  ? 8.846   7.535   -2.797  1.00 0.00 ? 4  SER A O    7 
ATOM   4337 C CB   . SER A 1 4  ? 10.036  9.696   -1.217  1.00 0.00 ? 4  SER A CB   7 
ATOM   4338 O OG   . SER A 1 4  ? 9.390   10.731  -1.930  1.00 0.00 ? 4  SER A OG   7 
ATOM   4339 H H    . SER A 1 4  ? 9.243   7.856   1.229   1.00 0.00 ? 4  SER A H    7 
ATOM   4340 H HA   . SER A 1 4  ? 8.274   9.258   -0.089  1.00 0.00 ? 4  SER A HA   7 
ATOM   4341 H HB2  . SER A 1 4  ? 10.585  10.149  -0.389  1.00 0.00 ? 4  SER A HB2  7 
ATOM   4342 H HB3  . SER A 1 4  ? 10.752  9.211   -1.879  1.00 0.00 ? 4  SER A HB3  7 
ATOM   4343 H HG   . SER A 1 4  ? 8.929   10.345  -2.679  1.00 0.00 ? 4  SER A HG   7 
ATOM   4344 N N    . GLY A 1 5  ? 6.929   7.894   -1.649  1.00 0.00 ? 5  GLY A N    7 
ATOM   4345 C CA   . GLY A 1 5  ? 5.920   7.654   -2.665  1.00 0.00 ? 5  GLY A CA   7 
ATOM   4346 C C    . GLY A 1 5  ? 4.625   8.337   -2.190  1.00 0.00 ? 5  GLY A C    7 
ATOM   4347 O O    . GLY A 1 5  ? 4.503   8.621   -1.006  1.00 0.00 ? 5  GLY A O    7 
ATOM   4348 H H    . GLY A 1 5  ? 6.549   8.240   -0.783  1.00 0.00 ? 5  GLY A H    7 
ATOM   4349 H HA2  . GLY A 1 5  ? 6.272   8.052   -3.611  1.00 0.00 ? 5  GLY A HA2  7 
ATOM   4350 H HA3  . GLY A 1 5  ? 5.751   6.581   -2.763  1.00 0.00 ? 5  GLY A HA3  7 
ATOM   4351 N N    . PRO A 1 6  ? 3.625   8.595   -3.050  1.00 0.00 ? 6  PRO A N    7 
ATOM   4352 C CA   . PRO A 1 6  ? 2.261   8.961   -2.642  1.00 0.00 ? 6  PRO A CA   7 
ATOM   4353 C C    . PRO A 1 6  ? 1.597   7.941   -1.692  1.00 0.00 ? 6  PRO A C    7 
ATOM   4354 O O    . PRO A 1 6  ? 0.682   8.290   -0.948  1.00 0.00 ? 6  PRO A O    7 
ATOM   4355 C CB   . PRO A 1 6  ? 1.472   9.124   -3.947  1.00 0.00 ? 6  PRO A CB   7 
ATOM   4356 C CG   . PRO A 1 6  ? 2.563   9.445   -4.969  1.00 0.00 ? 6  PRO A CG   7 
ATOM   4357 C CD   . PRO A 1 6  ? 3.742   8.595   -4.488  1.00 0.00 ? 6  PRO A CD   7 
ATOM   4358 H HA   . PRO A 1 6  ? 2.319   9.927   -2.137  1.00 0.00 ? 6  PRO A HA   7 
ATOM   4359 H HB2  . PRO A 1 6  ? 0.998   8.180   -4.229  1.00 0.00 ? 6  PRO A HB2  7 
ATOM   4360 H HB3  . PRO A 1 6  ? 0.718   9.910   -3.882  1.00 0.00 ? 6  PRO A HB3  7 
ATOM   4361 H HG2  . PRO A 1 6  ? 2.264   9.197   -5.988  1.00 0.00 ? 6  PRO A HG2  7 
ATOM   4362 H HG3  . PRO A 1 6  ? 2.822   10.504  -4.904  1.00 0.00 ? 6  PRO A HG3  7 
ATOM   4363 H HD2  . PRO A 1 6  ? 3.680   7.559   -4.819  1.00 0.00 ? 6  PRO A HD2  7 
ATOM   4364 H HD3  . PRO A 1 6  ? 4.679   9.032   -4.824  1.00 0.00 ? 6  PRO A HD3  7 
ATOM   4365 N N    . CYS A 1 7  ? 2.099   6.698   -1.695  1.00 0.00 ? 7  CYS A N    7 
ATOM   4366 C CA   . CYS A 1 7  ? 1.980   5.688   -0.640  1.00 0.00 ? 7  CYS A CA   7 
ATOM   4367 C C    . CYS A 1 7  ? 2.201   6.300   0.742   1.00 0.00 ? 7  CYS A C    7 
ATOM   4368 O O    . CYS A 1 7  ? 1.416   6.081   1.651   1.00 0.00 ? 7  CYS A O    7 
ATOM   4369 C CB   . CYS A 1 7  ? 3.051   4.622   -0.940  1.00 0.00 ? 7  CYS A CB   7 
ATOM   4370 S SG   . CYS A 1 7  ? 3.020   3.043   -0.061  1.00 0.00 ? 7  CYS A SG   7 
ATOM   4371 H H    . CYS A 1 7  ? 2.811   6.515   -2.389  1.00 0.00 ? 7  CYS A H    7 
ATOM   4372 H HA   . CYS A 1 7  ? 0.972   5.265   -0.615  1.00 0.00 ? 7  CYS A HA   7 
ATOM   4373 H HB2  . CYS A 1 7  ? 2.992   4.366   -1.993  1.00 0.00 ? 7  CYS A HB2  7 
ATOM   4374 H HB3  . CYS A 1 7  ? 4.041   5.056   -0.782  1.00 0.00 ? 7  CYS A HB3  7 
ATOM   4375 N N    . CYS A 1 8  ? 3.277   7.065   0.899   1.00 0.00 ? 8  CYS A N    7 
ATOM   4376 C CA   . CYS A 1 8  ? 3.545   7.870   2.078   1.00 0.00 ? 8  CYS A CA   7 
ATOM   4377 C C    . CYS A 1 8  ? 3.149   9.298   1.754   1.00 0.00 ? 8  CYS A C    7 
ATOM   4378 O O    . CYS A 1 8  ? 3.886   10.013  1.086   1.00 0.00 ? 8  CYS A O    7 
ATOM   4379 C CB   . CYS A 1 8  ? 5.032   7.812   2.398   1.00 0.00 ? 8  CYS A CB   7 
ATOM   4380 S SG   . CYS A 1 8  ? 5.573   6.210   3.013   1.00 0.00 ? 8  CYS A SG   7 
ATOM   4381 H H    . CYS A 1 8  ? 3.858   7.199   0.087   1.00 0.00 ? 8  CYS A H    7 
ATOM   4382 H HA   . CYS A 1 8  ? 2.937   7.495   2.907   1.00 0.00 ? 8  CYS A HA   7 
ATOM   4383 H HB2  . CYS A 1 8  ? 5.581   8.053   1.492   1.00 0.00 ? 8  CYS A HB2  7 
ATOM   4384 H HB3  . CYS A 1 8  ? 5.268   8.581   3.132   1.00 0.00 ? 8  CYS A HB3  7 
ATOM   4385 N N    . ARG A 1 9  ? 1.959   9.681   2.203   1.00 0.00 ? 9  ARG A N    7 
ATOM   4386 C CA   . ARG A 1 9  ? 1.121   10.658  1.550   1.00 0.00 ? 9  ARG A CA   7 
ATOM   4387 C C    . ARG A 1 9  ? 1.832   11.980  1.258   1.00 0.00 ? 9  ARG A C    7 
ATOM   4388 O O    . ARG A 1 9  ? 2.040   12.798  2.151   1.00 0.00 ? 9  ARG A O    7 
ATOM   4389 C CB   . ARG A 1 9  ? -0.189  10.814  2.305   1.00 0.00 ? 9  ARG A CB   7 
ATOM   4390 C CG   . ARG A 1 9  ? -1.133  11.650  1.451   1.00 0.00 ? 9  ARG A CG   7 
ATOM   4391 C CD   . ARG A 1 9  ? -1.432  11.085  0.053   1.00 0.00 ? 9  ARG A CD   7 
ATOM   4392 N NE   . ARG A 1 9  ? -2.535  11.804  -0.603  1.00 0.00 ? 9  ARG A NE   7 
ATOM   4393 C CZ   . ARG A 1 9  ? -2.443  13.003  -1.210  1.00 0.00 ? 9  ARG A CZ   7 
ATOM   4394 N NH1  . ARG A 1 9  ? -1.288  13.686  -1.241  1.00 0.00 ? 9  ARG A NH1  7 
ATOM   4395 N NH2  . ARG A 1 9  ? -3.529  13.522  -1.800  1.00 0.00 ? 9  ARG A NH2  7 
ATOM   4396 H H    . ARG A 1 9  ? 1.522   9.087   2.883   1.00 0.00 ? 9  ARG A H    7 
ATOM   4397 H HA   . ARG A 1 9  ? 0.868   10.180  0.614   1.00 0.00 ? 9  ARG A HA   7 
ATOM   4398 H HB2  . ARG A 1 9  ? -0.639  9.836   2.479   1.00 0.00 ? 9  ARG A HB2  7 
ATOM   4399 H HB3  . ARG A 1 9  ? -0.024  11.300  3.268   1.00 0.00 ? 9  ARG A HB3  7 
ATOM   4400 H HG2  . ARG A 1 9  ? -2.055  11.674  2.001   1.00 0.00 ? 9  ARG A HG2  7 
ATOM   4401 H HG3  . ARG A 1 9  ? -0.747  12.664  1.375   1.00 0.00 ? 9  ARG A HG3  7 
ATOM   4402 H HD2  . ARG A 1 9  ? -0.561  11.144  -0.600  1.00 0.00 ? 9  ARG A HD2  7 
ATOM   4403 H HD3  . ARG A 1 9  ? -1.724  10.037  0.146   1.00 0.00 ? 9  ARG A HD3  7 
ATOM   4404 H HE   . ARG A 1 9  ? -3.432  11.339  -0.604  1.00 0.00 ? 9  ARG A HE   7 
ATOM   4405 H HH11 . ARG A 1 9  ? -0.462  13.309  -0.799  1.00 0.00 ? 9  ARG A HH11 7 
ATOM   4406 H HH12 . ARG A 1 9  ? -1.244  14.582  -1.704  1.00 0.00 ? 9  ARG A HH12 7 
ATOM   4407 H HH21 . ARG A 1 9  ? -4.403  13.016  -1.788  1.00 0.00 ? 9  ARG A HH21 7 
ATOM   4408 H HH22 . ARG A 1 9  ? -3.473  14.419  -2.262  1.00 0.00 ? 9  ARG A HH22 7 
ATOM   4409 N N    . ASN A 1 10 ? 2.233   12.115  -0.013  1.00 0.00 ? 10 ASN A N    7 
ATOM   4410 C CA   . ASN A 1 10 ? 3.239   13.026  -0.553  1.00 0.00 ? 10 ASN A CA   7 
ATOM   4411 C C    . ASN A 1 10 ? 4.642   12.685  -0.020  1.00 0.00 ? 10 ASN A C    7 
ATOM   4412 O O    . ASN A 1 10 ? 5.552   12.382  -0.791  1.00 0.00 ? 10 ASN A O    7 
ATOM   4413 C CB   . ASN A 1 10 ? 2.833   14.482  -0.294  1.00 0.00 ? 10 ASN A CB   7 
ATOM   4414 C CG   . ASN A 1 10 ? 3.637   15.469  -1.145  1.00 0.00 ? 10 ASN A CG   7 
ATOM   4415 O OD1  . ASN A 1 10 ? 3.442   15.544  -2.356  1.00 0.00 ? 10 ASN A OD1  7 
ATOM   4416 N ND2  . ASN A 1 10 ? 4.540   16.230  -0.518  1.00 0.00 ? 10 ASN A ND2  7 
ATOM   4417 H H    . ASN A 1 10 ? 1.860   11.422  -0.637  1.00 0.00 ? 10 ASN A H    7 
ATOM   4418 H HA   . ASN A 1 10 ? 3.230   12.860  -1.633  1.00 0.00 ? 10 ASN A HA   7 
ATOM   4419 H HB2  . ASN A 1 10 ? 1.775   14.593  -0.522  1.00 0.00 ? 10 ASN A HB2  7 
ATOM   4420 H HB3  . ASN A 1 10 ? 2.953   14.723  0.764   1.00 0.00 ? 10 ASN A HB3  7 
ATOM   4421 H HD21 . ASN A 1 10 ? 4.667   16.144  0.480   1.00 0.00 ? 10 ASN A HD21 7 
ATOM   4422 H HD22 . ASN A 1 10 ? 5.087   16.898  -1.043  1.00 0.00 ? 10 ASN A HD22 7 
ATOM   4423 N N    . CYS A 1 11 ? 4.780   12.708  1.313   1.00 0.00 ? 11 CYS A N    7 
ATOM   4424 C CA   . CYS A 1 11 ? 5.919   12.233  2.100   1.00 0.00 ? 11 CYS A CA   7 
ATOM   4425 C C    . CYS A 1 11 ? 5.479   11.894  3.544   1.00 0.00 ? 11 CYS A C    7 
ATOM   4426 O O    . CYS A 1 11 ? 6.310   11.914  4.451   1.00 0.00 ? 11 CYS A O    7 
ATOM   4427 C CB   . CYS A 1 11 ? 7.044   13.290  2.039   1.00 0.00 ? 11 CYS A CB   7 
ATOM   4428 S SG   . CYS A 1 11 ? 8.637   12.952  2.862   1.00 0.00 ? 11 CYS A SG   7 
ATOM   4429 H H    . CYS A 1 11 ? 3.933   12.911  1.823   1.00 0.00 ? 11 CYS A H    7 
ATOM   4430 H HA   . CYS A 1 11 ? 6.280   11.310  1.650   1.00 0.00 ? 11 CYS A HA   7 
ATOM   4431 H HB2  . CYS A 1 11 ? 7.286   13.478  0.991   1.00 0.00 ? 11 CYS A HB2  7 
ATOM   4432 H HB3  . CYS A 1 11 ? 6.665   14.224  2.458   1.00 0.00 ? 11 CYS A HB3  7 
ATOM   4433 N N    . LYS A 1 12 ? 4.188   11.581  3.776   1.00 0.00 ? 12 LYS A N    7 
ATOM   4434 C CA   . LYS A 1 12 ? 3.614   11.351  5.105   1.00 0.00 ? 12 LYS A CA   7 
ATOM   4435 C C    . LYS A 1 12 ? 2.973   9.958   5.180   1.00 0.00 ? 12 LYS A C    7 
ATOM   4436 O O    . LYS A 1 12 ? 1.764   9.838   4.980   1.00 0.00 ? 12 LYS A O    7 
ATOM   4437 C CB   . LYS A 1 12 ? 2.597   12.463  5.436   1.00 0.00 ? 12 LYS A CB   7 
ATOM   4438 C CG   . LYS A 1 12 ? 3.176   13.888  5.395   1.00 0.00 ? 12 LYS A CG   7 
ATOM   4439 C CD   . LYS A 1 12 ? 4.286   14.100  6.438   1.00 0.00 ? 12 LYS A CD   7 
ATOM   4440 C CE   . LYS A 1 12 ? 4.732   15.567  6.517   1.00 0.00 ? 12 LYS A CE   7 
ATOM   4441 N NZ   . LYS A 1 12 ? 5.326   16.039  5.254   1.00 0.00 ? 12 LYS A NZ   7 
ATOM   4442 H H    . LYS A 1 12 ? 3.532   11.602  3.000   1.00 0.00 ? 12 LYS A H    7 
ATOM   4443 H HA   . LYS A 1 12 ? 4.384   11.384  5.878   1.00 0.00 ? 12 LYS A HA   7 
ATOM   4444 H HB2  . LYS A 1 12 ? 1.767   12.422  4.729   1.00 0.00 ? 12 LYS A HB2  7 
ATOM   4445 H HB3  . LYS A 1 12 ? 2.192   12.284  6.434   1.00 0.00 ? 12 LYS A HB3  7 
ATOM   4446 H HG2  . LYS A 1 12 ? 3.556   14.102  4.395   1.00 0.00 ? 12 LYS A HG2  7 
ATOM   4447 H HG3  . LYS A 1 12 ? 2.365   14.585  5.605   1.00 0.00 ? 12 LYS A HG3  7 
ATOM   4448 H HD2  . LYS A 1 12 ? 3.912   13.802  7.418   1.00 0.00 ? 12 LYS A HD2  7 
ATOM   4449 H HD3  . LYS A 1 12 ? 5.155   13.485  6.201   1.00 0.00 ? 12 LYS A HD3  7 
ATOM   4450 H HE2  . LYS A 1 12 ? 3.879   16.199  6.767   1.00 0.00 ? 12 LYS A HE2  7 
ATOM   4451 H HE3  . LYS A 1 12 ? 5.480   15.666  7.305   1.00 0.00 ? 12 LYS A HE3  7 
ATOM   4452 H HZ1  . LYS A 1 12 ? 5.630   16.996  5.363   1.00 0.00 ? 12 LYS A HZ1  7 
ATOM   4453 H HZ2  . LYS A 1 12 ? 6.118   15.459  5.016   1.00 0.00 ? 12 LYS A HZ2  7 
ATOM   4454 H HZ3  . LYS A 1 12 ? 4.638   15.988  4.517   1.00 0.00 ? 12 LYS A HZ3  7 
ATOM   4455 N N    . PHE A 1 13 ? 3.786   8.932   5.497   1.00 0.00 ? 13 PHE A N    7 
ATOM   4456 C CA   . PHE A 1 13 ? 3.426   7.534   5.770   1.00 0.00 ? 13 PHE A CA   7 
ATOM   4457 C C    . PHE A 1 13 ? 1.925   7.318   6.033   1.00 0.00 ? 13 PHE A C    7 
ATOM   4458 O O    . PHE A 1 13 ? 1.425   7.735   7.079   1.00 0.00 ? 13 PHE A O    7 
ATOM   4459 C CB   . PHE A 1 13 ? 4.276   7.011   6.943   1.00 0.00 ? 13 PHE A CB   7 
ATOM   4460 C CG   . PHE A 1 13 ? 5.716   6.663   6.588   1.00 0.00 ? 13 PHE A CG   7 
ATOM   4461 C CD1  . PHE A 1 13 ? 6.019   5.400   6.034   1.00 0.00 ? 13 PHE A CD1  7 
ATOM   4462 C CD2  . PHE A 1 13 ? 6.754   7.599   6.803   1.00 0.00 ? 13 PHE A CD2  7 
ATOM   4463 C CE1  . PHE A 1 13 ? 7.343   5.092   5.666   1.00 0.00 ? 13 PHE A CE1  7 
ATOM   4464 C CE2  . PHE A 1 13 ? 8.086   7.265   6.481   1.00 0.00 ? 13 PHE A CE2  7 
ATOM   4465 C CZ   . PHE A 1 13 ? 8.379   6.013   5.901   1.00 0.00 ? 13 PHE A CZ   7 
ATOM   4466 H H    . PHE A 1 13 ? 4.767   9.151   5.607   1.00 0.00 ? 13 PHE A H    7 
ATOM   4467 H HA   . PHE A 1 13 ? 3.703   6.935   4.907   1.00 0.00 ? 13 PHE A HA   7 
ATOM   4468 H HB2  . PHE A 1 13 ? 4.267   7.743   7.755   1.00 0.00 ? 13 PHE A HB2  7 
ATOM   4469 H HB3  . PHE A 1 13 ? 3.816   6.108   7.338   1.00 0.00 ? 13 PHE A HB3  7 
ATOM   4470 H HD1  . PHE A 1 13 ? 5.228   4.694   5.827   1.00 0.00 ? 13 PHE A HD1  7 
ATOM   4471 H HD2  . PHE A 1 13 ? 6.532   8.570   7.222   1.00 0.00 ? 13 PHE A HD2  7 
ATOM   4472 H HE1  . PHE A 1 13 ? 7.555   4.180   5.142   1.00 0.00 ? 13 PHE A HE1  7 
ATOM   4473 H HE2  . PHE A 1 13 ? 8.878   7.973   6.675   1.00 0.00 ? 13 PHE A HE2  7 
ATOM   4474 H HZ   . PHE A 1 13 ? 9.396   5.770   5.619   1.00 0.00 ? 13 PHE A HZ   7 
ATOM   4475 N N    . LEU A 1 14 ? 1.213   6.685   5.082   1.00 0.00 ? 14 LEU A N    7 
ATOM   4476 C CA   . LEU A 1 14 ? -0.217  6.401   5.168   1.00 0.00 ? 14 LEU A CA   7 
ATOM   4477 C C    . LEU A 1 14 ? -0.552  5.497   6.359   1.00 0.00 ? 14 LEU A C    7 
ATOM   4478 O O    . LEU A 1 14 ? 0.304   5.036   7.116   1.00 0.00 ? 14 LEU A O    7 
ATOM   4479 C CB   . LEU A 1 14 ? -0.746  5.787   3.849   1.00 0.00 ? 14 LEU A CB   7 
ATOM   4480 C CG   . LEU A 1 14 ? -1.211  6.756   2.757   1.00 0.00 ? 14 LEU A CG   7 
ATOM   4481 C CD1  . LEU A 1 14 ? -1.614  6.023   1.465   1.00 0.00 ? 14 LEU A CD1  7 
ATOM   4482 C CD2  . LEU A 1 14 ? -2.386  7.640   3.206   1.00 0.00 ? 14 LEU A CD2  7 
ATOM   4483 H H    . LEU A 1 14 ? 1.675   6.359   4.249   1.00 0.00 ? 14 LEU A H    7 
ATOM   4484 H HA   . LEU A 1 14 ? -0.720  7.349   5.351   1.00 0.00 ? 14 LEU A HA   7 
ATOM   4485 H HB2  . LEU A 1 14 ? 0.019   5.149   3.461   1.00 0.00 ? 14 LEU A HB2  7 
ATOM   4486 H HB3  . LEU A 1 14 ? -1.569  5.119   4.002   1.00 0.00 ? 14 LEU A HB3  7 
ATOM   4487 H HG   . LEU A 1 14 ? -0.345  7.354   2.531   1.00 0.00 ? 14 LEU A HG   7 
ATOM   4488 H HD11 . LEU A 1 14 ? -2.549  5.494   1.612   1.00 0.00 ? 14 LEU A HD11 7 
ATOM   4489 H HD12 . LEU A 1 14 ? -1.746  6.743   0.657   1.00 0.00 ? 14 LEU A HD12 7 
ATOM   4490 H HD13 . LEU A 1 14 ? -0.864  5.296   1.161   1.00 0.00 ? 14 LEU A HD13 7 
ATOM   4491 H HD21 . LEU A 1 14 ? -2.082  8.333   3.989   1.00 0.00 ? 14 LEU A HD21 7 
ATOM   4492 H HD22 . LEU A 1 14 ? -2.750  8.230   2.364   1.00 0.00 ? 14 LEU A HD22 7 
ATOM   4493 H HD23 . LEU A 1 14 ? -3.201  7.019   3.580   1.00 0.00 ? 14 LEU A HD23 7 
ATOM   4494 N N    . LYS A 1 15 ? -1.860  5.303   6.512   1.00 0.00 ? 15 LYS A N    7 
ATOM   4495 C CA   . LYS A 1 15 ? -2.514  4.870   7.741   1.00 0.00 ? 15 LYS A CA   7 
ATOM   4496 C C    . LYS A 1 15 ? -2.632  3.340   7.810   1.00 0.00 ? 15 LYS A C    7 
ATOM   4497 O O    . LYS A 1 15 ? -3.703  2.817   8.116   1.00 0.00 ? 15 LYS A O    7 
ATOM   4498 C CB   . LYS A 1 15 ? -3.864  5.606   7.889   1.00 0.00 ? 15 LYS A CB   7 
ATOM   4499 C CG   . LYS A 1 15 ? -3.792  7.129   7.651   1.00 0.00 ? 15 LYS A CG   7 
ATOM   4500 C CD   . LYS A 1 15 ? -2.788  7.852   8.568   1.00 0.00 ? 15 LYS A CD   7 
ATOM   4501 C CE   . LYS A 1 15 ? -2.628  9.336   8.202   1.00 0.00 ? 15 LYS A CE   7 
ATOM   4502 N NZ   . LYS A 1 15 ? -3.876  10.099  8.377   1.00 0.00 ? 15 LYS A NZ   7 
ATOM   4503 H H    . LYS A 1 15 ? -2.414  5.646   5.744   1.00 0.00 ? 15 LYS A H    7 
ATOM   4504 H HA   . LYS A 1 15 ? -1.895  5.168   8.586   1.00 0.00 ? 15 LYS A HA   7 
ATOM   4505 H HB2  . LYS A 1 15 ? -4.576  5.195   7.171   1.00 0.00 ? 15 LYS A HB2  7 
ATOM   4506 H HB3  . LYS A 1 15 ? -4.256  5.427   8.893   1.00 0.00 ? 15 LYS A HB3  7 
ATOM   4507 H HG2  . LYS A 1 15 ? -3.528  7.321   6.611   1.00 0.00 ? 15 LYS A HG2  7 
ATOM   4508 H HG3  . LYS A 1 15 ? -4.787  7.543   7.820   1.00 0.00 ? 15 LYS A HG3  7 
ATOM   4509 H HD2  . LYS A 1 15 ? -3.107  7.757   9.607   1.00 0.00 ? 15 LYS A HD2  7 
ATOM   4510 H HD3  . LYS A 1 15 ? -1.802  7.397   8.468   1.00 0.00 ? 15 LYS A HD3  7 
ATOM   4511 H HE2  . LYS A 1 15 ? -1.864  9.779   8.843   1.00 0.00 ? 15 LYS A HE2  7 
ATOM   4512 H HE3  . LYS A 1 15 ? -2.301  9.425   7.166   1.00 0.00 ? 15 LYS A HE3  7 
ATOM   4513 H HZ1  . LYS A 1 15 ? -4.591  9.723   7.771   1.00 0.00 ? 15 LYS A HZ1  7 
ATOM   4514 H HZ2  . LYS A 1 15 ? -4.180  10.034  9.338   1.00 0.00 ? 15 LYS A HZ2  7 
ATOM   4515 H HZ3  . LYS A 1 15 ? -3.712  11.067  8.141   1.00 0.00 ? 15 LYS A HZ3  7 
ATOM   4516 N N    . GLU A 1 16 ? -1.510  2.643   7.550   1.00 0.00 ? 16 GLU A N    7 
ATOM   4517 C CA   . GLU A 1 16 ? -1.302  1.198   7.643   1.00 0.00 ? 16 GLU A CA   7 
ATOM   4518 C C    . GLU A 1 16 ? -2.503  0.389   7.135   1.00 0.00 ? 16 GLU A C    7 
ATOM   4519 O O    . GLU A 1 16 ? -3.374  0.007   7.916   1.00 0.00 ? 16 GLU A O    7 
ATOM   4520 C CB   . GLU A 1 16 ? -0.856  0.828   9.071   1.00 0.00 ? 16 GLU A CB   7 
ATOM   4521 C CG   . GLU A 1 16 ? -0.442  -0.648  9.192   1.00 0.00 ? 16 GLU A CG   7 
ATOM   4522 C CD   . GLU A 1 16 ? 0.173   -0.947  10.561  1.00 0.00 ? 16 GLU A CD   7 
ATOM   4523 O OE1  . GLU A 1 16 ? -0.604  -1.304  11.473  1.00 0.00 ? 16 GLU A OE1  7 
ATOM   4524 O OE2  . GLU A 1 16 ? 1.411   -0.807  10.676  1.00 0.00 ? 16 GLU A OE2  7 
ATOM   4525 H H    . GLU A 1 16 ? -0.688  3.183   7.317   1.00 0.00 ? 16 GLU A H    7 
ATOM   4526 H HA   . GLU A 1 16 ? -0.466  0.992   6.975   1.00 0.00 ? 16 GLU A HA   7 
ATOM   4527 H HB2  . GLU A 1 16 ? 0.002   1.449   9.335   1.00 0.00 ? 16 GLU A HB2  7 
ATOM   4528 H HB3  . GLU A 1 16 ? -1.660  1.040   9.779   1.00 0.00 ? 16 GLU A HB3  7 
ATOM   4529 H HG2  . GLU A 1 16 ? -1.312  -1.289  9.043   1.00 0.00 ? 16 GLU A HG2  7 
ATOM   4530 H HG3  . GLU A 1 16 ? 0.283   -0.888  8.413   1.00 0.00 ? 16 GLU A HG3  7 
ATOM   4531 N N    . GLY A 1 17 ? -2.547  0.153   5.815   1.00 0.00 ? 17 GLY A N    7 
ATOM   4532 C CA   . GLY A 1 17 ? -3.680  -0.413  5.105   1.00 0.00 ? 17 GLY A CA   7 
ATOM   4533 C C    . GLY A 1 17 ? -4.414  0.679   4.321   1.00 0.00 ? 17 GLY A C    7 
ATOM   4534 O O    . GLY A 1 17 ? -5.643  0.721   4.361   1.00 0.00 ? 17 GLY A O    7 
ATOM   4535 H H    . GLY A 1 17 ? -1.781  0.455   5.230   1.00 0.00 ? 17 GLY A H    7 
ATOM   4536 H HA2  . GLY A 1 17 ? -3.307  -1.169  4.418   1.00 0.00 ? 17 GLY A HA2  7 
ATOM   4537 H HA3  . GLY A 1 17 ? -4.373  -0.910  5.785   1.00 0.00 ? 17 GLY A HA3  7 
ATOM   4538 N N    . THR A 1 18 ? -3.675  1.544   3.593   1.00 0.00 ? 18 THR A N    7 
ATOM   4539 C CA   . THR A 1 18 ? -4.248  2.517   2.660   1.00 0.00 ? 18 THR A CA   7 
ATOM   4540 C C    . THR A 1 18 ? -3.479  2.562   1.330   1.00 0.00 ? 18 THR A C    7 
ATOM   4541 O O    . THR A 1 18 ? -2.257  2.685   1.320   1.00 0.00 ? 18 THR A O    7 
ATOM   4542 C CB   . THR A 1 18 ? -4.322  3.910   3.280   1.00 0.00 ? 18 THR A CB   7 
ATOM   4543 O OG1  . THR A 1 18 ? -4.934  3.891   4.557   1.00 0.00 ? 18 THR A OG1  7 
ATOM   4544 C CG2  . THR A 1 18 ? -5.125  4.825   2.347   1.00 0.00 ? 18 THR A CG2  7 
ATOM   4545 H H    . THR A 1 18 ? -2.667  1.505   3.665   1.00 0.00 ? 18 THR A H    7 
ATOM   4546 H HA   . THR A 1 18 ? -5.273  2.233   2.454   1.00 0.00 ? 18 THR A HA   7 
ATOM   4547 H HB   . THR A 1 18 ? -3.309  4.279   3.380   1.00 0.00 ? 18 THR A HB   7 
ATOM   4548 H HG1  . THR A 1 18 ? -4.403  3.350   5.146   1.00 0.00 ? 18 THR A HG1  7 
ATOM   4549 H HG21 . THR A 1 18 ? -4.678  4.912   1.359   1.00 0.00 ? 18 THR A HG21 7 
ATOM   4550 H HG22 . THR A 1 18 ? -5.182  5.823   2.782   1.00 0.00 ? 18 THR A HG22 7 
ATOM   4551 H HG23 . THR A 1 18 ? -6.141  4.445   2.236   1.00 0.00 ? 18 THR A HG23 7 
ATOM   4552 N N    . ILE A 1 19 ? -4.223  2.506   0.216   1.00 0.00 ? 19 ILE A N    7 
ATOM   4553 C CA   . ILE A 1 19 ? -3.764  2.253   -1.150  1.00 0.00 ? 19 ILE A CA   7 
ATOM   4554 C C    . ILE A 1 19 ? -2.840  3.352   -1.703  1.00 0.00 ? 19 ILE A C    7 
ATOM   4555 O O    . ILE A 1 19 ? -3.104  4.546   -1.559  1.00 0.00 ? 19 ILE A O    7 
ATOM   4556 C CB   . ILE A 1 19 ? -4.974  2.012   -2.074  1.00 0.00 ? 19 ILE A CB   7 
ATOM   4557 C CG1  . ILE A 1 19 ? -5.885  0.887   -1.556  1.00 0.00 ? 19 ILE A CG1  7 
ATOM   4558 C CG2  . ILE A 1 19 ? -4.553  1.779   -3.534  1.00 0.00 ? 19 ILE A CG2  7 
ATOM   4559 C CD1  . ILE A 1 19 ? -7.249  0.812   -2.259  1.00 0.00 ? 19 ILE A CD1  7 
ATOM   4560 H H    . ILE A 1 19 ? -5.224  2.529   0.347   1.00 0.00 ? 19 ILE A H    7 
ATOM   4561 H HA   . ILE A 1 19 ? -3.244  1.302   -1.153  1.00 0.00 ? 19 ILE A HA   7 
ATOM   4562 H HB   . ILE A 1 19 ? -5.564  2.904   -2.058  1.00 0.00 ? 19 ILE A HB   7 
ATOM   4563 H HG12 . ILE A 1 19 ? -5.336  -0.049  -1.630  1.00 0.00 ? 19 ILE A HG12 7 
ATOM   4564 H HG13 . ILE A 1 19 ? -6.123  1.063   -0.510  1.00 0.00 ? 19 ILE A HG13 7 
ATOM   4565 H HG21 . ILE A 1 19 ? -4.084  2.673   -3.941  1.00 0.00 ? 19 ILE A HG21 7 
ATOM   4566 H HG22 . ILE A 1 19 ? -3.858  0.945   -3.608  1.00 0.00 ? 19 ILE A HG22 7 
ATOM   4567 H HG23 . ILE A 1 19 ? -5.426  1.577   -4.143  1.00 0.00 ? 19 ILE A HG23 7 
ATOM   4568 H HD11 . ILE A 1 19 ? -7.146  0.581   -3.315  1.00 0.00 ? 19 ILE A HD11 7 
ATOM   4569 H HD12 . ILE A 1 19 ? -7.852  0.031   -1.793  1.00 0.00 ? 19 ILE A HD12 7 
ATOM   4570 H HD13 . ILE A 1 19 ? -7.772  1.764   -2.155  1.00 0.00 ? 19 ILE A HD13 7 
ATOM   4571 N N    . CYS A 1 20 ? -1.790  2.895   -2.400  1.00 0.00 ? 20 CYS A N    7 
ATOM   4572 C CA   . CYS A 1 20 ? -0.941  3.635   -3.334  1.00 0.00 ? 20 CYS A CA   7 
ATOM   4573 C C    . CYS A 1 20 ? -1.554  3.611   -4.743  1.00 0.00 ? 20 CYS A C    7 
ATOM   4574 O O    . CYS A 1 20 ? -1.983  4.647   -5.249  1.00 0.00 ? 20 CYS A O    7 
ATOM   4575 C CB   . CYS A 1 20 ? 0.498   3.072   -3.322  1.00 0.00 ? 20 CYS A CB   7 
ATOM   4576 S SG   . CYS A 1 20 ? 1.561   3.552   -4.727  1.00 0.00 ? 20 CYS A SG   7 
ATOM   4577 H H    . CYS A 1 20 ? -1.682  1.895   -2.375  1.00 0.00 ? 20 CYS A H    7 
ATOM   4578 H HA   . CYS A 1 20 ? -0.862  4.668   -3.014  1.00 0.00 ? 20 CYS A HA   7 
ATOM   4579 H HB2  . CYS A 1 20 ? 0.975   3.365   -2.389  1.00 0.00 ? 20 CYS A HB2  7 
ATOM   4580 H HB3  . CYS A 1 20 ? 0.448   1.986   -3.338  1.00 0.00 ? 20 CYS A HB3  7 
ATOM   4581 N N    . LYS A 1 21 ? -1.533  2.436   -5.390  1.00 0.00 ? 21 LYS A N    7 
ATOM   4582 C CA   . LYS A 1 21 ? -1.730  2.284   -6.835  1.00 0.00 ? 21 LYS A CA   7 
ATOM   4583 C C    . LYS A 1 21 ? -3.211  2.297   -7.241  1.00 0.00 ? 21 LYS A C    7 
ATOM   4584 O O    . LYS A 1 21 ? -3.596  3.066   -8.121  1.00 0.00 ? 21 LYS A O    7 
ATOM   4585 C CB   . LYS A 1 21 ? -1.038  1.014   -7.354  1.00 0.00 ? 21 LYS A CB   7 
ATOM   4586 C CG   . LYS A 1 21 ? 0.484   1.081   -7.164  1.00 0.00 ? 21 LYS A CG   7 
ATOM   4587 C CD   . LYS A 1 21 ? 1.179   0.011   -8.011  1.00 0.00 ? 21 LYS A CD   7 
ATOM   4588 C CE   . LYS A 1 21 ? 2.702   0.061   -7.839  1.00 0.00 ? 21 LYS A CE   7 
ATOM   4589 N NZ   . LYS A 1 21 ? 3.375   -0.935  -8.692  1.00 0.00 ? 21 LYS A NZ   7 
ATOM   4590 H H    . LYS A 1 21 ? -1.216  1.634   -4.866  1.00 0.00 ? 21 LYS A H    7 
ATOM   4591 H HA   . LYS A 1 21 ? -1.230  3.113   -7.339  1.00 0.00 ? 21 LYS A HA   7 
ATOM   4592 H HB2  . LYS A 1 21 ? -1.435  0.127   -6.856  1.00 0.00 ? 21 LYS A HB2  7 
ATOM   4593 H HB3  . LYS A 1 21 ? -1.250  0.927   -8.423  1.00 0.00 ? 21 LYS A HB3  7 
ATOM   4594 H HG2  . LYS A 1 21 ? 0.852   2.060   -7.479  1.00 0.00 ? 21 LYS A HG2  7 
ATOM   4595 H HG3  . LYS A 1 21 ? 0.724   0.932   -6.111  1.00 0.00 ? 21 LYS A HG3  7 
ATOM   4596 H HD2  . LYS A 1 21 ? 0.811   -0.975  -7.716  1.00 0.00 ? 21 LYS A HD2  7 
ATOM   4597 H HD3  . LYS A 1 21 ? 0.940   0.180   -9.062  1.00 0.00 ? 21 LYS A HD3  7 
ATOM   4598 H HE2  . LYS A 1 21 ? 3.070   1.052   -8.108  1.00 0.00 ? 21 LYS A HE2  7 
ATOM   4599 H HE3  . LYS A 1 21 ? 2.960   -0.144  -6.800  1.00 0.00 ? 21 LYS A HE3  7 
ATOM   4600 H HZ1  . LYS A 1 21 ? 3.069   -1.861  -8.427  1.00 0.00 ? 21 LYS A HZ1  7 
ATOM   4601 H HZ2  . LYS A 1 21 ? 3.141   -0.766  -9.659  1.00 0.00 ? 21 LYS A HZ2  7 
ATOM   4602 H HZ3  . LYS A 1 21 ? 4.375   -0.864  -8.569  1.00 0.00 ? 21 LYS A HZ3  7 
ATOM   4603 N N    . ARG A 1 22 ? -4.017  1.418   -6.626  1.00 0.00 ? 22 ARG A N    7 
ATOM   4604 C CA   . ARG A 1 22 ? -5.423  1.174   -6.926  1.00 0.00 ? 22 ARG A CA   7 
ATOM   4605 C C    . ARG A 1 22 ? -5.546  0.338   -8.205  1.00 0.00 ? 22 ARG A C    7 
ATOM   4606 O O    . ARG A 1 22 ? -5.822  0.850   -9.290  1.00 0.00 ? 22 ARG A O    7 
ATOM   4607 C CB   . ARG A 1 22 ? -6.247  2.470   -6.920  1.00 0.00 ? 22 ARG A CB   7 
ATOM   4608 C CG   . ARG A 1 22 ? -7.730  2.255   -6.577  1.00 0.00 ? 22 ARG A CG   7 
ATOM   4609 C CD   . ARG A 1 22 ? -8.470  1.345   -7.567  1.00 0.00 ? 22 ARG A CD   7 
ATOM   4610 N NE   . ARG A 1 22 ? -9.913  1.306   -7.289  1.00 0.00 ? 22 ARG A NE   7 
ATOM   4611 C CZ   . ARG A 1 22 ? -10.804 0.510   -7.907  1.00 0.00 ? 22 ARG A CZ   7 
ATOM   4612 N NH1  . ARG A 1 22 ? -10.420 -0.367  -8.847  1.00 0.00 ? 22 ARG A NH1  7 
ATOM   4613 N NH2  . ARG A 1 22 ? -12.101 0.596   -7.579  1.00 0.00 ? 22 ARG A NH2  7 
ATOM   4614 H H    . ARG A 1 22 ? -3.623  0.843   -5.900  1.00 0.00 ? 22 ARG A H    7 
ATOM   4615 H HA   . ARG A 1 22 ? -5.797  0.572   -6.098  1.00 0.00 ? 22 ARG A HA   7 
ATOM   4616 H HB2  . ARG A 1 22 ? -5.842  3.124   -6.148  1.00 0.00 ? 22 ARG A HB2  7 
ATOM   4617 H HB3  . ARG A 1 22 ? -6.153  2.975   -7.879  1.00 0.00 ? 22 ARG A HB3  7 
ATOM   4618 H HG2  . ARG A 1 22 ? -7.812  1.834   -5.573  1.00 0.00 ? 22 ARG A HG2  7 
ATOM   4619 H HG3  . ARG A 1 22 ? -8.215  3.233   -6.572  1.00 0.00 ? 22 ARG A HG3  7 
ATOM   4620 H HD2  . ARG A 1 22 ? -8.319  1.715   -8.583  1.00 0.00 ? 22 ARG A HD2  7 
ATOM   4621 H HD3  . ARG A 1 22 ? -8.079  0.330   -7.489  1.00 0.00 ? 22 ARG A HD3  7 
ATOM   4622 H HE   . ARG A 1 22 ? -10.253 1.943   -6.583  1.00 0.00 ? 22 ARG A HE   7 
ATOM   4623 H HH11 . ARG A 1 22 ? -9.447  -0.442  -9.103  1.00 0.00 ? 22 ARG A HH11 7 
ATOM   4624 H HH12 . ARG A 1 22 ? -11.105 -0.955  -9.300  1.00 0.00 ? 22 ARG A HH12 7 
ATOM   4625 H HH21 . ARG A 1 22 ? -12.402 1.255   -6.875  1.00 0.00 ? 22 ARG A HH21 7 
ATOM   4626 H HH22 . ARG A 1 22 ? -12.780 0.006   -8.039  1.00 0.00 ? 22 ARG A HH22 7 
ATOM   4627 N N    . ALA A 1 23 ? -5.346  -0.971  -8.024  1.00 0.00 ? 23 ALA A N    7 
ATOM   4628 C CA   . ALA A 1 23 ? -5.535  -2.046  -8.991  1.00 0.00 ? 23 ALA A CA   7 
ATOM   4629 C C    . ALA A 1 23 ? -4.813  -1.819  -10.325 1.00 0.00 ? 23 ALA A C    7 
ATOM   4630 O O    . ALA A 1 23 ? -5.406  -1.970  -11.392 1.00 0.00 ? 23 ALA A O    7 
ATOM   4631 C CB   . ALA A 1 23 ? -7.034  -2.352  -9.146  1.00 0.00 ? 23 ALA A CB   7 
ATOM   4632 H H    . ALA A 1 23 ? -5.118  -1.235  -7.079  1.00 0.00 ? 23 ALA A H    7 
ATOM   4633 H HA   . ALA A 1 23 ? -5.053  -2.918  -8.558  1.00 0.00 ? 23 ALA A HA   7 
ATOM   4634 H HB1  . ALA A 1 23 ? -7.482  -2.540  -8.169  1.00 0.00 ? 23 ALA A HB1  7 
ATOM   4635 H HB2  . ALA A 1 23 ? -7.546  -1.509  -9.612  1.00 0.00 ? 23 ALA A HB2  7 
ATOM   4636 H HB3  . ALA A 1 23 ? -7.173  -3.239  -9.766  1.00 0.00 ? 23 ALA A HB3  7 
ATOM   4637 N N    . ARG A 1 24 ? -3.516  -1.484  -10.246 1.00 0.00 ? 24 ARG A N    7 
ATOM   4638 C CA   . ARG A 1 24 ? -2.608  -1.316  -11.378 1.00 0.00 ? 24 ARG A CA   7 
ATOM   4639 C C    . ARG A 1 24 ? -1.212  -1.814  -10.982 1.00 0.00 ? 24 ARG A C    7 
ATOM   4640 O O    . ARG A 1 24 ? -0.798  -1.672  -9.830  1.00 0.00 ? 24 ARG A O    7 
ATOM   4641 C CB   . ARG A 1 24 ? -2.576  0.152   -11.834 1.00 0.00 ? 24 ARG A CB   7 
ATOM   4642 C CG   . ARG A 1 24 ? -3.910  0.548   -12.484 1.00 0.00 ? 24 ARG A CG   7 
ATOM   4643 C CD   . ARG A 1 24 ? -3.874  1.970   -13.048 1.00 0.00 ? 24 ARG A CD   7 
ATOM   4644 N NE   . ARG A 1 24 ? -5.095  2.282   -13.806 1.00 0.00 ? 24 ARG A NE   7 
ATOM   4645 C CZ   . ARG A 1 24 ? -6.331  2.462   -13.300 1.00 0.00 ? 24 ARG A CZ   7 
ATOM   4646 N NH1  . ARG A 1 24 ? -6.562  2.437   -11.977 1.00 0.00 ? 24 ARG A NH1  7 
ATOM   4647 N NH2  . ARG A 1 24 ? -7.357  2.666   -14.138 1.00 0.00 ? 24 ARG A NH2  7 
ATOM   4648 H H    . ARG A 1 24 ? -3.110  -1.379  -9.327  1.00 0.00 ? 24 ARG A H    7 
ATOM   4649 H HA   . ARG A 1 24 ? -2.966  -1.904  -12.225 1.00 0.00 ? 24 ARG A HA   7 
ATOM   4650 H HB2  . ARG A 1 24 ? -2.358  0.807   -10.989 1.00 0.00 ? 24 ARG A HB2  7 
ATOM   4651 H HB3  . ARG A 1 24 ? -1.786  0.273   -12.579 1.00 0.00 ? 24 ARG A HB3  7 
ATOM   4652 H HG2  . ARG A 1 24 ? -4.133  -0.147  -13.296 1.00 0.00 ? 24 ARG A HG2  7 
ATOM   4653 H HG3  . ARG A 1 24 ? -4.706  0.493   -11.743 1.00 0.00 ? 24 ARG A HG3  7 
ATOM   4654 H HD2  . ARG A 1 24 ? -3.741  2.689   -12.237 1.00 0.00 ? 24 ARG A HD2  7 
ATOM   4655 H HD3  . ARG A 1 24 ? -3.027  2.062   -13.731 1.00 0.00 ? 24 ARG A HD3  7 
ATOM   4656 H HE   . ARG A 1 24 ? -4.991  2.328   -14.810 1.00 0.00 ? 24 ARG A HE   7 
ATOM   4657 H HH11 . ARG A 1 24 ? -5.803  2.284   -11.329 1.00 0.00 ? 24 ARG A HH11 7 
ATOM   4658 H HH12 . ARG A 1 24 ? -7.501  2.566   -11.628 1.00 0.00 ? 24 ARG A HH12 7 
ATOM   4659 H HH21 . ARG A 1 24 ? -7.200  2.681   -15.136 1.00 0.00 ? 24 ARG A HH21 7 
ATOM   4660 H HH22 . ARG A 1 24 ? -8.291  2.794   -13.774 1.00 0.00 ? 24 ARG A HH22 7 
ATOM   4661 N N    . GLY A 1 25 ? -0.489  -2.400  -11.947 1.00 0.00 ? 25 GLY A N    7 
ATOM   4662 C CA   . GLY A 1 25 ? 0.877   -2.883  -11.787 1.00 0.00 ? 25 GLY A CA   7 
ATOM   4663 C C    . GLY A 1 25 ? 0.925   -4.251  -11.098 1.00 0.00 ? 25 GLY A C    7 
ATOM   4664 O O    . GLY A 1 25 ? 1.213   -5.258  -11.746 1.00 0.00 ? 25 GLY A O    7 
ATOM   4665 H H    . GLY A 1 25 ? -0.899  -2.480  -12.867 1.00 0.00 ? 25 GLY A H    7 
ATOM   4666 H HA2  . GLY A 1 25 ? 1.318   -2.963  -12.781 1.00 0.00 ? 25 GLY A HA2  7 
ATOM   4667 H HA3  . GLY A 1 25 ? 1.469   -2.163  -11.219 1.00 0.00 ? 25 GLY A HA3  7 
ATOM   4668 N N    . ASP A 1 26 ? 0.678   -4.277  -9.779  1.00 0.00 ? 26 ASP A N    7 
ATOM   4669 C CA   . ASP A 1 26 ? 0.870   -5.445  -8.922  1.00 0.00 ? 26 ASP A CA   7 
ATOM   4670 C C    . ASP A 1 26 ? -0.342  -6.390  -8.980  1.00 0.00 ? 26 ASP A C    7 
ATOM   4671 O O    . ASP A 1 26 ? -0.259  -7.442  -9.615  1.00 0.00 ? 26 ASP A O    7 
ATOM   4672 C CB   . ASP A 1 26 ? 1.198   -5.003  -7.486  1.00 0.00 ? 26 ASP A CB   7 
ATOM   4673 C CG   . ASP A 1 26 ? 2.491   -4.187  -7.368  1.00 0.00 ? 26 ASP A CG   7 
ATOM   4674 O OD1  . ASP A 1 26 ? 3.528   -4.675  -7.870  1.00 0.00 ? 26 ASP A OD1  7 
ATOM   4675 O OD2  . ASP A 1 26 ? 2.427   -3.092  -6.766  1.00 0.00 ? 26 ASP A OD2  7 
ATOM   4676 H H    . ASP A 1 26 ? 0.417   -3.411  -9.327  1.00 0.00 ? 26 ASP A H    7 
ATOM   4677 H HA   . ASP A 1 26 ? 1.741   -6.000  -9.271  1.00 0.00 ? 26 ASP A HA   7 
ATOM   4678 H HB2  . ASP A 1 26 ? 0.367   -4.403  -7.133  1.00 0.00 ? 26 ASP A HB2  7 
ATOM   4679 H HB3  . ASP A 1 26 ? 1.288   -5.881  -6.844  1.00 0.00 ? 26 ASP A HB3  7 
ATOM   4680 N N    . ASP A 1 27 ? -1.447  -6.037  -8.300  1.00 0.00 ? 27 ASP A N    7 
ATOM   4681 C CA   . ASP A 1 27 ? -2.622  -6.891  -8.123  1.00 0.00 ? 27 ASP A CA   7 
ATOM   4682 C C    . ASP A 1 27 ? -3.897  -6.027  -8.139  1.00 0.00 ? 27 ASP A C    7 
ATOM   4683 O O    . ASP A 1 27 ? -4.144  -5.342  -9.132  1.00 0.00 ? 27 ASP A O    7 
ATOM   4684 C CB   . ASP A 1 27 ? -2.420  -7.763  -6.866  1.00 0.00 ? 27 ASP A CB   7 
ATOM   4685 C CG   . ASP A 1 27 ? -3.513  -8.822  -6.682  1.00 0.00 ? 27 ASP A CG   7 
ATOM   4686 O OD1  . ASP A 1 27 ? -3.520  -9.784  -7.480  1.00 0.00 ? 27 ASP A OD1  7 
ATOM   4687 O OD2  . ASP A 1 27 ? -4.327  -8.646  -5.749  1.00 0.00 ? 27 ASP A OD2  7 
ATOM   4688 H H    . ASP A 1 27 ? -1.448  -5.156  -7.807  1.00 0.00 ? 27 ASP A H    7 
ATOM   4689 H HA   . ASP A 1 27 ? -2.711  -7.575  -8.964  1.00 0.00 ? 27 ASP A HA   7 
ATOM   4690 H HB2  . ASP A 1 27 ? -1.464  -8.283  -6.943  1.00 0.00 ? 27 ASP A HB2  7 
ATOM   4691 H HB3  . ASP A 1 27 ? -2.370  -7.113  -5.995  1.00 0.00 ? 27 ASP A HB3  7 
ATOM   4692 N N    . MET A 1 28 ? -4.707  -6.063  -7.068  1.00 0.00 ? 28 MET A N    7 
ATOM   4693 C CA   . MET A 1 28 ? -5.941  -5.305  -6.901  1.00 0.00 ? 28 MET A CA   7 
ATOM   4694 C C    . MET A 1 28 ? -5.851  -4.565  -5.567  1.00 0.00 ? 28 MET A C    7 
ATOM   4695 O O    . MET A 1 28 ? -6.177  -5.121  -4.522  1.00 0.00 ? 28 MET A O    7 
ATOM   4696 C CB   . MET A 1 28 ? -7.171  -6.216  -6.931  1.00 0.00 ? 28 MET A CB   7 
ATOM   4697 C CG   . MET A 1 28 ? -7.293  -7.046  -8.215  1.00 0.00 ? 28 MET A CG   7 
ATOM   4698 S SD   . MET A 1 28 ? -8.904  -7.852  -8.458  1.00 0.00 ? 28 MET A SD   7 
ATOM   4699 C CE   . MET A 1 28 ? -9.086  -8.743  -6.889  1.00 0.00 ? 28 MET A CE   7 
ATOM   4700 H H    . MET A 1 28 ? -4.446  -6.650  -6.288  1.00 0.00 ? 28 MET A H    7 
ATOM   4701 H HA   . MET A 1 28 ? -6.079  -4.596  -7.713  1.00 0.00 ? 28 MET A HA   7 
ATOM   4702 H HB2  . MET A 1 28 ? -7.117  -6.873  -6.068  1.00 0.00 ? 28 MET A HB2  7 
ATOM   4703 H HB3  . MET A 1 28 ? -8.052  -5.579  -6.833  1.00 0.00 ? 28 MET A HB3  7 
ATOM   4704 H HG2  . MET A 1 28 ? -7.130  -6.396  -9.075  1.00 0.00 ? 28 MET A HG2  7 
ATOM   4705 H HG3  . MET A 1 28 ? -6.521  -7.817  -8.218  1.00 0.00 ? 28 MET A HG3  7 
ATOM   4706 H HE1  . MET A 1 28 ? -9.986  -9.356  -6.929  1.00 0.00 ? 28 MET A HE1  7 
ATOM   4707 H HE2  . MET A 1 28 ? -8.220  -9.383  -6.722  1.00 0.00 ? 28 MET A HE2  7 
ATOM   4708 H HE3  . MET A 1 28 ? -9.181  -8.033  -6.067  1.00 0.00 ? 28 MET A HE3  7 
ATOM   4709 N N    . ASP A 1 29 ? -5.388  -3.313  -5.633  1.00 0.00 ? 29 ASP A N    7 
ATOM   4710 C CA   . ASP A 1 29 ? -5.128  -2.403  -4.517  1.00 0.00 ? 29 ASP A CA   7 
ATOM   4711 C C    . ASP A 1 29 ? -3.830  -2.793  -3.788  1.00 0.00 ? 29 ASP A C    7 
ATOM   4712 O O    . ASP A 1 29 ? -3.469  -3.968  -3.776  1.00 0.00 ? 29 ASP A O    7 
ATOM   4713 C CB   . ASP A 1 29 ? -6.340  -2.331  -3.578  1.00 0.00 ? 29 ASP A CB   7 
ATOM   4714 C CG   . ASP A 1 29 ? -7.672  -2.045  -4.287  1.00 0.00 ? 29 ASP A CG   7 
ATOM   4715 O OD1  . ASP A 1 29 ? -7.664  -1.222  -5.228  1.00 0.00 ? 29 ASP A OD1  7 
ATOM   4716 O OD2  . ASP A 1 29 ? -8.680  -2.657  -3.871  1.00 0.00 ? 29 ASP A OD2  7 
ATOM   4717 H H    . ASP A 1 29 ? -5.207  -2.984  -6.561  1.00 0.00 ? 29 ASP A H    7 
ATOM   4718 H HA   . ASP A 1 29 ? -4.978  -1.415  -4.954  1.00 0.00 ? 29 ASP A HA   7 
ATOM   4719 H HB2  . ASP A 1 29 ? -6.416  -3.264  -3.026  1.00 0.00 ? 29 ASP A HB2  7 
ATOM   4720 H HB3  . ASP A 1 29 ? -6.162  -1.544  -2.860  1.00 0.00 ? 29 ASP A HB3  7 
ATOM   4721 N N    . ASP A 1 30 ? -3.094  -1.818  -3.223  1.00 0.00 ? 30 ASP A N    7 
ATOM   4722 C CA   . ASP A 1 30 ? -1.676  -1.985  -2.873  1.00 0.00 ? 30 ASP A CA   7 
ATOM   4723 C C    . ASP A 1 30 ? -1.300  -0.942  -1.813  1.00 0.00 ? 30 ASP A C    7 
ATOM   4724 O O    . ASP A 1 30 ? -0.987  0.199   -2.136  1.00 0.00 ? 30 ASP A O    7 
ATOM   4725 C CB   . ASP A 1 30 ? -0.801  -1.803  -4.126  1.00 0.00 ? 30 ASP A CB   7 
ATOM   4726 C CG   . ASP A 1 30 ? -0.945  -2.955  -5.121  1.00 0.00 ? 30 ASP A CG   7 
ATOM   4727 O OD1  . ASP A 1 30 ? -0.499  -4.069  -4.763  1.00 0.00 ? 30 ASP A OD1  7 
ATOM   4728 O OD2  . ASP A 1 30 ? -1.509  -2.713  -6.211  1.00 0.00 ? 30 ASP A OD2  7 
ATOM   4729 H H    . ASP A 1 30 ? -3.490  -0.891  -3.107  1.00 0.00 ? 30 ASP A H    7 
ATOM   4730 H HA   . ASP A 1 30 ? -1.502  -2.997  -2.477  1.00 0.00 ? 30 ASP A HA   7 
ATOM   4731 H HB2  . ASP A 1 30 ? -1.057  -0.856  -4.601  1.00 0.00 ? 30 ASP A HB2  7 
ATOM   4732 H HB3  . ASP A 1 30 ? 0.245   -1.744  -3.828  1.00 0.00 ? 30 ASP A HB3  7 
ATOM   4733 N N    . TYR A 1 31 ? -1.359  -1.346  -0.546  1.00 0.00 ? 31 TYR A N    7 
ATOM   4734 C CA   . TYR A 1 31 ? -1.564  -0.489  0.621   1.00 0.00 ? 31 TYR A CA   7 
ATOM   4735 C C    . TYR A 1 31 ? -0.245  -0.190  1.356   1.00 0.00 ? 31 TYR A C    7 
ATOM   4736 O O    . TYR A 1 31 ? 0.463   -1.120  1.740   1.00 0.00 ? 31 TYR A O    7 
ATOM   4737 C CB   . TYR A 1 31 ? -2.550  -1.195  1.568   1.00 0.00 ? 31 TYR A CB   7 
ATOM   4738 C CG   . TYR A 1 31 ? -3.865  -1.660  0.942   1.00 0.00 ? 31 TYR A CG   7 
ATOM   4739 C CD1  . TYR A 1 31 ? -3.912  -2.830  0.147   1.00 0.00 ? 31 TYR A CD1  7 
ATOM   4740 C CD2  . TYR A 1 31 ? -5.051  -0.927  1.164   1.00 0.00 ? 31 TYR A CD2  7 
ATOM   4741 C CE1  . TYR A 1 31 ? -5.119  -3.226  -0.465  1.00 0.00 ? 31 TYR A CE1  7 
ATOM   4742 C CE2  . TYR A 1 31 ? -6.270  -1.355  0.600   1.00 0.00 ? 31 TYR A CE2  7 
ATOM   4743 C CZ   . TYR A 1 31 ? -6.294  -2.474  -0.255  1.00 0.00 ? 31 TYR A CZ   7 
ATOM   4744 O OH   . TYR A 1 31 ? -7.480  -2.900  -0.785  1.00 0.00 ? 31 TYR A OH   7 
ATOM   4745 H H    . TYR A 1 31 ? -1.518  -2.332  -0.435  1.00 0.00 ? 31 TYR A H    7 
ATOM   4746 H HA   . TYR A 1 31 ? -2.032  0.458   0.327   1.00 0.00 ? 31 TYR A HA   7 
ATOM   4747 H HB2  . TYR A 1 31 ? -2.069  -2.050  2.049   1.00 0.00 ? 31 TYR A HB2  7 
ATOM   4748 H HB3  . TYR A 1 31 ? -2.769  -0.490  2.364   1.00 0.00 ? 31 TYR A HB3  7 
ATOM   4749 H HD1  . TYR A 1 31 ? -3.032  -3.429  -0.006  1.00 0.00 ? 31 TYR A HD1  7 
ATOM   4750 H HD2  . TYR A 1 31 ? -5.033  -0.028  1.753   1.00 0.00 ? 31 TYR A HD2  7 
ATOM   4751 H HE1  . TYR A 1 31 ? -5.142  -4.111  -1.086  1.00 0.00 ? 31 TYR A HE1  7 
ATOM   4752 H HE2  . TYR A 1 31 ? -7.171  -0.788  0.780   1.00 0.00 ? 31 TYR A HE2  7 
ATOM   4753 H HH   . TYR A 1 31 ? -8.209  -2.300  -0.613  1.00 0.00 ? 31 TYR A HH   7 
ATOM   4754 N N    . CYS A 1 32 ? 0.053   1.100   1.602   1.00 0.00 ? 32 CYS A N    7 
ATOM   4755 C CA   . CYS A 1 32 ? 1.154   1.557   2.448   1.00 0.00 ? 32 CYS A CA   7 
ATOM   4756 C C    . CYS A 1 32 ? 0.966   1.082   3.884   1.00 0.00 ? 32 CYS A C    7 
ATOM   4757 O O    . CYS A 1 32 ? -0.164  0.966   4.362   1.00 0.00 ? 32 CYS A O    7 
ATOM   4758 C CB   . CYS A 1 32 ? 1.366   3.091   2.415   1.00 0.00 ? 32 CYS A CB   7 
ATOM   4759 S SG   . CYS A 1 32 ? 3.037   3.517   1.909   1.00 0.00 ? 32 CYS A SG   7 
ATOM   4760 H H    . CYS A 1 32 ? -0.586  1.799   1.276   1.00 0.00 ? 32 CYS A H    7 
ATOM   4761 H HA   . CYS A 1 32 ? 2.044   1.070   2.049   1.00 0.00 ? 32 CYS A HA   7 
ATOM   4762 H HB2  . CYS A 1 32 ? 0.680   3.622   1.760   1.00 0.00 ? 32 CYS A HB2  7 
ATOM   4763 H HB3  . CYS A 1 32 ? 1.271   3.536   3.406   1.00 0.00 ? 32 CYS A HB3  7 
ATOM   4764 N N    . ASN A 1 33 ? 2.095   0.799   4.544   1.00 0.00 ? 33 ASN A N    7 
ATOM   4765 C CA   . ASN A 1 33 ? 2.130   0.067   5.812   1.00 0.00 ? 33 ASN A CA   7 
ATOM   4766 C C    . ASN A 1 33 ? 2.480   0.936   7.028   1.00 0.00 ? 33 ASN A C    7 
ATOM   4767 O O    . ASN A 1 33 ? 2.617   0.396   8.124   1.00 0.00 ? 33 ASN A O    7 
ATOM   4768 C CB   . ASN A 1 33 ? 3.112   -1.103  5.673   1.00 0.00 ? 33 ASN A CB   7 
ATOM   4769 C CG   . ASN A 1 33 ? 2.678   -2.079  4.583   1.00 0.00 ? 33 ASN A CG   7 
ATOM   4770 O OD1  . ASN A 1 33 ? 1.496   -2.376  4.409   1.00 0.00 ? 33 ASN A OD1  7 
ATOM   4771 N ND2  . ASN A 1 33 ? 3.658   -2.574  3.842   1.00 0.00 ? 33 ASN A ND2  7 
ATOM   4772 H H    . ASN A 1 33 ? 2.973   0.974   4.063   1.00 0.00 ? 33 ASN A H    7 
ATOM   4773 H HA   . ASN A 1 33 ? 1.161   -0.390  6.013   1.00 0.00 ? 33 ASN A HA   7 
ATOM   4774 H HB2  . ASN A 1 33 ? 4.106   -0.698  5.460   1.00 0.00 ? 33 ASN A HB2  7 
ATOM   4775 H HB3  . ASN A 1 33 ? 3.182   -1.682  6.591   1.00 0.00 ? 33 ASN A HB3  7 
ATOM   4776 H HD21 . ASN A 1 33 ? 4.604   -2.303  4.059   1.00 0.00 ? 33 ASN A HD21 7 
ATOM   4777 H HD22 . ASN A 1 33 ? 3.460   -3.224  3.100   1.00 0.00 ? 33 ASN A HD22 7 
ATOM   4778 N N    . GLY A 1 34 ? 2.676   2.254   6.860   1.00 0.00 ? 34 GLY A N    7 
ATOM   4779 C CA   . GLY A 1 34 ? 3.192   3.116   7.919   1.00 0.00 ? 34 GLY A CA   7 
ATOM   4780 C C    . GLY A 1 34 ? 4.718   3.001   8.101   1.00 0.00 ? 34 GLY A C    7 
ATOM   4781 O O    . GLY A 1 34 ? 5.341   3.942   8.589   1.00 0.00 ? 34 GLY A O    7 
ATOM   4782 H H    . GLY A 1 34 ? 2.548   2.665   5.947   1.00 0.00 ? 34 GLY A H    7 
ATOM   4783 H HA2  . GLY A 1 34 ? 2.928   4.138   7.658   1.00 0.00 ? 34 GLY A HA2  7 
ATOM   4784 H HA3  . GLY A 1 34 ? 2.705   2.884   8.868   1.00 0.00 ? 34 GLY A HA3  7 
ATOM   4785 N N    . LYS A 1 35 ? 5.311   1.853   7.729   1.00 0.00 ? 35 LYS A N    7 
ATOM   4786 C CA   . LYS A 1 35 ? 6.729   1.523   7.853   1.00 0.00 ? 35 LYS A CA   7 
ATOM   4787 C C    . LYS A 1 35 ? 7.505   1.838   6.568   1.00 0.00 ? 35 LYS A C    7 
ATOM   4788 O O    . LYS A 1 35 ? 8.645   2.297   6.646   1.00 0.00 ? 35 LYS A O    7 
ATOM   4789 C CB   . LYS A 1 35 ? 6.890   0.033   8.212   1.00 0.00 ? 35 LYS A CB   7 
ATOM   4790 C CG   . LYS A 1 35 ? 6.012   -0.441  9.382   1.00 0.00 ? 35 LYS A CG   7 
ATOM   4791 C CD   . LYS A 1 35 ? 6.193   0.413   10.646  1.00 0.00 ? 35 LYS A CD   7 
ATOM   4792 C CE   . LYS A 1 35 ? 5.304   -0.070  11.801  1.00 0.00 ? 35 LYS A CE   7 
ATOM   4793 N NZ   . LYS A 1 35 ? 5.662   -1.423  12.261  1.00 0.00 ? 35 LYS A NZ   7 
ATOM   4794 H H    . LYS A 1 35 ? 4.724   1.115   7.368   1.00 0.00 ? 35 LYS A H    7 
ATOM   4795 H HA   . LYS A 1 35 ? 7.175   2.115   8.652   1.00 0.00 ? 35 LYS A HA   7 
ATOM   4796 H HB2  . LYS A 1 35 ? 6.637   -0.579  7.343   1.00 0.00 ? 35 LYS A HB2  7 
ATOM   4797 H HB3  . LYS A 1 35 ? 7.937   -0.153  8.462   1.00 0.00 ? 35 LYS A HB3  7 
ATOM   4798 H HG2  . LYS A 1 35 ? 4.963   -0.421  9.084   1.00 0.00 ? 35 LYS A HG2  7 
ATOM   4799 H HG3  . LYS A 1 35 ? 6.277   -1.477  9.600   1.00 0.00 ? 35 LYS A HG3  7 
ATOM   4800 H HD2  . LYS A 1 35 ? 7.240   0.393   10.956  1.00 0.00 ? 35 LYS A HD2  7 
ATOM   4801 H HD3  . LYS A 1 35 ? 5.915   1.445   10.436  1.00 0.00 ? 35 LYS A HD3  7 
ATOM   4802 H HE2  . LYS A 1 35 ? 5.414   0.615   12.643  1.00 0.00 ? 35 LYS A HE2  7 
ATOM   4803 H HE3  . LYS A 1 35 ? 4.259   -0.067  11.487  1.00 0.00 ? 35 LYS A HE3  7 
ATOM   4804 H HZ1  . LYS A 1 35 ? 5.536   -2.083  11.506  1.00 0.00 ? 35 LYS A HZ1  7 
ATOM   4805 H HZ2  . LYS A 1 35 ? 6.627   -1.433  12.559  1.00 0.00 ? 35 LYS A HZ2  7 
ATOM   4806 H HZ3  . LYS A 1 35 ? 5.069   -1.684  13.036  1.00 0.00 ? 35 LYS A HZ3  7 
ATOM   4807 N N    . THR A 1 36 ? 6.902   1.564   5.400   1.00 0.00 ? 36 THR A N    7 
ATOM   4808 C CA   . THR A 1 36 ? 7.528   1.693   4.081   1.00 0.00 ? 36 THR A CA   7 
ATOM   4809 C C    . THR A 1 36 ? 6.592   2.317   3.041   1.00 0.00 ? 36 THR A C    7 
ATOM   4810 O O    . THR A 1 36 ? 5.373   2.128   3.100   1.00 0.00 ? 36 THR A O    7 
ATOM   4811 C CB   . THR A 1 36 ? 8.066   0.332   3.614   1.00 0.00 ? 36 THR A CB   7 
ATOM   4812 O OG1  . THR A 1 36 ? 8.612   0.413   2.309   1.00 0.00 ? 36 THR A OG1  7 
ATOM   4813 C CG2  . THR A 1 36 ? 7.008   -0.786  3.650   1.00 0.00 ? 36 THR A CG2  7 
ATOM   4814 H H    . THR A 1 36 ? 5.970   1.176   5.439   1.00 0.00 ? 36 THR A H    7 
ATOM   4815 H HA   . THR A 1 36 ? 8.395   2.349   4.179   1.00 0.00 ? 36 THR A HA   7 
ATOM   4816 H HB   . THR A 1 36 ? 8.891   0.109   4.285   1.00 0.00 ? 36 THR A HB   7 
ATOM   4817 H HG1  . THR A 1 36 ? 9.300   1.084   2.304   1.00 0.00 ? 36 THR A HG1  7 
ATOM   4818 H HG21 . THR A 1 36 ? 7.450   -1.720  3.300   1.00 0.00 ? 36 THR A HG21 7 
ATOM   4819 H HG22 . THR A 1 36 ? 6.165   -0.535  3.008   1.00 0.00 ? 36 THR A HG22 7 
ATOM   4820 H HG23 . THR A 1 36 ? 6.648   -0.943  4.668   1.00 0.00 ? 36 THR A HG23 7 
ATOM   4821 N N    . CYS A 1 37 ? 7.223   3.030   2.088   1.00 0.00 ? 37 CYS A N    7 
ATOM   4822 C CA   . CYS A 1 37 ? 6.627   3.746   0.948   1.00 0.00 ? 37 CYS A CA   7 
ATOM   4823 C C    . CYS A 1 37 ? 6.713   2.990   -0.387  1.00 0.00 ? 37 CYS A C    7 
ATOM   4824 O O    . CYS A 1 37 ? 6.392   3.563   -1.429  1.00 0.00 ? 37 CYS A O    7 
ATOM   4825 C CB   . CYS A 1 37 ? 7.251   5.150   0.795   1.00 0.00 ? 37 CYS A CB   7 
ATOM   4826 S SG   . CYS A 1 37 ? 7.470   6.073   2.339   1.00 0.00 ? 37 CYS A SG   7 
ATOM   4827 H H    . CYS A 1 37 ? 8.228   3.068   2.183   1.00 0.00 ? 37 CYS A H    7 
ATOM   4828 H HA   . CYS A 1 37 ? 5.575   3.868   1.153   1.00 0.00 ? 37 CYS A HA   7 
ATOM   4829 H HB2  . CYS A 1 37 ? 8.228   5.064   0.319   1.00 0.00 ? 37 CYS A HB2  7 
ATOM   4830 H HB3  . CYS A 1 37 ? 6.619   5.748   0.139   1.00 0.00 ? 37 CYS A HB3  7 
ATOM   4831 N N    . ASP A 1 38 ? 7.148   1.724   -0.367  1.00 0.00 ? 38 ASP A N    7 
ATOM   4832 C CA   . ASP A 1 38 ? 7.434   0.926   -1.556  1.00 0.00 ? 38 ASP A CA   7 
ATOM   4833 C C    . ASP A 1 38 ? 6.160   0.202   -2.019  1.00 0.00 ? 38 ASP A C    7 
ATOM   4834 O O    . ASP A 1 38 ? 6.129   -1.027  -2.016  1.00 0.00 ? 38 ASP A O    7 
ATOM   4835 C CB   . ASP A 1 38 ? 8.604   -0.030  -1.234  1.00 0.00 ? 38 ASP A CB   7 
ATOM   4836 C CG   . ASP A 1 38 ? 9.065   -0.872  -2.432  1.00 0.00 ? 38 ASP A CG   7 
ATOM   4837 O OD1  . ASP A 1 38 ? 9.121   -0.309  -3.548  1.00 0.00 ? 38 ASP A OD1  7 
ATOM   4838 O OD2  . ASP A 1 38 ? 9.359   -2.067  -2.211  1.00 0.00 ? 38 ASP A OD2  7 
ATOM   4839 H H    . ASP A 1 38 ? 7.330   1.313   0.536   1.00 0.00 ? 38 ASP A H    7 
ATOM   4840 H HA   . ASP A 1 38 ? 7.765   1.586   -2.362  1.00 0.00 ? 38 ASP A HA   7 
ATOM   4841 H HB2  . ASP A 1 38 ? 9.461   0.556   -0.897  1.00 0.00 ? 38 ASP A HB2  7 
ATOM   4842 H HB3  . ASP A 1 38 ? 8.310   -0.692  -0.415  1.00 0.00 ? 38 ASP A HB3  7 
ATOM   4843 N N    . CYS A 1 39 ? 5.127   0.984   -2.401  1.00 0.00 ? 39 CYS A N    7 
ATOM   4844 C CA   . CYS A 1 39 ? 3.761   0.607   -2.783  1.00 0.00 ? 39 CYS A CA   7 
ATOM   4845 C C    . CYS A 1 39 ? 3.461   -0.891  -2.608  1.00 0.00 ? 39 CYS A C    7 
ATOM   4846 O O    . CYS A 1 39 ? 3.431   -1.626  -3.595  1.00 0.00 ? 39 CYS A O    7 
ATOM   4847 C CB   . CYS A 1 39 ? 3.461   1.154   -4.183  1.00 0.00 ? 39 CYS A CB   7 
ATOM   4848 S SG   . CYS A 1 39 ? 3.471   2.971   -4.272  1.00 0.00 ? 39 CYS A SG   7 
ATOM   4849 H H    . CYS A 1 39 ? 5.283   1.979   -2.403  1.00 0.00 ? 39 CYS A H    7 
ATOM   4850 H HA   . CYS A 1 39 ? 3.072   1.146   -2.141  1.00 0.00 ? 39 CYS A HA   7 
ATOM   4851 H HB2  . CYS A 1 39 ? 4.195   0.762   -4.881  1.00 0.00 ? 39 CYS A HB2  7 
ATOM   4852 H HB3  . CYS A 1 39 ? 2.477   0.809   -4.478  1.00 0.00 ? 39 CYS A HB3  7 
ATOM   4853 N N    . PRO A 1 40 ? 3.309   -1.348  -1.346  1.00 0.00 ? 40 PRO A N    7 
ATOM   4854 C CA   . PRO A 1 40 ? 3.364   -2.754  -0.957  1.00 0.00 ? 40 PRO A CA   7 
ATOM   4855 C C    . PRO A 1 40 ? 2.402   -3.658  -1.730  1.00 0.00 ? 40 PRO A C    7 
ATOM   4856 O O    . PRO A 1 40 ? 1.312   -3.231  -2.107  1.00 0.00 ? 40 PRO A O    7 
ATOM   4857 C CB   . PRO A 1 40 ? 3.094   -2.789  0.549   1.00 0.00 ? 40 PRO A CB   7 
ATOM   4858 C CG   . PRO A 1 40 ? 3.619   -1.431  1.012   1.00 0.00 ? 40 PRO A CG   7 
ATOM   4859 C CD   . PRO A 1 40 ? 3.281   -0.512  -0.152  1.00 0.00 ? 40 PRO A CD   7 
ATOM   4860 H HA   . PRO A 1 40 ? 4.390   -3.078  -1.132  1.00 0.00 ? 40 PRO A HA   7 
ATOM   4861 H HB2  . PRO A 1 40 ? 2.026   -2.852  0.750   1.00 0.00 ? 40 PRO A HB2  7 
ATOM   4862 H HB3  . PRO A 1 40 ? 3.602   -3.619  1.035   1.00 0.00 ? 40 PRO A HB3  7 
ATOM   4863 H HG2  . PRO A 1 40 ? 3.148   -1.072  1.924   1.00 0.00 ? 40 PRO A HG2  7 
ATOM   4864 H HG3  . PRO A 1 40 ? 4.703   -1.486  1.140   1.00 0.00 ? 40 PRO A HG3  7 
ATOM   4865 H HD2  . PRO A 1 40 ? 2.275   -0.110  -0.035  1.00 0.00 ? 40 PRO A HD2  7 
ATOM   4866 H HD3  . PRO A 1 40 ? 4.001   0.306   -0.149  1.00 0.00 ? 40 PRO A HD3  7 
ATOM   4867 N N    . ARG A 1 41 ? 2.833   -4.903  -1.973  1.00 0.00 ? 41 ARG A N    7 
ATOM   4868 C CA   . ARG A 1 41 ? 2.191   -5.864  -2.851  1.00 0.00 ? 41 ARG A CA   7 
ATOM   4869 C C    . ARG A 1 41 ? 1.028   -6.568  -2.128  1.00 0.00 ? 41 ARG A C    7 
ATOM   4870 O O    . ARG A 1 41 ? 1.008   -7.792  -2.038  1.00 0.00 ? 41 ARG A O    7 
ATOM   4871 C CB   . ARG A 1 41 ? 3.288   -6.827  -3.355  1.00 0.00 ? 41 ARG A CB   7 
ATOM   4872 C CG   . ARG A 1 41 ? 4.068   -6.303  -4.574  1.00 0.00 ? 41 ARG A CG   7 
ATOM   4873 C CD   . ARG A 1 41 ? 4.709   -4.925  -4.365  1.00 0.00 ? 41 ARG A CD   7 
ATOM   4874 N NE   . ARG A 1 41 ? 5.554   -4.549  -5.508  1.00 0.00 ? 41 ARG A NE   7 
ATOM   4875 C CZ   . ARG A 1 41 ? 6.214   -3.385  -5.646  1.00 0.00 ? 41 ARG A CZ   7 
ATOM   4876 N NH1  . ARG A 1 41 ? 6.145   -2.426  -4.710  1.00 0.00 ? 41 ARG A NH1  7 
ATOM   4877 N NH2  . ARG A 1 41 ? 6.958   -3.182  -6.742  1.00 0.00 ? 41 ARG A NH2  7 
ATOM   4878 H H    . ARG A 1 41 ? 3.729   -5.201  -1.620  1.00 0.00 ? 41 ARG A H    7 
ATOM   4879 H HA   . ARG A 1 41 ? 1.767   -5.355  -3.719  1.00 0.00 ? 41 ARG A HA   7 
ATOM   4880 H HB2  . ARG A 1 41 ? 3.984   -7.072  -2.550  1.00 0.00 ? 41 ARG A HB2  7 
ATOM   4881 H HB3  . ARG A 1 41 ? 2.832   -7.759  -3.664  1.00 0.00 ? 41 ARG A HB3  7 
ATOM   4882 H HG2  . ARG A 1 41 ? 4.851   -7.028  -4.809  1.00 0.00 ? 41 ARG A HG2  7 
ATOM   4883 H HG3  . ARG A 1 41 ? 3.390   -6.251  -5.428  1.00 0.00 ? 41 ARG A HG3  7 
ATOM   4884 H HD2  . ARG A 1 41 ? 3.924   -4.176  -4.264  1.00 0.00 ? 41 ARG A HD2  7 
ATOM   4885 H HD3  . ARG A 1 41 ? 5.318   -4.939  -3.461  1.00 0.00 ? 41 ARG A HD3  7 
ATOM   4886 H HE   . ARG A 1 41 ? 5.634   -5.232  -6.249  1.00 0.00 ? 41 ARG A HE   7 
ATOM   4887 H HH11 . ARG A 1 41 ? 5.574   -2.557  -3.887  1.00 0.00 ? 41 ARG A HH11 7 
ATOM   4888 H HH12 . ARG A 1 41 ? 6.657   -1.564  -4.832  1.00 0.00 ? 41 ARG A HH12 7 
ATOM   4889 H HH21 . ARG A 1 41 ? 7.019   -3.899  -7.451  1.00 0.00 ? 41 ARG A HH21 7 
ATOM   4890 H HH22 . ARG A 1 41 ? 7.464   -2.315  -6.858  1.00 0.00 ? 41 ARG A HH22 7 
ATOM   4891 N N    . ASN A 1 42 ? 0.042   -5.781  -1.661  1.00 0.00 ? 42 ASN A N    7 
ATOM   4892 C CA   . ASN A 1 42 ? -1.281  -6.208  -1.217  1.00 0.00 ? 42 ASN A CA   7 
ATOM   4893 C C    . ASN A 1 42 ? -1.209  -7.301  -0.132  1.00 0.00 ? 42 ASN A C    7 
ATOM   4894 O O    . ASN A 1 42 ? -1.088  -8.475  -0.479  1.00 0.00 ? 42 ASN A O    7 
ATOM   4895 C CB   . ASN A 1 42 ? -2.102  -6.628  -2.449  1.00 0.00 ? 42 ASN A CB   7 
ATOM   4896 C CG   . ASN A 1 42 ? -3.581  -6.918  -2.161  1.00 0.00 ? 42 ASN A CG   7 
ATOM   4897 O OD1  . ASN A 1 42 ? -3.983  -7.159  -1.023  1.00 0.00 ? 42 ASN A OD1  7 
ATOM   4898 N ND2  . ASN A 1 42 ? -4.399  -6.896  -3.215  1.00 0.00 ? 42 ASN A ND2  7 
ATOM   4899 H H    . ASN A 1 42 ? 0.162   -4.782  -1.764  1.00 0.00 ? 42 ASN A H    7 
ATOM   4900 H HA   . ASN A 1 42 ? -1.777  -5.318  -0.832  1.00 0.00 ? 42 ASN A HA   7 
ATOM   4901 H HB2  . ASN A 1 42 ? -2.039  -5.827  -3.183  1.00 0.00 ? 42 ASN A HB2  7 
ATOM   4902 H HB3  . ASN A 1 42 ? -1.654  -7.499  -2.915  1.00 0.00 ? 42 ASN A HB3  7 
ATOM   4903 H HD21 . ASN A 1 42 ? -4.037  -6.655  -4.126  1.00 0.00 ? 42 ASN A HD21 7 
ATOM   4904 H HD22 . ASN A 1 42 ? -5.383  -7.088  -3.105  1.00 0.00 ? 42 ASN A HD22 7 
ATOM   4905 N N    . PRO A 1 43 ? -1.309  -6.947  1.166   1.00 0.00 ? 43 PRO A N    7 
ATOM   4906 C CA   . PRO A 1 43 ? -1.214  -7.865  2.304   1.00 0.00 ? 43 PRO A CA   7 
ATOM   4907 C C    . PRO A 1 43 ? -1.958  -9.200  2.166   1.00 0.00 ? 43 PRO A C    7 
ATOM   4908 O O    . PRO A 1 43 ? -1.454  -10.234 2.604   1.00 0.00 ? 43 PRO A O    7 
ATOM   4909 C CB   . PRO A 1 43 ? -1.706  -7.064  3.516   1.00 0.00 ? 43 PRO A CB   7 
ATOM   4910 C CG   . PRO A 1 43 ? -1.281  -5.639  3.165   1.00 0.00 ? 43 PRO A CG   7 
ATOM   4911 C CD   . PRO A 1 43 ? -1.500  -5.586  1.652   1.00 0.00 ? 43 PRO A CD   7 
ATOM   4912 H HA   . PRO A 1 43 ? -0.158  -8.084  2.429   1.00 0.00 ? 43 PRO A HA   7 
ATOM   4913 H HB2  . PRO A 1 43 ? -2.796  -7.103  3.584   1.00 0.00 ? 43 PRO A HB2  7 
ATOM   4914 H HB3  . PRO A 1 43 ? -1.264  -7.411  4.452   1.00 0.00 ? 43 PRO A HB3  7 
ATOM   4915 H HG2  . PRO A 1 43 ? -1.867  -4.888  3.696   1.00 0.00 ? 43 PRO A HG2  7 
ATOM   4916 H HG3  . PRO A 1 43 ? -0.220  -5.510  3.389   1.00 0.00 ? 43 PRO A HG3  7 
ATOM   4917 H HD2  . PRO A 1 43 ? -2.528  -5.283  1.446   1.00 0.00 ? 43 PRO A HD2  7 
ATOM   4918 H HD3  . PRO A 1 43 ? -0.801  -4.878  1.201   1.00 0.00 ? 43 PRO A HD3  7 
ATOM   4919 N N    . HIS A 1 44 ? -3.150  -9.173  1.557   1.00 0.00 ? 44 HIS A N    7 
ATOM   4920 C CA   . HIS A 1 44 ? -4.015  -10.331 1.349   1.00 0.00 ? 44 HIS A CA   7 
ATOM   4921 C C    . HIS A 1 44 ? -3.387  -11.377 0.418   1.00 0.00 ? 44 HIS A C    7 
ATOM   4922 O O    . HIS A 1 44 ? -3.543  -12.576 0.647   1.00 0.00 ? 44 HIS A O    7 
ATOM   4923 C CB   . HIS A 1 44 ? -5.387  -9.865  0.827   1.00 0.00 ? 44 HIS A CB   7 
ATOM   4924 C CG   . HIS A 1 44 ? -6.025  -8.808  1.693   1.00 0.00 ? 44 HIS A CG   7 
ATOM   4925 N ND1  . HIS A 1 44 ? -6.059  -7.457  1.429   1.00 0.00 ? 44 HIS A ND1  7 
ATOM   4926 C CD2  . HIS A 1 44 ? -6.456  -8.989  2.977   1.00 0.00 ? 44 HIS A CD2  7 
ATOM   4927 C CE1  . HIS A 1 44 ? -6.524  -6.845  2.532   1.00 0.00 ? 44 HIS A CE1  7 
ATOM   4928 N NE2  . HIS A 1 44 ? -6.782  -7.736  3.503   1.00 0.00 ? 44 HIS A NE2  7 
ATOM   4929 H H    . HIS A 1 44 ? -3.476  -8.286  1.204   1.00 0.00 ? 44 HIS A H    7 
ATOM   4930 H HA   . HIS A 1 44 ? -4.167  -10.802 2.318   1.00 0.00 ? 44 HIS A HA   7 
ATOM   4931 H HB2  . HIS A 1 44 ? -5.276  -9.451  -0.173  1.00 0.00 ? 44 HIS A HB2  7 
ATOM   4932 H HB3  . HIS A 1 44 ? -6.060  -10.721 0.766   1.00 0.00 ? 44 HIS A HB3  7 
ATOM   4933 H HD1  . HIS A 1 44 ? -5.745  -7.007  0.580   1.00 0.00 ? 44 HIS A HD1  7 
ATOM   4934 H HD2  . HIS A 1 44 ? -6.457  -9.929  3.505   1.00 0.00 ? 44 HIS A HD2  7 
ATOM   4935 H HE1  . HIS A 1 44 ? -6.645  -5.778  2.631   1.00 0.00 ? 44 HIS A HE1  7 
ATOM   4936 N N    . LYS A 1 45 ? -2.697  -10.917 -0.636  1.00 0.00 ? 45 LYS A N    7 
ATOM   4937 C CA   . LYS A 1 45 ? -2.051  -11.738 -1.652  1.00 0.00 ? 45 LYS A CA   7 
ATOM   4938 C C    . LYS A 1 45 ? -0.565  -11.888 -1.304  1.00 0.00 ? 45 LYS A C    7 
ATOM   4939 O O    . LYS A 1 45 ? -0.152  -12.923 -0.782  1.00 0.00 ? 45 LYS A O    7 
ATOM   4940 C CB   . LYS A 1 45 ? -2.277  -11.151 -3.062  1.00 0.00 ? 45 LYS A CB   7 
ATOM   4941 C CG   . LYS A 1 45 ? -3.686  -11.401 -3.628  1.00 0.00 ? 45 LYS A CG   7 
ATOM   4942 C CD   . LYS A 1 45 ? -4.791  -10.618 -2.903  1.00 0.00 ? 45 LYS A CD   7 
ATOM   4943 C CE   . LYS A 1 45 ? -6.124  -10.713 -3.656  1.00 0.00 ? 45 LYS A CE   7 
ATOM   4944 N NZ   . LYS A 1 45 ? -7.151  -9.851  -3.047  1.00 0.00 ? 45 LYS A NZ   7 
ATOM   4945 H H    . LYS A 1 45 ? -2.579  -9.919  -0.706  1.00 0.00 ? 45 LYS A H    7 
ATOM   4946 H HA   . LYS A 1 45 ? -2.485  -12.731 -1.652  1.00 0.00 ? 45 LYS A HA   7 
ATOM   4947 H HB2  . LYS A 1 45 ? -2.063  -10.080 -3.070  1.00 0.00 ? 45 LYS A HB2  7 
ATOM   4948 H HB3  . LYS A 1 45 ? -1.577  -11.636 -3.747  1.00 0.00 ? 45 LYS A HB3  7 
ATOM   4949 H HG2  . LYS A 1 45 ? -3.675  -11.092 -4.675  1.00 0.00 ? 45 LYS A HG2  7 
ATOM   4950 H HG3  . LYS A 1 45 ? -3.913  -12.468 -3.597  1.00 0.00 ? 45 LYS A HG3  7 
ATOM   4951 H HD2  . LYS A 1 45 ? -4.938  -11.031 -1.905  1.00 0.00 ? 45 LYS A HD2  7 
ATOM   4952 H HD3  . LYS A 1 45 ? -4.491  -9.574  -2.823  1.00 0.00 ? 45 LYS A HD3  7 
ATOM   4953 H HE2  . LYS A 1 45 ? -5.994  -10.405 -4.693  1.00 0.00 ? 45 LYS A HE2  7 
ATOM   4954 H HE3  . LYS A 1 45 ? -6.477  -11.745 -3.641  1.00 0.00 ? 45 LYS A HE3  7 
ATOM   4955 H HZ1  . LYS A 1 45 ? -7.290  -10.118 -2.083  1.00 0.00 ? 45 LYS A HZ1  7 
ATOM   4956 H HZ2  . LYS A 1 45 ? -6.849  -8.888  -3.088  1.00 0.00 ? 45 LYS A HZ2  7 
ATOM   4957 H HZ3  . LYS A 1 45 ? -8.020  -9.951  -3.552  1.00 0.00 ? 45 LYS A HZ3  7 
ATOM   4958 N N    . GLY A 1 46 ? 0.226   -10.849 -1.599  1.00 0.00 ? 46 GLY A N    7 
ATOM   4959 C CA   . GLY A 1 46 ? 1.662   -10.787 -1.359  1.00 0.00 ? 46 GLY A CA   7 
ATOM   4960 C C    . GLY A 1 46 ? 2.003   -10.187 0.014   1.00 0.00 ? 46 GLY A C    7 
ATOM   4961 O O    . GLY A 1 46 ? 1.115   -9.967  0.839   1.00 0.00 ? 46 GLY A O    7 
ATOM   4962 H H    . GLY A 1 46 ? -0.217  -10.035 -1.999  1.00 0.00 ? 46 GLY A H    7 
ATOM   4963 H HA2  . GLY A 1 46 ? 2.102   -11.784 -1.436  1.00 0.00 ? 46 GLY A HA2  7 
ATOM   4964 H HA3  . GLY A 1 46 ? 2.091   -10.170 -2.148  1.00 0.00 ? 46 GLY A HA3  7 
ATOM   4965 N N    . PRO A 1 47 ? 3.299   -9.930  0.278   1.00 0.00 ? 47 PRO A N    7 
ATOM   4966 C CA   . PRO A 1 47 ? 3.798   -9.468  1.570   1.00 0.00 ? 47 PRO A CA   7 
ATOM   4967 C C    . PRO A 1 47 ? 3.582   -7.958  1.770   1.00 0.00 ? 47 PRO A C    7 
ATOM   4968 O O    . PRO A 1 47 ? 3.241   -7.230  0.835   1.00 0.00 ? 47 PRO A O    7 
ATOM   4969 C CB   . PRO A 1 47 ? 5.290   -9.827  1.557   1.00 0.00 ? 47 PRO A CB   7 
ATOM   4970 C CG   . PRO A 1 47 ? 5.660   -9.658  0.082   1.00 0.00 ? 47 PRO A CG   7 
ATOM   4971 C CD   . PRO A 1 47 ? 4.407   -10.166 -0.637  1.00 0.00 ? 47 PRO A CD   7 
ATOM   4972 H HA   . PRO A 1 47 ? 3.310   -10.010 2.384   1.00 0.00 ? 47 PRO A HA   7 
ATOM   4973 H HB2  . PRO A 1 47 ? 5.898   -9.203  2.214   1.00 0.00 ? 47 PRO A HB2  7 
ATOM   4974 H HB3  . PRO A 1 47 ? 5.415   -10.875 1.836   1.00 0.00 ? 47 PRO A HB3  7 
ATOM   4975 H HG2  . PRO A 1 47 ? 5.808   -8.598  -0.136  1.00 0.00 ? 47 PRO A HG2  7 
ATOM   4976 H HG3  . PRO A 1 47 ? 6.554   -10.221 -0.189  1.00 0.00 ? 47 PRO A HG3  7 
ATOM   4977 H HD2  . PRO A 1 47 ? 4.279   -9.636  -1.582  1.00 0.00 ? 47 PRO A HD2  7 
ATOM   4978 H HD3  . PRO A 1 47 ? 4.501   -11.237 -0.822  1.00 0.00 ? 47 PRO A HD3  7 
ATOM   4979 N N    . ALA A 1 48 ? 3.810   -7.497  3.010   1.00 0.00 ? 48 ALA A N    7 
ATOM   4980 C CA   . ALA A 1 48 ? 3.720   -6.097  3.419   1.00 0.00 ? 48 ALA A CA   7 
ATOM   4981 C C    . ALA A 1 48 ? 5.036   -5.359  3.110   1.00 0.00 ? 48 ALA A C    7 
ATOM   4982 O O    . ALA A 1 48 ? 5.659   -4.785  4.002   1.00 0.00 ? 48 ALA A O    7 
ATOM   4983 C CB   . ALA A 1 48 ? 3.335   -6.036  4.906   1.00 0.00 ? 48 ALA A CB   7 
ATOM   4984 H H    . ALA A 1 48 ? 4.091   -8.160  3.719   1.00 0.00 ? 48 ALA A H    7 
ATOM   4985 H HA   . ALA A 1 48 ? 2.919   -5.605  2.863   1.00 0.00 ? 48 ALA A HA   7 
ATOM   4986 H HB1  . ALA A 1 48 ? 2.384   -6.546  5.066   1.00 0.00 ? 48 ALA A HB1  7 
ATOM   4987 H HB2  . ALA A 1 48 ? 4.100   -6.516  5.519   1.00 0.00 ? 48 ALA A HB2  7 
ATOM   4988 H HB3  . ALA A 1 48 ? 3.225   -4.999  5.227   1.00 0.00 ? 48 ALA A HB3  7 
ATOM   4989 N N    . THR A 1 49 ? 5.430   -5.362  1.827   1.00 0.00 ? 49 THR A N    7 
ATOM   4990 C CA   . THR A 1 49 ? 6.561   -4.628  1.260   1.00 0.00 ? 49 THR A CA   7 
ATOM   4991 C C    . THR A 1 49 ? 6.501   -4.707  -0.277  1.00 0.00 ? 49 THR A C    7 
ATOM   4992 O O    . THR A 1 49 ? 5.924   -5.635  -0.845  1.00 0.00 ? 49 THR A O    7 
ATOM   4993 C CB   . THR A 1 49 ? 7.910   -5.129  1.826   1.00 0.00 ? 49 THR A CB   7 
ATOM   4994 O OG1  . THR A 1 49 ? 8.979   -4.353  1.317   1.00 0.00 ? 49 THR A OG1  7 
ATOM   4995 C CG2  . THR A 1 49 ? 8.176   -6.615  1.542   1.00 0.00 ? 49 THR A CG2  7 
ATOM   4996 H H    . THR A 1 49 ? 4.858   -5.871  1.167   1.00 0.00 ? 49 THR A H    7 
ATOM   4997 H HA   . THR A 1 49 ? 6.439   -3.580  1.549   1.00 0.00 ? 49 THR A HA   7 
ATOM   4998 H HB   . THR A 1 49 ? 7.922   -4.988  2.908   1.00 0.00 ? 49 THR A HB   7 
ATOM   4999 H HG1  . THR A 1 49 ? 9.048   -4.507  0.372   1.00 0.00 ? 49 THR A HG1  7 
ATOM   5000 H HG21 . THR A 1 49 ? 9.129   -6.907  1.986   1.00 0.00 ? 49 THR A HG21 7 
ATOM   5001 H HG22 . THR A 1 49 ? 8.217   -6.801  0.469   1.00 0.00 ? 49 THR A HG22 7 
ATOM   5002 H HG23 . THR A 1 49 ? 7.389   -7.228  1.982   1.00 0.00 ? 49 THR A HG23 7 
HETATM 5003 N N    . NH2 A 1 50 ? 7.067   -3.707  -0.960  1.00 0.00 ? 50 NH2 A N    7 
HETATM 5004 H HN1  . NH2 A 1 50 ? 7.035   -3.704  -1.970  1.00 0.00 ? 50 NH2 A HN1  7 
HETATM 5005 H HN2  . NH2 A 1 50 ? 7.519   -2.951  -0.467  1.00 0.00 ? 50 NH2 A HN2  7 
ATOM   5006 N N    . GLU A 1 1  ? 15.913  14.317  -0.899  1.00 0.00 ? 1  GLU A N    8 
ATOM   5007 C CA   . GLU A 1 1  ? 14.440  14.229  -0.837  1.00 0.00 ? 1  GLU A CA   8 
ATOM   5008 C C    . GLU A 1 1  ? 13.988  13.158  0.172   1.00 0.00 ? 1  GLU A C    8 
ATOM   5009 O O    . GLU A 1 1  ? 14.763  12.276  0.543   1.00 0.00 ? 1  GLU A O    8 
ATOM   5010 C CB   . GLU A 1 1  ? 13.865  13.997  -2.250  1.00 0.00 ? 1  GLU A CB   8 
ATOM   5011 C CG   . GLU A 1 1  ? 12.329  14.036  -2.360  1.00 0.00 ? 1  GLU A CG   8 
ATOM   5012 C CD   . GLU A 1 1  ? 11.730  15.347  -1.840  1.00 0.00 ? 1  GLU A CD   8 
ATOM   5013 O OE1  . GLU A 1 1  ? 11.887  16.366  -2.547  1.00 0.00 ? 1  GLU A OE1  8 
ATOM   5014 O OE2  . GLU A 1 1  ? 11.131  15.313  -0.743  1.00 0.00 ? 1  GLU A OE2  8 
ATOM   5015 H H1   . GLU A 1 1  ? 16.283  14.510  0.021   1.00 0.00 ? 1  GLU A H1   8 
ATOM   5016 H H2   . GLU A 1 1  ? 16.184  15.056  -1.532  1.00 0.00 ? 1  GLU A H2   8 
ATOM   5017 H H3   . GLU A 1 1  ? 16.285  13.439  -1.230  1.00 0.00 ? 1  GLU A H3   8 
ATOM   5018 H HA   . GLU A 1 1  ? 14.102  15.204  -0.480  1.00 0.00 ? 1  GLU A HA   8 
ATOM   5019 H HB2  . GLU A 1 1  ? 14.264  14.768  -2.913  1.00 0.00 ? 1  GLU A HB2  8 
ATOM   5020 H HB3  . GLU A 1 1  ? 14.211  13.029  -2.622  1.00 0.00 ? 1  GLU A HB3  8 
ATOM   5021 H HG2  . GLU A 1 1  ? 12.061  13.932  -3.413  1.00 0.00 ? 1  GLU A HG2  8 
ATOM   5022 H HG3  . GLU A 1 1  ? 11.895  13.184  -1.838  1.00 0.00 ? 1  GLU A HG3  8 
ATOM   5023 N N    . CYS A 1 2  ? 12.726  13.241  0.622   1.00 0.00 ? 2  CYS A N    8 
ATOM   5024 C CA   . CYS A 1 2  ? 12.112  12.330  1.572   1.00 0.00 ? 2  CYS A CA   8 
ATOM   5025 C C    . CYS A 1 2  ? 12.014  10.913  0.993   1.00 0.00 ? 2  CYS A C    8 
ATOM   5026 O O    . CYS A 1 2  ? 11.575  10.719  -0.141  1.00 0.00 ? 2  CYS A O    8 
ATOM   5027 C CB   . CYS A 1 2  ? 10.744  12.879  2.001   1.00 0.00 ? 2  CYS A CB   8 
ATOM   5028 S SG   . CYS A 1 2  ? 9.422   12.958  0.755   1.00 0.00 ? 2  CYS A SG   8 
ATOM   5029 H H    . CYS A 1 2  ? 12.126  13.977  0.289   1.00 0.00 ? 2  CYS A H    8 
ATOM   5030 H HA   . CYS A 1 2  ? 12.746  12.326  2.461   1.00 0.00 ? 2  CYS A HA   8 
ATOM   5031 H HB2  . CYS A 1 2  ? 10.383  12.272  2.825   1.00 0.00 ? 2  CYS A HB2  8 
ATOM   5032 H HB3  . CYS A 1 2  ? 10.880  13.883  2.395   1.00 0.00 ? 2  CYS A HB3  8 
ATOM   5033 N N    . GLU A 1 3  ? 12.443  9.932   1.795   1.00 0.00 ? 3  GLU A N    8 
ATOM   5034 C CA   . GLU A 1 3  ? 12.487  8.513   1.467   1.00 0.00 ? 3  GLU A CA   8 
ATOM   5035 C C    . GLU A 1 3  ? 11.102  7.889   1.689   1.00 0.00 ? 3  GLU A C    8 
ATOM   5036 O O    . GLU A 1 3  ? 10.897  7.063   2.579   1.00 0.00 ? 3  GLU A O    8 
ATOM   5037 C CB   . GLU A 1 3  ? 13.567  7.844   2.321   1.00 0.00 ? 3  GLU A CB   8 
ATOM   5038 C CG   . GLU A 1 3  ? 14.970  8.461   2.180   1.00 0.00 ? 3  GLU A CG   8 
ATOM   5039 C CD   . GLU A 1 3  ? 15.490  8.413   0.742   1.00 0.00 ? 3  GLU A CD   8 
ATOM   5040 O OE1  . GLU A 1 3  ? 16.014  7.345   0.359   1.00 0.00 ? 3  GLU A OE1  8 
ATOM   5041 O OE2  . GLU A 1 3  ? 15.348  9.442   0.045   1.00 0.00 ? 3  GLU A OE2  8 
ATOM   5042 H H    . GLU A 1 3  ? 12.797  10.199  2.699   1.00 0.00 ? 3  GLU A H    8 
ATOM   5043 H HA   . GLU A 1 3  ? 12.767  8.376   0.424   1.00 0.00 ? 3  GLU A HA   8 
ATOM   5044 H HB2  . GLU A 1 3  ? 13.250  7.921   3.357   1.00 0.00 ? 3  GLU A HB2  8 
ATOM   5045 H HB3  . GLU A 1 3  ? 13.601  6.795   2.044   1.00 0.00 ? 3  GLU A HB3  8 
ATOM   5046 H HG2  . GLU A 1 3  ? 14.958  9.493   2.534   1.00 0.00 ? 3  GLU A HG2  8 
ATOM   5047 H HG3  . GLU A 1 3  ? 15.657  7.906   2.824   1.00 0.00 ? 3  GLU A HG3  8 
ATOM   5048 N N    . SER A 1 4  ? 10.145  8.343   0.876   1.00 0.00 ? 4  SER A N    8 
ATOM   5049 C CA   . SER A 1 4  ? 8.707   8.205   1.083   1.00 0.00 ? 4  SER A CA   8 
ATOM   5050 C C    . SER A 1 4  ? 7.968   8.816   -0.116  1.00 0.00 ? 4  SER A C    8 
ATOM   5051 O O    . SER A 1 4  ? 8.152   9.998   -0.413  1.00 0.00 ? 4  SER A O    8 
ATOM   5052 C CB   . SER A 1 4  ? 8.298   8.890   2.403   1.00 0.00 ? 4  SER A CB   8 
ATOM   5053 O OG   . SER A 1 4  ? 8.867   10.175  2.544   1.00 0.00 ? 4  SER A OG   8 
ATOM   5054 H H    . SER A 1 4  ? 10.459  9.000   0.179   1.00 0.00 ? 4  SER A H    8 
ATOM   5055 H HA   . SER A 1 4  ? 8.465   7.142   1.160   1.00 0.00 ? 4  SER A HA   8 
ATOM   5056 H HB2  . SER A 1 4  ? 7.219   8.999   2.459   1.00 0.00 ? 4  SER A HB2  8 
ATOM   5057 H HB3  . SER A 1 4  ? 8.624   8.287   3.247   1.00 0.00 ? 4  SER A HB3  8 
ATOM   5058 H HG   . SER A 1 4  ? 8.556   10.560  3.367   1.00 0.00 ? 4  SER A HG   8 
ATOM   5059 N N    . GLY A 1 5  ? 7.131   8.019   -0.801  1.00 0.00 ? 5  GLY A N    8 
ATOM   5060 C CA   . GLY A 1 5  ? 6.358   8.432   -1.962  1.00 0.00 ? 5  GLY A CA   8 
ATOM   5061 C C    . GLY A 1 5  ? 5.163   9.320   -1.584  1.00 0.00 ? 5  GLY A C    8 
ATOM   5062 O O    . GLY A 1 5  ? 4.945   9.596   -0.411  1.00 0.00 ? 5  GLY A O    8 
ATOM   5063 H H    . GLY A 1 5  ? 6.990   7.067   -0.510  1.00 0.00 ? 5  GLY A H    8 
ATOM   5064 H HA2  . GLY A 1 5  ? 7.029   8.948   -2.645  1.00 0.00 ? 5  GLY A HA2  8 
ATOM   5065 H HA3  . GLY A 1 5  ? 5.988   7.532   -2.455  1.00 0.00 ? 5  GLY A HA3  8 
ATOM   5066 N N    . PRO A 1 6  ? 4.369   9.771   -2.570  1.00 0.00 ? 6  PRO A N    8 
ATOM   5067 C CA   . PRO A 1 6  ? 3.187   10.610  -2.371  1.00 0.00 ? 6  PRO A CA   8 
ATOM   5068 C C    . PRO A 1 6  ? 2.092   9.954   -1.522  1.00 0.00 ? 6  PRO A C    8 
ATOM   5069 O O    . PRO A 1 6  ? 1.426   10.639  -0.747  1.00 0.00 ? 6  PRO A O    8 
ATOM   5070 C CB   . PRO A 1 6  ? 2.675   10.966  -3.774  1.00 0.00 ? 6  PRO A CB   8 
ATOM   5071 C CG   . PRO A 1 6  ? 3.911   10.773  -4.650  1.00 0.00 ? 6  PRO A CG   8 
ATOM   5072 C CD   . PRO A 1 6  ? 4.619   9.592   -3.983  1.00 0.00 ? 6  PRO A CD   8 
ATOM   5073 H HA   . PRO A 1 6  ? 3.529   11.508  -1.861  1.00 0.00 ? 6  PRO A HA   8 
ATOM   5074 H HB2  . PRO A 1 6  ? 1.907   10.260  -4.098  1.00 0.00 ? 6  PRO A HB2  8 
ATOM   5075 H HB3  . PRO A 1 6  ? 2.286   11.984  -3.826  1.00 0.00 ? 6  PRO A HB3  8 
ATOM   5076 H HG2  . PRO A 1 6  ? 3.655   10.568  -5.691  1.00 0.00 ? 6  PRO A HG2  8 
ATOM   5077 H HG3  . PRO A 1 6  ? 4.542   11.662  -4.590  1.00 0.00 ? 6  PRO A HG3  8 
ATOM   5078 H HD2  . PRO A 1 6  ? 4.194   8.630   -4.271  1.00 0.00 ? 6  PRO A HD2  8 
ATOM   5079 H HD3  . PRO A 1 6  ? 5.677   9.601   -4.230  1.00 0.00 ? 6  PRO A HD3  8 
ATOM   5080 N N    . CYS A 1 7  ? 1.931   8.629   -1.653  1.00 0.00 ? 7  CYS A N    8 
ATOM   5081 C CA   . CYS A 1 7  ? 1.142   7.793   -0.748  1.00 0.00 ? 7  CYS A CA   8 
ATOM   5082 C C    . CYS A 1 7  ? 1.590   8.008   0.693   1.00 0.00 ? 7  CYS A C    8 
ATOM   5083 O O    . CYS A 1 7  ? 0.753   8.249   1.553   1.00 0.00 ? 7  CYS A O    8 
ATOM   5084 C CB   . CYS A 1 7  ? 1.253   6.318   -1.167  1.00 0.00 ? 7  CYS A CB   8 
ATOM   5085 S SG   . CYS A 1 7  ? -0.087  5.263   -0.556  1.00 0.00 ? 7  CYS A SG   8 
ATOM   5086 H H    . CYS A 1 7  ? 2.517   8.155   -2.330  1.00 0.00 ? 7  CYS A H    8 
ATOM   5087 H HA   . CYS A 1 7  ? 0.091   8.088   -0.740  1.00 0.00 ? 7  CYS A HA   8 
ATOM   5088 H HB2  . CYS A 1 7  ? 1.242   6.225   -2.253  1.00 0.00 ? 7  CYS A HB2  8 
ATOM   5089 H HB3  . CYS A 1 7  ? 2.207   5.919   -0.840  1.00 0.00 ? 7  CYS A HB3  8 
ATOM   5090 N N    . CYS A 1 8  ? 2.902   7.979   0.951   1.00 0.00 ? 8  CYS A N    8 
ATOM   5091 C CA   . CYS A 1 8  ? 3.445   8.196   2.284   1.00 0.00 ? 8  CYS A CA   8 
ATOM   5092 C C    . CYS A 1 8  ? 3.424   9.705   2.504   1.00 0.00 ? 8  CYS A C    8 
ATOM   5093 O O    . CYS A 1 8  ? 4.283   10.419  1.998   1.00 0.00 ? 8  CYS A O    8 
ATOM   5094 C CB   . CYS A 1 8  ? 4.872   7.655   2.410   1.00 0.00 ? 8  CYS A CB   8 
ATOM   5095 S SG   . CYS A 1 8  ? 5.050   5.866   2.606   1.00 0.00 ? 8  CYS A SG   8 
ATOM   5096 H H    . CYS A 1 8  ? 3.530   7.945   0.160   1.00 0.00 ? 8  CYS A H    8 
ATOM   5097 H HA   . CYS A 1 8  ? 2.800   7.656   2.986   1.00 0.00 ? 8  CYS A HA   8 
ATOM   5098 H HB2  . CYS A 1 8  ? 5.438   7.973   1.542   1.00 0.00 ? 8  CYS A HB2  8 
ATOM   5099 H HB3  . CYS A 1 8  ? 5.306   8.113   3.297   1.00 0.00 ? 8  CYS A HB3  8 
ATOM   5100 N N    . ARG A 1 9  ? 2.384   10.182  3.184   1.00 0.00 ? 9  ARG A N    8 
ATOM   5101 C CA   . ARG A 1 9  ? 1.576   11.304  2.734   1.00 0.00 ? 9  ARG A CA   8 
ATOM   5102 C C    . ARG A 1 9  ? 2.360   12.563  2.363   1.00 0.00 ? 9  ARG A C    8 
ATOM   5103 O O    . ARG A 1 9  ? 2.748   13.343  3.230   1.00 0.00 ? 9  ARG A O    8 
ATOM   5104 C CB   . ARG A 1 9  ? 0.424   11.582  3.699   1.00 0.00 ? 9  ARG A CB   8 
ATOM   5105 C CG   . ARG A 1 9  ? -0.793  11.977  2.861   1.00 0.00 ? 9  ARG A CG   8 
ATOM   5106 C CD   . ARG A 1 9  ? -1.421  10.770  2.143   1.00 0.00 ? 9  ARG A CD   8 
ATOM   5107 N NE   . ARG A 1 9  ? -2.849  10.969  1.854   1.00 0.00 ? 9  ARG A NE   8 
ATOM   5108 C CZ   . ARG A 1 9  ? -3.367  11.772  0.907   1.00 0.00 ? 9  ARG A CZ   8 
ATOM   5109 N NH1  . ARG A 1 9  ? -2.579  12.493  0.094   1.00 0.00 ? 9  ARG A NH1  8 
ATOM   5110 N NH2  . ARG A 1 9  ? -4.698  11.848  0.771   1.00 0.00 ? 9  ARG A NH2  8 
ATOM   5111 H H    . ARG A 1 9  ? 1.905   9.502   3.748   1.00 0.00 ? 9  ARG A H    8 
ATOM   5112 H HA   . ARG A 1 9  ? 1.133   10.922  1.822   1.00 0.00 ? 9  ARG A HA   8 
ATOM   5113 H HB2  . ARG A 1 9  ? 0.171   10.704  4.297   1.00 0.00 ? 9  ARG A HB2  8 
ATOM   5114 H HB3  . ARG A 1 9  ? 0.680   12.385  4.393   1.00 0.00 ? 9  ARG A HB3  8 
ATOM   5115 H HG2  . ARG A 1 9  ? -1.499  12.394  3.554   1.00 0.00 ? 9  ARG A HG2  8 
ATOM   5116 H HG3  . ARG A 1 9  ? -0.526  12.752  2.143   1.00 0.00 ? 9  ARG A HG3  8 
ATOM   5117 H HD2  . ARG A 1 9  ? -0.898  10.521  1.220   1.00 0.00 ? 9  ARG A HD2  8 
ATOM   5118 H HD3  . ARG A 1 9  ? -1.367  9.904   2.794   1.00 0.00 ? 9  ARG A HD3  8 
ATOM   5119 H HE   . ARG A 1 9  ? -3.489  10.434  2.425   1.00 0.00 ? 9  ARG A HE   8 
ATOM   5120 H HH11 . ARG A 1 9  ? -1.574  12.443  0.184   1.00 0.00 ? 9  ARG A HH11 8 
ATOM   5121 H HH12 . ARG A 1 9  ? -2.992  13.090  -0.609  1.00 0.00 ? 9  ARG A HH12 8 
ATOM   5122 H HH21 . ARG A 1 9  ? -5.299  11.309  1.379   1.00 0.00 ? 9  ARG A HH21 8 
ATOM   5123 H HH22 . ARG A 1 9  ? -5.102  12.446  0.065   1.00 0.00 ? 9  ARG A HH22 8 
ATOM   5124 N N    . ASN A 1 10 ? 2.605   12.703  1.053   1.00 0.00 ? 10 ASN A N    8 
ATOM   5125 C CA   . ASN A 1 10 ? 3.623   13.535  0.409   1.00 0.00 ? 10 ASN A CA   8 
ATOM   5126 C C    . ASN A 1 10 ? 5.036   13.046  0.770   1.00 0.00 ? 10 ASN A C    8 
ATOM   5127 O O    . ASN A 1 10 ? 5.818   12.657  -0.098  1.00 0.00 ? 10 ASN A O    8 
ATOM   5128 C CB   . ASN A 1 10 ? 3.420   15.017  0.752   1.00 0.00 ? 10 ASN A CB   8 
ATOM   5129 C CG   . ASN A 1 10 ? 4.275   15.935  -0.127  1.00 0.00 ? 10 ASN A CG   8 
ATOM   5130 O OD1  . ASN A 1 10 ? 5.351   16.367  0.284   1.00 0.00 ? 10 ASN A OD1  8 
ATOM   5131 N ND2  . ASN A 1 10 ? 3.802   16.231  -1.341  1.00 0.00 ? 10 ASN A ND2  8 
ATOM   5132 H H    . ASN A 1 10 ? 2.084   12.066  0.473   1.00 0.00 ? 10 ASN A H    8 
ATOM   5133 H HA   . ASN A 1 10 ? 3.473   13.424  -0.665  1.00 0.00 ? 10 ASN A HA   8 
ATOM   5134 H HB2  . ASN A 1 10 ? 2.366   15.261  0.643   1.00 0.00 ? 10 ASN A HB2  8 
ATOM   5135 H HB3  . ASN A 1 10 ? 3.679   15.205  1.795   1.00 0.00 ? 10 ASN A HB3  8 
ATOM   5136 H HD21 . ASN A 1 10 ? 2.915   15.855  -1.642  1.00 0.00 ? 10 ASN A HD21 8 
ATOM   5137 H HD22 . ASN A 1 10 ? 4.333   16.833  -1.955  1.00 0.00 ? 10 ASN A HD22 8 
ATOM   5138 N N    . CYS A 1 11 ? 5.321   13.068  2.077   1.00 0.00 ? 11 CYS A N    8 
ATOM   5139 C CA   . CYS A 1 11 ? 6.519   12.601  2.759   1.00 0.00 ? 11 CYS A CA   8 
ATOM   5140 C C    . CYS A 1 11 ? 6.185   11.952  4.124   1.00 0.00 ? 11 CYS A C    8 
ATOM   5141 O O    . CYS A 1 11 ? 7.115   11.635  4.866   1.00 0.00 ? 11 CYS A O    8 
ATOM   5142 C CB   . CYS A 1 11 ? 7.477   13.791  2.944   1.00 0.00 ? 11 CYS A CB   8 
ATOM   5143 S SG   . CYS A 1 11 ? 8.224   14.466  1.434   1.00 0.00 ? 11 CYS A SG   8 
ATOM   5144 H H    . CYS A 1 11 ? 4.559   13.346  2.673   1.00 0.00 ? 11 CYS A H    8 
ATOM   5145 H HA   . CYS A 1 11 ? 7.020   11.859  2.143   1.00 0.00 ? 11 CYS A HA   8 
ATOM   5146 H HB2  . CYS A 1 11 ? 6.946   14.602  3.448   1.00 0.00 ? 11 CYS A HB2  8 
ATOM   5147 H HB3  . CYS A 1 11 ? 8.307   13.497  3.587   1.00 0.00 ? 11 CYS A HB3  8 
ATOM   5148 N N    . LYS A 1 12 ? 4.895   11.776  4.485   1.00 0.00 ? 12 LYS A N    8 
ATOM   5149 C CA   . LYS A 1 12 ? 4.448   11.523  5.857   1.00 0.00 ? 12 LYS A CA   8 
ATOM   5150 C C    . LYS A 1 12 ? 3.667   10.206  5.918   1.00 0.00 ? 12 LYS A C    8 
ATOM   5151 O O    . LYS A 1 12 ? 2.437   10.228  5.965   1.00 0.00 ? 12 LYS A O    8 
ATOM   5152 C CB   . LYS A 1 12 ? 3.592   12.709  6.352   1.00 0.00 ? 12 LYS A CB   8 
ATOM   5153 C CG   . LYS A 1 12 ? 4.277   14.082  6.271   1.00 0.00 ? 12 LYS A CG   8 
ATOM   5154 C CD   . LYS A 1 12 ? 5.516   14.172  7.174   1.00 0.00 ? 12 LYS A CD   8 
ATOM   5155 C CE   . LYS A 1 12 ? 6.112   15.588  7.193   1.00 0.00 ? 12 LYS A CE   8 
ATOM   5156 N NZ   . LYS A 1 12 ? 5.197   16.576  7.793   1.00 0.00 ? 12 LYS A NZ   8 
ATOM   5157 H H    . LYS A 1 12 ? 4.156   11.902  3.797   1.00 0.00 ? 12 LYS A H    8 
ATOM   5158 H HA   . LYS A 1 12 ? 5.294   11.430  6.540   1.00 0.00 ? 12 LYS A HA   8 
ATOM   5159 H HB2  . LYS A 1 12 ? 2.675   12.768  5.763   1.00 0.00 ? 12 LYS A HB2  8 
ATOM   5160 H HB3  . LYS A 1 12 ? 3.303   12.527  7.390   1.00 0.00 ? 12 LYS A HB3  8 
ATOM   5161 H HG2  . LYS A 1 12 ? 4.558   14.305  5.240   1.00 0.00 ? 12 LYS A HG2  8 
ATOM   5162 H HG3  . LYS A 1 12 ? 3.547   14.826  6.588   1.00 0.00 ? 12 LYS A HG3  8 
ATOM   5163 H HD2  . LYS A 1 12 ? 5.251   13.880  8.192   1.00 0.00 ? 12 LYS A HD2  8 
ATOM   5164 H HD3  . LYS A 1 12 ? 6.284   13.489  6.808   1.00 0.00 ? 12 LYS A HD3  8 
ATOM   5165 H HE2  . LYS A 1 12 ? 7.031   15.578  7.782   1.00 0.00 ? 12 LYS A HE2  8 
ATOM   5166 H HE3  . LYS A 1 12 ? 6.354   15.900  6.177   1.00 0.00 ? 12 LYS A HE3  8 
ATOM   5167 H HZ1  . LYS A 1 12 ? 5.646   17.481  7.818   1.00 0.00 ? 12 LYS A HZ1  8 
ATOM   5168 H HZ2  . LYS A 1 12 ? 4.353   16.638  7.242   1.00 0.00 ? 12 LYS A HZ2  8 
ATOM   5169 H HZ3  . LYS A 1 12 ? 4.963   16.293  8.735   1.00 0.00 ? 12 LYS A HZ3  8 
ATOM   5170 N N    . PHE A 1 13 ? 4.401   9.078   5.918   1.00 0.00 ? 13 PHE A N    8 
ATOM   5171 C CA   . PHE A 1 13 ? 3.938   7.680   5.962   1.00 0.00 ? 13 PHE A CA   8 
ATOM   5172 C C    . PHE A 1 13 ? 2.485   7.545   6.445   1.00 0.00 ? 13 PHE A C    8 
ATOM   5173 O O    . PHE A 1 13 ? 2.217   7.761   7.628   1.00 0.00 ? 13 PHE A O    8 
ATOM   5174 C CB   . PHE A 1 13 ? 4.891   6.839   6.825   1.00 0.00 ? 13 PHE A CB   8 
ATOM   5175 C CG   . PHE A 1 13 ? 6.333   6.789   6.336   1.00 0.00 ? 13 PHE A CG   8 
ATOM   5176 C CD1  . PHE A 1 13 ? 7.242   7.795   6.743   1.00 0.00 ? 13 PHE A CD1  8 
ATOM   5177 C CD2  . PHE A 1 13 ? 6.774   5.753   5.481   1.00 0.00 ? 13 PHE A CD2  8 
ATOM   5178 C CE1  . PHE A 1 13 ? 8.576   7.771   6.289   1.00 0.00 ? 13 PHE A CE1  8 
ATOM   5179 C CE2  . PHE A 1 13 ? 8.100   5.754   4.999   1.00 0.00 ? 13 PHE A CE2  8 
ATOM   5180 C CZ   . PHE A 1 13 ? 9.004   6.746   5.423   1.00 0.00 ? 13 PHE A CZ   8 
ATOM   5181 H H    . PHE A 1 13 ? 5.400   9.211   5.873   1.00 0.00 ? 13 PHE A H    8 
ATOM   5182 H HA   . PHE A 1 13 ? 4.020   7.276   4.957   1.00 0.00 ? 13 PHE A HA   8 
ATOM   5183 H HB2  . PHE A 1 13 ? 4.877   7.207   7.854   1.00 0.00 ? 13 PHE A HB2  8 
ATOM   5184 H HB3  . PHE A 1 13 ? 4.494   5.827   6.840   1.00 0.00 ? 13 PHE A HB3  8 
ATOM   5185 H HD1  . PHE A 1 13 ? 6.921   8.585   7.407   1.00 0.00 ? 13 PHE A HD1  8 
ATOM   5186 H HD2  . PHE A 1 13 ? 6.100   4.960   5.196   1.00 0.00 ? 13 PHE A HD2  8 
ATOM   5187 H HE1  . PHE A 1 13 ? 9.272   8.536   6.608   1.00 0.00 ? 13 PHE A HE1  8 
ATOM   5188 H HE2  . PHE A 1 13 ? 8.440   4.990   4.317   1.00 0.00 ? 13 PHE A HE2  8 
ATOM   5189 H HZ   . PHE A 1 13 ? 10.032  6.718   5.090   1.00 0.00 ? 13 PHE A HZ   8 
ATOM   5190 N N    . LEU A 1 14 ? 1.548   7.276   5.518   1.00 0.00 ? 14 LEU A N    8 
ATOM   5191 C CA   . LEU A 1 14 ? 0.126   7.546   5.694   1.00 0.00 ? 14 LEU A CA   8 
ATOM   5192 C C    . LEU A 1 14 ? -0.557  6.618   6.702   1.00 0.00 ? 14 LEU A C    8 
ATOM   5193 O O    . LEU A 1 14 ? 0.086   5.881   7.452   1.00 0.00 ? 14 LEU A O    8 
ATOM   5194 C CB   . LEU A 1 14 ? -0.584  7.637   4.317   1.00 0.00 ? 14 LEU A CB   8 
ATOM   5195 C CG   . LEU A 1 14 ? -0.703  6.397   3.404   1.00 0.00 ? 14 LEU A CG   8 
ATOM   5196 C CD1  . LEU A 1 14 ? -1.073  5.096   4.126   1.00 0.00 ? 14 LEU A CD1  8 
ATOM   5197 C CD2  . LEU A 1 14 ? -1.784  6.656   2.337   1.00 0.00 ? 14 LEU A CD2  8 
ATOM   5198 H H    . LEU A 1 14 ? 1.831   7.050   4.580   1.00 0.00 ? 14 LEU A H    8 
ATOM   5199 H HA   . LEU A 1 14 ? 0.050   8.549   6.123   1.00 0.00 ? 14 LEU A HA   8 
ATOM   5200 H HB2  . LEU A 1 14 ? -1.582  8.050   4.397   1.00 0.00 ? 14 LEU A HB2  8 
ATOM   5201 H HB3  . LEU A 1 14 ? -0.046  8.403   3.785   1.00 0.00 ? 14 LEU A HB3  8 
ATOM   5202 H HG   . LEU A 1 14 ? 0.246   6.246   2.899   1.00 0.00 ? 14 LEU A HG   8 
ATOM   5203 H HD11 . LEU A 1 14 ? -0.299  4.812   4.838   1.00 0.00 ? 14 LEU A HD11 8 
ATOM   5204 H HD12 . LEU A 1 14 ? -2.033  5.206   4.622   1.00 0.00 ? 14 LEU A HD12 8 
ATOM   5205 H HD13 . LEU A 1 14 ? -1.174  4.286   3.410   1.00 0.00 ? 14 LEU A HD13 8 
ATOM   5206 H HD21 . LEU A 1 14 ? -1.596  7.580   1.793   1.00 0.00 ? 14 LEU A HD21 8 
ATOM   5207 H HD22 . LEU A 1 14 ? -1.807  5.834   1.625   1.00 0.00 ? 14 LEU A HD22 8 
ATOM   5208 H HD23 . LEU A 1 14 ? -2.765  6.737   2.807   1.00 0.00 ? 14 LEU A HD23 8 
ATOM   5209 N N    . LYS A 1 15 ? -1.888  6.688   6.695   1.00 0.00 ? 15 LYS A N    8 
ATOM   5210 C CA   . LYS A 1 15 ? -2.805  5.919   7.525   1.00 0.00 ? 15 LYS A CA   8 
ATOM   5211 C C    . LYS A 1 15 ? -2.795  4.439   7.098   1.00 0.00 ? 15 LYS A C    8 
ATOM   5212 O O    . LYS A 1 15 ? -3.709  3.987   6.409   1.00 0.00 ? 15 LYS A O    8 
ATOM   5213 C CB   . LYS A 1 15 ? -4.203  6.560   7.440   1.00 0.00 ? 15 LYS A CB   8 
ATOM   5214 C CG   . LYS A 1 15 ? -4.209  7.975   8.044   1.00 0.00 ? 15 LYS A CG   8 
ATOM   5215 C CD   . LYS A 1 15 ? -5.543  8.683   7.771   1.00 0.00 ? 15 LYS A CD   8 
ATOM   5216 C CE   . LYS A 1 15 ? -5.658  10.021  8.520   1.00 0.00 ? 15 LYS A CE   8 
ATOM   5217 N NZ   . LYS A 1 15 ? -4.629  10.991  8.107   1.00 0.00 ? 15 LYS A NZ   8 
ATOM   5218 H H    . LYS A 1 15 ? -2.280  7.323   6.015   1.00 0.00 ? 15 LYS A H    8 
ATOM   5219 H HA   . LYS A 1 15 ? -2.474  5.990   8.561   1.00 0.00 ? 15 LYS A HA   8 
ATOM   5220 H HB2  . LYS A 1 15 ? -4.519  6.609   6.396   1.00 0.00 ? 15 LYS A HB2  8 
ATOM   5221 H HB3  . LYS A 1 15 ? -4.920  5.946   7.989   1.00 0.00 ? 15 LYS A HB3  8 
ATOM   5222 H HG2  . LYS A 1 15 ? -4.045  7.902   9.120   1.00 0.00 ? 15 LYS A HG2  8 
ATOM   5223 H HG3  . LYS A 1 15 ? -3.407  8.574   7.610   1.00 0.00 ? 15 LYS A HG3  8 
ATOM   5224 H HD2  . LYS A 1 15 ? -5.653  8.854   6.699   1.00 0.00 ? 15 LYS A HD2  8 
ATOM   5225 H HD3  . LYS A 1 15 ? -6.359  8.038   8.102   1.00 0.00 ? 15 LYS A HD3  8 
ATOM   5226 H HE2  . LYS A 1 15 ? -6.638  10.455  8.321   1.00 0.00 ? 15 LYS A HE2  8 
ATOM   5227 H HE3  . LYS A 1 15 ? -5.568  9.848   9.594   1.00 0.00 ? 15 LYS A HE3  8 
ATOM   5228 H HZ1  . LYS A 1 15 ? -3.712  10.620  8.311   1.00 0.00 ? 15 LYS A HZ1  8 
ATOM   5229 H HZ2  . LYS A 1 15 ? -4.708  11.166  7.115   1.00 0.00 ? 15 LYS A HZ2  8 
ATOM   5230 H HZ3  . LYS A 1 15 ? -4.760  11.855  8.612   1.00 0.00 ? 15 LYS A HZ3  8 
ATOM   5231 N N    . GLU A 1 16 ? -1.738  3.718   7.519   1.00 0.00 ? 16 GLU A N    8 
ATOM   5232 C CA   . GLU A 1 16 ? -1.425  2.301   7.330   1.00 0.00 ? 16 GLU A CA   8 
ATOM   5233 C C    . GLU A 1 16 ? -2.627  1.446   6.910   1.00 0.00 ? 16 GLU A C    8 
ATOM   5234 O O    . GLU A 1 16 ? -3.569  1.273   7.683   1.00 0.00 ? 16 GLU A O    8 
ATOM   5235 C CB   . GLU A 1 16 ? -0.778  1.787   8.633   1.00 0.00 ? 16 GLU A CB   8 
ATOM   5236 C CG   . GLU A 1 16 ? -0.505  0.273   8.654   1.00 0.00 ? 16 GLU A CG   8 
ATOM   5237 C CD   . GLU A 1 16 ? 0.344   -0.134  9.863   1.00 0.00 ? 16 GLU A CD   8 
ATOM   5238 O OE1  . GLU A 1 16 ? -0.017  0.289   10.984  1.00 0.00 ? 16 GLU A OE1  8 
ATOM   5239 O OE2  . GLU A 1 16 ? 1.337   -0.865  9.656   1.00 0.00 ? 16 GLU A OE2  8 
ATOM   5240 H H    . GLU A 1 16 ? -1.028  4.230   8.022   1.00 0.00 ? 16 GLU A H    8 
ATOM   5241 H HA   . GLU A 1 16 ? -0.674  2.253   6.537   1.00 0.00 ? 16 GLU A HA   8 
ATOM   5242 H HB2  . GLU A 1 16 ? 0.166   2.317   8.774   1.00 0.00 ? 16 GLU A HB2  8 
ATOM   5243 H HB3  . GLU A 1 16 ? -1.430  2.025   9.477   1.00 0.00 ? 16 GLU A HB3  8 
ATOM   5244 H HG2  . GLU A 1 16 ? -1.449  -0.271  8.706   1.00 0.00 ? 16 GLU A HG2  8 
ATOM   5245 H HG3  . GLU A 1 16 ? -0.003  -0.018  7.732   1.00 0.00 ? 16 GLU A HG3  8 
ATOM   5246 N N    . GLY A 1 17 ? -2.575  0.928   5.675   1.00 0.00 ? 17 GLY A N    8 
ATOM   5247 C CA   . GLY A 1 17 ? -3.626  0.139   5.056   1.00 0.00 ? 17 GLY A CA   8 
ATOM   5248 C C    . GLY A 1 17 ? -4.411  0.973   4.040   1.00 0.00 ? 17 GLY A C    8 
ATOM   5249 O O    . GLY A 1 17 ? -5.638  1.028   4.112   1.00 0.00 ? 17 GLY A O    8 
ATOM   5250 H H    . GLY A 1 17 ? -1.758  1.111   5.108   1.00 0.00 ? 17 GLY A H    8 
ATOM   5251 H HA2  . GLY A 1 17 ? -3.147  -0.690  4.539   1.00 0.00 ? 17 GLY A HA2  8 
ATOM   5252 H HA3  . GLY A 1 17 ? -4.298  -0.290  5.800   1.00 0.00 ? 17 GLY A HA3  8 
ATOM   5253 N N    . THR A 1 18 ? -3.701  1.577   3.072   1.00 0.00 ? 18 THR A N    8 
ATOM   5254 C CA   . THR A 1 18 ? -4.266  2.223   1.887   1.00 0.00 ? 18 THR A CA   8 
ATOM   5255 C C    . THR A 1 18 ? -3.856  1.451   0.629   1.00 0.00 ? 18 THR A C    8 
ATOM   5256 O O    . THR A 1 18 ? -2.699  1.548   0.220   1.00 0.00 ? 18 THR A O    8 
ATOM   5257 C CB   . THR A 1 18 ? -3.774  3.669   1.792   1.00 0.00 ? 18 THR A CB   8 
ATOM   5258 O OG1  . THR A 1 18 ? -4.242  4.422   2.895   1.00 0.00 ? 18 THR A OG1  8 
ATOM   5259 C CG2  . THR A 1 18 ? -4.209  4.330   0.477   1.00 0.00 ? 18 THR A CG2  8 
ATOM   5260 H H    . THR A 1 18 ? -2.693  1.548   3.139   1.00 0.00 ? 18 THR A H    8 
ATOM   5261 H HA   . THR A 1 18 ? -5.348  2.262   1.958   1.00 0.00 ? 18 THR A HA   8 
ATOM   5262 H HB   . THR A 1 18 ? -2.690  3.644   1.812   1.00 0.00 ? 18 THR A HB   8 
ATOM   5263 H HG1  . THR A 1 18 ? -5.201  4.429   2.876   1.00 0.00 ? 18 THR A HG1  8 
ATOM   5264 H HG21 . THR A 1 18 ? -3.726  3.872   -0.386  1.00 0.00 ? 18 THR A HG21 8 
ATOM   5265 H HG22 . THR A 1 18 ? -3.936  5.386   0.488   1.00 0.00 ? 18 THR A HG22 8 
ATOM   5266 H HG23 . THR A 1 18 ? -5.291  4.256   0.362   1.00 0.00 ? 18 THR A HG23 8 
ATOM   5267 N N    . ILE A 1 19 ? -4.807  0.749   -0.008  1.00 0.00 ? 19 ILE A N    8 
ATOM   5268 C CA   . ILE A 1 19 ? -4.575  -0.078  -1.198  1.00 0.00 ? 19 ILE A CA   8 
ATOM   5269 C C    . ILE A 1 19 ? -4.059  0.803   -2.348  1.00 0.00 ? 19 ILE A C    8 
ATOM   5270 O O    . ILE A 1 19 ? -4.784  1.639   -2.887  1.00 0.00 ? 19 ILE A O    8 
ATOM   5271 C CB   . ILE A 1 19 ? -5.808  -0.897  -1.634  1.00 0.00 ? 19 ILE A CB   8 
ATOM   5272 C CG1  . ILE A 1 19 ? -6.442  -1.696  -0.486  1.00 0.00 ? 19 ILE A CG1  8 
ATOM   5273 C CG2  . ILE A 1 19 ? -5.513  -1.804  -2.846  1.00 0.00 ? 19 ILE A CG2  8 
ATOM   5274 C CD1  . ILE A 1 19 ? -7.832  -2.262  -0.810  1.00 0.00 ? 19 ILE A CD1  8 
ATOM   5275 H H    . ILE A 1 19 ? -5.739  0.798   0.372   1.00 0.00 ? 19 ILE A H    8 
ATOM   5276 H HA   . ILE A 1 19 ? -3.842  -0.824  -0.911  1.00 0.00 ? 19 ILE A HA   8 
ATOM   5277 H HB   . ILE A 1 19 ? -6.532  -0.191  -1.959  1.00 0.00 ? 19 ILE A HB   8 
ATOM   5278 H HG12 . ILE A 1 19 ? -5.761  -2.500  -0.236  1.00 0.00 ? 19 ILE A HG12 8 
ATOM   5279 H HG13 . ILE A 1 19 ? -6.569  -1.053  0.385   1.00 0.00 ? 19 ILE A HG13 8 
ATOM   5280 H HG21 . ILE A 1 19 ? -5.077  -1.230  -3.663  1.00 0.00 ? 19 ILE A HG21 8 
ATOM   5281 H HG22 . ILE A 1 19 ? -4.818  -2.586  -2.551  1.00 0.00 ? 19 ILE A HG22 8 
ATOM   5282 H HG23 . ILE A 1 19 ? -6.423  -2.265  -3.225  1.00 0.00 ? 19 ILE A HG23 8 
ATOM   5283 H HD11 . ILE A 1 19 ? -8.518  -1.450  -1.056  1.00 0.00 ? 19 ILE A HD11 8 
ATOM   5284 H HD12 . ILE A 1 19 ? -7.787  -2.953  -1.648  1.00 0.00 ? 19 ILE A HD12 8 
ATOM   5285 H HD13 . ILE A 1 19 ? -8.217  -2.795  0.059   1.00 0.00 ? 19 ILE A HD13 8 
ATOM   5286 N N    . CYS A 1 20 ? -2.795  0.572   -2.707  1.00 0.00 ? 20 CYS A N    8 
ATOM   5287 C CA   . CYS A 1 20 ? -2.066  1.149   -3.834  1.00 0.00 ? 20 CYS A CA   8 
ATOM   5288 C C    . CYS A 1 20 ? -2.220  0.309   -5.112  1.00 0.00 ? 20 CYS A C    8 
ATOM   5289 O O    . CYS A 1 20 ? -2.165  0.862   -6.209  1.00 0.00 ? 20 CYS A O    8 
ATOM   5290 C CB   . CYS A 1 20 ? -0.593  1.361   -3.443  1.00 0.00 ? 20 CYS A CB   8 
ATOM   5291 S SG   . CYS A 1 20 ? 0.278   -0.075  -2.745  1.00 0.00 ? 20 CYS A SG   8 
ATOM   5292 H H    . CYS A 1 20 ? -2.341  -0.160  -2.187  1.00 0.00 ? 20 CYS A H    8 
ATOM   5293 H HA   . CYS A 1 20 ? -2.486  2.130   -4.049  1.00 0.00 ? 20 CYS A HA   8 
ATOM   5294 H HB2  . CYS A 1 20 ? -0.028  1.746   -4.294  1.00 0.00 ? 20 CYS A HB2  8 
ATOM   5295 H HB3  . CYS A 1 20 ? -0.581  2.130   -2.673  1.00 0.00 ? 20 CYS A HB3  8 
ATOM   5296 N N    . LYS A 1 21 ? -2.439  -1.008  -4.973  1.00 0.00 ? 21 LYS A N    8 
ATOM   5297 C CA   . LYS A 1 21 ? -2.798  -1.909  -6.066  1.00 0.00 ? 21 LYS A CA   8 
ATOM   5298 C C    . LYS A 1 21 ? -3.702  -3.036  -5.551  1.00 0.00 ? 21 LYS A C    8 
ATOM   5299 O O    . LYS A 1 21 ? -3.447  -3.617  -4.498  1.00 0.00 ? 21 LYS A O    8 
ATOM   5300 C CB   . LYS A 1 21 ? -1.534  -2.470  -6.745  1.00 0.00 ? 21 LYS A CB   8 
ATOM   5301 C CG   . LYS A 1 21 ? -1.822  -3.393  -7.946  1.00 0.00 ? 21 LYS A CG   8 
ATOM   5302 C CD   . LYS A 1 21 ? -2.377  -2.637  -9.168  1.00 0.00 ? 21 LYS A CD   8 
ATOM   5303 C CE   . LYS A 1 21 ? -2.922  -3.583  -10.248 1.00 0.00 ? 21 LYS A CE   8 
ATOM   5304 N NZ   . LYS A 1 21 ? -1.906  -4.531  -10.737 1.00 0.00 ? 21 LYS A NZ   8 
ATOM   5305 H H    . LYS A 1 21 ? -2.451  -1.382  -4.034  1.00 0.00 ? 21 LYS A H    8 
ATOM   5306 H HA   . LYS A 1 21 ? -3.360  -1.324  -6.796  1.00 0.00 ? 21 LYS A HA   8 
ATOM   5307 H HB2  . LYS A 1 21 ? -0.912  -1.644  -7.089  1.00 0.00 ? 21 LYS A HB2  8 
ATOM   5308 H HB3  . LYS A 1 21 ? -0.968  -3.040  -6.007  1.00 0.00 ? 21 LYS A HB3  8 
ATOM   5309 H HG2  . LYS A 1 21 ? -0.885  -3.872  -8.236  1.00 0.00 ? 21 LYS A HG2  8 
ATOM   5310 H HG3  . LYS A 1 21 ? -2.515  -4.182  -7.651  1.00 0.00 ? 21 LYS A HG3  8 
ATOM   5311 H HD2  . LYS A 1 21 ? -3.199  -1.988  -8.869  1.00 0.00 ? 21 LYS A HD2  8 
ATOM   5312 H HD3  . LYS A 1 21 ? -1.587  -2.012  -9.590  1.00 0.00 ? 21 LYS A HD3  8 
ATOM   5313 H HE2  . LYS A 1 21 ? -3.764  -4.148  -9.845  1.00 0.00 ? 21 LYS A HE2  8 
ATOM   5314 H HE3  . LYS A 1 21 ? -3.275  -2.990  -11.093 1.00 0.00 ? 21 LYS A HE3  8 
ATOM   5315 H HZ1  . LYS A 1 21 ? -1.596  -5.115  -9.975  1.00 0.00 ? 21 LYS A HZ1  8 
ATOM   5316 H HZ2  . LYS A 1 21 ? -2.310  -5.110  -11.460 1.00 0.00 ? 21 LYS A HZ2  8 
ATOM   5317 H HZ3  . LYS A 1 21 ? -1.119  -4.021  -11.114 1.00 0.00 ? 21 LYS A HZ3  8 
ATOM   5318 N N    . ARG A 1 22 ? -4.749  -3.353  -6.324  1.00 0.00 ? 22 ARG A N    8 
ATOM   5319 C CA   . ARG A 1 22 ? -5.687  -4.439  -6.088  1.00 0.00 ? 22 ARG A CA   8 
ATOM   5320 C C    . ARG A 1 22 ? -5.101  -5.718  -6.692  1.00 0.00 ? 22 ARG A C    8 
ATOM   5321 O O    . ARG A 1 22 ? -5.383  -6.075  -7.836  1.00 0.00 ? 22 ARG A O    8 
ATOM   5322 C CB   . ARG A 1 22 ? -7.050  -4.061  -6.680  1.00 0.00 ? 22 ARG A CB   8 
ATOM   5323 C CG   . ARG A 1 22 ? -8.143  -5.137  -6.539  1.00 0.00 ? 22 ARG A CG   8 
ATOM   5324 C CD   . ARG A 1 22 ? -8.506  -5.455  -5.080  1.00 0.00 ? 22 ARG A CD   8 
ATOM   5325 N NE   . ARG A 1 22 ? -8.894  -4.250  -4.329  1.00 0.00 ? 22 ARG A NE   8 
ATOM   5326 C CZ   . ARG A 1 22 ? -10.046 -3.565  -4.459  1.00 0.00 ? 22 ARG A CZ   8 
ATOM   5327 N NH1  . ARG A 1 22 ? -11.014 -3.975  -5.292  1.00 0.00 ? 22 ARG A NH1  8 
ATOM   5328 N NH2  . ARG A 1 22 ? -10.229 -2.449  -3.739  1.00 0.00 ? 22 ARG A NH2  8 
ATOM   5329 H H    . ARG A 1 22 ? -4.857  -2.848  -7.187  1.00 0.00 ? 22 ARG A H    8 
ATOM   5330 H HA   . ARG A 1 22 ? -5.823  -4.555  -5.013  1.00 0.00 ? 22 ARG A HA   8 
ATOM   5331 H HB2  . ARG A 1 22 ? -7.382  -3.146  -6.192  1.00 0.00 ? 22 ARG A HB2  8 
ATOM   5332 H HB3  . ARG A 1 22 ? -6.905  -3.841  -7.734  1.00 0.00 ? 22 ARG A HB3  8 
ATOM   5333 H HG2  . ARG A 1 22 ? -9.036  -4.782  -7.056  1.00 0.00 ? 22 ARG A HG2  8 
ATOM   5334 H HG3  . ARG A 1 22 ? -7.832  -6.059  -7.028  1.00 0.00 ? 22 ARG A HG3  8 
ATOM   5335 H HD2  . ARG A 1 22 ? -9.320  -6.182  -5.058  1.00 0.00 ? 22 ARG A HD2  8 
ATOM   5336 H HD3  . ARG A 1 22 ? -7.647  -5.909  -4.588  1.00 0.00 ? 22 ARG A HD3  8 
ATOM   5337 H HE   . ARG A 1 22 ? -8.216  -3.908  -3.663  1.00 0.00 ? 22 ARG A HE   8 
ATOM   5338 H HH11 . ARG A 1 22 ? -10.894 -4.816  -5.837  1.00 0.00 ? 22 ARG A HH11 8 
ATOM   5339 H HH12 . ARG A 1 22 ? -11.868 -3.441  -5.378  1.00 0.00 ? 22 ARG A HH12 8 
ATOM   5340 H HH21 . ARG A 1 22 ? -9.506  -2.128  -3.111  1.00 0.00 ? 22 ARG A HH21 8 
ATOM   5341 H HH22 . ARG A 1 22 ? -11.085 -1.922  -3.832  1.00 0.00 ? 22 ARG A HH22 8 
ATOM   5342 N N    . ALA A 1 23 ? -4.250  -6.379  -5.902  1.00 0.00 ? 23 ALA A N    8 
ATOM   5343 C CA   . ALA A 1 23 ? -3.470  -7.551  -6.290  1.00 0.00 ? 23 ALA A CA   8 
ATOM   5344 C C    . ALA A 1 23 ? -4.275  -8.851  -6.134  1.00 0.00 ? 23 ALA A C    8 
ATOM   5345 O O    . ALA A 1 23 ? -3.835  -9.786  -5.463  1.00 0.00 ? 23 ALA A O    8 
ATOM   5346 C CB   . ALA A 1 23 ? -2.159  -7.563  -5.490  1.00 0.00 ? 23 ALA A CB   8 
ATOM   5347 H H    . ALA A 1 23 ? -4.077  -5.958  -5.006  1.00 0.00 ? 23 ALA A H    8 
ATOM   5348 H HA   . ALA A 1 23 ? -3.192  -7.452  -7.339  1.00 0.00 ? 23 ALA A HA   8 
ATOM   5349 H HB1  . ALA A 1 23 ? -1.536  -8.405  -5.797  1.00 0.00 ? 23 ALA A HB1  8 
ATOM   5350 H HB2  . ALA A 1 23 ? -1.615  -6.640  -5.685  1.00 0.00 ? 23 ALA A HB2  8 
ATOM   5351 H HB3  . ALA A 1 23 ? -2.362  -7.641  -4.421  1.00 0.00 ? 23 ALA A HB3  8 
ATOM   5352 N N    . ARG A 1 24 ? -5.447  -8.915  -6.786  1.00 0.00 ? 24 ARG A N    8 
ATOM   5353 C CA   . ARG A 1 24 ? -6.341  -10.070 -6.789  1.00 0.00 ? 24 ARG A CA   8 
ATOM   5354 C C    . ARG A 1 24 ? -5.802  -11.090 -7.794  1.00 0.00 ? 24 ARG A C    8 
ATOM   5355 O O    . ARG A 1 24 ? -5.979  -10.952 -9.004  1.00 0.00 ? 24 ARG A O    8 
ATOM   5356 C CB   . ARG A 1 24 ? -7.777  -9.620  -7.096  1.00 0.00 ? 24 ARG A CB   8 
ATOM   5357 C CG   . ARG A 1 24 ? -8.899  -10.559 -6.615  1.00 0.00 ? 24 ARG A CG   8 
ATOM   5358 C CD   . ARG A 1 24 ? -9.030  -11.901 -7.357  1.00 0.00 ? 24 ARG A CD   8 
ATOM   5359 N NE   . ARG A 1 24 ? -8.045  -12.907 -6.929  1.00 0.00 ? 24 ARG A NE   8 
ATOM   5360 C CZ   . ARG A 1 24 ? -8.009  -13.544 -5.743  1.00 0.00 ? 24 ARG A CZ   8 
ATOM   5361 N NH1  . ARG A 1 24 ? -8.927  -13.312 -4.792  1.00 0.00 ? 24 ARG A NH1  8 
ATOM   5362 N NH2  . ARG A 1 24 ? -7.036  -14.434 -5.506  1.00 0.00 ? 24 ARG A NH2  8 
ATOM   5363 H H    . ARG A 1 24 ? -5.735  -8.112  -7.327  1.00 0.00 ? 24 ARG A H    8 
ATOM   5364 H HA   . ARG A 1 24 ? -6.364  -10.495 -5.785  1.00 0.00 ? 24 ARG A HA   8 
ATOM   5365 H HB2  . ARG A 1 24 ? -7.928  -8.688  -6.557  1.00 0.00 ? 24 ARG A HB2  8 
ATOM   5366 H HB3  . ARG A 1 24 ? -7.882  -9.421  -8.161  1.00 0.00 ? 24 ARG A HB3  8 
ATOM   5367 H HG2  . ARG A 1 24 ? -8.802  -10.721 -5.542  1.00 0.00 ? 24 ARG A HG2  8 
ATOM   5368 H HG3  . ARG A 1 24 ? -9.838  -10.022 -6.773  1.00 0.00 ? 24 ARG A HG3  8 
ATOM   5369 H HD2  . ARG A 1 24 ? -10.029 -12.305 -7.186  1.00 0.00 ? 24 ARG A HD2  8 
ATOM   5370 H HD3  . ARG A 1 24 ? -8.920  -11.732 -8.430  1.00 0.00 ? 24 ARG A HD3  8 
ATOM   5371 H HE   . ARG A 1 24 ? -7.341  -13.150 -7.611  1.00 0.00 ? 24 ARG A HE   8 
ATOM   5372 H HH11 . ARG A 1 24 ? -9.672  -12.651 -4.955  1.00 0.00 ? 24 ARG A HH11 8 
ATOM   5373 H HH12 . ARG A 1 24 ? -8.875  -13.804 -3.911  1.00 0.00 ? 24 ARG A HH12 8 
ATOM   5374 H HH21 . ARG A 1 24 ? -6.335  -14.620 -6.211  1.00 0.00 ? 24 ARG A HH21 8 
ATOM   5375 H HH22 . ARG A 1 24 ? -6.999  -14.920 -4.622  1.00 0.00 ? 24 ARG A HH22 8 
ATOM   5376 N N    . GLY A 1 25 ? -5.130  -12.111 -7.258  1.00 0.00 ? 25 GLY A N    8 
ATOM   5377 C CA   . GLY A 1 25 ? -4.524  -13.200 -8.011  1.00 0.00 ? 25 GLY A CA   8 
ATOM   5378 C C    . GLY A 1 25 ? -3.916  -14.218 -7.049  1.00 0.00 ? 25 GLY A C    8 
ATOM   5379 O O    . GLY A 1 25 ? -4.519  -15.260 -6.791  1.00 0.00 ? 25 GLY A O    8 
ATOM   5380 H H    . GLY A 1 25 ? -5.093  -12.120 -6.250  1.00 0.00 ? 25 GLY A H    8 
ATOM   5381 H HA2  . GLY A 1 25 ? -5.289  -13.686 -8.620  1.00 0.00 ? 25 GLY A HA2  8 
ATOM   5382 H HA3  . GLY A 1 25 ? -3.751  -12.805 -8.673  1.00 0.00 ? 25 GLY A HA3  8 
ATOM   5383 N N    . ASP A 1 26 ? -2.731  -13.902 -6.504  1.00 0.00 ? 26 ASP A N    8 
ATOM   5384 C CA   . ASP A 1 26 ? -2.073  -14.675 -5.453  1.00 0.00 ? 26 ASP A CA   8 
ATOM   5385 C C    . ASP A 1 26 ? -2.810  -14.465 -4.122  1.00 0.00 ? 26 ASP A C    8 
ATOM   5386 O O    . ASP A 1 26 ? -3.330  -15.422 -3.547  1.00 0.00 ? 26 ASP A O    8 
ATOM   5387 C CB   . ASP A 1 26 ? -0.568  -14.344 -5.381  1.00 0.00 ? 26 ASP A CB   8 
ATOM   5388 C CG   . ASP A 1 26 ? -0.247  -12.874 -5.074  1.00 0.00 ? 26 ASP A CG   8 
ATOM   5389 O OD1  . ASP A 1 26 ? -0.625  -12.019 -5.905  1.00 0.00 ? 26 ASP A OD1  8 
ATOM   5390 O OD2  . ASP A 1 26 ? 0.365   -12.628 -4.012  1.00 0.00 ? 26 ASP A OD2  8 
ATOM   5391 H H    . ASP A 1 26 ? -2.292  -13.032 -6.772  1.00 0.00 ? 26 ASP A H    8 
ATOM   5392 H HA   . ASP A 1 26 ? -2.140  -15.734 -5.718  1.00 0.00 ? 26 ASP A HA   8 
ATOM   5393 H HB2  . ASP A 1 26 ? -0.114  -14.983 -4.618  1.00 0.00 ? 26 ASP A HB2  8 
ATOM   5394 H HB3  . ASP A 1 26 ? -0.104  -14.600 -6.335  1.00 0.00 ? 26 ASP A HB3  8 
ATOM   5395 N N    . ASP A 1 27 ? -2.884  -13.207 -3.660  1.00 0.00 ? 27 ASP A N    8 
ATOM   5396 C CA   . ASP A 1 27 ? -3.637  -12.748 -2.509  1.00 0.00 ? 27 ASP A CA   8 
ATOM   5397 C C    . ASP A 1 27 ? -4.799  -11.869 -3.012  1.00 0.00 ? 27 ASP A C    8 
ATOM   5398 O O    . ASP A 1 27 ? -5.413  -12.176 -4.035  1.00 0.00 ? 27 ASP A O    8 
ATOM   5399 C CB   . ASP A 1 27 ? -2.646  -12.062 -1.538  1.00 0.00 ? 27 ASP A CB   8 
ATOM   5400 C CG   . ASP A 1 27 ? -1.802  -10.916 -2.129  1.00 0.00 ? 27 ASP A CG   8 
ATOM   5401 O OD1  . ASP A 1 27 ? -2.354  -10.117 -2.915  1.00 0.00 ? 27 ASP A OD1  8 
ATOM   5402 O OD2  . ASP A 1 27 ? -0.605  -10.850 -1.772  1.00 0.00 ? 27 ASP A OD2  8 
ATOM   5403 H H    . ASP A 1 27 ? -2.424  -12.464 -4.161  1.00 0.00 ? 27 ASP A H    8 
ATOM   5404 H HA   . ASP A 1 27 ? -4.087  -13.588 -1.976  1.00 0.00 ? 27 ASP A HA   8 
ATOM   5405 H HB2  . ASP A 1 27 ? -3.190  -11.684 -0.680  1.00 0.00 ? 27 ASP A HB2  8 
ATOM   5406 H HB3  . ASP A 1 27 ? -1.967  -12.833 -1.166  1.00 0.00 ? 27 ASP A HB3  8 
ATOM   5407 N N    . MET A 1 28 ? -5.085  -10.768 -2.307  1.00 0.00 ? 28 MET A N    8 
ATOM   5408 C CA   . MET A 1 28 ? -5.965  -9.690  -2.725  1.00 0.00 ? 28 MET A CA   8 
ATOM   5409 C C    . MET A 1 28 ? -5.577  -8.448  -1.926  1.00 0.00 ? 28 MET A C    8 
ATOM   5410 O O    . MET A 1 28 ? -5.399  -8.526  -0.711  1.00 0.00 ? 28 MET A O    8 
ATOM   5411 C CB   . MET A 1 28 ? -7.454  -10.050 -2.596  1.00 0.00 ? 28 MET A CB   8 
ATOM   5412 C CG   . MET A 1 28 ? -7.866  -10.585 -1.220  1.00 0.00 ? 28 MET A CG   8 
ATOM   5413 S SD   . MET A 1 28 ? -9.621  -11.032 -1.104  1.00 0.00 ? 28 MET A SD   8 
ATOM   5414 C CE   . MET A 1 28 ? -9.675  -11.662 0.594   1.00 0.00 ? 28 MET A CE   8 
ATOM   5415 H H    . MET A 1 28 ? -4.533  -10.565 -1.488  1.00 0.00 ? 28 MET A H    8 
ATOM   5416 H HA   . MET A 1 28 ? -5.783  -9.490  -3.779  1.00 0.00 ? 28 MET A HA   8 
ATOM   5417 H HB2  . MET A 1 28 ? -8.051  -9.166  -2.826  1.00 0.00 ? 28 MET A HB2  8 
ATOM   5418 H HB3  . MET A 1 28 ? -7.679  -10.802 -3.351  1.00 0.00 ? 28 MET A HB3  8 
ATOM   5419 H HG2  . MET A 1 28 ? -7.280  -11.475 -0.989  1.00 0.00 ? 28 MET A HG2  8 
ATOM   5420 H HG3  . MET A 1 28 ? -7.659  -9.826  -0.467  1.00 0.00 ? 28 MET A HG3  8 
ATOM   5421 H HE1  . MET A 1 28 ? -9.373  -10.877 1.288   1.00 0.00 ? 28 MET A HE1  8 
ATOM   5422 H HE2  . MET A 1 28 ? -10.692 -11.978 0.828   1.00 0.00 ? 28 MET A HE2  8 
ATOM   5423 H HE3  . MET A 1 28 ? -9.003  -12.513 0.691   1.00 0.00 ? 28 MET A HE3  8 
ATOM   5424 N N    . ASP A 1 29 ? -5.423  -7.323  -2.634  1.00 0.00 ? 29 ASP A N    8 
ATOM   5425 C CA   . ASP A 1 29 ? -5.030  -6.012  -2.118  1.00 0.00 ? 29 ASP A CA   8 
ATOM   5426 C C    . ASP A 1 29 ? -3.507  -5.913  -1.891  1.00 0.00 ? 29 ASP A C    8 
ATOM   5427 O O    . ASP A 1 29 ? -2.827  -6.935  -1.812  1.00 0.00 ? 29 ASP A O    8 
ATOM   5428 C CB   . ASP A 1 29 ? -5.829  -5.654  -0.854  1.00 0.00 ? 29 ASP A CB   8 
ATOM   5429 C CG   . ASP A 1 29 ? -7.334  -5.940  -0.945  1.00 0.00 ? 29 ASP A CG   8 
ATOM   5430 O OD1  . ASP A 1 29 ? -7.945  -5.489  -1.934  1.00 0.00 ? 29 ASP A OD1  8 
ATOM   5431 O OD2  . ASP A 1 29 ? -7.851  -6.616  -0.027  1.00 0.00 ? 29 ASP A OD2  8 
ATOM   5432 H H    . ASP A 1 29 ? -5.617  -7.392  -3.617  1.00 0.00 ? 29 ASP A H    8 
ATOM   5433 H HA   . ASP A 1 29 ? -5.301  -5.290  -2.891  1.00 0.00 ? 29 ASP A HA   8 
ATOM   5434 H HB2  . ASP A 1 29 ? -5.411  -6.204  -0.013  1.00 0.00 ? 29 ASP A HB2  8 
ATOM   5435 H HB3  . ASP A 1 29 ? -5.692  -4.596  -0.663  1.00 0.00 ? 29 ASP A HB3  8 
ATOM   5436 N N    . ASP A 1 30 ? -2.982  -4.680  -1.777  1.00 0.00 ? 30 ASP A N    8 
ATOM   5437 C CA   . ASP A 1 30 ? -1.570  -4.347  -1.552  1.00 0.00 ? 30 ASP A CA   8 
ATOM   5438 C C    . ASP A 1 30 ? -1.542  -2.855  -1.220  1.00 0.00 ? 30 ASP A C    8 
ATOM   5439 O O    . ASP A 1 30 ? -1.997  -2.046  -2.023  1.00 0.00 ? 30 ASP A O    8 
ATOM   5440 C CB   . ASP A 1 30 ? -0.662  -4.613  -2.778  1.00 0.00 ? 30 ASP A CB   8 
ATOM   5441 C CG   . ASP A 1 30 ? -0.101  -6.034  -2.930  1.00 0.00 ? 30 ASP A CG   8 
ATOM   5442 O OD1  . ASP A 1 30 ? -0.049  -6.768  -1.921  1.00 0.00 ? 30 ASP A OD1  8 
ATOM   5443 O OD2  . ASP A 1 30 ? 0.325   -6.351  -4.061  1.00 0.00 ? 30 ASP A OD2  8 
ATOM   5444 H H    . ASP A 1 30 ? -3.611  -3.880  -1.768  1.00 0.00 ? 30 ASP A H    8 
ATOM   5445 H HA   . ASP A 1 30 ? -1.205  -4.906  -0.690  1.00 0.00 ? 30 ASP A HA   8 
ATOM   5446 H HB2  . ASP A 1 30 ? -1.182  -4.324  -3.687  1.00 0.00 ? 30 ASP A HB2  8 
ATOM   5447 H HB3  . ASP A 1 30 ? 0.221   -3.975  -2.700  1.00 0.00 ? 30 ASP A HB3  8 
ATOM   5448 N N    . TYR A 1 31 ? -1.036  -2.526  -0.024  1.00 0.00 ? 31 TYR A N    8 
ATOM   5449 C CA   . TYR A 1 31 ? -1.231  -1.258  0.683   1.00 0.00 ? 31 TYR A CA   8 
ATOM   5450 C C    . TYR A 1 31 ? 0.093   -0.528  0.953   1.00 0.00 ? 31 TYR A C    8 
ATOM   5451 O O    . TYR A 1 31 ? 1.129   -1.168  1.121   1.00 0.00 ? 31 TYR A O    8 
ATOM   5452 C CB   . TYR A 1 31 ? -1.934  -1.522  2.033   1.00 0.00 ? 31 TYR A CB   8 
ATOM   5453 C CG   . TYR A 1 31 ? -3.146  -2.449  2.010   1.00 0.00 ? 31 TYR A CG   8 
ATOM   5454 C CD1  . TYR A 1 31 ? -2.970  -3.850  1.899   1.00 0.00 ? 31 TYR A CD1  8 
ATOM   5455 C CD2  . TYR A 1 31 ? -4.445  -1.932  2.205   1.00 0.00 ? 31 TYR A CD2  8 
ATOM   5456 C CE1  . TYR A 1 31 ? -4.088  -4.707  1.893   1.00 0.00 ? 31 TYR A CE1  8 
ATOM   5457 C CE2  . TYR A 1 31 ? -5.550  -2.797  2.307   1.00 0.00 ? 31 TYR A CE2  8 
ATOM   5458 C CZ   . TYR A 1 31 ? -5.387  -4.174  2.053   1.00 0.00 ? 31 TYR A CZ   8 
ATOM   5459 O OH   . TYR A 1 31 ? -6.471  -5.004  2.082   1.00 0.00 ? 31 TYR A OH   8 
ATOM   5460 H H    . TYR A 1 31 ? -0.701  -3.303  0.517   1.00 0.00 ? 31 TYR A H    8 
ATOM   5461 H HA   . TYR A 1 31 ? -1.869  -0.606  0.089   1.00 0.00 ? 31 TYR A HA   8 
ATOM   5462 H HB2  . TYR A 1 31 ? -1.227  -1.930  2.759   1.00 0.00 ? 31 TYR A HB2  8 
ATOM   5463 H HB3  . TYR A 1 31 ? -2.230  -0.550  2.423   1.00 0.00 ? 31 TYR A HB3  8 
ATOM   5464 H HD1  . TYR A 1 31 ? -1.980  -4.275  1.824   1.00 0.00 ? 31 TYR A HD1  8 
ATOM   5465 H HD2  . TYR A 1 31 ? -4.609  -0.871  2.242   1.00 0.00 ? 31 TYR A HD2  8 
ATOM   5466 H HE1  . TYR A 1 31 ? -3.942  -5.769  1.776   1.00 0.00 ? 31 TYR A HE1  8 
ATOM   5467 H HE2  . TYR A 1 31 ? -6.535  -2.391  2.486   1.00 0.00 ? 31 TYR A HE2  8 
ATOM   5468 H HH   . TYR A 1 31 ? -7.310  -4.536  2.091   1.00 0.00 ? 31 TYR A HH   8 
ATOM   5469 N N    . CYS A 1 32 ? 0.029   0.808   1.090   1.00 0.00 ? 32 CYS A N    8 
ATOM   5470 C CA   . CYS A 1 32 ? 1.058   1.626   1.734   1.00 0.00 ? 32 CYS A CA   8 
ATOM   5471 C C    . CYS A 1 32 ? 0.849   1.445   3.238   1.00 0.00 ? 32 CYS A C    8 
ATOM   5472 O O    . CYS A 1 32 ? -0.202  1.812   3.768   1.00 0.00 ? 32 CYS A O    8 
ATOM   5473 C CB   . CYS A 1 32 ? 0.985   3.109   1.316   1.00 0.00 ? 32 CYS A CB   8 
ATOM   5474 S SG   . CYS A 1 32 ? 0.703   3.389   -0.456  1.00 0.00 ? 32 CYS A SG   8 
ATOM   5475 H H    . CYS A 1 32 ? -0.870  1.246   0.959   1.00 0.00 ? 32 CYS A H    8 
ATOM   5476 H HA   . CYS A 1 32 ? 2.040   1.258   1.424   1.00 0.00 ? 32 CYS A HA   8 
ATOM   5477 H HB2  . CYS A 1 32 ? 0.223   3.652   1.871   1.00 0.00 ? 32 CYS A HB2  8 
ATOM   5478 H HB3  . CYS A 1 32 ? 1.910   3.591   1.617   1.00 0.00 ? 32 CYS A HB3  8 
ATOM   5479 N N    . ASN A 1 33 ? 1.815   0.789   3.891   1.00 0.00 ? 33 ASN A N    8 
ATOM   5480 C CA   . ASN A 1 33 ? 1.616   0.137   5.190   1.00 0.00 ? 33 ASN A CA   8 
ATOM   5481 C C    . ASN A 1 33 ? 2.261   0.891   6.364   1.00 0.00 ? 33 ASN A C    8 
ATOM   5482 O O    . ASN A 1 33 ? 2.606   0.268   7.368   1.00 0.00 ? 33 ASN A O    8 
ATOM   5483 C CB   . ASN A 1 33 ? 2.039   -1.346  5.111   1.00 0.00 ? 33 ASN A CB   8 
ATOM   5484 C CG   . ASN A 1 33 ? 3.543   -1.550  5.184   1.00 0.00 ? 33 ASN A CG   8 
ATOM   5485 O OD1  . ASN A 1 33 ? 4.073   -2.146  6.119   1.00 0.00 ? 33 ASN A OD1  8 
ATOM   5486 N ND2  . ASN A 1 33 ? 4.220   -1.013  4.185   1.00 0.00 ? 33 ASN A ND2  8 
ATOM   5487 H H    . ASN A 1 33 ? 2.668   0.607   3.378   1.00 0.00 ? 33 ASN A H    8 
ATOM   5488 H HA   . ASN A 1 33 ? 0.553   0.101   5.404   1.00 0.00 ? 33 ASN A HA   8 
ATOM   5489 H HB2  . ASN A 1 33 ? 1.637   -1.871  5.958   1.00 0.00 ? 33 ASN A HB2  8 
ATOM   5490 H HB3  . ASN A 1 33 ? 1.639   -1.812  4.208   1.00 0.00 ? 33 ASN A HB3  8 
ATOM   5491 H HD21 . ASN A 1 33 ? 3.698   -0.607  3.429   1.00 0.00 ? 33 ASN A HD21 8 
ATOM   5492 H HD22 . ASN A 1 33 ? 5.222   -1.037  4.189   1.00 0.00 ? 33 ASN A HD22 8 
ATOM   5493 N N    . GLY A 1 34 ? 2.447   2.218   6.258   1.00 0.00 ? 34 GLY A N    8 
ATOM   5494 C CA   . GLY A 1 34 ? 3.080   3.026   7.298   1.00 0.00 ? 34 GLY A CA   8 
ATOM   5495 C C    . GLY A 1 34 ? 4.609   2.848   7.381   1.00 0.00 ? 34 GLY A C    8 
ATOM   5496 O O    . GLY A 1 34 ? 5.296   3.747   7.863   1.00 0.00 ? 34 GLY A O    8 
ATOM   5497 H H    . GLY A 1 34 ? 2.155   2.688   5.413   1.00 0.00 ? 34 GLY A H    8 
ATOM   5498 H HA2  . GLY A 1 34 ? 2.853   4.070   7.082   1.00 0.00 ? 34 GLY A HA2  8 
ATOM   5499 H HA3  . GLY A 1 34 ? 2.645   2.786   8.270   1.00 0.00 ? 34 GLY A HA3  8 
ATOM   5500 N N    . LYS A 1 35 ? 5.151   1.703   6.931   1.00 0.00 ? 35 LYS A N    8 
ATOM   5501 C CA   . LYS A 1 35 ? 6.581   1.420   6.867   1.00 0.00 ? 35 LYS A CA   8 
ATOM   5502 C C    . LYS A 1 35 ? 7.191   2.019   5.600   1.00 0.00 ? 35 LYS A C    8 
ATOM   5503 O O    . LYS A 1 35 ? 8.205   2.711   5.682   1.00 0.00 ? 35 LYS A O    8 
ATOM   5504 C CB   . LYS A 1 35 ? 6.836   -0.096  6.932   1.00 0.00 ? 35 LYS A CB   8 
ATOM   5505 C CG   . LYS A 1 35 ? 6.295   -0.760  8.208   1.00 0.00 ? 35 LYS A CG   8 
ATOM   5506 C CD   . LYS A 1 35 ? 6.845   -0.090  9.477   1.00 0.00 ? 35 LYS A CD   8 
ATOM   5507 C CE   . LYS A 1 35 ? 6.552   -0.901  10.747  1.00 0.00 ? 35 LYS A CE   8 
ATOM   5508 N NZ   . LYS A 1 35 ? 7.318   -2.159  10.794  1.00 0.00 ? 35 LYS A NZ   8 
ATOM   5509 H H    . LYS A 1 35 ? 4.539   0.984   6.573   1.00 0.00 ? 35 LYS A H    8 
ATOM   5510 H HA   . LYS A 1 35 ? 7.085   1.888   7.713   1.00 0.00 ? 35 LYS A HA   8 
ATOM   5511 H HB2  . LYS A 1 35 ? 6.382   -0.585  6.068   1.00 0.00 ? 35 LYS A HB2  8 
ATOM   5512 H HB3  . LYS A 1 35 ? 7.913   -0.270  6.886   1.00 0.00 ? 35 LYS A HB3  8 
ATOM   5513 H HG2  . LYS A 1 35 ? 5.205   -0.715  8.224   1.00 0.00 ? 35 LYS A HG2  8 
ATOM   5514 H HG3  . LYS A 1 35 ? 6.592   -1.810  8.185   1.00 0.00 ? 35 LYS A HG3  8 
ATOM   5515 H HD2  . LYS A 1 35 ? 7.924   0.052   9.386   1.00 0.00 ? 35 LYS A HD2  8 
ATOM   5516 H HD3  . LYS A 1 35 ? 6.375   0.888   9.596   1.00 0.00 ? 35 LYS A HD3  8 
ATOM   5517 H HE2  . LYS A 1 35 ? 6.832   -0.305  11.618  1.00 0.00 ? 35 LYS A HE2  8 
ATOM   5518 H HE3  . LYS A 1 35 ? 5.487   -1.125  10.807  1.00 0.00 ? 35 LYS A HE3  8 
ATOM   5519 H HZ1  . LYS A 1 35 ? 7.124   -2.640  11.661  1.00 0.00 ? 35 LYS A HZ1  8 
ATOM   5520 H HZ2  . LYS A 1 35 ? 7.056   -2.748  10.018  1.00 0.00 ? 35 LYS A HZ2  8 
ATOM   5521 H HZ3  . LYS A 1 35 ? 8.306   -1.953  10.740  1.00 0.00 ? 35 LYS A HZ3  8 
ATOM   5522 N N    . THR A 1 36 ? 6.579   1.746   4.436   1.00 0.00 ? 36 THR A N    8 
ATOM   5523 C CA   . THR A 1 36 ? 7.029   2.269   3.149   1.00 0.00 ? 36 THR A CA   8 
ATOM   5524 C C    . THR A 1 36 ? 5.915   2.325   2.096   1.00 0.00 ? 36 THR A C    8 
ATOM   5525 O O    . THR A 1 36 ? 4.830   1.759   2.255   1.00 0.00 ? 36 THR A O    8 
ATOM   5526 C CB   . THR A 1 36 ? 8.272   1.502   2.646   1.00 0.00 ? 36 THR A CB   8 
ATOM   5527 O OG1  . THR A 1 36 ? 8.833   2.136   1.511   1.00 0.00 ? 36 THR A OG1  8 
ATOM   5528 C CG2  . THR A 1 36 ? 7.970   0.032   2.321   1.00 0.00 ? 36 THR A CG2  8 
ATOM   5529 H H    . THR A 1 36 ? 5.759   1.156   4.459   1.00 0.00 ? 36 THR A H    8 
ATOM   5530 H HA   . THR A 1 36 ? 7.328   3.304   3.324   1.00 0.00 ? 36 THR A HA   8 
ATOM   5531 H HB   . THR A 1 36 ? 9.040   1.542   3.414   1.00 0.00 ? 36 THR A HB   8 
ATOM   5532 H HG1  . THR A 1 36 ? 9.557   1.599   1.179   1.00 0.00 ? 36 THR A HG1  8 
ATOM   5533 H HG21 . THR A 1 36 ? 8.889   -0.475  2.023   1.00 0.00 ? 36 THR A HG21 8 
ATOM   5534 H HG22 . THR A 1 36 ? 7.252   -0.039  1.504   1.00 0.00 ? 36 THR A HG22 8 
ATOM   5535 H HG23 . THR A 1 36 ? 7.564   -0.474  3.198   1.00 0.00 ? 36 THR A HG23 8 
ATOM   5536 N N    . CYS A 1 37 ? 6.248   3.038   1.012   1.00 0.00 ? 37 CYS A N    8 
ATOM   5537 C CA   . CYS A 1 37 ? 5.453   3.264   -0.193  1.00 0.00 ? 37 CYS A CA   8 
ATOM   5538 C C    . CYS A 1 37 ? 6.216   2.813   -1.445  1.00 0.00 ? 37 CYS A C    8 
ATOM   5539 O O    . CYS A 1 37 ? 6.265   3.530   -2.444  1.00 0.00 ? 37 CYS A O    8 
ATOM   5540 C CB   . CYS A 1 37 ? 5.028   4.737   -0.248  1.00 0.00 ? 37 CYS A CB   8 
ATOM   5541 S SG   . CYS A 1 37 ? 3.909   5.136   1.109   1.00 0.00 ? 37 CYS A SG   8 
ATOM   5542 H H    . CYS A 1 37 ? 7.175   3.442   1.041   1.00 0.00 ? 37 CYS A H    8 
ATOM   5543 H HA   . CYS A 1 37 ? 4.532   2.675   -0.166  1.00 0.00 ? 37 CYS A HA   8 
ATOM   5544 H HB2  . CYS A 1 37 ? 5.895   5.397   -0.228  1.00 0.00 ? 37 CYS A HB2  8 
ATOM   5545 H HB3  . CYS A 1 37 ? 4.477   4.915   -1.171  1.00 0.00 ? 37 CYS A HB3  8 
ATOM   5546 N N    . ASP A 1 38 ? 6.757   1.586   -1.401  1.00 0.00 ? 38 ASP A N    8 
ATOM   5547 C CA   . ASP A 1 38 ? 7.214   0.831   -2.569  1.00 0.00 ? 38 ASP A CA   8 
ATOM   5548 C C    . ASP A 1 38 ? 6.116   -0.176  -2.966  1.00 0.00 ? 38 ASP A C    8 
ATOM   5549 O O    . ASP A 1 38 ? 6.408   -1.347  -3.203  1.00 0.00 ? 38 ASP A O    8 
ATOM   5550 C CB   . ASP A 1 38 ? 8.552   0.141   -2.232  1.00 0.00 ? 38 ASP A CB   8 
ATOM   5551 C CG   . ASP A 1 38 ? 9.651   1.132   -1.835  1.00 0.00 ? 38 ASP A CG   8 
ATOM   5552 O OD1  . ASP A 1 38 ? 9.929   2.037   -2.653  1.00 0.00 ? 38 ASP A OD1  8 
ATOM   5553 O OD2  . ASP A 1 38 ? 10.197  0.970   -0.721  1.00 0.00 ? 38 ASP A OD2  8 
ATOM   5554 H H    . ASP A 1 38 ? 6.715   1.090   -0.522  1.00 0.00 ? 38 ASP A H    8 
ATOM   5555 H HA   . ASP A 1 38 ? 7.378   1.491   -3.423  1.00 0.00 ? 38 ASP A HA   8 
ATOM   5556 H HB2  . ASP A 1 38 ? 8.393   -0.575  -1.422  1.00 0.00 ? 38 ASP A HB2  8 
ATOM   5557 H HB3  . ASP A 1 38 ? 8.903   -0.413  -3.105  1.00 0.00 ? 38 ASP A HB3  8 
ATOM   5558 N N    . CYS A 1 39 ? 4.853   0.295   -2.991  1.00 0.00 ? 39 CYS A N    8 
ATOM   5559 C CA   . CYS A 1 39 ? 3.597   -0.458  -2.957  1.00 0.00 ? 39 CYS A CA   8 
ATOM   5560 C C    . CYS A 1 39 ? 3.763   -1.910  -2.463  1.00 0.00 ? 39 CYS A C    8 
ATOM   5561 O O    . CYS A 1 39 ? 3.679   -2.841  -3.264  1.00 0.00 ? 39 CYS A O    8 
ATOM   5562 C CB   . CYS A 1 39 ? 2.860   -0.335  -4.304  1.00 0.00 ? 39 CYS A CB   8 
ATOM   5563 S SG   . CYS A 1 39 ? 1.174   -1.017  -4.316  1.00 0.00 ? 39 CYS A SG   8 
ATOM   5564 H H    . CYS A 1 39 ? 4.742   1.291   -2.872  1.00 0.00 ? 39 CYS A H    8 
ATOM   5565 H HA   . CYS A 1 39 ? 2.985   0.072   -2.230  1.00 0.00 ? 39 CYS A HA   8 
ATOM   5566 H HB2  . CYS A 1 39 ? 2.777   0.721   -4.564  1.00 0.00 ? 39 CYS A HB2  8 
ATOM   5567 H HB3  . CYS A 1 39 ? 3.445   -0.826  -5.083  1.00 0.00 ? 39 CYS A HB3  8 
ATOM   5568 N N    . PRO A 1 40 ? 4.051   -2.112  -1.160  1.00 0.00 ? 40 PRO A N    8 
ATOM   5569 C CA   . PRO A 1 40 ? 4.528   -3.387  -0.629  1.00 0.00 ? 40 PRO A CA   8 
ATOM   5570 C C    . PRO A 1 40 ? 3.452   -4.484  -0.587  1.00 0.00 ? 40 PRO A C    8 
ATOM   5571 O O    . PRO A 1 40 ? 2.260   -4.235  -0.775  1.00 0.00 ? 40 PRO A O    8 
ATOM   5572 C CB   . PRO A 1 40 ? 5.115   -3.077  0.753   1.00 0.00 ? 40 PRO A CB   8 
ATOM   5573 C CG   . PRO A 1 40 ? 4.401   -1.797  1.175   1.00 0.00 ? 40 PRO A CG   8 
ATOM   5574 C CD   . PRO A 1 40 ? 4.123   -1.074  -0.139  1.00 0.00 ? 40 PRO A CD   8 
ATOM   5575 H HA   . PRO A 1 40 ? 5.341   -3.741  -1.268  1.00 0.00 ? 40 PRO A HA   8 
ATOM   5576 H HB2  . PRO A 1 40 ? 4.980   -3.880  1.480   1.00 0.00 ? 40 PRO A HB2  8 
ATOM   5577 H HB3  . PRO A 1 40 ? 6.180   -2.862  0.655   1.00 0.00 ? 40 PRO A HB3  8 
ATOM   5578 H HG2  . PRO A 1 40 ? 3.466   -2.057  1.674   1.00 0.00 ? 40 PRO A HG2  8 
ATOM   5579 H HG3  . PRO A 1 40 ? 5.031   -1.190  1.822   1.00 0.00 ? 40 PRO A HG3  8 
ATOM   5580 H HD2  . PRO A 1 40 ? 3.201   -0.500  -0.070  1.00 0.00 ? 40 PRO A HD2  8 
ATOM   5581 H HD3  . PRO A 1 40 ? 4.944   -0.390  -0.340  1.00 0.00 ? 40 PRO A HD3  8 
ATOM   5582 N N    . ARG A 1 41 ? 3.927   -5.720  -0.375  1.00 0.00 ? 41 ARG A N    8 
ATOM   5583 C CA   . ARG A 1 41 ? 3.200   -6.967  -0.583  1.00 0.00 ? 41 ARG A CA   8 
ATOM   5584 C C    . ARG A 1 41 ? 2.403   -7.353  0.674   1.00 0.00 ? 41 ARG A C    8 
ATOM   5585 O O    . ARG A 1 41 ? 2.770   -8.304  1.362   1.00 0.00 ? 41 ARG A O    8 
ATOM   5586 C CB   . ARG A 1 41 ? 4.215   -8.043  -1.030  1.00 0.00 ? 41 ARG A CB   8 
ATOM   5587 C CG   . ARG A 1 41 ? 3.641   -9.437  -1.352  1.00 0.00 ? 41 ARG A CG   8 
ATOM   5588 C CD   . ARG A 1 41 ? 2.478   -9.446  -2.353  1.00 0.00 ? 41 ARG A CD   8 
ATOM   5589 N NE   . ARG A 1 41 ? 2.850   -8.842  -3.642  1.00 0.00 ? 41 ARG A NE   8 
ATOM   5590 C CZ   . ARG A 1 41 ? 2.150   -8.949  -4.786  1.00 0.00 ? 41 ARG A CZ   8 
ATOM   5591 N NH1  . ARG A 1 41 ? 0.992   -9.623  -4.835  1.00 0.00 ? 41 ARG A NH1  8 
ATOM   5592 N NH2  . ARG A 1 41 ? 2.624   -8.374  -5.901  1.00 0.00 ? 41 ARG A NH2  8 
ATOM   5593 H H    . ARG A 1 41 ? 4.915   -5.804  -0.181  1.00 0.00 ? 41 ARG A H    8 
ATOM   5594 H HA   . ARG A 1 41 ? 2.504   -6.824  -1.410  1.00 0.00 ? 41 ARG A HA   8 
ATOM   5595 H HB2  . ARG A 1 41 ? 4.727   -7.678  -1.923  1.00 0.00 ? 41 ARG A HB2  8 
ATOM   5596 H HB3  . ARG A 1 41 ? 4.972   -8.166  -0.252  1.00 0.00 ? 41 ARG A HB3  8 
ATOM   5597 H HG2  . ARG A 1 41 ? 4.451   -10.046 -1.760  1.00 0.00 ? 41 ARG A HG2  8 
ATOM   5598 H HG3  . ARG A 1 41 ? 3.306   -9.925  -0.437  1.00 0.00 ? 41 ARG A HG3  8 
ATOM   5599 H HD2  . ARG A 1 41 ? 2.189   -10.487 -2.515  1.00 0.00 ? 41 ARG A HD2  8 
ATOM   5600 H HD3  . ARG A 1 41 ? 1.622   -8.916  -1.934  1.00 0.00 ? 41 ARG A HD3  8 
ATOM   5601 H HE   . ARG A 1 41 ? 3.714   -8.319  -3.663  1.00 0.00 ? 41 ARG A HE   8 
ATOM   5602 H HH11 . ARG A 1 41 ? 0.627   -10.070 -4.005  1.00 0.00 ? 41 ARG A HH11 8 
ATOM   5603 H HH12 . ARG A 1 41 ? 0.492   -9.709  -5.709  1.00 0.00 ? 41 ARG A HH12 8 
ATOM   5604 H HH21 . ARG A 1 41 ? 3.497   -7.867  -5.876  1.00 0.00 ? 41 ARG A HH21 8 
ATOM   5605 H HH22 . ARG A 1 41 ? 2.114   -8.455  -6.769  1.00 0.00 ? 41 ARG A HH22 8 
ATOM   5606 N N    . ASN A 1 42 ? 1.304   -6.620  0.937   1.00 0.00 ? 42 ASN A N    8 
ATOM   5607 C CA   . ASN A 1 42 ? 0.204   -6.951  1.854   1.00 0.00 ? 42 ASN A CA   8 
ATOM   5608 C C    . ASN A 1 42 ? 0.637   -7.784  3.071   1.00 0.00 ? 42 ASN A C    8 
ATOM   5609 O O    . ASN A 1 42 ? 0.581   -9.008  2.994   1.00 0.00 ? 42 ASN A O    8 
ATOM   5610 C CB   . ASN A 1 42 ? -0.907  -7.638  1.035   1.00 0.00 ? 42 ASN A CB   8 
ATOM   5611 C CG   . ASN A 1 42 ? -2.180  -8.025  1.797   1.00 0.00 ? 42 ASN A CG   8 
ATOM   5612 O OD1  . ASN A 1 42 ? -2.325  -7.765  2.991   1.00 0.00 ? 42 ASN A OD1  8 
ATOM   5613 N ND2  . ASN A 1 42 ? -3.115  -8.652  1.075   1.00 0.00 ? 42 ASN A ND2  8 
ATOM   5614 H H    . ASN A 1 42 ? 1.139   -5.825  0.335   1.00 0.00 ? 42 ASN A H    8 
ATOM   5615 H HA   . ASN A 1 42 ? -0.220  -6.020  2.224   1.00 0.00 ? 42 ASN A HA   8 
ATOM   5616 H HB2  . ASN A 1 42 ? -1.222  -6.952  0.253   1.00 0.00 ? 42 ASN A HB2  8 
ATOM   5617 H HB3  . ASN A 1 42 ? -0.494  -8.531  0.565   1.00 0.00 ? 42 ASN A HB3  8 
ATOM   5618 H HD21 . ASN A 1 42 ? -2.951  -8.825  0.094   1.00 0.00 ? 42 ASN A HD21 8 
ATOM   5619 H HD22 . ASN A 1 42 ? -3.986  -8.949  1.491   1.00 0.00 ? 42 ASN A HD22 8 
ATOM   5620 N N    . PRO A 1 43 ? 1.054   -7.145  4.180   1.00 0.00 ? 43 PRO A N    8 
ATOM   5621 C CA   . PRO A 1 43 ? 1.352   -7.784  5.462   1.00 0.00 ? 43 PRO A CA   8 
ATOM   5622 C C    . PRO A 1 43 ? 0.179   -8.623  6.003   1.00 0.00 ? 43 PRO A C    8 
ATOM   5623 O O    . PRO A 1 43 ? -0.584  -8.172  6.853   1.00 0.00 ? 43 PRO A O    8 
ATOM   5624 C CB   . PRO A 1 43 ? 1.749   -6.638  6.405   1.00 0.00 ? 43 PRO A CB   8 
ATOM   5625 C CG   . PRO A 1 43 ? 2.319   -5.591  5.452   1.00 0.00 ? 43 PRO A CG   8 
ATOM   5626 C CD   . PRO A 1 43 ? 1.411   -5.735  4.230   1.00 0.00 ? 43 PRO A CD   8 
ATOM   5627 H HA   . PRO A 1 43 ? 2.227   -8.423  5.324   1.00 0.00 ? 43 PRO A HA   8 
ATOM   5628 H HB2  . PRO A 1 43 ? 0.876   -6.202  6.891   1.00 0.00 ? 43 PRO A HB2  8 
ATOM   5629 H HB3  . PRO A 1 43 ? 2.471   -6.963  7.156   1.00 0.00 ? 43 PRO A HB3  8 
ATOM   5630 H HG2  . PRO A 1 43 ? 2.294   -4.584  5.871   1.00 0.00 ? 43 PRO A HG2  8 
ATOM   5631 H HG3  . PRO A 1 43 ? 3.343   -5.858  5.186   1.00 0.00 ? 43 PRO A HG3  8 
ATOM   5632 H HD2  . PRO A 1 43 ? 0.502   -5.147  4.354   1.00 0.00 ? 43 PRO A HD2  8 
ATOM   5633 H HD3  . PRO A 1 43 ? 1.945   -5.403  3.339   1.00 0.00 ? 43 PRO A HD3  8 
ATOM   5634 N N    . HIS A 1 44 ? 0.050   -9.855  5.496   1.00 0.00 ? 44 HIS A N    8 
ATOM   5635 C CA   . HIS A 1 44 ? -1.047  -10.786 5.769   1.00 0.00 ? 44 HIS A CA   8 
ATOM   5636 C C    . HIS A 1 44 ? -1.181  -11.116 7.262   1.00 0.00 ? 44 HIS A C    8 
ATOM   5637 O O    . HIS A 1 44 ? -2.289  -11.122 7.797   1.00 0.00 ? 44 HIS A O    8 
ATOM   5638 C CB   . HIS A 1 44 ? -0.877  -12.074 4.942   1.00 0.00 ? 44 HIS A CB   8 
ATOM   5639 C CG   . HIS A 1 44 ? -0.761  -11.849 3.456   1.00 0.00 ? 44 HIS A CG   8 
ATOM   5640 N ND1  . HIS A 1 44 ? 0.386   -11.970 2.705   1.00 0.00 ? 44 HIS A ND1  8 
ATOM   5641 C CD2  . HIS A 1 44 ? -1.752  -11.395 2.630   1.00 0.00 ? 44 HIS A CD2  8 
ATOM   5642 C CE1  . HIS A 1 44 ? 0.086   -11.592 1.450   1.00 0.00 ? 44 HIS A CE1  8 
ATOM   5643 N NE2  . HIS A 1 44 ? -1.206  -11.235 1.354   1.00 0.00 ? 44 HIS A NE2  8 
ATOM   5644 H H    . HIS A 1 44 ? 0.673   -10.078 4.732   1.00 0.00 ? 44 HIS A H    8 
ATOM   5645 H HA   . HIS A 1 44 ? -1.967  -10.301 5.451   1.00 0.00 ? 44 HIS A HA   8 
ATOM   5646 H HB2  . HIS A 1 44 ? 0.018   -12.599 5.266   1.00 0.00 ? 44 HIS A HB2  8 
ATOM   5647 H HB3  . HIS A 1 44 ? -1.733  -12.728 5.121   1.00 0.00 ? 44 HIS A HB3  8 
ATOM   5648 H HD1  . HIS A 1 44 ? 1.296   -12.250 3.043   1.00 0.00 ? 44 HIS A HD1  8 
ATOM   5649 H HD2  . HIS A 1 44 ? -2.761  -11.166 2.932   1.00 0.00 ? 44 HIS A HD2  8 
ATOM   5650 H HE1  . HIS A 1 44 ? 0.799   -11.548 0.642   1.00 0.00 ? 44 HIS A HE1  8 
ATOM   5651 N N    . LYS A 1 45 ? -0.043  -11.364 7.925   1.00 0.00 ? 45 LYS A N    8 
ATOM   5652 C CA   . LYS A 1 45 ? 0.066   -11.617 9.355   1.00 0.00 ? 45 LYS A CA   8 
ATOM   5653 C C    . LYS A 1 45 ? -0.228  -10.298 10.083  1.00 0.00 ? 45 LYS A C    8 
ATOM   5654 O O    . LYS A 1 45 ? 0.624   -9.410  10.132  1.00 0.00 ? 45 LYS A O    8 
ATOM   5655 C CB   . LYS A 1 45 ? 1.462   -12.166 9.703   1.00 0.00 ? 45 LYS A CB   8 
ATOM   5656 C CG   . LYS A 1 45 ? 1.745   -13.591 9.189   1.00 0.00 ? 45 LYS A CG   8 
ATOM   5657 C CD   . LYS A 1 45 ? 1.882   -13.694 7.659   1.00 0.00 ? 45 LYS A CD   8 
ATOM   5658 C CE   . LYS A 1 45 ? 2.480   -15.035 7.212   1.00 0.00 ? 45 LYS A CE   8 
ATOM   5659 N NZ   . LYS A 1 45 ? 1.599   -16.173 7.529   1.00 0.00 ? 45 LYS A NZ   8 
ATOM   5660 H H    . LYS A 1 45 ? 0.810   -11.331 7.392   1.00 0.00 ? 45 LYS A H    8 
ATOM   5661 H HA   . LYS A 1 45 ? -0.666  -12.375 9.634   1.00 0.00 ? 45 LYS A HA   8 
ATOM   5662 H HB2  . LYS A 1 45 ? 2.236   -11.490 9.333   1.00 0.00 ? 45 LYS A HB2  8 
ATOM   5663 H HB3  . LYS A 1 45 ? 1.544   -12.200 10.792  1.00 0.00 ? 45 LYS A HB3  8 
ATOM   5664 H HG2  . LYS A 1 45 ? 2.687   -13.915 9.635   1.00 0.00 ? 45 LYS A HG2  8 
ATOM   5665 H HG3  . LYS A 1 45 ? 0.959   -14.264 9.534   1.00 0.00 ? 45 LYS A HG3  8 
ATOM   5666 H HD2  . LYS A 1 45 ? 0.903   -13.590 7.191   1.00 0.00 ? 45 LYS A HD2  8 
ATOM   5667 H HD3  . LYS A 1 45 ? 2.532   -12.893 7.303   1.00 0.00 ? 45 LYS A HD3  8 
ATOM   5668 H HE2  . LYS A 1 45 ? 2.629   -15.013 6.131   1.00 0.00 ? 45 LYS A HE2  8 
ATOM   5669 H HE3  . LYS A 1 45 ? 3.449   -15.187 7.691   1.00 0.00 ? 45 LYS A HE3  8 
ATOM   5670 H HZ1  . LYS A 1 45 ? 0.707   -16.044 7.075   1.00 0.00 ? 45 LYS A HZ1  8 
ATOM   5671 H HZ2  . LYS A 1 45 ? 2.023   -17.029 7.200   1.00 0.00 ? 45 LYS A HZ2  8 
ATOM   5672 H HZ3  . LYS A 1 45 ? 1.464   -16.228 8.528   1.00 0.00 ? 45 LYS A HZ3  8 
ATOM   5673 N N    . GLY A 1 46 ? -1.465  -10.155 10.581  1.00 0.00 ? 46 GLY A N    8 
ATOM   5674 C CA   . GLY A 1 46 ? -2.048  -8.874  10.958  1.00 0.00 ? 46 GLY A CA   8 
ATOM   5675 C C    . GLY A 1 46 ? -2.361  -8.093  9.674   1.00 0.00 ? 46 GLY A C    8 
ATOM   5676 O O    . GLY A 1 46 ? -1.558  -7.241  9.295   1.00 0.00 ? 46 GLY A O    8 
ATOM   5677 H H    . GLY A 1 46 ? -2.090  -10.946 10.518  1.00 0.00 ? 46 GLY A H    8 
ATOM   5678 H HA2  . GLY A 1 46 ? -2.949  -9.039  11.549  1.00 0.00 ? 46 GLY A HA2  8 
ATOM   5679 H HA3  . GLY A 1 46 ? -1.345  -8.314  11.578  1.00 0.00 ? 46 GLY A HA3  8 
ATOM   5680 N N    . PRO A 1 47 ? -3.481  -8.401  8.983   1.00 0.00 ? 47 PRO A N    8 
ATOM   5681 C CA   . PRO A 1 47 ? -3.796  -7.949  7.627   1.00 0.00 ? 47 PRO A CA   8 
ATOM   5682 C C    . PRO A 1 47 ? -3.542  -6.457  7.375   1.00 0.00 ? 47 PRO A C    8 
ATOM   5683 O O    . PRO A 1 47 ? -4.028  -5.613  8.127   1.00 0.00 ? 47 PRO A O    8 
ATOM   5684 C CB   . PRO A 1 47 ? -5.265  -8.322  7.400   1.00 0.00 ? 47 PRO A CB   8 
ATOM   5685 C CG   . PRO A 1 47 ? -5.409  -9.596  8.230   1.00 0.00 ? 47 PRO A CG   8 
ATOM   5686 C CD   . PRO A 1 47 ? -4.516  -9.320  9.443   1.00 0.00 ? 47 PRO A CD   8 
ATOM   5687 H HA   . PRO A 1 47 ? -3.197  -8.557  6.946   1.00 0.00 ? 47 PRO A HA   8 
ATOM   5688 H HB2  . PRO A 1 47 ? -5.921  -7.551  7.807   1.00 0.00 ? 47 PRO A HB2  8 
ATOM   5689 H HB3  . PRO A 1 47 ? -5.494  -8.486  6.346   1.00 0.00 ? 47 PRO A HB3  8 
ATOM   5690 H HG2  . PRO A 1 47 ? -6.445  -9.793  8.513   1.00 0.00 ? 47 PRO A HG2  8 
ATOM   5691 H HG3  . PRO A 1 47 ? -5.013  -10.443 7.665   1.00 0.00 ? 47 PRO A HG3  8 
ATOM   5692 H HD2  . PRO A 1 47 ? -5.100  -8.829  10.224  1.00 0.00 ? 47 PRO A HD2  8 
ATOM   5693 H HD3  . PRO A 1 47 ? -4.112  -10.259 9.822   1.00 0.00 ? 47 PRO A HD3  8 
ATOM   5694 N N    . ALA A 1 48 ? -2.749  -6.155  6.332   1.00 0.00 ? 48 ALA A N    8 
ATOM   5695 C CA   . ALA A 1 48 ? -2.328  -4.819  5.906   1.00 0.00 ? 48 ALA A CA   8 
ATOM   5696 C C    . ALA A 1 48 ? -1.300  -4.150  6.839   1.00 0.00 ? 48 ALA A C    8 
ATOM   5697 O O    . ALA A 1 48 ? -0.492  -3.350  6.367   1.00 0.00 ? 48 ALA A O    8 
ATOM   5698 C CB   . ALA A 1 48 ? -3.535  -3.906  5.633   1.00 0.00 ? 48 ALA A CB   8 
ATOM   5699 H H    . ALA A 1 48 ? -2.395  -6.929  5.790   1.00 0.00 ? 48 ALA A H    8 
ATOM   5700 H HA   . ALA A 1 48 ? -1.838  -4.971  4.942   1.00 0.00 ? 48 ALA A HA   8 
ATOM   5701 H HB1  . ALA A 1 48 ? -4.254  -4.414  4.988   1.00 0.00 ? 48 ALA A HB1  8 
ATOM   5702 H HB2  . ALA A 1 48 ? -4.029  -3.616  6.560   1.00 0.00 ? 48 ALA A HB2  8 
ATOM   5703 H HB3  . ALA A 1 48 ? -3.196  -3.003  5.126   1.00 0.00 ? 48 ALA A HB3  8 
ATOM   5704 N N    . THR A 1 49 ? -1.332  -4.451  8.147   1.00 0.00 ? 49 THR A N    8 
ATOM   5705 C CA   . THR A 1 49 ? -0.503  -3.845  9.186   1.00 0.00 ? 49 THR A CA   8 
ATOM   5706 C C    . THR A 1 49 ? 0.921   -4.416  9.108   1.00 0.00 ? 49 THR A C    8 
ATOM   5707 O O    . THR A 1 49 ? 1.164   -5.548  9.523   1.00 0.00 ? 49 THR A O    8 
ATOM   5708 C CB   . THR A 1 49 ? -1.152  -4.085  10.568  1.00 0.00 ? 49 THR A CB   8 
ATOM   5709 O OG1  . THR A 1 49 ? -2.483  -3.603  10.577  1.00 0.00 ? 49 THR A OG1  8 
ATOM   5710 C CG2  . THR A 1 49 ? -0.379  -3.400  11.704  1.00 0.00 ? 49 THR A CG2  8 
ATOM   5711 H H    . THR A 1 49 ? -2.012  -5.125  8.468   1.00 0.00 ? 49 THR A H    8 
ATOM   5712 H HA   . THR A 1 49 ? -0.483  -2.766  9.019   1.00 0.00 ? 49 THR A HA   8 
ATOM   5713 H HB   . THR A 1 49 ? -1.187  -5.154  10.783  1.00 0.00 ? 49 THR A HB   8 
ATOM   5714 H HG1  . THR A 1 49 ? -2.991  -4.088  9.921   1.00 0.00 ? 49 THR A HG1  8 
ATOM   5715 H HG21 . THR A 1 49 ? -0.867  -3.604  12.658  1.00 0.00 ? 49 THR A HG21 8 
ATOM   5716 H HG22 . THR A 1 49 ? -0.354  -2.324  11.548  1.00 0.00 ? 49 THR A HG22 8 
ATOM   5717 H HG23 . THR A 1 49 ? 0.644   -3.775  11.755  1.00 0.00 ? 49 THR A HG23 8 
HETATM 5718 N N    . NH2 A 1 50 ? 1.866   -3.639  8.567   1.00 0.00 ? 50 NH2 A N    8 
HETATM 5719 H HN1  . NH2 A 1 50 ? 1.633   -2.710  8.245   1.00 0.00 ? 50 NH2 A HN1  8 
HETATM 5720 H HN2  . NH2 A 1 50 ? 2.815   -3.978  8.494   1.00 0.00 ? 50 NH2 A HN2  8 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLU 1  1  1  GLU GLU A . n 
A 1 2  CYS 2  2  2  CYS CYS A . n 
A 1 3  GLU 3  3  3  GLU GLU A . n 
A 1 4  SER 4  4  4  SER SER A . n 
A 1 5  GLY 5  5  5  GLY GLY A . n 
A 1 6  PRO 6  6  6  PRO PRO A . n 
A 1 7  CYS 7  7  7  CYS CYS A . n 
A 1 8  CYS 8  8  8  CYS CYS A . n 
A 1 9  ARG 9  9  9  ARG ARG A . n 
A 1 10 ASN 10 10 10 ASN ASN A . n 
A 1 11 CYS 11 11 11 CYS CYS A . n 
A 1 12 LYS 12 12 12 LYS LYS A . n 
A 1 13 PHE 13 13 13 PHE PHE A . n 
A 1 14 LEU 14 14 14 LEU LEU A . n 
A 1 15 LYS 15 15 15 LYS LYS A . n 
A 1 16 GLU 16 16 16 GLU GLU A . n 
A 1 17 GLY 17 17 17 GLY GLY A . n 
A 1 18 THR 18 18 18 THR THR A . n 
A 1 19 ILE 19 19 19 ILE ILE A . n 
A 1 20 CYS 20 20 20 CYS CYS A . n 
A 1 21 LYS 21 21 21 LYS LYS A . n 
A 1 22 ARG 22 22 22 ARG ARG A . n 
A 1 23 ALA 23 23 23 ALA ALA A . n 
A 1 24 ARG 24 24 24 ARG ARG A . n 
A 1 25 GLY 25 25 25 GLY GLY A . n 
A 1 26 ASP 26 26 26 ASP ASP A . n 
A 1 27 ASP 27 27 27 ASP ASP A . n 
A 1 28 MET 28 28 28 MET MET A . n 
A 1 29 ASP 29 29 29 ASP ASP A . n 
A 1 30 ASP 30 30 30 ASP ASP A . n 
A 1 31 TYR 31 31 31 TYR TYR A . n 
A 1 32 CYS 32 32 32 CYS CYS A . n 
A 1 33 ASN 33 33 33 ASN ASN A . n 
A 1 34 GLY 34 34 34 GLY GLY A . n 
A 1 35 LYS 35 35 35 LYS LYS A . n 
A 1 36 THR 36 36 36 THR THR A . n 
A 1 37 CYS 37 37 37 CYS CYS A . n 
A 1 38 ASP 38 38 38 ASP ASP A . n 
A 1 39 CYS 39 39 39 CYS CYS A . n 
A 1 40 PRO 40 40 40 PRO PRO A . n 
A 1 41 ARG 41 41 41 ARG ARG A . n 
A 1 42 ASN 42 42 42 ASN ASN A . n 
A 1 43 PRO 43 43 43 PRO PRO A . n 
A 1 44 HIS 44 44 44 HIS HIS A . n 
A 1 45 LYS 45 45 45 LYS LYS A . n 
A 1 46 GLY 46 46 46 GLY GLY A . n 
A 1 47 PRO 47 47 47 PRO PRO A . n 
A 1 48 ALA 48 48 48 ALA ALA A . n 
A 1 49 THR 49 49 49 THR THR A . n 
A 1 50 NH2 50 50 50 NH2 NH2 A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1993-10-31 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status  
2 4 'Structure model' pdbx_struct_assembly  
3 4 'Structure model' pdbx_struct_oper_list 
4 4 'Structure model' struct_conf           
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_database_status.process_site' 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              2 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             GLY 
_pdbx_validate_rmsd_angle.auth_seq_id_1              5 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              6 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              6 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                130.31 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            11.01 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 PRO A 6  ? ? -57.11  14.61   
2   1 CYS A 7  ? ? -58.64  -6.21   
3   1 ARG A 9  ? ? -77.67  -84.23  
4   1 CYS A 11 ? ? -150.78 -26.98  
5   1 GLU A 16 ? ? 0.16    91.26   
6   1 ASP A 29 ? ? 68.80   -169.11 
7   1 ASP A 30 ? ? -156.44 75.60   
8   1 ASP A 38 ? ? -98.50  40.19   
9   1 PRO A 43 ? ? -50.47  -80.59  
10  1 HIS A 44 ? ? 33.27   54.76   
11  2 PRO A 6  ? ? -28.58  73.48   
12  2 CYS A 7  ? ? -171.28 -61.24  
13  2 ARG A 9  ? ? -22.35  -73.18  
14  2 CYS A 11 ? ? 174.47  -35.97  
15  2 PHE A 13 ? ? -52.47  109.01  
16  2 LEU A 14 ? ? -73.80  -163.54 
17  2 GLU A 16 ? ? 0.10    113.33  
18  2 LYS A 21 ? ? -146.93 -151.60 
19  2 ARG A 22 ? ? 82.11   -68.37  
20  2 ASP A 26 ? ? -136.17 -86.17  
21  2 ASP A 27 ? ? -86.87  -124.64 
22  2 ASP A 29 ? ? -120.22 -165.75 
23  2 CYS A 39 ? ? 19.42   67.22   
24  3 ARG A 9  ? ? -21.06  -72.85  
25  3 CYS A 11 ? ? 152.28  -43.33  
26  3 PHE A 13 ? ? -42.14  107.00  
27  3 LEU A 14 ? ? -70.75  -157.67 
28  3 LYS A 15 ? ? -69.81  80.99   
29  3 GLU A 16 ? ? -23.26  111.96  
30  3 ALA A 23 ? ? 59.84   173.09  
31  3 ASP A 29 ? ? 90.66   142.14  
32  3 ASP A 30 ? ? -158.79 87.25   
33  3 ASP A 38 ? ? -85.14  49.15   
34  3 CYS A 39 ? ? 34.12   58.90   
35  3 PRO A 43 ? ? -60.02  98.92   
36  4 CYS A 7  ? ? -68.82  17.77   
37  4 ARG A 9  ? ? -65.10  95.56   
38  4 ASN A 10 ? ? 25.62   64.85   
39  4 CYS A 11 ? ? 105.19  -32.20  
40  4 PHE A 13 ? ? -21.61  115.73  
41  4 LYS A 15 ? ? -86.56  41.25   
42  4 GLU A 16 ? ? 35.15   78.13   
43  4 LYS A 21 ? ? -72.11  -104.97 
44  4 ARG A 22 ? ? -169.12 -52.72  
45  4 ALA A 23 ? ? -36.42  111.44  
46  4 ASP A 26 ? ? -71.48  -83.71  
47  4 ASP A 27 ? ? -113.17 59.27   
48  4 MET A 28 ? ? -122.08 -51.57  
49  4 ASP A 30 ? ? -164.00 96.38   
50  4 ASP A 38 ? ? -109.57 61.59   
51  4 CYS A 39 ? ? 14.50   74.79   
52  4 ARG A 41 ? ? -77.25  48.07   
53  4 ASN A 42 ? ? 67.66   93.20   
54  4 PRO A 43 ? ? -48.16  87.13   
55  4 LYS A 45 ? ? 63.58   178.32  
56  4 ALA A 48 ? ? 75.38   -56.88  
57  5 ARG A 9  ? ? -16.59  -72.36  
58  5 CYS A 11 ? ? 172.95  -30.65  
59  5 LEU A 14 ? ? -71.93  -158.37 
60  5 GLU A 16 ? ? -20.71  120.89  
61  5 MET A 28 ? ? 75.64   -32.67  
62  5 CYS A 37 ? ? -140.26 53.96   
63  5 ASP A 38 ? ? -92.51  43.09   
64  5 CYS A 39 ? ? 36.70   63.79   
65  5 HIS A 44 ? ? -156.12 29.85   
66  6 PRO A 6  ? ? -48.97  -12.73  
67  6 ARG A 9  ? ? -11.09  -79.15  
68  6 CYS A 11 ? ? 163.23  -33.12  
69  6 LEU A 14 ? ? -75.04  -165.88 
70  6 GLU A 16 ? ? 61.23   132.01  
71  6 LYS A 21 ? ? -78.72  -86.83  
72  6 ARG A 22 ? ? 105.36  125.31  
73  6 ALA A 23 ? ? -136.12 -118.25 
74  6 ASP A 30 ? ? -165.76 106.13  
75  6 CYS A 39 ? ? 19.31   68.87   
76  6 ASN A 42 ? ? 50.89   100.29  
77  7 SER A 4  ? ? 77.24   99.02   
78  7 ARG A 9  ? ? -52.81  101.03  
79  7 ASN A 10 ? ? 65.61   -58.15  
80  7 CYS A 11 ? ? -156.54 24.21   
81  7 PHE A 13 ? ? -15.08  108.64  
82  7 LYS A 15 ? ? -90.90  49.08   
83  7 GLU A 16 ? ? 39.98   85.42   
84  7 CYS A 20 ? ? -86.69  -70.37  
85  7 ARG A 22 ? ? 76.29   80.10   
86  7 ASP A 26 ? ? -83.44  -76.51  
87  7 ASP A 27 ? ? -144.54 -121.79 
88  7 ASP A 29 ? ? 75.75   148.25  
89  7 CYS A 39 ? ? 5.26    73.17   
90  7 ASN A 42 ? ? 54.36   96.98   
91  7 LYS A 45 ? ? -97.21  -78.58  
92  8 SER A 4  ? ? -177.69 122.22  
93  8 ARG A 9  ? ? -51.96  97.27   
94  8 ASN A 10 ? ? 64.79   -60.24  
95  8 PHE A 13 ? ? -17.82  104.80  
96  8 LEU A 14 ? ? -71.03  -168.43 
97  8 LYS A 15 ? ? -69.62  77.53   
98  8 GLU A 16 ? ? -17.39  113.18  
99  8 ASP A 27 ? ? -111.30 -139.95 
100 8 ASP A 29 ? ? 79.59   162.21  
101 8 ASP A 38 ? ? -98.79  45.05   
102 8 CYS A 39 ? ? 17.41   70.30   
103 8 ASN A 42 ? ? 31.57   88.56   
104 8 PRO A 43 ? ? -55.03  81.50   
105 8 ALA A 48 ? ? 71.95   -30.37  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 PRO A 6  ? ? CYS A 7  ? ? 132.51  
2 2 CYS A 7  ? ? CYS A 8  ? ? 145.60  
3 2 MET A 28 ? ? ASP A 29 ? ? -147.60 
4 3 CYS A 32 ? ? ASN A 33 ? ? -149.33 
5 4 CYS A 8  ? ? ARG A 9  ? ? -149.18 
6 5 ASP A 29 ? ? ASP A 30 ? ? -144.91 
7 7 CYS A 8  ? ? ARG A 9  ? ? -149.46 
8 8 CYS A 8  ? ? ARG A 9  ? ? -130.26 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 4 HIS A 44 ? ? 0.081 'SIDE CHAIN' 
2 5 HIS A 44 ? ? 0.087 'SIDE CHAIN' 
#