data_2EF1
# 
_entry.id   2EF1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2EF1         
RCSB  RCSB026584   
WWPDB D_1000026584 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2007-02-27 
_pdbx_database_PDB_obs_spr.pdb_id           2EF1 
_pdbx_database_PDB_obs_spr.replace_pdb_id   2DF1 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          srz001000050.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2EF1 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-20 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kukimoto-Niino, M.'                                     1 
'Nureki, O.'                                             2 
'Murayama, K.'                                           3 
'Shirouzu, M.'                                           4 
'Katada, T.'                                             5 
'Hara-Yokoyama, M.'                                      6 
'Yokoyama, S.'                                           7 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the extracellular domain of human CD38' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kukimoto-Niino, M.' 1 
primary 'Nureki, O.'         2 
primary 'Murayama, K.'       3 
primary 'Shirouzu, M.'       4 
primary 'Katada, T.'         5 
primary 'Hara-Yokoyama, M.'  6 
primary 'Yokoyama, S.'       7 
# 
_cell.entry_id           2EF1 
_cell.length_a           57.593 
_cell.length_b           51.164 
_cell.length_c           101.135 
_cell.angle_alpha        90.00 
_cell.angle_beta         97.53 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2EF1 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ADP-ribosyl cyclase 1'                               29689.703 2   3.2.2.5 ? 'extracellular domain' ? 
2 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' 238.305   2   ?       ? ?                      ? 
3 water       nat water                                                 18.015    182 ?       ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Cyclic ADP-ribose hydrolase 1, cADPr hydrolase 1, Lymphocyte differentiation antigen CD38, T10, Acute lymphoblastic leukemia cells antigen CD38
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCNKILL
WSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVV
HVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKF
LQCVKNPEDSSCTSEI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCNKILL
WSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVV
HVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKF
LQCVKNPEDSSCTSEI
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         srz001000050.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   TRP n 
1 3   ARG n 
1 4   GLN n 
1 5   THR n 
1 6   TRP n 
1 7   SER n 
1 8   GLY n 
1 9   PRO n 
1 10  GLY n 
1 11  THR n 
1 12  THR n 
1 13  LYS n 
1 14  ARG n 
1 15  PHE n 
1 16  PRO n 
1 17  GLU n 
1 18  THR n 
1 19  VAL n 
1 20  LEU n 
1 21  ALA n 
1 22  ARG n 
1 23  CYS n 
1 24  VAL n 
1 25  LYS n 
1 26  TYR n 
1 27  THR n 
1 28  GLU n 
1 29  ILE n 
1 30  HIS n 
1 31  PRO n 
1 32  GLU n 
1 33  MET n 
1 34  ARG n 
1 35  HIS n 
1 36  VAL n 
1 37  ASP n 
1 38  CYS n 
1 39  GLN n 
1 40  SER n 
1 41  VAL n 
1 42  TRP n 
1 43  ASP n 
1 44  ALA n 
1 45  PHE n 
1 46  LYS n 
1 47  GLY n 
1 48  ALA n 
1 49  PHE n 
1 50  ILE n 
1 51  SER n 
1 52  LYS n 
1 53  HIS n 
1 54  PRO n 
1 55  CYS n 
1 56  ASN n 
1 57  ILE n 
1 58  THR n 
1 59  GLU n 
1 60  GLU n 
1 61  ASP n 
1 62  TYR n 
1 63  GLN n 
1 64  PRO n 
1 65  LEU n 
1 66  MET n 
1 67  LYS n 
1 68  LEU n 
1 69  GLY n 
1 70  THR n 
1 71  GLN n 
1 72  THR n 
1 73  VAL n 
1 74  PRO n 
1 75  CYS n 
1 76  ASN n 
1 77  LYS n 
1 78  ILE n 
1 79  LEU n 
1 80  LEU n 
1 81  TRP n 
1 82  SER n 
1 83  ARG n 
1 84  ILE n 
1 85  LYS n 
1 86  ASP n 
1 87  LEU n 
1 88  ALA n 
1 89  HIS n 
1 90  GLN n 
1 91  PHE n 
1 92  THR n 
1 93  GLN n 
1 94  VAL n 
1 95  GLN n 
1 96  ARG n 
1 97  ASP n 
1 98  MET n 
1 99  PHE n 
1 100 THR n 
1 101 LEU n 
1 102 GLU n 
1 103 ASP n 
1 104 THR n 
1 105 LEU n 
1 106 LEU n 
1 107 GLY n 
1 108 TYR n 
1 109 LEU n 
1 110 ALA n 
1 111 ASP n 
1 112 ASP n 
1 113 LEU n 
1 114 THR n 
1 115 TRP n 
1 116 CYS n 
1 117 GLY n 
1 118 GLU n 
1 119 PHE n 
1 120 ASN n 
1 121 THR n 
1 122 SER n 
1 123 LYS n 
1 124 ILE n 
1 125 ASN n 
1 126 TYR n 
1 127 GLN n 
1 128 SER n 
1 129 CYS n 
1 130 PRO n 
1 131 ASP n 
1 132 TRP n 
1 133 ARG n 
1 134 LYS n 
1 135 ASP n 
1 136 CYS n 
1 137 SER n 
1 138 ASN n 
1 139 ASN n 
1 140 PRO n 
1 141 VAL n 
1 142 SER n 
1 143 VAL n 
1 144 PHE n 
1 145 TRP n 
1 146 LYS n 
1 147 THR n 
1 148 VAL n 
1 149 SER n 
1 150 ARG n 
1 151 ARG n 
1 152 PHE n 
1 153 ALA n 
1 154 GLU n 
1 155 ALA n 
1 156 ALA n 
1 157 CYS n 
1 158 ASP n 
1 159 VAL n 
1 160 VAL n 
1 161 HIS n 
1 162 VAL n 
1 163 MET n 
1 164 LEU n 
1 165 ASN n 
1 166 GLY n 
1 167 SER n 
1 168 ARG n 
1 169 SER n 
1 170 LYS n 
1 171 ILE n 
1 172 PHE n 
1 173 ASP n 
1 174 LYS n 
1 175 ASN n 
1 176 SER n 
1 177 THR n 
1 178 PHE n 
1 179 GLY n 
1 180 SER n 
1 181 VAL n 
1 182 GLU n 
1 183 VAL n 
1 184 HIS n 
1 185 ASN n 
1 186 LEU n 
1 187 GLN n 
1 188 PRO n 
1 189 GLU n 
1 190 LYS n 
1 191 VAL n 
1 192 GLN n 
1 193 THR n 
1 194 LEU n 
1 195 GLU n 
1 196 ALA n 
1 197 TRP n 
1 198 VAL n 
1 199 ILE n 
1 200 HIS n 
1 201 GLY n 
1 202 GLY n 
1 203 ARG n 
1 204 GLU n 
1 205 ASP n 
1 206 SER n 
1 207 ARG n 
1 208 ASP n 
1 209 LEU n 
1 210 CYS n 
1 211 GLN n 
1 212 ASP n 
1 213 PRO n 
1 214 THR n 
1 215 ILE n 
1 216 LYS n 
1 217 GLU n 
1 218 LEU n 
1 219 GLU n 
1 220 SER n 
1 221 ILE n 
1 222 ILE n 
1 223 SER n 
1 224 LYS n 
1 225 ARG n 
1 226 ASN n 
1 227 ILE n 
1 228 GLN n 
1 229 PHE n 
1 230 SER n 
1 231 CYS n 
1 232 LYS n 
1 233 ASN n 
1 234 ILE n 
1 235 TYR n 
1 236 ARG n 
1 237 PRO n 
1 238 ASP n 
1 239 LYS n 
1 240 PHE n 
1 241 LEU n 
1 242 GLN n 
1 243 CYS n 
1 244 VAL n 
1 245 LYS n 
1 246 ASN n 
1 247 PRO n 
1 248 GLU n 
1 249 ASP n 
1 250 SER n 
1 251 SER n 
1 252 CYS n 
1 253 THR n 
1 254 SER n 
1 255 GLU n 
1 256 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 CD38 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'JM109(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pMAL-CR1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CD38_HUMAN 
_struct_ref.pdbx_db_accession          P28907 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCNKILL
WSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVV
HVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKF
LQCVKNPEDSSCTSEI
;
_struct_ref.pdbx_align_begin           45 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2EF1 A 1 ? 256 ? P28907 45 ? 300 ? 45 300 
2 1 2EF1 B 1 ? 256 ? P28907 45 ? 300 ? 45 300 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2EF1 THR A 5 ? UNP P28907 GLN 49 'SEE REMARK 999' 49 1 
2 2EF1 THR B 5 ? UNP P28907 GLN 49 'SEE REMARK 999' 49 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                               ?     'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                              ?     'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                            ?     'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                       ?     'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                              ?     'C3 H7 N O2 S'   121.158 
EPE non-polymer         . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES 'C8 H18 N2 O4 S' 238.305 
GLN 'L-peptide linking' y GLUTAMINE                                             ?     'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                       ?     'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                               ?     'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                             ?     'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                 ?     'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                            ?     'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                               ?     'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                ?     'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                            ?     'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                         ?     'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                               ?     'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                ?     'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                             ?     'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                            ?     'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                              ?     'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                ?     'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2EF1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.49 
_exptl_crystal.density_percent_sol   50.54 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'20% PEG 10000, 0.1M HEPES, 0.1M SODIUM IODIDE, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-02-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL44B2' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL44B2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     2EF1 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   21501 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.06 
_reflns.pdbx_netI_over_sigmaI        17.9641 
_reflns.B_iso_Wilson_estimate        26.5 
_reflns.pdbx_redundancy              3.08246 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   81.4 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.194 
_reflns_shell.meanI_over_sigI_obs    4.62687 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2EF1 
_refine.ls_number_reflns_obs                     21492 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1217355.38 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.57 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    93.2 
_refine.ls_R_factor_obs                          0.203 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.203 
_refine.ls_R_factor_R_free                       0.256 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.9 
_refine.ls_number_reflns_R_free                  2133 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               38.7 
_refine.aniso_B[1][1]                            10.36 
_refine.aniso_B[2][2]                            -13.11 
_refine.aniso_B[3][3]                            2.75 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -2.31 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.312435 
_refine.solvent_model_param_bsol                 27.735 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1YH3' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2EF1 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             0.25 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.37 
_refine_analyze.Luzzati_sigma_a_free            0.41 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3973 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             182 
_refine_hist.number_atoms_total               4185 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        45.57 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.2   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 21.6  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.76  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.55 
_refine_ls_shell.number_reflns_R_work             2674 
_refine_ls_shell.R_factor_R_work                  0.255 
_refine_ls_shell.percent_reflns_obs               77.4 
_refine_ls_shell.R_factor_R_free                  0.361 
_refine_ls_shell.R_factor_R_free_error            0.021 
_refine_ls_shell.percent_reflns_R_free            9.8 
_refine_ls_shell.number_reflns_R_free             290 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top       'X-RAY DIFFRACTION' 
2 water_rep.param   water.top         'X-RAY DIFFRACTION' 
3 epe_xplor_par.txt epe_xplor_top.txt 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2EF1 
_struct.title                     'Crystal structure of the extracellular domain of human CD38' 
_struct.pdbx_descriptor           'ADP-ribosyl cyclase 1 (E.C.3.2.2.5)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2EF1 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;Hydrolase, Cell sueface antigen, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 14  ? HIS A 30  ? ARG A 58  HIS A 74  1 ? 17 
HELX_P HELX_P2  2  PRO A 31  ? ARG A 34  ? PRO A 75  ARG A 78  5 ? 4  
HELX_P HELX_P3  3  ASP A 37  ? ILE A 50  ? ASP A 81  ILE A 94  1 ? 14 
HELX_P HELX_P4  4  THR A 58  ? GLY A 69  ? THR A 102 GLY A 113 1 ? 12 
HELX_P HELX_P5  5  PRO A 74  ? LYS A 77  ? PRO A 118 LYS A 121 5 ? 4  
HELX_P HELX_P6  6  ILE A 84  ? GLN A 95  ? ILE A 128 GLN A 139 1 ? 12 
HELX_P HELX_P7  7  THR A 100 ? ASP A 103 ? THR A 144 ASP A 147 5 ? 4  
HELX_P HELX_P8  8  THR A 104 ? ASP A 111 ? THR A 148 ASP A 155 1 ? 8  
HELX_P HELX_P9  9  ASN A 139 ? ALA A 156 ? ASN A 183 ALA A 200 1 ? 18 
HELX_P HELX_P10 10 SER A 176 ? VAL A 181 ? SER A 220 VAL A 225 1 ? 6  
HELX_P HELX_P11 11 GLU A 182 ? LEU A 186 ? GLU A 226 LEU A 230 5 ? 5  
HELX_P HELX_P12 12 ASP A 208 ? GLN A 211 ? ASP A 252 GLN A 255 5 ? 4  
HELX_P HELX_P13 13 ASP A 212 ? ARG A 225 ? ASP A 256 ARG A 269 1 ? 14 
HELX_P HELX_P14 14 ARG A 236 ? ASN A 246 ? ARG A 280 ASN A 290 1 ? 11 
HELX_P HELX_P15 15 ARG B 14  ? HIS B 30  ? ARG B 58  HIS B 74  1 ? 17 
HELX_P HELX_P16 16 PRO B 31  ? ARG B 34  ? PRO B 75  ARG B 78  5 ? 4  
HELX_P HELX_P17 17 ASP B 37  ? ILE B 50  ? ASP B 81  ILE B 94  1 ? 14 
HELX_P HELX_P18 18 THR B 58  ? ASP B 61  ? THR B 102 ASP B 105 5 ? 4  
HELX_P HELX_P19 19 TYR B 62  ? GLY B 69  ? TYR B 106 GLY B 113 1 ? 8  
HELX_P HELX_P20 20 ILE B 84  ? GLN B 95  ? ILE B 128 GLN B 139 1 ? 12 
HELX_P HELX_P21 21 THR B 100 ? ASP B 103 ? THR B 144 ASP B 147 5 ? 4  
HELX_P HELX_P22 22 THR B 104 ? ASP B 111 ? THR B 148 ASP B 155 1 ? 8  
HELX_P HELX_P23 23 ASN B 139 ? ALA B 155 ? ASN B 183 ALA B 199 1 ? 17 
HELX_P HELX_P24 24 SER B 176 ? VAL B 181 ? SER B 220 VAL B 225 1 ? 6  
HELX_P HELX_P25 25 VAL B 181 ? LEU B 186 ? VAL B 225 LEU B 230 1 ? 6  
HELX_P HELX_P26 26 ASP B 208 ? GLN B 211 ? ASP B 252 GLN B 255 5 ? 4  
HELX_P HELX_P27 27 ASP B 212 ? ARG B 225 ? ASP B 256 ARG B 269 1 ? 14 
HELX_P HELX_P28 28 ARG B 236 ? LYS B 245 ? ARG B 280 LYS B 289 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 23  SG ? ? ? 1_555 A CYS 38  SG ? ? A CYS 67  A CYS 82  1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf2  disulf ? ? A CYS 55  SG ? ? ? 1_555 A CYS 136 SG ? ? A CYS 99  A CYS 180 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf3  disulf ? ? A CYS 75  SG ? ? ? 1_555 A CYS 157 SG ? ? A CYS 119 A CYS 201 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf4  disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 129 SG ? ? A CYS 160 A CYS 173 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf5  disulf ? ? A CYS 210 SG ? ? ? 1_555 A CYS 231 SG ? ? A CYS 254 A CYS 275 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf6  disulf ? ? B CYS 23  SG ? ? ? 1_555 B CYS 38  SG ? ? B CYS 67  B CYS 82  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf7  disulf ? ? B CYS 55  SG ? ? ? 1_555 B CYS 136 SG ? ? B CYS 99  B CYS 180 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf8  disulf ? ? B CYS 75  SG ? ? ? 1_555 B CYS 157 SG ? ? B CYS 119 B CYS 201 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf9  disulf ? ? B CYS 116 SG ? ? ? 1_555 B CYS 129 SG ? ? B CYS 160 B CYS 173 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf10 disulf ? ? B CYS 210 SG ? ? ? 1_555 B CYS 231 SG ? ? B CYS 254 B CYS 275 1_555 ? ? ? ? ? ? ? 2.030 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
C ? 2 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 8   ? PRO A 9   ? GLY A 52  PRO A 53  
A 2 SER A 128 ? CYS A 129 ? SER A 172 CYS A 173 
B 1 LEU A 79  ? SER A 82  ? LEU A 123 SER A 126 
B 2 ASP A 158 ? ASN A 165 ? ASP A 202 ASN A 209 
B 3 VAL A 191 ? ILE A 199 ? VAL A 235 ILE A 243 
B 4 GLN A 228 ? ILE A 234 ? GLN A 272 ILE A 278 
C 1 GLY B 8   ? PRO B 9   ? GLY B 52  PRO B 53  
C 2 SER B 128 ? CYS B 129 ? SER B 172 CYS B 173 
D 1 LEU B 79  ? SER B 82  ? LEU B 123 SER B 126 
D 2 ASP B 158 ? ASN B 165 ? ASP B 202 ASN B 209 
D 3 VAL B 191 ? ILE B 199 ? VAL B 235 ILE B 243 
D 4 GLN B 228 ? ILE B 234 ? GLN B 272 ILE B 278 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 8   ? N GLY A 52  O CYS A 129 ? O CYS A 173 
B 1 2 N LEU A 80  ? N LEU A 124 O HIS A 161 ? O HIS A 205 
B 2 3 N LEU A 164 ? N LEU A 208 O TRP A 197 ? O TRP A 241 
B 3 4 N ALA A 196 ? N ALA A 240 O SER A 230 ? O SER A 274 
C 1 2 N GLY B 8   ? N GLY B 52  O CYS B 129 ? O CYS B 173 
D 1 2 N LEU B 80  ? N LEU B 124 O HIS B 161 ? O HIS B 205 
D 2 3 N LEU B 164 ? N LEU B 208 O TRP B 197 ? O TRP B 241 
D 3 4 N ALA B 196 ? N ALA B 240 O SER B 230 ? O SER B 274 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE EPE A 301' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE EPE B 302' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 ARG A 83  ? ARG A 127 . ? 1_555 ? 
2  AC1 7 LEU A 113 ? LEU A 157 . ? 1_555 ? 
3  AC1 7 THR A 114 ? THR A 158 . ? 1_555 ? 
4  AC1 7 SER A 176 ? SER A 220 . ? 1_555 ? 
5  AC1 7 THR A 177 ? THR A 221 . ? 1_555 ? 
6  AC1 7 HOH E .   ? HOH A 345 . ? 1_555 ? 
7  AC1 7 HOH E .   ? HOH A 355 . ? 1_555 ? 
8  AC2 6 ARG B 83  ? ARG B 127 . ? 1_555 ? 
9  AC2 6 LEU B 113 ? LEU B 157 . ? 1_555 ? 
10 AC2 6 SER B 176 ? SER B 220 . ? 1_555 ? 
11 AC2 6 THR B 177 ? THR B 221 . ? 1_555 ? 
12 AC2 6 HOH F .   ? HOH B 340 . ? 1_555 ? 
13 AC2 6 HOH F .   ? HOH B 347 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2EF1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2EF1 
_atom_sites.fract_transf_matrix[1][1]   0.017363 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002294 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019545 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009974 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 1   ? -11.678 36.465  45.191  1.00 72.85  ? 45  ARG A N   1 
ATOM   2    C CA  . ARG A 1 1   ? -11.535 37.358  46.378  1.00 70.70  ? 45  ARG A CA  1 
ATOM   3    C C   . ARG A 1 1   ? -11.817 36.591  47.660  1.00 69.29  ? 45  ARG A C   1 
ATOM   4    O O   . ARG A 1 1   ? -12.070 37.185  48.710  1.00 66.45  ? 45  ARG A O   1 
ATOM   5    C CB  . ARG A 1 1   ? -12.508 38.532  46.287  1.00 72.39  ? 45  ARG A CB  1 
ATOM   6    C CG  . ARG A 1 1   ? -13.973 38.124  46.296  1.00 74.65  ? 45  ARG A CG  1 
ATOM   7    C CD  . ARG A 1 1   ? -14.792 39.060  47.172  1.00 71.90  ? 45  ARG A CD  1 
ATOM   8    N NE  . ARG A 1 1   ? -16.222 38.957  46.896  1.00 70.79  ? 45  ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 1   ? -17.161 39.619  47.565  1.00 69.34  ? 45  ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 1   ? -16.825 40.435  48.557  1.00 67.67  ? 45  ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 1   ? -18.436 39.472  47.234  1.00 66.46  ? 45  ARG A NH2 1 
ATOM   12   N N   . TRP A 1 2   ? -11.781 35.267  47.566  1.00 67.18  ? 46  TRP A N   1 
ATOM   13   C CA  . TRP A 1 2   ? -12.039 34.417  48.719  1.00 64.00  ? 46  TRP A CA  1 
ATOM   14   C C   . TRP A 1 2   ? -10.852 33.494  48.990  1.00 60.23  ? 46  TRP A C   1 
ATOM   15   O O   . TRP A 1 2   ? -10.991 32.452  49.632  1.00 61.42  ? 46  TRP A O   1 
ATOM   16   C CB  . TRP A 1 2   ? -13.308 33.593  48.481  1.00 60.03  ? 46  TRP A CB  1 
ATOM   17   C CG  . TRP A 1 2   ? -14.578 34.404  48.505  1.00 54.12  ? 46  TRP A CG  1 
ATOM   18   C CD1 . TRP A 1 2   ? -15.145 35.007  49.592  1.00 51.46  ? 46  TRP A CD1 1 
ATOM   19   C CD2 . TRP A 1 2   ? -15.449 34.673  47.398  1.00 50.99  ? 46  TRP A CD2 1 
ATOM   20   N NE1 . TRP A 1 2   ? -16.318 35.631  49.232  1.00 47.42  ? 46  TRP A NE1 1 
ATOM   21   C CE2 . TRP A 1 2   ? -16.528 35.442  47.892  1.00 47.61  ? 46  TRP A CE2 1 
ATOM   22   C CE3 . TRP A 1 2   ? -15.422 34.337  46.035  1.00 46.09  ? 46  TRP A CE3 1 
ATOM   23   C CZ2 . TRP A 1 2   ? -17.573 35.882  47.073  1.00 47.24  ? 46  TRP A CZ2 1 
ATOM   24   C CZ3 . TRP A 1 2   ? -16.459 34.771  45.220  1.00 51.79  ? 46  TRP A CZ3 1 
ATOM   25   C CH2 . TRP A 1 2   ? -17.523 35.537  45.744  1.00 57.16  ? 46  TRP A CH2 1 
ATOM   26   N N   . ARG A 1 3   ? -9.683  33.892  48.503  1.00 52.19  ? 47  ARG A N   1 
ATOM   27   C CA  . ARG A 1 3   ? -8.476  33.105  48.689  1.00 55.80  ? 47  ARG A CA  1 
ATOM   28   C C   . ARG A 1 3   ? -8.066  32.996  50.154  1.00 56.94  ? 47  ARG A C   1 
ATOM   29   O O   . ARG A 1 3   ? -7.840  34.007  50.819  1.00 57.98  ? 47  ARG A O   1 
ATOM   30   C CB  . ARG A 1 3   ? -7.319  33.717  47.895  1.00 54.08  ? 47  ARG A CB  1 
ATOM   31   C CG  . ARG A 1 3   ? -5.984  33.030  48.131  1.00 54.95  ? 47  ARG A CG  1 
ATOM   32   C CD  . ARG A 1 3   ? -4.876  33.651  47.297  1.00 59.09  ? 47  ARG A CD  1 
ATOM   33   N NE  . ARG A 1 3   ? -5.098  33.463  45.866  1.00 60.15  ? 47  ARG A NE  1 
ATOM   34   C CZ  . ARG A 1 3   ? -4.223  33.800  44.923  1.00 61.62  ? 47  ARG A CZ  1 
ATOM   35   N NH1 . ARG A 1 3   ? -3.060  34.345  45.259  1.00 61.18  ? 47  ARG A NH1 1 
ATOM   36   N NH2 . ARG A 1 3   ? -4.504  33.583  43.644  1.00 59.96  ? 47  ARG A NH2 1 
ATOM   37   N N   . GLN A 1 4   ? -7.974  31.764  50.650  1.00 57.60  ? 48  GLN A N   1 
ATOM   38   C CA  . GLN A 1 4   ? -7.549  31.517  52.027  1.00 54.44  ? 48  GLN A CA  1 
ATOM   39   C C   . GLN A 1 4   ? -6.026  31.509  51.987  1.00 55.19  ? 48  GLN A C   1 
ATOM   40   O O   . GLN A 1 4   ? -5.433  31.188  50.954  1.00 54.56  ? 48  GLN A O   1 
ATOM   41   C CB  . GLN A 1 4   ? -8.002  30.134  52.507  1.00 50.22  ? 48  GLN A CB  1 
ATOM   42   C CG  . GLN A 1 4   ? -9.488  29.851  52.422  1.00 55.12  ? 48  GLN A CG  1 
ATOM   43   C CD  . GLN A 1 4   ? -9.809  28.371  52.599  1.00 46.28  ? 48  GLN A CD  1 
ATOM   44   O OE1 . GLN A 1 4   ? -9.371  27.736  53.562  1.00 43.10  ? 48  GLN A OE1 1 
ATOM   45   N NE2 . GLN A 1 4   ? -10.576 27.816  51.666  1.00 36.81  ? 48  GLN A NE2 1 
ATOM   46   N N   . THR A 1 5   ? -5.382  31.874  53.087  1.00 51.61  ? 49  THR A N   1 
ATOM   47   C CA  . THR A 1 5   ? -3.931  31.812  53.099  1.00 49.97  ? 49  THR A CA  1 
ATOM   48   C C   . THR A 1 5   ? -3.634  30.423  53.654  1.00 47.09  ? 49  THR A C   1 
ATOM   49   O O   . THR A 1 5   ? -4.222  30.015  54.661  1.00 45.02  ? 49  THR A O   1 
ATOM   50   C CB  . THR A 1 5   ? -3.284  32.887  54.017  1.00 53.19  ? 49  THR A CB  1 
ATOM   51   O OG1 . THR A 1 5   ? -3.496  32.547  55.392  1.00 46.93  ? 49  THR A OG1 1 
ATOM   52   C CG2 . THR A 1 5   ? -3.879  34.265  53.731  1.00 53.14  ? 49  THR A CG2 1 
ATOM   53   N N   . TRP A 1 6   ? -2.757  29.684  52.981  1.00 43.25  ? 50  TRP A N   1 
ATOM   54   C CA  . TRP A 1 6   ? -2.395  28.347  53.433  1.00 36.29  ? 50  TRP A CA  1 
ATOM   55   C C   . TRP A 1 6   ? -1.084  28.419  54.205  1.00 36.93  ? 50  TRP A C   1 
ATOM   56   O O   . TRP A 1 6   ? -0.448  29.474  54.252  1.00 35.24  ? 50  TRP A O   1 
ATOM   57   C CB  . TRP A 1 6   ? -2.269  27.390  52.247  1.00 25.22  ? 50  TRP A CB  1 
ATOM   58   C CG  . TRP A 1 6   ? -3.517  27.295  51.415  1.00 29.24  ? 50  TRP A CG  1 
ATOM   59   C CD1 . TRP A 1 6   ? -3.710  27.815  50.166  1.00 30.09  ? 50  TRP A CD1 1 
ATOM   60   C CD2 . TRP A 1 6   ? -4.748  26.651  51.774  1.00 25.08  ? 50  TRP A CD2 1 
ATOM   61   N NE1 . TRP A 1 6   ? -4.981  27.533  49.725  1.00 30.13  ? 50  TRP A NE1 1 
ATOM   62   C CE2 . TRP A 1 6   ? -5.640  26.820  50.692  1.00 23.90  ? 50  TRP A CE2 1 
ATOM   63   C CE3 . TRP A 1 6   ? -5.183  25.949  52.905  1.00 25.08  ? 50  TRP A CE3 1 
ATOM   64   C CZ2 . TRP A 1 6   ? -6.943  26.312  50.704  1.00 20.48  ? 50  TRP A CZ2 1 
ATOM   65   C CZ3 . TRP A 1 6   ? -6.477  25.443  52.918  1.00 26.68  ? 50  TRP A CZ3 1 
ATOM   66   C CH2 . TRP A 1 6   ? -7.343  25.629  51.821  1.00 29.89  ? 50  TRP A CH2 1 
ATOM   67   N N   . SER A 1 7   ? -0.678  27.297  54.797  1.00 37.08  ? 51  SER A N   1 
ATOM   68   C CA  . SER A 1 7   ? 0.540   27.243  55.603  1.00 36.16  ? 51  SER A CA  1 
ATOM   69   C C   . SER A 1 7   ? 1.812   26.885  54.850  1.00 33.06  ? 51  SER A C   1 
ATOM   70   O O   . SER A 1 7   ? 2.909   27.129  55.341  1.00 35.69  ? 51  SER A O   1 
ATOM   71   C CB  . SER A 1 7   ? 0.353   26.252  56.756  1.00 39.04  ? 51  SER A CB  1 
ATOM   72   O OG  . SER A 1 7   ? -0.771  26.590  57.553  1.00 44.52  ? 51  SER A OG  1 
ATOM   73   N N   . GLY A 1 8   ? 1.675   26.305  53.663  1.00 33.76  ? 52  GLY A N   1 
ATOM   74   C CA  . GLY A 1 8   ? 2.851   25.927  52.900  1.00 24.36  ? 52  GLY A CA  1 
ATOM   75   C C   . GLY A 1 8   ? 3.299   26.969  51.889  1.00 30.33  ? 52  GLY A C   1 
ATOM   76   O O   . GLY A 1 8   ? 2.581   27.938  51.625  1.00 25.41  ? 52  GLY A O   1 
ATOM   77   N N   . PRO A 1 9   ? 4.498   26.802  51.307  1.00 23.52  ? 53  PRO A N   1 
ATOM   78   C CA  . PRO A 1 9   ? 4.986   27.764  50.319  1.00 18.70  ? 53  PRO A CA  1 
ATOM   79   C C   . PRO A 1 9   ? 4.076   27.783  49.094  1.00 24.35  ? 53  PRO A C   1 
ATOM   80   O O   . PRO A 1 9   ? 3.464   26.773  48.743  1.00 24.28  ? 53  PRO A O   1 
ATOM   81   C CB  . PRO A 1 9   ? 6.383   27.245  49.996  1.00 22.34  ? 53  PRO A CB  1 
ATOM   82   C CG  . PRO A 1 9   ? 6.252   25.772  50.206  1.00 31.72  ? 53  PRO A CG  1 
ATOM   83   C CD  . PRO A 1 9   ? 5.459   25.702  51.487  1.00 19.49  ? 53  PRO A CD  1 
ATOM   84   N N   . GLY A 1 10  ? 3.985   28.940  48.452  1.00 25.25  ? 54  GLY A N   1 
ATOM   85   C CA  . GLY A 1 10  ? 3.148   29.063  47.277  1.00 23.43  ? 54  GLY A CA  1 
ATOM   86   C C   . GLY A 1 10  ? 3.796   28.372  46.097  1.00 26.58  ? 54  GLY A C   1 
ATOM   87   O O   . GLY A 1 10  ? 4.888   27.819  46.226  1.00 27.98  ? 54  GLY A O   1 
ATOM   88   N N   . THR A 1 11  ? 3.128   28.410  44.948  1.00 15.22  ? 55  THR A N   1 
ATOM   89   C CA  . THR A 1 11  ? 3.627   27.777  43.741  1.00 15.98  ? 55  THR A CA  1 
ATOM   90   C C   . THR A 1 11  ? 4.992   28.318  43.327  1.00 21.64  ? 55  THR A C   1 
ATOM   91   O O   . THR A 1 11  ? 5.265   29.512  43.443  1.00 20.99  ? 55  THR A O   1 
ATOM   92   C CB  . THR A 1 11  ? 2.636   27.976  42.573  1.00 14.71  ? 55  THR A CB  1 
ATOM   93   O OG1 . THR A 1 11  ? 1.379   27.374  42.911  1.00 16.87  ? 55  THR A OG1 1 
ATOM   94   C CG2 . THR A 1 11  ? 3.171   27.352  41.297  1.00 9.87   ? 55  THR A CG2 1 
ATOM   95   N N   . THR A 1 12  ? 5.849   27.430  42.840  1.00 16.92  ? 56  THR A N   1 
ATOM   96   C CA  . THR A 1 12  ? 7.170   27.835  42.405  1.00 17.03  ? 56  THR A CA  1 
ATOM   97   C C   . THR A 1 12  ? 7.035   28.887  41.319  1.00 21.79  ? 56  THR A C   1 
ATOM   98   O O   . THR A 1 12  ? 6.308   28.696  40.345  1.00 20.55  ? 56  THR A O   1 
ATOM   99   C CB  . THR A 1 12  ? 7.949   26.662  41.818  1.00 20.53  ? 56  THR A CB  1 
ATOM   100  O OG1 . THR A 1 12  ? 7.919   25.560  42.732  1.00 20.98  ? 56  THR A OG1 1 
ATOM   101  C CG2 . THR A 1 12  ? 9.384   27.077  41.549  1.00 19.56  ? 56  THR A CG2 1 
ATOM   102  N N   . LYS A 1 13  ? 7.732   30.001  41.492  1.00 24.26  ? 57  LYS A N   1 
ATOM   103  C CA  . LYS A 1 13  ? 7.688   31.068  40.508  1.00 27.59  ? 57  LYS A CA  1 
ATOM   104  C C   . LYS A 1 13  ? 8.016   30.456  39.153  1.00 22.38  ? 57  LYS A C   1 
ATOM   105  O O   . LYS A 1 13  ? 8.840   29.545  39.061  1.00 20.45  ? 57  LYS A O   1 
ATOM   106  C CB  . LYS A 1 13  ? 8.723   32.139  40.848  1.00 36.55  ? 57  LYS A CB  1 
ATOM   107  C CG  . LYS A 1 13  ? 10.158  31.646  40.716  1.00 51.33  ? 57  LYS A CG  1 
ATOM   108  C CD  . LYS A 1 13  ? 11.168  32.622  41.296  1.00 61.77  ? 57  LYS A CD  1 
ATOM   109  C CE  . LYS A 1 13  ? 12.578  32.053  41.182  1.00 70.11  ? 57  LYS A CE  1 
ATOM   110  N NZ  . LYS A 1 13  ? 13.553  32.752  42.062  1.00 66.69  ? 57  LYS A NZ  1 
ATOM   111  N N   . ARG A 1 14  ? 7.347   30.937  38.113  1.00 19.79  ? 58  ARG A N   1 
ATOM   112  C CA  . ARG A 1 14  ? 7.585   30.453  36.762  1.00 22.25  ? 58  ARG A CA  1 
ATOM   113  C C   . ARG A 1 14  ? 7.280   28.964  36.582  1.00 20.67  ? 58  ARG A C   1 
ATOM   114  O O   . ARG A 1 14  ? 7.842   28.300  35.706  1.00 21.73  ? 58  ARG A O   1 
ATOM   115  C CB  . ARG A 1 14  ? 9.037   30.748  36.389  1.00 30.67  ? 58  ARG A CB  1 
ATOM   116  C CG  . ARG A 1 14  ? 9.368   32.234  36.420  1.00 31.96  ? 58  ARG A CG  1 
ATOM   117  C CD  . ARG A 1 14  ? 9.195   32.861  35.053  1.00 32.96  ? 58  ARG A CD  1 
ATOM   118  N NE  . ARG A 1 14  ? 10.188  32.336  34.116  1.00 36.57  ? 58  ARG A NE  1 
ATOM   119  C CZ  . ARG A 1 14  ? 10.227  32.635  32.822  1.00 35.43  ? 58  ARG A CZ  1 
ATOM   120  N NH1 . ARG A 1 14  ? 9.328   33.461  32.306  1.00 31.84  ? 58  ARG A NH1 1 
ATOM   121  N NH2 . ARG A 1 14  ? 11.158  32.098  32.043  1.00 28.01  ? 58  ARG A NH2 1 
ATOM   122  N N   . PHE A 1 15  ? 6.385   28.442  37.410  1.00 18.81  ? 59  PHE A N   1 
ATOM   123  C CA  . PHE A 1 15  ? 6.015   27.037  37.334  1.00 20.66  ? 59  PHE A CA  1 
ATOM   124  C C   . PHE A 1 15  ? 5.613   26.631  35.909  1.00 25.23  ? 59  PHE A C   1 
ATOM   125  O O   . PHE A 1 15  ? 6.139   25.658  35.373  1.00 27.69  ? 59  PHE A O   1 
ATOM   126  C CB  . PHE A 1 15  ? 4.877   26.738  38.315  1.00 15.86  ? 59  PHE A CB  1 
ATOM   127  C CG  . PHE A 1 15  ? 4.381   25.322  38.258  1.00 16.60  ? 59  PHE A CG  1 
ATOM   128  C CD1 . PHE A 1 15  ? 5.212   24.269  38.616  1.00 14.25  ? 59  PHE A CD1 1 
ATOM   129  C CD2 . PHE A 1 15  ? 3.071   25.045  37.862  1.00 20.11  ? 59  PHE A CD2 1 
ATOM   130  C CE1 . PHE A 1 15  ? 4.755   22.953  38.589  1.00 21.37  ? 59  PHE A CE1 1 
ATOM   131  C CE2 . PHE A 1 15  ? 2.594   23.731  37.827  1.00 19.46  ? 59  PHE A CE2 1 
ATOM   132  C CZ  . PHE A 1 15  ? 3.436   22.684  38.192  1.00 30.96  ? 59  PHE A CZ  1 
ATOM   133  N N   . PRO A 1 16  ? 4.682   27.372  35.279  1.00 21.84  ? 60  PRO A N   1 
ATOM   134  C CA  . PRO A 1 16  ? 4.274   27.018  33.916  1.00 23.88  ? 60  PRO A CA  1 
ATOM   135  C C   . PRO A 1 16  ? 5.454   26.951  32.947  1.00 20.95  ? 60  PRO A C   1 
ATOM   136  O O   . PRO A 1 16  ? 5.662   25.943  32.270  1.00 26.51  ? 60  PRO A O   1 
ATOM   137  C CB  . PRO A 1 16  ? 3.278   28.124  33.552  1.00 22.21  ? 60  PRO A CB  1 
ATOM   138  C CG  . PRO A 1 16  ? 2.663   28.473  34.883  1.00 23.95  ? 60  PRO A CG  1 
ATOM   139  C CD  . PRO A 1 16  ? 3.876   28.498  35.791  1.00 24.12  ? 60  PRO A CD  1 
ATOM   140  N N   . GLU A 1 17  ? 6.227   28.027  32.890  1.00 24.55  ? 61  GLU A N   1 
ATOM   141  C CA  . GLU A 1 17  ? 7.382   28.086  32.005  1.00 24.76  ? 61  GLU A CA  1 
ATOM   142  C C   . GLU A 1 17  ? 8.379   26.966  32.301  1.00 22.85  ? 61  GLU A C   1 
ATOM   143  O O   . GLU A 1 17  ? 8.995   26.426  31.387  1.00 24.89  ? 61  GLU A O   1 
ATOM   144  C CB  . GLU A 1 17  ? 8.076   29.448  32.125  1.00 34.12  ? 61  GLU A CB  1 
ATOM   145  C CG  . GLU A 1 17  ? 7.254   30.629  31.582  1.00 42.49  ? 61  GLU A CG  1 
ATOM   146  C CD  . GLU A 1 17  ? 6.270   31.204  32.597  1.00 44.56  ? 61  GLU A CD  1 
ATOM   147  O OE1 . GLU A 1 17  ? 5.574   30.421  33.271  1.00 55.47  ? 61  GLU A OE1 1 
ATOM   148  O OE2 . GLU A 1 17  ? 6.184   32.445  32.715  1.00 49.86  ? 61  GLU A OE2 1 
ATOM   149  N N   . THR A 1 18  ? 8.523   26.609  33.574  1.00 18.68  ? 62  THR A N   1 
ATOM   150  C CA  . THR A 1 18  ? 9.447   25.550  33.972  1.00 15.08  ? 62  THR A CA  1 
ATOM   151  C C   . THR A 1 18  ? 8.977   24.160  33.529  1.00 18.08  ? 62  THR A C   1 
ATOM   152  O O   . THR A 1 18  ? 9.773   23.360  33.037  1.00 22.80  ? 62  THR A O   1 
ATOM   153  C CB  . THR A 1 18  ? 9.661   25.552  35.506  1.00 22.50  ? 62  THR A CB  1 
ATOM   154  O OG1 . THR A 1 18  ? 10.083  26.856  35.926  1.00 17.67  ? 62  THR A OG1 1 
ATOM   155  C CG2 . THR A 1 18  ? 10.732  24.535  35.902  1.00 16.56  ? 62  THR A CG2 1 
ATOM   156  N N   . VAL A 1 19  ? 7.690   23.867  33.696  1.00 16.93  ? 63  VAL A N   1 
ATOM   157  C CA  . VAL A 1 19  ? 7.170   22.571  33.283  1.00 19.85  ? 63  VAL A CA  1 
ATOM   158  C C   . VAL A 1 19  ? 7.326   22.397  31.770  1.00 21.52  ? 63  VAL A C   1 
ATOM   159  O O   . VAL A 1 19  ? 7.748   21.344  31.298  1.00 25.62  ? 63  VAL A O   1 
ATOM   160  C CB  . VAL A 1 19  ? 5.676   22.397  33.673  1.00 19.35  ? 63  VAL A CB  1 
ATOM   161  C CG1 . VAL A 1 19  ? 5.117   21.135  33.041  1.00 22.01  ? 63  VAL A CG1 1 
ATOM   162  C CG2 . VAL A 1 19  ? 5.532   22.308  35.184  1.00 14.38  ? 63  VAL A CG2 1 
ATOM   163  N N   . LEU A 1 20  ? 7.000   23.434  31.007  1.00 23.15  ? 64  LEU A N   1 
ATOM   164  C CA  . LEU A 1 20  ? 7.114   23.353  29.557  1.00 20.51  ? 64  LEU A CA  1 
ATOM   165  C C   . LEU A 1 20  ? 8.546   23.093  29.123  1.00 22.14  ? 64  LEU A C   1 
ATOM   166  O O   . LEU A 1 20  ? 8.805   22.194  28.323  1.00 27.59  ? 64  LEU A O   1 
ATOM   167  C CB  . LEU A 1 20  ? 6.606   24.644  28.909  1.00 22.39  ? 64  LEU A CB  1 
ATOM   168  C CG  . LEU A 1 20  ? 5.091   24.858  28.969  1.00 28.26  ? 64  LEU A CG  1 
ATOM   169  C CD1 . LEU A 1 20  ? 4.753   26.330  28.742  1.00 29.49  ? 64  LEU A CD1 1 
ATOM   170  C CD2 . LEU A 1 20  ? 4.416   23.967  27.920  1.00 23.88  ? 64  LEU A CD2 1 
ATOM   171  N N   . ALA A 1 21  ? 9.475   23.879  29.654  1.00 19.74  ? 65  ALA A N   1 
ATOM   172  C CA  . ALA A 1 21  ? 10.884  23.734  29.306  1.00 23.52  ? 65  ALA A CA  1 
ATOM   173  C C   . ALA A 1 21  ? 11.375  22.340  29.647  1.00 18.38  ? 65  ALA A C   1 
ATOM   174  O O   . ALA A 1 21  ? 12.087  21.718  28.857  1.00 21.99  ? 65  ALA A O   1 
ATOM   175  C CB  . ALA A 1 21  ? 11.725  24.778  30.045  1.00 21.15  ? 65  ALA A CB  1 
ATOM   176  N N   . ARG A 1 22  ? 10.994  21.856  30.825  1.00 18.61  ? 66  ARG A N   1 
ATOM   177  C CA  . ARG A 1 22  ? 11.398  20.529  31.272  1.00 19.16  ? 66  ARG A CA  1 
ATOM   178  C C   . ARG A 1 22  ? 10.840  19.447  30.361  1.00 20.46  ? 66  ARG A C   1 
ATOM   179  O O   . ARG A 1 22  ? 11.515  18.455  30.099  1.00 26.49  ? 66  ARG A O   1 
ATOM   180  C CB  . ARG A 1 22  ? 10.932  20.274  32.704  1.00 17.68  ? 66  ARG A CB  1 
ATOM   181  C CG  . ARG A 1 22  ? 11.670  21.073  33.761  1.00 20.34  ? 66  ARG A CG  1 
ATOM   182  C CD  . ARG A 1 22  ? 11.272  20.586  35.145  1.00 20.70  ? 66  ARG A CD  1 
ATOM   183  N NE  . ARG A 1 22  ? 12.003  21.260  36.207  1.00 19.51  ? 66  ARG A NE  1 
ATOM   184  C CZ  . ARG A 1 22  ? 11.969  20.895  37.484  1.00 21.45  ? 66  ARG A CZ  1 
ATOM   185  N NH1 . ARG A 1 22  ? 11.236  19.856  37.870  1.00 19.99  ? 66  ARG A NH1 1 
ATOM   186  N NH2 . ARG A 1 22  ? 12.675  21.567  38.375  1.00 28.58  ? 66  ARG A NH2 1 
ATOM   187  N N   . CYS A 1 23  ? 9.606   19.631  29.892  1.00 20.82  ? 67  CYS A N   1 
ATOM   188  C CA  . CYS A 1 23  ? 8.984   18.661  28.994  1.00 22.22  ? 67  CYS A CA  1 
ATOM   189  C C   . CYS A 1 23  ? 9.736   18.677  27.673  1.00 25.97  ? 67  CYS A C   1 
ATOM   190  O O   . CYS A 1 23  ? 10.040  17.626  27.113  1.00 29.87  ? 67  CYS A O   1 
ATOM   191  C CB  . CYS A 1 23  ? 7.515   19.005  28.753  1.00 28.59  ? 67  CYS A CB  1 
ATOM   192  S SG  . CYS A 1 23  ? 6.641   17.899  27.591  1.00 29.94  ? 67  CYS A SG  1 
ATOM   193  N N   . VAL A 1 24  ? 10.037  19.876  27.182  1.00 24.51  ? 68  VAL A N   1 
ATOM   194  C CA  . VAL A 1 24  ? 10.779  20.029  25.934  1.00 20.52  ? 68  VAL A CA  1 
ATOM   195  C C   . VAL A 1 24  ? 12.165  19.389  26.058  1.00 25.71  ? 68  VAL A C   1 
ATOM   196  O O   . VAL A 1 24  ? 12.573  18.601  25.206  1.00 26.75  ? 68  VAL A O   1 
ATOM   197  C CB  . VAL A 1 24  ? 10.940  21.525  25.574  1.00 29.47  ? 68  VAL A CB  1 
ATOM   198  C CG1 . VAL A 1 24  ? 12.084  21.714  24.593  1.00 15.14  ? 68  VAL A CG1 1 
ATOM   199  C CG2 . VAL A 1 24  ? 9.631   22.061  24.983  1.00 19.93  ? 68  VAL A CG2 1 
ATOM   200  N N   . LYS A 1 25  ? 12.887  19.724  27.124  1.00 26.83  ? 69  LYS A N   1 
ATOM   201  C CA  . LYS A 1 25  ? 14.225  19.173  27.332  1.00 28.79  ? 69  LYS A CA  1 
ATOM   202  C C   . LYS A 1 25  ? 14.178  17.650  27.425  1.00 26.20  ? 69  LYS A C   1 
ATOM   203  O O   . LYS A 1 25  ? 15.015  16.956  26.846  1.00 25.29  ? 69  LYS A O   1 
ATOM   204  C CB  . LYS A 1 25  ? 14.851  19.758  28.608  1.00 31.77  ? 69  LYS A CB  1 
ATOM   205  C CG  . LYS A 1 25  ? 16.118  19.041  29.101  1.00 32.45  ? 69  LYS A CG  1 
ATOM   206  C CD  . LYS A 1 25  ? 17.426  19.747  28.743  1.00 38.97  ? 69  LYS A CD  1 
ATOM   207  C CE  . LYS A 1 25  ? 17.739  19.724  27.252  1.00 47.92  ? 69  LYS A CE  1 
ATOM   208  N NZ  . LYS A 1 25  ? 16.878  20.656  26.475  1.00 58.17  ? 69  LYS A NZ  1 
ATOM   209  N N   . TYR A 1 26  ? 13.191  17.137  28.152  1.00 25.73  ? 70  TYR A N   1 
ATOM   210  C CA  . TYR A 1 26  ? 13.042  15.699  28.327  1.00 26.81  ? 70  TYR A CA  1 
ATOM   211  C C   . TYR A 1 26  ? 12.858  14.972  27.003  1.00 26.43  ? 70  TYR A C   1 
ATOM   212  O O   . TYR A 1 26  ? 13.568  14.010  26.710  1.00 24.26  ? 70  TYR A O   1 
ATOM   213  C CB  . TYR A 1 26  ? 11.840  15.380  29.214  1.00 26.53  ? 70  TYR A CB  1 
ATOM   214  C CG  . TYR A 1 26  ? 11.849  13.951  29.700  1.00 21.10  ? 70  TYR A CG  1 
ATOM   215  C CD1 . TYR A 1 26  ? 12.584  13.589  30.829  1.00 21.93  ? 70  TYR A CD1 1 
ATOM   216  C CD2 . TYR A 1 26  ? 11.185  12.949  28.997  1.00 17.42  ? 70  TYR A CD2 1 
ATOM   217  C CE1 . TYR A 1 26  ? 12.668  12.257  31.247  1.00 20.72  ? 70  TYR A CE1 1 
ATOM   218  C CE2 . TYR A 1 26  ? 11.259  11.604  29.406  1.00 21.51  ? 70  TYR A CE2 1 
ATOM   219  C CZ  . TYR A 1 26  ? 12.007  11.267  30.534  1.00 26.06  ? 70  TYR A CZ  1 
ATOM   220  O OH  . TYR A 1 26  ? 12.110  9.948   30.944  1.00 19.45  ? 70  TYR A OH  1 
ATOM   221  N N   . THR A 1 27  ? 11.891  15.420  26.210  1.00 23.28  ? 71  THR A N   1 
ATOM   222  C CA  . THR A 1 27  ? 11.629  14.776  24.934  1.00 24.78  ? 71  THR A CA  1 
ATOM   223  C C   . THR A 1 27  ? 12.820  14.950  24.006  1.00 25.95  ? 71  THR A C   1 
ATOM   224  O O   . THR A 1 27  ? 12.979  14.211  23.042  1.00 34.36  ? 71  THR A O   1 
ATOM   225  C CB  . THR A 1 27  ? 10.348  15.332  24.262  1.00 18.56  ? 71  THR A CB  1 
ATOM   226  O OG1 . THR A 1 27  ? 10.487  16.737  24.025  1.00 30.18  ? 71  THR A OG1 1 
ATOM   227  C CG2 . THR A 1 27  ? 9.139   15.088  25.155  1.00 18.49  ? 71  THR A CG2 1 
ATOM   228  N N   . GLU A 1 28  ? 13.663  15.928  24.309  1.00 34.30  ? 72  GLU A N   1 
ATOM   229  C CA  . GLU A 1 28  ? 14.853  16.180  23.505  1.00 36.09  ? 72  GLU A CA  1 
ATOM   230  C C   . GLU A 1 28  ? 15.919  15.137  23.845  1.00 36.38  ? 72  GLU A C   1 
ATOM   231  O O   . GLU A 1 28  ? 16.625  14.637  22.960  1.00 31.66  ? 72  GLU A O   1 
ATOM   232  C CB  . GLU A 1 28  ? 15.378  17.594  23.779  1.00 38.64  ? 72  GLU A CB  1 
ATOM   233  C CG  . GLU A 1 28  ? 16.693  17.925  23.093  1.00 49.41  ? 72  GLU A CG  1 
ATOM   234  C CD  . GLU A 1 28  ? 17.092  19.383  23.253  1.00 57.26  ? 72  GLU A CD  1 
ATOM   235  O OE1 . GLU A 1 28  ? 18.224  19.730  22.854  1.00 63.61  ? 72  GLU A OE1 1 
ATOM   236  O OE2 . GLU A 1 28  ? 16.277  20.185  23.767  1.00 54.53  ? 72  GLU A OE2 1 
ATOM   237  N N   . ILE A 1 29  ? 16.018  14.803  25.128  1.00 34.06  ? 73  ILE A N   1 
ATOM   238  C CA  . ILE A 1 29  ? 16.987  13.815  25.594  1.00 39.51  ? 73  ILE A CA  1 
ATOM   239  C C   . ILE A 1 29  ? 16.488  12.379  25.422  1.00 34.10  ? 73  ILE A C   1 
ATOM   240  O O   . ILE A 1 29  ? 17.276  11.435  25.442  1.00 41.51  ? 73  ILE A O   1 
ATOM   241  C CB  . ILE A 1 29  ? 17.337  14.040  27.077  1.00 43.35  ? 73  ILE A CB  1 
ATOM   242  C CG1 . ILE A 1 29  ? 17.939  15.433  27.255  1.00 45.89  ? 73  ILE A CG1 1 
ATOM   243  C CG2 . ILE A 1 29  ? 18.329  12.986  27.553  1.00 43.53  ? 73  ILE A CG2 1 
ATOM   244  C CD1 . ILE A 1 29  ? 18.336  15.744  28.681  1.00 51.45  ? 73  ILE A CD1 1 
ATOM   245  N N   . HIS A 1 30  ? 15.181  12.213  25.256  1.00 29.34  ? 74  HIS A N   1 
ATOM   246  C CA  . HIS A 1 30  ? 14.610  10.883  25.079  1.00 23.47  ? 74  HIS A CA  1 
ATOM   247  C C   . HIS A 1 30  ? 13.851  10.814  23.767  1.00 24.78  ? 74  HIS A C   1 
ATOM   248  O O   . HIS A 1 30  ? 12.642  11.039  23.728  1.00 26.23  ? 74  HIS A O   1 
ATOM   249  C CB  . HIS A 1 30  ? 13.662  10.551  26.229  1.00 19.63  ? 74  HIS A CB  1 
ATOM   250  C CG  . HIS A 1 30  ? 14.349  10.370  27.547  1.00 32.30  ? 74  HIS A CG  1 
ATOM   251  N ND1 . HIS A 1 30  ? 14.774  9.139   28.004  1.00 40.21  ? 74  HIS A ND1 1 
ATOM   252  C CD2 . HIS A 1 30  ? 14.689  11.264  28.506  1.00 25.70  ? 74  HIS A CD2 1 
ATOM   253  C CE1 . HIS A 1 30  ? 15.342  9.283   29.187  1.00 31.70  ? 74  HIS A CE1 1 
ATOM   254  N NE2 . HIS A 1 30  ? 15.305  10.563  29.514  1.00 29.09  ? 74  HIS A NE2 1 
ATOM   255  N N   . PRO A 1 31  ? 14.552  10.510  22.665  1.00 29.48  ? 75  PRO A N   1 
ATOM   256  C CA  . PRO A 1 31  ? 13.870  10.429  21.370  1.00 29.86  ? 75  PRO A CA  1 
ATOM   257  C C   . PRO A 1 31  ? 12.653  9.511   21.381  1.00 31.47  ? 75  PRO A C   1 
ATOM   258  O O   . PRO A 1 31  ? 11.665  9.772   20.692  1.00 34.22  ? 75  PRO A O   1 
ATOM   259  C CB  . PRO A 1 31  ? 14.972  9.961   20.420  1.00 30.19  ? 75  PRO A CB  1 
ATOM   260  C CG  . PRO A 1 31  ? 15.993  9.321   21.332  1.00 37.39  ? 75  PRO A CG  1 
ATOM   261  C CD  . PRO A 1 31  ? 15.986  10.216  22.525  1.00 22.28  ? 75  PRO A CD  1 
ATOM   262  N N   . GLU A 1 32  ? 12.713  8.453   22.184  1.00 25.06  ? 76  GLU A N   1 
ATOM   263  C CA  . GLU A 1 32  ? 11.606  7.508   22.278  1.00 21.89  ? 76  GLU A CA  1 
ATOM   264  C C   . GLU A 1 32  ? 10.330  8.186   22.772  1.00 24.72  ? 76  GLU A C   1 
ATOM   265  O O   . GLU A 1 32  ? 9.239   7.608   22.710  1.00 28.46  ? 76  GLU A O   1 
ATOM   266  C CB  . GLU A 1 32  ? 11.960  6.349   23.226  1.00 22.00  ? 76  GLU A CB  1 
ATOM   267  C CG  . GLU A 1 32  ? 11.930  6.720   24.696  1.00 24.82  ? 76  GLU A CG  1 
ATOM   268  C CD  . GLU A 1 32  ? 13.270  7.180   25.222  1.00 26.17  ? 76  GLU A CD  1 
ATOM   269  O OE1 . GLU A 1 32  ? 14.078  7.711   24.431  1.00 25.41  ? 76  GLU A OE1 1 
ATOM   270  O OE2 . GLU A 1 32  ? 13.509  7.014   26.435  1.00 27.23  ? 76  GLU A OE2 1 
ATOM   271  N N   . MET A 1 33  ? 10.461  9.411   23.262  1.00 20.97  ? 77  MET A N   1 
ATOM   272  C CA  . MET A 1 33  ? 9.304   10.136  23.770  1.00 27.47  ? 77  MET A CA  1 
ATOM   273  C C   . MET A 1 33  ? 8.919   11.346  22.917  1.00 25.63  ? 77  MET A C   1 
ATOM   274  O O   . MET A 1 33  ? 8.095   12.158  23.331  1.00 24.29  ? 77  MET A O   1 
ATOM   275  C CB  . MET A 1 33  ? 9.561   10.588  25.214  1.00 26.89  ? 77  MET A CB  1 
ATOM   276  C CG  . MET A 1 33  ? 9.655   9.459   26.233  1.00 18.44  ? 77  MET A CG  1 
ATOM   277  S SD  . MET A 1 33  ? 8.163   8.457   26.366  1.00 28.96  ? 77  MET A SD  1 
ATOM   278  C CE  . MET A 1 33  ? 7.038   9.493   27.336  1.00 10.91  ? 77  MET A CE  1 
ATOM   279  N N   . ARG A 1 34  ? 9.510   11.457  21.729  1.00 26.80  ? 78  ARG A N   1 
ATOM   280  C CA  . ARG A 1 34  ? 9.238   12.575  20.824  1.00 27.16  ? 78  ARG A CA  1 
ATOM   281  C C   . ARG A 1 34  ? 7.766   12.717  20.433  1.00 27.98  ? 78  ARG A C   1 
ATOM   282  O O   . ARG A 1 34  ? 7.321   13.803  20.075  1.00 36.36  ? 78  ARG A O   1 
ATOM   283  C CB  . ARG A 1 34  ? 10.076  12.439  19.555  1.00 23.91  ? 78  ARG A CB  1 
ATOM   284  C CG  . ARG A 1 34  ? 11.579  12.584  19.750  1.00 33.51  ? 78  ARG A CG  1 
ATOM   285  C CD  . ARG A 1 34  ? 12.020  14.025  19.612  1.00 38.40  ? 78  ARG A CD  1 
ATOM   286  N NE  . ARG A 1 34  ? 13.374  14.130  19.072  1.00 51.58  ? 78  ARG A NE  1 
ATOM   287  C CZ  . ARG A 1 34  ? 14.475  13.764  19.720  1.00 51.18  ? 78  ARG A CZ  1 
ATOM   288  N NH1 . ARG A 1 34  ? 14.387  13.269  20.945  1.00 57.15  ? 78  ARG A NH1 1 
ATOM   289  N NH2 . ARG A 1 34  ? 15.663  13.880  19.137  1.00 50.71  ? 78  ARG A NH2 1 
ATOM   290  N N   . HIS A 1 35  ? 7.012   11.628  20.498  1.00 26.76  ? 79  HIS A N   1 
ATOM   291  C CA  . HIS A 1 35  ? 5.592   11.663  20.141  1.00 32.00  ? 79  HIS A CA  1 
ATOM   292  C C   . HIS A 1 35  ? 4.763   12.560  21.079  1.00 33.99  ? 79  HIS A C   1 
ATOM   293  O O   . HIS A 1 35  ? 3.631   12.934  20.761  1.00 34.78  ? 79  HIS A O   1 
ATOM   294  C CB  . HIS A 1 35  ? 5.012   10.244  20.162  1.00 20.92  ? 79  HIS A CB  1 
ATOM   295  C CG  . HIS A 1 35  ? 5.129   9.565   21.493  1.00 28.60  ? 79  HIS A CG  1 
ATOM   296  N ND1 . HIS A 1 35  ? 6.267   8.900   21.893  1.00 28.28  ? 79  HIS A ND1 1 
ATOM   297  C CD2 . HIS A 1 35  ? 4.264   9.488   22.534  1.00 30.44  ? 79  HIS A CD2 1 
ATOM   298  C CE1 . HIS A 1 35  ? 6.100   8.442   23.121  1.00 28.75  ? 79  HIS A CE1 1 
ATOM   299  N NE2 . HIS A 1 35  ? 4.893   8.786   23.533  1.00 27.35  ? 79  HIS A NE2 1 
ATOM   300  N N   . VAL A 1 36  ? 5.332   12.896  22.231  1.00 28.27  ? 80  VAL A N   1 
ATOM   301  C CA  . VAL A 1 36  ? 4.657   13.725  23.231  1.00 27.63  ? 80  VAL A CA  1 
ATOM   302  C C   . VAL A 1 36  ? 4.501   15.195  22.825  1.00 26.61  ? 80  VAL A C   1 
ATOM   303  O O   . VAL A 1 36  ? 5.450   15.818  22.365  1.00 31.49  ? 80  VAL A O   1 
ATOM   304  C CB  . VAL A 1 36  ? 5.432   13.670  24.590  1.00 22.93  ? 80  VAL A CB  1 
ATOM   305  C CG1 . VAL A 1 36  ? 4.919   14.742  25.534  1.00 18.00  ? 80  VAL A CG1 1 
ATOM   306  C CG2 . VAL A 1 36  ? 5.288   12.282  25.225  1.00 8.13   ? 80  VAL A CG2 1 
ATOM   307  N N   . ASP A 1 37  ? 3.305   15.747  22.995  1.00 26.51  ? 81  ASP A N   1 
ATOM   308  C CA  . ASP A 1 37  ? 3.081   17.157  22.678  1.00 28.30  ? 81  ASP A CA  1 
ATOM   309  C C   . ASP A 1 37  ? 3.051   17.899  24.010  1.00 27.74  ? 81  ASP A C   1 
ATOM   310  O O   . ASP A 1 37  ? 2.070   17.841  24.746  1.00 31.29  ? 81  ASP A O   1 
ATOM   311  C CB  . ASP A 1 37  ? 1.760   17.357  21.931  1.00 26.78  ? 81  ASP A CB  1 
ATOM   312  C CG  . ASP A 1 37  ? 1.523   18.805  21.550  1.00 34.54  ? 81  ASP A CG  1 
ATOM   313  O OD1 . ASP A 1 37  ? 2.407   19.408  20.900  1.00 47.77  ? 81  ASP A OD1 1 
ATOM   314  O OD2 . ASP A 1 37  ? 0.453   19.345  21.894  1.00 36.70  ? 81  ASP A OD2 1 
ATOM   315  N N   . CYS A 1 38  ? 4.138   18.600  24.305  1.00 31.76  ? 82  CYS A N   1 
ATOM   316  C CA  . CYS A 1 38  ? 4.284   19.322  25.558  1.00 30.65  ? 82  CYS A CA  1 
ATOM   317  C C   . CYS A 1 38  ? 3.218   20.342  25.911  1.00 33.75  ? 82  CYS A C   1 
ATOM   318  O O   . CYS A 1 38  ? 3.002   20.621  27.092  1.00 32.24  ? 82  CYS A O   1 
ATOM   319  C CB  . CYS A 1 38  ? 5.663   19.971  25.611  1.00 33.97  ? 82  CYS A CB  1 
ATOM   320  S SG  . CYS A 1 38  ? 7.000   18.742  25.773  1.00 28.01  ? 82  CYS A SG  1 
ATOM   321  N N   . GLN A 1 39  ? 2.550   20.905  24.911  1.00 33.63  ? 83  GLN A N   1 
ATOM   322  C CA  . GLN A 1 39  ? 1.509   21.871  25.215  1.00 32.21  ? 83  GLN A CA  1 
ATOM   323  C C   . GLN A 1 39  ? 0.333   21.103  25.802  1.00 31.39  ? 83  GLN A C   1 
ATOM   324  O O   . GLN A 1 39  ? -0.271  21.527  26.789  1.00 25.98  ? 83  GLN A O   1 
ATOM   325  C CB  . GLN A 1 39  ? 1.070   22.633  23.962  1.00 31.97  ? 83  GLN A CB  1 
ATOM   326  C CG  . GLN A 1 39  ? -0.142  23.509  24.226  1.00 45.00  ? 83  GLN A CG  1 
ATOM   327  C CD  . GLN A 1 39  ? -0.568  24.327  23.035  1.00 50.47  ? 83  GLN A CD  1 
ATOM   328  O OE1 . GLN A 1 39  ? -0.820  23.792  21.953  1.00 57.23  ? 83  GLN A OE1 1 
ATOM   329  N NE2 . GLN A 1 39  ? -0.661  25.640  23.226  1.00 53.54  ? 83  GLN A NE2 1 
ATOM   330  N N   . SER A 1 40  ? 0.017   19.965  25.191  1.00 28.37  ? 84  SER A N   1 
ATOM   331  C CA  . SER A 1 40  ? -1.077  19.120  25.663  1.00 31.91  ? 84  SER A CA  1 
ATOM   332  C C   . SER A 1 40  ? -0.760  18.700  27.090  1.00 30.67  ? 84  SER A C   1 
ATOM   333  O O   . SER A 1 40  ? -1.624  18.744  27.972  1.00 28.08  ? 84  SER A O   1 
ATOM   334  C CB  . SER A 1 40  ? -1.202  17.869  24.792  1.00 29.75  ? 84  SER A CB  1 
ATOM   335  O OG  . SER A 1 40  ? -1.452  18.209  23.445  1.00 39.17  ? 84  SER A OG  1 
ATOM   336  N N   . VAL A 1 41  ? 0.489   18.282  27.292  1.00 25.07  ? 85  VAL A N   1 
ATOM   337  C CA  . VAL A 1 41  ? 0.983   17.859  28.598  1.00 23.25  ? 85  VAL A CA  1 
ATOM   338  C C   . VAL A 1 41  ? 0.679   18.943  29.631  1.00 19.98  ? 85  VAL A C   1 
ATOM   339  O O   . VAL A 1 41  ? -0.017  18.704  30.625  1.00 20.18  ? 85  VAL A O   1 
ATOM   340  C CB  . VAL A 1 41  ? 2.521   17.630  28.573  1.00 31.89  ? 85  VAL A CB  1 
ATOM   341  C CG1 . VAL A 1 41  ? 3.018   17.254  29.964  1.00 23.36  ? 85  VAL A CG1 1 
ATOM   342  C CG2 . VAL A 1 41  ? 2.883   16.543  27.561  1.00 19.69  ? 85  VAL A CG2 1 
ATOM   343  N N   . TRP A 1 42  ? 1.192   20.141  29.383  1.00 21.86  ? 86  TRP A N   1 
ATOM   344  C CA  . TRP A 1 42  ? 0.974   21.247  30.307  1.00 23.97  ? 86  TRP A CA  1 
ATOM   345  C C   . TRP A 1 42  ? -0.506  21.490  30.541  1.00 25.79  ? 86  TRP A C   1 
ATOM   346  O O   . TRP A 1 42  ? -0.933  21.759  31.670  1.00 26.37  ? 86  TRP A O   1 
ATOM   347  C CB  . TRP A 1 42  ? 1.627   22.535  29.793  1.00 17.59  ? 86  TRP A CB  1 
ATOM   348  C CG  . TRP A 1 42  ? 1.259   23.720  30.627  1.00 22.39  ? 86  TRP A CG  1 
ATOM   349  C CD1 . TRP A 1 42  ? 0.697   24.880  30.191  1.00 20.12  ? 86  TRP A CD1 1 
ATOM   350  C CD2 . TRP A 1 42  ? 1.353   23.830  32.056  1.00 22.28  ? 86  TRP A CD2 1 
ATOM   351  N NE1 . TRP A 1 42  ? 0.428   25.710  31.259  1.00 30.68  ? 86  TRP A NE1 1 
ATOM   352  C CE2 . TRP A 1 42  ? 0.821   25.089  32.415  1.00 26.32  ? 86  TRP A CE2 1 
ATOM   353  C CE3 . TRP A 1 42  ? 1.829   22.985  33.069  1.00 23.07  ? 86  TRP A CE3 1 
ATOM   354  C CZ2 . TRP A 1 42  ? 0.753   25.526  33.745  1.00 25.72  ? 86  TRP A CZ2 1 
ATOM   355  C CZ3 . TRP A 1 42  ? 1.759   23.419  34.394  1.00 20.74  ? 86  TRP A CZ3 1 
ATOM   356  C CH2 . TRP A 1 42  ? 1.225   24.679  34.718  1.00 17.65  ? 86  TRP A CH2 1 
ATOM   357  N N   . ASP A 1 43  ? -1.292  21.394  29.475  1.00 27.37  ? 87  ASP A N   1 
ATOM   358  C CA  . ASP A 1 43  ? -2.726  21.612  29.591  1.00 25.72  ? 87  ASP A CA  1 
ATOM   359  C C   . ASP A 1 43  ? -3.364  20.607  30.535  1.00 21.45  ? 87  ASP A C   1 
ATOM   360  O O   . ASP A 1 43  ? -4.130  20.989  31.418  1.00 23.18  ? 87  ASP A O   1 
ATOM   361  C CB  . ASP A 1 43  ? -3.390  21.551  28.218  1.00 31.82  ? 87  ASP A CB  1 
ATOM   362  C CG  . ASP A 1 43  ? -3.950  22.886  27.796  1.00 41.39  ? 87  ASP A CG  1 
ATOM   363  O OD1 . ASP A 1 43  ? -3.175  23.867  27.758  1.00 38.98  ? 87  ASP A OD1 1 
ATOM   364  O OD2 . ASP A 1 43  ? -5.165  22.958  27.510  1.00 46.99  ? 87  ASP A OD2 1 
ATOM   365  N N   . ALA A 1 44  ? -3.044  19.328  30.348  1.00 12.69  ? 88  ALA A N   1 
ATOM   366  C CA  . ALA A 1 44  ? -3.581  18.276  31.205  1.00 19.95  ? 88  ALA A CA  1 
ATOM   367  C C   . ALA A 1 44  ? -3.068  18.432  32.647  1.00 23.46  ? 88  ALA A C   1 
ATOM   368  O O   . ALA A 1 44  ? -3.787  18.158  33.609  1.00 25.49  ? 88  ALA A O   1 
ATOM   369  C CB  . ALA A 1 44  ? -3.198  16.904  30.649  1.00 23.40  ? 88  ALA A CB  1 
ATOM   370  N N   . PHE A 1 45  ? -1.825  18.875  32.794  1.00 21.59  ? 89  PHE A N   1 
ATOM   371  C CA  . PHE A 1 45  ? -1.245  19.076  34.120  1.00 28.36  ? 89  PHE A CA  1 
ATOM   372  C C   . PHE A 1 45  ? -2.033  20.180  34.834  1.00 29.98  ? 89  PHE A C   1 
ATOM   373  O O   . PHE A 1 45  ? -2.499  20.020  35.965  1.00 30.41  ? 89  PHE A O   1 
ATOM   374  C CB  . PHE A 1 45  ? 0.215   19.509  33.984  1.00 26.04  ? 89  PHE A CB  1 
ATOM   375  C CG  . PHE A 1 45  ? 1.039   19.280  35.215  1.00 24.08  ? 89  PHE A CG  1 
ATOM   376  C CD1 . PHE A 1 45  ? 0.490   19.433  36.484  1.00 29.51  ? 89  PHE A CD1 1 
ATOM   377  C CD2 . PHE A 1 45  ? 2.381   18.936  35.106  1.00 29.89  ? 89  PHE A CD2 1 
ATOM   378  C CE1 . PHE A 1 45  ? 1.267   19.245  37.625  1.00 33.75  ? 89  PHE A CE1 1 
ATOM   379  C CE2 . PHE A 1 45  ? 3.166   18.747  36.242  1.00 34.02  ? 89  PHE A CE2 1 
ATOM   380  C CZ  . PHE A 1 45  ? 2.607   18.902  37.502  1.00 28.78  ? 89  PHE A CZ  1 
ATOM   381  N N   . LYS A 1 46  ? -2.168  21.304  34.146  1.00 27.52  ? 90  LYS A N   1 
ATOM   382  C CA  . LYS A 1 46  ? -2.882  22.468  34.652  1.00 28.37  ? 90  LYS A CA  1 
ATOM   383  C C   . LYS A 1 46  ? -4.343  22.138  34.981  1.00 30.20  ? 90  LYS A C   1 
ATOM   384  O O   . LYS A 1 46  ? -4.882  22.580  35.993  1.00 27.05  ? 90  LYS A O   1 
ATOM   385  C CB  . LYS A 1 46  ? -2.799  23.568  33.591  1.00 37.99  ? 90  LYS A CB  1 
ATOM   386  C CG  . LYS A 1 46  ? -3.262  24.940  34.018  1.00 40.68  ? 90  LYS A CG  1 
ATOM   387  C CD  . LYS A 1 46  ? -2.912  25.982  32.960  1.00 43.25  ? 90  LYS A CD  1 
ATOM   388  C CE  . LYS A 1 46  ? -3.530  25.663  31.605  1.00 40.79  ? 90  LYS A CE  1 
ATOM   389  N NZ  . LYS A 1 46  ? -3.243  26.737  30.609  1.00 48.97  ? 90  LYS A NZ  1 
ATOM   390  N N   . GLY A 1 47  ? -4.974  21.342  34.125  1.00 32.02  ? 91  GLY A N   1 
ATOM   391  C CA  . GLY A 1 47  ? -6.364  20.981  34.336  1.00 30.60  ? 91  GLY A CA  1 
ATOM   392  C C   . GLY A 1 47  ? -6.637  20.178  35.594  1.00 30.75  ? 91  GLY A C   1 
ATOM   393  O O   . GLY A 1 47  ? -7.763  20.138  36.083  1.00 29.10  ? 91  GLY A O   1 
ATOM   394  N N   . ALA A 1 48  ? -5.614  19.535  36.132  1.00 27.58  ? 92  ALA A N   1 
ATOM   395  C CA  . ALA A 1 48  ? -5.815  18.737  37.325  1.00 25.77  ? 92  ALA A CA  1 
ATOM   396  C C   . ALA A 1 48  ? -6.074  19.562  38.580  1.00 30.14  ? 92  ALA A C   1 
ATOM   397  O O   . ALA A 1 48  ? -6.782  19.103  39.479  1.00 30.46  ? 92  ALA A O   1 
ATOM   398  C CB  . ALA A 1 48  ? -4.618  17.827  37.547  1.00 17.70  ? 92  ALA A CB  1 
ATOM   399  N N   . PHE A 1 49  ? -5.529  20.778  38.647  1.00 29.73  ? 93  PHE A N   1 
ATOM   400  C CA  . PHE A 1 49  ? -5.694  21.591  39.857  1.00 27.46  ? 93  PHE A CA  1 
ATOM   401  C C   . PHE A 1 49  ? -6.216  23.019  39.706  1.00 27.24  ? 93  PHE A C   1 
ATOM   402  O O   . PHE A 1 49  ? -6.622  23.633  40.691  1.00 27.07  ? 93  PHE A O   1 
ATOM   403  C CB  . PHE A 1 49  ? -4.364  21.645  40.599  1.00 22.96  ? 93  PHE A CB  1 
ATOM   404  C CG  . PHE A 1 49  ? -3.324  22.464  39.896  1.00 21.41  ? 93  PHE A CG  1 
ATOM   405  C CD1 . PHE A 1 49  ? -3.087  23.780  40.274  1.00 15.78  ? 93  PHE A CD1 1 
ATOM   406  C CD2 . PHE A 1 49  ? -2.606  21.931  38.827  1.00 18.58  ? 93  PHE A CD2 1 
ATOM   407  C CE1 . PHE A 1 49  ? -2.147  24.555  39.598  1.00 18.25  ? 93  PHE A CE1 1 
ATOM   408  C CE2 . PHE A 1 49  ? -1.670  22.692  38.145  1.00 11.21  ? 93  PHE A CE2 1 
ATOM   409  C CZ  . PHE A 1 49  ? -1.436  24.009  38.530  1.00 15.23  ? 93  PHE A CZ  1 
ATOM   410  N N   . ILE A 1 50  ? -6.185  23.562  38.495  1.00 29.87  ? 94  ILE A N   1 
ATOM   411  C CA  . ILE A 1 50  ? -6.664  24.927  38.278  1.00 30.60  ? 94  ILE A CA  1 
ATOM   412  C C   . ILE A 1 50  ? -8.170  25.045  38.474  1.00 24.50  ? 94  ILE A C   1 
ATOM   413  O O   . ILE A 1 50  ? -8.925  24.153  38.109  1.00 28.08  ? 94  ILE A O   1 
ATOM   414  C CB  . ILE A 1 50  ? -6.310  25.434  36.853  1.00 31.64  ? 94  ILE A CB  1 
ATOM   415  C CG1 . ILE A 1 50  ? -4.812  25.738  36.772  1.00 41.02  ? 94  ILE A CG1 1 
ATOM   416  C CG2 . ILE A 1 50  ? -7.113  26.691  36.515  1.00 23.06  ? 94  ILE A CG2 1 
ATOM   417  C CD1 . ILE A 1 50  ? -4.367  26.912  37.641  1.00 36.53  ? 94  ILE A CD1 1 
ATOM   418  N N   . SER A 1 51  ? -8.590  26.155  39.065  1.00 24.10  ? 95  SER A N   1 
ATOM   419  C CA  . SER A 1 51  ? -10.000 26.416  39.294  1.00 28.13  ? 95  SER A CA  1 
ATOM   420  C C   . SER A 1 51  ? -10.622 25.414  40.267  1.00 32.39  ? 95  SER A C   1 
ATOM   421  O O   . SER A 1 51  ? -11.844 25.300  40.358  1.00 30.84  ? 95  SER A O   1 
ATOM   422  C CB  . SER A 1 51  ? -10.743 26.395  37.952  1.00 27.64  ? 95  SER A CB  1 
ATOM   423  O OG  . SER A 1 51  ? -12.068 26.859  38.094  1.00 34.07  ? 95  SER A OG  1 
ATOM   424  N N   . LYS A 1 52  ? -9.777  24.690  40.995  1.00 29.90  ? 96  LYS A N   1 
ATOM   425  C CA  . LYS A 1 52  ? -10.258 23.713  41.964  1.00 27.21  ? 96  LYS A CA  1 
ATOM   426  C C   . LYS A 1 52  ? -9.741  24.041  43.359  1.00 27.78  ? 96  LYS A C   1 
ATOM   427  O O   . LYS A 1 52  ? -8.638  24.570  43.516  1.00 27.19  ? 96  LYS A O   1 
ATOM   428  C CB  . LYS A 1 52  ? -9.806  22.303  41.569  1.00 23.42  ? 96  LYS A CB  1 
ATOM   429  C CG  . LYS A 1 52  ? -10.270 21.876  40.190  1.00 28.85  ? 96  LYS A CG  1 
ATOM   430  C CD  . LYS A 1 52  ? -9.739  20.501  39.783  1.00 27.47  ? 96  LYS A CD  1 
ATOM   431  C CE  . LYS A 1 52  ? -10.179 20.175  38.358  1.00 31.58  ? 96  LYS A CE  1 
ATOM   432  N NZ  . LYS A 1 52  ? -9.775  18.818  37.902  1.00 34.66  ? 96  LYS A NZ  1 
ATOM   433  N N   . HIS A 1 53  ? -10.544 23.744  44.373  1.00 24.30  ? 97  HIS A N   1 
ATOM   434  C CA  . HIS A 1 53  ? -10.119 23.995  45.742  1.00 26.40  ? 97  HIS A CA  1 
ATOM   435  C C   . HIS A 1 53  ? -8.936  23.050  45.965  1.00 24.06  ? 97  HIS A C   1 
ATOM   436  O O   . HIS A 1 53  ? -9.066  21.835  45.805  1.00 23.38  ? 97  HIS A O   1 
ATOM   437  C CB  . HIS A 1 53  ? -11.255 23.690  46.728  1.00 26.86  ? 97  HIS A CB  1 
ATOM   438  C CG  . HIS A 1 53  ? -10.958 24.105  48.137  1.00 22.99  ? 97  HIS A CG  1 
ATOM   439  N ND1 . HIS A 1 53  ? -10.819 25.422  48.511  1.00 26.46  ? 97  HIS A ND1 1 
ATOM   440  C CD2 . HIS A 1 53  ? -10.743 23.374  49.256  1.00 24.58  ? 97  HIS A CD2 1 
ATOM   441  C CE1 . HIS A 1 53  ? -10.528 25.487  49.798  1.00 27.41  ? 97  HIS A CE1 1 
ATOM   442  N NE2 . HIS A 1 53  ? -10.475 24.257  50.273  1.00 26.87  ? 97  HIS A NE2 1 
ATOM   443  N N   . PRO A 1 54  ? -7.770  23.598  46.343  1.00 21.74  ? 98  PRO A N   1 
ATOM   444  C CA  . PRO A 1 54  ? -6.532  22.846  46.588  1.00 23.62  ? 98  PRO A CA  1 
ATOM   445  C C   . PRO A 1 54  ? -6.527  21.855  47.753  1.00 26.14  ? 98  PRO A C   1 
ATOM   446  O O   . PRO A 1 54  ? -5.468  21.416  48.192  1.00 28.59  ? 98  PRO A O   1 
ATOM   447  C CB  . PRO A 1 54  ? -5.501  23.950  46.771  1.00 19.71  ? 98  PRO A CB  1 
ATOM   448  C CG  . PRO A 1 54  ? -6.288  24.984  47.501  1.00 22.34  ? 98  PRO A CG  1 
ATOM   449  C CD  . PRO A 1 54  ? -7.590  25.015  46.707  1.00 20.52  ? 98  PRO A CD  1 
ATOM   450  N N   . CYS A 1 55  ? -7.701  21.515  48.264  1.00 27.48  ? 99  CYS A N   1 
ATOM   451  C CA  . CYS A 1 55  ? -7.784  20.553  49.352  1.00 27.51  ? 99  CYS A CA  1 
ATOM   452  C C   . CYS A 1 55  ? -8.702  19.418  48.951  1.00 25.10  ? 99  CYS A C   1 
ATOM   453  O O   . CYS A 1 55  ? -9.001  18.548  49.756  1.00 22.60  ? 99  CYS A O   1 
ATOM   454  C CB  . CYS A 1 55  ? -8.313  21.197  50.635  1.00 27.39  ? 99  CYS A CB  1 
ATOM   455  S SG  . CYS A 1 55  ? -7.042  21.989  51.664  1.00 29.40  ? 99  CYS A SG  1 
ATOM   456  N N   . ASN A 1 56  ? -9.140  19.429  47.697  1.00 24.49  ? 100 ASN A N   1 
ATOM   457  C CA  . ASN A 1 56  ? -10.037 18.398  47.211  1.00 29.11  ? 100 ASN A CA  1 
ATOM   458  C C   . ASN A 1 56  ? -9.594  17.806  45.888  1.00 27.63  ? 100 ASN A C   1 
ATOM   459  O O   . ASN A 1 56  ? -10.416 17.483  45.038  1.00 33.30  ? 100 ASN A O   1 
ATOM   460  C CB  . ASN A 1 56  ? -11.451 18.966  47.091  1.00 26.27  ? 100 ASN A CB  1 
ATOM   461  C CG  . ASN A 1 56  ? -12.053 19.287  48.441  1.00 36.28  ? 100 ASN A CG  1 
ATOM   462  O OD1 . ASN A 1 56  ? -12.507 18.393  49.163  1.00 37.95  ? 100 ASN A OD1 1 
ATOM   463  N ND2 . ASN A 1 56  ? -12.038 20.566  48.807  1.00 41.88  ? 100 ASN A ND2 1 
ATOM   464  N N   . ILE A 1 57  ? -8.288  17.665  45.717  1.00 29.42  ? 101 ILE A N   1 
ATOM   465  C CA  . ILE A 1 57  ? -7.755  17.081  44.496  1.00 30.23  ? 101 ILE A CA  1 
ATOM   466  C C   . ILE A 1 57  ? -7.815  15.561  44.647  1.00 30.25  ? 101 ILE A C   1 
ATOM   467  O O   . ILE A 1 57  ? -7.608  15.031  45.740  1.00 30.84  ? 101 ILE A O   1 
ATOM   468  C CB  . ILE A 1 57  ? -6.293  17.513  44.261  1.00 26.72  ? 101 ILE A CB  1 
ATOM   469  C CG1 . ILE A 1 57  ? -6.173  19.039  44.359  1.00 24.30  ? 101 ILE A CG1 1 
ATOM   470  C CG2 . ILE A 1 57  ? -5.832  17.038  42.896  1.00 29.82  ? 101 ILE A CG2 1 
ATOM   471  C CD1 . ILE A 1 57  ? -7.047  19.785  43.362  1.00 24.88  ? 101 ILE A CD1 1 
ATOM   472  N N   . THR A 1 58  ? -8.115  14.861  43.560  1.00 28.42  ? 102 THR A N   1 
ATOM   473  C CA  . THR A 1 58  ? -8.194  13.401  43.602  1.00 34.24  ? 102 THR A CA  1 
ATOM   474  C C   . THR A 1 58  ? -7.317  12.825  42.502  1.00 30.27  ? 102 THR A C   1 
ATOM   475  O O   . THR A 1 58  ? -6.862  13.557  41.626  1.00 27.16  ? 102 THR A O   1 
ATOM   476  C CB  . THR A 1 58  ? -9.640  12.904  43.374  1.00 36.53  ? 102 THR A CB  1 
ATOM   477  O OG1 . THR A 1 58  ? -10.043 13.212  42.034  1.00 41.14  ? 102 THR A OG1 1 
ATOM   478  C CG2 . THR A 1 58  ? -10.596 13.572  44.346  1.00 32.09  ? 102 THR A CG2 1 
ATOM   479  N N   . GLU A 1 59  ? -7.082  11.517  42.545  1.00 32.12  ? 103 GLU A N   1 
ATOM   480  C CA  . GLU A 1 59  ? -6.259  10.870  41.526  1.00 37.81  ? 103 GLU A CA  1 
ATOM   481  C C   . GLU A 1 59  ? -6.814  11.131  40.131  1.00 36.08  ? 103 GLU A C   1 
ATOM   482  O O   . GLU A 1 59  ? -6.067  11.420  39.197  1.00 38.27  ? 103 GLU A O   1 
ATOM   483  C CB  . GLU A 1 59  ? -6.181  9.353   41.758  1.00 36.78  ? 103 GLU A CB  1 
ATOM   484  C CG  . GLU A 1 59  ? -5.498  8.941   43.052  1.00 49.61  ? 103 GLU A CG  1 
ATOM   485  C CD  . GLU A 1 59  ? -6.474  8.740   44.201  1.00 60.87  ? 103 GLU A CD  1 
ATOM   486  O OE1 . GLU A 1 59  ? -7.290  9.655   44.468  1.00 58.92  ? 103 GLU A OE1 1 
ATOM   487  O OE2 . GLU A 1 59  ? -6.418  7.663   44.840  1.00 60.65  ? 103 GLU A OE2 1 
ATOM   488  N N   . GLU A 1 60  ? -8.132  11.033  39.996  1.00 39.25  ? 104 GLU A N   1 
ATOM   489  C CA  . GLU A 1 60  ? -8.780  11.243  38.711  1.00 39.11  ? 104 GLU A CA  1 
ATOM   490  C C   . GLU A 1 60  ? -8.469  12.597  38.085  1.00 38.33  ? 104 GLU A C   1 
ATOM   491  O O   . GLU A 1 60  ? -8.397  12.714  36.864  1.00 36.89  ? 104 GLU A O   1 
ATOM   492  C CB  . GLU A 1 60  ? -10.288 11.052  38.852  1.00 52.54  ? 104 GLU A CB  1 
ATOM   493  C CG  . GLU A 1 60  ? -10.660 9.614   39.167  1.00 68.48  ? 104 GLU A CG  1 
ATOM   494  C CD  . GLU A 1 60  ? -10.116 8.632   38.134  1.00 77.62  ? 104 GLU A CD  1 
ATOM   495  O OE1 . GLU A 1 60  ? -10.115 7.412   38.415  1.00 79.43  ? 104 GLU A OE1 1 
ATOM   496  O OE2 . GLU A 1 60  ? -9.695  9.076   37.039  1.00 76.11  ? 104 GLU A OE2 1 
ATOM   497  N N   . ASP A 1 61  ? -8.286  13.622  38.909  1.00 35.15  ? 105 ASP A N   1 
ATOM   498  C CA  . ASP A 1 61  ? -7.957  14.929  38.369  1.00 28.73  ? 105 ASP A CA  1 
ATOM   499  C C   . ASP A 1 61  ? -6.672  14.827  37.547  1.00 26.13  ? 105 ASP A C   1 
ATOM   500  O O   . ASP A 1 61  ? -6.512  15.529  36.558  1.00 25.58  ? 105 ASP A O   1 
ATOM   501  C CB  . ASP A 1 61  ? -7.775  15.960  39.492  1.00 34.29  ? 105 ASP A CB  1 
ATOM   502  C CG  . ASP A 1 61  ? -9.093  16.395  40.116  1.00 28.77  ? 105 ASP A CG  1 
ATOM   503  O OD1 . ASP A 1 61  ? -10.048 16.671  39.363  1.00 32.05  ? 105 ASP A OD1 1 
ATOM   504  O OD2 . ASP A 1 61  ? -9.171  16.479  41.358  1.00 27.71  ? 105 ASP A OD2 1 
ATOM   505  N N   . TYR A 1 62  ? -5.766  13.938  37.945  1.00 24.78  ? 106 TYR A N   1 
ATOM   506  C CA  . TYR A 1 62  ? -4.501  13.771  37.229  1.00 26.53  ? 106 TYR A CA  1 
ATOM   507  C C   . TYR A 1 62  ? -4.511  12.726  36.117  1.00 28.12  ? 106 TYR A C   1 
ATOM   508  O O   . TYR A 1 62  ? -3.529  12.598  35.375  1.00 26.14  ? 106 TYR A O   1 
ATOM   509  C CB  . TYR A 1 62  ? -3.371  13.429  38.206  1.00 20.60  ? 106 TYR A CB  1 
ATOM   510  C CG  . TYR A 1 62  ? -2.885  14.612  39.009  1.00 26.84  ? 106 TYR A CG  1 
ATOM   511  C CD1 . TYR A 1 62  ? -3.185  14.739  40.369  1.00 16.02  ? 106 TYR A CD1 1 
ATOM   512  C CD2 . TYR A 1 62  ? -2.138  15.620  38.404  1.00 21.74  ? 106 TYR A CD2 1 
ATOM   513  C CE1 . TYR A 1 62  ? -2.752  15.845  41.099  1.00 18.12  ? 106 TYR A CE1 1 
ATOM   514  C CE2 . TYR A 1 62  ? -1.707  16.722  39.125  1.00 17.61  ? 106 TYR A CE2 1 
ATOM   515  C CZ  . TYR A 1 62  ? -2.015  16.831  40.465  1.00 14.89  ? 106 TYR A CZ  1 
ATOM   516  O OH  . TYR A 1 62  ? -1.590  17.938  41.158  1.00 22.02  ? 106 TYR A OH  1 
ATOM   517  N N   . GLN A 1 63  ? -5.603  11.978  35.993  1.00 27.35  ? 107 GLN A N   1 
ATOM   518  C CA  . GLN A 1 63  ? -5.690  10.945  34.960  1.00 30.75  ? 107 GLN A CA  1 
ATOM   519  C C   . GLN A 1 63  ? -5.361  11.438  33.543  1.00 27.16  ? 107 GLN A C   1 
ATOM   520  O O   . GLN A 1 63  ? -4.659  10.766  32.794  1.00 31.13  ? 107 GLN A O   1 
ATOM   521  C CB  . GLN A 1 63  ? -7.070  10.287  34.966  1.00 35.36  ? 107 GLN A CB  1 
ATOM   522  C CG  . GLN A 1 63  ? -7.148  9.102   34.017  1.00 45.89  ? 107 GLN A CG  1 
ATOM   523  C CD  . GLN A 1 63  ? -6.114  8.038   34.336  1.00 51.92  ? 107 GLN A CD  1 
ATOM   524  O OE1 . GLN A 1 63  ? -5.779  7.208   33.488  1.00 58.31  ? 107 GLN A OE1 1 
ATOM   525  N NE2 . GLN A 1 63  ? -5.607  8.051   35.568  1.00 49.21  ? 107 GLN A NE2 1 
ATOM   526  N N   . PRO A 1 64  ? -5.877  12.606  33.147  1.00 22.70  ? 108 PRO A N   1 
ATOM   527  C CA  . PRO A 1 64  ? -5.542  13.064  31.796  1.00 24.55  ? 108 PRO A CA  1 
ATOM   528  C C   . PRO A 1 64  ? -4.030  13.223  31.633  1.00 26.71  ? 108 PRO A C   1 
ATOM   529  O O   . PRO A 1 64  ? -3.466  12.880  30.591  1.00 28.34  ? 108 PRO A O   1 
ATOM   530  C CB  . PRO A 1 64  ? -6.279  14.393  31.692  1.00 23.28  ? 108 PRO A CB  1 
ATOM   531  C CG  . PRO A 1 64  ? -7.512  14.134  32.519  1.00 21.51  ? 108 PRO A CG  1 
ATOM   532  C CD  . PRO A 1 64  ? -6.929  13.445  33.743  1.00 21.26  ? 108 PRO A CD  1 
ATOM   533  N N   . LEU A 1 65  ? -3.370  13.741  32.666  1.00 24.99  ? 109 LEU A N   1 
ATOM   534  C CA  . LEU A 1 65  ? -1.922  13.921  32.609  1.00 24.27  ? 109 LEU A CA  1 
ATOM   535  C C   . LEU A 1 65  ? -1.255  12.551  32.577  1.00 24.79  ? 109 LEU A C   1 
ATOM   536  O O   . LEU A 1 65  ? -0.297  12.332  31.835  1.00 23.00  ? 109 LEU A O   1 
ATOM   537  C CB  . LEU A 1 65  ? -1.431  14.717  33.825  1.00 22.51  ? 109 LEU A CB  1 
ATOM   538  C CG  . LEU A 1 65  ? 0.074   14.948  33.965  1.00 26.40  ? 109 LEU A CG  1 
ATOM   539  C CD1 . LEU A 1 65  ? 0.623   15.682  32.749  1.00 19.57  ? 109 LEU A CD1 1 
ATOM   540  C CD2 . LEU A 1 65  ? 0.334   15.742  35.226  1.00 28.75  ? 109 LEU A CD2 1 
ATOM   541  N N   . MET A 1 66  ? -1.784  11.629  33.377  1.00 21.15  ? 110 MET A N   1 
ATOM   542  C CA  . MET A 1 66  ? -1.246  10.278  33.457  1.00 23.84  ? 110 MET A CA  1 
ATOM   543  C C   . MET A 1 66  ? -1.253  9.601   32.092  1.00 25.56  ? 110 MET A C   1 
ATOM   544  O O   . MET A 1 66  ? -0.291  8.933   31.712  1.00 30.21  ? 110 MET A O   1 
ATOM   545  C CB  . MET A 1 66  ? -2.068  9.444   34.444  1.00 25.75  ? 110 MET A CB  1 
ATOM   546  C CG  . MET A 1 66  ? -2.018  9.926   35.883  1.00 29.08  ? 110 MET A CG  1 
ATOM   547  S SD  . MET A 1 66  ? -0.405  9.649   36.650  1.00 36.95  ? 110 MET A SD  1 
ATOM   548  C CE  . MET A 1 66  ? 0.400   11.187  36.299  1.00 37.04  ? 110 MET A CE  1 
ATOM   549  N N   . LYS A 1 67  ? -2.342  9.778   31.354  1.00 29.04  ? 111 LYS A N   1 
ATOM   550  C CA  . LYS A 1 67  ? -2.467  9.169   30.037  1.00 30.17  ? 111 LYS A CA  1 
ATOM   551  C C   . LYS A 1 67  ? -1.462  9.784   29.065  1.00 26.96  ? 111 LYS A C   1 
ATOM   552  O O   . LYS A 1 67  ? -0.678  9.068   28.455  1.00 25.39  ? 111 LYS A O   1 
ATOM   553  C CB  . LYS A 1 67  ? -3.896  9.339   29.507  1.00 33.59  ? 111 LYS A CB  1 
ATOM   554  C CG  . LYS A 1 67  ? -4.266  8.373   28.383  1.00 45.38  ? 111 LYS A CG  1 
ATOM   555  C CD  . LYS A 1 67  ? -3.475  8.639   27.107  1.00 54.16  ? 111 LYS A CD  1 
ATOM   556  C CE  . LYS A 1 67  ? -3.758  7.585   26.039  1.00 62.67  ? 111 LYS A CE  1 
ATOM   557  N NZ  . LYS A 1 67  ? -3.005  7.846   24.769  1.00 63.49  ? 111 LYS A NZ  1 
ATOM   558  N N   . LEU A 1 68  ? -1.480  11.105  28.921  1.00 24.66  ? 112 LEU A N   1 
ATOM   559  C CA  . LEU A 1 68  ? -0.548  11.770  28.018  1.00 23.48  ? 112 LEU A CA  1 
ATOM   560  C C   . LEU A 1 68  ? 0.898   11.440  28.385  1.00 27.30  ? 112 LEU A C   1 
ATOM   561  O O   . LEU A 1 68  ? 1.795   11.518  27.541  1.00 26.89  ? 112 LEU A O   1 
ATOM   562  C CB  . LEU A 1 68  ? -0.761  13.284  28.060  1.00 20.33  ? 112 LEU A CB  1 
ATOM   563  C CG  . LEU A 1 68  ? -2.090  13.756  27.458  1.00 30.61  ? 112 LEU A CG  1 
ATOM   564  C CD1 . LEU A 1 68  ? -2.311  15.228  27.756  1.00 21.71  ? 112 LEU A CD1 1 
ATOM   565  C CD2 . LEU A 1 68  ? -2.084  13.500  25.957  1.00 27.67  ? 112 LEU A CD2 1 
ATOM   566  N N   . GLY A 1 69  ? 1.117   11.059  29.642  1.00 23.46  ? 113 GLY A N   1 
ATOM   567  C CA  . GLY A 1 69  ? 2.459   10.732  30.089  1.00 25.82  ? 113 GLY A CA  1 
ATOM   568  C C   . GLY A 1 69  ? 2.817   9.254   30.147  1.00 30.57  ? 113 GLY A C   1 
ATOM   569  O O   . GLY A 1 69  ? 3.830   8.896   30.752  1.00 34.82  ? 113 GLY A O   1 
ATOM   570  N N   . THR A 1 70  ? 2.003   8.396   29.533  1.00 28.43  ? 114 THR A N   1 
ATOM   571  C CA  . THR A 1 70  ? 2.269   6.959   29.525  1.00 25.06  ? 114 THR A CA  1 
ATOM   572  C C   . THR A 1 70  ? 3.699   6.761   29.067  1.00 26.60  ? 114 THR A C   1 
ATOM   573  O O   . THR A 1 70  ? 4.140   7.394   28.107  1.00 33.16  ? 114 THR A O   1 
ATOM   574  C CB  . THR A 1 70  ? 1.357   6.186   28.526  1.00 33.31  ? 114 THR A CB  1 
ATOM   575  O OG1 . THR A 1 70  ? -0.014  6.511   28.757  1.00 36.23  ? 114 THR A OG1 1 
ATOM   576  C CG2 . THR A 1 70  ? 1.523   4.686   28.711  1.00 33.26  ? 114 THR A CG2 1 
ATOM   577  N N   . GLN A 1 71  ? 4.426   5.885   29.745  1.00 29.01  ? 115 GLN A N   1 
ATOM   578  C CA  . GLN A 1 71  ? 5.808   5.628   29.371  1.00 29.67  ? 115 GLN A CA  1 
ATOM   579  C C   . GLN A 1 71  ? 6.211   4.215   29.757  1.00 30.42  ? 115 GLN A C   1 
ATOM   580  O O   . GLN A 1 71  ? 5.903   3.745   30.849  1.00 29.94  ? 115 GLN A O   1 
ATOM   581  C CB  . GLN A 1 71  ? 6.725   6.643   30.052  1.00 25.82  ? 115 GLN A CB  1 
ATOM   582  C CG  . GLN A 1 71  ? 8.168   6.596   29.594  1.00 24.69  ? 115 GLN A CG  1 
ATOM   583  C CD  . GLN A 1 71  ? 9.004   7.676   30.251  1.00 25.10  ? 115 GLN A CD  1 
ATOM   584  O OE1 . GLN A 1 71  ? 10.154  7.906   29.877  1.00 24.75  ? 115 GLN A OE1 1 
ATOM   585  N NE2 . GLN A 1 71  ? 8.427   8.342   31.239  1.00 18.37  ? 115 GLN A NE2 1 
ATOM   586  N N   . THR A 1 72  ? 6.903   3.539   28.852  1.00 34.06  ? 116 THR A N   1 
ATOM   587  C CA  . THR A 1 72  ? 7.336   2.173   29.099  1.00 37.06  ? 116 THR A CA  1 
ATOM   588  C C   . THR A 1 72  ? 8.703   2.123   29.754  1.00 35.94  ? 116 THR A C   1 
ATOM   589  O O   . THR A 1 72  ? 9.720   2.402   29.122  1.00 38.91  ? 116 THR A O   1 
ATOM   590  C CB  . THR A 1 72  ? 7.417   1.359   27.795  1.00 35.90  ? 116 THR A CB  1 
ATOM   591  O OG1 . THR A 1 72  ? 6.134   1.328   27.159  1.00 47.52  ? 116 THR A OG1 1 
ATOM   592  C CG2 . THR A 1 72  ? 7.863   -0.061  28.092  1.00 36.95  ? 116 THR A CG2 1 
ATOM   593  N N   . VAL A 1 73  ? 8.729   1.763   31.026  1.00 31.74  ? 117 VAL A N   1 
ATOM   594  C CA  . VAL A 1 73  ? 9.990   1.653   31.733  1.00 30.28  ? 117 VAL A CA  1 
ATOM   595  C C   . VAL A 1 73  ? 10.271  0.171   31.900  1.00 27.44  ? 117 VAL A C   1 
ATOM   596  O O   . VAL A 1 73  ? 9.431   -0.563  32.414  1.00 32.52  ? 117 VAL A O   1 
ATOM   597  C CB  . VAL A 1 73  ? 9.909   2.300   33.121  1.00 26.71  ? 117 VAL A CB  1 
ATOM   598  C CG1 . VAL A 1 73  ? 11.246  2.220   33.802  1.00 26.67  ? 117 VAL A CG1 1 
ATOM   599  C CG2 . VAL A 1 73  ? 9.478   3.748   32.990  1.00 33.49  ? 117 VAL A CG2 1 
ATOM   600  N N   . PRO A 1 74  ? 11.438  -0.299  31.435  1.00 26.92  ? 118 PRO A N   1 
ATOM   601  C CA  . PRO A 1 74  ? 11.742  -1.725  31.588  1.00 25.84  ? 118 PRO A CA  1 
ATOM   602  C C   . PRO A 1 74  ? 11.461  -2.070  33.052  1.00 25.61  ? 118 PRO A C   1 
ATOM   603  O O   . PRO A 1 74  ? 12.192  -1.653  33.949  1.00 31.91  ? 118 PRO A O   1 
ATOM   604  C CB  . PRO A 1 74  ? 13.219  -1.789  31.225  1.00 25.21  ? 118 PRO A CB  1 
ATOM   605  C CG  . PRO A 1 74  ? 13.342  -0.709  30.187  1.00 20.78  ? 118 PRO A CG  1 
ATOM   606  C CD  . PRO A 1 74  ? 12.556  0.417   30.798  1.00 20.36  ? 118 PRO A CD  1 
ATOM   607  N N   . CYS A 1 75  ? 10.391  -2.818  33.287  1.00 22.34  ? 119 CYS A N   1 
ATOM   608  C CA  . CYS A 1 75  ? 9.979   -3.137  34.637  1.00 26.87  ? 119 CYS A CA  1 
ATOM   609  C C   . CYS A 1 75  ? 10.981  -3.786  35.587  1.00 24.24  ? 119 CYS A C   1 
ATOM   610  O O   . CYS A 1 75  ? 10.852  -3.642  36.796  1.00 26.55  ? 119 CYS A O   1 
ATOM   611  C CB  . CYS A 1 75  ? 8.671   -3.946  34.612  1.00 24.89  ? 119 CYS A CB  1 
ATOM   612  S SG  . CYS A 1 75  ? 8.678   -5.653  33.954  1.00 32.17  ? 119 CYS A SG  1 
ATOM   613  N N   . ASN A 1 76  ? 11.984  -4.479  35.070  1.00 23.50  ? 120 ASN A N   1 
ATOM   614  C CA  . ASN A 1 76  ? 12.947  -5.122  35.960  1.00 23.38  ? 120 ASN A CA  1 
ATOM   615  C C   . ASN A 1 76  ? 14.139  -4.237  36.304  1.00 22.21  ? 120 ASN A C   1 
ATOM   616  O O   . ASN A 1 76  ? 15.091  -4.699  36.934  1.00 29.39  ? 120 ASN A O   1 
ATOM   617  C CB  . ASN A 1 76  ? 13.440  -6.439  35.342  1.00 22.41  ? 120 ASN A CB  1 
ATOM   618  C CG  . ASN A 1 76  ? 14.129  -6.235  34.007  1.00 26.25  ? 120 ASN A CG  1 
ATOM   619  O OD1 . ASN A 1 76  ? 13.645  -5.487  33.157  1.00 27.73  ? 120 ASN A OD1 1 
ATOM   620  N ND2 . ASN A 1 76  ? 15.257  -6.910  33.809  1.00 19.41  ? 120 ASN A ND2 1 
ATOM   621  N N   . LYS A 1 77  ? 14.080  -2.967  35.910  1.00 21.45  ? 121 LYS A N   1 
ATOM   622  C CA  . LYS A 1 77  ? 15.177  -2.029  36.162  1.00 21.96  ? 121 LYS A CA  1 
ATOM   623  C C   . LYS A 1 77  ? 14.743  -0.803  36.979  1.00 26.03  ? 121 LYS A C   1 
ATOM   624  O O   . LYS A 1 77  ? 15.228  0.317   36.760  1.00 27.13  ? 121 LYS A O   1 
ATOM   625  C CB  . LYS A 1 77  ? 15.766  -1.553  34.831  1.00 26.76  ? 121 LYS A CB  1 
ATOM   626  C CG  . LYS A 1 77  ? 15.981  -2.655  33.803  1.00 33.93  ? 121 LYS A CG  1 
ATOM   627  C CD  . LYS A 1 77  ? 16.982  -3.692  34.283  1.00 33.69  ? 121 LYS A CD  1 
ATOM   628  C CE  . LYS A 1 77  ? 18.392  -3.149  34.262  1.00 39.35  ? 121 LYS A CE  1 
ATOM   629  N NZ  . LYS A 1 77  ? 19.342  -4.101  34.913  1.00 49.47  ? 121 LYS A NZ  1 
ATOM   630  N N   . ILE A 1 78  ? 13.847  -1.008  37.930  1.00 14.89  ? 122 ILE A N   1 
ATOM   631  C CA  . ILE A 1 78  ? 13.374  0.108   38.725  1.00 17.77  ? 122 ILE A CA  1 
ATOM   632  C C   . ILE A 1 78  ? 14.123  0.290   40.032  1.00 16.54  ? 122 ILE A C   1 
ATOM   633  O O   . ILE A 1 78  ? 14.449  -0.673  40.726  1.00 18.20  ? 122 ILE A O   1 
ATOM   634  C CB  . ILE A 1 78  ? 11.855  -0.023  38.993  1.00 21.00  ? 122 ILE A CB  1 
ATOM   635  C CG1 . ILE A 1 78  ? 11.104  0.151   37.669  1.00 23.00  ? 122 ILE A CG1 1 
ATOM   636  C CG2 . ILE A 1 78  ? 11.398  1.014   40.000  1.00 18.57  ? 122 ILE A CG2 1 
ATOM   637  C CD1 . ILE A 1 78  ? 9.608   0.093   37.791  1.00 36.12  ? 122 ILE A CD1 1 
ATOM   638  N N   . LEU A 1 79  ? 14.420  1.548   40.342  1.00 26.39  ? 123 LEU A N   1 
ATOM   639  C CA  . LEU A 1 79  ? 15.109  1.894   41.577  1.00 20.88  ? 123 LEU A CA  1 
ATOM   640  C C   . LEU A 1 79  ? 14.232  2.808   42.391  1.00 16.93  ? 123 LEU A C   1 
ATOM   641  O O   . LEU A 1 79  ? 13.988  3.951   42.008  1.00 22.25  ? 123 LEU A O   1 
ATOM   642  C CB  . LEU A 1 79  ? 16.442  2.610   41.309  1.00 18.02  ? 123 LEU A CB  1 
ATOM   643  C CG  . LEU A 1 79  ? 17.149  3.097   42.591  1.00 19.09  ? 123 LEU A CG  1 
ATOM   644  C CD1 . LEU A 1 79  ? 17.422  1.906   43.514  1.00 15.06  ? 123 LEU A CD1 1 
ATOM   645  C CD2 . LEU A 1 79  ? 18.455  3.814   42.252  1.00 15.23  ? 123 LEU A CD2 1 
ATOM   646  N N   . LEU A 1 80  ? 13.732  2.295   43.503  1.00 18.05  ? 124 LEU A N   1 
ATOM   647  C CA  . LEU A 1 80  ? 12.920  3.100   44.396  1.00 14.52  ? 124 LEU A CA  1 
ATOM   648  C C   . LEU A 1 80  ? 13.930  3.651   45.409  1.00 19.81  ? 124 LEU A C   1 
ATOM   649  O O   . LEU A 1 80  ? 14.997  3.076   45.599  1.00 19.12  ? 124 LEU A O   1 
ATOM   650  C CB  . LEU A 1 80  ? 11.877  2.230   45.099  1.00 15.43  ? 124 LEU A CB  1 
ATOM   651  C CG  . LEU A 1 80  ? 10.904  1.447   44.212  1.00 18.25  ? 124 LEU A CG  1 
ATOM   652  C CD1 . LEU A 1 80  ? 10.015  0.571   45.096  1.00 17.14  ? 124 LEU A CD1 1 
ATOM   653  C CD2 . LEU A 1 80  ? 10.065  2.411   43.366  1.00 14.17  ? 124 LEU A CD2 1 
ATOM   654  N N   . TRP A 1 81  ? 13.614  4.767   46.048  1.00 21.63  ? 125 TRP A N   1 
ATOM   655  C CA  . TRP A 1 81  ? 14.543  5.336   47.009  1.00 27.18  ? 125 TRP A CA  1 
ATOM   656  C C   . TRP A 1 81  ? 13.789  6.103   48.061  1.00 23.35  ? 125 TRP A C   1 
ATOM   657  O O   . TRP A 1 81  ? 12.704  6.615   47.816  1.00 31.90  ? 125 TRP A O   1 
ATOM   658  C CB  . TRP A 1 81  ? 15.547  6.272   46.317  1.00 22.44  ? 125 TRP A CB  1 
ATOM   659  C CG  . TRP A 1 81  ? 14.899  7.427   45.630  1.00 27.85  ? 125 TRP A CG  1 
ATOM   660  C CD1 . TRP A 1 81  ? 14.386  7.444   44.364  1.00 26.09  ? 125 TRP A CD1 1 
ATOM   661  C CD2 . TRP A 1 81  ? 14.623  8.715   46.193  1.00 26.82  ? 125 TRP A CD2 1 
ATOM   662  N NE1 . TRP A 1 81  ? 13.804  8.660   44.104  1.00 24.78  ? 125 TRP A NE1 1 
ATOM   663  C CE2 . TRP A 1 81  ? 13.933  9.461   45.208  1.00 30.00  ? 125 TRP A CE2 1 
ATOM   664  C CE3 . TRP A 1 81  ? 14.887  9.313   47.434  1.00 25.46  ? 125 TRP A CE3 1 
ATOM   665  C CZ2 . TRP A 1 81  ? 13.501  10.780  45.427  1.00 31.62  ? 125 TRP A CZ2 1 
ATOM   666  C CZ3 . TRP A 1 81  ? 14.458  10.623  47.655  1.00 27.67  ? 125 TRP A CZ3 1 
ATOM   667  C CH2 . TRP A 1 81  ? 13.773  11.341  46.653  1.00 35.45  ? 125 TRP A CH2 1 
ATOM   668  N N   . SER A 1 82  ? 14.371  6.196   49.243  1.00 26.72  ? 126 SER A N   1 
ATOM   669  C CA  . SER A 1 82  ? 13.706  6.914   50.306  1.00 22.56  ? 126 SER A CA  1 
ATOM   670  C C   . SER A 1 82  ? 14.704  7.806   51.027  1.00 26.80  ? 126 SER A C   1 
ATOM   671  O O   . SER A 1 82  ? 15.683  7.330   51.600  1.00 28.64  ? 126 SER A O   1 
ATOM   672  C CB  . SER A 1 82  ? 13.063  5.916   51.268  1.00 18.38  ? 126 SER A CB  1 
ATOM   673  O OG  . SER A 1 82  ? 12.245  6.574   52.209  1.00 33.24  ? 126 SER A OG  1 
ATOM   674  N N   . ARG A 1 83  ? 14.458  9.108   50.951  1.00 27.56  ? 127 ARG A N   1 
ATOM   675  C CA  . ARG A 1 83  ? 15.287  10.111  51.597  1.00 22.53  ? 127 ARG A CA  1 
ATOM   676  C C   . ARG A 1 83  ? 16.785  9.967   51.355  1.00 26.76  ? 127 ARG A C   1 
ATOM   677  O O   . ARG A 1 83  ? 17.598  10.085  52.271  1.00 18.39  ? 127 ARG A O   1 
ATOM   678  C CB  . ARG A 1 83  ? 14.951  10.121  53.087  1.00 30.35  ? 127 ARG A CB  1 
ATOM   679  C CG  . ARG A 1 83  ? 13.499  10.529  53.294  1.00 37.71  ? 127 ARG A CG  1 
ATOM   680  C CD  . ARG A 1 83  ? 12.950  10.188  54.650  1.00 41.70  ? 127 ARG A CD  1 
ATOM   681  N NE  . ARG A 1 83  ? 11.534  10.539  54.731  1.00 42.76  ? 127 ARG A NE  1 
ATOM   682  C CZ  . ARG A 1 83  ? 10.782  10.373  55.816  1.00 53.36  ? 127 ARG A CZ  1 
ATOM   683  N NH1 . ARG A 1 83  ? 11.308  9.858   56.923  1.00 49.22  ? 127 ARG A NH1 1 
ATOM   684  N NH2 . ARG A 1 83  ? 9.501   10.719  55.795  1.00 46.54  ? 127 ARG A NH2 1 
ATOM   685  N N   . ILE A 1 84  ? 17.133  9.730   50.094  1.00 26.54  ? 128 ILE A N   1 
ATOM   686  C CA  . ILE A 1 84  ? 18.521  9.583   49.672  1.00 24.50  ? 128 ILE A CA  1 
ATOM   687  C C   . ILE A 1 84  ? 18.514  9.976   48.193  1.00 27.20  ? 128 ILE A C   1 
ATOM   688  O O   . ILE A 1 84  ? 19.139  9.342   47.340  1.00 30.37  ? 128 ILE A O   1 
ATOM   689  C CB  . ILE A 1 84  ? 19.013  8.115   49.862  1.00 23.15  ? 128 ILE A CB  1 
ATOM   690  C CG1 . ILE A 1 84  ? 20.518  8.028   49.605  1.00 28.61  ? 128 ILE A CG1 1 
ATOM   691  C CG2 . ILE A 1 84  ? 18.266  7.174   48.922  1.00 21.40  ? 128 ILE A CG2 1 
ATOM   692  C CD1 . ILE A 1 84  ? 21.366  8.698   50.665  1.00 32.79  ? 128 ILE A CD1 1 
ATOM   693  N N   . LYS A 1 85  ? 17.786  11.051  47.916  1.00 30.11  ? 129 LYS A N   1 
ATOM   694  C CA  . LYS A 1 85  ? 17.610  11.579  46.569  1.00 34.32  ? 129 LYS A CA  1 
ATOM   695  C C   . LYS A 1 85  ? 18.858  11.687  45.702  1.00 34.77  ? 129 LYS A C   1 
ATOM   696  O O   . LYS A 1 85  ? 18.950  11.053  44.647  1.00 40.70  ? 129 LYS A O   1 
ATOM   697  C CB  . LYS A 1 85  ? 16.936  12.953  46.645  1.00 35.44  ? 129 LYS A CB  1 
ATOM   698  C CG  . LYS A 1 85  ? 16.465  13.521  45.310  1.00 33.98  ? 129 LYS A CG  1 
ATOM   699  C CD  . LYS A 1 85  ? 15.540  14.714  45.546  1.00 43.69  ? 129 LYS A CD  1 
ATOM   700  C CE  . LYS A 1 85  ? 14.923  15.243  44.258  1.00 47.53  ? 129 LYS A CE  1 
ATOM   701  N NZ  . LYS A 1 85  ? 15.933  15.867  43.351  1.00 51.59  ? 129 LYS A NZ  1 
ATOM   702  N N   . ASP A 1 86  ? 19.810  12.498  46.137  1.00 29.33  ? 130 ASP A N   1 
ATOM   703  C CA  . ASP A 1 86  ? 21.017  12.716  45.361  1.00 28.66  ? 130 ASP A CA  1 
ATOM   704  C C   . ASP A 1 86  ? 21.765  11.456  44.919  1.00 26.98  ? 130 ASP A C   1 
ATOM   705  O O   . ASP A 1 86  ? 22.074  11.304  43.737  1.00 27.32  ? 130 ASP A O   1 
ATOM   706  C CB  . ASP A 1 86  ? 21.953  13.687  46.107  1.00 32.33  ? 130 ASP A CB  1 
ATOM   707  C CG  . ASP A 1 86  ? 22.225  13.267  47.544  1.00 48.08  ? 130 ASP A CG  1 
ATOM   708  O OD1 . ASP A 1 86  ? 21.272  12.871  48.254  1.00 54.33  ? 130 ASP A OD1 1 
ATOM   709  O OD2 . ASP A 1 86  ? 23.397  13.349  47.968  1.00 50.56  ? 130 ASP A OD2 1 
ATOM   710  N N   . LEU A 1 87  ? 22.047  10.541  45.837  1.00 28.54  ? 131 LEU A N   1 
ATOM   711  C CA  . LEU A 1 87  ? 22.768  9.336   45.438  1.00 29.85  ? 131 LEU A CA  1 
ATOM   712  C C   . LEU A 1 87  ? 21.925  8.433   44.530  1.00 27.89  ? 131 LEU A C   1 
ATOM   713  O O   . LEU A 1 87  ? 22.443  7.818   43.592  1.00 20.82  ? 131 LEU A O   1 
ATOM   714  C CB  . LEU A 1 87  ? 23.249  8.551   46.664  1.00 25.73  ? 131 LEU A CB  1 
ATOM   715  C CG  . LEU A 1 87  ? 24.121  7.339   46.301  1.00 36.08  ? 131 LEU A CG  1 
ATOM   716  C CD1 . LEU A 1 87  ? 25.269  7.789   45.403  1.00 32.45  ? 131 LEU A CD1 1 
ATOM   717  C CD2 . LEU A 1 87  ? 24.651  6.663   47.565  1.00 31.15  ? 131 LEU A CD2 1 
ATOM   718  N N   . ALA A 1 88  ? 20.626  8.360   44.799  1.00 22.43  ? 132 ALA A N   1 
ATOM   719  C CA  . ALA A 1 88  ? 19.744  7.531   43.985  1.00 24.77  ? 132 ALA A CA  1 
ATOM   720  C C   . ALA A 1 88  ? 19.823  7.985   42.530  1.00 22.35  ? 132 ALA A C   1 
ATOM   721  O O   . ALA A 1 88  ? 19.873  7.171   41.607  1.00 23.99  ? 132 ALA A O   1 
ATOM   722  C CB  . ALA A 1 88  ? 18.309  7.643   44.487  1.00 18.92  ? 132 ALA A CB  1 
ATOM   723  N N   . HIS A 1 89  ? 19.862  9.295   42.338  1.00 17.70  ? 133 HIS A N   1 
ATOM   724  C CA  . HIS A 1 89  ? 19.907  9.867   41.000  1.00 27.23  ? 133 HIS A CA  1 
ATOM   725  C C   . HIS A 1 89  ? 21.294  9.918   40.358  1.00 26.77  ? 133 HIS A C   1 
ATOM   726  O O   . HIS A 1 89  ? 21.413  9.892   39.132  1.00 25.35  ? 133 HIS A O   1 
ATOM   727  C CB  . HIS A 1 89  ? 19.244  11.248  41.026  1.00 21.19  ? 133 HIS A CB  1 
ATOM   728  C CG  . HIS A 1 89  ? 17.765  11.191  41.266  1.00 30.37  ? 133 HIS A CG  1 
ATOM   729  N ND1 . HIS A 1 89  ? 17.053  12.238  41.808  1.00 43.70  ? 133 HIS A ND1 1 
ATOM   730  C CD2 . HIS A 1 89  ? 16.862  10.209  41.028  1.00 32.70  ? 133 HIS A CD2 1 
ATOM   731  C CE1 . HIS A 1 89  ? 15.777  11.903  41.895  1.00 39.15  ? 133 HIS A CE1 1 
ATOM   732  N NE2 . HIS A 1 89  ? 15.635  10.677  41.429  1.00 26.24  ? 133 HIS A NE2 1 
ATOM   733  N N   . GLN A 1 90  ? 22.347  9.991   41.165  1.00 30.63  ? 134 GLN A N   1 
ATOM   734  C CA  . GLN A 1 90  ? 23.684  9.986   40.587  1.00 30.85  ? 134 GLN A CA  1 
ATOM   735  C C   . GLN A 1 90  ? 23.868  8.582   40.020  1.00 31.64  ? 134 GLN A C   1 
ATOM   736  O O   . GLN A 1 90  ? 24.560  8.384   39.020  1.00 32.10  ? 134 GLN A O   1 
ATOM   737  C CB  . GLN A 1 90  ? 24.752  10.248  41.646  1.00 30.84  ? 134 GLN A CB  1 
ATOM   738  C CG  . GLN A 1 90  ? 24.715  11.627  42.267  1.00 38.20  ? 134 GLN A CG  1 
ATOM   739  C CD  . GLN A 1 90  ? 25.870  11.850  43.228  1.00 43.90  ? 134 GLN A CD  1 
ATOM   740  O OE1 . GLN A 1 90  ? 27.028  11.968  42.817  1.00 47.68  ? 134 GLN A OE1 1 
ATOM   741  N NE2 . GLN A 1 90  ? 25.561  11.899  44.518  1.00 47.61  ? 134 GLN A NE2 1 
ATOM   742  N N   . PHE A 1 91  ? 23.222  7.614   40.669  1.00 31.96  ? 135 PHE A N   1 
ATOM   743  C CA  . PHE A 1 91  ? 23.290  6.217   40.255  1.00 27.68  ? 135 PHE A CA  1 
ATOM   744  C C   . PHE A 1 91  ? 22.667  5.965   38.884  1.00 27.78  ? 135 PHE A C   1 
ATOM   745  O O   . PHE A 1 91  ? 23.297  5.358   38.015  1.00 29.36  ? 135 PHE A O   1 
ATOM   746  C CB  . PHE A 1 91  ? 22.618  5.309   41.295  1.00 25.01  ? 135 PHE A CB  1 
ATOM   747  C CG  . PHE A 1 91  ? 22.641  3.854   40.919  1.00 25.90  ? 135 PHE A CG  1 
ATOM   748  C CD1 . PHE A 1 91  ? 21.675  3.325   40.066  1.00 26.79  ? 135 PHE A CD1 1 
ATOM   749  C CD2 . PHE A 1 91  ? 23.680  3.029   41.345  1.00 21.55  ? 135 PHE A CD2 1 
ATOM   750  C CE1 . PHE A 1 91  ? 21.745  1.999   39.633  1.00 19.95  ? 135 PHE A CE1 1 
ATOM   751  C CE2 . PHE A 1 91  ? 23.759  1.700   40.917  1.00 27.95  ? 135 PHE A CE2 1 
ATOM   752  C CZ  . PHE A 1 91  ? 22.788  1.188   40.057  1.00 21.38  ? 135 PHE A CZ  1 
ATOM   753  N N   . THR A 1 92  ? 21.434  6.421   38.680  1.00 24.39  ? 136 THR A N   1 
ATOM   754  C CA  . THR A 1 92  ? 20.797  6.211   37.383  1.00 29.40  ? 136 THR A CA  1 
ATOM   755  C C   . THR A 1 92  ? 21.419  7.104   36.308  1.00 29.41  ? 136 THR A C   1 
ATOM   756  O O   . THR A 1 92  ? 21.236  6.873   35.112  1.00 28.30  ? 136 THR A O   1 
ATOM   757  C CB  . THR A 1 92  ? 19.266  6.430   37.456  1.00 27.58  ? 136 THR A CB  1 
ATOM   758  O OG1 . THR A 1 92  ? 18.978  7.739   37.961  1.00 25.15  ? 136 THR A OG1 1 
ATOM   759  C CG2 . THR A 1 92  ? 18.640  5.382   38.372  1.00 20.17  ? 136 THR A CG2 1 
ATOM   760  N N   . GLN A 1 93  ? 22.169  8.116   36.733  1.00 30.65  ? 137 GLN A N   1 
ATOM   761  C CA  . GLN A 1 93  ? 22.840  8.998   35.782  1.00 33.50  ? 137 GLN A CA  1 
ATOM   762  C C   . GLN A 1 93  ? 24.038  8.265   35.193  1.00 32.99  ? 137 GLN A C   1 
ATOM   763  O O   . GLN A 1 93  ? 24.509  8.600   34.108  1.00 29.15  ? 137 GLN A O   1 
ATOM   764  C CB  . GLN A 1 93  ? 23.299  10.291  36.467  1.00 33.25  ? 137 GLN A CB  1 
ATOM   765  C CG  . GLN A 1 93  ? 22.174  11.295  36.650  1.00 38.62  ? 137 GLN A CG  1 
ATOM   766  C CD  . GLN A 1 93  ? 21.483  11.625  35.334  1.00 41.27  ? 137 GLN A CD  1 
ATOM   767  O OE1 . GLN A 1 93  ? 20.274  11.863  35.295  1.00 36.45  ? 137 GLN A OE1 1 
ATOM   768  N NE2 . GLN A 1 93  ? 22.252  11.646  34.251  1.00 38.03  ? 137 GLN A NE2 1 
ATOM   769  N N   . VAL A 1 94  ? 24.521  7.257   35.916  1.00 30.66  ? 138 VAL A N   1 
ATOM   770  C CA  . VAL A 1 94  ? 25.657  6.465   35.462  1.00 34.80  ? 138 VAL A CA  1 
ATOM   771  C C   . VAL A 1 94  ? 25.152  5.168   34.849  1.00 36.69  ? 138 VAL A C   1 
ATOM   772  O O   . VAL A 1 94  ? 25.437  4.868   33.688  1.00 42.03  ? 138 VAL A O   1 
ATOM   773  C CB  . VAL A 1 94  ? 26.603  6.112   36.620  1.00 37.43  ? 138 VAL A CB  1 
ATOM   774  C CG1 . VAL A 1 94  ? 27.782  5.324   36.089  1.00 31.28  ? 138 VAL A CG1 1 
ATOM   775  C CG2 . VAL A 1 94  ? 27.069  7.382   37.322  1.00 36.09  ? 138 VAL A CG2 1 
ATOM   776  N N   . GLN A 1 95  ? 24.408  4.403   35.645  1.00 34.59  ? 139 GLN A N   1 
ATOM   777  C CA  . GLN A 1 95  ? 23.822  3.141   35.202  1.00 27.51  ? 139 GLN A CA  1 
ATOM   778  C C   . GLN A 1 95  ? 22.510  3.521   34.498  1.00 33.87  ? 139 GLN A C   1 
ATOM   779  O O   . GLN A 1 95  ? 21.418  3.328   35.038  1.00 34.78  ? 139 GLN A O   1 
ATOM   780  C CB  . GLN A 1 95  ? 23.541  2.255   36.422  1.00 25.20  ? 139 GLN A CB  1 
ATOM   781  C CG  . GLN A 1 95  ? 23.238  0.804   36.098  1.00 28.20  ? 139 GLN A CG  1 
ATOM   782  C CD  . GLN A 1 95  ? 24.439  0.083   35.504  1.00 41.15  ? 139 GLN A CD  1 
ATOM   783  O OE1 . GLN A 1 95  ? 25.470  -0.087  36.168  1.00 43.16  ? 139 GLN A OE1 1 
ATOM   784  N NE2 . GLN A 1 95  ? 24.316  -0.341  34.245  1.00 35.31  ? 139 GLN A NE2 1 
ATOM   785  N N   . ARG A 1 96  ? 22.630  4.068   33.290  1.00 38.30  ? 140 ARG A N   1 
ATOM   786  C CA  . ARG A 1 96  ? 21.477  4.529   32.522  1.00 42.56  ? 140 ARG A CA  1 
ATOM   787  C C   . ARG A 1 96  ? 20.405  3.515   32.142  1.00 40.20  ? 140 ARG A C   1 
ATOM   788  O O   . ARG A 1 96  ? 19.395  3.888   31.548  1.00 40.31  ? 140 ARG A O   1 
ATOM   789  C CB  . ARG A 1 96  ? 21.940  5.251   31.256  1.00 47.09  ? 140 ARG A CB  1 
ATOM   790  C CG  . ARG A 1 96  ? 22.590  6.605   31.506  1.00 55.29  ? 140 ARG A CG  1 
ATOM   791  C CD  . ARG A 1 96  ? 22.574  7.454   30.241  1.00 58.38  ? 140 ARG A CD  1 
ATOM   792  N NE  . ARG A 1 96  ? 23.393  8.653   30.368  1.00 66.72  ? 140 ARG A NE  1 
ATOM   793  C CZ  . ARG A 1 96  ? 23.169  9.634   31.236  1.00 72.93  ? 140 ARG A CZ  1 
ATOM   794  N NH1 . ARG A 1 96  ? 22.138  9.570   32.070  1.00 75.46  ? 140 ARG A NH1 1 
ATOM   795  N NH2 . ARG A 1 96  ? 23.983  10.682  31.273  1.00 78.30  ? 140 ARG A NH2 1 
ATOM   796  N N   . ASP A 1 97  ? 20.608  2.245   32.469  1.00 34.80  ? 141 ASP A N   1 
ATOM   797  C CA  . ASP A 1 97  ? 19.604  1.241   32.137  1.00 36.47  ? 141 ASP A CA  1 
ATOM   798  C C   . ASP A 1 97  ? 18.758  0.949   33.372  1.00 32.77  ? 141 ASP A C   1 
ATOM   799  O O   . ASP A 1 97  ? 18.011  -0.025  33.408  1.00 32.69  ? 141 ASP A O   1 
ATOM   800  C CB  . ASP A 1 97  ? 20.271  -0.036  31.608  1.00 39.00  ? 141 ASP A CB  1 
ATOM   801  C CG  . ASP A 1 97  ? 20.946  -0.847  32.698  1.00 49.24  ? 141 ASP A CG  1 
ATOM   802  O OD1 . ASP A 1 97  ? 21.626  -0.251  33.566  1.00 46.18  ? 141 ASP A OD1 1 
ATOM   803  O OD2 . ASP A 1 97  ? 20.803  -2.090  32.673  1.00 52.22  ? 141 ASP A OD2 1 
ATOM   804  N N   . MET A 1 98  ? 18.905  1.811   34.381  1.00 34.09  ? 142 MET A N   1 
ATOM   805  C CA  . MET A 1 98  ? 18.164  1.738   35.643  1.00 30.13  ? 142 MET A CA  1 
ATOM   806  C C   . MET A 1 98  ? 17.323  3.012   35.713  1.00 26.83  ? 142 MET A C   1 
ATOM   807  O O   . MET A 1 98  ? 17.733  4.049   35.199  1.00 34.02  ? 142 MET A O   1 
ATOM   808  C CB  . MET A 1 98  ? 19.121  1.693   36.835  1.00 30.32  ? 142 MET A CB  1 
ATOM   809  C CG  . MET A 1 98  ? 19.814  0.363   37.044  1.00 35.17  ? 142 MET A CG  1 
ATOM   810  S SD  . MET A 1 98  ? 18.673  -0.947  37.521  1.00 43.16  ? 142 MET A SD  1 
ATOM   811  C CE  . MET A 1 98  ? 18.645  -0.794  39.316  1.00 24.35  ? 142 MET A CE  1 
ATOM   812  N N   . PHE A 1 99  ? 16.160  2.956   36.351  1.00 29.86  ? 143 PHE A N   1 
ATOM   813  C CA  . PHE A 1 99  ? 15.301  4.139   36.402  1.00 25.26  ? 143 PHE A CA  1 
ATOM   814  C C   . PHE A 1 99  ? 14.603  4.396   37.732  1.00 23.80  ? 143 PHE A C   1 
ATOM   815  O O   . PHE A 1 99  ? 14.118  3.469   38.380  1.00 19.25  ? 143 PHE A O   1 
ATOM   816  C CB  . PHE A 1 99  ? 14.220  4.044   35.310  1.00 24.88  ? 143 PHE A CB  1 
ATOM   817  C CG  . PHE A 1 99  ? 14.766  3.806   33.924  1.00 29.50  ? 143 PHE A CG  1 
ATOM   818  C CD1 . PHE A 1 99  ? 14.993  4.870   33.057  1.00 31.14  ? 143 PHE A CD1 1 
ATOM   819  C CD2 . PHE A 1 99  ? 15.074  2.515   33.496  1.00 32.50  ? 143 PHE A CD2 1 
ATOM   820  C CE1 . PHE A 1 99  ? 15.523  4.658   31.775  1.00 36.64  ? 143 PHE A CE1 1 
ATOM   821  C CE2 . PHE A 1 99  ? 15.608  2.287   32.215  1.00 44.43  ? 143 PHE A CE2 1 
ATOM   822  C CZ  . PHE A 1 99  ? 15.832  3.364   31.353  1.00 38.39  ? 143 PHE A CZ  1 
ATOM   823  N N   . THR A 1 100 ? 14.564  5.666   38.127  1.00 20.37  ? 144 THR A N   1 
ATOM   824  C CA  . THR A 1 100 ? 13.867  6.083   39.336  1.00 23.57  ? 144 THR A CA  1 
ATOM   825  C C   . THR A 1 100 ? 12.650  6.841   38.814  1.00 25.35  ? 144 THR A C   1 
ATOM   826  O O   . THR A 1 100 ? 12.580  7.160   37.623  1.00 19.64  ? 144 THR A O   1 
ATOM   827  C CB  . THR A 1 100 ? 14.697  7.059   40.195  1.00 28.97  ? 144 THR A CB  1 
ATOM   828  O OG1 . THR A 1 100 ? 15.003  8.232   39.423  1.00 35.37  ? 144 THR A OG1 1 
ATOM   829  C CG2 . THR A 1 100 ? 15.983  6.398   40.671  1.00 29.54  ? 144 THR A CG2 1 
ATOM   830  N N   . LEU A 1 101 ? 11.702  7.138   39.694  1.00 20.48  ? 145 LEU A N   1 
ATOM   831  C CA  . LEU A 1 101 ? 10.505  7.858   39.288  1.00 22.04  ? 145 LEU A CA  1 
ATOM   832  C C   . LEU A 1 101 ? 10.858  9.173   38.579  1.00 27.00  ? 145 LEU A C   1 
ATOM   833  O O   . LEU A 1 101 ? 10.379  9.441   37.475  1.00 24.95  ? 145 LEU A O   1 
ATOM   834  C CB  . LEU A 1 101 ? 9.619   8.131   40.514  1.00 16.18  ? 145 LEU A CB  1 
ATOM   835  C CG  . LEU A 1 101 ? 8.330   8.944   40.315  1.00 25.40  ? 145 LEU A CG  1 
ATOM   836  C CD1 . LEU A 1 101 ? 7.435   8.269   39.275  1.00 14.16  ? 145 LEU A CD1 1 
ATOM   837  C CD2 . LEU A 1 101 ? 7.596   9.089   41.644  1.00 8.87   ? 145 LEU A CD2 1 
ATOM   838  N N   . GLU A 1 102 ? 11.723  9.975   39.197  1.00 27.24  ? 146 GLU A N   1 
ATOM   839  C CA  . GLU A 1 102 ? 12.102  11.264  38.625  1.00 23.72  ? 146 GLU A CA  1 
ATOM   840  C C   . GLU A 1 102 ? 12.827  11.169  37.282  1.00 24.31  ? 146 GLU A C   1 
ATOM   841  O O   . GLU A 1 102 ? 13.177  12.188  36.690  1.00 23.56  ? 146 GLU A O   1 
ATOM   842  C CB  . GLU A 1 102 ? 12.959  12.051  39.619  1.00 22.39  ? 146 GLU A CB  1 
ATOM   843  C CG  . GLU A 1 102 ? 12.318  12.275  40.987  1.00 25.90  ? 146 GLU A CG  1 
ATOM   844  C CD  . GLU A 1 102 ? 12.244  11.007  41.828  1.00 25.89  ? 146 GLU A CD  1 
ATOM   845  O OE1 . GLU A 1 102 ? 13.128  10.135  41.682  1.00 29.27  ? 146 GLU A OE1 1 
ATOM   846  O OE2 . GLU A 1 102 ? 11.309  10.887  42.647  1.00 28.38  ? 146 GLU A OE2 1 
ATOM   847  N N   . ASP A 1 103 ? 13.057  9.948   36.806  1.00 27.92  ? 147 ASP A N   1 
ATOM   848  C CA  . ASP A 1 103 ? 13.717  9.733   35.517  1.00 17.21  ? 147 ASP A CA  1 
ATOM   849  C C   . ASP A 1 103 ? 12.668  9.554   34.425  1.00 22.12  ? 147 ASP A C   1 
ATOM   850  O O   . ASP A 1 103 ? 12.994  9.539   33.241  1.00 21.93  ? 147 ASP A O   1 
ATOM   851  C CB  . ASP A 1 103 ? 14.627  8.510   35.576  1.00 15.67  ? 147 ASP A CB  1 
ATOM   852  C CG  . ASP A 1 103 ? 15.864  8.748   36.426  1.00 18.96  ? 147 ASP A CG  1 
ATOM   853  O OD1 . ASP A 1 103 ? 16.270  7.835   37.169  1.00 23.13  ? 147 ASP A OD1 1 
ATOM   854  O OD2 . ASP A 1 103 ? 16.437  9.847   36.343  1.00 19.15  ? 147 ASP A OD2 1 
ATOM   855  N N   . THR A 1 104 ? 11.406  9.408   34.829  1.00 17.63  ? 148 THR A N   1 
ATOM   856  C CA  . THR A 1 104 ? 10.318  9.279   33.870  1.00 16.42  ? 148 THR A CA  1 
ATOM   857  C C   . THR A 1 104 ? 9.881   10.702  33.529  1.00 18.86  ? 148 THR A C   1 
ATOM   858  O O   . THR A 1 104 ? 10.151  11.629  34.289  1.00 23.01  ? 148 THR A O   1 
ATOM   859  C CB  . THR A 1 104 ? 9.109   8.524   34.463  1.00 16.96  ? 148 THR A CB  1 
ATOM   860  O OG1 . THR A 1 104 ? 8.511   9.304   35.504  1.00 19.32  ? 148 THR A OG1 1 
ATOM   861  C CG2 . THR A 1 104 ? 9.541   7.193   35.030  1.00 18.82  ? 148 THR A CG2 1 
ATOM   862  N N   . LEU A 1 105 ? 9.215   10.881  32.396  1.00 16.81  ? 149 LEU A N   1 
ATOM   863  C CA  . LEU A 1 105 ? 8.763   12.205  31.980  1.00 17.75  ? 149 LEU A CA  1 
ATOM   864  C C   . LEU A 1 105 ? 8.016   12.934  33.097  1.00 21.90  ? 149 LEU A C   1 
ATOM   865  O O   . LEU A 1 105 ? 8.422   14.005  33.530  1.00 22.96  ? 149 LEU A O   1 
ATOM   866  C CB  . LEU A 1 105 ? 7.856   12.095  30.748  1.00 23.24  ? 149 LEU A CB  1 
ATOM   867  C CG  . LEU A 1 105 ? 7.080   13.347  30.322  1.00 21.77  ? 149 LEU A CG  1 
ATOM   868  C CD1 . LEU A 1 105 ? 8.052   14.445  29.929  1.00 27.16  ? 149 LEU A CD1 1 
ATOM   869  C CD2 . LEU A 1 105 ? 6.166   13.016  29.157  1.00 32.09  ? 149 LEU A CD2 1 
ATOM   870  N N   . LEU A 1 106 ? 6.923   12.340  33.558  1.00 20.21  ? 150 LEU A N   1 
ATOM   871  C CA  . LEU A 1 106 ? 6.115   12.937  34.606  1.00 19.82  ? 150 LEU A CA  1 
ATOM   872  C C   . LEU A 1 106 ? 6.915   13.272  35.860  1.00 17.35  ? 150 LEU A C   1 
ATOM   873  O O   . LEU A 1 106 ? 6.787   14.364  36.406  1.00 18.88  ? 150 LEU A O   1 
ATOM   874  C CB  . LEU A 1 106 ? 4.954   12.007  34.961  1.00 26.06  ? 150 LEU A CB  1 
ATOM   875  C CG  . LEU A 1 106 ? 4.017   11.619  33.809  1.00 33.45  ? 150 LEU A CG  1 
ATOM   876  C CD1 . LEU A 1 106 ? 2.989   10.617  34.316  1.00 30.60  ? 150 LEU A CD1 1 
ATOM   877  C CD2 . LEU A 1 106 ? 3.326   12.859  33.236  1.00 28.16  ? 150 LEU A CD2 1 
ATOM   878  N N   . GLY A 1 107 ? 7.740   12.339  36.319  1.00 19.38  ? 151 GLY A N   1 
ATOM   879  C CA  . GLY A 1 107 ? 8.531   12.599  37.509  1.00 15.39  ? 151 GLY A CA  1 
ATOM   880  C C   . GLY A 1 107 ? 9.528   13.725  37.290  1.00 17.65  ? 151 GLY A C   1 
ATOM   881  O O   . GLY A 1 107 ? 9.853   14.481  38.201  1.00 15.82  ? 151 GLY A O   1 
ATOM   882  N N   . TYR A 1 108 ? 10.006  13.838  36.060  1.00 17.61  ? 152 TYR A N   1 
ATOM   883  C CA  . TYR A 1 108 ? 10.973  14.860  35.690  1.00 21.26  ? 152 TYR A CA  1 
ATOM   884  C C   . TYR A 1 108 ? 10.314  16.239  35.666  1.00 23.05  ? 152 TYR A C   1 
ATOM   885  O O   . TYR A 1 108 ? 10.926  17.239  36.032  1.00 26.05  ? 152 TYR A O   1 
ATOM   886  C CB  . TYR A 1 108 ? 11.554  14.516  34.314  1.00 14.86  ? 152 TYR A CB  1 
ATOM   887  C CG  . TYR A 1 108 ? 12.683  15.402  33.841  1.00 20.03  ? 152 TYR A CG  1 
ATOM   888  C CD1 . TYR A 1 108 ? 12.440  16.524  33.041  1.00 16.16  ? 152 TYR A CD1 1 
ATOM   889  C CD2 . TYR A 1 108 ? 14.004  15.086  34.149  1.00 17.48  ? 152 TYR A CD2 1 
ATOM   890  C CE1 . TYR A 1 108 ? 13.493  17.301  32.555  1.00 13.62  ? 152 TYR A CE1 1 
ATOM   891  C CE2 . TYR A 1 108 ? 15.052  15.850  33.671  1.00 21.25  ? 152 TYR A CE2 1 
ATOM   892  C CZ  . TYR A 1 108 ? 14.797  16.953  32.871  1.00 21.86  ? 152 TYR A CZ  1 
ATOM   893  O OH  . TYR A 1 108 ? 15.863  17.667  32.370  1.00 27.70  ? 152 TYR A OH  1 
ATOM   894  N N   . LEU A 1 109 ? 9.056   16.276  35.243  1.00 22.71  ? 153 LEU A N   1 
ATOM   895  C CA  . LEU A 1 109 ? 8.308   17.515  35.156  1.00 21.34  ? 153 LEU A CA  1 
ATOM   896  C C   . LEU A 1 109 ? 8.001   18.161  36.504  1.00 22.66  ? 153 LEU A C   1 
ATOM   897  O O   . LEU A 1 109 ? 8.090   19.383  36.649  1.00 27.18  ? 153 LEU A O   1 
ATOM   898  C CB  . LEU A 1 109 ? 6.990   17.278  34.409  1.00 17.84  ? 153 LEU A CB  1 
ATOM   899  C CG  . LEU A 1 109 ? 7.088   16.950  32.922  1.00 19.91  ? 153 LEU A CG  1 
ATOM   900  C CD1 . LEU A 1 109 ? 5.695   16.760  32.339  1.00 15.84  ? 153 LEU A CD1 1 
ATOM   901  C CD2 . LEU A 1 109 ? 7.819   18.078  32.203  1.00 20.84  ? 153 LEU A CD2 1 
ATOM   902  N N   . ALA A 1 110 ? 7.650   17.343  37.491  1.00 22.60  ? 154 ALA A N   1 
ATOM   903  C CA  . ALA A 1 110 ? 7.274   17.856  38.802  1.00 17.75  ? 154 ALA A CA  1 
ATOM   904  C C   . ALA A 1 110 ? 8.360   17.927  39.872  1.00 16.56  ? 154 ALA A C   1 
ATOM   905  O O   . ALA A 1 110 ? 8.179   18.587  40.903  1.00 20.97  ? 154 ALA A O   1 
ATOM   906  C CB  . ALA A 1 110 ? 6.094   17.046  39.321  1.00 19.85  ? 154 ALA A CB  1 
ATOM   907  N N   . ASP A 1 111 ? 9.485   17.266  39.627  1.00 21.15  ? 155 ASP A N   1 
ATOM   908  C CA  . ASP A 1 111 ? 10.576  17.217  40.596  1.00 20.59  ? 155 ASP A CA  1 
ATOM   909  C C   . ASP A 1 111 ? 10.956  18.547  41.249  1.00 20.24  ? 155 ASP A C   1 
ATOM   910  O O   . ASP A 1 111 ? 11.354  19.503  40.583  1.00 17.16  ? 155 ASP A O   1 
ATOM   911  C CB  . ASP A 1 111 ? 11.818  16.591  39.960  1.00 20.48  ? 155 ASP A CB  1 
ATOM   912  C CG  . ASP A 1 111 ? 12.784  16.022  40.998  1.00 28.91  ? 155 ASP A CG  1 
ATOM   913  O OD1 . ASP A 1 111 ? 13.911  15.640  40.619  1.00 39.15  ? 155 ASP A OD1 1 
ATOM   914  O OD2 . ASP A 1 111 ? 12.416  15.941  42.191  1.00 28.20  ? 155 ASP A OD2 1 
ATOM   915  N N   . ASP A 1 112 ? 10.829  18.577  42.571  1.00 18.99  ? 156 ASP A N   1 
ATOM   916  C CA  . ASP A 1 112 ? 11.157  19.737  43.390  1.00 25.25  ? 156 ASP A CA  1 
ATOM   917  C C   . ASP A 1 112 ? 10.347  20.992  43.109  1.00 26.51  ? 156 ASP A C   1 
ATOM   918  O O   . ASP A 1 112 ? 10.815  22.103  43.345  1.00 32.04  ? 156 ASP A O   1 
ATOM   919  C CB  . ASP A 1 112 ? 12.653  20.060  43.290  1.00 22.12  ? 156 ASP A CB  1 
ATOM   920  C CG  . ASP A 1 112 ? 13.515  18.989  43.918  1.00 28.60  ? 156 ASP A CG  1 
ATOM   921  O OD1 . ASP A 1 112 ? 13.149  18.501  45.009  1.00 31.08  ? 156 ASP A OD1 1 
ATOM   922  O OD2 . ASP A 1 112 ? 14.559  18.641  43.330  1.00 38.34  ? 156 ASP A OD2 1 
ATOM   923  N N   . LEU A 1 113 ? 9.134   20.819  42.605  1.00 28.45  ? 157 LEU A N   1 
ATOM   924  C CA  . LEU A 1 113 ? 8.273   21.959  42.336  1.00 25.13  ? 157 LEU A CA  1 
ATOM   925  C C   . LEU A 1 113 ? 7.064   21.916  43.253  1.00 24.94  ? 157 LEU A C   1 
ATOM   926  O O   . LEU A 1 113 ? 6.694   20.858  43.775  1.00 24.12  ? 157 LEU A O   1 
ATOM   927  C CB  . LEU A 1 113 ? 7.824   21.955  40.872  1.00 17.93  ? 157 LEU A CB  1 
ATOM   928  C CG  . LEU A 1 113 ? 8.994   22.244  39.933  1.00 16.21  ? 157 LEU A CG  1 
ATOM   929  C CD1 . LEU A 1 113 ? 8.608   22.008  38.478  1.00 8.79   ? 157 LEU A CD1 1 
ATOM   930  C CD2 . LEU A 1 113 ? 9.443   23.672  40.169  1.00 10.92  ? 157 LEU A CD2 1 
ATOM   931  N N   . THR A 1 114 ? 6.462   23.078  43.462  1.00 24.05  ? 158 THR A N   1 
ATOM   932  C CA  . THR A 1 114 ? 5.274   23.192  44.292  1.00 25.57  ? 158 THR A CA  1 
ATOM   933  C C   . THR A 1 114 ? 4.233   23.880  43.426  1.00 22.25  ? 158 THR A C   1 
ATOM   934  O O   . THR A 1 114 ? 4.578   24.705  42.583  1.00 24.19  ? 158 THR A O   1 
ATOM   935  C CB  . THR A 1 114 ? 5.533   24.058  45.548  1.00 30.16  ? 158 THR A CB  1 
ATOM   936  O OG1 . THR A 1 114 ? 6.440   23.384  46.423  1.00 36.70  ? 158 THR A OG1 1 
ATOM   937  C CG2 . THR A 1 114 ? 4.230   24.319  46.293  1.00 28.84  ? 158 THR A CG2 1 
ATOM   938  N N   . TRP A 1 115 ? 2.966   23.547  43.623  1.00 22.91  ? 159 TRP A N   1 
ATOM   939  C CA  . TRP A 1 115 ? 1.924   24.179  42.830  1.00 27.01  ? 159 TRP A CA  1 
ATOM   940  C C   . TRP A 1 115 ? 0.530   23.958  43.397  1.00 27.97  ? 159 TRP A C   1 
ATOM   941  O O   . TRP A 1 115 ? 0.269   22.982  44.097  1.00 26.06  ? 159 TRP A O   1 
ATOM   942  C CB  . TRP A 1 115 ? 1.985   23.676  41.378  1.00 22.09  ? 159 TRP A CB  1 
ATOM   943  C CG  . TRP A 1 115 ? 1.601   22.222  41.206  1.00 25.47  ? 159 TRP A CG  1 
ATOM   944  C CD1 . TRP A 1 115 ? 0.338   21.718  41.033  1.00 25.17  ? 159 TRP A CD1 1 
ATOM   945  C CD2 . TRP A 1 115 ? 2.479   21.087  41.264  1.00 22.13  ? 159 TRP A CD2 1 
ATOM   946  N NE1 . TRP A 1 115 ? 0.377   20.342  40.988  1.00 26.10  ? 159 TRP A NE1 1 
ATOM   947  C CE2 . TRP A 1 115 ? 1.677   19.929  41.128  1.00 25.28  ? 159 TRP A CE2 1 
ATOM   948  C CE3 . TRP A 1 115 ? 3.864   20.936  41.426  1.00 20.37  ? 159 TRP A CE3 1 
ATOM   949  C CZ2 . TRP A 1 115 ? 2.216   18.635  41.150  1.00 18.02  ? 159 TRP A CZ2 1 
ATOM   950  C CZ3 . TRP A 1 115 ? 4.401   19.650  41.448  1.00 16.93  ? 159 TRP A CZ3 1 
ATOM   951  C CH2 . TRP A 1 115 ? 3.574   18.516  41.311  1.00 17.91  ? 159 TRP A CH2 1 
ATOM   952  N N   . CYS A 1 116 ? -0.360  24.893  43.101  1.00 29.05  ? 160 CYS A N   1 
ATOM   953  C CA  . CYS A 1 116 ? -1.734  24.791  43.539  1.00 25.00  ? 160 CYS A CA  1 
ATOM   954  C C   . CYS A 1 116 ? -2.553  25.890  42.891  1.00 26.27  ? 160 CYS A C   1 
ATOM   955  O O   . CYS A 1 116 ? -2.014  26.885  42.406  1.00 28.49  ? 160 CYS A O   1 
ATOM   956  C CB  . CYS A 1 116 ? -1.834  24.873  45.065  1.00 20.93  ? 160 CYS A CB  1 
ATOM   957  S SG  . CYS A 1 116 ? -1.423  26.483  45.800  1.00 25.64  ? 160 CYS A SG  1 
ATOM   958  N N   . GLY A 1 117 ? -3.862  25.692  42.863  1.00 26.39  ? 161 GLY A N   1 
ATOM   959  C CA  . GLY A 1 117 ? -4.726  26.681  42.269  1.00 27.64  ? 161 GLY A CA  1 
ATOM   960  C C   . GLY A 1 117 ? -5.703  27.254  43.266  1.00 28.34  ? 161 GLY A C   1 
ATOM   961  O O   . GLY A 1 117 ? -5.479  27.216  44.478  1.00 24.36  ? 161 GLY A O   1 
ATOM   962  N N   . GLU A 1 118 ? -6.811  27.760  42.743  1.00 29.47  ? 162 GLU A N   1 
ATOM   963  C CA  . GLU A 1 118 ? -7.830  28.375  43.574  1.00 39.19  ? 162 GLU A CA  1 
ATOM   964  C C   . GLU A 1 118 ? -9.207  28.018  43.027  1.00 32.36  ? 162 GLU A C   1 
ATOM   965  O O   . GLU A 1 118 ? -9.384  27.918  41.816  1.00 31.48  ? 162 GLU A O   1 
ATOM   966  C CB  . GLU A 1 118 ? -7.607  29.885  43.557  1.00 42.43  ? 162 GLU A CB  1 
ATOM   967  C CG  . GLU A 1 118 ? -8.571  30.712  44.351  1.00 54.17  ? 162 GLU A CG  1 
ATOM   968  C CD  . GLU A 1 118 ? -8.191  32.177  44.301  1.00 65.72  ? 162 GLU A CD  1 
ATOM   969  O OE1 . GLU A 1 118 ? -8.008  32.704  43.180  1.00 68.31  ? 162 GLU A OE1 1 
ATOM   970  O OE2 . GLU A 1 118 ? -8.067  32.801  45.376  1.00 70.96  ? 162 GLU A OE2 1 
ATOM   971  N N   . PHE A 1 119 ? -10.178 27.821  43.911  1.00 27.92  ? 163 PHE A N   1 
ATOM   972  C CA  . PHE A 1 119 ? -11.519 27.468  43.462  1.00 28.89  ? 163 PHE A CA  1 
ATOM   973  C C   . PHE A 1 119 ? -12.171 28.516  42.565  1.00 32.29  ? 163 PHE A C   1 
ATOM   974  O O   . PHE A 1 119 ? -12.162 29.713  42.864  1.00 34.10  ? 163 PHE A O   1 
ATOM   975  C CB  . PHE A 1 119 ? -12.441 27.215  44.648  1.00 30.38  ? 163 PHE A CB  1 
ATOM   976  C CG  . PHE A 1 119 ? -13.835 26.837  44.245  1.00 26.47  ? 163 PHE A CG  1 
ATOM   977  C CD1 . PHE A 1 119 ? -14.077 25.636  43.590  1.00 28.52  ? 163 PHE A CD1 1 
ATOM   978  C CD2 . PHE A 1 119 ? -14.898 27.698  44.479  1.00 27.93  ? 163 PHE A CD2 1 
ATOM   979  C CE1 . PHE A 1 119 ? -15.361 25.296  43.165  1.00 33.10  ? 163 PHE A CE1 1 
ATOM   980  C CE2 . PHE A 1 119 ? -16.186 27.371  44.059  1.00 36.46  ? 163 PHE A CE2 1 
ATOM   981  C CZ  . PHE A 1 119 ? -16.418 26.168  43.400  1.00 38.09  ? 163 PHE A CZ  1 
ATOM   982  N N   . ASN A 1 120 ? -12.745 28.044  41.465  1.00 35.63  ? 164 ASN A N   1 
ATOM   983  C CA  . ASN A 1 120 ? -13.436 28.897  40.504  1.00 41.09  ? 164 ASN A CA  1 
ATOM   984  C C   . ASN A 1 120 ? -12.617 30.090  40.011  1.00 40.38  ? 164 ASN A C   1 
ATOM   985  O O   . ASN A 1 120 ? -13.137 31.190  39.837  1.00 38.49  ? 164 ASN A O   1 
ATOM   986  C CB  . ASN A 1 120 ? -14.756 29.385  41.105  1.00 39.44  ? 164 ASN A CB  1 
ATOM   987  C CG  . ASN A 1 120 ? -15.668 30.005  40.068  1.00 47.57  ? 164 ASN A CG  1 
ATOM   988  O OD1 . ASN A 1 120 ? -15.957 29.394  39.034  1.00 55.65  ? 164 ASN A OD1 1 
ATOM   989  N ND2 . ASN A 1 120 ? -16.133 31.219  40.338  1.00 41.64  ? 164 ASN A ND2 1 
ATOM   990  N N   . THR A 1 121 ? -11.332 29.858  39.786  1.00 42.12  ? 165 THR A N   1 
ATOM   991  C CA  . THR A 1 121 ? -10.433 30.888  39.290  1.00 39.74  ? 165 THR A CA  1 
ATOM   992  C C   . THR A 1 121 ? -9.436  30.198  38.381  1.00 40.71  ? 165 THR A C   1 
ATOM   993  O O   . THR A 1 121 ? -9.151  29.015  38.558  1.00 42.28  ? 165 THR A O   1 
ATOM   994  C CB  . THR A 1 121 ? -9.683  31.577  40.438  1.00 45.23  ? 165 THR A CB  1 
ATOM   995  O OG1 . THR A 1 121 ? -10.606 32.353  41.211  1.00 46.95  ? 165 THR A OG1 1 
ATOM   996  C CG2 . THR A 1 121 ? -8.605  32.483  39.899  1.00 43.33  ? 165 THR A CG2 1 
ATOM   997  N N   . SER A 1 122 ? -8.921  30.925  37.398  1.00 35.88  ? 166 SER A N   1 
ATOM   998  C CA  . SER A 1 122 ? -7.953  30.356  36.469  1.00 34.26  ? 166 SER A CA  1 
ATOM   999  C C   . SER A 1 122 ? -6.546  30.763  36.888  1.00 30.29  ? 166 SER A C   1 
ATOM   1000 O O   . SER A 1 122 ? -5.577  30.531  36.169  1.00 35.65  ? 166 SER A O   1 
ATOM   1001 C CB  . SER A 1 122 ? -8.225  30.861  35.052  1.00 39.07  ? 166 SER A CB  1 
ATOM   1002 O OG  . SER A 1 122 ? -7.987  32.258  34.968  1.00 50.10  ? 166 SER A OG  1 
ATOM   1003 N N   . LYS A 1 123 ? -6.441  31.371  38.058  1.00 29.59  ? 167 LYS A N   1 
ATOM   1004 C CA  . LYS A 1 123 ? -5.156  31.828  38.554  1.00 36.82  ? 167 LYS A CA  1 
ATOM   1005 C C   . LYS A 1 123 ? -4.368  30.801  39.354  1.00 35.15  ? 167 LYS A C   1 
ATOM   1006 O O   . LYS A 1 123 ? -4.927  30.033  40.143  1.00 30.09  ? 167 LYS A O   1 
ATOM   1007 C CB  . LYS A 1 123 ? -5.342  33.083  39.411  1.00 36.74  ? 167 LYS A CB  1 
ATOM   1008 C CG  . LYS A 1 123 ? -5.823  34.302  38.635  1.00 51.02  ? 167 LYS A CG  1 
ATOM   1009 C CD  . LYS A 1 123 ? -5.770  35.557  39.500  1.00 59.45  ? 167 LYS A CD  1 
ATOM   1010 C CE  . LYS A 1 123 ? -6.082  36.811  38.692  1.00 66.09  ? 167 LYS A CE  1 
ATOM   1011 N NZ  . LYS A 1 123 ? -5.929  38.052  39.507  1.00 69.84  ? 167 LYS A NZ  1 
ATOM   1012 N N   . ILE A 1 124 ? -3.061  30.785  39.122  1.00 28.65  ? 168 ILE A N   1 
ATOM   1013 C CA  . ILE A 1 124 ? -2.177  29.907  39.860  1.00 24.77  ? 168 ILE A CA  1 
ATOM   1014 C C   . ILE A 1 124 ? -1.866  30.696  41.121  1.00 26.41  ? 168 ILE A C   1 
ATOM   1015 O O   . ILE A 1 124 ? -1.522  31.879  41.058  1.00 26.13  ? 168 ILE A O   1 
ATOM   1016 C CB  . ILE A 1 124 ? -0.881  29.614  39.082  1.00 28.96  ? 168 ILE A CB  1 
ATOM   1017 C CG1 . ILE A 1 124 ? -1.157  28.555  38.009  1.00 29.51  ? 168 ILE A CG1 1 
ATOM   1018 C CG2 . ILE A 1 124 ? 0.213   29.153  40.035  1.00 27.55  ? 168 ILE A CG2 1 
ATOM   1019 C CD1 . ILE A 1 124 ? 0.069   28.145  37.197  1.00 20.70  ? 168 ILE A CD1 1 
ATOM   1020 N N   . ASN A 1 125 ? -2.020  30.042  42.265  1.00 27.97  ? 169 ASN A N   1 
ATOM   1021 C CA  . ASN A 1 125 ? -1.778  30.669  43.556  1.00 26.84  ? 169 ASN A CA  1 
ATOM   1022 C C   . ASN A 1 125 ? -0.296  30.678  43.897  1.00 27.84  ? 169 ASN A C   1 
ATOM   1023 O O   . ASN A 1 125 ? 0.248   29.657  44.314  1.00 28.73  ? 169 ASN A O   1 
ATOM   1024 C CB  . ASN A 1 125 ? -2.539  29.913  44.648  1.00 27.71  ? 169 ASN A CB  1 
ATOM   1025 C CG  . ASN A 1 125 ? -2.506  30.629  45.985  1.00 30.85  ? 169 ASN A CG  1 
ATOM   1026 O OD1 . ASN A 1 125 ? -1.526  31.300  46.318  1.00 28.48  ? 169 ASN A OD1 1 
ATOM   1027 N ND2 . ASN A 1 125 ? -3.571  30.474  46.769  1.00 19.71  ? 169 ASN A ND2 1 
ATOM   1028 N N   . TYR A 1 126 ? 0.356   31.825  43.722  1.00 27.81  ? 170 TYR A N   1 
ATOM   1029 C CA  . TYR A 1 126 ? 1.782   31.943  44.034  1.00 24.97  ? 170 TYR A CA  1 
ATOM   1030 C C   . TYR A 1 126 ? 1.993   32.430  45.463  1.00 27.03  ? 170 TYR A C   1 
ATOM   1031 O O   . TYR A 1 126 ? 3.108   32.421  45.968  1.00 26.23  ? 170 TYR A O   1 
ATOM   1032 C CB  . TYR A 1 126 ? 2.482   32.912  43.070  1.00 20.03  ? 170 TYR A CB  1 
ATOM   1033 C CG  . TYR A 1 126 ? 2.623   32.395  41.658  1.00 18.58  ? 170 TYR A CG  1 
ATOM   1034 C CD1 . TYR A 1 126 ? 1.703   32.734  40.676  1.00 15.41  ? 170 TYR A CD1 1 
ATOM   1035 C CD2 . TYR A 1 126 ? 3.663   31.530  41.316  1.00 25.66  ? 170 TYR A CD2 1 
ATOM   1036 C CE1 . TYR A 1 126 ? 1.808   32.227  39.388  1.00 21.86  ? 170 TYR A CE1 1 
ATOM   1037 C CE2 . TYR A 1 126 ? 3.778   31.011  40.034  1.00 20.47  ? 170 TYR A CE2 1 
ATOM   1038 C CZ  . TYR A 1 126 ? 2.848   31.362  39.074  1.00 26.14  ? 170 TYR A CZ  1 
ATOM   1039 O OH  . TYR A 1 126 ? 2.958   30.850  37.802  1.00 26.58  ? 170 TYR A OH  1 
ATOM   1040 N N   . GLN A 1 127 ? 0.915   32.860  46.108  1.00 31.30  ? 171 GLN A N   1 
ATOM   1041 C CA  . GLN A 1 127 ? 1.000   33.354  47.474  1.00 34.24  ? 171 GLN A CA  1 
ATOM   1042 C C   . GLN A 1 127 ? 1.294   32.236  48.464  1.00 32.57  ? 171 GLN A C   1 
ATOM   1043 O O   . GLN A 1 127 ? 2.242   32.325  49.244  1.00 27.67  ? 171 GLN A O   1 
ATOM   1044 C CB  . GLN A 1 127 ? -0.303  34.058  47.875  1.00 40.37  ? 171 GLN A CB  1 
ATOM   1045 C CG  . GLN A 1 127 ? -0.170  35.561  48.032  1.00 50.17  ? 171 GLN A CG  1 
ATOM   1046 C CD  . GLN A 1 127 ? 0.066   36.269  46.711  1.00 64.02  ? 171 GLN A CD  1 
ATOM   1047 O OE1 . GLN A 1 127 ? -0.868  36.483  45.934  1.00 68.43  ? 171 GLN A OE1 1 
ATOM   1048 N NE2 . GLN A 1 127 ? 1.320   36.627  46.442  1.00 66.59  ? 171 GLN A NE2 1 
ATOM   1049 N N   . SER A 1 128 ? 0.475   31.189  48.432  1.00 30.16  ? 172 SER A N   1 
ATOM   1050 C CA  . SER A 1 128 ? 0.646   30.061  49.340  1.00 31.46  ? 172 SER A CA  1 
ATOM   1051 C C   . SER A 1 128 ? -0.126  28.841  48.858  1.00 31.93  ? 172 SER A C   1 
ATOM   1052 O O   . SER A 1 128 ? -1.086  28.968  48.100  1.00 33.35  ? 172 SER A O   1 
ATOM   1053 C CB  . SER A 1 128 ? 0.145   30.433  50.734  1.00 32.53  ? 172 SER A CB  1 
ATOM   1054 O OG  . SER A 1 128 ? -1.258  30.650  50.711  1.00 38.77  ? 172 SER A OG  1 
ATOM   1055 N N   . CYS A 1 129 ? 0.302   27.664  49.311  1.00 28.09  ? 173 CYS A N   1 
ATOM   1056 C CA  . CYS A 1 129 ? -0.342  26.402  48.967  1.00 19.72  ? 173 CYS A CA  1 
ATOM   1057 C C   . CYS A 1 129 ? -0.502  25.573  50.233  1.00 25.66  ? 173 CYS A C   1 
ATOM   1058 O O   . CYS A 1 129 ? 0.236   25.746  51.202  1.00 25.75  ? 173 CYS A O   1 
ATOM   1059 C CB  . CYS A 1 129 ? 0.494   25.607  47.963  1.00 19.06  ? 173 CYS A CB  1 
ATOM   1060 S SG  . CYS A 1 129 ? 0.545   26.301  46.289  1.00 26.05  ? 173 CYS A SG  1 
ATOM   1061 N N   . PRO A 1 130 ? -1.467  24.650  50.237  1.00 24.22  ? 174 PRO A N   1 
ATOM   1062 C CA  . PRO A 1 130 ? -1.716  23.793  51.398  1.00 30.78  ? 174 PRO A CA  1 
ATOM   1063 C C   . PRO A 1 130 ? -0.525  22.941  51.826  1.00 30.93  ? 174 PRO A C   1 
ATOM   1064 O O   . PRO A 1 130 ? 0.132   22.306  50.997  1.00 29.41  ? 174 PRO A O   1 
ATOM   1065 C CB  . PRO A 1 130 ? -2.876  22.907  50.937  1.00 25.90  ? 174 PRO A CB  1 
ATOM   1066 C CG  . PRO A 1 130 ? -3.576  23.745  49.927  1.00 32.87  ? 174 PRO A CG  1 
ATOM   1067 C CD  . PRO A 1 130 ? -2.436  24.374  49.166  1.00 26.94  ? 174 PRO A CD  1 
ATOM   1068 N N   . ASP A 1 131 ? -0.239  22.943  53.122  1.00 31.47  ? 175 ASP A N   1 
ATOM   1069 C CA  . ASP A 1 131 ? 0.819   22.102  53.650  1.00 32.39  ? 175 ASP A CA  1 
ATOM   1070 C C   . ASP A 1 131 ? 0.059   20.826  53.996  1.00 35.41  ? 175 ASP A C   1 
ATOM   1071 O O   . ASP A 1 131 ? -1.028  20.893  54.576  1.00 35.50  ? 175 ASP A O   1 
ATOM   1072 C CB  . ASP A 1 131 ? 1.440   22.712  54.906  1.00 35.24  ? 175 ASP A CB  1 
ATOM   1073 C CG  . ASP A 1 131 ? 2.368   21.742  55.624  1.00 40.24  ? 175 ASP A CG  1 
ATOM   1074 O OD1 . ASP A 1 131 ? 1.873   20.914  56.415  1.00 35.72  ? 175 ASP A OD1 1 
ATOM   1075 O OD2 . ASP A 1 131 ? 3.593   21.794  55.382  1.00 47.80  ? 175 ASP A OD2 1 
ATOM   1076 N N   . TRP A 1 132 ? 0.607   19.670  53.635  1.00 38.87  ? 176 TRP A N   1 
ATOM   1077 C CA  . TRP A 1 132 ? -0.088  18.415  53.898  1.00 43.33  ? 176 TRP A CA  1 
ATOM   1078 C C   . TRP A 1 132 ? -0.419  18.172  55.367  1.00 47.06  ? 176 TRP A C   1 
ATOM   1079 O O   . TRP A 1 132 ? -1.497  17.663  55.677  1.00 44.23  ? 176 TRP A O   1 
ATOM   1080 C CB  . TRP A 1 132 ? 0.700   17.219  53.340  1.00 52.78  ? 176 TRP A CB  1 
ATOM   1081 C CG  . TRP A 1 132 ? 1.916   16.807  54.133  1.00 62.40  ? 176 TRP A CG  1 
ATOM   1082 C CD1 . TRP A 1 132 ? 3.206   17.202  53.924  1.00 66.45  ? 176 TRP A CD1 1 
ATOM   1083 C CD2 . TRP A 1 132 ? 1.952   15.881  55.229  1.00 63.74  ? 176 TRP A CD2 1 
ATOM   1084 N NE1 . TRP A 1 132 ? 4.046   16.575  54.816  1.00 70.20  ? 176 TRP A NE1 1 
ATOM   1085 C CE2 . TRP A 1 132 ? 3.302   15.759  55.629  1.00 70.41  ? 176 TRP A CE2 1 
ATOM   1086 C CE3 . TRP A 1 132 ? 0.976   15.143  55.912  1.00 64.50  ? 176 TRP A CE3 1 
ATOM   1087 C CZ2 . TRP A 1 132 ? 3.701   14.924  56.682  1.00 72.41  ? 176 TRP A CZ2 1 
ATOM   1088 C CZ3 . TRP A 1 132 ? 1.372   14.313  56.959  1.00 67.65  ? 176 TRP A CZ3 1 
ATOM   1089 C CH2 . TRP A 1 132 ? 2.724   14.212  57.332  1.00 69.27  ? 176 TRP A CH2 1 
ATOM   1090 N N   . ARG A 1 133 ? 0.497   18.541  56.264  1.00 46.78  ? 177 ARG A N   1 
ATOM   1091 C CA  . ARG A 1 133 ? 0.291   18.341  57.697  1.00 48.93  ? 177 ARG A CA  1 
ATOM   1092 C C   . ARG A 1 133 ? -0.694  19.325  58.309  1.00 44.69  ? 177 ARG A C   1 
ATOM   1093 O O   . ARG A 1 133 ? -1.724  18.929  58.850  1.00 39.43  ? 177 ARG A O   1 
ATOM   1094 C CB  . ARG A 1 133 ? 1.606   18.480  58.478  1.00 61.74  ? 177 ARG A CB  1 
ATOM   1095 C CG  . ARG A 1 133 ? 2.853   17.949  57.806  1.00 71.44  ? 177 ARG A CG  1 
ATOM   1096 C CD  . ARG A 1 133 ? 4.017   17.882  58.796  1.00 81.30  ? 177 ARG A CD  1 
ATOM   1097 N NE  . ARG A 1 133 ? 4.247   19.147  59.498  1.00 90.04  ? 177 ARG A NE  1 
ATOM   1098 C CZ  . ARG A 1 133 ? 4.693   20.262  58.924  1.00 93.88  ? 177 ARG A CZ  1 
ATOM   1099 N NH1 . ARG A 1 133 ? 4.966   20.286  57.625  1.00 94.81  ? 177 ARG A NH1 1 
ATOM   1100 N NH2 . ARG A 1 133 ? 4.868   21.357  59.653  1.00 94.68  ? 177 ARG A NH2 1 
ATOM   1101 N N   . LYS A 1 134 ? -0.361  20.611  58.223  1.00 41.93  ? 178 LYS A N   1 
ATOM   1102 C CA  . LYS A 1 134 ? -1.176  21.666  58.817  1.00 43.56  ? 178 LYS A CA  1 
ATOM   1103 C C   . LYS A 1 134 ? -2.479  22.036  58.115  1.00 42.26  ? 178 LYS A C   1 
ATOM   1104 O O   . LYS A 1 134 ? -3.416  22.500  58.764  1.00 40.69  ? 178 LYS A O   1 
ATOM   1105 C CB  . LYS A 1 134 ? -0.330  22.928  58.999  1.00 39.24  ? 178 LYS A CB  1 
ATOM   1106 C CG  . LYS A 1 134 ? 0.890   22.729  59.888  1.00 45.53  ? 178 LYS A CG  1 
ATOM   1107 C CD  . LYS A 1 134 ? 1.700   24.014  60.021  1.00 49.62  ? 178 LYS A CD  1 
ATOM   1108 C CE  . LYS A 1 134 ? 2.991   23.780  60.799  1.00 56.24  ? 178 LYS A CE  1 
ATOM   1109 N NZ  . LYS A 1 134 ? 3.822   25.019  60.901  1.00 63.03  ? 178 LYS A NZ  1 
ATOM   1110 N N   . ASP A 1 135 ? -2.554  21.839  56.804  1.00 41.76  ? 179 ASP A N   1 
ATOM   1111 C CA  . ASP A 1 135 ? -3.770  22.199  56.087  1.00 38.38  ? 179 ASP A CA  1 
ATOM   1112 C C   . ASP A 1 135 ? -4.628  21.025  55.643  1.00 34.86  ? 179 ASP A C   1 
ATOM   1113 O O   . ASP A 1 135 ? -5.701  20.815  56.188  1.00 36.72  ? 179 ASP A O   1 
ATOM   1114 C CB  . ASP A 1 135 ? -3.429  23.085  54.887  1.00 34.23  ? 179 ASP A CB  1 
ATOM   1115 C CG  . ASP A 1 135 ? -2.825  24.410  55.299  1.00 37.99  ? 179 ASP A CG  1 
ATOM   1116 O OD1 . ASP A 1 135 ? -3.389  25.062  56.204  1.00 38.49  ? 179 ASP A OD1 1 
ATOM   1117 O OD2 . ASP A 1 135 ? -1.792  24.805  54.717  1.00 40.57  ? 179 ASP A OD2 1 
ATOM   1118 N N   . CYS A 1 136 ? -4.164  20.267  54.653  1.00 35.69  ? 180 CYS A N   1 
ATOM   1119 C CA  . CYS A 1 136 ? -4.922  19.122  54.148  1.00 30.49  ? 180 CYS A CA  1 
ATOM   1120 C C   . CYS A 1 136 ? -4.027  18.226  53.303  1.00 28.48  ? 180 CYS A C   1 
ATOM   1121 O O   . CYS A 1 136 ? -3.152  18.705  52.584  1.00 34.06  ? 180 CYS A O   1 
ATOM   1122 C CB  . CYS A 1 136 ? -6.104  19.600  53.308  1.00 30.77  ? 180 CYS A CB  1 
ATOM   1123 S SG  . CYS A 1 136 ? -5.617  20.550  51.830  1.00 35.30  ? 180 CYS A SG  1 
ATOM   1124 N N   . SER A 1 137 ? -4.260  16.923  53.375  1.00 22.98  ? 181 SER A N   1 
ATOM   1125 C CA  . SER A 1 137 ? -3.442  15.971  52.639  1.00 26.26  ? 181 SER A CA  1 
ATOM   1126 C C   . SER A 1 137 ? -3.759  15.855  51.155  1.00 28.02  ? 181 SER A C   1 
ATOM   1127 O O   . SER A 1 137 ? -2.904  15.467  50.357  1.00 29.86  ? 181 SER A O   1 
ATOM   1128 C CB  . SER A 1 137 ? -3.560  14.593  53.285  1.00 27.42  ? 181 SER A CB  1 
ATOM   1129 O OG  . SER A 1 137 ? -4.910  14.179  53.350  1.00 33.62  ? 181 SER A OG  1 
ATOM   1130 N N   . ASN A 1 138 ? -4.983  16.192  50.776  1.00 26.42  ? 182 ASN A N   1 
ATOM   1131 C CA  . ASN A 1 138 ? -5.371  16.071  49.384  1.00 22.82  ? 182 ASN A CA  1 
ATOM   1132 C C   . ASN A 1 138 ? -5.163  17.315  48.555  1.00 25.68  ? 182 ASN A C   1 
ATOM   1133 O O   . ASN A 1 138 ? -6.080  17.785  47.882  1.00 27.27  ? 182 ASN A O   1 
ATOM   1134 C CB  . ASN A 1 138 ? -6.817  15.612  49.305  1.00 26.09  ? 182 ASN A CB  1 
ATOM   1135 C CG  . ASN A 1 138 ? -6.987  14.193  49.808  1.00 32.12  ? 182 ASN A CG  1 
ATOM   1136 O OD1 . ASN A 1 138 ? -6.173  13.324  49.500  1.00 30.12  ? 182 ASN A OD1 1 
ATOM   1137 N ND2 . ASN A 1 138 ? -8.042  13.949  50.576  1.00 27.11  ? 182 ASN A ND2 1 
ATOM   1138 N N   . ASN A 1 139 ? -3.939  17.833  48.600  1.00 23.94  ? 183 ASN A N   1 
ATOM   1139 C CA  . ASN A 1 139 ? -3.568  19.026  47.852  1.00 20.53  ? 183 ASN A CA  1 
ATOM   1140 C C   . ASN A 1 139 ? -2.971  18.596  46.515  1.00 20.56  ? 183 ASN A C   1 
ATOM   1141 O O   . ASN A 1 139 ? -2.599  17.439  46.339  1.00 27.28  ? 183 ASN A O   1 
ATOM   1142 C CB  . ASN A 1 139 ? -2.559  19.863  48.648  1.00 19.71  ? 183 ASN A CB  1 
ATOM   1143 C CG  . ASN A 1 139 ? -1.334  19.072  49.054  1.00 16.31  ? 183 ASN A CG  1 
ATOM   1144 O OD1 . ASN A 1 139 ? -1.227  18.606  50.190  1.00 21.84  ? 183 ASN A OD1 1 
ATOM   1145 N ND2 . ASN A 1 139 ? -0.406  18.905  48.123  1.00 19.86  ? 183 ASN A ND2 1 
ATOM   1146 N N   . PRO A 1 140 ? -2.863  19.527  45.557  1.00 18.68  ? 184 PRO A N   1 
ATOM   1147 C CA  . PRO A 1 140 ? -2.313  19.216  44.234  1.00 17.73  ? 184 PRO A CA  1 
ATOM   1148 C C   . PRO A 1 140 ? -0.986  18.460  44.231  1.00 17.98  ? 184 PRO A C   1 
ATOM   1149 O O   . PRO A 1 140 ? -0.844  17.456  43.533  1.00 23.55  ? 184 PRO A O   1 
ATOM   1150 C CB  . PRO A 1 140 ? -2.196  20.594  43.576  1.00 23.41  ? 184 PRO A CB  1 
ATOM   1151 C CG  . PRO A 1 140 ? -3.298  21.367  44.204  1.00 17.00  ? 184 PRO A CG  1 
ATOM   1152 C CD  . PRO A 1 140 ? -3.202  20.957  45.659  1.00 16.53  ? 184 PRO A CD  1 
ATOM   1153 N N   . VAL A 1 141 ? -0.005  18.933  44.994  1.00 16.35  ? 185 VAL A N   1 
ATOM   1154 C CA  . VAL A 1 141 ? 1.290   18.254  45.012  1.00 15.17  ? 185 VAL A CA  1 
ATOM   1155 C C   . VAL A 1 141 ? 1.266   16.840  45.600  1.00 18.16  ? 185 VAL A C   1 
ATOM   1156 O O   . VAL A 1 141 ? 1.686   15.892  44.944  1.00 20.16  ? 185 VAL A O   1 
ATOM   1157 C CB  . VAL A 1 141 ? 2.355   19.097  45.748  1.00 18.30  ? 185 VAL A CB  1 
ATOM   1158 C CG1 . VAL A 1 141 ? 3.617   18.286  45.944  1.00 10.28  ? 185 VAL A CG1 1 
ATOM   1159 C CG2 . VAL A 1 141 ? 2.668   20.364  44.935  1.00 10.45  ? 185 VAL A CG2 1 
ATOM   1160 N N   . SER A 1 142 ? 0.772   16.689  46.824  1.00 20.10  ? 186 SER A N   1 
ATOM   1161 C CA  . SER A 1 142 ? 0.723   15.371  47.453  1.00 22.60  ? 186 SER A CA  1 
ATOM   1162 C C   . SER A 1 142 ? -0.025  14.343  46.610  1.00 26.90  ? 186 SER A C   1 
ATOM   1163 O O   . SER A 1 142 ? 0.489   13.250  46.343  1.00 27.19  ? 186 SER A O   1 
ATOM   1164 C CB  . SER A 1 142 ? 0.075   15.468  48.833  1.00 21.57  ? 186 SER A CB  1 
ATOM   1165 O OG  . SER A 1 142 ? 0.768   16.403  49.635  1.00 23.79  ? 186 SER A OG  1 
ATOM   1166 N N   . VAL A 1 143 ? -1.240  14.695  46.195  1.00 26.56  ? 187 VAL A N   1 
ATOM   1167 C CA  . VAL A 1 143 ? -2.067  13.807  45.384  1.00 18.26  ? 187 VAL A CA  1 
ATOM   1168 C C   . VAL A 1 143 ? -1.319  13.387  44.128  1.00 13.75  ? 187 VAL A C   1 
ATOM   1169 O O   . VAL A 1 143 ? -1.388  12.237  43.709  1.00 17.67  ? 187 VAL A O   1 
ATOM   1170 C CB  . VAL A 1 143 ? -3.398  14.502  44.996  1.00 24.83  ? 187 VAL A CB  1 
ATOM   1171 C CG1 . VAL A 1 143 ? -4.161  13.668  43.961  1.00 16.78  ? 187 VAL A CG1 1 
ATOM   1172 C CG2 . VAL A 1 143 ? -4.246  14.702  46.246  1.00 12.76  ? 187 VAL A CG2 1 
ATOM   1173 N N   . PHE A 1 144 ? -0.594  14.324  43.533  1.00 13.26  ? 188 PHE A N   1 
ATOM   1174 C CA  . PHE A 1 144 ? 0.168   14.025  42.327  1.00 16.22  ? 188 PHE A CA  1 
ATOM   1175 C C   . PHE A 1 144 ? 1.211   12.948  42.587  1.00 17.77  ? 188 PHE A C   1 
ATOM   1176 O O   . PHE A 1 144 ? 1.312   11.969  41.852  1.00 16.77  ? 188 PHE A O   1 
ATOM   1177 C CB  . PHE A 1 144 ? 0.888   15.274  41.813  1.00 16.61  ? 188 PHE A CB  1 
ATOM   1178 C CG  . PHE A 1 144 ? 1.927   14.979  40.765  1.00 17.48  ? 188 PHE A CG  1 
ATOM   1179 C CD1 . PHE A 1 144 ? 1.570   14.843  39.427  1.00 25.04  ? 188 PHE A CD1 1 
ATOM   1180 C CD2 . PHE A 1 144 ? 3.260   14.791  41.124  1.00 22.27  ? 188 PHE A CD2 1 
ATOM   1181 C CE1 . PHE A 1 144 ? 2.528   14.519  38.457  1.00 23.62  ? 188 PHE A CE1 1 
ATOM   1182 C CE2 . PHE A 1 144 ? 4.224   14.466  40.167  1.00 23.57  ? 188 PHE A CE2 1 
ATOM   1183 C CZ  . PHE A 1 144 ? 3.856   14.329  38.829  1.00 27.04  ? 188 PHE A CZ  1 
ATOM   1184 N N   . TRP A 1 145 ? 2.008   13.144  43.627  1.00 16.63  ? 189 TRP A N   1 
ATOM   1185 C CA  . TRP A 1 145 ? 3.049   12.189  43.932  1.00 15.04  ? 189 TRP A CA  1 
ATOM   1186 C C   . TRP A 1 145 ? 2.549   10.814  44.347  1.00 20.91  ? 189 TRP A C   1 
ATOM   1187 O O   . TRP A 1 145 ? 3.064   9.804   43.863  1.00 22.67  ? 189 TRP A O   1 
ATOM   1188 C CB  . TRP A 1 145 ? 3.986   12.766  44.988  1.00 12.89  ? 189 TRP A CB  1 
ATOM   1189 C CG  . TRP A 1 145 ? 4.872   13.810  44.407  1.00 18.87  ? 189 TRP A CG  1 
ATOM   1190 C CD1 . TRP A 1 145 ? 4.871   15.148  44.692  1.00 18.14  ? 189 TRP A CD1 1 
ATOM   1191 C CD2 . TRP A 1 145 ? 5.848   13.619  43.380  1.00 13.32  ? 189 TRP A CD2 1 
ATOM   1192 N NE1 . TRP A 1 145 ? 5.782   15.799  43.901  1.00 16.13  ? 189 TRP A NE1 1 
ATOM   1193 C CE2 . TRP A 1 145 ? 6.399   14.885  43.087  1.00 18.70  ? 189 TRP A CE2 1 
ATOM   1194 C CE3 . TRP A 1 145 ? 6.310   12.500  42.677  1.00 13.95  ? 189 TRP A CE3 1 
ATOM   1195 C CZ2 . TRP A 1 145 ? 7.394   15.066  42.118  1.00 17.81  ? 189 TRP A CZ2 1 
ATOM   1196 C CZ3 . TRP A 1 145 ? 7.302   12.679  41.710  1.00 19.07  ? 189 TRP A CZ3 1 
ATOM   1197 C CH2 . TRP A 1 145 ? 7.831   13.957  41.442  1.00 14.95  ? 189 TRP A CH2 1 
ATOM   1198 N N   . LYS A 1 146 ? 1.548   10.747  45.217  1.00 20.31  ? 190 LYS A N   1 
ATOM   1199 C CA  . LYS A 1 146 ? 1.067   9.428   45.623  1.00 23.82  ? 190 LYS A CA  1 
ATOM   1200 C C   . LYS A 1 146 ? 0.453   8.700   44.435  1.00 21.67  ? 190 LYS A C   1 
ATOM   1201 O O   . LYS A 1 146 ? 0.416   7.474   44.405  1.00 23.07  ? 190 LYS A O   1 
ATOM   1202 C CB  . LYS A 1 146 ? 0.057   9.523   46.776  1.00 25.31  ? 190 LYS A CB  1 
ATOM   1203 C CG  . LYS A 1 146 ? -1.297  10.095  46.419  1.00 41.63  ? 190 LYS A CG  1 
ATOM   1204 C CD  . LYS A 1 146 ? -2.212  10.091  47.638  1.00 40.38  ? 190 LYS A CD  1 
ATOM   1205 C CE  . LYS A 1 146 ? -3.549  10.750  47.329  1.00 41.61  ? 190 LYS A CE  1 
ATOM   1206 N NZ  . LYS A 1 146 ? -4.416  10.877  48.538  1.00 40.72  ? 190 LYS A NZ  1 
ATOM   1207 N N   . THR A 1 147 ? -0.003  9.456   43.440  1.00 22.33  ? 191 THR A N   1 
ATOM   1208 C CA  . THR A 1 147 ? -0.602  8.851   42.260  1.00 21.07  ? 191 THR A CA  1 
ATOM   1209 C C   . THR A 1 147 ? 0.455   8.295   41.312  1.00 22.28  ? 191 THR A C   1 
ATOM   1210 O O   . THR A 1 147 ? 0.396   7.134   40.927  1.00 28.52  ? 191 THR A O   1 
ATOM   1211 C CB  . THR A 1 147 ? -1.470  9.861   41.480  1.00 27.16  ? 191 THR A CB  1 
ATOM   1212 O OG1 . THR A 1 147 ? -2.548  10.316  42.308  1.00 26.39  ? 191 THR A OG1 1 
ATOM   1213 C CG2 . THR A 1 147 ? -2.037  9.208   40.219  1.00 25.35  ? 191 THR A CG2 1 
ATOM   1214 N N   . VAL A 1 148 ? 1.419   9.125   40.930  1.00 21.67  ? 192 VAL A N   1 
ATOM   1215 C CA  . VAL A 1 148 ? 2.465   8.684   40.019  1.00 24.05  ? 192 VAL A CA  1 
ATOM   1216 C C   . VAL A 1 148 ? 3.339   7.617   40.672  1.00 24.19  ? 192 VAL A C   1 
ATOM   1217 O O   . VAL A 1 148 ? 3.815   6.693   40.008  1.00 24.47  ? 192 VAL A O   1 
ATOM   1218 C CB  . VAL A 1 148 ? 3.359   9.859   39.564  1.00 28.24  ? 192 VAL A CB  1 
ATOM   1219 C CG1 . VAL A 1 148 ? 2.567   10.811  38.702  1.00 27.96  ? 192 VAL A CG1 1 
ATOM   1220 C CG2 . VAL A 1 148 ? 3.917   10.591  40.768  1.00 34.12  ? 192 VAL A CG2 1 
ATOM   1221 N N   . SER A 1 149 ? 3.547   7.740   41.975  1.00 21.96  ? 193 SER A N   1 
ATOM   1222 C CA  . SER A 1 149 ? 4.355   6.762   42.694  1.00 28.54  ? 193 SER A CA  1 
ATOM   1223 C C   . SER A 1 149 ? 3.682   5.398   42.654  1.00 30.81  ? 193 SER A C   1 
ATOM   1224 O O   . SER A 1 149 ? 4.301   4.392   42.318  1.00 30.85  ? 193 SER A O   1 
ATOM   1225 C CB  . SER A 1 149 ? 4.538   7.192   44.146  1.00 21.01  ? 193 SER A CB  1 
ATOM   1226 O OG  . SER A 1 149 ? 5.299   8.382   44.209  1.00 28.59  ? 193 SER A OG  1 
ATOM   1227 N N   . ARG A 1 150 ? 2.401   5.375   42.994  1.00 26.96  ? 194 ARG A N   1 
ATOM   1228 C CA  . ARG A 1 150 ? 1.659   4.132   43.001  1.00 31.06  ? 194 ARG A CA  1 
ATOM   1229 C C   . ARG A 1 150 ? 1.667   3.455   41.640  1.00 25.67  ? 194 ARG A C   1 
ATOM   1230 O O   . ARG A 1 150 ? 1.752   2.237   41.555  1.00 20.59  ? 194 ARG A O   1 
ATOM   1231 C CB  . ARG A 1 150 ? 0.224   4.382   43.462  1.00 36.33  ? 194 ARG A CB  1 
ATOM   1232 C CG  . ARG A 1 150 ? -0.676  3.179   43.314  1.00 42.84  ? 194 ARG A CG  1 
ATOM   1233 C CD  . ARG A 1 150 ? -1.882  3.285   44.216  1.00 50.68  ? 194 ARG A CD  1 
ATOM   1234 N NE  . ARG A 1 150 ? -3.061  2.728   43.574  1.00 58.82  ? 194 ARG A NE  1 
ATOM   1235 C CZ  . ARG A 1 150 ? -3.717  3.326   42.587  1.00 67.71  ? 194 ARG A CZ  1 
ATOM   1236 N NH1 . ARG A 1 150 ? -3.307  4.508   42.132  1.00 68.29  ? 194 ARG A NH1 1 
ATOM   1237 N NH2 . ARG A 1 150 ? -4.781  2.739   42.052  1.00 70.06  ? 194 ARG A NH2 1 
ATOM   1238 N N   . ARG A 1 151 ? 1.591   4.247   40.578  1.00 29.47  ? 195 ARG A N   1 
ATOM   1239 C CA  . ARG A 1 151 ? 1.584   3.698   39.226  1.00 30.89  ? 195 ARG A CA  1 
ATOM   1240 C C   . ARG A 1 151 ? 2.959   3.158   38.873  1.00 26.50  ? 195 ARG A C   1 
ATOM   1241 O O   . ARG A 1 151 ? 3.086   2.135   38.207  1.00 32.11  ? 195 ARG A O   1 
ATOM   1242 C CB  . ARG A 1 151 ? 1.158   4.772   38.223  1.00 36.26  ? 195 ARG A CB  1 
ATOM   1243 C CG  . ARG A 1 151 ? -0.215  5.366   38.528  1.00 49.04  ? 195 ARG A CG  1 
ATOM   1244 C CD  . ARG A 1 151 ? -0.587  6.506   37.584  1.00 59.81  ? 195 ARG A CD  1 
ATOM   1245 N NE  . ARG A 1 151 ? -1.532  6.101   36.544  1.00 65.43  ? 195 ARG A NE  1 
ATOM   1246 C CZ  . ARG A 1 151 ? -1.258  5.243   35.566  1.00 67.28  ? 195 ARG A CZ  1 
ATOM   1247 N NH1 . ARG A 1 151 ? -0.054  4.687   35.483  1.00 69.05  ? 195 ARG A NH1 1 
ATOM   1248 N NH2 . ARG A 1 151 ? -2.191  4.939   34.672  1.00 58.44  ? 195 ARG A NH2 1 
ATOM   1249 N N   . PHE A 1 152 ? 3.990   3.846   39.338  1.00 20.68  ? 196 PHE A N   1 
ATOM   1250 C CA  . PHE A 1 152 ? 5.352   3.426   39.073  1.00 23.76  ? 196 PHE A CA  1 
ATOM   1251 C C   . PHE A 1 152 ? 5.616   2.095   39.771  1.00 21.40  ? 196 PHE A C   1 
ATOM   1252 O O   . PHE A 1 152 ? 6.164   1.169   39.179  1.00 27.71  ? 196 PHE A O   1 
ATOM   1253 C CB  . PHE A 1 152 ? 6.333   4.488   39.575  1.00 16.82  ? 196 PHE A CB  1 
ATOM   1254 C CG  . PHE A 1 152 ? 7.723   4.321   39.047  1.00 18.52  ? 196 PHE A CG  1 
ATOM   1255 C CD1 . PHE A 1 152 ? 7.964   4.333   37.677  1.00 13.83  ? 196 PHE A CD1 1 
ATOM   1256 C CD2 . PHE A 1 152 ? 8.800   4.172   39.914  1.00 17.63  ? 196 PHE A CD2 1 
ATOM   1257 C CE1 . PHE A 1 152 ? 9.260   4.202   37.174  1.00 10.95  ? 196 PHE A CE1 1 
ATOM   1258 C CE2 . PHE A 1 152 ? 10.101  4.040   39.422  1.00 14.93  ? 196 PHE A CE2 1 
ATOM   1259 C CZ  . PHE A 1 152 ? 10.334  4.055   38.050  1.00 13.19  ? 196 PHE A CZ  1 
ATOM   1260 N N   . ALA A 1 153 ? 5.214   2.003   41.032  1.00 23.38  ? 197 ALA A N   1 
ATOM   1261 C CA  . ALA A 1 153 ? 5.405   0.782   41.802  1.00 22.19  ? 197 ALA A CA  1 
ATOM   1262 C C   . ALA A 1 153 ? 4.657   -0.390  41.181  1.00 24.31  ? 197 ALA A C   1 
ATOM   1263 O O   . ALA A 1 153 ? 5.218   -1.474  41.031  1.00 26.20  ? 197 ALA A O   1 
ATOM   1264 C CB  . ALA A 1 153 ? 4.945   0.994   43.235  1.00 27.56  ? 197 ALA A CB  1 
ATOM   1265 N N   . GLU A 1 154 ? 3.396   -0.165  40.812  1.00 23.15  ? 198 GLU A N   1 
ATOM   1266 C CA  . GLU A 1 154 ? 2.571   -1.214  40.212  1.00 25.77  ? 198 GLU A CA  1 
ATOM   1267 C C   . GLU A 1 154 ? 3.182   -1.804  38.945  1.00 27.37  ? 198 GLU A C   1 
ATOM   1268 O O   . GLU A 1 154 ? 2.960   -2.975  38.622  1.00 27.01  ? 198 GLU A O   1 
ATOM   1269 C CB  . GLU A 1 154 ? 1.183   -0.686  39.838  1.00 27.42  ? 198 GLU A CB  1 
ATOM   1270 C CG  . GLU A 1 154 ? 0.299   -0.230  40.977  1.00 34.54  ? 198 GLU A CG  1 
ATOM   1271 C CD  . GLU A 1 154 ? -1.052  0.259   40.473  1.00 35.07  ? 198 GLU A CD  1 
ATOM   1272 O OE1 . GLU A 1 154 ? -1.080  0.925   39.414  1.00 34.96  ? 198 GLU A OE1 1 
ATOM   1273 O OE2 . GLU A 1 154 ? -2.076  -0.012  41.132  1.00 28.40  ? 198 GLU A OE2 1 
ATOM   1274 N N   . ALA A 1 155 ? 3.938   -0.987  38.226  1.00 25.19  ? 199 ALA A N   1 
ATOM   1275 C CA  . ALA A 1 155 ? 4.538   -1.421  36.978  1.00 25.49  ? 199 ALA A CA  1 
ATOM   1276 C C   . ALA A 1 155 ? 5.817   -2.226  37.147  1.00 23.67  ? 199 ALA A C   1 
ATOM   1277 O O   . ALA A 1 155 ? 6.279   -2.855  36.197  1.00 29.01  ? 199 ALA A O   1 
ATOM   1278 C CB  . ALA A 1 155 ? 4.793   -0.206  36.077  1.00 23.83  ? 199 ALA A CB  1 
ATOM   1279 N N   . ALA A 1 156 ? 6.387   -2.218  38.346  1.00 22.54  ? 200 ALA A N   1 
ATOM   1280 C CA  . ALA A 1 156 ? 7.628   -2.953  38.595  1.00 22.39  ? 200 ALA A CA  1 
ATOM   1281 C C   . ALA A 1 156 ? 7.448   -4.480  38.504  1.00 24.03  ? 200 ALA A C   1 
ATOM   1282 O O   . ALA A 1 156 ? 6.348   -4.992  38.713  1.00 25.11  ? 200 ALA A O   1 
ATOM   1283 C CB  . ALA A 1 156 ? 8.183   -2.569  39.958  1.00 18.37  ? 200 ALA A CB  1 
ATOM   1284 N N   . CYS A 1 157 ? 8.532   -5.185  38.175  1.00 19.47  ? 201 CYS A N   1 
ATOM   1285 C CA  . CYS A 1 157 ? 8.528   -6.647  38.055  1.00 22.78  ? 201 CYS A CA  1 
ATOM   1286 C C   . CYS A 1 157 ? 9.887   -7.229  38.427  1.00 20.92  ? 201 CYS A C   1 
ATOM   1287 O O   . CYS A 1 157 ? 10.878  -6.505  38.549  1.00 19.48  ? 201 CYS A O   1 
ATOM   1288 C CB  . CYS A 1 157 ? 8.203   -7.099  36.618  1.00 18.90  ? 201 CYS A CB  1 
ATOM   1289 S SG  . CYS A 1 157 ? 9.543   -6.760  35.432  1.00 31.85  ? 201 CYS A SG  1 
ATOM   1290 N N   . ASP A 1 158 ? 9.917   -8.545  38.611  1.00 27.15  ? 202 ASP A N   1 
ATOM   1291 C CA  . ASP A 1 158 ? 11.149  -9.257  38.920  1.00 21.86  ? 202 ASP A CA  1 
ATOM   1292 C C   . ASP A 1 158 ? 11.804  -8.769  40.213  1.00 25.50  ? 202 ASP A C   1 
ATOM   1293 O O   . ASP A 1 158 ? 11.253  -8.951  41.301  1.00 26.57  ? 202 ASP A O   1 
ATOM   1294 C CB  . ASP A 1 158 ? 12.100  -9.098  37.738  1.00 22.13  ? 202 ASP A CB  1 
ATOM   1295 C CG  . ASP A 1 158 ? 13.271  -10.038 37.801  1.00 28.18  ? 202 ASP A CG  1 
ATOM   1296 O OD1 . ASP A 1 158 ? 13.054  -11.240 38.077  1.00 27.54  ? 202 ASP A OD1 1 
ATOM   1297 O OD2 . ASP A 1 158 ? 14.404  -9.573  37.559  1.00 26.83  ? 202 ASP A OD2 1 
ATOM   1298 N N   . VAL A 1 159 ? 12.983  -8.162  40.091  1.00 27.24  ? 203 VAL A N   1 
ATOM   1299 C CA  . VAL A 1 159 ? 13.702  -7.634  41.248  1.00 21.33  ? 203 VAL A CA  1 
ATOM   1300 C C   . VAL A 1 159 ? 13.642  -6.102  41.258  1.00 22.56  ? 203 VAL A C   1 
ATOM   1301 O O   . VAL A 1 159 ? 14.087  -5.442  40.326  1.00 23.70  ? 203 VAL A O   1 
ATOM   1302 C CB  . VAL A 1 159 ? 15.189  -8.094  41.252  1.00 21.58  ? 203 VAL A CB  1 
ATOM   1303 C CG1 . VAL A 1 159 ? 15.943  -7.438  42.395  1.00 24.68  ? 203 VAL A CG1 1 
ATOM   1304 C CG2 . VAL A 1 159 ? 15.265  -9.602  41.410  1.00 18.94  ? 203 VAL A CG2 1 
ATOM   1305 N N   . VAL A 1 160 ? 13.069  -5.552  42.321  1.00 21.03  ? 204 VAL A N   1 
ATOM   1306 C CA  . VAL A 1 160 ? 12.941  -4.115  42.484  1.00 17.01  ? 204 VAL A CA  1 
ATOM   1307 C C   . VAL A 1 160 ? 13.931  -3.736  43.562  1.00 19.27  ? 204 VAL A C   1 
ATOM   1308 O O   . VAL A 1 160 ? 14.011  -4.413  44.583  1.00 23.32  ? 204 VAL A O   1 
ATOM   1309 C CB  . VAL A 1 160 ? 11.521  -3.725  42.972  1.00 26.52  ? 204 VAL A CB  1 
ATOM   1310 C CG1 . VAL A 1 160 ? 11.409  -2.222  43.126  1.00 23.84  ? 204 VAL A CG1 1 
ATOM   1311 C CG2 . VAL A 1 160 ? 10.471  -4.247  42.003  1.00 21.86  ? 204 VAL A CG2 1 
ATOM   1312 N N   . HIS A 1 161 ? 14.692  -2.669  43.342  1.00 16.17  ? 205 HIS A N   1 
ATOM   1313 C CA  . HIS A 1 161 ? 15.657  -2.234  44.340  1.00 19.74  ? 205 HIS A CA  1 
ATOM   1314 C C   . HIS A 1 161 ? 15.189  -0.945  44.987  1.00 23.10  ? 205 HIS A C   1 
ATOM   1315 O O   . HIS A 1 161 ? 14.516  -0.129  44.356  1.00 22.88  ? 205 HIS A O   1 
ATOM   1316 C CB  . HIS A 1 161 ? 17.046  -2.010  43.719  1.00 17.44  ? 205 HIS A CB  1 
ATOM   1317 C CG  . HIS A 1 161 ? 17.631  -3.236  43.094  1.00 30.79  ? 205 HIS A CG  1 
ATOM   1318 N ND1 . HIS A 1 161 ? 17.234  -3.707  41.859  1.00 35.21  ? 205 HIS A ND1 1 
ATOM   1319 C CD2 . HIS A 1 161 ? 18.549  -4.120  43.555  1.00 29.91  ? 205 HIS A CD2 1 
ATOM   1320 C CE1 . HIS A 1 161 ? 17.881  -4.826  41.588  1.00 32.99  ? 205 HIS A CE1 1 
ATOM   1321 N NE2 . HIS A 1 161 ? 18.684  -5.099  42.601  1.00 29.12  ? 205 HIS A NE2 1 
ATOM   1322 N N   . VAL A 1 162 ? 15.523  -0.780  46.260  1.00 21.01  ? 206 VAL A N   1 
ATOM   1323 C CA  . VAL A 1 162 ? 15.173  0.434   46.968  1.00 18.76  ? 206 VAL A CA  1 
ATOM   1324 C C   . VAL A 1 162 ? 16.403  0.942   47.697  1.00 22.16  ? 206 VAL A C   1 
ATOM   1325 O O   . VAL A 1 162 ? 17.040  0.217   48.468  1.00 24.01  ? 206 VAL A O   1 
ATOM   1326 C CB  . VAL A 1 162 ? 14.021  0.227   47.985  1.00 21.87  ? 206 VAL A CB  1 
ATOM   1327 C CG1 . VAL A 1 162 ? 14.383  -0.837  49.007  1.00 20.52  ? 206 VAL A CG1 1 
ATOM   1328 C CG2 . VAL A 1 162 ? 13.720  1.541   48.679  1.00 17.18  ? 206 VAL A CG2 1 
ATOM   1329 N N   . MET A 1 163 ? 16.752  2.193   47.430  1.00 23.63  ? 207 MET A N   1 
ATOM   1330 C CA  . MET A 1 163 ? 17.899  2.796   48.076  1.00 19.77  ? 207 MET A CA  1 
ATOM   1331 C C   . MET A 1 163 ? 17.377  3.454   49.349  1.00 20.80  ? 207 MET A C   1 
ATOM   1332 O O   . MET A 1 163 ? 16.389  4.187   49.313  1.00 21.70  ? 207 MET A O   1 
ATOM   1333 C CB  . MET A 1 163 ? 18.541  3.820   47.140  1.00 19.24  ? 207 MET A CB  1 
ATOM   1334 C CG  . MET A 1 163 ? 19.984  4.115   47.468  1.00 29.34  ? 207 MET A CG  1 
ATOM   1335 S SD  . MET A 1 163 ? 20.775  5.217   46.300  1.00 32.58  ? 207 MET A SD  1 
ATOM   1336 C CE  . MET A 1 163 ? 21.406  4.060   45.091  1.00 27.82  ? 207 MET A CE  1 
ATOM   1337 N N   . LEU A 1 164 ? 18.018  3.162   50.477  1.00 22.91  ? 208 LEU A N   1 
ATOM   1338 C CA  . LEU A 1 164 ? 17.601  3.720   51.760  1.00 23.25  ? 208 LEU A CA  1 
ATOM   1339 C C   . LEU A 1 164 ? 18.760  4.443   52.422  1.00 26.40  ? 208 LEU A C   1 
ATOM   1340 O O   . LEU A 1 164 ? 19.923  4.106   52.187  1.00 24.27  ? 208 LEU A O   1 
ATOM   1341 C CB  . LEU A 1 164 ? 17.089  2.611   52.685  1.00 23.74  ? 208 LEU A CB  1 
ATOM   1342 C CG  . LEU A 1 164 ? 15.910  1.803   52.143  1.00 32.60  ? 208 LEU A CG  1 
ATOM   1343 C CD1 . LEU A 1 164 ? 15.496  0.742   53.159  1.00 23.45  ? 208 LEU A CD1 1 
ATOM   1344 C CD2 . LEU A 1 164 ? 14.750  2.749   51.825  1.00 29.69  ? 208 LEU A CD2 1 
ATOM   1345 N N   . ASN A 1 165 ? 18.441  5.431   53.252  1.00 19.71  ? 209 ASN A N   1 
ATOM   1346 C CA  . ASN A 1 165 ? 19.476  6.210   53.923  1.00 28.73  ? 209 ASN A CA  1 
ATOM   1347 C C   . ASN A 1 165 ? 19.802  5.699   55.329  1.00 28.76  ? 209 ASN A C   1 
ATOM   1348 O O   . ASN A 1 165 ? 19.004  5.851   56.261  1.00 21.98  ? 209 ASN A O   1 
ATOM   1349 C CB  . ASN A 1 165 ? 19.058  7.677   54.001  1.00 25.88  ? 209 ASN A CB  1 
ATOM   1350 C CG  . ASN A 1 165 ? 20.205  8.581   54.392  1.00 33.35  ? 209 ASN A CG  1 
ATOM   1351 O OD1 . ASN A 1 165 ? 21.176  8.140   55.012  1.00 36.88  ? 209 ASN A OD1 1 
ATOM   1352 N ND2 . ASN A 1 165 ? 20.098  9.857   54.041  1.00 31.24  ? 209 ASN A ND2 1 
ATOM   1353 N N   . GLY A 1 166 ? 20.988  5.106   55.467  1.00 27.39  ? 210 GLY A N   1 
ATOM   1354 C CA  . GLY A 1 166 ? 21.422  4.563   56.745  1.00 32.27  ? 210 GLY A CA  1 
ATOM   1355 C C   . GLY A 1 166 ? 21.676  5.575   57.849  1.00 36.69  ? 210 GLY A C   1 
ATOM   1356 O O   . GLY A 1 166 ? 21.623  5.227   59.029  1.00 39.86  ? 210 GLY A O   1 
ATOM   1357 N N   . SER A 1 167 ? 21.947  6.823   57.474  1.00 31.96  ? 211 SER A N   1 
ATOM   1358 C CA  . SER A 1 167 ? 22.216  7.888   58.442  1.00 35.52  ? 211 SER A CA  1 
ATOM   1359 C C   . SER A 1 167 ? 20.987  8.375   59.200  1.00 39.61  ? 211 SER A C   1 
ATOM   1360 O O   . SER A 1 167 ? 21.113  9.124   60.166  1.00 45.68  ? 211 SER A O   1 
ATOM   1361 C CB  . SER A 1 167 ? 22.832  9.096   57.736  1.00 31.91  ? 211 SER A CB  1 
ATOM   1362 O OG  . SER A 1 167 ? 24.083  8.770   57.160  1.00 56.97  ? 211 SER A OG  1 
ATOM   1363 N N   . ARG A 1 168 ? 19.807  7.942   58.773  1.00 35.83  ? 212 ARG A N   1 
ATOM   1364 C CA  . ARG A 1 168 ? 18.554  8.394   59.369  1.00 37.92  ? 212 ARG A CA  1 
ATOM   1365 C C   . ARG A 1 168 ? 18.100  7.682   60.636  1.00 36.78  ? 212 ARG A C   1 
ATOM   1366 O O   . ARG A 1 168 ? 18.355  6.491   60.825  1.00 37.73  ? 212 ARG A O   1 
ATOM   1367 C CB  . ARG A 1 168 ? 17.448  8.304   58.316  1.00 44.91  ? 212 ARG A CB  1 
ATOM   1368 C CG  . ARG A 1 168 ? 17.800  8.977   56.997  1.00 45.99  ? 212 ARG A CG  1 
ATOM   1369 C CD  . ARG A 1 168 ? 17.372  10.424  56.977  1.00 55.93  ? 212 ARG A CD  1 
ATOM   1370 N NE  . ARG A 1 168 ? 15.928  10.540  57.164  1.00 68.33  ? 212 ARG A NE  1 
ATOM   1371 C CZ  . ARG A 1 168 ? 15.222  11.630  56.885  1.00 70.31  ? 212 ARG A CZ  1 
ATOM   1372 N NH1 . ARG A 1 168 ? 15.827  12.708  56.400  1.00 71.08  ? 212 ARG A NH1 1 
ATOM   1373 N NH2 . ARG A 1 168 ? 13.912  11.642  57.093  1.00 69.36  ? 212 ARG A NH2 1 
ATOM   1374 N N   . SER A 1 169 ? 17.410  8.424   61.498  1.00 30.44  ? 213 SER A N   1 
ATOM   1375 C CA  . SER A 1 169 ? 16.900  7.870   62.747  1.00 41.47  ? 213 SER A CA  1 
ATOM   1376 C C   . SER A 1 169 ? 16.091  6.619   62.429  1.00 37.49  ? 213 SER A C   1 
ATOM   1377 O O   . SER A 1 169 ? 16.119  5.636   63.172  1.00 41.72  ? 213 SER A O   1 
ATOM   1378 C CB  . SER A 1 169 ? 16.025  8.903   63.462  1.00 43.02  ? 213 SER A CB  1 
ATOM   1379 O OG  . SER A 1 169 ? 15.051  9.434   62.578  1.00 66.04  ? 213 SER A OG  1 
ATOM   1380 N N   . LYS A 1 170 ? 15.372  6.666   61.315  1.00 31.42  ? 214 LYS A N   1 
ATOM   1381 C CA  . LYS A 1 170 ? 14.581  5.531   60.867  1.00 32.48  ? 214 LYS A CA  1 
ATOM   1382 C C   . LYS A 1 170 ? 14.972  5.236   59.423  1.00 29.68  ? 214 LYS A C   1 
ATOM   1383 O O   . LYS A 1 170 ? 14.420  5.830   58.504  1.00 32.58  ? 214 LYS A O   1 
ATOM   1384 C CB  . LYS A 1 170 ? 13.090  5.853   60.937  1.00 31.97  ? 214 LYS A CB  1 
ATOM   1385 C CG  . LYS A 1 170 ? 12.602  6.295   62.300  1.00 36.77  ? 214 LYS A CG  1 
ATOM   1386 C CD  . LYS A 1 170 ? 11.096  6.093   62.417  1.00 42.08  ? 214 LYS A CD  1 
ATOM   1387 C CE  . LYS A 1 170 ? 10.508  6.829   63.614  1.00 50.74  ? 214 LYS A CE  1 
ATOM   1388 N NZ  . LYS A 1 170 ? 10.519  8.313   63.417  1.00 57.05  ? 214 LYS A NZ  1 
ATOM   1389 N N   . ILE A 1 171 ? 15.925  4.328   59.223  1.00 27.73  ? 215 ILE A N   1 
ATOM   1390 C CA  . ILE A 1 171 ? 16.376  3.991   57.876  1.00 22.55  ? 215 ILE A CA  1 
ATOM   1391 C C   . ILE A 1 171 ? 15.157  3.680   57.017  1.00 25.74  ? 215 ILE A C   1 
ATOM   1392 O O   . ILE A 1 171 ? 15.082  4.077   55.855  1.00 17.27  ? 215 ILE A O   1 
ATOM   1393 C CB  . ILE A 1 171 ? 17.352  2.799   57.899  1.00 27.43  ? 215 ILE A CB  1 
ATOM   1394 C CG1 . ILE A 1 171 ? 18.533  3.132   58.830  1.00 19.96  ? 215 ILE A CG1 1 
ATOM   1395 C CG2 . ILE A 1 171 ? 17.853  2.506   56.479  1.00 15.79  ? 215 ILE A CG2 1 
ATOM   1396 C CD1 . ILE A 1 171 ? 19.552  2.016   59.004  1.00 23.02  ? 215 ILE A CD1 1 
ATOM   1397 N N   . PHE A 1 172 ? 14.201  2.964   57.597  1.00 27.23  ? 216 PHE A N   1 
ATOM   1398 C CA  . PHE A 1 172 ? 12.963  2.672   56.899  1.00 19.88  ? 216 PHE A CA  1 
ATOM   1399 C C   . PHE A 1 172 ? 11.867  3.364   57.686  1.00 24.41  ? 216 PHE A C   1 
ATOM   1400 O O   . PHE A 1 172 ? 11.570  2.987   58.818  1.00 27.17  ? 216 PHE A O   1 
ATOM   1401 C CB  . PHE A 1 172 ? 12.653  1.184   56.846  1.00 21.07  ? 216 PHE A CB  1 
ATOM   1402 C CG  . PHE A 1 172 ? 11.253  0.905   56.414  1.00 25.62  ? 216 PHE A CG  1 
ATOM   1403 C CD1 . PHE A 1 172 ? 10.841  1.219   55.128  1.00 22.19  ? 216 PHE A CD1 1 
ATOM   1404 C CD2 . PHE A 1 172 ? 10.313  0.430   57.320  1.00 28.45  ? 216 PHE A CD2 1 
ATOM   1405 C CE1 . PHE A 1 172 ? 9.518   1.073   54.752  1.00 25.45  ? 216 PHE A CE1 1 
ATOM   1406 C CE2 . PHE A 1 172 ? 8.985   0.280   56.957  1.00 19.34  ? 216 PHE A CE2 1 
ATOM   1407 C CZ  . PHE A 1 172 ? 8.584   0.603   55.672  1.00 25.31  ? 216 PHE A CZ  1 
ATOM   1408 N N   . ASP A 1 173 ? 11.261  4.378   57.084  1.00 29.29  ? 217 ASP A N   1 
ATOM   1409 C CA  . ASP A 1 173 ? 10.213  5.128   57.751  1.00 26.32  ? 217 ASP A CA  1 
ATOM   1410 C C   . ASP A 1 173 ? 8.836   4.816   57.195  1.00 28.80  ? 217 ASP A C   1 
ATOM   1411 O O   . ASP A 1 173 ? 8.550   5.114   56.037  1.00 29.90  ? 217 ASP A O   1 
ATOM   1412 C CB  . ASP A 1 173 ? 10.475  6.623   57.600  1.00 31.70  ? 217 ASP A CB  1 
ATOM   1413 C CG  . ASP A 1 173 ? 9.566   7.466   58.465  1.00 32.41  ? 217 ASP A CG  1 
ATOM   1414 O OD1 . ASP A 1 173 ? 8.426   7.039   58.736  1.00 36.61  ? 217 ASP A OD1 1 
ATOM   1415 O OD2 . ASP A 1 173 ? 9.992   8.567   58.864  1.00 42.32  ? 217 ASP A OD2 1 
ATOM   1416 N N   . LYS A 1 174 ? 7.981   4.228   58.023  1.00 30.47  ? 218 LYS A N   1 
ATOM   1417 C CA  . LYS A 1 174 ? 6.625   3.919   57.594  1.00 36.03  ? 218 LYS A CA  1 
ATOM   1418 C C   . LYS A 1 174 ? 5.986   5.176   57.009  1.00 35.61  ? 218 LYS A C   1 
ATOM   1419 O O   . LYS A 1 174 ? 5.291   5.131   55.992  1.00 33.00  ? 218 LYS A O   1 
ATOM   1420 C CB  . LYS A 1 174 ? 5.782   3.444   58.776  1.00 33.08  ? 218 LYS A CB  1 
ATOM   1421 C CG  . LYS A 1 174 ? 6.073   2.035   59.229  1.00 42.69  ? 218 LYS A CG  1 
ATOM   1422 C CD  . LYS A 1 174 ? 5.021   1.578   60.235  1.00 45.15  ? 218 LYS A CD  1 
ATOM   1423 C CE  . LYS A 1 174 ? 5.196   2.271   61.569  1.00 47.48  ? 218 LYS A CE  1 
ATOM   1424 N NZ  . LYS A 1 174 ? 6.490   1.888   62.208  1.00 50.64  ? 218 LYS A NZ  1 
ATOM   1425 N N   . ASN A 1 175 ? 6.239   6.303   57.658  1.00 34.09  ? 219 ASN A N   1 
ATOM   1426 C CA  . ASN A 1 175 ? 5.670   7.557   57.215  1.00 37.48  ? 219 ASN A CA  1 
ATOM   1427 C C   . ASN A 1 175 ? 6.521   8.183   56.136  1.00 37.96  ? 219 ASN A C   1 
ATOM   1428 O O   . ASN A 1 175 ? 7.319   9.080   56.397  1.00 46.59  ? 219 ASN A O   1 
ATOM   1429 C CB  . ASN A 1 175 ? 5.527   8.523   58.386  1.00 43.22  ? 219 ASN A CB  1 
ATOM   1430 C CG  . ASN A 1 175 ? 4.306   9.400   58.254  1.00 57.38  ? 219 ASN A CG  1 
ATOM   1431 O OD1 . ASN A 1 175 ? 3.176   8.914   58.322  1.00 70.82  ? 219 ASN A OD1 1 
ATOM   1432 N ND2 . ASN A 1 175 ? 4.520   10.694  58.048  1.00 62.95  ? 219 ASN A ND2 1 
ATOM   1433 N N   . SER A 1 176 ? 6.345   7.688   54.920  1.00 36.00  ? 220 SER A N   1 
ATOM   1434 C CA  . SER A 1 176 ? 7.070   8.183   53.765  1.00 31.26  ? 220 SER A CA  1 
ATOM   1435 C C   . SER A 1 176 ? 6.382   7.594   52.554  1.00 30.40  ? 220 SER A C   1 
ATOM   1436 O O   . SER A 1 176 ? 5.668   6.600   52.667  1.00 32.31  ? 220 SER A O   1 
ATOM   1437 C CB  . SER A 1 176 ? 8.535   7.733   53.799  1.00 29.30  ? 220 SER A CB  1 
ATOM   1438 O OG  . SER A 1 176 ? 8.662   6.341   53.577  1.00 28.94  ? 220 SER A OG  1 
ATOM   1439 N N   . THR A 1 177 ? 6.587   8.210   51.399  1.00 28.60  ? 221 THR A N   1 
ATOM   1440 C CA  . THR A 1 177 ? 5.981   7.718   50.176  1.00 26.19  ? 221 THR A CA  1 
ATOM   1441 C C   . THR A 1 177 ? 6.339   6.250   49.977  1.00 29.09  ? 221 THR A C   1 
ATOM   1442 O O   . THR A 1 177 ? 5.487   5.439   49.623  1.00 29.52  ? 221 THR A O   1 
ATOM   1443 C CB  . THR A 1 177 ? 6.472   8.513   48.969  1.00 26.97  ? 221 THR A CB  1 
ATOM   1444 O OG1 . THR A 1 177 ? 6.300   9.909   49.231  1.00 24.84  ? 221 THR A OG1 1 
ATOM   1445 C CG2 . THR A 1 177 ? 5.689   8.118   47.714  1.00 18.59  ? 221 THR A CG2 1 
ATOM   1446 N N   . PHE A 1 178 ? 7.602   5.906   50.209  1.00 29.55  ? 222 PHE A N   1 
ATOM   1447 C CA  . PHE A 1 178 ? 8.028   4.523   50.044  1.00 27.79  ? 222 PHE A CA  1 
ATOM   1448 C C   . PHE A 1 178 ? 7.241   3.571   50.939  1.00 21.56  ? 222 PHE A C   1 
ATOM   1449 O O   . PHE A 1 178 ? 6.642   2.614   50.455  1.00 18.30  ? 222 PHE A O   1 
ATOM   1450 C CB  . PHE A 1 178 ? 9.517   4.353   50.344  1.00 20.32  ? 222 PHE A CB  1 
ATOM   1451 C CG  . PHE A 1 178 ? 9.971   2.924   50.279  1.00 25.36  ? 222 PHE A CG  1 
ATOM   1452 C CD1 . PHE A 1 178 ? 9.988   2.243   49.066  1.00 22.31  ? 222 PHE A CD1 1 
ATOM   1453 C CD2 . PHE A 1 178 ? 10.316  2.235   51.435  1.00 22.15  ? 222 PHE A CD2 1 
ATOM   1454 C CE1 . PHE A 1 178 ? 10.341  0.895   49.005  1.00 23.71  ? 222 PHE A CE1 1 
ATOM   1455 C CE2 . PHE A 1 178 ? 10.669  0.886   51.380  1.00 29.50  ? 222 PHE A CE2 1 
ATOM   1456 C CZ  . PHE A 1 178 ? 10.679  0.216   50.158  1.00 19.59  ? 222 PHE A CZ  1 
ATOM   1457 N N   . GLY A 1 179 ? 7.246   3.853   52.239  1.00 18.25  ? 223 GLY A N   1 
ATOM   1458 C CA  . GLY A 1 179 ? 6.554   3.016   53.203  1.00 25.32  ? 223 GLY A CA  1 
ATOM   1459 C C   . GLY A 1 179 ? 5.032   3.051   53.238  1.00 28.23  ? 223 GLY A C   1 
ATOM   1460 O O   . GLY A 1 179 ? 4.409   2.095   53.702  1.00 31.74  ? 223 GLY A O   1 
ATOM   1461 N N   . SER A 1 180 ? 4.422   4.128   52.755  1.00 27.02  ? 224 SER A N   1 
ATOM   1462 C CA  . SER A 1 180 ? 2.966   4.225   52.774  1.00 27.16  ? 224 SER A CA  1 
ATOM   1463 C C   . SER A 1 180 ? 2.270   3.932   51.454  1.00 27.84  ? 224 SER A C   1 
ATOM   1464 O O   . SER A 1 180 ? 1.070   3.669   51.438  1.00 26.59  ? 224 SER A O   1 
ATOM   1465 C CB  . SER A 1 180 ? 2.529   5.601   53.266  1.00 30.72  ? 224 SER A CB  1 
ATOM   1466 O OG  . SER A 1 180 ? 2.757   5.729   54.654  1.00 36.44  ? 224 SER A OG  1 
ATOM   1467 N N   . VAL A 1 181 ? 2.995   3.976   50.344  1.00 23.87  ? 225 VAL A N   1 
ATOM   1468 C CA  . VAL A 1 181 ? 2.342   3.688   49.083  1.00 27.68  ? 225 VAL A CA  1 
ATOM   1469 C C   . VAL A 1 181 ? 3.075   2.767   48.111  1.00 28.53  ? 225 VAL A C   1 
ATOM   1470 O O   . VAL A 1 181 ? 2.452   1.889   47.518  1.00 39.15  ? 225 VAL A O   1 
ATOM   1471 C CB  . VAL A 1 181 ? 1.895   5.013   48.361  1.00 31.71  ? 225 VAL A CB  1 
ATOM   1472 C CG1 . VAL A 1 181 ? 2.791   6.156   48.751  1.00 23.83  ? 225 VAL A CG1 1 
ATOM   1473 C CG2 . VAL A 1 181 ? 1.879   4.821   46.833  1.00 24.22  ? 225 VAL A CG2 1 
ATOM   1474 N N   . GLU A 1 182 ? 4.381   2.932   47.951  1.00 24.54  ? 226 GLU A N   1 
ATOM   1475 C CA  . GLU A 1 182 ? 5.109   2.094   47.004  1.00 19.04  ? 226 GLU A CA  1 
ATOM   1476 C C   . GLU A 1 182 ? 5.278   0.633   47.414  1.00 21.07  ? 226 GLU A C   1 
ATOM   1477 O O   . GLU A 1 182 ? 5.084   -0.278  46.607  1.00 21.85  ? 226 GLU A O   1 
ATOM   1478 C CB  . GLU A 1 182 ? 6.481   2.699   46.713  1.00 18.88  ? 226 GLU A CB  1 
ATOM   1479 C CG  . GLU A 1 182 ? 6.411   4.096   46.123  1.00 31.60  ? 226 GLU A CG  1 
ATOM   1480 C CD  . GLU A 1 182 ? 7.778   4.645   45.749  1.00 36.18  ? 226 GLU A CD  1 
ATOM   1481 O OE1 . GLU A 1 182 ? 8.654   4.726   46.634  1.00 31.05  ? 226 GLU A OE1 1 
ATOM   1482 O OE2 . GLU A 1 182 ? 7.969   4.998   44.568  1.00 43.09  ? 226 GLU A OE2 1 
ATOM   1483 N N   . VAL A 1 183 ? 5.649   0.402   48.662  1.00 17.90  ? 227 VAL A N   1 
ATOM   1484 C CA  . VAL A 1 183 ? 5.855   -0.959  49.118  1.00 25.45  ? 227 VAL A CA  1 
ATOM   1485 C C   . VAL A 1 183 ? 4.554   -1.771  49.123  1.00 22.34  ? 227 VAL A C   1 
ATOM   1486 O O   . VAL A 1 183 ? 4.574   -2.980  48.916  1.00 20.62  ? 227 VAL A O   1 
ATOM   1487 C CB  . VAL A 1 183 ? 6.496   -0.977  50.534  1.00 26.19  ? 227 VAL A CB  1 
ATOM   1488 C CG1 . VAL A 1 183 ? 5.491   -0.507  51.579  1.00 27.03  ? 227 VAL A CG1 1 
ATOM   1489 C CG2 . VAL A 1 183 ? 7.006   -2.370  50.849  1.00 29.02  ? 227 VAL A CG2 1 
ATOM   1490 N N   . HIS A 1 184 ? 3.427   -1.100  49.334  1.00 18.90  ? 228 HIS A N   1 
ATOM   1491 C CA  . HIS A 1 184 ? 2.141   -1.781  49.382  1.00 21.99  ? 228 HIS A CA  1 
ATOM   1492 C C   . HIS A 1 184 ? 1.514   -1.939  48.003  1.00 28.24  ? 228 HIS A C   1 
ATOM   1493 O O   . HIS A 1 184 ? 0.436   -2.515  47.860  1.00 27.49  ? 228 HIS A O   1 
ATOM   1494 C CB  . HIS A 1 184 ? 1.175   -1.016  50.284  1.00 22.09  ? 228 HIS A CB  1 
ATOM   1495 C CG  . HIS A 1 184 ? 1.702   -0.765  51.663  1.00 17.97  ? 228 HIS A CG  1 
ATOM   1496 N ND1 . HIS A 1 184 ? 1.898   -1.774  52.579  1.00 16.55  ? 228 HIS A ND1 1 
ATOM   1497 C CD2 . HIS A 1 184 ? 2.052   0.384   52.287  1.00 16.27  ? 228 HIS A CD2 1 
ATOM   1498 C CE1 . HIS A 1 184 ? 2.342   -1.257  53.711  1.00 18.27  ? 228 HIS A CE1 1 
ATOM   1499 N NE2 . HIS A 1 184 ? 2.444   0.051   53.561  1.00 20.92  ? 228 HIS A NE2 1 
ATOM   1500 N N   . ASN A 1 185 ? 2.188   -1.433  46.982  1.00 30.86  ? 229 ASN A N   1 
ATOM   1501 C CA  . ASN A 1 185 ? 1.638   -1.534  45.651  1.00 28.21  ? 229 ASN A CA  1 
ATOM   1502 C C   . ASN A 1 185 ? 2.492   -2.314  44.670  1.00 26.36  ? 229 ASN A C   1 
ATOM   1503 O O   . ASN A 1 185 ? 2.183   -2.372  43.482  1.00 25.92  ? 229 ASN A O   1 
ATOM   1504 C CB  . ASN A 1 185 ? 1.303   -0.136  45.144  1.00 31.28  ? 229 ASN A CB  1 
ATOM   1505 C CG  . ASN A 1 185 ? -0.020  0.363   45.694  1.00 27.70  ? 229 ASN A CG  1 
ATOM   1506 O OD1 . ASN A 1 185 ? -1.086  0.001   45.194  1.00 30.52  ? 229 ASN A OD1 1 
ATOM   1507 N ND2 . ASN A 1 185 ? 0.039   1.169   46.742  1.00 28.09  ? 229 ASN A ND2 1 
ATOM   1508 N N   . LEU A 1 186 ? 3.569   -2.912  45.170  1.00 27.99  ? 230 LEU A N   1 
ATOM   1509 C CA  . LEU A 1 186 ? 4.415   -3.756  44.334  1.00 27.84  ? 230 LEU A CA  1 
ATOM   1510 C C   . LEU A 1 186 ? 3.568   -5.028  44.194  1.00 29.31  ? 230 LEU A C   1 
ATOM   1511 O O   . LEU A 1 186 ? 3.063   -5.554  45.189  1.00 23.00  ? 230 LEU A O   1 
ATOM   1512 C CB  . LEU A 1 186 ? 5.739   -4.081  45.043  1.00 19.59  ? 230 LEU A CB  1 
ATOM   1513 C CG  . LEU A 1 186 ? 6.768   -2.949  45.199  1.00 28.08  ? 230 LEU A CG  1 
ATOM   1514 C CD1 . LEU A 1 186 ? 7.821   -3.351  46.207  1.00 22.00  ? 230 LEU A CD1 1 
ATOM   1515 C CD2 . LEU A 1 186 ? 7.411   -2.623  43.862  1.00 15.84  ? 230 LEU A CD2 1 
ATOM   1516 N N   . GLN A 1 187 ? 3.392   -5.518  42.974  1.00 26.70  ? 231 GLN A N   1 
ATOM   1517 C CA  . GLN A 1 187 ? 2.581   -6.719  42.780  1.00 30.54  ? 231 GLN A CA  1 
ATOM   1518 C C   . GLN A 1 187 ? 3.331   -8.045  42.945  1.00 25.56  ? 231 GLN A C   1 
ATOM   1519 O O   . GLN A 1 187 ? 4.365   -8.267  42.324  1.00 25.01  ? 231 GLN A O   1 
ATOM   1520 C CB  . GLN A 1 187 ? 1.910   -6.672  41.407  1.00 28.14  ? 231 GLN A CB  1 
ATOM   1521 C CG  . GLN A 1 187 ? 0.797   -5.655  41.312  1.00 37.50  ? 231 GLN A CG  1 
ATOM   1522 C CD  . GLN A 1 187 ? 0.139   -5.651  39.948  1.00 47.42  ? 231 GLN A CD  1 
ATOM   1523 O OE1 . GLN A 1 187 ? 0.463   -4.822  39.090  1.00 44.27  ? 231 GLN A OE1 1 
ATOM   1524 N NE2 . GLN A 1 187 ? -0.780  -6.595  39.731  1.00 42.57  ? 231 GLN A NE2 1 
ATOM   1525 N N   . PRO A 1 188 ? 2.805   -8.948  43.793  1.00 26.41  ? 232 PRO A N   1 
ATOM   1526 C CA  . PRO A 1 188 ? 3.408   -10.262 44.052  1.00 26.11  ? 232 PRO A CA  1 
ATOM   1527 C C   . PRO A 1 188 ? 3.466   -11.097 42.774  1.00 35.07  ? 232 PRO A C   1 
ATOM   1528 O O   . PRO A 1 188 ? 4.340   -11.943 42.599  1.00 42.16  ? 232 PRO A O   1 
ATOM   1529 C CB  . PRO A 1 188 ? 2.464   -10.882 45.081  1.00 26.32  ? 232 PRO A CB  1 
ATOM   1530 C CG  . PRO A 1 188 ? 1.877   -9.696  45.783  1.00 23.14  ? 232 PRO A CG  1 
ATOM   1531 C CD  . PRO A 1 188 ? 1.621   -8.740  44.643  1.00 26.23  ? 232 PRO A CD  1 
ATOM   1532 N N   . GLU A 1 189 ? 2.518   -10.849 41.882  1.00 38.95  ? 233 GLU A N   1 
ATOM   1533 C CA  . GLU A 1 189 ? 2.441   -11.569 40.622  1.00 46.18  ? 233 GLU A CA  1 
ATOM   1534 C C   . GLU A 1 189 ? 3.620   -11.224 39.715  1.00 47.29  ? 233 GLU A C   1 
ATOM   1535 O O   . GLU A 1 189 ? 4.122   -12.079 38.984  1.00 51.31  ? 233 GLU A O   1 
ATOM   1536 C CB  . GLU A 1 189 ? 1.134   -11.213 39.895  1.00 55.72  ? 233 GLU A CB  1 
ATOM   1537 C CG  . GLU A 1 189 ? 0.028   -10.674 40.803  1.00 66.47  ? 233 GLU A CG  1 
ATOM   1538 C CD  . GLU A 1 189 ? -0.625  -11.750 41.651  1.00 76.29  ? 233 GLU A CD  1 
ATOM   1539 O OE1 . GLU A 1 189 ? -1.302  -11.400 42.644  1.00 78.92  ? 233 GLU A OE1 1 
ATOM   1540 O OE2 . GLU A 1 189 ? -0.471  -12.944 41.317  1.00 82.36  ? 233 GLU A OE2 1 
ATOM   1541 N N   . LYS A 1 190 ? 4.061   -9.970  39.771  1.00 39.43  ? 234 LYS A N   1 
ATOM   1542 C CA  . LYS A 1 190 ? 5.146   -9.497  38.913  1.00 35.11  ? 234 LYS A CA  1 
ATOM   1543 C C   . LYS A 1 190 ? 6.508   -9.439  39.592  1.00 33.69  ? 234 LYS A C   1 
ATOM   1544 O O   . LYS A 1 190 ? 7.539   -9.759  38.995  1.00 27.16  ? 234 LYS A O   1 
ATOM   1545 C CB  . LYS A 1 190 ? 4.813   -8.093  38.400  1.00 33.26  ? 234 LYS A CB  1 
ATOM   1546 C CG  . LYS A 1 190 ? 3.376   -7.913  37.950  1.00 39.15  ? 234 LYS A CG  1 
ATOM   1547 C CD  . LYS A 1 190 ? 3.059   -6.455  37.662  1.00 35.38  ? 234 LYS A CD  1 
ATOM   1548 C CE  . LYS A 1 190 ? 3.921   -5.911  36.542  1.00 37.09  ? 234 LYS A CE  1 
ATOM   1549 N NZ  . LYS A 1 190 ? 3.497   -4.548  36.129  1.00 40.91  ? 234 LYS A NZ  1 
ATOM   1550 N N   . VAL A 1 191 ? 6.496   -9.002  40.841  1.00 30.16  ? 235 VAL A N   1 
ATOM   1551 C CA  . VAL A 1 191 ? 7.708   -8.835  41.611  1.00 26.47  ? 235 VAL A CA  1 
ATOM   1552 C C   . VAL A 1 191 ? 7.988   -10.017 42.518  1.00 25.26  ? 235 VAL A C   1 
ATOM   1553 O O   . VAL A 1 191 ? 7.118   -10.444 43.263  1.00 25.37  ? 235 VAL A O   1 
ATOM   1554 C CB  . VAL A 1 191 ? 7.598   -7.563  42.469  1.00 26.65  ? 235 VAL A CB  1 
ATOM   1555 C CG1 . VAL A 1 191 ? 8.874   -7.356  43.274  1.00 25.12  ? 235 VAL A CG1 1 
ATOM   1556 C CG2 . VAL A 1 191 ? 7.309   -6.367  41.570  1.00 21.90  ? 235 VAL A CG2 1 
ATOM   1557 N N   . GLN A 1 192 ? 9.207   -10.546 42.461  1.00 28.91  ? 236 GLN A N   1 
ATOM   1558 C CA  . GLN A 1 192 ? 9.553   -11.670 43.324  1.00 36.90  ? 236 GLN A CA  1 
ATOM   1559 C C   . GLN A 1 192 ? 10.425  -11.197 44.489  1.00 30.87  ? 236 GLN A C   1 
ATOM   1560 O O   . GLN A 1 192 ? 10.319  -11.707 45.604  1.00 34.79  ? 236 GLN A O   1 
ATOM   1561 C CB  . GLN A 1 192 ? 10.292  -12.768 42.540  1.00 43.60  ? 236 GLN A CB  1 
ATOM   1562 C CG  . GLN A 1 192 ? 11.749  -12.458 42.237  1.00 56.26  ? 236 GLN A CG  1 
ATOM   1563 C CD  . GLN A 1 192 ? 12.689  -13.596 42.623  1.00 64.74  ? 236 GLN A CD  1 
ATOM   1564 O OE1 . GLN A 1 192 ? 13.917  -13.461 42.542  1.00 61.33  ? 236 GLN A OE1 1 
ATOM   1565 N NE2 . GLN A 1 192 ? 12.117  -14.722 43.046  1.00 63.05  ? 236 GLN A NE2 1 
ATOM   1566 N N   . THR A 1 193 ? 11.261  -10.197 44.239  1.00 23.75  ? 237 THR A N   1 
ATOM   1567 C CA  . THR A 1 193 ? 12.151  -9.713  45.279  1.00 24.59  ? 237 THR A CA  1 
ATOM   1568 C C   . THR A 1 193 ? 12.281  -8.196  45.401  1.00 23.04  ? 237 THR A C   1 
ATOM   1569 O O   . THR A 1 193 ? 12.325  -7.479  44.397  1.00 21.96  ? 237 THR A O   1 
ATOM   1570 C CB  . THR A 1 193 ? 13.584  -10.288 45.079  1.00 21.46  ? 237 THR A CB  1 
ATOM   1571 O OG1 . THR A 1 193 ? 13.518  -11.709 44.889  1.00 24.88  ? 237 THR A OG1 1 
ATOM   1572 C CG2 . THR A 1 193 ? 14.450  -9.988  46.291  1.00 17.14  ? 237 THR A CG2 1 
ATOM   1573 N N   . LEU A 1 194 ? 12.342  -7.726  46.648  1.00 21.24  ? 238 LEU A N   1 
ATOM   1574 C CA  . LEU A 1 194 ? 12.549  -6.313  46.957  1.00 18.14  ? 238 LEU A CA  1 
ATOM   1575 C C   . LEU A 1 194 ? 13.917  -6.303  47.624  1.00 22.94  ? 238 LEU A C   1 
ATOM   1576 O O   . LEU A 1 194 ? 14.073  -6.846  48.719  1.00 17.21  ? 238 LEU A O   1 
ATOM   1577 C CB  . LEU A 1 194 ? 11.526  -5.776  47.965  1.00 16.09  ? 238 LEU A CB  1 
ATOM   1578 C CG  . LEU A 1 194 ? 11.891  -4.366  48.464  1.00 18.07  ? 238 LEU A CG  1 
ATOM   1579 C CD1 . LEU A 1 194 ? 11.696  -3.378  47.327  1.00 22.28  ? 238 LEU A CD1 1 
ATOM   1580 C CD2 . LEU A 1 194 ? 11.046  -3.960  49.651  1.00 13.71  ? 238 LEU A CD2 1 
ATOM   1581 N N   . GLU A 1 195 ? 14.907  -5.715  46.958  1.00 21.39  ? 239 GLU A N   1 
ATOM   1582 C CA  . GLU A 1 195 ? 16.255  -5.647  47.509  1.00 21.13  ? 239 GLU A CA  1 
ATOM   1583 C C   . GLU A 1 195 ? 16.588  -4.229  47.964  1.00 23.06  ? 239 GLU A C   1 
ATOM   1584 O O   . GLU A 1 195 ? 16.590  -3.285  47.167  1.00 28.20  ? 239 GLU A O   1 
ATOM   1585 C CB  . GLU A 1 195 ? 17.279  -6.097  46.469  1.00 21.28  ? 239 GLU A CB  1 
ATOM   1586 C CG  . GLU A 1 195 ? 18.711  -6.173  47.002  1.00 34.69  ? 239 GLU A CG  1 
ATOM   1587 C CD  . GLU A 1 195 ? 19.717  -6.609  45.944  1.00 32.68  ? 239 GLU A CD  1 
ATOM   1588 O OE1 . GLU A 1 195 ? 20.351  -5.738  45.318  1.00 40.84  ? 239 GLU A OE1 1 
ATOM   1589 O OE2 . GLU A 1 195 ? 19.868  -7.826  45.728  1.00 38.38  ? 239 GLU A OE2 1 
ATOM   1590 N N   . ALA A 1 196 ? 16.864  -4.075  49.249  1.00 21.48  ? 240 ALA A N   1 
ATOM   1591 C CA  . ALA A 1 196 ? 17.211  -2.768  49.779  1.00 18.82  ? 240 ALA A CA  1 
ATOM   1592 C C   . ALA A 1 196 ? 18.724  -2.566  49.799  1.00 19.80  ? 240 ALA A C   1 
ATOM   1593 O O   . ALA A 1 196 ? 19.492  -3.515  49.965  1.00 20.77  ? 240 ALA A O   1 
ATOM   1594 C CB  . ALA A 1 196 ? 16.652  -2.608  51.180  1.00 15.36  ? 240 ALA A CB  1 
ATOM   1595 N N   . TRP A 1 197 ? 19.138  -1.320  49.598  1.00 22.27  ? 241 TRP A N   1 
ATOM   1596 C CA  . TRP A 1 197 ? 20.543  -0.940  49.635  1.00 18.33  ? 241 TRP A CA  1 
ATOM   1597 C C   . TRP A 1 197 ? 20.608  0.161   50.679  1.00 19.96  ? 241 TRP A C   1 
ATOM   1598 O O   . TRP A 1 197 ? 20.160  1.280   50.430  1.00 19.47  ? 241 TRP A O   1 
ATOM   1599 C CB  . TRP A 1 197 ? 21.025  -0.347  48.306  1.00 18.40  ? 241 TRP A CB  1 
ATOM   1600 C CG  . TRP A 1 197 ? 21.055  -1.272  47.134  1.00 26.84  ? 241 TRP A CG  1 
ATOM   1601 C CD1 . TRP A 1 197 ? 20.954  -2.631  47.148  1.00 26.64  ? 241 TRP A CD1 1 
ATOM   1602 C CD2 . TRP A 1 197 ? 21.247  -0.897  45.766  1.00 26.53  ? 241 TRP A CD2 1 
ATOM   1603 N NE1 . TRP A 1 197 ? 21.073  -3.129  45.871  1.00 23.01  ? 241 TRP A NE1 1 
ATOM   1604 C CE2 . TRP A 1 197 ? 21.256  -2.086  45.003  1.00 29.51  ? 241 TRP A CE2 1 
ATOM   1605 C CE3 . TRP A 1 197 ? 21.416  0.331   45.108  1.00 31.82  ? 241 TRP A CE3 1 
ATOM   1606 C CZ2 . TRP A 1 197 ? 21.428  -2.085  43.611  1.00 27.86  ? 241 TRP A CZ2 1 
ATOM   1607 C CZ3 . TRP A 1 197 ? 21.587  0.332   43.721  1.00 27.30  ? 241 TRP A CZ3 1 
ATOM   1608 C CH2 . TRP A 1 197 ? 21.591  -0.868  42.991  1.00 22.11  ? 241 TRP A CH2 1 
ATOM   1609 N N   . VAL A 1 198 ? 21.149  -0.142  51.851  1.00 20.08  ? 242 VAL A N   1 
ATOM   1610 C CA  . VAL A 1 198 ? 21.248  0.882   52.871  1.00 24.70  ? 242 VAL A CA  1 
ATOM   1611 C C   . VAL A 1 198 ? 22.588  1.576   52.707  1.00 28.27  ? 242 VAL A C   1 
ATOM   1612 O O   . VAL A 1 198 ? 23.641  0.943   52.767  1.00 34.35  ? 242 VAL A O   1 
ATOM   1613 C CB  . VAL A 1 198 ? 21.122  0.289   54.275  1.00 29.56  ? 242 VAL A CB  1 
ATOM   1614 C CG1 . VAL A 1 198 ? 21.096  1.414   55.307  1.00 23.31  ? 242 VAL A CG1 1 
ATOM   1615 C CG2 . VAL A 1 198 ? 19.853  -0.550  54.361  1.00 21.15  ? 242 VAL A CG2 1 
ATOM   1616 N N   . ILE A 1 199 ? 22.528  2.883   52.479  1.00 29.71  ? 243 ILE A N   1 
ATOM   1617 C CA  . ILE A 1 199 ? 23.712  3.703   52.272  1.00 27.87  ? 243 ILE A CA  1 
ATOM   1618 C C   . ILE A 1 199 ? 24.263  4.263   53.580  1.00 30.68  ? 243 ILE A C   1 
ATOM   1619 O O   . ILE A 1 199 ? 23.600  5.052   54.248  1.00 29.01  ? 243 ILE A O   1 
ATOM   1620 C CB  . ILE A 1 199 ? 23.380  4.880   51.332  1.00 34.15  ? 243 ILE A CB  1 
ATOM   1621 C CG1 . ILE A 1 199 ? 22.695  4.349   50.068  1.00 32.27  ? 243 ILE A CG1 1 
ATOM   1622 C CG2 . ILE A 1 199 ? 24.643  5.651   50.982  1.00 26.95  ? 243 ILE A CG2 1 
ATOM   1623 C CD1 . ILE A 1 199 ? 23.485  3.271   49.347  1.00 24.80  ? 243 ILE A CD1 1 
ATOM   1624 N N   . HIS A 1 200 ? 25.476  3.855   53.939  1.00 24.54  ? 244 HIS A N   1 
ATOM   1625 C CA  . HIS A 1 200 ? 26.115  4.335   55.166  1.00 32.95  ? 244 HIS A CA  1 
ATOM   1626 C C   . HIS A 1 200 ? 26.575  5.779   55.029  1.00 29.97  ? 244 HIS A C   1 
ATOM   1627 O O   . HIS A 1 200 ? 26.867  6.232   53.922  1.00 29.67  ? 244 HIS A O   1 
ATOM   1628 C CB  . HIS A 1 200 ? 27.305  3.438   55.517  1.00 31.73  ? 244 HIS A CB  1 
ATOM   1629 C CG  . HIS A 1 200 ? 26.904  2.052   55.897  1.00 34.87  ? 244 HIS A CG  1 
ATOM   1630 N ND1 . HIS A 1 200 ? 27.229  1.491   57.111  1.00 34.20  ? 244 HIS A ND1 1 
ATOM   1631 C CD2 . HIS A 1 200 ? 26.135  1.141   55.254  1.00 35.98  ? 244 HIS A CD2 1 
ATOM   1632 C CE1 . HIS A 1 200 ? 26.674  0.296   57.203  1.00 40.74  ? 244 HIS A CE1 1 
ATOM   1633 N NE2 . HIS A 1 200 ? 26.005  0.060   56.090  1.00 36.38  ? 244 HIS A NE2 1 
ATOM   1634 N N   . GLY A 1 201 ? 26.648  6.501   56.146  1.00 36.41  ? 245 GLY A N   1 
ATOM   1635 C CA  . GLY A 1 201 ? 27.064  7.887   56.063  1.00 47.92  ? 245 GLY A CA  1 
ATOM   1636 C C   . GLY A 1 201 ? 27.569  8.652   57.275  1.00 55.38  ? 245 GLY A C   1 
ATOM   1637 O O   . GLY A 1 201 ? 27.325  9.854   57.370  1.00 55.76  ? 245 GLY A O   1 
ATOM   1638 N N   . GLY A 1 202 ? 28.269  7.992   58.195  1.00 65.27  ? 246 GLY A N   1 
ATOM   1639 C CA  . GLY A 1 202 ? 28.808  8.701   59.351  1.00 67.33  ? 246 GLY A CA  1 
ATOM   1640 C C   . GLY A 1 202 ? 27.960  8.751   60.605  1.00 72.05  ? 246 GLY A C   1 
ATOM   1641 O O   . GLY A 1 202 ? 28.446  9.141   61.673  1.00 71.54  ? 246 GLY A O   1 
ATOM   1642 N N   . ARG A 1 203 ? 26.697  8.353   60.480  1.00 74.30  ? 247 ARG A N   1 
ATOM   1643 C CA  . ARG A 1 203 ? 25.766  8.348   61.604  1.00 75.76  ? 247 ARG A CA  1 
ATOM   1644 C C   . ARG A 1 203 ? 26.416  7.729   62.847  1.00 75.26  ? 247 ARG A C   1 
ATOM   1645 O O   . ARG A 1 203 ? 26.260  8.234   63.959  1.00 76.46  ? 247 ARG A O   1 
ATOM   1646 C CB  . ARG A 1 203 ? 24.494  7.579   61.208  1.00 75.97  ? 247 ARG A CB  1 
ATOM   1647 C CG  . ARG A 1 203 ? 23.318  7.700   62.177  1.00 77.51  ? 247 ARG A CG  1 
ATOM   1648 C CD  . ARG A 1 203 ? 23.402  6.672   63.295  1.00 82.10  ? 247 ARG A CD  1 
ATOM   1649 N NE  . ARG A 1 203 ? 22.257  6.726   64.203  1.00 88.15  ? 247 ARG A NE  1 
ATOM   1650 C CZ  . ARG A 1 203 ? 22.005  7.728   65.043  1.00 89.13  ? 247 ARG A CZ  1 
ATOM   1651 N NH1 . ARG A 1 203 ? 22.820  8.774   65.101  1.00 87.70  ? 247 ARG A NH1 1 
ATOM   1652 N NH2 . ARG A 1 203 ? 20.935  7.684   65.827  1.00 89.53  ? 247 ARG A NH2 1 
ATOM   1653 N N   . GLU A 1 204 ? 27.158  6.646   62.647  1.00 71.62  ? 248 GLU A N   1 
ATOM   1654 C CA  . GLU A 1 204 ? 27.827  5.961   63.742  1.00 68.38  ? 248 GLU A CA  1 
ATOM   1655 C C   . GLU A 1 204 ? 29.038  5.199   63.252  1.00 64.26  ? 248 GLU A C   1 
ATOM   1656 O O   . GLU A 1 204 ? 29.563  5.445   62.164  1.00 65.04  ? 248 GLU A O   1 
ATOM   1657 C CB  . GLU A 1 204 ? 26.896  4.946   64.396  1.00 76.76  ? 248 GLU A CB  1 
ATOM   1658 C CG  . GLU A 1 204 ? 25.706  5.514   65.113  1.00 89.22  ? 248 GLU A CG  1 
ATOM   1659 C CD  . GLU A 1 204 ? 24.804  4.419   65.635  1.00 98.00  ? 248 GLU A CD  1 
ATOM   1660 O OE1 . GLU A 1 204 ? 25.265  3.623   66.486  1.00 101.27 ? 248 GLU A OE1 1 
ATOM   1661 O OE2 . GLU A 1 204 ? 23.639  4.349   65.187  1.00 101.72 ? 248 GLU A OE2 1 
ATOM   1662 N N   . ASP A 1 205 ? 29.467  4.261   64.088  1.00 57.88  ? 249 ASP A N   1 
ATOM   1663 C CA  . ASP A 1 205 ? 30.586  3.393   63.783  1.00 46.52  ? 249 ASP A CA  1 
ATOM   1664 C C   . ASP A 1 205 ? 29.995  2.342   62.856  1.00 41.23  ? 249 ASP A C   1 
ATOM   1665 O O   . ASP A 1 205 ? 28.813  2.010   62.967  1.00 36.80  ? 249 ASP A O   1 
ATOM   1666 C CB  . ASP A 1 205 ? 31.106  2.742   65.067  1.00 42.18  ? 249 ASP A CB  1 
ATOM   1667 C CG  . ASP A 1 205 ? 31.870  3.717   65.948  1.00 46.38  ? 249 ASP A CG  1 
ATOM   1668 O OD1 . ASP A 1 205 ? 32.211  3.349   67.095  1.00 50.35  ? 249 ASP A OD1 1 
ATOM   1669 O OD2 . ASP A 1 205 ? 32.140  4.847   65.488  1.00 42.30  ? 249 ASP A OD2 1 
ATOM   1670 N N   . SER A 1 206 ? 30.809  1.821   61.948  1.00 33.81  ? 250 SER A N   1 
ATOM   1671 C CA  . SER A 1 206 ? 30.341  0.819   60.995  1.00 33.04  ? 250 SER A CA  1 
ATOM   1672 C C   . SER A 1 206 ? 29.822  -0.465  61.633  1.00 31.30  ? 250 SER A C   1 
ATOM   1673 O O   . SER A 1 206 ? 30.496  -1.075  62.462  1.00 36.11  ? 250 SER A O   1 
ATOM   1674 C CB  . SER A 1 206 ? 31.455  0.478   60.005  1.00 25.10  ? 250 SER A CB  1 
ATOM   1675 O OG  . SER A 1 206 ? 31.008  -0.470  59.055  1.00 36.96  ? 250 SER A OG  1 
ATOM   1676 N N   . ARG A 1 207 ? 28.613  -0.858  61.233  1.00 30.29  ? 251 ARG A N   1 
ATOM   1677 C CA  . ARG A 1 207 ? 27.963  -2.080  61.707  1.00 31.54  ? 251 ARG A CA  1 
ATOM   1678 C C   . ARG A 1 207 ? 26.915  -2.522  60.672  1.00 31.77  ? 251 ARG A C   1 
ATOM   1679 O O   . ARG A 1 207 ? 26.652  -1.802  59.706  1.00 30.22  ? 251 ARG A O   1 
ATOM   1680 C CB  . ARG A 1 207 ? 27.293  -1.848  63.062  1.00 29.77  ? 251 ARG A CB  1 
ATOM   1681 C CG  . ARG A 1 207 ? 26.067  -0.960  63.031  1.00 39.11  ? 251 ARG A CG  1 
ATOM   1682 C CD  . ARG A 1 207 ? 25.418  -0.929  64.404  1.00 45.73  ? 251 ARG A CD  1 
ATOM   1683 N NE  . ARG A 1 207 ? 24.196  -0.130  64.433  1.00 57.38  ? 251 ARG A NE  1 
ATOM   1684 C CZ  . ARG A 1 207 ? 24.144  1.178   64.194  1.00 62.50  ? 251 ARG A CZ  1 
ATOM   1685 N NH1 . ARG A 1 207 ? 25.250  1.849   63.898  1.00 65.21  ? 251 ARG A NH1 1 
ATOM   1686 N NH2 . ARG A 1 207 ? 22.984  1.819   64.262  1.00 62.00  ? 251 ARG A NH2 1 
ATOM   1687 N N   . ASP A 1 208 ? 26.318  -3.697  60.865  1.00 29.42  ? 252 ASP A N   1 
ATOM   1688 C CA  . ASP A 1 208 ? 25.325  -4.194  59.913  1.00 32.80  ? 252 ASP A CA  1 
ATOM   1689 C C   . ASP A 1 208 ? 23.978  -3.501  60.072  1.00 31.07  ? 252 ASP A C   1 
ATOM   1690 O O   . ASP A 1 208 ? 23.209  -3.808  60.990  1.00 29.49  ? 252 ASP A O   1 
ATOM   1691 C CB  . ASP A 1 208 ? 25.125  -5.705  60.057  1.00 29.74  ? 252 ASP A CB  1 
ATOM   1692 C CG  . ASP A 1 208 ? 24.408  -6.311  58.858  1.00 30.77  ? 252 ASP A CG  1 
ATOM   1693 O OD1 . ASP A 1 208 ? 23.781  -5.553  58.089  1.00 31.20  ? 252 ASP A OD1 1 
ATOM   1694 O OD2 . ASP A 1 208 ? 24.466  -7.545  58.685  1.00 36.97  ? 252 ASP A OD2 1 
ATOM   1695 N N   . LEU A 1 209 ? 23.699  -2.568  59.168  1.00 27.09  ? 253 LEU A N   1 
ATOM   1696 C CA  . LEU A 1 209 ? 22.450  -1.821  59.205  1.00 25.76  ? 253 LEU A CA  1 
ATOM   1697 C C   . LEU A 1 209 ? 21.259  -2.620  58.680  1.00 25.97  ? 253 LEU A C   1 
ATOM   1698 O O   . LEU A 1 209 ? 20.112  -2.217  58.843  1.00 36.05  ? 253 LEU A O   1 
ATOM   1699 C CB  . LEU A 1 209 ? 22.614  -0.516  58.437  1.00 20.15  ? 253 LEU A CB  1 
ATOM   1700 C CG  . LEU A 1 209 ? 23.535  0.453   59.183  1.00 22.69  ? 253 LEU A CG  1 
ATOM   1701 C CD1 . LEU A 1 209 ? 23.704  1.724   58.373  1.00 19.56  ? 253 LEU A CD1 1 
ATOM   1702 C CD2 . LEU A 1 209 ? 22.951  0.764   60.571  1.00 22.27  ? 253 LEU A CD2 1 
ATOM   1703 N N   . CYS A 1 210 ? 21.532  -3.764  58.065  1.00 26.11  ? 254 CYS A N   1 
ATOM   1704 C CA  . CYS A 1 210 ? 20.467  -4.622  57.572  1.00 27.71  ? 254 CYS A CA  1 
ATOM   1705 C C   . CYS A 1 210 ? 19.794  -5.382  58.724  1.00 31.67  ? 254 CYS A C   1 
ATOM   1706 O O   . CYS A 1 210 ? 18.855  -6.147  58.499  1.00 36.88  ? 254 CYS A O   1 
ATOM   1707 C CB  . CYS A 1 210 ? 21.015  -5.613  56.546  1.00 23.51  ? 254 CYS A CB  1 
ATOM   1708 S SG  . CYS A 1 210 ? 21.315  -4.914  54.890  1.00 36.55  ? 254 CYS A SG  1 
ATOM   1709 N N   . GLN A 1 211 ? 20.286  -5.188  59.949  1.00 31.16  ? 255 GLN A N   1 
ATOM   1710 C CA  . GLN A 1 211 ? 19.702  -5.834  61.129  1.00 27.84  ? 255 GLN A CA  1 
ATOM   1711 C C   . GLN A 1 211 ? 18.924  -4.799  61.933  1.00 29.00  ? 255 GLN A C   1 
ATOM   1712 O O   . GLN A 1 211 ? 18.374  -5.103  62.992  1.00 23.75  ? 255 GLN A O   1 
ATOM   1713 C CB  . GLN A 1 211 ? 20.786  -6.448  62.027  1.00 29.94  ? 255 GLN A CB  1 
ATOM   1714 C CG  . GLN A 1 211 ? 21.601  -7.541  61.355  1.00 35.50  ? 255 GLN A CG  1 
ATOM   1715 C CD  . GLN A 1 211 ? 20.726  -8.580  60.676  1.00 34.78  ? 255 GLN A CD  1 
ATOM   1716 O OE1 . GLN A 1 211 ? 19.909  -9.236  61.325  1.00 29.94  ? 255 GLN A OE1 1 
ATOM   1717 N NE2 . GLN A 1 211 ? 20.890  -8.729  59.362  1.00 31.22  ? 255 GLN A NE2 1 
ATOM   1718 N N   . ASP A 1 212 ? 18.894  -3.571  61.420  1.00 28.55  ? 256 ASP A N   1 
ATOM   1719 C CA  . ASP A 1 212 ? 18.187  -2.474  62.068  1.00 31.18  ? 256 ASP A CA  1 
ATOM   1720 C C   . ASP A 1 212 ? 16.702  -2.794  62.236  1.00 30.63  ? 256 ASP A C   1 
ATOM   1721 O O   . ASP A 1 212 ? 16.080  -3.379  61.354  1.00 36.65  ? 256 ASP A O   1 
ATOM   1722 C CB  . ASP A 1 212 ? 18.360  -1.192  61.246  1.00 31.11  ? 256 ASP A CB  1 
ATOM   1723 C CG  . ASP A 1 212 ? 17.646  -0.001  61.862  1.00 34.02  ? 256 ASP A CG  1 
ATOM   1724 O OD1 . ASP A 1 212 ? 16.453  0.220   61.554  1.00 37.08  ? 256 ASP A OD1 1 
ATOM   1725 O OD2 . ASP A 1 212 ? 18.278  0.710   62.669  1.00 36.04  ? 256 ASP A OD2 1 
ATOM   1726 N N   . PRO A 1 213 ? 16.118  -2.419  63.383  1.00 32.13  ? 257 PRO A N   1 
ATOM   1727 C CA  . PRO A 1 213 ? 14.703  -2.654  63.691  1.00 28.15  ? 257 PRO A CA  1 
ATOM   1728 C C   . PRO A 1 213 ? 13.736  -2.218  62.589  1.00 28.49  ? 257 PRO A C   1 
ATOM   1729 O O   . PRO A 1 213 ? 12.746  -2.904  62.330  1.00 28.71  ? 257 PRO A O   1 
ATOM   1730 C CB  . PRO A 1 213 ? 14.499  -1.860  64.977  1.00 27.72  ? 257 PRO A CB  1 
ATOM   1731 C CG  . PRO A 1 213 ? 15.814  -2.032  65.663  1.00 34.50  ? 257 PRO A CG  1 
ATOM   1732 C CD  . PRO A 1 213 ? 16.803  -1.800  64.532  1.00 34.44  ? 257 PRO A CD  1 
ATOM   1733 N N   . THR A 1 214 ? 14.011  -1.082  61.949  1.00 24.16  ? 258 THR A N   1 
ATOM   1734 C CA  . THR A 1 214 ? 13.129  -0.598  60.891  1.00 25.48  ? 258 THR A CA  1 
ATOM   1735 C C   . THR A 1 214 ? 13.245  -1.477  59.649  1.00 28.09  ? 258 THR A C   1 
ATOM   1736 O O   . THR A 1 214 ? 12.256  -1.696  58.940  1.00 27.55  ? 258 THR A O   1 
ATOM   1737 C CB  . THR A 1 214 ? 13.436  0.865   60.489  1.00 24.32  ? 258 THR A CB  1 
ATOM   1738 O OG1 . THR A 1 214 ? 14.678  0.923   59.779  1.00 30.81  ? 258 THR A OG1 1 
ATOM   1739 C CG2 . THR A 1 214 ? 13.509  1.754   61.721  1.00 17.03  ? 258 THR A CG2 1 
ATOM   1740 N N   . ILE A 1 215 ? 14.448  -1.986  59.392  1.00 24.48  ? 259 ILE A N   1 
ATOM   1741 C CA  . ILE A 1 215 ? 14.668  -2.843  58.236  1.00 22.52  ? 259 ILE A CA  1 
ATOM   1742 C C   . ILE A 1 215 ? 13.940  -4.161  58.448  1.00 27.81  ? 259 ILE A C   1 
ATOM   1743 O O   . ILE A 1 215 ? 13.312  -4.692  57.528  1.00 33.28  ? 259 ILE A O   1 
ATOM   1744 C CB  . ILE A 1 215 ? 16.172  -3.094  58.005  1.00 19.99  ? 259 ILE A CB  1 
ATOM   1745 C CG1 . ILE A 1 215 ? 16.854  -1.785  57.618  1.00 18.74  ? 259 ILE A CG1 1 
ATOM   1746 C CG2 . ILE A 1 215 ? 16.382  -4.113  56.900  1.00 13.33  ? 259 ILE A CG2 1 
ATOM   1747 C CD1 . ILE A 1 215 ? 16.317  -1.163  56.338  1.00 25.10  ? 259 ILE A CD1 1 
ATOM   1748 N N   . LYS A 1 216 ? 14.008  -4.680  59.669  1.00 32.50  ? 260 LYS A N   1 
ATOM   1749 C CA  . LYS A 1 216 ? 13.335  -5.933  60.001  1.00 35.08  ? 260 LYS A CA  1 
ATOM   1750 C C   . LYS A 1 216 ? 11.836  -5.777  59.775  1.00 30.97  ? 260 LYS A C   1 
ATOM   1751 O O   . LYS A 1 216 ? 11.147  -6.709  59.355  1.00 26.43  ? 260 LYS A O   1 
ATOM   1752 C CB  . LYS A 1 216 ? 13.607  -6.311  61.462  1.00 37.08  ? 260 LYS A CB  1 
ATOM   1753 C CG  . LYS A 1 216 ? 14.986  -6.919  61.711  1.00 50.16  ? 260 LYS A CG  1 
ATOM   1754 C CD  . LYS A 1 216 ? 15.048  -8.388  61.274  1.00 57.01  ? 260 LYS A CD  1 
ATOM   1755 C CE  . LYS A 1 216 ? 14.856  -8.560  59.767  1.00 57.91  ? 260 LYS A CE  1 
ATOM   1756 N NZ  . LYS A 1 216 ? 14.726  -9.990  59.375  1.00 58.01  ? 260 LYS A NZ  1 
ATOM   1757 N N   . GLU A 1 217 ? 11.356  -4.575  60.059  1.00 29.55  ? 261 GLU A N   1 
ATOM   1758 C CA  . GLU A 1 217 ? 9.956   -4.223  59.905  1.00 32.73  ? 261 GLU A CA  1 
ATOM   1759 C C   . GLU A 1 217 ? 9.590   -4.184  58.424  1.00 34.60  ? 261 GLU A C   1 
ATOM   1760 O O   . GLU A 1 217 ? 8.511   -4.642  58.030  1.00 30.00  ? 261 GLU A O   1 
ATOM   1761 C CB  . GLU A 1 217 ? 9.720   -2.860  60.548  1.00 33.60  ? 261 GLU A CB  1 
ATOM   1762 C CG  . GLU A 1 217 ? 8.321   -2.321  60.438  1.00 36.42  ? 261 GLU A CG  1 
ATOM   1763 C CD  . GLU A 1 217 ? 8.196   -0.968  61.107  1.00 46.58  ? 261 GLU A CD  1 
ATOM   1764 O OE1 . GLU A 1 217 ? 7.172   -0.287  60.895  1.00 54.43  ? 261 GLU A OE1 1 
ATOM   1765 O OE2 . GLU A 1 217 ? 9.125   -0.588  61.850  1.00 43.85  ? 261 GLU A OE2 1 
ATOM   1766 N N   . LEU A 1 218 ? 10.491  -3.633  57.609  1.00 30.72  ? 262 LEU A N   1 
ATOM   1767 C CA  . LEU A 1 218 ? 10.264  -3.549  56.169  1.00 27.09  ? 262 LEU A CA  1 
ATOM   1768 C C   . LEU A 1 218 ? 10.104  -4.979  55.668  1.00 29.49  ? 262 LEU A C   1 
ATOM   1769 O O   . LEU A 1 218 ? 9.144   -5.309  54.965  1.00 26.40  ? 262 LEU A O   1 
ATOM   1770 C CB  . LEU A 1 218 ? 11.465  -2.904  55.467  1.00 28.20  ? 262 LEU A CB  1 
ATOM   1771 C CG  . LEU A 1 218 ? 11.273  -2.191  54.122  1.00 27.01  ? 262 LEU A CG  1 
ATOM   1772 C CD1 . LEU A 1 218 ? 12.621  -2.108  53.420  1.00 22.55  ? 262 LEU A CD1 1 
ATOM   1773 C CD2 . LEU A 1 218 ? 10.264  -2.915  53.246  1.00 21.02  ? 262 LEU A CD2 1 
ATOM   1774 N N   . GLU A 1 219 ? 11.058  -5.822  56.045  1.00 24.49  ? 263 GLU A N   1 
ATOM   1775 C CA  . GLU A 1 219 ? 11.042  -7.221  55.656  1.00 28.61  ? 263 GLU A CA  1 
ATOM   1776 C C   . GLU A 1 219 ? 9.734   -7.890  56.078  1.00 29.93  ? 263 GLU A C   1 
ATOM   1777 O O   . GLU A 1 219 ? 9.204   -8.740  55.367  1.00 29.59  ? 263 GLU A O   1 
ATOM   1778 C CB  . GLU A 1 219 ? 12.224  -7.945  56.290  1.00 29.67  ? 263 GLU A CB  1 
ATOM   1779 C CG  . GLU A 1 219 ? 12.323  -9.402  55.922  1.00 40.80  ? 263 GLU A CG  1 
ATOM   1780 C CD  . GLU A 1 219 ? 13.533  -10.061 56.542  1.00 52.34  ? 263 GLU A CD  1 
ATOM   1781 O OE1 . GLU A 1 219 ? 14.661  -9.588  56.292  1.00 58.64  ? 263 GLU A OE1 1 
ATOM   1782 O OE2 . GLU A 1 219 ? 13.359  -11.050 57.281  1.00 63.11  ? 263 GLU A OE2 1 
ATOM   1783 N N   . SER A 1 220 ? 9.217   -7.505  57.237  1.00 28.54  ? 264 SER A N   1 
ATOM   1784 C CA  . SER A 1 220 ? 7.971   -8.068  57.725  1.00 29.19  ? 264 SER A CA  1 
ATOM   1785 C C   . SER A 1 220 ? 6.843   -7.692  56.774  1.00 30.56  ? 264 SER A C   1 
ATOM   1786 O O   . SER A 1 220 ? 6.103   -8.551  56.295  1.00 31.24  ? 264 SER A O   1 
ATOM   1787 C CB  . SER A 1 220 ? 7.658   -7.535  59.122  1.00 25.28  ? 264 SER A CB  1 
ATOM   1788 O OG  . SER A 1 220 ? 6.363   -7.940  59.524  1.00 36.83  ? 264 SER A OG  1 
ATOM   1789 N N   . ILE A 1 221 ? 6.723   -6.396  56.506  1.00 34.34  ? 265 ILE A N   1 
ATOM   1790 C CA  . ILE A 1 221 ? 5.692   -5.871  55.614  1.00 27.70  ? 265 ILE A CA  1 
ATOM   1791 C C   . ILE A 1 221 ? 5.743   -6.515  54.238  1.00 26.63  ? 265 ILE A C   1 
ATOM   1792 O O   . ILE A 1 221 ? 4.726   -6.953  53.712  1.00 42.21  ? 265 ILE A O   1 
ATOM   1793 C CB  . ILE A 1 221 ? 5.857   -4.359  55.444  1.00 25.46  ? 265 ILE A CB  1 
ATOM   1794 C CG1 . ILE A 1 221 ? 5.498   -3.657  56.749  1.00 23.07  ? 265 ILE A CG1 1 
ATOM   1795 C CG2 . ILE A 1 221 ? 5.016   -3.860  54.286  1.00 37.31  ? 265 ILE A CG2 1 
ATOM   1796 C CD1 . ILE A 1 221 ? 5.735   -2.158  56.709  1.00 20.90  ? 265 ILE A CD1 1 
ATOM   1797 N N   . ILE A 1 222 ? 6.934   -6.557  53.656  1.00 27.91  ? 266 ILE A N   1 
ATOM   1798 C CA  . ILE A 1 222 ? 7.144   -7.126  52.334  1.00 27.75  ? 266 ILE A CA  1 
ATOM   1799 C C   . ILE A 1 222 ? 6.851   -8.619  52.281  1.00 29.23  ? 266 ILE A C   1 
ATOM   1800 O O   . ILE A 1 222 ? 6.081   -9.078  51.439  1.00 30.39  ? 266 ILE A O   1 
ATOM   1801 C CB  . ILE A 1 222 ? 8.596   -6.840  51.854  1.00 32.67  ? 266 ILE A CB  1 
ATOM   1802 C CG1 . ILE A 1 222 ? 8.610   -5.549  51.041  1.00 38.01  ? 266 ILE A CG1 1 
ATOM   1803 C CG2 . ILE A 1 222 ? 9.142   -7.992  51.024  1.00 39.06  ? 266 ILE A CG2 1 
ATOM   1804 C CD1 . ILE A 1 222 ? 7.724   -5.609  49.791  1.00 41.83  ? 266 ILE A CD1 1 
ATOM   1805 N N   . SER A 1 223 ? 7.470   -9.369  53.182  1.00 25.18  ? 267 SER A N   1 
ATOM   1806 C CA  . SER A 1 223 ? 7.271   -10.810 53.252  1.00 31.05  ? 267 SER A CA  1 
ATOM   1807 C C   . SER A 1 223 ? 5.781   -11.151 53.346  1.00 28.82  ? 267 SER A C   1 
ATOM   1808 O O   . SER A 1 223 ? 5.297   -12.078 52.702  1.00 27.61  ? 267 SER A O   1 
ATOM   1809 C CB  . SER A 1 223 ? 8.006   -11.369 54.471  1.00 24.78  ? 267 SER A CB  1 
ATOM   1810 O OG  . SER A 1 223 ? 7.812   -12.766 54.587  1.00 43.11  ? 267 SER A OG  1 
ATOM   1811 N N   . LYS A 1 224 ? 5.066   -10.382 54.154  1.00 30.76  ? 268 LYS A N   1 
ATOM   1812 C CA  . LYS A 1 224 ? 3.638   -10.571 54.360  1.00 38.28  ? 268 LYS A CA  1 
ATOM   1813 C C   . LYS A 1 224 ? 2.874   -10.502 53.037  1.00 41.00  ? 268 LYS A C   1 
ATOM   1814 O O   . LYS A 1 224 ? 1.868   -11.191 52.863  1.00 44.12  ? 268 LYS A O   1 
ATOM   1815 C CB  . LYS A 1 224 ? 3.115   -9.490  55.310  1.00 45.03  ? 268 LYS A CB  1 
ATOM   1816 C CG  . LYS A 1 224 ? 1.787   -9.807  55.971  1.00 61.65  ? 268 LYS A CG  1 
ATOM   1817 C CD  . LYS A 1 224 ? 1.948   -10.882 57.043  1.00 69.50  ? 268 LYS A CD  1 
ATOM   1818 C CE  . LYS A 1 224 ? 0.637   -11.117 57.789  1.00 69.86  ? 268 LYS A CE  1 
ATOM   1819 N NZ  . LYS A 1 224 ? 0.771   -12.119 58.886  1.00 67.71  ? 268 LYS A NZ  1 
ATOM   1820 N N   . ARG A 1 225 ? 3.352   -9.676  52.108  1.00 38.49  ? 269 ARG A N   1 
ATOM   1821 C CA  . ARG A 1 225 ? 2.693   -9.520  50.808  1.00 34.99  ? 269 ARG A CA  1 
ATOM   1822 C C   . ARG A 1 225 ? 3.214   -10.524 49.785  1.00 35.00  ? 269 ARG A C   1 
ATOM   1823 O O   . ARG A 1 225 ? 3.056   -10.346 48.583  1.00 33.91  ? 269 ARG A O   1 
ATOM   1824 C CB  . ARG A 1 225 ? 2.878   -8.092  50.282  1.00 36.20  ? 269 ARG A CB  1 
ATOM   1825 C CG  . ARG A 1 225 ? 2.418   -7.018  51.260  1.00 35.23  ? 269 ARG A CG  1 
ATOM   1826 C CD  . ARG A 1 225 ? 2.367   -5.639  50.613  1.00 32.68  ? 269 ARG A CD  1 
ATOM   1827 N NE  . ARG A 1 225 ? 1.427   -5.617  49.503  1.00 36.53  ? 269 ARG A NE  1 
ATOM   1828 C CZ  . ARG A 1 225 ? 1.783   -5.473  48.234  1.00 36.71  ? 269 ARG A CZ  1 
ATOM   1829 N NH1 . ARG A 1 225 ? 3.066   -5.326  47.926  1.00 29.45  ? 269 ARG A NH1 1 
ATOM   1830 N NH2 . ARG A 1 225 ? 0.861   -5.506  47.277  1.00 25.21  ? 269 ARG A NH2 1 
ATOM   1831 N N   . ASN A 1 226 ? 3.845   -11.577 50.289  1.00 35.14  ? 270 ASN A N   1 
ATOM   1832 C CA  . ASN A 1 226 ? 4.390   -12.649 49.473  1.00 29.73  ? 270 ASN A CA  1 
ATOM   1833 C C   . ASN A 1 226 ? 5.485   -12.265 48.500  1.00 28.35  ? 270 ASN A C   1 
ATOM   1834 O O   . ASN A 1 226 ? 5.503   -12.720 47.363  1.00 26.46  ? 270 ASN A O   1 
ATOM   1835 C CB  . ASN A 1 226 ? 3.264   -13.367 48.736  1.00 37.84  ? 270 ASN A CB  1 
ATOM   1836 C CG  . ASN A 1 226 ? 2.296   -14.039 49.685  1.00 44.38  ? 270 ASN A CG  1 
ATOM   1837 O OD1 . ASN A 1 226 ? 1.480   -13.378 50.331  1.00 45.02  ? 270 ASN A OD1 1 
ATOM   1838 N ND2 . ASN A 1 226 ? 2.393   -15.362 49.791  1.00 52.65  ? 270 ASN A ND2 1 
ATOM   1839 N N   . ILE A 1 227 ? 6.406   -11.428 48.961  1.00 32.26  ? 271 ILE A N   1 
ATOM   1840 C CA  . ILE A 1 227 ? 7.543   -11.012 48.156  1.00 31.59  ? 271 ILE A CA  1 
ATOM   1841 C C   . ILE A 1 227 ? 8.784   -11.229 49.004  1.00 27.36  ? 271 ILE A C   1 
ATOM   1842 O O   . ILE A 1 227 ? 8.802   -10.880 50.180  1.00 29.77  ? 271 ILE A O   1 
ATOM   1843 C CB  . ILE A 1 227 ? 7.459   -9.521  47.760  1.00 33.27  ? 271 ILE A CB  1 
ATOM   1844 C CG1 . ILE A 1 227 ? 6.262   -9.298  46.833  1.00 27.39  ? 271 ILE A CG1 1 
ATOM   1845 C CG2 . ILE A 1 227 ? 8.755   -9.091  47.064  1.00 26.11  ? 271 ILE A CG2 1 
ATOM   1846 C CD1 . ILE A 1 227 ? 6.068   -7.854  46.441  1.00 20.19  ? 271 ILE A CD1 1 
ATOM   1847 N N   . GLN A 1 228 ? 9.819   -11.813 48.416  1.00 24.46  ? 272 GLN A N   1 
ATOM   1848 C CA  . GLN A 1 228 ? 11.039  -12.055 49.166  1.00 32.52  ? 272 GLN A CA  1 
ATOM   1849 C C   . GLN A 1 228 ? 11.742  -10.724 49.438  1.00 32.60  ? 272 GLN A C   1 
ATOM   1850 O O   . GLN A 1 228 ? 11.573  -9.756  48.690  1.00 29.56  ? 272 GLN A O   1 
ATOM   1851 C CB  . GLN A 1 228 ? 11.963  -12.995 48.387  1.00 29.71  ? 272 GLN A CB  1 
ATOM   1852 C CG  . GLN A 1 228 ? 11.327  -14.326 48.017  1.00 40.83  ? 272 GLN A CG  1 
ATOM   1853 C CD  . GLN A 1 228 ? 12.230  -15.182 47.140  1.00 55.12  ? 272 GLN A CD  1 
ATOM   1854 O OE1 . GLN A 1 228 ? 13.263  -15.691 47.590  1.00 57.22  ? 272 GLN A OE1 1 
ATOM   1855 N NE2 . GLN A 1 228 ? 11.848  -15.338 45.877  1.00 58.15  ? 272 GLN A NE2 1 
ATOM   1856 N N   . PHE A 1 229 ? 12.515  -10.679 50.521  1.00 25.00  ? 273 PHE A N   1 
ATOM   1857 C CA  . PHE A 1 229 ? 13.251  -9.478  50.888  1.00 24.22  ? 273 PHE A CA  1 
ATOM   1858 C C   . PHE A 1 229 ? 14.736  -9.775  50.914  1.00 26.34  ? 273 PHE A C   1 
ATOM   1859 O O   . PHE A 1 229 ? 15.154  -10.872 51.277  1.00 30.65  ? 273 PHE A O   1 
ATOM   1860 C CB  . PHE A 1 229 ? 12.826  -8.970  52.270  1.00 21.56  ? 273 PHE A CB  1 
ATOM   1861 C CG  . PHE A 1 229 ? 13.524  -7.697  52.686  1.00 28.05  ? 273 PHE A CG  1 
ATOM   1862 C CD1 . PHE A 1 229 ? 13.264  -6.499  52.025  1.00 21.71  ? 273 PHE A CD1 1 
ATOM   1863 C CD2 . PHE A 1 229 ? 14.467  -7.704  53.717  1.00 23.34  ? 273 PHE A CD2 1 
ATOM   1864 C CE1 . PHE A 1 229 ? 13.935  -5.320  52.380  1.00 29.96  ? 273 PHE A CE1 1 
ATOM   1865 C CE2 . PHE A 1 229 ? 15.143  -6.538  54.081  1.00 29.41  ? 273 PHE A CE2 1 
ATOM   1866 C CZ  . PHE A 1 229 ? 14.878  -5.341  53.412  1.00 30.90  ? 273 PHE A CZ  1 
ATOM   1867 N N   . SER A 1 230 ? 15.530  -8.790  50.523  1.00 29.83  ? 274 SER A N   1 
ATOM   1868 C CA  . SER A 1 230 ? 16.977  -8.925  50.515  1.00 31.01  ? 274 SER A CA  1 
ATOM   1869 C C   . SER A 1 230 ? 17.528  -7.557  50.895  1.00 30.28  ? 274 SER A C   1 
ATOM   1870 O O   . SER A 1 230 ? 16.984  -6.529  50.493  1.00 29.26  ? 274 SER A O   1 
ATOM   1871 C CB  . SER A 1 230 ? 17.470  -9.334  49.123  1.00 36.83  ? 274 SER A CB  1 
ATOM   1872 O OG  . SER A 1 230 ? 18.853  -9.657  49.135  1.00 35.38  ? 274 SER A OG  1 
ATOM   1873 N N   . CYS A 1 231 ? 18.599  -7.548  51.677  1.00 26.91  ? 275 CYS A N   1 
ATOM   1874 C CA  . CYS A 1 231 ? 19.194  -6.301  52.120  1.00 27.88  ? 275 CYS A CA  1 
ATOM   1875 C C   . CYS A 1 231 ? 20.704  -6.313  51.979  1.00 31.40  ? 275 CYS A C   1 
ATOM   1876 O O   . CYS A 1 231 ? 21.364  -7.312  52.255  1.00 32.75  ? 275 CYS A O   1 
ATOM   1877 C CB  . CYS A 1 231 ? 18.824  -6.040  53.572  1.00 26.60  ? 275 CYS A CB  1 
ATOM   1878 S SG  . CYS A 1 231 ? 19.441  -4.467  54.242  1.00 32.16  ? 275 CYS A SG  1 
ATOM   1879 N N   . LYS A 1 232 ? 21.250  -5.185  51.554  1.00 28.65  ? 276 LYS A N   1 
ATOM   1880 C CA  . LYS A 1 232 ? 22.677  -5.089  51.367  1.00 29.52  ? 276 LYS A CA  1 
ATOM   1881 C C   . LYS A 1 232 ? 23.197  -3.780  51.895  1.00 31.73  ? 276 LYS A C   1 
ATOM   1882 O O   . LYS A 1 232 ? 22.599  -2.727  51.677  1.00 30.17  ? 276 LYS A O   1 
ATOM   1883 C CB  . LYS A 1 232 ? 23.021  -5.238  49.887  1.00 24.70  ? 276 LYS A CB  1 
ATOM   1884 C CG  . LYS A 1 232 ? 22.709  -6.624  49.351  1.00 39.04  ? 276 LYS A CG  1 
ATOM   1885 C CD  . LYS A 1 232 ? 22.882  -6.701  47.849  1.00 46.30  ? 276 LYS A CD  1 
ATOM   1886 C CE  . LYS A 1 232 ? 22.626  -8.114  47.337  1.00 46.19  ? 276 LYS A CE  1 
ATOM   1887 N NZ  . LYS A 1 232 ? 22.788  -8.194  45.852  1.00 52.30  ? 276 LYS A NZ  1 
ATOM   1888 N N   . ASN A 1 233 ? 24.307  -3.871  52.615  1.00 29.85  ? 277 ASN A N   1 
ATOM   1889 C CA  . ASN A 1 233 ? 24.968  -2.712  53.188  1.00 31.02  ? 277 ASN A CA  1 
ATOM   1890 C C   . ASN A 1 233 ? 25.873  -2.097  52.131  1.00 29.23  ? 277 ASN A C   1 
ATOM   1891 O O   . ASN A 1 233 ? 26.653  -2.798  51.496  1.00 33.53  ? 277 ASN A O   1 
ATOM   1892 C CB  . ASN A 1 233 ? 25.838  -3.133  54.379  1.00 29.08  ? 277 ASN A CB  1 
ATOM   1893 C CG  . ASN A 1 233 ? 25.032  -3.449  55.626  1.00 27.97  ? 277 ASN A CG  1 
ATOM   1894 O OD1 . ASN A 1 233 ? 24.491  -2.555  56.276  1.00 33.18  ? 277 ASN A OD1 1 
ATOM   1895 N ND2 . ASN A 1 233 ? 24.957  -4.724  55.971  1.00 30.86  ? 277 ASN A ND2 1 
ATOM   1896 N N   . ILE A 1 234 ? 25.751  -0.798  51.910  1.00 29.86  ? 278 ILE A N   1 
ATOM   1897 C CA  . ILE A 1 234 ? 26.639  -0.136  50.968  1.00 30.75  ? 278 ILE A CA  1 
ATOM   1898 C C   . ILE A 1 234 ? 27.482  0.735   51.882  1.00 33.69  ? 278 ILE A C   1 
ATOM   1899 O O   . ILE A 1 234 ? 27.149  1.886   52.176  1.00 32.75  ? 278 ILE A O   1 
ATOM   1900 C CB  . ILE A 1 234 ? 25.864  0.686   49.918  1.00 34.79  ? 278 ILE A CB  1 
ATOM   1901 C CG1 . ILE A 1 234 ? 25.147  -0.283  48.968  1.00 30.55  ? 278 ILE A CG1 1 
ATOM   1902 C CG2 . ILE A 1 234 ? 26.816  1.573   49.122  1.00 21.39  ? 278 ILE A CG2 1 
ATOM   1903 C CD1 . ILE A 1 234 ? 24.350  0.378   47.878  1.00 45.16  ? 278 ILE A CD1 1 
ATOM   1904 N N   . TYR A 1 235 ? 28.561  0.123   52.362  1.00 35.40  ? 279 TYR A N   1 
ATOM   1905 C CA  . TYR A 1 235 ? 29.496  0.733   53.297  1.00 32.17  ? 279 TYR A CA  1 
ATOM   1906 C C   . TYR A 1 235 ? 30.239  1.958   52.791  1.00 28.56  ? 279 TYR A C   1 
ATOM   1907 O O   . TYR A 1 235 ? 30.360  2.944   53.510  1.00 25.53  ? 279 TYR A O   1 
ATOM   1908 C CB  . TYR A 1 235 ? 30.495  -0.325  53.759  1.00 26.65  ? 279 TYR A CB  1 
ATOM   1909 C CG  . TYR A 1 235 ? 29.888  -1.415  54.615  1.00 24.28  ? 279 TYR A CG  1 
ATOM   1910 C CD1 . TYR A 1 235 ? 29.476  -1.151  55.919  1.00 19.23  ? 279 TYR A CD1 1 
ATOM   1911 C CD2 . TYR A 1 235 ? 29.742  -2.717  54.127  1.00 22.93  ? 279 TYR A CD2 1 
ATOM   1912 C CE1 . TYR A 1 235 ? 28.939  -2.152  56.720  1.00 19.63  ? 279 TYR A CE1 1 
ATOM   1913 C CE2 . TYR A 1 235 ? 29.204  -3.728  54.919  1.00 19.38  ? 279 TYR A CE2 1 
ATOM   1914 C CZ  . TYR A 1 235 ? 28.805  -3.433  56.214  1.00 24.02  ? 279 TYR A CZ  1 
ATOM   1915 O OH  . TYR A 1 235 ? 28.257  -4.416  57.001  1.00 36.43  ? 279 TYR A OH  1 
ATOM   1916 N N   . ARG A 1 236 ? 30.733  1.899   51.558  1.00 31.40  ? 280 ARG A N   1 
ATOM   1917 C CA  . ARG A 1 236 ? 31.467  3.025   50.987  1.00 34.17  ? 280 ARG A CA  1 
ATOM   1918 C C   . ARG A 1 236 ? 30.767  3.562   49.734  1.00 39.04  ? 280 ARG A C   1 
ATOM   1919 O O   . ARG A 1 236 ? 31.029  3.105   48.619  1.00 39.58  ? 280 ARG A O   1 
ATOM   1920 C CB  . ARG A 1 236 ? 32.899  2.596   50.639  1.00 36.05  ? 280 ARG A CB  1 
ATOM   1921 C CG  . ARG A 1 236 ? 33.587  1.745   51.714  1.00 39.14  ? 280 ARG A CG  1 
ATOM   1922 C CD  . ARG A 1 236 ? 33.708  2.481   53.051  1.00 42.95  ? 280 ARG A CD  1 
ATOM   1923 N NE  . ARG A 1 236 ? 34.763  3.490   53.041  1.00 45.54  ? 280 ARG A NE  1 
ATOM   1924 C CZ  . ARG A 1 236 ? 36.055  3.224   53.203  1.00 43.87  ? 280 ARG A CZ  1 
ATOM   1925 N NH1 . ARG A 1 236 ? 36.943  4.205   53.177  1.00 44.06  ? 280 ARG A NH1 1 
ATOM   1926 N NH2 . ARG A 1 236 ? 36.459  1.980   53.407  1.00 45.01  ? 280 ARG A NH2 1 
ATOM   1927 N N   . PRO A 1 237 ? 29.858  4.536   49.907  1.00 36.13  ? 281 PRO A N   1 
ATOM   1928 C CA  . PRO A 1 237 ? 29.114  5.144   48.802  1.00 38.31  ? 281 PRO A CA  1 
ATOM   1929 C C   . PRO A 1 237 ? 30.014  5.647   47.686  1.00 40.08  ? 281 PRO A C   1 
ATOM   1930 O O   . PRO A 1 237 ? 29.767  5.363   46.516  1.00 41.64  ? 281 PRO A O   1 
ATOM   1931 C CB  . PRO A 1 237 ? 28.356  6.274   49.483  1.00 36.59  ? 281 PRO A CB  1 
ATOM   1932 C CG  . PRO A 1 237 ? 28.059  5.696   50.816  1.00 41.42  ? 281 PRO A CG  1 
ATOM   1933 C CD  . PRO A 1 237 ? 29.382  5.063   51.195  1.00 41.72  ? 281 PRO A CD  1 
ATOM   1934 N N   . ASP A 1 238 ? 31.053  6.395   48.043  1.00 42.51  ? 282 ASP A N   1 
ATOM   1935 C CA  . ASP A 1 238 ? 31.973  6.920   47.040  1.00 43.88  ? 282 ASP A CA  1 
ATOM   1936 C C   . ASP A 1 238 ? 32.602  5.798   46.227  1.00 37.99  ? 282 ASP A C   1 
ATOM   1937 O O   . ASP A 1 238 ? 32.796  5.931   45.025  1.00 40.95  ? 282 ASP A O   1 
ATOM   1938 C CB  . ASP A 1 238 ? 33.075  7.767   47.691  1.00 48.68  ? 282 ASP A CB  1 
ATOM   1939 C CG  . ASP A 1 238 ? 33.673  7.116   48.933  1.00 53.07  ? 282 ASP A CG  1 
ATOM   1940 O OD1 . ASP A 1 238 ? 33.644  5.872   49.042  1.00 53.10  ? 282 ASP A OD1 1 
ATOM   1941 O OD2 . ASP A 1 238 ? 34.188  7.858   49.798  1.00 55.22  ? 282 ASP A OD2 1 
ATOM   1942 N N   . LYS A 1 239 ? 32.913  4.688   46.885  1.00 42.36  ? 283 LYS A N   1 
ATOM   1943 C CA  . LYS A 1 239 ? 33.518  3.555   46.198  1.00 44.85  ? 283 LYS A CA  1 
ATOM   1944 C C   . LYS A 1 239 ? 32.443  2.842   45.399  1.00 44.49  ? 283 LYS A C   1 
ATOM   1945 O O   . LYS A 1 239 ? 32.727  2.138   44.431  1.00 46.07  ? 283 LYS A O   1 
ATOM   1946 C CB  . LYS A 1 239 ? 34.138  2.578   47.201  1.00 49.13  ? 283 LYS A CB  1 
ATOM   1947 C CG  . LYS A 1 239 ? 34.817  1.372   46.541  1.00 64.52  ? 283 LYS A CG  1 
ATOM   1948 C CD  . LYS A 1 239 ? 35.091  0.248   47.540  1.00 71.96  ? 283 LYS A CD  1 
ATOM   1949 C CE  . LYS A 1 239 ? 33.793  -0.332  48.104  1.00 77.33  ? 283 LYS A CE  1 
ATOM   1950 N NZ  . LYS A 1 239 ? 34.023  -1.469  49.045  1.00 74.53  ? 283 LYS A NZ  1 
ATOM   1951 N N   . PHE A 1 240 ? 31.198  3.029   45.819  1.00 44.92  ? 284 PHE A N   1 
ATOM   1952 C CA  . PHE A 1 240 ? 30.075  2.407   45.142  1.00 46.02  ? 284 PHE A CA  1 
ATOM   1953 C C   . PHE A 1 240 ? 29.944  2.953   43.732  1.00 46.23  ? 284 PHE A C   1 
ATOM   1954 O O   . PHE A 1 240 ? 30.080  2.211   42.767  1.00 50.62  ? 284 PHE A O   1 
ATOM   1955 C CB  . PHE A 1 240 ? 28.789  2.663   45.918  1.00 44.76  ? 284 PHE A CB  1 
ATOM   1956 C CG  . PHE A 1 240 ? 27.564  2.134   45.245  1.00 48.60  ? 284 PHE A CG  1 
ATOM   1957 C CD1 . PHE A 1 240 ? 27.457  0.784   44.929  1.00 52.53  ? 284 PHE A CD1 1 
ATOM   1958 C CD2 . PHE A 1 240 ? 26.502  2.980   44.945  1.00 44.78  ? 284 PHE A CD2 1 
ATOM   1959 C CE1 . PHE A 1 240 ? 26.311  0.285   44.326  1.00 52.80  ? 284 PHE A CE1 1 
ATOM   1960 C CE2 . PHE A 1 240 ? 25.351  2.492   44.342  1.00 47.85  ? 284 PHE A CE2 1 
ATOM   1961 C CZ  . PHE A 1 240 ? 25.253  1.144   44.033  1.00 52.37  ? 284 PHE A CZ  1 
ATOM   1962 N N   . LEU A 1 241 ? 29.682  4.252   43.615  1.00 48.30  ? 285 LEU A N   1 
ATOM   1963 C CA  . LEU A 1 241 ? 29.531  4.880   42.306  1.00 52.60  ? 285 LEU A CA  1 
ATOM   1964 C C   . LEU A 1 241 ? 30.716  4.578   41.411  1.00 52.18  ? 285 LEU A C   1 
ATOM   1965 O O   . LEU A 1 241 ? 30.549  4.160   40.267  1.00 53.47  ? 285 LEU A O   1 
ATOM   1966 C CB  . LEU A 1 241 ? 29.387  6.398   42.439  1.00 53.13  ? 285 LEU A CB  1 
ATOM   1967 C CG  . LEU A 1 241 ? 28.005  6.967   42.756  1.00 58.41  ? 285 LEU A CG  1 
ATOM   1968 C CD1 . LEU A 1 241 ? 28.058  8.493   42.689  1.00 53.45  ? 285 LEU A CD1 1 
ATOM   1969 C CD2 . LEU A 1 241 ? 26.986  6.430   41.757  1.00 59.15  ? 285 LEU A CD2 1 
ATOM   1970 N N   . GLN A 1 242 ? 31.911  4.800   41.945  1.00 50.96  ? 286 GLN A N   1 
ATOM   1971 C CA  . GLN A 1 242 ? 33.145  4.562   41.215  1.00 50.49  ? 286 GLN A CA  1 
ATOM   1972 C C   . GLN A 1 242 ? 33.192  3.192   40.533  1.00 47.73  ? 286 GLN A C   1 
ATOM   1973 O O   . GLN A 1 242 ? 33.618  3.089   39.381  1.00 49.31  ? 286 GLN A O   1 
ATOM   1974 C CB  . GLN A 1 242 ? 34.334  4.719   42.163  1.00 55.25  ? 286 GLN A CB  1 
ATOM   1975 C CG  . GLN A 1 242 ? 35.670  4.329   41.567  1.00 65.49  ? 286 GLN A CG  1 
ATOM   1976 C CD  . GLN A 1 242 ? 36.796  4.453   42.569  1.00 74.50  ? 286 GLN A CD  1 
ATOM   1977 O OE1 . GLN A 1 242 ? 37.934  4.068   42.296  1.00 78.92  ? 286 GLN A OE1 1 
ATOM   1978 N NE2 . GLN A 1 242 ? 36.486  5.001   43.741  1.00 75.72  ? 286 GLN A NE2 1 
ATOM   1979 N N   . CYS A 1 243 ? 32.757  2.146   41.233  1.00 42.51  ? 287 CYS A N   1 
ATOM   1980 C CA  . CYS A 1 243 ? 32.770  0.797   40.662  1.00 47.91  ? 287 CYS A CA  1 
ATOM   1981 C C   . CYS A 1 243 ? 31.618  0.546   39.706  1.00 52.04  ? 287 CYS A C   1 
ATOM   1982 O O   . CYS A 1 243 ? 31.614  -0.438  38.963  1.00 49.03  ? 287 CYS A O   1 
ATOM   1983 C CB  . CYS A 1 243 ? 32.764  -0.262  41.764  1.00 46.78  ? 287 CYS A CB  1 
ATOM   1984 S SG  . CYS A 1 243 ? 34.420  -0.891  42.126  1.00 62.64  ? 287 CYS A SG  1 
ATOM   1985 N N   . VAL A 1 244 ? 30.634  1.434   39.741  1.00 50.14  ? 288 VAL A N   1 
ATOM   1986 C CA  . VAL A 1 244 ? 29.493  1.329   38.853  1.00 59.20  ? 288 VAL A CA  1 
ATOM   1987 C C   . VAL A 1 244 ? 29.846  2.179   37.637  1.00 63.25  ? 288 VAL A C   1 
ATOM   1988 O O   . VAL A 1 244 ? 29.422  1.905   36.514  1.00 63.89  ? 288 VAL A O   1 
ATOM   1989 C CB  . VAL A 1 244 ? 28.213  1.901   39.513  1.00 60.19  ? 288 VAL A CB  1 
ATOM   1990 C CG1 . VAL A 1 244 ? 27.054  1.856   38.529  1.00 60.44  ? 288 VAL A CG1 1 
ATOM   1991 C CG2 . VAL A 1 244 ? 27.875  1.113   40.771  1.00 56.92  ? 288 VAL A CG2 1 
ATOM   1992 N N   . LYS A 1 245 ? 30.659  3.200   37.889  1.00 64.55  ? 289 LYS A N   1 
ATOM   1993 C CA  . LYS A 1 245 ? 31.089  4.148   36.871  1.00 67.61  ? 289 LYS A CA  1 
ATOM   1994 C C   . LYS A 1 245 ? 32.252  3.667   36.004  1.00 73.01  ? 289 LYS A C   1 
ATOM   1995 O O   . LYS A 1 245 ? 32.405  4.120   34.869  1.00 75.96  ? 289 LYS A O   1 
ATOM   1996 C CB  . LYS A 1 245 ? 31.460  5.469   37.552  1.00 62.33  ? 289 LYS A CB  1 
ATOM   1997 C CG  . LYS A 1 245 ? 31.643  6.640   36.612  1.00 59.17  ? 289 LYS A CG  1 
ATOM   1998 C CD  . LYS A 1 245 ? 31.833  7.931   37.387  1.00 48.52  ? 289 LYS A CD  1 
ATOM   1999 C CE  . LYS A 1 245 ? 30.644  8.223   38.288  1.00 45.80  ? 289 LYS A CE  1 
ATOM   2000 N NZ  . LYS A 1 245 ? 30.800  9.524   39.004  1.00 40.81  ? 289 LYS A NZ  1 
ATOM   2001 N N   . ASN A 1 246 ? 33.070  2.760   36.534  1.00 77.01  ? 290 ASN A N   1 
ATOM   2002 C CA  . ASN A 1 246 ? 34.220  2.238   35.790  1.00 78.90  ? 290 ASN A CA  1 
ATOM   2003 C C   . ASN A 1 246 ? 34.457  0.753   36.042  1.00 79.76  ? 290 ASN A C   1 
ATOM   2004 O O   . ASN A 1 246 ? 35.549  0.362   36.455  1.00 82.35  ? 290 ASN A O   1 
ATOM   2005 C CB  . ASN A 1 246 ? 35.498  2.999   36.168  1.00 79.93  ? 290 ASN A CB  1 
ATOM   2006 C CG  . ASN A 1 246 ? 35.446  4.463   35.793  1.00 80.05  ? 290 ASN A CG  1 
ATOM   2007 O OD1 . ASN A 1 246 ? 34.640  5.222   36.328  1.00 86.98  ? 290 ASN A OD1 1 
ATOM   2008 N ND2 . ASN A 1 246 ? 36.310  4.869   34.869  1.00 77.71  ? 290 ASN A ND2 1 
ATOM   2009 N N   . PRO A 1 247 ? 33.445  -0.095  35.797  1.00 80.28  ? 291 PRO A N   1 
ATOM   2010 C CA  . PRO A 1 247 ? 33.594  -1.539  36.016  1.00 79.08  ? 291 PRO A CA  1 
ATOM   2011 C C   . PRO A 1 247 ? 34.677  -2.182  35.143  1.00 78.62  ? 291 PRO A C   1 
ATOM   2012 O O   . PRO A 1 247 ? 34.371  -3.212  34.509  1.00 80.79  ? 291 PRO A O   1 
ATOM   2013 C CB  . PRO A 1 247 ? 32.203  -2.083  35.691  1.00 79.11  ? 291 PRO A CB  1 
ATOM   2014 C CG  . PRO A 1 247 ? 31.300  -0.937  36.028  1.00 81.63  ? 291 PRO A CG  1 
ATOM   2015 C CD  . PRO A 1 247 ? 32.051  0.238   35.453  1.00 80.30  ? 291 PRO A CD  1 
ATOM   2016 N N   . ARG B 1 1   ? -6.329  -37.694 2.825   1.00 80.83  ? 45  ARG B N   1 
ATOM   2017 C CA  . ARG B 1 1   ? -6.018  -38.309 1.501   1.00 80.90  ? 45  ARG B CA  1 
ATOM   2018 C C   . ARG B 1 1   ? -6.000  -37.273 0.384   1.00 80.09  ? 45  ARG B C   1 
ATOM   2019 O O   . ARG B 1 1   ? -6.215  -37.606 -0.785  1.00 80.12  ? 45  ARG B O   1 
ATOM   2020 C CB  . ARG B 1 1   ? -7.053  -39.377 1.157   1.00 81.41  ? 45  ARG B CB  1 
ATOM   2021 C CG  . ARG B 1 1   ? -8.482  -38.862 1.149   1.00 82.77  ? 45  ARG B CG  1 
ATOM   2022 C CD  . ARG B 1 1   ? -9.406  -39.811 0.405   1.00 82.72  ? 45  ARG B CD  1 
ATOM   2023 N NE  . ARG B 1 1   ? -10.797 -39.364 0.434   1.00 82.86  ? 45  ARG B NE  1 
ATOM   2024 C CZ  . ARG B 1 1   ? -11.757 -39.859 -0.341  1.00 80.85  ? 45  ARG B CZ  1 
ATOM   2025 N NH1 . ARG B 1 1   ? -11.480 -40.822 -1.213  1.00 82.99  ? 45  ARG B NH1 1 
ATOM   2026 N NH2 . ARG B 1 1   ? -12.994 -39.394 -0.246  1.00 78.92  ? 45  ARG B NH2 1 
ATOM   2027 N N   . TRP B 1 2   ? -5.743  -36.019 0.738   1.00 78.44  ? 46  TRP B N   1 
ATOM   2028 C CA  . TRP B 1 2   ? -5.716  -34.958 -0.260  1.00 74.11  ? 46  TRP B CA  1 
ATOM   2029 C C   . TRP B 1 2   ? -4.505  -34.045 -0.138  1.00 72.40  ? 46  TRP B C   1 
ATOM   2030 O O   . TRP B 1 2   ? -4.357  -33.092 -0.903  1.00 71.76  ? 46  TRP B O   1 
ATOM   2031 C CB  . TRP B 1 2   ? -7.006  -34.141 -0.176  1.00 71.50  ? 46  TRP B CB  1 
ATOM   2032 C CG  . TRP B 1 2   ? -8.220  -34.945 -0.516  1.00 64.59  ? 46  TRP B CG  1 
ATOM   2033 C CD1 . TRP B 1 2   ? -8.489  -35.560 -1.708  1.00 58.92  ? 46  TRP B CD1 1 
ATOM   2034 C CD2 . TRP B 1 2   ? -9.329  -35.226 0.342   1.00 65.66  ? 46  TRP B CD2 1 
ATOM   2035 N NE1 . TRP B 1 2   ? -9.700  -36.205 -1.645  1.00 64.05  ? 46  TRP B NE1 1 
ATOM   2036 C CE2 . TRP B 1 2   ? -10.238 -36.017 -0.397  1.00 66.98  ? 46  TRP B CE2 1 
ATOM   2037 C CE3 . TRP B 1 2   ? -9.646  -34.886 1.666   1.00 64.38  ? 46  TRP B CE3 1 
ATOM   2038 C CZ2 . TRP B 1 2   ? -11.447 -36.475 0.144   1.00 67.68  ? 46  TRP B CZ2 1 
ATOM   2039 C CZ3 . TRP B 1 2   ? -10.847 -35.341 2.205   1.00 63.72  ? 46  TRP B CZ3 1 
ATOM   2040 C CH2 . TRP B 1 2   ? -11.732 -36.128 1.443   1.00 69.96  ? 46  TRP B CH2 1 
ATOM   2041 N N   . ARG B 1 3   ? -3.638  -34.337 0.823   1.00 71.50  ? 47  ARG B N   1 
ATOM   2042 C CA  . ARG B 1 3   ? -2.437  -33.540 1.009   1.00 72.01  ? 47  ARG B CA  1 
ATOM   2043 C C   . ARG B 1 3   ? -1.690  -33.443 -0.319  1.00 72.17  ? 47  ARG B C   1 
ATOM   2044 O O   . ARG B 1 3   ? -1.427  -34.455 -0.974  1.00 74.55  ? 47  ARG B O   1 
ATOM   2045 C CB  . ARG B 1 3   ? -1.530  -34.180 2.064   1.00 72.39  ? 47  ARG B CB  1 
ATOM   2046 C CG  . ARG B 1 3   ? -0.118  -33.607 2.094   1.00 75.68  ? 47  ARG B CG  1 
ATOM   2047 C CD  . ARG B 1 3   ? 0.728   -34.267 3.166   1.00 76.60  ? 47  ARG B CD  1 
ATOM   2048 N NE  . ARG B 1 3   ? 0.193   -34.005 4.497   1.00 80.16  ? 47  ARG B NE  1 
ATOM   2049 C CZ  . ARG B 1 3   ? 0.762   -34.417 5.624   1.00 84.40  ? 47  ARG B CZ  1 
ATOM   2050 N NH1 . ARG B 1 3   ? 1.889   -35.116 5.580   1.00 84.15  ? 47  ARG B NH1 1 
ATOM   2051 N NH2 . ARG B 1 3   ? 0.208   -34.125 6.794   1.00 85.96  ? 47  ARG B NH2 1 
ATOM   2052 N N   . GLN B 1 4   ? -1.363  -32.219 -0.717  1.00 68.05  ? 48  GLN B N   1 
ATOM   2053 C CA  . GLN B 1 4   ? -0.635  -31.985 -1.955  1.00 60.22  ? 48  GLN B CA  1 
ATOM   2054 C C   . GLN B 1 4   ? 0.866   -32.030 -1.660  1.00 57.68  ? 48  GLN B C   1 
ATOM   2055 O O   . GLN B 1 4   ? 1.284   -31.923 -0.508  1.00 56.03  ? 48  GLN B O   1 
ATOM   2056 C CB  . GLN B 1 4   ? -1.023  -30.621 -2.531  1.00 55.52  ? 48  GLN B CB  1 
ATOM   2057 C CG  . GLN B 1 4   ? -0.197  -30.191 -3.730  1.00 56.94  ? 48  GLN B CG  1 
ATOM   2058 C CD  . GLN B 1 4   ? -0.623  -28.845 -4.287  1.00 54.87  ? 48  GLN B CD  1 
ATOM   2059 O OE1 . GLN B 1 4   ? 0.038   -28.290 -5.164  1.00 53.73  ? 48  GLN B OE1 1 
ATOM   2060 N NE2 . GLN B 1 4   ? -1.735  -28.318 -3.783  1.00 49.69  ? 48  GLN B NE2 1 
ATOM   2061 N N   . THR B 1 5   ? 1.675   -32.203 -2.697  1.00 53.78  ? 49  THR B N   1 
ATOM   2062 C CA  . THR B 1 5   ? 3.118   -32.245 -2.520  1.00 51.08  ? 49  THR B CA  1 
ATOM   2063 C C   . THR B 1 5   ? 3.731   -30.892 -2.880  1.00 50.88  ? 49  THR B C   1 
ATOM   2064 O O   . THR B 1 5   ? 3.667   -30.459 -4.033  1.00 56.53  ? 49  THR B O   1 
ATOM   2065 C CB  . THR B 1 5   ? 3.745   -33.346 -3.400  1.00 53.92  ? 49  THR B CB  1 
ATOM   2066 O OG1 . THR B 1 5   ? 3.363   -34.635 -2.898  1.00 57.44  ? 49  THR B OG1 1 
ATOM   2067 C CG2 . THR B 1 5   ? 5.263   -33.232 -3.408  1.00 50.83  ? 49  THR B CG2 1 
ATOM   2068 N N   . TRP B 1 6   ? 4.323   -30.225 -1.892  1.00 44.42  ? 50  TRP B N   1 
ATOM   2069 C CA  . TRP B 1 6   ? 4.948   -28.923 -2.116  1.00 40.49  ? 50  TRP B CA  1 
ATOM   2070 C C   . TRP B 1 6   ? 6.420   -29.071 -2.498  1.00 38.93  ? 50  TRP B C   1 
ATOM   2071 O O   . TRP B 1 6   ? 7.010   -30.136 -2.318  1.00 39.29  ? 50  TRP B O   1 
ATOM   2072 C CB  . TRP B 1 6   ? 4.816   -28.053 -0.865  1.00 33.96  ? 50  TRP B CB  1 
ATOM   2073 C CG  . TRP B 1 6   ? 3.424   -28.002 -0.339  1.00 28.39  ? 50  TRP B CG  1 
ATOM   2074 C CD1 . TRP B 1 6   ? 2.956   -28.600 0.793   1.00 27.53  ? 50  TRP B CD1 1 
ATOM   2075 C CD2 . TRP B 1 6   ? 2.300   -27.347 -0.942  1.00 27.70  ? 50  TRP B CD2 1 
ATOM   2076 N NE1 . TRP B 1 6   ? 1.612   -28.361 0.934   1.00 30.39  ? 50  TRP B NE1 1 
ATOM   2077 C CE2 . TRP B 1 6   ? 1.182   -27.594 -0.117  1.00 28.57  ? 50  TRP B CE2 1 
ATOM   2078 C CE3 . TRP B 1 6   ? 2.128   -26.576 -2.101  1.00 31.08  ? 50  TRP B CE3 1 
ATOM   2079 C CZ2 . TRP B 1 6   ? -0.095  -27.097 -0.412  1.00 27.47  ? 50  TRP B CZ2 1 
ATOM   2080 C CZ3 . TRP B 1 6   ? 0.853   -26.081 -2.395  1.00 31.15  ? 50  TRP B CZ3 1 
ATOM   2081 C CH2 . TRP B 1 6   ? -0.238  -26.345 -1.552  1.00 22.83  ? 50  TRP B CH2 1 
ATOM   2082 N N   . SER B 1 7   ? 7.008   -27.994 -3.012  1.00 37.14  ? 51  SER B N   1 
ATOM   2083 C CA  . SER B 1 7   ? 8.400   -28.000 -3.453  1.00 39.33  ? 51  SER B CA  1 
ATOM   2084 C C   . SER B 1 7   ? 9.396   -27.542 -2.397  1.00 40.58  ? 51  SER B C   1 
ATOM   2085 O O   . SER B 1 7   ? 10.602  -27.574 -2.622  1.00 41.05  ? 51  SER B O   1 
ATOM   2086 C CB  . SER B 1 7   ? 8.555   -27.113 -4.692  1.00 43.97  ? 51  SER B CB  1 
ATOM   2087 O OG  . SER B 1 7   ? 7.570   -27.415 -5.668  1.00 48.89  ? 51  SER B OG  1 
ATOM   2088 N N   . GLY B 1 8   ? 8.895   -27.109 -1.247  1.00 45.61  ? 52  GLY B N   1 
ATOM   2089 C CA  . GLY B 1 8   ? 9.784   -26.649 -0.196  1.00 42.56  ? 52  GLY B CA  1 
ATOM   2090 C C   . GLY B 1 8   ? 9.924   -27.656 0.928   1.00 44.57  ? 52  GLY B C   1 
ATOM   2091 O O   . GLY B 1 8   ? 9.054   -28.514 1.105   1.00 46.71  ? 52  GLY B O   1 
ATOM   2092 N N   . PRO B 1 9   ? 11.013  -27.581 1.711   1.00 38.52  ? 53  PRO B N   1 
ATOM   2093 C CA  . PRO B 1 9   ? 11.178  -28.537 2.806   1.00 35.81  ? 53  PRO B CA  1 
ATOM   2094 C C   . PRO B 1 9   ? 10.025  -28.472 3.802   1.00 37.18  ? 53  PRO B C   1 
ATOM   2095 O O   . PRO B 1 9   ? 9.402   -27.421 3.986   1.00 33.70  ? 53  PRO B O   1 
ATOM   2096 C CB  . PRO B 1 9   ? 12.527  -28.146 3.417   1.00 36.70  ? 53  PRO B CB  1 
ATOM   2097 C CG  . PRO B 1 9   ? 12.667  -26.696 3.072   1.00 43.35  ? 53  PRO B CG  1 
ATOM   2098 C CD  . PRO B 1 9   ? 12.133  -26.625 1.662   1.00 34.58  ? 53  PRO B CD  1 
ATOM   2099 N N   . GLY B 1 10  ? 9.740   -29.612 4.424   1.00 32.93  ? 54  GLY B N   1 
ATOM   2100 C CA  . GLY B 1 10  ? 8.661   -29.692 5.387   1.00 29.45  ? 54  GLY B CA  1 
ATOM   2101 C C   . GLY B 1 10  ? 9.002   -29.067 6.725   1.00 31.24  ? 54  GLY B C   1 
ATOM   2102 O O   . GLY B 1 10  ? 10.161  -28.744 7.003   1.00 23.90  ? 54  GLY B O   1 
ATOM   2103 N N   . THR B 1 11  ? 7.980   -28.900 7.559   1.00 30.34  ? 55  THR B N   1 
ATOM   2104 C CA  . THR B 1 11  ? 8.157   -28.301 8.868   1.00 33.02  ? 55  THR B CA  1 
ATOM   2105 C C   . THR B 1 11  ? 9.387   -28.865 9.557   1.00 31.55  ? 55  THR B C   1 
ATOM   2106 O O   . THR B 1 11  ? 9.640   -30.065 9.515   1.00 39.22  ? 55  THR B O   1 
ATOM   2107 C CB  . THR B 1 11  ? 6.935   -28.549 9.762   1.00 32.67  ? 55  THR B CB  1 
ATOM   2108 O OG1 . THR B 1 11  ? 5.782   -27.938 9.172   1.00 29.05  ? 55  THR B OG1 1 
ATOM   2109 C CG2 . THR B 1 11  ? 7.166   -27.966 11.150  1.00 31.25  ? 55  THR B CG2 1 
ATOM   2110 N N   . THR B 1 12  ? 10.161  -27.987 10.179  1.00 34.91  ? 56  THR B N   1 
ATOM   2111 C CA  . THR B 1 12  ? 11.355  -28.411 10.884  1.00 34.95  ? 56  THR B CA  1 
ATOM   2112 C C   . THR B 1 12  ? 10.949  -29.437 11.933  1.00 35.44  ? 56  THR B C   1 
ATOM   2113 O O   . THR B 1 12  ? 9.994   -29.223 12.683  1.00 28.61  ? 56  THR B O   1 
ATOM   2114 C CB  . THR B 1 12  ? 12.019  -27.231 11.592  1.00 36.60  ? 56  THR B CB  1 
ATOM   2115 O OG1 . THR B 1 12  ? 12.171  -26.147 10.666  1.00 41.38  ? 56  THR B OG1 1 
ATOM   2116 C CG2 . THR B 1 12  ? 13.389  -27.639 12.124  1.00 36.52  ? 56  THR B CG2 1 
ATOM   2117 N N   . LYS B 1 13  ? 11.661  -30.557 11.977  1.00 38.00  ? 57  LYS B N   1 
ATOM   2118 C CA  . LYS B 1 13  ? 11.353  -31.593 12.952  1.00 42.40  ? 57  LYS B CA  1 
ATOM   2119 C C   . LYS B 1 13  ? 11.459  -31.001 14.356  1.00 37.84  ? 57  LYS B C   1 
ATOM   2120 O O   . LYS B 1 13  ? 12.309  -30.150 14.608  1.00 38.18  ? 57  LYS B O   1 
ATOM   2121 C CB  . LYS B 1 13  ? 12.318  -32.772 12.796  1.00 47.19  ? 57  LYS B CB  1 
ATOM   2122 C CG  . LYS B 1 13  ? 13.787  -32.422 12.976  1.00 50.79  ? 57  LYS B CG  1 
ATOM   2123 C CD  . LYS B 1 13  ? 14.645  -33.684 13.000  1.00 62.87  ? 57  LYS B CD  1 
ATOM   2124 C CE  . LYS B 1 13  ? 16.090  -33.379 13.387  1.00 67.51  ? 57  LYS B CE  1 
ATOM   2125 N NZ  . LYS B 1 13  ? 16.876  -34.623 13.676  1.00 68.39  ? 57  LYS B NZ  1 
ATOM   2126 N N   . ARG B 1 14  ? 10.581  -31.435 15.257  1.00 37.15  ? 58  ARG B N   1 
ATOM   2127 C CA  . ARG B 1 14  ? 10.580  -30.949 16.638  1.00 38.14  ? 58  ARG B CA  1 
ATOM   2128 C C   . ARG B 1 14  ? 10.138  -29.493 16.720  1.00 37.77  ? 58  ARG B C   1 
ATOM   2129 O O   . ARG B 1 14  ? 10.410  -28.804 17.704  1.00 42.61  ? 58  ARG B O   1 
ATOM   2130 C CB  . ARG B 1 14  ? 11.978  -31.087 17.258  1.00 35.94  ? 58  ARG B CB  1 
ATOM   2131 C CG  . ARG B 1 14  ? 12.495  -32.520 17.326  1.00 48.33  ? 58  ARG B CG  1 
ATOM   2132 C CD  . ARG B 1 14  ? 11.782  -33.330 18.398  1.00 50.11  ? 58  ARG B CD  1 
ATOM   2133 N NE  . ARG B 1 14  ? 12.286  -33.022 19.735  1.00 56.86  ? 58  ARG B NE  1 
ATOM   2134 C CZ  . ARG B 1 14  ? 11.689  -33.398 20.862  1.00 58.71  ? 58  ARG B CZ  1 
ATOM   2135 N NH1 . ARG B 1 14  ? 10.557  -34.096 20.819  1.00 51.82  ? 58  ARG B NH1 1 
ATOM   2136 N NH2 . ARG B 1 14  ? 12.227  -33.080 22.034  1.00 48.39  ? 58  ARG B NH2 1 
ATOM   2137 N N   . PHE B 1 15  ? 9.455   -29.029 15.683  1.00 32.46  ? 59  PHE B N   1 
ATOM   2138 C CA  . PHE B 1 15  ? 8.979   -27.654 15.638  1.00 29.19  ? 59  PHE B CA  1 
ATOM   2139 C C   . PHE B 1 15  ? 8.191   -27.245 16.892  1.00 29.34  ? 59  PHE B C   1 
ATOM   2140 O O   . PHE B 1 15  ? 8.549   -26.276 17.564  1.00 30.74  ? 59  PHE B O   1 
ATOM   2141 C CB  . PHE B 1 15  ? 8.118   -27.450 14.388  1.00 24.69  ? 59  PHE B CB  1 
ATOM   2142 C CG  . PHE B 1 15  ? 7.621   -26.048 14.215  1.00 22.16  ? 59  PHE B CG  1 
ATOM   2143 C CD1 . PHE B 1 15  ? 8.506   -25.016 13.945  1.00 14.21  ? 59  PHE B CD1 1 
ATOM   2144 C CD2 . PHE B 1 15  ? 6.264   -25.760 14.328  1.00 16.51  ? 59  PHE B CD2 1 
ATOM   2145 C CE1 . PHE B 1 15  ? 8.048   -23.712 13.787  1.00 27.55  ? 59  PHE B CE1 1 
ATOM   2146 C CE2 . PHE B 1 15  ? 5.792   -24.454 14.173  1.00 18.72  ? 59  PHE B CE2 1 
ATOM   2147 C CZ  . PHE B 1 15  ? 6.680   -23.432 13.903  1.00 22.80  ? 59  PHE B CZ  1 
ATOM   2148 N N   . PRO B 1 16  ? 7.112   -27.980 17.228  1.00 25.11  ? 60  PRO B N   1 
ATOM   2149 C CA  . PRO B 1 16  ? 6.303   -27.650 18.413  1.00 29.75  ? 60  PRO B CA  1 
ATOM   2150 C C   . PRO B 1 16  ? 7.137   -27.567 19.689  1.00 30.10  ? 60  PRO B C   1 
ATOM   2151 O O   . PRO B 1 16  ? 7.026   -26.613 20.460  1.00 36.87  ? 60  PRO B O   1 
ATOM   2152 C CB  . PRO B 1 16  ? 5.284   -28.790 18.478  1.00 22.28  ? 60  PRO B CB  1 
ATOM   2153 C CG  . PRO B 1 16  ? 5.164   -29.236 17.055  1.00 28.24  ? 60  PRO B CG  1 
ATOM   2154 C CD  . PRO B 1 16  ? 6.605   -29.200 16.577  1.00 27.87  ? 60  PRO B CD  1 
ATOM   2155 N N   . GLU B 1 17  ? 7.971   -28.575 19.906  1.00 28.70  ? 61  GLU B N   1 
ATOM   2156 C CA  . GLU B 1 17  ? 8.819   -28.608 21.085  1.00 32.65  ? 61  GLU B CA  1 
ATOM   2157 C C   . GLU B 1 17  ? 9.857   -27.488 21.045  1.00 29.98  ? 61  GLU B C   1 
ATOM   2158 O O   . GLU B 1 17  ? 10.170  -26.895 22.076  1.00 32.73  ? 61  GLU B O   1 
ATOM   2159 C CB  . GLU B 1 17  ? 9.511   -29.974 21.212  1.00 32.49  ? 61  GLU B CB  1 
ATOM   2160 C CG  . GLU B 1 17  ? 8.561   -31.126 21.543  1.00 39.48  ? 61  GLU B CG  1 
ATOM   2161 C CD  . GLU B 1 17  ? 7.856   -31.697 20.319  1.00 46.72  ? 61  GLU B CD  1 
ATOM   2162 O OE1 . GLU B 1 17  ? 6.797   -32.342 20.485  1.00 44.50  ? 61  GLU B OE1 1 
ATOM   2163 O OE2 . GLU B 1 17  ? 8.366   -31.515 19.192  1.00 49.12  ? 61  GLU B OE2 1 
ATOM   2164 N N   . THR B 1 18  ? 10.381  -27.192 19.859  1.00 25.54  ? 62  THR B N   1 
ATOM   2165 C CA  . THR B 1 18  ? 11.375  -26.129 19.717  1.00 24.81  ? 62  THR B CA  1 
ATOM   2166 C C   . THR B 1 18  ? 10.783  -24.753 20.039  1.00 25.22  ? 62  THR B C   1 
ATOM   2167 O O   . THR B 1 18  ? 11.420  -23.926 20.695  1.00 26.19  ? 62  THR B O   1 
ATOM   2168 C CB  . THR B 1 18  ? 11.955  -26.102 18.295  1.00 28.77  ? 62  THR B CB  1 
ATOM   2169 O OG1 . THR B 1 18  ? 12.582  -27.361 18.017  1.00 30.17  ? 62  THR B OG1 1 
ATOM   2170 C CG2 . THR B 1 18  ? 12.982  -24.978 18.151  1.00 29.43  ? 62  THR B CG2 1 
ATOM   2171 N N   . VAL B 1 19  ? 9.558   -24.515 19.590  1.00 21.78  ? 63  VAL B N   1 
ATOM   2172 C CA  . VAL B 1 19  ? 8.914   -23.245 19.843  1.00 22.09  ? 63  VAL B CA  1 
ATOM   2173 C C   . VAL B 1 19  ? 8.646   -23.034 21.329  1.00 26.89  ? 63  VAL B C   1 
ATOM   2174 O O   . VAL B 1 19  ? 8.982   -21.990 21.885  1.00 26.01  ? 63  VAL B O   1 
ATOM   2175 C CB  . VAL B 1 19  ? 7.591   -23.141 19.062  1.00 22.01  ? 63  VAL B CB  1 
ATOM   2176 C CG1 . VAL B 1 19  ? 6.785   -21.944 19.549  1.00 15.17  ? 63  VAL B CG1 1 
ATOM   2177 C CG2 . VAL B 1 19  ? 7.889   -23.005 17.581  1.00 18.08  ? 63  VAL B CG2 1 
ATOM   2178 N N   . LEU B 1 20  ? 8.036   -24.026 21.969  1.00 31.59  ? 64  LEU B N   1 
ATOM   2179 C CA  . LEU B 1 20  ? 7.724   -23.935 23.390  1.00 27.11  ? 64  LEU B CA  1 
ATOM   2180 C C   . LEU B 1 20  ? 9.002   -23.725 24.182  1.00 25.98  ? 64  LEU B C   1 
ATOM   2181 O O   . LEU B 1 20  ? 9.071   -22.857 25.048  1.00 25.88  ? 64  LEU B O   1 
ATOM   2182 C CB  . LEU B 1 20  ? 7.019   -25.211 23.864  1.00 25.64  ? 64  LEU B CB  1 
ATOM   2183 C CG  . LEU B 1 20  ? 5.585   -25.429 23.358  1.00 36.54  ? 64  LEU B CG  1 
ATOM   2184 C CD1 . LEU B 1 20  ? 5.225   -26.906 23.440  1.00 39.64  ? 64  LEU B CD1 1 
ATOM   2185 C CD2 . LEU B 1 20  ? 4.607   -24.586 24.170  1.00 22.53  ? 64  LEU B CD2 1 
ATOM   2186 N N   . ALA B 1 21  ? 10.020  -24.515 23.876  1.00 19.81  ? 65  ALA B N   1 
ATOM   2187 C CA  . ALA B 1 21  ? 11.285  -24.396 24.581  1.00 25.77  ? 65  ALA B CA  1 
ATOM   2188 C C   . ALA B 1 21  ? 11.864  -23.005 24.390  1.00 28.21  ? 65  ALA B C   1 
ATOM   2189 O O   . ALA B 1 21  ? 12.375  -22.401 25.335  1.00 30.95  ? 65  ALA B O   1 
ATOM   2190 C CB  . ALA B 1 21  ? 12.264  -25.440 24.082  1.00 18.86  ? 65  ALA B CB  1 
ATOM   2191 N N   . ARG B 1 22  ? 11.779  -22.498 23.163  1.00 30.75  ? 66  ARG B N   1 
ATOM   2192 C CA  . ARG B 1 22  ? 12.312  -21.175 22.861  1.00 29.08  ? 66  ARG B CA  1 
ATOM   2193 C C   . ARG B 1 22  ? 11.557  -20.090 23.606  1.00 29.39  ? 66  ARG B C   1 
ATOM   2194 O O   . ARG B 1 22  ? 12.148  -19.102 24.053  1.00 26.96  ? 66  ARG B O   1 
ATOM   2195 C CB  . ARG B 1 22  ? 12.261  -20.905 21.360  1.00 24.82  ? 66  ARG B CB  1 
ATOM   2196 C CG  . ARG B 1 22  ? 13.345  -21.619 20.568  1.00 24.13  ? 66  ARG B CG  1 
ATOM   2197 C CD  . ARG B 1 22  ? 13.278  -21.242 19.104  1.00 23.23  ? 66  ARG B CD  1 
ATOM   2198 N NE  . ARG B 1 22  ? 14.413  -21.750 18.353  1.00 20.19  ? 66  ARG B NE  1 
ATOM   2199 C CZ  . ARG B 1 22  ? 14.699  -21.382 17.110  1.00 25.08  ? 66  ARG B CZ  1 
ATOM   2200 N NH1 . ARG B 1 22  ? 13.928  -20.504 16.482  1.00 25.69  ? 66  ARG B NH1 1 
ATOM   2201 N NH2 . ARG B 1 22  ? 15.760  -21.881 16.497  1.00 24.59  ? 66  ARG B NH2 1 
ATOM   2202 N N   . CYS B 1 23  ? 10.249  -20.281 23.744  1.00 24.76  ? 67  CYS B N   1 
ATOM   2203 C CA  . CYS B 1 23  ? 9.432   -19.310 24.444  1.00 26.72  ? 67  CYS B CA  1 
ATOM   2204 C C   . CYS B 1 23  ? 9.771   -19.341 25.924  1.00 27.71  ? 67  CYS B C   1 
ATOM   2205 O O   . CYS B 1 23  ? 9.847   -18.301 26.579  1.00 31.20  ? 67  CYS B O   1 
ATOM   2206 C CB  . CYS B 1 23  ? 7.953   -19.618 24.247  1.00 23.94  ? 67  CYS B CB  1 
ATOM   2207 S SG  . CYS B 1 23  ? 6.845   -18.445 25.089  1.00 27.78  ? 67  CYS B SG  1 
ATOM   2208 N N   . VAL B 1 24  ? 9.969   -20.543 26.450  1.00 27.00  ? 68  VAL B N   1 
ATOM   2209 C CA  . VAL B 1 24  ? 10.302  -20.701 27.855  1.00 21.84  ? 68  VAL B CA  1 
ATOM   2210 C C   . VAL B 1 24  ? 11.679  -20.104 28.122  1.00 21.88  ? 68  VAL B C   1 
ATOM   2211 O O   . VAL B 1 24  ? 11.886  -19.426 29.127  1.00 26.43  ? 68  VAL B O   1 
ATOM   2212 C CB  . VAL B 1 24  ? 10.279  -22.193 28.261  1.00 21.23  ? 68  VAL B CB  1 
ATOM   2213 C CG1 . VAL B 1 24  ? 10.887  -22.378 29.646  1.00 23.03  ? 68  VAL B CG1 1 
ATOM   2214 C CG2 . VAL B 1 24  ? 8.847   -22.698 28.260  1.00 12.28  ? 68  VAL B CG2 1 
ATOM   2215 N N   . LYS B 1 25  ? 12.612  -20.334 27.207  1.00 19.98  ? 69  LYS B N   1 
ATOM   2216 C CA  . LYS B 1 25  ? 13.969  -19.817 27.357  1.00 25.30  ? 69  LYS B CA  1 
ATOM   2217 C C   . LYS B 1 25  ? 14.037  -18.299 27.264  1.00 23.33  ? 69  LYS B C   1 
ATOM   2218 O O   . LYS B 1 25  ? 14.746  -17.656 28.035  1.00 22.32  ? 69  LYS B O   1 
ATOM   2219 C CB  . LYS B 1 25  ? 14.892  -20.438 26.297  1.00 30.35  ? 69  LYS B CB  1 
ATOM   2220 C CG  . LYS B 1 25  ? 16.306  -19.851 26.245  1.00 33.90  ? 69  LYS B CG  1 
ATOM   2221 C CD  . LYS B 1 25  ? 17.026  -19.894 27.594  1.00 41.18  ? 69  LYS B CD  1 
ATOM   2222 C CE  . LYS B 1 25  ? 17.253  -21.320 28.078  1.00 48.29  ? 69  LYS B CE  1 
ATOM   2223 N NZ  . LYS B 1 25  ? 18.096  -21.358 29.312  1.00 54.75  ? 69  LYS B NZ  1 
ATOM   2224 N N   . TYR B 1 26  ? 13.291  -17.734 26.318  1.00 27.43  ? 70  TYR B N   1 
ATOM   2225 C CA  . TYR B 1 26  ? 13.272  -16.292 26.102  1.00 21.68  ? 70  TYR B CA  1 
ATOM   2226 C C   . TYR B 1 26  ? 12.767  -15.523 27.317  1.00 27.49  ? 70  TYR B C   1 
ATOM   2227 O O   . TYR B 1 26  ? 13.366  -14.524 27.719  1.00 21.77  ? 70  TYR B O   1 
ATOM   2228 C CB  . TYR B 1 26  ? 12.384  -15.943 24.907  1.00 22.83  ? 70  TYR B CB  1 
ATOM   2229 C CG  . TYR B 1 26  ? 12.529  -14.505 24.480  1.00 21.98  ? 70  TYR B CG  1 
ATOM   2230 C CD1 . TYR B 1 26  ? 13.540  -14.117 23.599  1.00 18.01  ? 70  TYR B CD1 1 
ATOM   2231 C CD2 . TYR B 1 26  ? 11.707  -13.515 25.019  1.00 24.80  ? 70  TYR B CD2 1 
ATOM   2232 C CE1 . TYR B 1 26  ? 13.732  -12.774 23.271  1.00 24.34  ? 70  TYR B CE1 1 
ATOM   2233 C CE2 . TYR B 1 26  ? 11.892  -12.163 24.699  1.00 20.41  ? 70  TYR B CE2 1 
ATOM   2234 C CZ  . TYR B 1 26  ? 12.903  -11.802 23.829  1.00 23.78  ? 70  TYR B CZ  1 
ATOM   2235 O OH  . TYR B 1 26  ? 13.096  -10.473 23.534  1.00 25.93  ? 70  TYR B OH  1 
ATOM   2236 N N   . THR B 1 27  ? 11.656  -15.975 27.891  1.00 22.85  ? 71  THR B N   1 
ATOM   2237 C CA  . THR B 1 27  ? 11.091  -15.298 29.052  1.00 28.63  ? 71  THR B CA  1 
ATOM   2238 C C   . THR B 1 27  ? 11.963  -15.504 30.285  1.00 27.61  ? 71  THR B C   1 
ATOM   2239 O O   . THR B 1 27  ? 11.943  -14.701 31.218  1.00 34.89  ? 71  THR B O   1 
ATOM   2240 C CB  . THR B 1 27  ? 9.646   -15.772 29.339  1.00 22.43  ? 71  THR B CB  1 
ATOM   2241 O OG1 . THR B 1 27  ? 9.631   -17.184 29.561  1.00 26.25  ? 71  THR B OG1 1 
ATOM   2242 C CG2 . THR B 1 27  ? 8.743   -15.438 28.159  1.00 14.35  ? 71  THR B CG2 1 
ATOM   2243 N N   . GLU B 1 28  ? 12.739  -16.576 30.279  1.00 27.60  ? 72  GLU B N   1 
ATOM   2244 C CA  . GLU B 1 28  ? 13.635  -16.859 31.387  1.00 28.65  ? 72  GLU B CA  1 
ATOM   2245 C C   . GLU B 1 28  ? 14.788  -15.860 31.344  1.00 27.88  ? 72  GLU B C   1 
ATOM   2246 O O   . GLU B 1 28  ? 15.237  -15.360 32.380  1.00 20.36  ? 72  GLU B O   1 
ATOM   2247 C CB  . GLU B 1 28  ? 14.172  -18.285 31.272  1.00 30.62  ? 72  GLU B CB  1 
ATOM   2248 C CG  . GLU B 1 28  ? 15.195  -18.659 32.326  1.00 36.99  ? 72  GLU B CG  1 
ATOM   2249 C CD  . GLU B 1 28  ? 15.635  -20.108 32.208  1.00 49.91  ? 72  GLU B CD  1 
ATOM   2250 O OE1 . GLU B 1 28  ? 16.118  -20.494 31.120  1.00 42.86  ? 72  GLU B OE1 1 
ATOM   2251 O OE2 . GLU B 1 28  ? 15.497  -20.859 33.202  1.00 50.35  ? 72  GLU B OE2 1 
ATOM   2252 N N   . ILE B 1 29  ? 15.252  -15.567 30.132  1.00 28.09  ? 73  ILE B N   1 
ATOM   2253 C CA  . ILE B 1 29  ? 16.353  -14.629 29.930  1.00 29.82  ? 73  ILE B CA  1 
ATOM   2254 C C   . ILE B 1 29  ? 15.906  -13.174 30.042  1.00 28.10  ? 73  ILE B C   1 
ATOM   2255 O O   . ILE B 1 29  ? 16.633  -12.339 30.574  1.00 31.93  ? 73  ILE B O   1 
ATOM   2256 C CB  . ILE B 1 29  ? 17.004  -14.832 28.550  1.00 28.45  ? 73  ILE B CB  1 
ATOM   2257 C CG1 . ILE B 1 29  ? 17.686  -16.198 28.497  1.00 29.39  ? 73  ILE B CG1 1 
ATOM   2258 C CG2 . ILE B 1 29  ? 18.006  -13.724 28.276  1.00 30.02  ? 73  ILE B CG2 1 
ATOM   2259 C CD1 . ILE B 1 29  ? 18.268  -16.539 27.137  1.00 36.65  ? 73  ILE B CD1 1 
ATOM   2260 N N   . HIS B 1 30  ? 14.712  -12.883 29.532  1.00 26.79  ? 74  HIS B N   1 
ATOM   2261 C CA  . HIS B 1 30  ? 14.146  -11.532 29.557  1.00 25.39  ? 74  HIS B CA  1 
ATOM   2262 C C   . HIS B 1 30  ? 13.033  -11.471 30.583  1.00 25.06  ? 74  HIS B C   1 
ATOM   2263 O O   . HIS B 1 30  ? 11.868  -11.680 30.257  1.00 22.91  ? 74  HIS B O   1 
ATOM   2264 C CB  . HIS B 1 30  ? 13.574  -11.164 28.185  1.00 23.09  ? 74  HIS B CB  1 
ATOM   2265 C CG  . HIS B 1 30  ? 14.598  -11.119 27.096  1.00 29.63  ? 74  HIS B CG  1 
ATOM   2266 N ND1 . HIS B 1 30  ? 15.192  -9.947  26.681  1.00 34.05  ? 74  HIS B ND1 1 
ATOM   2267 C CD2 . HIS B 1 30  ? 15.156  -12.107 26.357  1.00 26.92  ? 74  HIS B CD2 1 
ATOM   2268 C CE1 . HIS B 1 30  ? 16.072  -10.214 25.733  1.00 33.26  ? 74  HIS B CE1 1 
ATOM   2269 N NE2 . HIS B 1 30  ? 16.070  -11.518 25.518  1.00 29.16  ? 74  HIS B NE2 1 
ATOM   2270 N N   . PRO B 1 31  ? 13.376  -11.178 31.843  1.00 27.77  ? 75  PRO B N   1 
ATOM   2271 C CA  . PRO B 1 31  ? 12.357  -11.103 32.891  1.00 30.19  ? 75  PRO B CA  1 
ATOM   2272 C C   . PRO B 1 31  ? 11.240  -10.098 32.644  1.00 22.79  ? 75  PRO B C   1 
ATOM   2273 O O   . PRO B 1 31  ? 10.151  -10.249 33.185  1.00 28.92  ? 75  PRO B O   1 
ATOM   2274 C CB  . PRO B 1 31  ? 13.174  -10.791 34.146  1.00 34.11  ? 75  PRO B CB  1 
ATOM   2275 C CG  . PRO B 1 31  ? 14.361  -10.070 33.611  1.00 39.98  ? 75  PRO B CG  1 
ATOM   2276 C CD  . PRO B 1 31  ? 14.707  -10.867 32.385  1.00 30.96  ? 75  PRO B CD  1 
ATOM   2277 N N   . GLU B 1 32  ? 11.493  -9.083  31.826  1.00 20.74  ? 76  GLU B N   1 
ATOM   2278 C CA  . GLU B 1 32  ? 10.464  -8.081  31.546  1.00 24.30  ? 76  GLU B CA  1 
ATOM   2279 C C   . GLU B 1 32  ? 9.285   -8.669  30.767  1.00 24.15  ? 76  GLU B C   1 
ATOM   2280 O O   . GLU B 1 32  ? 8.241   -8.032  30.632  1.00 25.64  ? 76  GLU B O   1 
ATOM   2281 C CB  . GLU B 1 32  ? 11.053  -6.893  30.765  1.00 23.59  ? 76  GLU B CB  1 
ATOM   2282 C CG  . GLU B 1 32  ? 11.442  -7.196  29.323  1.00 30.40  ? 76  GLU B CG  1 
ATOM   2283 C CD  . GLU B 1 32  ? 12.807  -7.855  29.189  1.00 30.03  ? 76  GLU B CD  1 
ATOM   2284 O OE1 . GLU B 1 32  ? 13.371  -8.303  30.215  1.00 27.43  ? 76  GLU B OE1 1 
ATOM   2285 O OE2 . GLU B 1 32  ? 13.311  -7.927  28.046  1.00 30.02  ? 76  GLU B OE2 1 
ATOM   2286 N N   . MET B 1 33  ? 9.460   -9.892  30.276  1.00 23.98  ? 77  MET B N   1 
ATOM   2287 C CA  . MET B 1 33  ? 8.436   -10.591 29.506  1.00 25.46  ? 77  MET B CA  1 
ATOM   2288 C C   . MET B 1 33  ? 7.795   -11.778 30.248  1.00 26.66  ? 77  MET B C   1 
ATOM   2289 O O   . MET B 1 33  ? 7.047   -12.552 29.643  1.00 25.48  ? 77  MET B O   1 
ATOM   2290 C CB  . MET B 1 33  ? 9.047   -11.095 28.193  1.00 22.19  ? 77  MET B CB  1 
ATOM   2291 C CG  . MET B 1 33  ? 9.508   -9.994  27.250  1.00 24.85  ? 77  MET B CG  1 
ATOM   2292 S SD  . MET B 1 33  ? 8.089   -9.117  26.592  1.00 32.87  ? 77  MET B SD  1 
ATOM   2293 C CE  . MET B 1 33  ? 7.711   -10.145 25.174  1.00 27.90  ? 77  MET B CE  1 
ATOM   2294 N N   . ARG B 1 34  ? 8.065   -11.899 31.550  1.00 25.89  ? 78  ARG B N   1 
ATOM   2295 C CA  . ARG B 1 34  ? 7.551   -13.010 32.370  1.00 27.91  ? 78  ARG B CA  1 
ATOM   2296 C C   . ARG B 1 34  ? 6.035   -13.154 32.433  1.00 25.48  ? 78  ARG B C   1 
ATOM   2297 O O   . ARG B 1 34  ? 5.539   -14.168 32.904  1.00 30.89  ? 78  ARG B O   1 
ATOM   2298 C CB  . ARG B 1 34  ? 8.080   -12.918 33.810  1.00 26.20  ? 78  ARG B CB  1 
ATOM   2299 C CG  . ARG B 1 34  ? 9.585   -13.096 33.976  1.00 28.73  ? 78  ARG B CG  1 
ATOM   2300 C CD  . ARG B 1 34  ? 10.036  -14.497 33.633  1.00 20.60  ? 78  ARG B CD  1 
ATOM   2301 N NE  . ARG B 1 34  ? 11.438  -14.723 33.980  1.00 33.11  ? 78  ARG B NE  1 
ATOM   2302 C CZ  . ARG B 1 34  ? 11.898  -14.879 35.221  1.00 35.88  ? 78  ARG B CZ  1 
ATOM   2303 N NH1 . ARG B 1 34  ? 11.071  -14.838 36.257  1.00 37.81  ? 78  ARG B NH1 1 
ATOM   2304 N NH2 . ARG B 1 34  ? 13.193  -15.077 35.427  1.00 35.77  ? 78  ARG B NH2 1 
ATOM   2305 N N   . HIS B 1 35  ? 5.303   -12.144 31.977  1.00 29.72  ? 79  HIS B N   1 
ATOM   2306 C CA  . HIS B 1 35  ? 3.836   -12.196 31.988  1.00 34.37  ? 79  HIS B CA  1 
ATOM   2307 C C   . HIS B 1 35  ? 3.310   -13.066 30.846  1.00 33.47  ? 79  HIS B C   1 
ATOM   2308 O O   . HIS B 1 35  ? 2.120   -13.365 30.772  1.00 32.47  ? 79  HIS B O   1 
ATOM   2309 C CB  . HIS B 1 35  ? 3.257   -10.794 31.825  1.00 25.80  ? 79  HIS B CB  1 
ATOM   2310 C CG  . HIS B 1 35  ? 3.659   -10.136 30.544  1.00 30.03  ? 79  HIS B CG  1 
ATOM   2311 N ND1 . HIS B 1 35  ? 4.875   -9.509  30.380  1.00 26.82  ? 79  HIS B ND1 1 
ATOM   2312 C CD2 . HIS B 1 35  ? 3.035   -10.068 29.343  1.00 31.75  ? 79  HIS B CD2 1 
ATOM   2313 C CE1 . HIS B 1 35  ? 4.984   -9.082  29.134  1.00 33.78  ? 79  HIS B CE1 1 
ATOM   2314 N NE2 . HIS B 1 35  ? 3.881   -9.410  28.484  1.00 30.40  ? 79  HIS B NE2 1 
ATOM   2315 N N   . VAL B 1 36  ? 4.202   -13.459 29.947  1.00 35.55  ? 80  VAL B N   1 
ATOM   2316 C CA  . VAL B 1 36  ? 3.810   -14.269 28.804  1.00 31.55  ? 80  VAL B CA  1 
ATOM   2317 C C   . VAL B 1 36  ? 3.536   -15.723 29.163  1.00 30.63  ? 80  VAL B C   1 
ATOM   2318 O O   . VAL B 1 36  ? 4.335   -16.369 29.846  1.00 29.44  ? 80  VAL B O   1 
ATOM   2319 C CB  . VAL B 1 36  ? 4.903   -14.236 27.699  1.00 33.10  ? 80  VAL B CB  1 
ATOM   2320 C CG1 . VAL B 1 36  ? 4.525   -15.159 26.545  1.00 28.39  ? 80  VAL B CG1 1 
ATOM   2321 C CG2 . VAL B 1 36  ? 5.089   -12.814 27.194  1.00 30.86  ? 80  VAL B CG2 1 
ATOM   2322 N N   . ASP B 1 37  ? 2.391   -16.225 28.708  1.00 26.65  ? 81  ASP B N   1 
ATOM   2323 C CA  . ASP B 1 37  ? 2.025   -17.620 28.924  1.00 29.97  ? 81  ASP B CA  1 
ATOM   2324 C C   . ASP B 1 37  ? 2.422   -18.324 27.631  1.00 26.62  ? 81  ASP B C   1 
ATOM   2325 O O   . ASP B 1 37  ? 1.775   -18.167 26.601  1.00 30.06  ? 81  ASP B O   1 
ATOM   2326 C CB  . ASP B 1 37  ? 0.518   -17.761 29.165  1.00 34.04  ? 81  ASP B CB  1 
ATOM   2327 C CG  . ASP B 1 37  ? 0.069   -19.214 29.245  1.00 38.98  ? 81  ASP B CG  1 
ATOM   2328 O OD1 . ASP B 1 37  ? -1.053  -19.455 29.736  1.00 52.26  ? 81  ASP B OD1 1 
ATOM   2329 O OD2 . ASP B 1 37  ? 0.819   -20.116 28.814  1.00 44.16  ? 81  ASP B OD2 1 
ATOM   2330 N N   . CYS B 1 38  ? 3.497   -19.091 27.688  1.00 24.82  ? 82  CYS B N   1 
ATOM   2331 C CA  . CYS B 1 38  ? 3.990   -19.773 26.510  1.00 29.09  ? 82  CYS B CA  1 
ATOM   2332 C C   . CYS B 1 38  ? 3.031   -20.796 25.924  1.00 33.67  ? 82  CYS B C   1 
ATOM   2333 O O   . CYS B 1 38  ? 3.035   -21.038 24.715  1.00 34.96  ? 82  CYS B O   1 
ATOM   2334 C CB  . CYS B 1 38  ? 5.343   -20.412 26.816  1.00 29.49  ? 82  CYS B CB  1 
ATOM   2335 S SG  . CYS B 1 38  ? 6.699   -19.200 26.972  1.00 33.03  ? 82  CYS B SG  1 
ATOM   2336 N N   . GLN B 1 39  ? 2.204   -21.397 26.761  1.00 26.06  ? 83  GLN B N   1 
ATOM   2337 C CA  . GLN B 1 39  ? 1.260   -22.370 26.242  1.00 31.95  ? 83  GLN B CA  1 
ATOM   2338 C C   . GLN B 1 39  ? 0.341   -21.619 25.288  1.00 34.28  ? 83  GLN B C   1 
ATOM   2339 O O   . GLN B 1 39  ? 0.065   -22.075 24.179  1.00 33.89  ? 83  GLN B O   1 
ATOM   2340 C CB  . GLN B 1 39  ? 0.440   -22.981 27.376  1.00 34.29  ? 83  GLN B CB  1 
ATOM   2341 C CG  . GLN B 1 39  ? 0.333   -24.492 27.315  1.00 40.99  ? 83  GLN B CG  1 
ATOM   2342 C CD  . GLN B 1 39  ? -1.106  -24.978 27.284  1.00 50.21  ? 83  GLN B CD  1 
ATOM   2343 O OE1 . GLN B 1 39  ? -1.968  -24.477 28.013  1.00 52.32  ? 83  GLN B OE1 1 
ATOM   2344 N NE2 . GLN B 1 39  ? -1.369  -25.971 26.447  1.00 54.76  ? 83  GLN B NE2 1 
ATOM   2345 N N   . SER B 1 40  ? -0.123  -20.457 25.733  1.00 31.43  ? 84  SER B N   1 
ATOM   2346 C CA  . SER B 1 40  ? -1.013  -19.625 24.934  1.00 36.61  ? 84  SER B CA  1 
ATOM   2347 C C   . SER B 1 40  ? -0.353  -19.220 23.628  1.00 32.20  ? 84  SER B C   1 
ATOM   2348 O O   . SER B 1 40  ? -0.944  -19.335 22.557  1.00 29.36  ? 84  SER B O   1 
ATOM   2349 C CB  . SER B 1 40  ? -1.403  -18.370 25.720  1.00 40.34  ? 84  SER B CB  1 
ATOM   2350 O OG  . SER B 1 40  ? -2.229  -18.702 26.826  1.00 45.43  ? 84  SER B OG  1 
ATOM   2351 N N   . VAL B 1 41  ? 0.878   -18.740 23.733  1.00 28.50  ? 85  VAL B N   1 
ATOM   2352 C CA  . VAL B 1 41  ? 1.638   -18.313 22.574  1.00 30.16  ? 85  VAL B CA  1 
ATOM   2353 C C   . VAL B 1 41  ? 1.650   -19.407 21.510  1.00 30.21  ? 85  VAL B C   1 
ATOM   2354 O O   . VAL B 1 41  ? 1.369   -19.147 20.338  1.00 26.66  ? 85  VAL B O   1 
ATOM   2355 C CB  . VAL B 1 41  ? 3.084   -17.966 22.986  1.00 27.24  ? 85  VAL B CB  1 
ATOM   2356 C CG1 . VAL B 1 41  ? 3.957   -17.767 21.760  1.00 25.16  ? 85  VAL B CG1 1 
ATOM   2357 C CG2 . VAL B 1 41  ? 3.071   -16.719 23.832  1.00 31.98  ? 85  VAL B CG2 1 
ATOM   2358 N N   . TRP B 1 42  ? 1.975   -20.627 21.930  1.00 30.52  ? 86  TRP B N   1 
ATOM   2359 C CA  . TRP B 1 42  ? 2.016   -21.764 21.021  1.00 32.00  ? 86  TRP B CA  1 
ATOM   2360 C C   . TRP B 1 42  ? 0.670   -21.932 20.336  1.00 35.05  ? 86  TRP B C   1 
ATOM   2361 O O   . TRP B 1 42  ? 0.609   -22.065 19.116  1.00 38.09  ? 86  TRP B O   1 
ATOM   2362 C CB  . TRP B 1 42  ? 2.362   -23.047 21.778  1.00 33.98  ? 86  TRP B CB  1 
ATOM   2363 C CG  . TRP B 1 42  ? 2.302   -24.282 20.922  1.00 34.68  ? 86  TRP B CG  1 
ATOM   2364 C CD1 . TRP B 1 42  ? 1.666   -25.448 21.219  1.00 34.33  ? 86  TRP B CD1 1 
ATOM   2365 C CD2 . TRP B 1 42  ? 2.886   -24.463 19.624  1.00 33.35  ? 86  TRP B CD2 1 
ATOM   2366 N NE1 . TRP B 1 42  ? 1.810   -26.346 20.189  1.00 36.01  ? 86  TRP B NE1 1 
ATOM   2367 C CE2 . TRP B 1 42  ? 2.555   -25.768 19.197  1.00 27.80  ? 86  TRP B CE2 1 
ATOM   2368 C CE3 . TRP B 1 42  ? 3.654   -23.648 18.780  1.00 32.48  ? 86  TRP B CE3 1 
ATOM   2369 C CZ2 . TRP B 1 42  ? 2.962   -26.282 17.962  1.00 29.78  ? 86  TRP B CZ2 1 
ATOM   2370 C CZ3 . TRP B 1 42  ? 4.063   -24.160 17.546  1.00 36.14  ? 86  TRP B CZ3 1 
ATOM   2371 C CH2 . TRP B 1 42  ? 3.713   -25.467 17.150  1.00 36.24  ? 86  TRP B CH2 1 
ATOM   2372 N N   . ASP B 1 43  ? -0.404  -21.923 21.122  1.00 34.53  ? 87  ASP B N   1 
ATOM   2373 C CA  . ASP B 1 43  ? -1.748  -22.077 20.572  1.00 39.04  ? 87  ASP B CA  1 
ATOM   2374 C C   . ASP B 1 43  ? -2.013  -21.051 19.495  1.00 34.74  ? 87  ASP B C   1 
ATOM   2375 O O   . ASP B 1 43  ? -2.395  -21.403 18.385  1.00 34.69  ? 87  ASP B O   1 
ATOM   2376 C CB  . ASP B 1 43  ? -2.820  -21.932 21.656  1.00 40.62  ? 87  ASP B CB  1 
ATOM   2377 C CG  . ASP B 1 43  ? -3.050  -23.211 22.421  1.00 47.56  ? 87  ASP B CG  1 
ATOM   2378 O OD1 . ASP B 1 43  ? -3.089  -24.280 21.777  1.00 48.77  ? 87  ASP B OD1 1 
ATOM   2379 O OD2 . ASP B 1 43  ? -3.205  -23.146 23.661  1.00 57.32  ? 87  ASP B OD2 1 
ATOM   2380 N N   . ALA B 1 44  ? -1.820  -19.781 19.838  1.00 33.87  ? 88  ALA B N   1 
ATOM   2381 C CA  . ALA B 1 44  ? -2.036  -18.685 18.901  1.00 32.30  ? 88  ALA B CA  1 
ATOM   2382 C C   . ALA B 1 44  ? -1.232  -18.933 17.630  1.00 28.63  ? 88  ALA B C   1 
ATOM   2383 O O   . ALA B 1 44  ? -1.747  -18.818 16.519  1.00 32.48  ? 88  ALA B O   1 
ATOM   2384 C CB  . ALA B 1 44  ? -1.622  -17.360 19.544  1.00 28.65  ? 88  ALA B CB  1 
ATOM   2385 N N   . PHE B 1 45  ? 0.033   -19.282 17.811  1.00 25.63  ? 89  PHE B N   1 
ATOM   2386 C CA  . PHE B 1 45  ? 0.932   -19.564 16.701  1.00 32.03  ? 89  PHE B CA  1 
ATOM   2387 C C   . PHE B 1 45  ? 0.359   -20.694 15.834  1.00 35.69  ? 89  PHE B C   1 
ATOM   2388 O O   . PHE B 1 45  ? 0.283   -20.589 14.609  1.00 38.20  ? 89  PHE B O   1 
ATOM   2389 C CB  . PHE B 1 45  ? 2.288   -19.999 17.256  1.00 25.02  ? 89  PHE B CB  1 
ATOM   2390 C CG  . PHE B 1 45  ? 3.421   -19.853 16.291  1.00 27.09  ? 89  PHE B CG  1 
ATOM   2391 C CD1 . PHE B 1 45  ? 3.220   -19.994 14.921  1.00 33.22  ? 89  PHE B CD1 1 
ATOM   2392 C CD2 . PHE B 1 45  ? 4.704   -19.598 16.757  1.00 23.93  ? 89  PHE B CD2 1 
ATOM   2393 C CE1 . PHE B 1 45  ? 4.284   -19.882 14.031  1.00 36.30  ? 89  PHE B CE1 1 
ATOM   2394 C CE2 . PHE B 1 45  ? 5.771   -19.485 15.878  1.00 29.86  ? 89  PHE B CE2 1 
ATOM   2395 C CZ  . PHE B 1 45  ? 5.563   -19.626 14.512  1.00 31.10  ? 89  PHE B CZ  1 
ATOM   2396 N N   . LYS B 1 46  ? -0.028  -21.777 16.494  1.00 36.89  ? 90  LYS B N   1 
ATOM   2397 C CA  . LYS B 1 46  ? -0.588  -22.953 15.841  1.00 33.62  ? 90  LYS B CA  1 
ATOM   2398 C C   . LYS B 1 46  ? -1.883  -22.584 15.128  1.00 35.51  ? 90  LYS B C   1 
ATOM   2399 O O   . LYS B 1 46  ? -2.117  -22.978 13.982  1.00 35.95  ? 90  LYS B O   1 
ATOM   2400 C CB  . LYS B 1 46  ? -0.852  -24.027 16.897  1.00 37.59  ? 90  LYS B CB  1 
ATOM   2401 C CG  . LYS B 1 46  ? -0.965  -25.442 16.368  1.00 48.19  ? 90  LYS B CG  1 
ATOM   2402 C CD  . LYS B 1 46  ? -0.960  -26.462 17.505  1.00 50.74  ? 90  LYS B CD  1 
ATOM   2403 C CE  . LYS B 1 46  ? -2.133  -26.268 18.455  1.00 48.95  ? 90  LYS B CE  1 
ATOM   2404 N NZ  . LYS B 1 46  ? -2.177  -27.341 19.485  1.00 50.14  ? 90  LYS B NZ  1 
ATOM   2405 N N   . GLY B 1 47  ? -2.716  -21.811 15.812  1.00 31.71  ? 91  GLY B N   1 
ATOM   2406 C CA  . GLY B 1 47  ? -3.980  -21.405 15.234  1.00 35.29  ? 91  GLY B CA  1 
ATOM   2407 C C   . GLY B 1 47  ? -3.843  -20.623 13.940  1.00 36.72  ? 91  GLY B C   1 
ATOM   2408 O O   . GLY B 1 47  ? -4.765  -20.588 13.131  1.00 40.21  ? 91  GLY B O   1 
ATOM   2409 N N   . ALA B 1 48  ? -2.692  -20.001 13.729  1.00 31.48  ? 92  ALA B N   1 
ATOM   2410 C CA  . ALA B 1 48  ? -2.489  -19.207 12.527  1.00 35.25  ? 92  ALA B CA  1 
ATOM   2411 C C   . ALA B 1 48  ? -2.479  -20.026 11.238  1.00 37.35  ? 92  ALA B C   1 
ATOM   2412 O O   . ALA B 1 48  ? -2.976  -19.567 10.207  1.00 40.93  ? 92  ALA B O   1 
ATOM   2413 C CB  . ALA B 1 48  ? -1.189  -18.412 12.642  1.00 27.25  ? 92  ALA B CB  1 
ATOM   2414 N N   . PHE B 1 49  ? -1.934  -21.239 11.295  1.00 31.50  ? 93  PHE B N   1 
ATOM   2415 C CA  . PHE B 1 49  ? -1.830  -22.054 10.094  1.00 31.92  ? 93  PHE B CA  1 
ATOM   2416 C C   . PHE B 1 49  ? -2.396  -23.471 10.149  1.00 34.70  ? 93  PHE B C   1 
ATOM   2417 O O   . PHE B 1 49  ? -2.616  -24.080 9.102   1.00 34.92  ? 93  PHE B O   1 
ATOM   2418 C CB  . PHE B 1 49  ? -0.370  -22.119 9.667   1.00 25.53  ? 93  PHE B CB  1 
ATOM   2419 C CG  . PHE B 1 49  ? 0.474   -22.949 10.569  1.00 31.84  ? 93  PHE B CG  1 
ATOM   2420 C CD1 . PHE B 1 49  ? 0.795   -24.257 10.228  1.00 29.06  ? 93  PHE B CD1 1 
ATOM   2421 C CD2 . PHE B 1 49  ? 0.911   -22.444 11.791  1.00 34.57  ? 93  PHE B CD2 1 
ATOM   2422 C CE1 . PHE B 1 49  ? 1.540   -25.054 11.094  1.00 30.35  ? 93  PHE B CE1 1 
ATOM   2423 C CE2 . PHE B 1 49  ? 1.654   -23.231 12.661  1.00 28.00  ? 93  PHE B CE2 1 
ATOM   2424 C CZ  . PHE B 1 49  ? 1.969   -24.536 12.313  1.00 33.74  ? 93  PHE B CZ  1 
ATOM   2425 N N   . ILE B 1 50  ? -2.621  -24.005 11.346  1.00 35.19  ? 94  ILE B N   1 
ATOM   2426 C CA  . ILE B 1 50  ? -3.171  -25.358 11.465  1.00 37.50  ? 94  ILE B CA  1 
ATOM   2427 C C   . ILE B 1 50  ? -4.593  -25.446 10.900  1.00 36.55  ? 94  ILE B C   1 
ATOM   2428 O O   . ILE B 1 50  ? -5.414  -24.541 11.094  1.00 31.78  ? 94  ILE B O   1 
ATOM   2429 C CB  . ILE B 1 50  ? -3.181  -25.838 12.943  1.00 37.54  ? 94  ILE B CB  1 
ATOM   2430 C CG1 . ILE B 1 50  ? -1.789  -26.334 13.337  1.00 41.90  ? 94  ILE B CG1 1 
ATOM   2431 C CG2 . ILE B 1 50  ? -4.203  -26.952 13.143  1.00 36.60  ? 94  ILE B CG2 1 
ATOM   2432 C CD1 . ILE B 1 50  ? -1.339  -27.593 12.604  1.00 41.52  ? 94  ILE B CD1 1 
ATOM   2433 N N   . SER B 1 51  ? -4.865  -26.543 10.195  1.00 36.14  ? 95  SER B N   1 
ATOM   2434 C CA  . SER B 1 51  ? -6.175  -26.793 9.591   1.00 41.01  ? 95  SER B CA  1 
ATOM   2435 C C   . SER B 1 51  ? -6.530  -25.816 8.461   1.00 41.14  ? 95  SER B C   1 
ATOM   2436 O O   . SER B 1 51  ? -7.700  -25.677 8.091   1.00 40.21  ? 95  SER B O   1 
ATOM   2437 C CB  . SER B 1 51  ? -7.260  -26.755 10.672  1.00 38.64  ? 95  SER B CB  1 
ATOM   2438 O OG  . SER B 1 51  ? -8.508  -27.175 10.154  1.00 41.81  ? 95  SER B OG  1 
ATOM   2439 N N   . LYS B 1 52  ? -5.514  -25.150 7.915   1.00 35.36  ? 96  LYS B N   1 
ATOM   2440 C CA  . LYS B 1 52  ? -5.704  -24.182 6.840   1.00 32.27  ? 96  LYS B CA  1 
ATOM   2441 C C   . LYS B 1 52  ? -4.813  -24.503 5.651   1.00 33.23  ? 96  LYS B C   1 
ATOM   2442 O O   . LYS B 1 52  ? -3.710  -25.023 5.813   1.00 29.65  ? 96  LYS B O   1 
ATOM   2443 C CB  . LYS B 1 52  ? -5.394  -22.770 7.342   1.00 31.12  ? 96  LYS B CB  1 
ATOM   2444 C CG  . LYS B 1 52  ? -6.346  -22.291 8.411   1.00 36.80  ? 96  LYS B CG  1 
ATOM   2445 C CD  . LYS B 1 52  ? -5.881  -20.991 9.064   1.00 42.91  ? 96  LYS B CD  1 
ATOM   2446 C CE  . LYS B 1 52  ? -6.765  -20.661 10.270  1.00 44.29  ? 96  LYS B CE  1 
ATOM   2447 N NZ  . LYS B 1 52  ? -6.265  -19.511 11.071  1.00 43.92  ? 96  LYS B NZ  1 
ATOM   2448 N N   . HIS B 1 53  ? -5.297  -24.199 4.451   1.00 30.88  ? 97  HIS B N   1 
ATOM   2449 C CA  . HIS B 1 53  ? -4.517  -24.457 3.250   1.00 28.43  ? 97  HIS B CA  1 
ATOM   2450 C C   . HIS B 1 53  ? -3.296  -23.543 3.316   1.00 22.26  ? 97  HIS B C   1 
ATOM   2451 O O   . HIS B 1 53  ? -3.432  -22.332 3.368   1.00 22.27  ? 97  HIS B O   1 
ATOM   2452 C CB  . HIS B 1 53  ? -5.340  -24.153 1.990   1.00 26.47  ? 97  HIS B CB  1 
ATOM   2453 C CG  . HIS B 1 53  ? -4.705  -24.660 0.733   1.00 32.51  ? 97  HIS B CG  1 
ATOM   2454 N ND1 . HIS B 1 53  ? -4.653  -26.001 0.418   1.00 30.37  ? 97  HIS B ND1 1 
ATOM   2455 C CD2 . HIS B 1 53  ? -4.017  -24.019 -0.242  1.00 33.73  ? 97  HIS B CD2 1 
ATOM   2456 C CE1 . HIS B 1 53  ? -3.958  -26.164 -0.694  1.00 36.62  ? 97  HIS B CE1 1 
ATOM   2457 N NE2 . HIS B 1 53  ? -3.560  -24.977 -1.115  1.00 36.44  ? 97  HIS B NE2 1 
ATOM   2458 N N   . PRO B 1 54  ? -2.085  -24.120 3.302   1.00 31.72  ? 98  PRO B N   1 
ATOM   2459 C CA  . PRO B 1 54  ? -0.808  -23.389 3.372   1.00 25.40  ? 98  PRO B CA  1 
ATOM   2460 C C   . PRO B 1 54  ? -0.472  -22.425 2.230   1.00 29.79  ? 98  PRO B C   1 
ATOM   2461 O O   . PRO B 1 54  ? 0.694   -22.078 2.032   1.00 27.52  ? 98  PRO B O   1 
ATOM   2462 C CB  . PRO B 1 54  ? 0.214   -24.514 3.486   1.00 27.98  ? 98  PRO B CB  1 
ATOM   2463 C CG  . PRO B 1 54  ? -0.398  -25.593 2.638   1.00 22.68  ? 98  PRO B CG  1 
ATOM   2464 C CD  . PRO B 1 54  ? -1.847  -25.563 3.093   1.00 28.57  ? 98  PRO B CD  1 
ATOM   2465 N N   . CYS B 1 55  ? -1.481  -22.006 1.474   1.00 27.37  ? 99  CYS B N   1 
ATOM   2466 C CA  . CYS B 1 55  ? -1.269  -21.070 0.371   1.00 35.03  ? 99  CYS B CA  1 
ATOM   2467 C C   . CYS B 1 55  ? -2.303  -19.959 0.461   1.00 36.64  ? 99  CYS B C   1 
ATOM   2468 O O   . CYS B 1 55  ? -2.468  -19.169 -0.472  1.00 36.50  ? 99  CYS B O   1 
ATOM   2469 C CB  . CYS B 1 55  ? -1.406  -21.770 -0.987  1.00 37.81  ? 99  CYS B CB  1 
ATOM   2470 S SG  . CYS B 1 55  ? 0.102   -22.568 -1.624  1.00 45.92  ? 99  CYS B SG  1 
ATOM   2471 N N   . ASN B 1 56  ? -2.998  -19.910 1.592   1.00 35.32  ? 100 ASN B N   1 
ATOM   2472 C CA  . ASN B 1 56  ? -4.037  -18.915 1.818   1.00 41.23  ? 100 ASN B CA  1 
ATOM   2473 C C   . ASN B 1 56  ? -3.960  -18.330 3.225   1.00 39.43  ? 100 ASN B C   1 
ATOM   2474 O O   . ASN B 1 56  ? -4.981  -18.022 3.843   1.00 41.71  ? 100 ASN B O   1 
ATOM   2475 C CB  . ASN B 1 56  ? -5.411  -19.546 1.577   1.00 38.38  ? 100 ASN B CB  1 
ATOM   2476 C CG  . ASN B 1 56  ? -5.616  -19.945 0.127   1.00 54.15  ? 100 ASN B CG  1 
ATOM   2477 O OD1 . ASN B 1 56  ? -5.818  -19.094 -0.745  1.00 59.92  ? 100 ASN B OD1 1 
ATOM   2478 N ND2 . ASN B 1 56  ? -5.549  -21.241 -0.144  1.00 55.49  ? 100 ASN B ND2 1 
ATOM   2479 N N   . ILE B 1 57  ? -2.738  -18.181 3.728   1.00 39.15  ? 101 ILE B N   1 
ATOM   2480 C CA  . ILE B 1 57  ? -2.530  -17.619 5.054   1.00 33.40  ? 101 ILE B CA  1 
ATOM   2481 C C   . ILE B 1 57  ? -2.523  -16.105 4.924   1.00 34.80  ? 101 ILE B C   1 
ATOM   2482 O O   . ILE B 1 57  ? -1.888  -15.550 4.025   1.00 32.53  ? 101 ILE B O   1 
ATOM   2483 C CB  . ILE B 1 57  ? -1.186  -18.057 5.655   1.00 35.66  ? 101 ILE B CB  1 
ATOM   2484 C CG1 . ILE B 1 57  ? -1.055  -19.582 5.604   1.00 35.16  ? 101 ILE B CG1 1 
ATOM   2485 C CG2 . ILE B 1 57  ? -1.082  -17.552 7.086   1.00 36.31  ? 101 ILE B CG2 1 
ATOM   2486 C CD1 . ILE B 1 57  ? -2.209  -20.321 6.269   1.00 40.23  ? 101 ILE B CD1 1 
ATOM   2487 N N   . THR B 1 58  ? -3.230  -15.436 5.822   1.00 31.44  ? 102 THR B N   1 
ATOM   2488 C CA  . THR B 1 58  ? -3.298  -13.984 5.787   1.00 36.47  ? 102 THR B CA  1 
ATOM   2489 C C   . THR B 1 58  ? -2.649  -13.427 7.047   1.00 34.06  ? 102 THR B C   1 
ATOM   2490 O O   . THR B 1 58  ? -2.436  -14.161 8.009   1.00 35.32  ? 102 THR B O   1 
ATOM   2491 C CB  . THR B 1 58  ? -4.757  -13.513 5.732   1.00 35.73  ? 102 THR B CB  1 
ATOM   2492 O OG1 . THR B 1 58  ? -5.347  -13.641 7.030   1.00 41.04  ? 102 THR B OG1 1 
ATOM   2493 C CG2 . THR B 1 58  ? -5.546  -14.370 4.758   1.00 32.15  ? 102 THR B CG2 1 
ATOM   2494 N N   . GLU B 1 59  ? -2.335  -12.134 7.037   1.00 37.41  ? 103 GLU B N   1 
ATOM   2495 C CA  . GLU B 1 59  ? -1.726  -11.487 8.194   1.00 39.34  ? 103 GLU B CA  1 
ATOM   2496 C C   . GLU B 1 59  ? -2.603  -11.648 9.431   1.00 37.16  ? 103 GLU B C   1 
ATOM   2497 O O   . GLU B 1 59  ? -2.109  -11.946 10.516  1.00 36.48  ? 103 GLU B O   1 
ATOM   2498 C CB  . GLU B 1 59  ? -1.491  -9.993  7.925   1.00 43.78  ? 103 GLU B CB  1 
ATOM   2499 C CG  . GLU B 1 59  ? -0.266  -9.694  7.063   1.00 62.00  ? 103 GLU B CG  1 
ATOM   2500 C CD  . GLU B 1 59  ? -0.615  -9.300  5.636   1.00 72.36  ? 103 GLU B CD  1 
ATOM   2501 O OE1 . GLU B 1 59  ? -1.047  -8.144  5.419   1.00 75.11  ? 103 GLU B OE1 1 
ATOM   2502 O OE2 . GLU B 1 59  ? -0.460  -10.149 4.731   1.00 78.30  ? 103 GLU B OE2 1 
ATOM   2503 N N   . GLU B 1 60  ? -3.908  -11.463 9.263   1.00 38.75  ? 104 GLU B N   1 
ATOM   2504 C CA  . GLU B 1 60  ? -4.825  -11.585 10.385  1.00 44.90  ? 104 GLU B CA  1 
ATOM   2505 C C   . GLU B 1 60  ? -4.813  -12.965 11.023  1.00 43.71  ? 104 GLU B C   1 
ATOM   2506 O O   . GLU B 1 60  ? -5.190  -13.116 12.184  1.00 44.59  ? 104 GLU B O   1 
ATOM   2507 C CB  . GLU B 1 60  ? -6.244  -11.204 9.961   1.00 52.90  ? 104 GLU B CB  1 
ATOM   2508 C CG  . GLU B 1 60  ? -6.507  -9.706  10.056  1.00 68.68  ? 104 GLU B CG  1 
ATOM   2509 C CD  . GLU B 1 60  ? -7.930  -9.326  9.684   1.00 77.46  ? 104 GLU B CD  1 
ATOM   2510 O OE1 . GLU B 1 60  ? -8.314  -8.155  9.912   1.00 76.49  ? 104 GLU B OE1 1 
ATOM   2511 O OE2 . GLU B 1 60  ? -8.662  -10.194 9.159   1.00 79.67  ? 104 GLU B OE2 1 
ATOM   2512 N N   . ASP B 1 61  ? -4.386  -13.976 10.276  1.00 42.42  ? 105 ASP B N   1 
ATOM   2513 C CA  . ASP B 1 61  ? -4.316  -15.315 10.844  1.00 38.10  ? 105 ASP B CA  1 
ATOM   2514 C C   . ASP B 1 61  ? -3.300  -15.261 11.984  1.00 39.59  ? 105 ASP B C   1 
ATOM   2515 O O   . ASP B 1 61  ? -3.386  -16.030 12.939  1.00 38.01  ? 105 ASP B O   1 
ATOM   2516 C CB  . ASP B 1 61  ? -3.850  -16.339 9.801   1.00 43.58  ? 105 ASP B CB  1 
ATOM   2517 C CG  . ASP B 1 61  ? -4.911  -16.649 8.758   1.00 43.94  ? 105 ASP B CG  1 
ATOM   2518 O OD1 . ASP B 1 61  ? -6.052  -16.971 9.149   1.00 38.33  ? 105 ASP B OD1 1 
ATOM   2519 O OD2 . ASP B 1 61  ? -4.601  -16.584 7.550   1.00 45.59  ? 105 ASP B OD2 1 
ATOM   2520 N N   . TYR B 1 62  ? -2.341  -14.345 11.875  1.00 31.46  ? 106 TYR B N   1 
ATOM   2521 C CA  . TYR B 1 62  ? -1.307  -14.198 12.890  1.00 39.78  ? 106 TYR B CA  1 
ATOM   2522 C C   . TYR B 1 62  ? -1.604  -13.155 13.957  1.00 45.31  ? 106 TYR B C   1 
ATOM   2523 O O   . TYR B 1 62  ? -0.804  -12.977 14.882  1.00 46.72  ? 106 TYR B O   1 
ATOM   2524 C CB  . TYR B 1 62  ? 0.046   -13.864 12.249  1.00 34.81  ? 106 TYR B CB  1 
ATOM   2525 C CG  . TYR B 1 62  ? 0.761   -15.065 11.670  1.00 37.12  ? 106 TYR B CG  1 
ATOM   2526 C CD1 . TYR B 1 62  ? 0.631   -15.400 10.317  1.00 30.49  ? 106 TYR B CD1 1 
ATOM   2527 C CD2 . TYR B 1 62  ? 1.544   -15.891 12.484  1.00 30.35  ? 106 TYR B CD2 1 
ATOM   2528 C CE1 . TYR B 1 62  ? 1.268   -16.534 9.791   1.00 31.75  ? 106 TYR B CE1 1 
ATOM   2529 C CE2 . TYR B 1 62  ? 2.175   -17.023 11.972  1.00 27.34  ? 106 TYR B CE2 1 
ATOM   2530 C CZ  . TYR B 1 62  ? 2.036   -17.339 10.626  1.00 31.81  ? 106 TYR B CZ  1 
ATOM   2531 O OH  . TYR B 1 62  ? 2.660   -18.455 10.118  1.00 27.37  ? 106 TYR B OH  1 
ATOM   2532 N N   . GLN B 1 63  ? -2.739  -12.466 13.837  1.00 42.23  ? 107 GLN B N   1 
ATOM   2533 C CA  . GLN B 1 63  ? -3.092  -11.440 14.813  1.00 40.69  ? 107 GLN B CA  1 
ATOM   2534 C C   . GLN B 1 63  ? -2.976  -11.922 16.255  1.00 37.97  ? 107 GLN B C   1 
ATOM   2535 O O   . GLN B 1 63  ? -2.261  -11.321 17.053  1.00 38.37  ? 107 GLN B O   1 
ATOM   2536 C CB  . GLN B 1 63  ? -4.502  -10.896 14.552  1.00 43.74  ? 107 GLN B CB  1 
ATOM   2537 C CG  . GLN B 1 63  ? -4.534  -9.777  13.528  1.00 55.30  ? 107 GLN B CG  1 
ATOM   2538 C CD  . GLN B 1 63  ? -3.481  -8.712  13.811  1.00 62.84  ? 107 GLN B CD  1 
ATOM   2539 O OE1 . GLN B 1 63  ? -3.401  -8.182  14.925  1.00 59.71  ? 107 GLN B OE1 1 
ATOM   2540 N NE2 . GLN B 1 63  ? -2.665  -8.394  12.801  1.00 56.89  ? 107 GLN B NE2 1 
ATOM   2541 N N   . PRO B 1 64  ? -3.673  -13.012 16.608  1.00 32.81  ? 108 PRO B N   1 
ATOM   2542 C CA  . PRO B 1 64  ? -3.602  -13.529 17.977  1.00 32.26  ? 108 PRO B CA  1 
ATOM   2543 C C   . PRO B 1 64  ? -2.165  -13.677 18.492  1.00 34.07  ? 108 PRO B C   1 
ATOM   2544 O O   . PRO B 1 64  ? -1.847  -13.216 19.585  1.00 36.36  ? 108 PRO B O   1 
ATOM   2545 C CB  . PRO B 1 64  ? -4.329  -14.863 17.871  1.00 35.50  ? 108 PRO B CB  1 
ATOM   2546 C CG  . PRO B 1 64  ? -5.401  -14.552 16.853  1.00 35.87  ? 108 PRO B CG  1 
ATOM   2547 C CD  . PRO B 1 64  ? -4.612  -13.807 15.796  1.00 34.52  ? 108 PRO B CD  1 
ATOM   2548 N N   . LEU B 1 65  ? -1.299  -14.320 17.713  1.00 29.33  ? 109 LEU B N   1 
ATOM   2549 C CA  . LEU B 1 65  ? 0.089   -14.484 18.126  1.00 22.96  ? 109 LEU B CA  1 
ATOM   2550 C C   . LEU B 1 65  ? 0.729   -13.101 18.317  1.00 26.75  ? 109 LEU B C   1 
ATOM   2551 O O   . LEU B 1 65  ? 1.396   -12.852 19.323  1.00 29.02  ? 109 LEU B O   1 
ATOM   2552 C CB  . LEU B 1 65  ? 0.862   -15.293 17.079  1.00 12.53  ? 109 LEU B CB  1 
ATOM   2553 C CG  . LEU B 1 65  ? 2.374   -15.474 17.279  1.00 19.74  ? 109 LEU B CG  1 
ATOM   2554 C CD1 . LEU B 1 65  ? 2.647   -16.293 18.537  1.00 19.46  ? 109 LEU B CD1 1 
ATOM   2555 C CD2 . LEU B 1 65  ? 2.964   -16.169 16.074  1.00 16.05  ? 109 LEU B CD2 1 
ATOM   2556 N N   . MET B 1 66  ? 0.514   -12.207 17.354  1.00 25.27  ? 110 MET B N   1 
ATOM   2557 C CA  . MET B 1 66  ? 1.051   -10.848 17.405  1.00 24.43  ? 110 MET B CA  1 
ATOM   2558 C C   . MET B 1 66  ? 0.664   -10.167 18.717  1.00 30.54  ? 110 MET B C   1 
ATOM   2559 O O   . MET B 1 66  ? 1.490   -9.546  19.384  1.00 31.53  ? 110 MET B O   1 
ATOM   2560 C CB  . MET B 1 66  ? 0.495   -10.012 16.244  1.00 37.27  ? 110 MET B CB  1 
ATOM   2561 C CG  . MET B 1 66  ? 0.957   -10.415 14.855  1.00 33.90  ? 110 MET B CG  1 
ATOM   2562 S SD  . MET B 1 66  ? 2.734   -10.204 14.657  1.00 42.00  ? 110 MET B SD  1 
ATOM   2563 C CE  . MET B 1 66  ? 3.277   -11.895 14.954  1.00 40.96  ? 110 MET B CE  1 
ATOM   2564 N N   . LYS B 1 67  ? -0.611  -10.280 19.067  1.00 33.02  ? 111 LYS B N   1 
ATOM   2565 C CA  . LYS B 1 67  ? -1.142  -9.689  20.287  1.00 37.25  ? 111 LYS B CA  1 
ATOM   2566 C C   . LYS B 1 67  ? -0.424  -10.207 21.537  1.00 35.64  ? 111 LYS B C   1 
ATOM   2567 O O   . LYS B 1 67  ? 0.038   -9.421  22.359  1.00 34.08  ? 111 LYS B O   1 
ATOM   2568 C CB  . LYS B 1 67  ? -2.638  -9.987  20.386  1.00 41.74  ? 111 LYS B CB  1 
ATOM   2569 C CG  . LYS B 1 67  ? -3.285  -9.568  21.698  1.00 56.48  ? 111 LYS B CG  1 
ATOM   2570 C CD  . LYS B 1 67  ? -3.521  -8.068  21.762  1.00 61.36  ? 111 LYS B CD  1 
ATOM   2571 C CE  . LYS B 1 67  ? -4.503  -7.731  22.877  1.00 67.47  ? 111 LYS B CE  1 
ATOM   2572 N NZ  . LYS B 1 67  ? -5.013  -6.331  22.787  1.00 73.02  ? 111 LYS B NZ  1 
ATOM   2573 N N   . LEU B 1 68  ? -0.339  -11.528 21.680  1.00 33.39  ? 112 LEU B N   1 
ATOM   2574 C CA  . LEU B 1 68  ? 0.324   -12.124 22.838  1.00 32.09  ? 112 LEU B CA  1 
ATOM   2575 C C   . LEU B 1 68  ? 1.812   -11.790 22.858  1.00 32.48  ? 112 LEU B C   1 
ATOM   2576 O O   . LEU B 1 68  ? 2.423   -11.684 23.919  1.00 31.96  ? 112 LEU B O   1 
ATOM   2577 C CB  . LEU B 1 68  ? 0.162   -13.644 22.829  1.00 27.17  ? 112 LEU B CB  1 
ATOM   2578 C CG  . LEU B 1 68  ? -1.237  -14.246 22.937  1.00 28.74  ? 112 LEU B CG  1 
ATOM   2579 C CD1 . LEU B 1 68  ? -1.121  -15.761 23.065  1.00 23.33  ? 112 LEU B CD1 1 
ATOM   2580 C CD2 . LEU B 1 68  ? -1.949  -13.666 24.142  1.00 30.83  ? 112 LEU B CD2 1 
ATOM   2581 N N   . GLY B 1 69  ? 2.391   -11.630 21.674  1.00 32.98  ? 113 GLY B N   1 
ATOM   2582 C CA  . GLY B 1 69  ? 3.804   -11.327 21.578  1.00 28.20  ? 113 GLY B CA  1 
ATOM   2583 C C   . GLY B 1 69  ? 4.120   -9.850  21.669  1.00 31.55  ? 113 GLY B C   1 
ATOM   2584 O O   . GLY B 1 69  ? 5.275   -9.465  21.485  1.00 33.72  ? 113 GLY B O   1 
ATOM   2585 N N   . THR B 1 70  ? 3.109   -9.021  21.940  1.00 32.35  ? 114 THR B N   1 
ATOM   2586 C CA  . THR B 1 70  ? 3.319   -7.577  22.062  1.00 31.48  ? 114 THR B CA  1 
ATOM   2587 C C   . THR B 1 70  ? 4.572   -7.360  22.903  1.00 31.71  ? 114 THR B C   1 
ATOM   2588 O O   . THR B 1 70  ? 4.732   -7.966  23.968  1.00 26.55  ? 114 THR B O   1 
ATOM   2589 C CB  . THR B 1 70  ? 2.124   -6.873  22.764  1.00 36.52  ? 114 THR B CB  1 
ATOM   2590 O OG1 . THR B 1 70  ? 0.951   -6.976  21.948  1.00 37.85  ? 114 THR B OG1 1 
ATOM   2591 C CG2 . THR B 1 70  ? 2.430   -5.403  22.989  1.00 40.02  ? 114 THR B CG2 1 
ATOM   2592 N N   . GLN B 1 71  ? 5.463   -6.503  22.422  1.00 27.67  ? 115 GLN B N   1 
ATOM   2593 C CA  . GLN B 1 71  ? 6.702   -6.243  23.142  1.00 31.75  ? 115 GLN B CA  1 
ATOM   2594 C C   . GLN B 1 71  ? 7.269   -4.864  22.822  1.00 31.19  ? 115 GLN B C   1 
ATOM   2595 O O   . GLN B 1 71  ? 7.569   -4.561  21.673  1.00 31.24  ? 115 GLN B O   1 
ATOM   2596 C CB  . GLN B 1 71  ? 7.733   -7.321  22.790  1.00 26.19  ? 115 GLN B CB  1 
ATOM   2597 C CG  . GLN B 1 71  ? 9.040   -7.210  23.560  1.00 33.37  ? 115 GLN B CG  1 
ATOM   2598 C CD  . GLN B 1 71  ? 10.062  -8.271  23.162  1.00 24.07  ? 115 GLN B CD  1 
ATOM   2599 O OE1 . GLN B 1 71  ? 11.173  -8.296  23.687  1.00 38.02  ? 115 GLN B OE1 1 
ATOM   2600 N NE2 . GLN B 1 71  ? 9.691   -9.142  22.235  1.00 23.65  ? 115 GLN B NE2 1 
ATOM   2601 N N   . THR B 1 72  ? 7.416   -4.032  23.846  1.00 31.29  ? 116 THR B N   1 
ATOM   2602 C CA  . THR B 1 72  ? 7.958   -2.695  23.656  1.00 33.38  ? 116 THR B CA  1 
ATOM   2603 C C   . THR B 1 72  ? 9.477   -2.724  23.601  1.00 37.27  ? 116 THR B C   1 
ATOM   2604 O O   . THR B 1 72  ? 10.143  -3.030  24.593  1.00 40.44  ? 116 THR B O   1 
ATOM   2605 C CB  . THR B 1 72  ? 7.556   -1.738  24.802  1.00 34.85  ? 116 THR B CB  1 
ATOM   2606 O OG1 . THR B 1 72  ? 6.143   -1.510  24.771  1.00 36.75  ? 116 THR B OG1 1 
ATOM   2607 C CG2 . THR B 1 72  ? 8.286   -0.408  24.658  1.00 31.81  ? 116 THR B CG2 1 
ATOM   2608 N N   . VAL B 1 73  ? 10.021  -2.406  22.436  1.00 37.22  ? 117 VAL B N   1 
ATOM   2609 C CA  . VAL B 1 73  ? 11.464  -2.358  22.263  1.00 40.85  ? 117 VAL B CA  1 
ATOM   2610 C C   . VAL B 1 73  ? 11.819  -0.883  22.085  1.00 40.73  ? 117 VAL B C   1 
ATOM   2611 O O   . VAL B 1 73  ? 11.151  -0.173  21.338  1.00 47.57  ? 117 VAL B O   1 
ATOM   2612 C CB  . VAL B 1 73  ? 11.893  -3.166  21.017  1.00 41.26  ? 117 VAL B CB  1 
ATOM   2613 C CG1 . VAL B 1 73  ? 11.121  -2.693  19.809  1.00 49.24  ? 117 VAL B CG1 1 
ATOM   2614 C CG2 . VAL B 1 73  ? 13.384  -3.024  20.784  1.00 37.18  ? 117 VAL B CG2 1 
ATOM   2615 N N   . PRO B 1 74  ? 12.848  -0.390  22.795  1.00 44.06  ? 118 PRO B N   1 
ATOM   2616 C CA  . PRO B 1 74  ? 13.216  1.024   22.644  1.00 40.96  ? 118 PRO B CA  1 
ATOM   2617 C C   . PRO B 1 74  ? 13.223  1.402   21.160  1.00 37.69  ? 118 PRO B C   1 
ATOM   2618 O O   . PRO B 1 74  ? 14.113  1.000   20.410  1.00 38.09  ? 118 PRO B O   1 
ATOM   2619 C CB  . PRO B 1 74  ? 14.597  1.078   23.287  1.00 42.10  ? 118 PRO B CB  1 
ATOM   2620 C CG  . PRO B 1 74  ? 14.455  0.084   24.411  1.00 39.03  ? 118 PRO B CG  1 
ATOM   2621 C CD  . PRO B 1 74  ? 13.749  -1.076  23.740  1.00 39.46  ? 118 PRO B CD  1 
ATOM   2622 N N   . CYS B 1 75  ? 12.229  2.185   20.751  1.00 38.01  ? 119 CYS B N   1 
ATOM   2623 C CA  . CYS B 1 75  ? 12.074  2.559   19.351  1.00 35.68  ? 119 CYS B CA  1 
ATOM   2624 C C   . CYS B 1 75  ? 13.217  3.284   18.663  1.00 35.44  ? 119 CYS B C   1 
ATOM   2625 O O   . CYS B 1 75  ? 13.274  3.296   17.438  1.00 37.69  ? 119 CYS B O   1 
ATOM   2626 C CB  . CYS B 1 75  ? 10.772  3.347   19.151  1.00 37.58  ? 119 CYS B CB  1 
ATOM   2627 S SG  . CYS B 1 75  ? 10.737  5.085   19.701  1.00 38.22  ? 119 CYS B SG  1 
ATOM   2628 N N   . ASN B 1 76  ? 14.134  3.879   19.418  1.00 33.52  ? 120 ASN B N   1 
ATOM   2629 C CA  . ASN B 1 76  ? 15.246  4.580   18.779  1.00 31.25  ? 120 ASN B CA  1 
ATOM   2630 C C   . ASN B 1 76  ? 16.494  3.718   18.750  1.00 30.31  ? 120 ASN B C   1 
ATOM   2631 O O   . ASN B 1 76  ? 17.550  4.163   18.307  1.00 33.21  ? 120 ASN B O   1 
ATOM   2632 C CB  . ASN B 1 76  ? 15.544  5.909   19.493  1.00 26.73  ? 120 ASN B CB  1 
ATOM   2633 C CG  . ASN B 1 76  ? 16.008  5.721   20.928  1.00 23.06  ? 120 ASN B CG  1 
ATOM   2634 O OD1 . ASN B 1 76  ? 15.338  5.075   21.732  1.00 27.02  ? 120 ASN B OD1 1 
ATOM   2635 N ND2 . ASN B 1 76  ? 17.157  6.297   21.256  1.00 17.31  ? 120 ASN B ND2 1 
ATOM   2636 N N   . LYS B 1 77  ? 16.357  2.476   19.203  1.00 25.52  ? 121 LYS B N   1 
ATOM   2637 C CA  . LYS B 1 77  ? 17.476  1.540   19.261  1.00 32.15  ? 121 LYS B CA  1 
ATOM   2638 C C   . LYS B 1 77  ? 17.229  0.265   18.448  1.00 35.86  ? 121 LYS B C   1 
ATOM   2639 O O   . LYS B 1 77  ? 17.580  -0.842  18.876  1.00 37.67  ? 121 LYS B O   1 
ATOM   2640 C CB  . LYS B 1 77  ? 17.744  1.175   20.723  1.00 31.16  ? 121 LYS B CB  1 
ATOM   2641 C CG  . LYS B 1 77  ? 17.990  2.384   21.612  1.00 34.45  ? 121 LYS B CG  1 
ATOM   2642 C CD  . LYS B 1 77  ? 19.323  3.057   21.295  1.00 30.37  ? 121 LYS B CD  1 
ATOM   2643 C CE  . LYS B 1 77  ? 20.488  2.220   21.791  1.00 32.07  ? 121 LYS B CE  1 
ATOM   2644 N NZ  . LYS B 1 77  ? 21.808  2.784   21.376  1.00 43.58  ? 121 LYS B NZ  1 
ATOM   2645 N N   . ILE B 1 78  ? 16.635  0.425   17.271  1.00 31.68  ? 122 ILE B N   1 
ATOM   2646 C CA  . ILE B 1 78  ? 16.331  -0.708  16.411  1.00 29.31  ? 122 ILE B CA  1 
ATOM   2647 C C   . ILE B 1 78  ? 17.364  -0.911  15.311  1.00 30.04  ? 122 ILE B C   1 
ATOM   2648 O O   . ILE B 1 78  ? 17.785  0.038   14.655  1.00 29.85  ? 122 ILE B O   1 
ATOM   2649 C CB  . ILE B 1 78  ? 14.927  -0.551  15.780  1.00 20.52  ? 122 ILE B CB  1 
ATOM   2650 C CG1 . ILE B 1 78  ? 13.865  -0.810  16.849  1.00 28.18  ? 122 ILE B CG1 1 
ATOM   2651 C CG2 . ILE B 1 78  ? 14.760  -1.489  14.598  1.00 18.99  ? 122 ILE B CG2 1 
ATOM   2652 C CD1 . ILE B 1 78  ? 12.430  -0.800  16.324  1.00 35.26  ? 122 ILE B CD1 1 
ATOM   2653 N N   . LEU B 1 79  ? 17.775  -2.161  15.122  1.00 26.26  ? 123 LEU B N   1 
ATOM   2654 C CA  . LEU B 1 79  ? 18.750  -2.491  14.090  1.00 30.49  ? 123 LEU B CA  1 
ATOM   2655 C C   . LEU B 1 79  ? 18.149  -3.411  13.035  1.00 26.59  ? 123 LEU B C   1 
ATOM   2656 O O   . LEU B 1 79  ? 17.812  -4.560  13.319  1.00 31.20  ? 123 LEU B O   1 
ATOM   2657 C CB  . LEU B 1 79  ? 19.990  -3.173  14.690  1.00 17.47  ? 123 LEU B CB  1 
ATOM   2658 C CG  . LEU B 1 79  ? 20.981  -3.583  13.596  1.00 24.85  ? 123 LEU B CG  1 
ATOM   2659 C CD1 . LEU B 1 79  ? 21.453  -2.327  12.881  1.00 24.67  ? 123 LEU B CD1 1 
ATOM   2660 C CD2 . LEU B 1 79  ? 22.169  -4.342  14.171  1.00 17.94  ? 123 LEU B CD2 1 
ATOM   2661 N N   . LEU B 1 80  ? 18.002  -2.897  11.822  1.00 25.70  ? 124 LEU B N   1 
ATOM   2662 C CA  . LEU B 1 80  ? 17.480  -3.692  10.724  1.00 22.10  ? 124 LEU B CA  1 
ATOM   2663 C C   . LEU B 1 80  ? 18.714  -4.225  10.006  1.00 28.27  ? 124 LEU B C   1 
ATOM   2664 O O   . LEU B 1 80  ? 19.805  -3.669  10.144  1.00 25.03  ? 124 LEU B O   1 
ATOM   2665 C CB  . LEU B 1 80  ? 16.651  -2.827  9.777   1.00 23.87  ? 124 LEU B CB  1 
ATOM   2666 C CG  . LEU B 1 80  ? 15.368  -2.209  10.340  1.00 26.02  ? 124 LEU B CG  1 
ATOM   2667 C CD1 . LEU B 1 80  ? 14.746  -1.333  9.271   1.00 20.06  ? 124 LEU B CD1 1 
ATOM   2668 C CD2 . LEU B 1 80  ? 14.389  -3.302  10.795  1.00 15.53  ? 124 LEU B CD2 1 
ATOM   2669 N N   . TRP B 1 81  ? 18.555  -5.307  9.257   1.00 29.21  ? 125 TRP B N   1 
ATOM   2670 C CA  . TRP B 1 81  ? 19.689  -5.882  8.550   1.00 29.55  ? 125 TRP B CA  1 
ATOM   2671 C C   . TRP B 1 81  ? 19.232  -6.701  7.362   1.00 28.40  ? 125 TRP B C   1 
ATOM   2672 O O   . TRP B 1 81  ? 18.056  -7.049  7.247   1.00 31.47  ? 125 TRP B O   1 
ATOM   2673 C CB  . TRP B 1 81  ? 20.505  -6.785  9.480   1.00 29.33  ? 125 TRP B CB  1 
ATOM   2674 C CG  . TRP B 1 81  ? 19.714  -7.944  10.009  1.00 36.51  ? 125 TRP B CG  1 
ATOM   2675 C CD1 . TRP B 1 81  ? 18.852  -7.933  11.072  1.00 36.14  ? 125 TRP B CD1 1 
ATOM   2676 C CD2 . TRP B 1 81  ? 19.644  -9.265  9.452   1.00 39.25  ? 125 TRP B CD2 1 
ATOM   2677 N NE1 . TRP B 1 81  ? 18.247  -9.161  11.206  1.00 33.69  ? 125 TRP B NE1 1 
ATOM   2678 C CE2 . TRP B 1 81  ? 18.714  -9.997  10.225  1.00 41.48  ? 125 TRP B CE2 1 
ATOM   2679 C CE3 . TRP B 1 81  ? 20.275  -9.899  8.371   1.00 40.21  ? 125 TRP B CE3 1 
ATOM   2680 C CZ2 . TRP B 1 81  ? 18.398  -11.333 9.951   1.00 39.30  ? 125 TRP B CZ2 1 
ATOM   2681 C CZ3 . TRP B 1 81  ? 19.959  -11.230 8.097   1.00 36.59  ? 125 TRP B CZ3 1 
ATOM   2682 C CH2 . TRP B 1 81  ? 19.028  -11.930 8.886   1.00 41.66  ? 125 TRP B CH2 1 
ATOM   2683 N N   . SER B 1 82  ? 20.180  -7.018  6.490   1.00 26.44  ? 126 SER B N   1 
ATOM   2684 C CA  . SER B 1 82  ? 19.892  -7.818  5.314   1.00 35.94  ? 126 SER B CA  1 
ATOM   2685 C C   . SER B 1 82  ? 21.109  -8.586  4.812   1.00 35.41  ? 126 SER B C   1 
ATOM   2686 O O   . SER B 1 82  ? 22.150  -8.003  4.503   1.00 29.98  ? 126 SER B O   1 
ATOM   2687 C CB  . SER B 1 82  ? 19.341  -6.944  4.185   1.00 31.05  ? 126 SER B CB  1 
ATOM   2688 O OG  . SER B 1 82  ? 19.216  -7.712  3.003   1.00 38.53  ? 126 SER B OG  1 
ATOM   2689 N N   . ARG B 1 83  ? 20.954  -9.906  4.752   1.00 39.08  ? 127 ARG B N   1 
ATOM   2690 C CA  . ARG B 1 83  ? 21.983  -10.826 4.279   1.00 37.04  ? 127 ARG B CA  1 
ATOM   2691 C C   . ARG B 1 83  ? 23.351  -10.687 4.929   1.00 39.40  ? 127 ARG B C   1 
ATOM   2692 O O   . ARG B 1 83  ? 24.380  -10.724 4.259   1.00 43.39  ? 127 ARG B O   1 
ATOM   2693 C CB  . ARG B 1 83  ? 22.085  -10.715 2.759   1.00 39.12  ? 127 ARG B CB  1 
ATOM   2694 C CG  . ARG B 1 83  ? 20.749  -11.028 2.096   1.00 42.86  ? 127 ARG B CG  1 
ATOM   2695 C CD  . ARG B 1 83  ? 20.762  -10.877 0.597   1.00 44.11  ? 127 ARG B CD  1 
ATOM   2696 N NE  . ARG B 1 83  ? 19.404  -10.981 0.066   1.00 52.65  ? 127 ARG B NE  1 
ATOM   2697 C CZ  . ARG B 1 83  ? 19.079  -10.761 -1.204  1.00 53.92  ? 127 ARG B CZ  1 
ATOM   2698 N NH1 . ARG B 1 83  ? 20.018  -10.426 -2.082  1.00 57.43  ? 127 ARG B NH1 1 
ATOM   2699 N NH2 . ARG B 1 83  ? 17.813  -10.859 -1.592  1.00 50.29  ? 127 ARG B NH2 1 
ATOM   2700 N N   . ILE B 1 84  ? 23.344  -10.529 6.250   1.00 43.20  ? 128 ILE B N   1 
ATOM   2701 C CA  . ILE B 1 84  ? 24.558  -10.416 7.049   1.00 38.11  ? 128 ILE B CA  1 
ATOM   2702 C C   . ILE B 1 84  ? 24.135  -10.715 8.487   1.00 40.75  ? 128 ILE B C   1 
ATOM   2703 O O   . ILE B 1 84  ? 24.491  -10.012 9.438   1.00 36.22  ? 128 ILE B O   1 
ATOM   2704 C CB  . ILE B 1 84  ? 25.191  -9.011  6.936   1.00 36.51  ? 128 ILE B CB  1 
ATOM   2705 C CG1 . ILE B 1 84  ? 26.543  -9.004  7.659   1.00 40.49  ? 128 ILE B CG1 1 
ATOM   2706 C CG2 . ILE B 1 84  ? 24.245  -7.958  7.501   1.00 34.58  ? 128 ILE B CG2 1 
ATOM   2707 C CD1 . ILE B 1 84  ? 27.360  -7.753  7.456   1.00 36.81  ? 128 ILE B CD1 1 
ATOM   2708 N N   . LYS B 1 85  ? 23.369  -11.796 8.609   1.00 43.12  ? 129 LYS B N   1 
ATOM   2709 C CA  . LYS B 1 85  ? 22.804  -12.279 9.866   1.00 44.85  ? 129 LYS B CA  1 
ATOM   2710 C C   . LYS B 1 85  ? 23.758  -12.430 11.050  1.00 45.12  ? 129 LYS B C   1 
ATOM   2711 O O   . LYS B 1 85  ? 23.474  -11.940 12.146  1.00 41.59  ? 129 LYS B O   1 
ATOM   2712 C CB  . LYS B 1 85  ? 22.101  -13.615 9.601   1.00 42.90  ? 129 LYS B CB  1 
ATOM   2713 C CG  . LYS B 1 85  ? 21.256  -14.164 10.742  1.00 47.32  ? 129 LYS B CG  1 
ATOM   2714 C CD  . LYS B 1 85  ? 20.557  -15.448 10.298  1.00 50.20  ? 129 LYS B CD  1 
ATOM   2715 C CE  . LYS B 1 85  ? 19.503  -15.916 11.289  1.00 52.25  ? 129 LYS B CE  1 
ATOM   2716 N NZ  . LYS B 1 85  ? 20.083  -16.388 12.574  1.00 55.28  ? 129 LYS B NZ  1 
ATOM   2717 N N   . ASP B 1 86  ? 24.880  -13.109 10.834  1.00 50.49  ? 130 ASP B N   1 
ATOM   2718 C CA  . ASP B 1 86  ? 25.847  -13.351 11.908  1.00 52.63  ? 130 ASP B CA  1 
ATOM   2719 C C   . ASP B 1 86  ? 26.368  -12.104 12.618  1.00 46.95  ? 130 ASP B C   1 
ATOM   2720 O O   . ASP B 1 86  ? 26.120  -11.916 13.805  1.00 44.87  ? 130 ASP B O   1 
ATOM   2721 C CB  . ASP B 1 86  ? 27.026  -14.190 11.383  1.00 63.28  ? 130 ASP B CB  1 
ATOM   2722 C CG  . ASP B 1 86  ? 27.776  -13.512 10.247  1.00 74.97  ? 130 ASP B CG  1 
ATOM   2723 O OD1 . ASP B 1 86  ? 27.138  -13.159 9.231   1.00 77.32  ? 130 ASP B OD1 1 
ATOM   2724 O OD2 . ASP B 1 86  ? 29.011  -13.343 10.371  1.00 82.29  ? 130 ASP B OD2 1 
ATOM   2725 N N   . LEU B 1 87  ? 27.091  -11.255 11.900  1.00 46.77  ? 131 LEU B N   1 
ATOM   2726 C CA  . LEU B 1 87  ? 27.630  -10.041 12.499  1.00 44.81  ? 131 LEU B CA  1 
ATOM   2727 C C   . LEU B 1 87  ? 26.523  -9.186  13.131  1.00 41.89  ? 131 LEU B C   1 
ATOM   2728 O O   . LEU B 1 87  ? 26.681  -8.676  14.244  1.00 42.15  ? 131 LEU B O   1 
ATOM   2729 C CB  . LEU B 1 87  ? 28.384  -9.223  11.444  1.00 41.83  ? 131 LEU B CB  1 
ATOM   2730 C CG  . LEU B 1 87  ? 29.081  -7.965  11.971  1.00 48.26  ? 131 LEU B CG  1 
ATOM   2731 C CD1 . LEU B 1 87  ? 30.112  -8.362  13.025  1.00 52.03  ? 131 LEU B CD1 1 
ATOM   2732 C CD2 . LEU B 1 87  ? 29.745  -7.212  10.826  1.00 47.03  ? 131 LEU B CD2 1 
ATOM   2733 N N   . ALA B 1 88  ? 25.406  -9.037  12.422  1.00 33.57  ? 132 ALA B N   1 
ATOM   2734 C CA  . ALA B 1 88  ? 24.287  -8.239  12.913  1.00 31.01  ? 132 ALA B CA  1 
ATOM   2735 C C   . ALA B 1 88  ? 23.867  -8.677  14.314  1.00 36.48  ? 132 ALA B C   1 
ATOM   2736 O O   . ALA B 1 88  ? 23.873  -7.889  15.262  1.00 38.81  ? 132 ALA B O   1 
ATOM   2737 C CB  . ALA B 1 88  ? 23.111  -8.354  11.961  1.00 22.44  ? 132 ALA B CB  1 
ATOM   2738 N N   . HIS B 1 89  ? 23.503  -9.944  14.442  1.00 35.42  ? 133 HIS B N   1 
ATOM   2739 C CA  . HIS B 1 89  ? 23.083  -10.473 15.725  1.00 37.71  ? 133 HIS B CA  1 
ATOM   2740 C C   . HIS B 1 89  ? 24.198  -10.440 16.762  1.00 40.19  ? 133 HIS B C   1 
ATOM   2741 O O   . HIS B 1 89  ? 23.954  -10.114 17.924  1.00 37.90  ? 133 HIS B O   1 
ATOM   2742 C CB  . HIS B 1 89  ? 22.532  -11.880 15.526  1.00 33.58  ? 133 HIS B CB  1 
ATOM   2743 C CG  . HIS B 1 89  ? 21.237  -11.898 14.775  1.00 44.31  ? 133 HIS B CG  1 
ATOM   2744 N ND1 . HIS B 1 89  ? 20.722  -13.036 14.195  1.00 54.10  ? 133 HIS B ND1 1 
ATOM   2745 C CD2 . HIS B 1 89  ? 20.356  -10.905 14.503  1.00 42.07  ? 133 HIS B CD2 1 
ATOM   2746 C CE1 . HIS B 1 89  ? 19.581  -12.743 13.594  1.00 54.39  ? 133 HIS B CE1 1 
ATOM   2747 N NE2 . HIS B 1 89  ? 19.337  -11.456 13.766  1.00 42.67  ? 133 HIS B NE2 1 
ATOM   2748 N N   . GLN B 1 90  ? 25.420  -10.761 16.349  1.00 41.96  ? 134 GLN B N   1 
ATOM   2749 C CA  . GLN B 1 90  ? 26.550  -10.726 17.273  1.00 43.79  ? 134 GLN B CA  1 
ATOM   2750 C C   . GLN B 1 90  ? 26.675  -9.309  17.809  1.00 44.39  ? 134 GLN B C   1 
ATOM   2751 O O   . GLN B 1 90  ? 26.978  -9.105  18.982  1.00 53.99  ? 134 GLN B O   1 
ATOM   2752 C CB  . GLN B 1 90  ? 27.844  -11.115 16.561  1.00 46.77  ? 134 GLN B CB  1 
ATOM   2753 C CG  . GLN B 1 90  ? 27.926  -12.578 16.164  1.00 57.43  ? 134 GLN B CG  1 
ATOM   2754 C CD  . GLN B 1 90  ? 29.067  -12.856 15.202  1.00 59.24  ? 134 GLN B CD  1 
ATOM   2755 O OE1 . GLN B 1 90  ? 29.310  -14.002 14.824  1.00 62.21  ? 134 GLN B OE1 1 
ATOM   2756 N NE2 . GLN B 1 90  ? 29.769  -11.804 14.795  1.00 57.98  ? 134 GLN B NE2 1 
ATOM   2757 N N   . PHE B 1 91  ? 26.432  -8.332  16.940  1.00 41.34  ? 135 PHE B N   1 
ATOM   2758 C CA  . PHE B 1 91  ? 26.510  -6.929  17.318  1.00 39.38  ? 135 PHE B CA  1 
ATOM   2759 C C   . PHE B 1 91  ? 25.582  -6.606  18.483  1.00 40.84  ? 135 PHE B C   1 
ATOM   2760 O O   . PHE B 1 91  ? 26.005  -5.997  19.462  1.00 46.34  ? 135 PHE B O   1 
ATOM   2761 C CB  . PHE B 1 91  ? 26.176  -6.032  16.118  1.00 42.86  ? 135 PHE B CB  1 
ATOM   2762 C CG  . PHE B 1 91  ? 26.042  -4.571  16.470  1.00 44.00  ? 135 PHE B CG  1 
ATOM   2763 C CD1 . PHE B 1 91  ? 24.789  -4.000  16.668  1.00 39.67  ? 135 PHE B CD1 1 
ATOM   2764 C CD2 . PHE B 1 91  ? 27.172  -3.777  16.649  1.00 42.96  ? 135 PHE B CD2 1 
ATOM   2765 C CE1 . PHE B 1 91  ? 24.661  -2.659  17.044  1.00 39.43  ? 135 PHE B CE1 1 
ATOM   2766 C CE2 . PHE B 1 91  ? 27.053  -2.434  17.027  1.00 44.18  ? 135 PHE B CE2 1 
ATOM   2767 C CZ  . PHE B 1 91  ? 25.794  -1.877  17.225  1.00 37.38  ? 135 PHE B CZ  1 
ATOM   2768 N N   . THR B 1 92  ? 24.319  -7.011  18.392  1.00 42.30  ? 136 THR B N   1 
ATOM   2769 C CA  . THR B 1 92  ? 23.386  -6.728  19.478  1.00 42.25  ? 136 THR B CA  1 
ATOM   2770 C C   . THR B 1 92  ? 23.664  -7.596  20.701  1.00 43.82  ? 136 THR B C   1 
ATOM   2771 O O   . THR B 1 92  ? 23.187  -7.300  21.796  1.00 49.07  ? 136 THR B O   1 
ATOM   2772 C CB  . THR B 1 92  ? 21.911  -6.909  19.039  1.00 36.99  ? 136 THR B CB  1 
ATOM   2773 O OG1 . THR B 1 92  ? 21.719  -8.214  18.489  1.00 30.02  ? 136 THR B OG1 1 
ATOM   2774 C CG2 . THR B 1 92  ? 21.539  -5.867  18.002  1.00 37.23  ? 136 THR B CG2 1 
ATOM   2775 N N   . GLN B 1 93  ? 24.435  -8.663  20.516  1.00 45.93  ? 137 GLN B N   1 
ATOM   2776 C CA  . GLN B 1 93  ? 24.784  -9.544  21.626  1.00 48.15  ? 137 GLN B CA  1 
ATOM   2777 C C   . GLN B 1 93  ? 25.802  -8.838  22.510  1.00 47.96  ? 137 GLN B C   1 
ATOM   2778 O O   . GLN B 1 93  ? 25.920  -9.134  23.698  1.00 45.76  ? 137 GLN B O   1 
ATOM   2779 C CB  . GLN B 1 93  ? 25.364  -10.864 21.112  1.00 51.08  ? 137 GLN B CB  1 
ATOM   2780 C CG  . GLN B 1 93  ? 24.307  -11.898 20.738  1.00 54.42  ? 137 GLN B CG  1 
ATOM   2781 C CD  . GLN B 1 93  ? 23.486  -12.355 21.935  1.00 57.35  ? 137 GLN B CD  1 
ATOM   2782 O OE1 . GLN B 1 93  ? 22.462  -13.026 21.783  1.00 59.70  ? 137 GLN B OE1 1 
ATOM   2783 N NE2 . GLN B 1 93  ? 23.938  -12.002 23.135  1.00 51.86  ? 137 GLN B NE2 1 
ATOM   2784 N N   . VAL B 1 94  ? 26.535  -7.902  21.912  1.00 48.35  ? 138 VAL B N   1 
ATOM   2785 C CA  . VAL B 1 94  ? 27.538  -7.117  22.629  1.00 51.87  ? 138 VAL B CA  1 
ATOM   2786 C C   . VAL B 1 94  ? 26.925  -5.766  23.014  1.00 53.24  ? 138 VAL B C   1 
ATOM   2787 O O   . VAL B 1 94  ? 26.933  -5.377  24.183  1.00 55.66  ? 138 VAL B O   1 
ATOM   2788 C CB  . VAL B 1 94  ? 28.784  -6.873  21.755  1.00 53.97  ? 138 VAL B CB  1 
ATOM   2789 C CG1 . VAL B 1 94  ? 29.771  -5.979  22.489  1.00 54.31  ? 138 VAL B CG1 1 
ATOM   2790 C CG2 . VAL B 1 94  ? 29.432  -8.203  21.400  1.00 58.48  ? 138 VAL B CG2 1 
ATOM   2791 N N   . GLN B 1 95  ? 26.402  -5.051  22.024  1.00 50.16  ? 139 GLN B N   1 
ATOM   2792 C CA  . GLN B 1 95  ? 25.765  -3.767  22.272  1.00 44.72  ? 139 GLN B CA  1 
ATOM   2793 C C   . GLN B 1 95  ? 24.348  -4.138  22.699  1.00 47.77  ? 139 GLN B C   1 
ATOM   2794 O O   . GLN B 1 95  ? 23.403  -4.078  21.908  1.00 46.10  ? 139 GLN B O   1 
ATOM   2795 C CB  . GLN B 1 95  ? 25.748  -2.940  20.990  1.00 47.06  ? 139 GLN B CB  1 
ATOM   2796 C CG  . GLN B 1 95  ? 25.401  -1.478  21.187  1.00 56.80  ? 139 GLN B CG  1 
ATOM   2797 C CD  . GLN B 1 95  ? 26.447  -0.733  21.993  1.00 60.33  ? 139 GLN B CD  1 
ATOM   2798 O OE1 . GLN B 1 95  ? 27.633  -0.750  21.659  1.00 66.06  ? 139 GLN B OE1 1 
ATOM   2799 N NE2 . GLN B 1 95  ? 26.010  -0.067  23.056  1.00 60.29  ? 139 GLN B NE2 1 
ATOM   2800 N N   . ARG B 1 96  ? 24.230  -4.541  23.962  1.00 48.20  ? 140 ARG B N   1 
ATOM   2801 C CA  . ARG B 1 96  ? 22.980  -4.985  24.578  1.00 48.78  ? 140 ARG B CA  1 
ATOM   2802 C C   . ARG B 1 96  ? 21.828  -3.984  24.611  1.00 45.86  ? 140 ARG B C   1 
ATOM   2803 O O   . ARG B 1 96  ? 20.765  -4.289  25.151  1.00 48.13  ? 140 ARG B O   1 
ATOM   2804 C CB  . ARG B 1 96  ? 23.261  -5.447  26.008  1.00 49.26  ? 140 ARG B CB  1 
ATOM   2805 C CG  . ARG B 1 96  ? 24.459  -6.369  26.135  1.00 54.51  ? 140 ARG B CG  1 
ATOM   2806 C CD  . ARG B 1 96  ? 24.141  -7.798  25.729  1.00 59.76  ? 140 ARG B CD  1 
ATOM   2807 N NE  . ARG B 1 96  ? 23.244  -8.445  26.683  1.00 62.77  ? 140 ARG B NE  1 
ATOM   2808 C CZ  . ARG B 1 96  ? 23.016  -9.755  26.724  1.00 67.38  ? 140 ARG B CZ  1 
ATOM   2809 N NH1 . ARG B 1 96  ? 23.623  -10.563 25.863  1.00 67.33  ? 140 ARG B NH1 1 
ATOM   2810 N NH2 . ARG B 1 96  ? 22.178  -10.258 27.623  1.00 67.47  ? 140 ARG B NH2 1 
ATOM   2811 N N   . ASP B 1 97  ? 22.027  -2.791  24.063  1.00 43.75  ? 141 ASP B N   1 
ATOM   2812 C CA  . ASP B 1 97  ? 20.953  -1.801  24.059  1.00 46.64  ? 141 ASP B CA  1 
ATOM   2813 C C   . ASP B 1 97  ? 20.426  -1.594  22.639  1.00 42.93  ? 141 ASP B C   1 
ATOM   2814 O O   . ASP B 1 97  ? 19.596  -0.717  22.396  1.00 43.20  ? 141 ASP B O   1 
ATOM   2815 C CB  . ASP B 1 97  ? 21.438  -0.474  24.664  1.00 47.32  ? 141 ASP B CB  1 
ATOM   2816 C CG  . ASP B 1 97  ? 22.487  0.215   23.810  1.00 50.97  ? 141 ASP B CG  1 
ATOM   2817 O OD1 . ASP B 1 97  ? 23.273  -0.493  23.142  1.00 47.99  ? 141 ASP B OD1 1 
ATOM   2818 O OD2 . ASP B 1 97  ? 22.532  1.465   23.820  1.00 48.18  ? 141 ASP B OD2 1 
ATOM   2819 N N   . MET B 1 98  ? 20.926  -2.411  21.711  1.00 38.88  ? 142 MET B N   1 
ATOM   2820 C CA  . MET B 1 98  ? 20.511  -2.389  20.309  1.00 33.52  ? 142 MET B CA  1 
ATOM   2821 C C   . MET B 1 98  ? 19.671  -3.649  20.089  1.00 36.00  ? 142 MET B C   1 
ATOM   2822 O O   . MET B 1 98  ? 19.860  -4.649  20.788  1.00 34.66  ? 142 MET B O   1 
ATOM   2823 C CB  . MET B 1 98  ? 21.731  -2.411  19.386  1.00 39.49  ? 142 MET B CB  1 
ATOM   2824 C CG  . MET B 1 98  ? 22.524  -1.110  19.341  1.00 42.87  ? 142 MET B CG  1 
ATOM   2825 S SD  . MET B 1 98  ? 21.593  0.253   18.606  1.00 52.21  ? 142 MET B SD  1 
ATOM   2826 C CE  . MET B 1 98  ? 21.892  -0.035  16.857  1.00 48.66  ? 142 MET B CE  1 
ATOM   2827 N N   . PHE B 1 99  ? 18.754  -3.616  19.124  1.00 32.30  ? 143 PHE B N   1 
ATOM   2828 C CA  . PHE B 1 99  ? 17.885  -4.773  18.881  1.00 32.73  ? 143 PHE B CA  1 
ATOM   2829 C C   . PHE B 1 99  ? 17.545  -5.066  17.415  1.00 36.02  ? 143 PHE B C   1 
ATOM   2830 O O   . PHE B 1 99  ? 17.216  -4.154  16.644  1.00 34.10  ? 143 PHE B O   1 
ATOM   2831 C CB  . PHE B 1 99  ? 16.558  -4.590  19.633  1.00 32.18  ? 143 PHE B CB  1 
ATOM   2832 C CG  . PHE B 1 99  ? 16.704  -4.466  21.123  1.00 36.05  ? 143 PHE B CG  1 
ATOM   2833 C CD1 . PHE B 1 99  ? 16.793  -5.604  21.925  1.00 32.82  ? 143 PHE B CD1 1 
ATOM   2834 C CD2 . PHE B 1 99  ? 16.743  -3.211  21.727  1.00 31.82  ? 143 PHE B CD2 1 
ATOM   2835 C CE1 . PHE B 1 99  ? 16.915  -5.494  23.307  1.00 29.57  ? 143 PHE B CE1 1 
ATOM   2836 C CE2 . PHE B 1 99  ? 16.867  -3.086  23.108  1.00 36.90  ? 143 PHE B CE2 1 
ATOM   2837 C CZ  . PHE B 1 99  ? 16.952  -4.232  23.901  1.00 41.14  ? 143 PHE B CZ  1 
ATOM   2838 N N   . THR B 1 100 ? 17.616  -6.341  17.040  1.00 26.34  ? 144 THR B N   1 
ATOM   2839 C CA  . THR B 1 100 ? 17.241  -6.757  15.693  1.00 28.07  ? 144 THR B CA  1 
ATOM   2840 C C   . THR B 1 100 ? 15.905  -7.456  15.895  1.00 24.93  ? 144 THR B C   1 
ATOM   2841 O O   . THR B 1 100 ? 15.525  -7.732  17.030  1.00 23.48  ? 144 THR B O   1 
ATOM   2842 C CB  . THR B 1 100 ? 18.234  -7.763  15.069  1.00 25.21  ? 144 THR B CB  1 
ATOM   2843 O OG1 . THR B 1 100 ? 18.257  -8.967  15.845  1.00 32.39  ? 144 THR B OG1 1 
ATOM   2844 C CG2 . THR B 1 100 ? 19.627  -7.163  15.004  1.00 32.35  ? 144 THR B CG2 1 
ATOM   2845 N N   . LEU B 1 101 ? 15.191  -7.736  14.810  1.00 27.89  ? 145 LEU B N   1 
ATOM   2846 C CA  . LEU B 1 101 ? 13.896  -8.406  14.904  1.00 25.23  ? 145 LEU B CA  1 
ATOM   2847 C C   . LEU B 1 101 ? 14.009  -9.772  15.582  1.00 27.94  ? 145 LEU B C   1 
ATOM   2848 O O   . LEU B 1 101 ? 13.076  -10.226 16.238  1.00 29.72  ? 145 LEU B O   1 
ATOM   2849 C CB  . LEU B 1 101 ? 13.293  -8.569  13.508  1.00 28.79  ? 145 LEU B CB  1 
ATOM   2850 C CG  . LEU B 1 101 ? 12.046  -9.443  13.366  1.00 27.95  ? 145 LEU B CG  1 
ATOM   2851 C CD1 . LEU B 1 101 ? 10.941  -8.895  14.260  1.00 19.48  ? 145 LEU B CD1 1 
ATOM   2852 C CD2 . LEU B 1 101 ? 11.605  -9.487  11.902  1.00 20.04  ? 145 LEU B CD2 1 
ATOM   2853 N N   . GLU B 1 102 ? 15.158  -10.419 15.429  1.00 28.37  ? 146 GLU B N   1 
ATOM   2854 C CA  . GLU B 1 102 ? 15.371  -11.727 16.025  1.00 24.06  ? 146 GLU B CA  1 
ATOM   2855 C C   . GLU B 1 102 ? 15.671  -11.650 17.519  1.00 27.78  ? 146 GLU B C   1 
ATOM   2856 O O   . GLU B 1 102 ? 15.870  -12.675 18.173  1.00 26.63  ? 146 GLU B O   1 
ATOM   2857 C CB  . GLU B 1 102 ? 16.509  -12.449 15.311  1.00 27.54  ? 146 GLU B CB  1 
ATOM   2858 C CG  . GLU B 1 102 ? 16.242  -12.766 13.835  1.00 34.75  ? 146 GLU B CG  1 
ATOM   2859 C CD  . GLU B 1 102 ? 16.226  -11.531 12.952  1.00 30.09  ? 146 GLU B CD  1 
ATOM   2860 O OE1 . GLU B 1 102 ? 17.103  -10.662 13.140  1.00 33.20  ? 146 GLU B OE1 1 
ATOM   2861 O OE2 . GLU B 1 102 ? 15.350  -11.436 12.063  1.00 24.02  ? 146 GLU B OE2 1 
ATOM   2862 N N   . ASP B 1 103 ? 15.715  -10.442 18.064  1.00 24.00  ? 147 ASP B N   1 
ATOM   2863 C CA  . ASP B 1 103 ? 15.978  -10.280 19.492  1.00 25.15  ? 147 ASP B CA  1 
ATOM   2864 C C   . ASP B 1 103 ? 14.654  -10.130 20.234  1.00 24.80  ? 147 ASP B C   1 
ATOM   2865 O O   . ASP B 1 103 ? 14.614  -10.103 21.463  1.00 19.70  ? 147 ASP B O   1 
ATOM   2866 C CB  . ASP B 1 103 ? 16.876  -9.066  19.733  1.00 24.75  ? 147 ASP B CB  1 
ATOM   2867 C CG  . ASP B 1 103 ? 18.253  -9.235  19.110  1.00 31.47  ? 147 ASP B CG  1 
ATOM   2868 O OD1 . ASP B 1 103 ? 18.727  -8.308  18.417  1.00 32.88  ? 147 ASP B OD1 1 
ATOM   2869 O OD2 . ASP B 1 103 ? 18.863  -10.304 19.315  1.00 31.08  ? 147 ASP B OD2 1 
ATOM   2870 N N   . THR B 1 104 ? 13.566  -10.040 19.476  1.00 19.43  ? 148 THR B N   1 
ATOM   2871 C CA  . THR B 1 104 ? 12.240  -9.920  20.072  1.00 24.64  ? 148 THR B CA  1 
ATOM   2872 C C   . THR B 1 104 ? 11.723  -11.328 20.298  1.00 22.13  ? 148 THR B C   1 
ATOM   2873 O O   . THR B 1 104 ? 12.173  -12.268 19.640  1.00 20.92  ? 148 THR B O   1 
ATOM   2874 C CB  . THR B 1 104 ? 11.246  -9.196  19.139  1.00 28.62  ? 148 THR B CB  1 
ATOM   2875 O OG1 . THR B 1 104 ? 11.119  -9.932  17.913  1.00 22.50  ? 148 THR B OG1 1 
ATOM   2876 C CG2 . THR B 1 104 ? 11.723  -7.778  18.845  1.00 28.76  ? 148 THR B CG2 1 
ATOM   2877 N N   . LEU B 1 105 ? 10.783  -11.476 21.224  1.00 17.86  ? 149 LEU B N   1 
ATOM   2878 C CA  . LEU B 1 105 ? 10.228  -12.791 21.500  1.00 24.89  ? 149 LEU B CA  1 
ATOM   2879 C C   . LEU B 1 105 ? 9.752   -13.462 20.215  1.00 24.34  ? 149 LEU B C   1 
ATOM   2880 O O   . LEU B 1 105 ? 10.149  -14.583 19.914  1.00 27.64  ? 149 LEU B O   1 
ATOM   2881 C CB  . LEU B 1 105 ? 9.059   -12.692 22.486  1.00 22.78  ? 149 LEU B CB  1 
ATOM   2882 C CG  . LEU B 1 105 ? 8.273   -13.994 22.690  1.00 27.40  ? 149 LEU B CG  1 
ATOM   2883 C CD1 . LEU B 1 105 ? 9.226   -15.124 23.043  1.00 20.96  ? 149 LEU B CD1 1 
ATOM   2884 C CD2 . LEU B 1 105 ? 7.231   -13.808 23.782  1.00 26.17  ? 149 LEU B CD2 1 
ATOM   2885 N N   . LEU B 1 106 ? 8.911   -12.768 19.455  1.00 22.77  ? 150 LEU B N   1 
ATOM   2886 C CA  . LEU B 1 106 ? 8.378   -13.325 18.218  1.00 23.83  ? 150 LEU B CA  1 
ATOM   2887 C C   . LEU B 1 106 ? 9.426   -13.725 17.186  1.00 24.52  ? 150 LEU B C   1 
ATOM   2888 O O   . LEU B 1 106 ? 9.400   -14.843 16.679  1.00 27.85  ? 150 LEU B O   1 
ATOM   2889 C CB  . LEU B 1 106 ? 7.366   -12.356 17.605  1.00 26.97  ? 150 LEU B CB  1 
ATOM   2890 C CG  . LEU B 1 106 ? 6.047   -12.335 18.381  1.00 25.44  ? 150 LEU B CG  1 
ATOM   2891 C CD1 . LEU B 1 106 ? 5.147   -11.221 17.884  1.00 27.47  ? 150 LEU B CD1 1 
ATOM   2892 C CD2 . LEU B 1 106 ? 5.368   -13.686 18.233  1.00 28.60  ? 150 LEU B CD2 1 
ATOM   2893 N N   . GLY B 1 107 ? 10.351  -12.825 16.875  1.00 29.11  ? 151 GLY B N   1 
ATOM   2894 C CA  . GLY B 1 107 ? 11.378  -13.159 15.903  1.00 31.96  ? 151 GLY B CA  1 
ATOM   2895 C C   . GLY B 1 107 ? 12.277  -14.282 16.388  1.00 31.69  ? 151 GLY B C   1 
ATOM   2896 O O   . GLY B 1 107 ? 12.828  -15.047 15.593  1.00 31.43  ? 151 GLY B O   1 
ATOM   2897 N N   . TYR B 1 108 ? 12.414  -14.382 17.706  1.00 30.96  ? 152 TYR B N   1 
ATOM   2898 C CA  . TYR B 1 108 ? 13.248  -15.399 18.344  1.00 31.40  ? 152 TYR B CA  1 
ATOM   2899 C C   . TYR B 1 108 ? 12.648  -16.815 18.271  1.00 27.48  ? 152 TYR B C   1 
ATOM   2900 O O   . TYR B 1 108 ? 13.374  -17.798 18.141  1.00 22.58  ? 152 TYR B O   1 
ATOM   2901 C CB  . TYR B 1 108 ? 13.489  -14.980 19.801  1.00 25.33  ? 152 TYR B CB  1 
ATOM   2902 C CG  . TYR B 1 108 ? 14.327  -15.917 20.640  1.00 23.41  ? 152 TYR B CG  1 
ATOM   2903 C CD1 . TYR B 1 108 ? 13.760  -17.026 21.268  1.00 24.35  ? 152 TYR B CD1 1 
ATOM   2904 C CD2 . TYR B 1 108 ? 15.670  -15.644 20.880  1.00 26.56  ? 152 TYR B CD2 1 
ATOM   2905 C CE1 . TYR B 1 108 ? 14.506  -17.830 22.123  1.00 23.49  ? 152 TYR B CE1 1 
ATOM   2906 C CE2 . TYR B 1 108 ? 16.428  -16.439 21.732  1.00 27.33  ? 152 TYR B CE2 1 
ATOM   2907 C CZ  . TYR B 1 108 ? 15.841  -17.528 22.353  1.00 31.03  ? 152 TYR B CZ  1 
ATOM   2908 O OH  . TYR B 1 108 ? 16.588  -18.290 23.220  1.00 24.61  ? 152 TYR B OH  1 
ATOM   2909 N N   . LEU B 1 109 ? 11.324  -16.913 18.343  1.00 26.11  ? 153 LEU B N   1 
ATOM   2910 C CA  . LEU B 1 109 ? 10.648  -18.206 18.296  1.00 20.10  ? 153 LEU B CA  1 
ATOM   2911 C C   . LEU B 1 109 ? 10.708  -18.850 16.921  1.00 23.34  ? 153 LEU B C   1 
ATOM   2912 O O   . LEU B 1 109 ? 10.822  -20.072 16.799  1.00 22.66  ? 153 LEU B O   1 
ATOM   2913 C CB  . LEU B 1 109 ? 9.175   -18.050 18.681  1.00 22.02  ? 153 LEU B CB  1 
ATOM   2914 C CG  . LEU B 1 109 ? 8.810   -17.422 20.027  1.00 25.65  ? 153 LEU B CG  1 
ATOM   2915 C CD1 . LEU B 1 109 ? 7.295   -17.393 20.161  1.00 28.12  ? 153 LEU B CD1 1 
ATOM   2916 C CD2 . LEU B 1 109 ? 9.427   -18.218 21.169  1.00 25.74  ? 153 LEU B CD2 1 
ATOM   2917 N N   . ALA B 1 110 ? 10.638  -18.020 15.885  1.00 26.36  ? 154 ALA B N   1 
ATOM   2918 C CA  . ALA B 1 110 ? 10.620  -18.503 14.511  1.00 24.80  ? 154 ALA B CA  1 
ATOM   2919 C C   . ALA B 1 110 ? 11.944  -18.531 13.756  1.00 27.74  ? 154 ALA B C   1 
ATOM   2920 O O   . ALA B 1 110 ? 12.037  -19.153 12.694  1.00 31.21  ? 154 ALA B O   1 
ATOM   2921 C CB  . ALA B 1 110 ? 9.609   -17.694 13.721  1.00 21.21  ? 154 ALA B CB  1 
ATOM   2922 N N   . ASP B 1 111 ? 12.969  -17.876 14.287  1.00 27.01  ? 155 ASP B N   1 
ATOM   2923 C CA  . ASP B 1 111 ? 14.245  -17.831 13.588  1.00 27.20  ? 155 ASP B CA  1 
ATOM   2924 C C   . ASP B 1 111 ? 14.746  -19.172 13.051  1.00 32.95  ? 155 ASP B C   1 
ATOM   2925 O O   . ASP B 1 111 ? 14.903  -20.139 13.801  1.00 29.16  ? 155 ASP B O   1 
ATOM   2926 C CB  . ASP B 1 111 ? 15.321  -17.219 14.471  1.00 28.58  ? 155 ASP B CB  1 
ATOM   2927 C CG  . ASP B 1 111 ? 16.525  -16.766 13.669  1.00 35.63  ? 155 ASP B CG  1 
ATOM   2928 O OD1 . ASP B 1 111 ? 17.546  -16.371 14.273  1.00 40.74  ? 155 ASP B OD1 1 
ATOM   2929 O OD2 . ASP B 1 111 ? 16.440  -16.801 12.422  1.00 36.35  ? 155 ASP B OD2 1 
ATOM   2930 N N   . ASP B 1 112 ? 14.997  -19.206 11.741  1.00 33.44  ? 156 ASP B N   1 
ATOM   2931 C CA  . ASP B 1 112 ? 15.505  -20.387 11.047  1.00 34.65  ? 156 ASP B CA  1 
ATOM   2932 C C   . ASP B 1 112 ? 14.625  -21.622 11.081  1.00 36.11  ? 156 ASP B C   1 
ATOM   2933 O O   . ASP B 1 112 ? 15.103  -22.725 10.838  1.00 38.53  ? 156 ASP B O   1 
ATOM   2934 C CB  . ASP B 1 112 ? 16.883  -20.775 11.577  1.00 40.09  ? 156 ASP B CB  1 
ATOM   2935 C CG  . ASP B 1 112 ? 17.966  -19.829 11.126  1.00 53.16  ? 156 ASP B CG  1 
ATOM   2936 O OD1 . ASP B 1 112 ? 17.932  -19.405 9.947   1.00 60.97  ? 156 ASP B OD1 1 
ATOM   2937 O OD2 . ASP B 1 112 ? 18.860  -19.525 11.942  1.00 60.14  ? 156 ASP B OD2 1 
ATOM   2938 N N   . LEU B 1 113 ? 13.347  -21.451 11.381  1.00 30.50  ? 157 LEU B N   1 
ATOM   2939 C CA  . LEU B 1 113 ? 12.452  -22.593 11.423  1.00 31.16  ? 157 LEU B CA  1 
ATOM   2940 C C   . LEU B 1 113 ? 11.550  -22.583 10.196  1.00 31.61  ? 157 LEU B C   1 
ATOM   2941 O O   . LEU B 1 113 ? 11.434  -21.572 9.512   1.00 32.60  ? 157 LEU B O   1 
ATOM   2942 C CB  . LEU B 1 113 ? 11.616  -22.573 12.712  1.00 27.78  ? 157 LEU B CB  1 
ATOM   2943 C CG  . LEU B 1 113 ? 12.417  -22.724 14.014  1.00 26.27  ? 157 LEU B CG  1 
ATOM   2944 C CD1 . LEU B 1 113 ? 11.495  -22.720 15.210  1.00 21.57  ? 157 LEU B CD1 1 
ATOM   2945 C CD2 . LEU B 1 113 ? 13.199  -24.013 13.973  1.00 25.17  ? 157 LEU B CD2 1 
ATOM   2946 N N   . THR B 1 114 ? 10.936  -23.724 9.910   1.00 30.08  ? 158 THR B N   1 
ATOM   2947 C CA  . THR B 1 114 ? 10.033  -23.856 8.776   1.00 31.87  ? 158 THR B CA  1 
ATOM   2948 C C   . THR B 1 114 ? 8.804   -24.590 9.293   1.00 31.65  ? 158 THR B C   1 
ATOM   2949 O O   . THR B 1 114 ? 8.924   -25.507 10.104  1.00 34.22  ? 158 THR B O   1 
ATOM   2950 C CB  . THR B 1 114 ? 10.677  -24.678 7.631   1.00 37.23  ? 158 THR B CB  1 
ATOM   2951 O OG1 . THR B 1 114 ? 11.797  -23.965 7.090   1.00 40.22  ? 158 THR B OG1 1 
ATOM   2952 C CG2 . THR B 1 114 ? 9.670   -24.924 6.521   1.00 36.76  ? 158 THR B CG2 1 
ATOM   2953 N N   . TRP B 1 115 ? 7.623   -24.188 8.841   1.00 25.46  ? 159 TRP B N   1 
ATOM   2954 C CA  . TRP B 1 115 ? 6.407   -24.844 9.300   1.00 28.45  ? 159 TRP B CA  1 
ATOM   2955 C C   . TRP B 1 115 ? 5.215   -24.589 8.377   1.00 22.57  ? 159 TRP B C   1 
ATOM   2956 O O   . TRP B 1 115 ? 5.209   -23.636 7.612   1.00 34.66  ? 159 TRP B O   1 
ATOM   2957 C CB  . TRP B 1 115 ? 6.074   -24.366 10.723  1.00 18.13  ? 159 TRP B CB  1 
ATOM   2958 C CG  . TRP B 1 115 ? 5.628   -22.936 10.783  1.00 18.99  ? 159 TRP B CG  1 
ATOM   2959 C CD1 . TRP B 1 115 ? 4.345   -22.470 10.708  1.00 26.37  ? 159 TRP B CD1 1 
ATOM   2960 C CD2 . TRP B 1 115 ? 6.469   -21.782 10.835  1.00 23.55  ? 159 TRP B CD2 1 
ATOM   2961 N NE1 . TRP B 1 115 ? 4.335   -21.097 10.702  1.00 25.67  ? 159 TRP B NE1 1 
ATOM   2962 C CE2 . TRP B 1 115 ? 5.627   -20.648 10.778  1.00 24.99  ? 159 TRP B CE2 1 
ATOM   2963 C CE3 . TRP B 1 115 ? 7.855   -21.594 10.917  1.00 14.46  ? 159 TRP B CE3 1 
ATOM   2964 C CZ2 . TRP B 1 115 ? 6.126   -19.344 10.801  1.00 26.40  ? 159 TRP B CZ2 1 
ATOM   2965 C CZ3 . TRP B 1 115 ? 8.352   -20.299 10.939  1.00 22.38  ? 159 TRP B CZ3 1 
ATOM   2966 C CH2 . TRP B 1 115 ? 7.488   -19.188 10.881  1.00 24.29  ? 159 TRP B CH2 1 
ATOM   2967 N N   . CYS B 1 116 ? 4.217   -25.461 8.453   1.00 26.80  ? 160 CYS B N   1 
ATOM   2968 C CA  . CYS B 1 116 ? 2.994   -25.330 7.668   1.00 30.07  ? 160 CYS B CA  1 
ATOM   2969 C C   . CYS B 1 116 ? 2.040   -26.465 8.016   1.00 30.33  ? 160 CYS B C   1 
ATOM   2970 O O   . CYS B 1 116 ? 2.461   -27.543 8.436   1.00 36.67  ? 160 CYS B O   1 
ATOM   2971 C CB  . CYS B 1 116 ? 3.281   -25.350 6.167   1.00 26.10  ? 160 CYS B CB  1 
ATOM   2972 S SG  . CYS B 1 116 ? 3.720   -26.977 5.483   1.00 32.66  ? 160 CYS B SG  1 
ATOM   2973 N N   . GLY B 1 117 ? 0.753   -26.205 7.855   1.00 29.58  ? 161 GLY B N   1 
ATOM   2974 C CA  . GLY B 1 117 ? -0.241  -27.212 8.148   1.00 28.58  ? 161 GLY B CA  1 
ATOM   2975 C C   . GLY B 1 117 ? -0.908  -27.745 6.894   1.00 33.98  ? 161 GLY B C   1 
ATOM   2976 O O   . GLY B 1 117 ? -0.276  -27.883 5.844   1.00 34.41  ? 161 GLY B O   1 
ATOM   2977 N N   . GLU B 1 118 ? -2.202  -28.023 7.007   1.00 37.87  ? 162 GLU B N   1 
ATOM   2978 C CA  . GLU B 1 118 ? -2.979  -28.577 5.908   1.00 40.91  ? 162 GLU B CA  1 
ATOM   2979 C C   . GLU B 1 118 ? -4.462  -28.340 6.179   1.00 38.13  ? 162 GLU B C   1 
ATOM   2980 O O   . GLU B 1 118 ? -4.896  -28.345 7.329   1.00 38.19  ? 162 GLU B O   1 
ATOM   2981 C CB  . GLU B 1 118 ? -2.677  -30.071 5.809   1.00 50.59  ? 162 GLU B CB  1 
ATOM   2982 C CG  . GLU B 1 118 ? -3.571  -30.865 4.894   1.00 65.96  ? 162 GLU B CG  1 
ATOM   2983 C CD  . GLU B 1 118 ? -3.239  -32.345 4.936   1.00 76.46  ? 162 GLU B CD  1 
ATOM   2984 O OE1 . GLU B 1 118 ? -3.906  -33.126 4.222   1.00 82.96  ? 162 GLU B OE1 1 
ATOM   2985 O OE2 . GLU B 1 118 ? -2.311  -32.725 5.687   1.00 76.35  ? 162 GLU B OE2 1 
ATOM   2986 N N   . PHE B 1 119 ? -5.235  -28.132 5.120   1.00 36.78  ? 163 PHE B N   1 
ATOM   2987 C CA  . PHE B 1 119 ? -6.664  -27.868 5.252   1.00 34.57  ? 163 PHE B CA  1 
ATOM   2988 C C   . PHE B 1 119 ? -7.437  -28.983 5.945   1.00 42.77  ? 163 PHE B C   1 
ATOM   2989 O O   . PHE B 1 119 ? -7.140  -30.171 5.777   1.00 39.60  ? 163 PHE B O   1 
ATOM   2990 C CB  . PHE B 1 119 ? -7.293  -27.620 3.875   1.00 35.24  ? 163 PHE B CB  1 
ATOM   2991 C CG  . PHE B 1 119 ? -8.751  -27.239 3.932   1.00 27.97  ? 163 PHE B CG  1 
ATOM   2992 C CD1 . PHE B 1 119 ? -9.141  -26.002 4.425   1.00 30.68  ? 163 PHE B CD1 1 
ATOM   2993 C CD2 . PHE B 1 119 ? -9.732  -28.123 3.498   1.00 32.83  ? 163 PHE B CD2 1 
ATOM   2994 C CE1 . PHE B 1 119 ? -10.496 -25.644 4.486   1.00 39.26  ? 163 PHE B CE1 1 
ATOM   2995 C CE2 . PHE B 1 119 ? -11.088 -27.779 3.552   1.00 34.25  ? 163 PHE B CE2 1 
ATOM   2996 C CZ  . PHE B 1 119 ? -11.470 -26.537 4.047   1.00 40.27  ? 163 PHE B CZ  1 
ATOM   2997 N N   . ASN B 1 120 ? -8.438  -28.573 6.719   1.00 46.01  ? 164 ASN B N   1 
ATOM   2998 C CA  . ASN B 1 120 ? -9.317  -29.477 7.451   1.00 49.37  ? 164 ASN B CA  1 
ATOM   2999 C C   . ASN B 1 120 ? -8.580  -30.570 8.218   1.00 48.84  ? 164 ASN B C   1 
ATOM   3000 O O   . ASN B 1 120 ? -9.133  -31.634 8.492   1.00 48.60  ? 164 ASN B O   1 
ATOM   3001 C CB  . ASN B 1 120 ? -10.324 -30.106 6.485   1.00 49.02  ? 164 ASN B CB  1 
ATOM   3002 C CG  . ASN B 1 120 ? -11.465 -30.782 7.202   1.00 48.60  ? 164 ASN B CG  1 
ATOM   3003 O OD1 . ASN B 1 120 ? -12.153 -30.162 8.012   1.00 53.22  ? 164 ASN B OD1 1 
ATOM   3004 N ND2 . ASN B 1 120 ? -11.678 -32.059 6.908   1.00 56.42  ? 164 ASN B ND2 1 
ATOM   3005 N N   . THR B 1 121 ? -7.330  -30.296 8.567   1.00 47.59  ? 165 THR B N   1 
ATOM   3006 C CA  . THR B 1 121 ? -6.517  -31.246 9.313   1.00 49.24  ? 165 THR B CA  1 
ATOM   3007 C C   . THR B 1 121 ? -5.915  -30.563 10.536  1.00 48.16  ? 165 THR B C   1 
ATOM   3008 O O   . THR B 1 121 ? -5.636  -29.364 10.525  1.00 44.84  ? 165 THR B O   1 
ATOM   3009 C CB  . THR B 1 121 ? -5.387  -31.813 8.428   1.00 52.25  ? 165 THR B CB  1 
ATOM   3010 O OG1 . THR B 1 121 ? -5.956  -32.668 7.429   1.00 55.85  ? 165 THR B OG1 1 
ATOM   3011 C CG2 . THR B 1 121 ? -4.396  -32.604 9.251   1.00 46.93  ? 165 THR B CG2 1 
ATOM   3012 N N   . SER B 1 122 ? -5.736  -31.325 11.602  1.00 43.44  ? 166 SER B N   1 
ATOM   3013 C CA  . SER B 1 122 ? -5.161  -30.773 12.815  1.00 45.30  ? 166 SER B CA  1 
ATOM   3014 C C   . SER B 1 122 ? -3.715  -31.238 12.914  1.00 41.71  ? 166 SER B C   1 
ATOM   3015 O O   . SER B 1 122 ? -3.095  -31.158 13.968  1.00 48.15  ? 166 SER B O   1 
ATOM   3016 C CB  . SER B 1 122 ? -5.961  -31.245 14.035  1.00 49.07  ? 166 SER B CB  1 
ATOM   3017 O OG  . SER B 1 122 ? -6.041  -32.662 14.083  1.00 47.77  ? 166 SER B OG  1 
ATOM   3018 N N   . LYS B 1 123 ? -3.180  -31.706 11.794  1.00 39.96  ? 167 LYS B N   1 
ATOM   3019 C CA  . LYS B 1 123 ? -1.820  -32.214 11.741  1.00 40.32  ? 167 LYS B CA  1 
ATOM   3020 C C   . LYS B 1 123 ? -0.822  -31.298 11.032  1.00 40.88  ? 167 LYS B C   1 
ATOM   3021 O O   . LYS B 1 123 ? -1.173  -30.559 10.111  1.00 35.47  ? 167 LYS B O   1 
ATOM   3022 C CB  . LYS B 1 123 ? -1.831  -33.594 11.074  1.00 52.03  ? 167 LYS B CB  1 
ATOM   3023 C CG  . LYS B 1 123 ? -0.458  -34.203 10.843  1.00 65.54  ? 167 LYS B CG  1 
ATOM   3024 C CD  . LYS B 1 123 ? -0.563  -35.605 10.254  1.00 69.16  ? 167 LYS B CD  1 
ATOM   3025 C CE  . LYS B 1 123 ? 0.821   -36.209 10.045  1.00 73.67  ? 167 LYS B CE  1 
ATOM   3026 N NZ  . LYS B 1 123 ? 1.640   -36.164 11.297  1.00 70.88  ? 167 LYS B NZ  1 
ATOM   3027 N N   . ILE B 1 124 ? 0.431   -31.362 11.479  1.00 39.02  ? 168 ILE B N   1 
ATOM   3028 C CA  . ILE B 1 124 ? 1.507   -30.566 10.907  1.00 38.23  ? 168 ILE B CA  1 
ATOM   3029 C C   . ILE B 1 124 ? 2.210   -31.337 9.797   1.00 42.70  ? 168 ILE B C   1 
ATOM   3030 O O   . ILE B 1 124 ? 2.566   -32.508 9.964   1.00 40.47  ? 168 ILE B O   1 
ATOM   3031 C CB  . ILE B 1 124 ? 2.539   -30.176 11.983  1.00 34.71  ? 168 ILE B CB  1 
ATOM   3032 C CG1 . ILE B 1 124 ? 1.983   -29.039 12.834  1.00 36.97  ? 168 ILE B CG1 1 
ATOM   3033 C CG2 . ILE B 1 124 ? 3.855   -29.765 11.340  1.00 33.11  ? 168 ILE B CG2 1 
ATOM   3034 C CD1 . ILE B 1 124 ? 2.952   -28.546 13.879  1.00 30.91  ? 168 ILE B CD1 1 
ATOM   3035 N N   . ASN B 1 125 ? 2.416   -30.663 8.669   1.00 40.21  ? 169 ASN B N   1 
ATOM   3036 C CA  . ASN B 1 125 ? 3.065   -31.263 7.511   1.00 35.81  ? 169 ASN B CA  1 
ATOM   3037 C C   . ASN B 1 125 ? 4.579   -31.268 7.663   1.00 37.27  ? 169 ASN B C   1 
ATOM   3038 O O   . ASN B 1 125 ? 5.228   -30.235 7.486   1.00 34.19  ? 169 ASN B O   1 
ATOM   3039 C CB  . ASN B 1 125 ? 2.685   -30.489 6.243   1.00 38.04  ? 169 ASN B CB  1 
ATOM   3040 C CG  . ASN B 1 125 ? 3.156   -31.174 4.972   1.00 40.05  ? 169 ASN B CG  1 
ATOM   3041 O OD1 . ASN B 1 125 ? 4.260   -31.722 4.914   1.00 38.06  ? 169 ASN B OD1 1 
ATOM   3042 N ND2 . ASN B 1 125 ? 2.322   -31.131 3.937   1.00 36.28  ? 169 ASN B ND2 1 
ATOM   3043 N N   . TYR B 1 126 ? 5.143   -32.426 7.997   1.00 39.09  ? 170 TYR B N   1 
ATOM   3044 C CA  . TYR B 1 126 ? 6.590   -32.534 8.131   1.00 42.34  ? 170 TYR B CA  1 
ATOM   3045 C C   . TYR B 1 126 ? 7.170   -33.008 6.808   1.00 40.11  ? 170 TYR B C   1 
ATOM   3046 O O   . TYR B 1 126 ? 8.383   -33.056 6.635   1.00 44.98  ? 170 TYR B O   1 
ATOM   3047 C CB  . TYR B 1 126 ? 6.971   -33.513 9.245   1.00 42.45  ? 170 TYR B CB  1 
ATOM   3048 C CG  . TYR B 1 126 ? 6.583   -33.040 10.630  1.00 45.97  ? 170 TYR B CG  1 
ATOM   3049 C CD1 . TYR B 1 126 ? 5.294   -33.242 11.123  1.00 40.56  ? 170 TYR B CD1 1 
ATOM   3050 C CD2 . TYR B 1 126 ? 7.503   -32.372 11.444  1.00 44.36  ? 170 TYR B CD2 1 
ATOM   3051 C CE1 . TYR B 1 126 ? 4.927   -32.796 12.392  1.00 43.11  ? 170 TYR B CE1 1 
ATOM   3052 C CE2 . TYR B 1 126 ? 7.148   -31.918 12.716  1.00 46.39  ? 170 TYR B CE2 1 
ATOM   3053 C CZ  . TYR B 1 126 ? 5.859   -32.135 13.183  1.00 49.64  ? 170 TYR B CZ  1 
ATOM   3054 O OH  . TYR B 1 126 ? 5.502   -31.698 14.441  1.00 46.98  ? 170 TYR B OH  1 
ATOM   3055 N N   . GLN B 1 127 ? 6.284   -33.345 5.875   1.00 44.89  ? 171 GLN B N   1 
ATOM   3056 C CA  . GLN B 1 127 ? 6.670   -33.824 4.551   1.00 44.75  ? 171 GLN B CA  1 
ATOM   3057 C C   . GLN B 1 127 ? 7.258   -32.726 3.685   1.00 40.96  ? 171 GLN B C   1 
ATOM   3058 O O   . GLN B 1 127 ? 8.412   -32.800 3.265   1.00 36.36  ? 171 GLN B O   1 
ATOM   3059 C CB  . GLN B 1 127 ? 5.455   -34.428 3.835   1.00 52.33  ? 171 GLN B CB  1 
ATOM   3060 C CG  . GLN B 1 127 ? 5.206   -35.898 4.143   1.00 67.71  ? 171 GLN B CG  1 
ATOM   3061 C CD  . GLN B 1 127 ? 5.230   -36.202 5.631   1.00 76.64  ? 171 GLN B CD  1 
ATOM   3062 O OE1 . GLN B 1 127 ? 4.401   -35.701 6.395   1.00 85.80  ? 171 GLN B OE1 1 
ATOM   3063 N NE2 . GLN B 1 127 ? 6.188   -37.026 6.052   1.00 74.87  ? 171 GLN B NE2 1 
ATOM   3064 N N   . SER B 1 128 ? 6.451   -31.706 3.419   1.00 40.65  ? 172 SER B N   1 
ATOM   3065 C CA  . SER B 1 128 ? 6.874   -30.586 2.588   1.00 36.60  ? 172 SER B CA  1 
ATOM   3066 C C   . SER B 1 128 ? 6.009   -29.362 2.869   1.00 32.93  ? 172 SER B C   1 
ATOM   3067 O O   . SER B 1 128 ? 4.913   -29.486 3.411   1.00 32.78  ? 172 SER B O   1 
ATOM   3068 C CB  . SER B 1 128 ? 6.740   -30.974 1.119   1.00 38.78  ? 172 SER B CB  1 
ATOM   3069 O OG  . SER B 1 128 ? 5.417   -31.413 0.842   1.00 40.01  ? 172 SER B OG  1 
ATOM   3070 N N   . CYS B 1 129 ? 6.503   -28.186 2.496   1.00 28.67  ? 173 CYS B N   1 
ATOM   3071 C CA  . CYS B 1 129 ? 5.759   -26.942 2.687   1.00 33.32  ? 173 CYS B CA  1 
ATOM   3072 C C   . CYS B 1 129 ? 5.932   -26.025 1.476   1.00 36.13  ? 173 CYS B C   1 
ATOM   3073 O O   . CYS B 1 129 ? 6.984   -26.012 0.840   1.00 37.35  ? 173 CYS B O   1 
ATOM   3074 C CB  . CYS B 1 129 ? 6.228   -26.205 3.949   1.00 36.36  ? 173 CYS B CB  1 
ATOM   3075 S SG  . CYS B 1 129 ? 5.747   -26.974 5.530   1.00 32.33  ? 173 CYS B SG  1 
ATOM   3076 N N   . PRO B 1 130 ? 4.901   -25.229 1.157   1.00 37.06  ? 174 PRO B N   1 
ATOM   3077 C CA  . PRO B 1 130 ? 4.926   -24.305 0.019   1.00 39.60  ? 174 PRO B CA  1 
ATOM   3078 C C   . PRO B 1 130 ? 6.232   -23.538 -0.154  1.00 42.44  ? 174 PRO B C   1 
ATOM   3079 O O   . PRO B 1 130 ? 6.878   -23.157 0.824   1.00 37.88  ? 174 PRO B O   1 
ATOM   3080 C CB  . PRO B 1 130 ? 3.762   -23.369 0.315   1.00 35.13  ? 174 PRO B CB  1 
ATOM   3081 C CG  . PRO B 1 130 ? 2.797   -24.260 1.008   1.00 41.72  ? 174 PRO B CG  1 
ATOM   3082 C CD  . PRO B 1 130 ? 3.680   -25.033 1.957   1.00 36.11  ? 174 PRO B CD  1 
ATOM   3083 N N   . ASP B 1 131 ? 6.620   -23.325 -1.407  1.00 43.66  ? 175 ASP B N   1 
ATOM   3084 C CA  . ASP B 1 131 ? 7.821   -22.560 -1.708  1.00 45.20  ? 175 ASP B CA  1 
ATOM   3085 C C   . ASP B 1 131 ? 7.346   -21.216 -2.228  1.00 47.30  ? 175 ASP B C   1 
ATOM   3086 O O   . ASP B 1 131 ? 6.502   -21.145 -3.122  1.00 49.15  ? 175 ASP B O   1 
ATOM   3087 C CB  . ASP B 1 131 ? 8.682   -23.248 -2.770  1.00 49.71  ? 175 ASP B CB  1 
ATOM   3088 C CG  . ASP B 1 131 ? 9.855   -22.379 -3.223  1.00 53.97  ? 175 ASP B CG  1 
ATOM   3089 O OD1 . ASP B 1 131 ? 9.625   -21.389 -3.954  1.00 52.22  ? 175 ASP B OD1 1 
ATOM   3090 O OD2 . ASP B 1 131 ? 11.007  -22.682 -2.842  1.00 49.67  ? 175 ASP B OD2 1 
ATOM   3091 N N   . TRP B 1 132 ? 7.881   -20.152 -1.646  1.00 52.79  ? 176 TRP B N   1 
ATOM   3092 C CA  . TRP B 1 132 ? 7.517   -18.800 -2.028  1.00 55.34  ? 176 TRP B CA  1 
ATOM   3093 C C   . TRP B 1 132 ? 7.403   -18.621 -3.540  1.00 53.58  ? 176 TRP B C   1 
ATOM   3094 O O   . TRP B 1 132 ? 6.370   -18.177 -4.040  1.00 51.91  ? 176 TRP B O   1 
ATOM   3095 C CB  . TRP B 1 132 ? 8.539   -17.814 -1.439  1.00 62.17  ? 176 TRP B CB  1 
ATOM   3096 C CG  . TRP B 1 132 ? 9.032   -16.768 -2.395  1.00 73.53  ? 176 TRP B CG  1 
ATOM   3097 C CD1 . TRP B 1 132 ? 8.279   -15.855 -3.078  1.00 77.87  ? 176 TRP B CD1 1 
ATOM   3098 C CD2 . TRP B 1 132 ? 10.392  -16.523 -2.766  1.00 77.40  ? 176 TRP B CD2 1 
ATOM   3099 N NE1 . TRP B 1 132 ? 9.085   -15.055 -3.849  1.00 83.76  ? 176 TRP B NE1 1 
ATOM   3100 C CE2 . TRP B 1 132 ? 10.388  -15.442 -3.678  1.00 84.14  ? 176 TRP B CE2 1 
ATOM   3101 C CE3 . TRP B 1 132 ? 11.614  -17.109 -2.417  1.00 77.93  ? 176 TRP B CE3 1 
ATOM   3102 C CZ2 . TRP B 1 132 ? 11.564  -14.933 -4.248  1.00 85.89  ? 176 TRP B CZ2 1 
ATOM   3103 C CZ3 . TRP B 1 132 ? 12.785  -16.603 -2.985  1.00 85.72  ? 176 TRP B CZ3 1 
ATOM   3104 C CH2 . TRP B 1 132 ? 12.748  -15.525 -3.891  1.00 84.46  ? 176 TRP B CH2 1 
ATOM   3105 N N   . ARG B 1 133 ? 8.458   -18.978 -4.264  1.00 51.87  ? 177 ARG B N   1 
ATOM   3106 C CA  . ARG B 1 133 ? 8.472   -18.813 -5.710  1.00 56.23  ? 177 ARG B CA  1 
ATOM   3107 C C   . ARG B 1 133 ? 7.764   -19.897 -6.522  1.00 52.87  ? 177 ARG B C   1 
ATOM   3108 O O   . ARG B 1 133 ? 6.904   -19.596 -7.353  1.00 44.57  ? 177 ARG B O   1 
ATOM   3109 C CB  . ARG B 1 133 ? 9.918   -18.680 -6.198  1.00 63.88  ? 177 ARG B CB  1 
ATOM   3110 C CG  . ARG B 1 133 ? 10.039  -18.405 -7.688  1.00 71.44  ? 177 ARG B CG  1 
ATOM   3111 C CD  . ARG B 1 133 ? 11.464  -18.041 -8.092  1.00 76.64  ? 177 ARG B CD  1 
ATOM   3112 N NE  . ARG B 1 133 ? 11.524  -17.606 -9.488  1.00 83.03  ? 177 ARG B NE  1 
ATOM   3113 C CZ  . ARG B 1 133 ? 12.598  -17.081 -10.070 1.00 85.52  ? 177 ARG B CZ  1 
ATOM   3114 N NH1 . ARG B 1 133 ? 13.723  -16.918 -9.381  1.00 86.44  ? 177 ARG B NH1 1 
ATOM   3115 N NH2 . ARG B 1 133 ? 12.546  -16.711 -11.344 1.00 84.75  ? 177 ARG B NH2 1 
ATOM   3116 N N   . LYS B 1 134 ? 8.120   -21.153 -6.275  1.00 51.89  ? 178 LYS B N   1 
ATOM   3117 C CA  . LYS B 1 134 ? 7.549   -22.270 -7.020  1.00 50.55  ? 178 LYS B CA  1 
ATOM   3118 C C   . LYS B 1 134 ? 6.109   -22.649 -6.683  1.00 50.39  ? 178 LYS B C   1 
ATOM   3119 O O   . LYS B 1 134 ? 5.384   -23.130 -7.549  1.00 47.76  ? 178 LYS B O   1 
ATOM   3120 C CB  . LYS B 1 134 ? 8.445   -23.504 -6.872  1.00 51.62  ? 178 LYS B CB  1 
ATOM   3121 C CG  . LYS B 1 134 ? 9.912   -23.262 -7.214  1.00 49.99  ? 178 LYS B CG  1 
ATOM   3122 C CD  . LYS B 1 134 ? 10.760  -24.500 -6.918  1.00 57.40  ? 178 LYS B CD  1 
ATOM   3123 C CE  . LYS B 1 134 ? 12.255  -24.182 -6.899  1.00 54.83  ? 178 LYS B CE  1 
ATOM   3124 N NZ  . LYS B 1 134 ? 12.767  -23.682 -8.206  1.00 59.74  ? 178 LYS B NZ  1 
ATOM   3125 N N   . ASP B 1 135 ? 5.679   -22.442 -5.444  1.00 48.51  ? 179 ASP B N   1 
ATOM   3126 C CA  . ASP B 1 135 ? 4.312   -22.811 -5.094  1.00 49.29  ? 179 ASP B CA  1 
ATOM   3127 C C   . ASP B 1 135 ? 3.388   -21.627 -4.850  1.00 48.36  ? 179 ASP B C   1 
ATOM   3128 O O   . ASP B 1 135 ? 2.463   -21.395 -5.627  1.00 46.25  ? 179 ASP B O   1 
ATOM   3129 C CB  . ASP B 1 135 ? 4.314   -23.746 -3.885  1.00 49.29  ? 179 ASP B CB  1 
ATOM   3130 C CG  . ASP B 1 135 ? 5.105   -25.011 -4.141  1.00 51.48  ? 179 ASP B CG  1 
ATOM   3131 O OD1 . ASP B 1 135 ? 4.852   -25.664 -5.177  1.00 54.80  ? 179 ASP B OD1 1 
ATOM   3132 O OD2 . ASP B 1 135 ? 5.981   -25.351 -3.317  1.00 51.73  ? 179 ASP B OD2 1 
ATOM   3133 N N   . CYS B 1 136 ? 3.626   -20.885 -3.773  1.00 45.85  ? 180 CYS B N   1 
ATOM   3134 C CA  . CYS B 1 136 ? 2.800   -19.721 -3.462  1.00 45.43  ? 180 CYS B CA  1 
ATOM   3135 C C   . CYS B 1 136 ? 3.505   -18.778 -2.494  1.00 44.73  ? 180 CYS B C   1 
ATOM   3136 O O   . CYS B 1 136 ? 4.440   -19.173 -1.798  1.00 45.61  ? 180 CYS B O   1 
ATOM   3137 C CB  . CYS B 1 136 ? 1.450   -20.156 -2.878  1.00 48.82  ? 180 CYS B CB  1 
ATOM   3138 S SG  . CYS B 1 136 ? 1.531   -21.159 -1.355  1.00 48.63  ? 180 CYS B SG  1 
ATOM   3139 N N   . SER B 1 137 ? 3.054   -17.531 -2.451  1.00 39.43  ? 181 SER B N   1 
ATOM   3140 C CA  . SER B 1 137 ? 3.665   -16.543 -1.575  1.00 40.14  ? 181 SER B CA  1 
ATOM   3141 C C   . SER B 1 137 ? 2.966   -16.416 -0.214  1.00 36.94  ? 181 SER B C   1 
ATOM   3142 O O   . SER B 1 137 ? 3.590   -16.041 0.778   1.00 34.89  ? 181 SER B O   1 
ATOM   3143 C CB  . SER B 1 137 ? 3.702   -15.184 -2.284  1.00 37.44  ? 181 SER B CB  1 
ATOM   3144 O OG  . SER B 1 137 ? 2.400   -14.748 -2.618  1.00 33.15  ? 181 SER B OG  1 
ATOM   3145 N N   . ASN B 1 138 ? 1.677   -16.741 -0.168  1.00 35.25  ? 182 ASN B N   1 
ATOM   3146 C CA  . ASN B 1 138 ? 0.906   -16.658 1.072   1.00 37.37  ? 182 ASN B CA  1 
ATOM   3147 C C   . ASN B 1 138 ? 1.026   -17.898 1.966   1.00 34.85  ? 182 ASN B C   1 
ATOM   3148 O O   . ASN B 1 138 ? 0.021   -18.409 2.459   1.00 33.76  ? 182 ASN B O   1 
ATOM   3149 C CB  . ASN B 1 138 ? -0.575  -16.420 0.758   1.00 44.09  ? 182 ASN B CB  1 
ATOM   3150 C CG  . ASN B 1 138 ? -0.812  -15.140 -0.021  1.00 47.58  ? 182 ASN B CG  1 
ATOM   3151 O OD1 . ASN B 1 138 ? -0.314  -14.077 0.345   1.00 40.86  ? 182 ASN B OD1 1 
ATOM   3152 N ND2 . ASN B 1 138 ? -1.587  -15.237 -1.098  1.00 51.06  ? 182 ASN B ND2 1 
ATOM   3153 N N   . ASN B 1 139 ? 2.248   -18.376 2.177   1.00 30.63  ? 183 ASN B N   1 
ATOM   3154 C CA  . ASN B 1 139 ? 2.465   -19.550 3.014   1.00 33.27  ? 183 ASN B CA  1 
ATOM   3155 C C   . ASN B 1 139 ? 2.790   -19.120 4.452   1.00 35.49  ? 183 ASN B C   1 
ATOM   3156 O O   . ASN B 1 139 ? 3.300   -18.024 4.673   1.00 36.51  ? 183 ASN B O   1 
ATOM   3157 C CB  . ASN B 1 139 ? 3.595   -20.407 2.444   1.00 26.37  ? 183 ASN B CB  1 
ATOM   3158 C CG  . ASN B 1 139 ? 4.863   -19.622 2.224   1.00 28.67  ? 183 ASN B CG  1 
ATOM   3159 O OD1 . ASN B 1 139 ? 5.059   -19.028 1.167   1.00 33.29  ? 183 ASN B OD1 1 
ATOM   3160 N ND2 . ASN B 1 139 ? 5.730   -19.601 3.230   1.00 27.49  ? 183 ASN B ND2 1 
ATOM   3161 N N   . PRO B 1 140 ? 2.514   -19.995 5.440   1.00 36.40  ? 184 PRO B N   1 
ATOM   3162 C CA  . PRO B 1 140 ? 2.742   -19.761 6.876   1.00 30.76  ? 184 PRO B CA  1 
ATOM   3163 C C   . PRO B 1 140 ? 4.013   -18.997 7.210   1.00 25.28  ? 184 PRO B C   1 
ATOM   3164 O O   . PRO B 1 140 ? 3.982   -17.988 7.916   1.00 26.15  ? 184 PRO B O   1 
ATOM   3165 C CB  . PRO B 1 140 ? 2.756   -21.173 7.460   1.00 31.71  ? 184 PRO B CB  1 
ATOM   3166 C CG  . PRO B 1 140 ? 1.806   -21.905 6.578   1.00 33.25  ? 184 PRO B CG  1 
ATOM   3167 C CD  . PRO B 1 140 ? 2.200   -21.416 5.196   1.00 31.55  ? 184 PRO B CD  1 
ATOM   3168 N N   . VAL B 1 141 ? 5.134   -19.484 6.702   1.00 24.04  ? 185 VAL B N   1 
ATOM   3169 C CA  . VAL B 1 141 ? 6.413   -18.843 6.954   1.00 24.88  ? 185 VAL B CA  1 
ATOM   3170 C C   . VAL B 1 141 ? 6.485   -17.438 6.353   1.00 29.35  ? 185 VAL B C   1 
ATOM   3171 O O   . VAL B 1 141 ? 6.638   -16.458 7.079   1.00 33.69  ? 185 VAL B O   1 
ATOM   3172 C CB  . VAL B 1 141 ? 7.568   -19.713 6.407   1.00 29.66  ? 185 VAL B CB  1 
ATOM   3173 C CG1 . VAL B 1 141 ? 8.904   -18.986 6.565   1.00 14.10  ? 185 VAL B CG1 1 
ATOM   3174 C CG2 . VAL B 1 141 ? 7.590   -21.054 7.151   1.00 21.34  ? 185 VAL B CG2 1 
ATOM   3175 N N   . SER B 1 142 ? 6.362   -17.340 5.032   1.00 30.08  ? 186 SER B N   1 
ATOM   3176 C CA  . SER B 1 142 ? 6.426   -16.048 4.349   1.00 29.73  ? 186 SER B CA  1 
ATOM   3177 C C   . SER B 1 142 ? 5.516   -14.978 4.943   1.00 27.01  ? 186 SER B C   1 
ATOM   3178 O O   . SER B 1 142 ? 5.965   -13.867 5.208   1.00 31.51  ? 186 SER B O   1 
ATOM   3179 C CB  . SER B 1 142 ? 6.112   -16.216 2.858   1.00 21.09  ? 186 SER B CB  1 
ATOM   3180 O OG  . SER B 1 142 ? 7.151   -16.938 2.217   1.00 31.78  ? 186 SER B OG  1 
ATOM   3181 N N   . VAL B 1 143 ? 4.243   -15.305 5.145   1.00 24.86  ? 187 VAL B N   1 
ATOM   3182 C CA  . VAL B 1 143 ? 3.300   -14.346 5.707   1.00 23.56  ? 187 VAL B CA  1 
ATOM   3183 C C   . VAL B 1 143 ? 3.692   -13.917 7.121   1.00 24.05  ? 187 VAL B C   1 
ATOM   3184 O O   . VAL B 1 143 ? 3.494   -12.768 7.510   1.00 21.34  ? 187 VAL B O   1 
ATOM   3185 C CB  . VAL B 1 143 ? 1.880   -14.928 5.752   1.00 29.23  ? 187 VAL B CB  1 
ATOM   3186 C CG1 . VAL B 1 143 ? 0.953   -13.963 6.483   1.00 21.85  ? 187 VAL B CG1 1 
ATOM   3187 C CG2 . VAL B 1 143 ? 1.383   -15.202 4.329   1.00 18.30  ? 187 VAL B CG2 1 
ATOM   3188 N N   . PHE B 1 144 ? 4.237   -14.846 7.895   1.00 26.57  ? 188 PHE B N   1 
ATOM   3189 C CA  . PHE B 1 144 ? 4.655   -14.527 9.250   1.00 29.99  ? 188 PHE B CA  1 
ATOM   3190 C C   . PHE B 1 144 ? 5.692   -13.411 9.221   1.00 30.14  ? 188 PHE B C   1 
ATOM   3191 O O   . PHE B 1 144 ? 5.467   -12.314 9.745   1.00 29.06  ? 188 PHE B O   1 
ATOM   3192 C CB  . PHE B 1 144 ? 5.277   -15.752 9.936   1.00 26.49  ? 188 PHE B CB  1 
ATOM   3193 C CG  . PHE B 1 144 ? 5.952   -15.435 11.246  1.00 15.26  ? 188 PHE B CG  1 
ATOM   3194 C CD1 . PHE B 1 144 ? 5.202   -15.256 12.409  1.00 25.38  ? 188 PHE B CD1 1 
ATOM   3195 C CD2 . PHE B 1 144 ? 7.332   -15.276 11.311  1.00 18.41  ? 188 PHE B CD2 1 
ATOM   3196 C CE1 . PHE B 1 144 ? 5.818   -14.921 13.624  1.00 23.19  ? 188 PHE B CE1 1 
ATOM   3197 C CE2 . PHE B 1 144 ? 7.965   -14.939 12.521  1.00 20.39  ? 188 PHE B CE2 1 
ATOM   3198 C CZ  . PHE B 1 144 ? 7.204   -14.761 13.682  1.00 18.28  ? 188 PHE B CZ  1 
ATOM   3199 N N   . TRP B 1 145 ? 6.828   -13.700 8.597   1.00 25.42  ? 189 TRP B N   1 
ATOM   3200 C CA  . TRP B 1 145 ? 7.921   -12.742 8.537   1.00 29.88  ? 189 TRP B CA  1 
ATOM   3201 C C   . TRP B 1 145 ? 7.579   -11.363 8.000   1.00 31.22  ? 189 TRP B C   1 
ATOM   3202 O O   . TRP B 1 145 ? 8.060   -10.365 8.530   1.00 36.62  ? 189 TRP B O   1 
ATOM   3203 C CB  . TRP B 1 145 ? 9.096   -13.327 7.751   1.00 22.76  ? 189 TRP B CB  1 
ATOM   3204 C CG  . TRP B 1 145 ? 9.767   -14.438 8.484   1.00 34.09  ? 189 TRP B CG  1 
ATOM   3205 C CD1 . TRP B 1 145 ? 9.779   -15.759 8.141   1.00 35.86  ? 189 TRP B CD1 1 
ATOM   3206 C CD2 . TRP B 1 145 ? 10.485  -14.339 9.722   1.00 34.01  ? 189 TRP B CD2 1 
ATOM   3207 N NE1 . TRP B 1 145 ? 10.455  -16.488 9.085   1.00 38.04  ? 189 TRP B NE1 1 
ATOM   3208 C CE2 . TRP B 1 145 ? 10.900  -15.642 10.067  1.00 36.34  ? 189 TRP B CE2 1 
ATOM   3209 C CE3 . TRP B 1 145 ? 10.815  -13.276 10.572  1.00 28.75  ? 189 TRP B CE3 1 
ATOM   3210 C CZ2 . TRP B 1 145 ? 11.630  -15.913 11.230  1.00 33.25  ? 189 TRP B CZ2 1 
ATOM   3211 C CZ3 . TRP B 1 145 ? 11.538  -13.546 11.727  1.00 30.14  ? 189 TRP B CZ3 1 
ATOM   3212 C CH2 . TRP B 1 145 ? 11.938  -14.855 12.044  1.00 27.91  ? 189 TRP B CH2 1 
ATOM   3213 N N   . LYS B 1 146 ? 6.758   -11.285 6.962   1.00 26.11  ? 190 LYS B N   1 
ATOM   3214 C CA  . LYS B 1 146 ? 6.429   -9.973  6.425   1.00 29.91  ? 190 LYS B CA  1 
ATOM   3215 C C   . LYS B 1 146 ? 5.519   -9.258  7.413   1.00 30.64  ? 190 LYS B C   1 
ATOM   3216 O O   . LYS B 1 146 ? 5.561   -8.035  7.540   1.00 29.77  ? 190 LYS B O   1 
ATOM   3217 C CB  . LYS B 1 146 ? 5.768   -10.092 5.044   1.00 27.89  ? 190 LYS B CB  1 
ATOM   3218 C CG  . LYS B 1 146 ? 4.338   -10.595 5.037   1.00 37.66  ? 190 LYS B CG  1 
ATOM   3219 C CD  . LYS B 1 146 ? 3.854   -10.826 3.607   1.00 47.26  ? 190 LYS B CD  1 
ATOM   3220 C CE  . LYS B 1 146 ? 2.409   -11.326 3.570   1.00 56.84  ? 190 LYS B CE  1 
ATOM   3221 N NZ  . LYS B 1 146 ? 1.971   -11.715 2.193   1.00 45.34  ? 190 LYS B NZ  1 
ATOM   3222 N N   . THR B 1 147 ? 4.711   -10.034 8.128   1.00 29.55  ? 191 THR B N   1 
ATOM   3223 C CA  . THR B 1 147 ? 3.805   -9.474  9.119   1.00 30.16  ? 191 THR B CA  1 
ATOM   3224 C C   . THR B 1 147 ? 4.591   -8.894  10.289  1.00 34.61  ? 191 THR B C   1 
ATOM   3225 O O   . THR B 1 147 ? 4.399   -7.733  10.654  1.00 35.22  ? 191 THR B O   1 
ATOM   3226 C CB  . THR B 1 147 ? 2.849   -10.535 9.667   1.00 32.47  ? 191 THR B CB  1 
ATOM   3227 O OG1 . THR B 1 147 ? 1.961   -10.959 8.626   1.00 41.70  ? 191 THR B OG1 1 
ATOM   3228 C CG2 . THR B 1 147 ? 2.047   -9.981  10.830  1.00 31.31  ? 191 THR B CG2 1 
ATOM   3229 N N   . VAL B 1 148 ? 5.470   -9.700  10.882  1.00 27.27  ? 192 VAL B N   1 
ATOM   3230 C CA  . VAL B 1 148 ? 6.257   -9.217  12.005  1.00 28.30  ? 192 VAL B CA  1 
ATOM   3231 C C   . VAL B 1 148 ? 7.290   -8.182  11.563  1.00 24.73  ? 192 VAL B C   1 
ATOM   3232 O O   . VAL B 1 148 ? 7.553   -7.226  12.288  1.00 25.14  ? 192 VAL B O   1 
ATOM   3233 C CB  . VAL B 1 148 ? 6.966   -10.373 12.759  1.00 29.52  ? 192 VAL B CB  1 
ATOM   3234 C CG1 . VAL B 1 148 ? 5.934   -11.294 13.360  1.00 28.81  ? 192 VAL B CG1 1 
ATOM   3235 C CG2 . VAL B 1 148 ? 7.869   -11.146 11.821  1.00 29.63  ? 192 VAL B CG2 1 
ATOM   3236 N N   . SER B 1 149 ? 7.868   -8.359  10.378  1.00 20.57  ? 193 SER B N   1 
ATOM   3237 C CA  . SER B 1 149 ? 8.854   -7.395  9.879   1.00 27.49  ? 193 SER B CA  1 
ATOM   3238 C C   . SER B 1 149 ? 8.229   -6.014  9.711   1.00 29.77  ? 193 SER B C   1 
ATOM   3239 O O   . SER B 1 149 ? 8.864   -4.995  9.976   1.00 31.10  ? 193 SER B O   1 
ATOM   3240 C CB  . SER B 1 149 ? 9.424   -7.844  8.537   1.00 16.86  ? 193 SER B CB  1 
ATOM   3241 O OG  . SER B 1 149 ? 10.275  -8.960  8.699   1.00 31.85  ? 193 SER B OG  1 
ATOM   3242 N N   . ARG B 1 150 ? 6.978   -5.995  9.263   1.00 31.64  ? 194 ARG B N   1 
ATOM   3243 C CA  . ARG B 1 150 ? 6.249   -4.757  9.053   1.00 28.37  ? 194 ARG B CA  1 
ATOM   3244 C C   . ARG B 1 150 ? 5.986   -4.054  10.379  1.00 32.14  ? 194 ARG B C   1 
ATOM   3245 O O   . ARG B 1 150 ? 6.220   -2.854  10.515  1.00 26.72  ? 194 ARG B O   1 
ATOM   3246 C CB  . ARG B 1 150 ? 4.933   -5.062  8.337   1.00 31.84  ? 194 ARG B CB  1 
ATOM   3247 C CG  . ARG B 1 150 ? 3.962   -3.906  8.244   1.00 33.89  ? 194 ARG B CG  1 
ATOM   3248 C CD  . ARG B 1 150 ? 2.877   -4.226  7.230   1.00 44.10  ? 194 ARG B CD  1 
ATOM   3249 N NE  . ARG B 1 150 ? 1.601   -3.605  7.571   1.00 52.62  ? 194 ARG B NE  1 
ATOM   3250 C CZ  . ARG B 1 150 ? 0.801   -4.025  8.547   1.00 60.38  ? 194 ARG B CZ  1 
ATOM   3251 N NH1 . ARG B 1 150 ? 1.142   -5.077  9.288   1.00 63.55  ? 194 ARG B NH1 1 
ATOM   3252 N NH2 . ARG B 1 150 ? -0.343  -3.392  8.785   1.00 57.61  ? 194 ARG B NH2 1 
ATOM   3253 N N   . ARG B 1 151 ? 5.511   -4.814  11.359  1.00 30.28  ? 195 ARG B N   1 
ATOM   3254 C CA  . ARG B 1 151 ? 5.215   -4.264  12.674  1.00 35.82  ? 195 ARG B CA  1 
ATOM   3255 C C   . ARG B 1 151 ? 6.475   -3.727  13.346  1.00 32.35  ? 195 ARG B C   1 
ATOM   3256 O O   . ARG B 1 151 ? 6.458   -2.666  13.973  1.00 30.71  ? 195 ARG B O   1 
ATOM   3257 C CB  . ARG B 1 151 ? 4.555   -5.335  13.544  1.00 38.86  ? 195 ARG B CB  1 
ATOM   3258 C CG  . ARG B 1 151 ? 3.094   -5.577  13.199  1.00 54.42  ? 195 ARG B CG  1 
ATOM   3259 C CD  . ARG B 1 151 ? 2.539   -6.830  13.864  1.00 62.75  ? 195 ARG B CD  1 
ATOM   3260 N NE  . ARG B 1 151 ? 1.161   -6.638  14.311  1.00 65.64  ? 195 ARG B NE  1 
ATOM   3261 C CZ  . ARG B 1 151 ? 0.824   -5.938  15.390  1.00 62.74  ? 195 ARG B CZ  1 
ATOM   3262 N NH1 . ARG B 1 151 ? 1.767   -5.368  16.132  1.00 54.81  ? 195 ARG B NH1 1 
ATOM   3263 N NH2 . ARG B 1 151 ? -0.452  -5.805  15.726  1.00 64.25  ? 195 ARG B NH2 1 
ATOM   3264 N N   . PHE B 1 152 ? 7.571   -4.458  13.202  1.00 27.63  ? 196 PHE B N   1 
ATOM   3265 C CA  . PHE B 1 152 ? 8.825   -4.043  13.791  1.00 27.36  ? 196 PHE B CA  1 
ATOM   3266 C C   . PHE B 1 152 ? 9.233   -2.709  13.183  1.00 30.56  ? 196 PHE B C   1 
ATOM   3267 O O   . PHE B 1 152 ? 9.532   -1.759  13.905  1.00 34.43  ? 196 PHE B O   1 
ATOM   3268 C CB  . PHE B 1 152 ? 9.898   -5.097  13.533  1.00 22.10  ? 196 PHE B CB  1 
ATOM   3269 C CG  . PHE B 1 152 ? 11.124  -4.941  14.388  1.00 23.49  ? 196 PHE B CG  1 
ATOM   3270 C CD1 . PHE B 1 152 ? 11.013  -4.845  15.772  1.00 21.40  ? 196 PHE B CD1 1 
ATOM   3271 C CD2 . PHE B 1 152 ? 12.393  -4.935  13.817  1.00 22.24  ? 196 PHE B CD2 1 
ATOM   3272 C CE1 . PHE B 1 152 ? 12.151  -4.747  16.577  1.00 20.10  ? 196 PHE B CE1 1 
ATOM   3273 C CE2 . PHE B 1 152 ? 13.538  -4.837  14.612  1.00 25.08  ? 196 PHE B CE2 1 
ATOM   3274 C CZ  . PHE B 1 152 ? 13.415  -4.743  15.998  1.00 20.98  ? 196 PHE B CZ  1 
ATOM   3275 N N   . ALA B 1 153 ? 9.226   -2.635  11.854  1.00 32.28  ? 197 ALA B N   1 
ATOM   3276 C CA  . ALA B 1 153 ? 9.595   -1.410  11.148  1.00 31.06  ? 197 ALA B CA  1 
ATOM   3277 C C   . ALA B 1 153 ? 8.726   -0.219  11.579  1.00 33.23  ? 197 ALA B C   1 
ATOM   3278 O O   . ALA B 1 153 ? 9.244   0.859   11.889  1.00 31.10  ? 197 ALA B O   1 
ATOM   3279 C CB  . ALA B 1 153 ? 9.483   -1.625  9.643   1.00 26.10  ? 197 ALA B CB  1 
ATOM   3280 N N   . GLU B 1 154 ? 7.410   -0.424  11.602  1.00 29.59  ? 198 GLU B N   1 
ATOM   3281 C CA  . GLU B 1 154 ? 6.467   0.619   11.992  1.00 29.11  ? 198 GLU B CA  1 
ATOM   3282 C C   . GLU B 1 154 ? 6.694   1.149   13.411  1.00 33.22  ? 198 GLU B C   1 
ATOM   3283 O O   . GLU B 1 154 ? 6.232   2.238   13.748  1.00 31.26  ? 198 GLU B O   1 
ATOM   3284 C CB  . GLU B 1 154 ? 5.028   0.104   11.910  1.00 29.59  ? 198 GLU B CB  1 
ATOM   3285 C CG  . GLU B 1 154 ? 4.574   -0.369  10.546  1.00 37.39  ? 198 GLU B CG  1 
ATOM   3286 C CD  . GLU B 1 154 ? 3.143   -0.883  10.565  1.00 41.77  ? 198 GLU B CD  1 
ATOM   3287 O OE1 . GLU B 1 154 ? 2.792   -1.642  11.493  1.00 47.99  ? 198 GLU B OE1 1 
ATOM   3288 O OE2 . GLU B 1 154 ? 2.371   -0.537  9.649   1.00 49.86  ? 198 GLU B OE2 1 
ATOM   3289 N N   . ALA B 1 155 ? 7.393   0.385   14.245  1.00 31.87  ? 199 ALA B N   1 
ATOM   3290 C CA  . ALA B 1 155 ? 7.622   0.812   15.620  1.00 28.67  ? 199 ALA B CA  1 
ATOM   3291 C C   . ALA B 1 155 ? 8.907   1.606   15.790  1.00 24.52  ? 199 ALA B C   1 
ATOM   3292 O O   . ALA B 1 155 ? 9.157   2.159   16.859  1.00 31.62  ? 199 ALA B O   1 
ATOM   3293 C CB  . ALA B 1 155 ? 7.624   -0.409  16.567  1.00 20.46  ? 199 ALA B CB  1 
ATOM   3294 N N   . ALA B 1 156 ? 9.717   1.664   14.742  1.00 24.46  ? 200 ALA B N   1 
ATOM   3295 C CA  . ALA B 1 156 ? 10.979  2.390   14.805  1.00 25.40  ? 200 ALA B CA  1 
ATOM   3296 C C   . ALA B 1 156 ? 10.741  3.895   14.901  1.00 30.39  ? 200 ALA B C   1 
ATOM   3297 O O   . ALA B 1 156 ? 9.697   4.388   14.473  1.00 34.40  ? 200 ALA B O   1 
ATOM   3298 C CB  . ALA B 1 156 ? 11.829  2.064   13.585  1.00 24.82  ? 200 ALA B CB  1 
ATOM   3299 N N   . CYS B 1 157 ? 11.707  4.608   15.481  1.00 29.81  ? 201 CYS B N   1 
ATOM   3300 C CA  . CYS B 1 157 ? 11.636  6.060   15.647  1.00 29.00  ? 201 CYS B CA  1 
ATOM   3301 C C   . CYS B 1 157 ? 13.040  6.651   15.653  1.00 34.21  ? 201 CYS B C   1 
ATOM   3302 O O   . CYS B 1 157 ? 14.036  5.930   15.801  1.00 29.30  ? 201 CYS B O   1 
ATOM   3303 C CB  . CYS B 1 157 ? 10.973  6.436   16.973  1.00 29.08  ? 201 CYS B CB  1 
ATOM   3304 S SG  . CYS B 1 157 ? 12.008  6.033   18.420  1.00 37.68  ? 201 CYS B SG  1 
ATOM   3305 N N   . ASP B 1 158 ? 13.100  7.973   15.513  1.00 33.70  ? 202 ASP B N   1 
ATOM   3306 C CA  . ASP B 1 158 ? 14.356  8.716   15.506  1.00 33.44  ? 202 ASP B CA  1 
ATOM   3307 C C   . ASP B 1 158 ? 15.320  8.266   14.411  1.00 31.74  ? 202 ASP B C   1 
ATOM   3308 O O   . ASP B 1 158 ? 15.079  8.495   13.229  1.00 35.82  ? 202 ASP B O   1 
ATOM   3309 C CB  . ASP B 1 158 ? 15.049  8.599   16.866  1.00 32.90  ? 202 ASP B CB  1 
ATOM   3310 C CG  . ASP B 1 158 ? 16.068  9.702   17.095  1.00 38.48  ? 202 ASP B CG  1 
ATOM   3311 O OD1 . ASP B 1 158 ? 16.999  9.506   17.907  1.00 40.62  ? 202 ASP B OD1 1 
ATOM   3312 O OD2 . ASP B 1 158 ? 15.927  10.773  16.469  1.00 39.76  ? 202 ASP B OD2 1 
ATOM   3313 N N   . VAL B 1 159 ? 16.417  7.634   14.818  1.00 38.00  ? 203 VAL B N   1 
ATOM   3314 C CA  . VAL B 1 159 ? 17.437  7.148   13.890  1.00 34.79  ? 203 VAL B CA  1 
ATOM   3315 C C   . VAL B 1 159 ? 17.408  5.622   13.817  1.00 38.64  ? 203 VAL B C   1 
ATOM   3316 O O   . VAL B 1 159 ? 17.734  4.936   14.785  1.00 44.54  ? 203 VAL B O   1 
ATOM   3317 C CB  . VAL B 1 159 ? 18.861  7.583   14.336  1.00 35.36  ? 203 VAL B CB  1 
ATOM   3318 C CG1 . VAL B 1 159 ? 19.901  7.033   13.383  1.00 25.97  ? 203 VAL B CG1 1 
ATOM   3319 C CG2 . VAL B 1 159 ? 18.953  9.092   14.398  1.00 35.86  ? 203 VAL B CG2 1 
ATOM   3320 N N   . VAL B 1 160 ? 17.022  5.098   12.661  1.00 31.92  ? 204 VAL B N   1 
ATOM   3321 C CA  . VAL B 1 160 ? 16.955  3.663   12.456  1.00 26.34  ? 204 VAL B CA  1 
ATOM   3322 C C   . VAL B 1 160 ? 18.222  3.213   11.754  1.00 29.58  ? 204 VAL B C   1 
ATOM   3323 O O   . VAL B 1 160 ? 18.612  3.796   10.745  1.00 28.15  ? 204 VAL B O   1 
ATOM   3324 C CB  . VAL B 1 160 ? 15.754  3.277   11.564  1.00 30.92  ? 204 VAL B CB  1 
ATOM   3325 C CG1 . VAL B 1 160 ? 15.690  1.765   11.418  1.00 30.79  ? 204 VAL B CG1 1 
ATOM   3326 C CG2 . VAL B 1 160 ? 14.455  3.819   12.159  1.00 25.87  ? 204 VAL B CG2 1 
ATOM   3327 N N   . HIS B 1 161 ? 18.865  2.179   12.281  1.00 28.75  ? 205 HIS B N   1 
ATOM   3328 C CA  . HIS B 1 161 ? 20.084  1.675   11.664  1.00 26.97  ? 205 HIS B CA  1 
ATOM   3329 C C   . HIS B 1 161 ? 19.801  0.385   10.910  1.00 33.30  ? 205 HIS B C   1 
ATOM   3330 O O   . HIS B 1 161 ? 18.922  -0.392  11.298  1.00 31.11  ? 205 HIS B O   1 
ATOM   3331 C CB  . HIS B 1 161 ? 21.163  1.417   12.721  1.00 30.58  ? 205 HIS B CB  1 
ATOM   3332 C CG  . HIS B 1 161 ? 21.570  2.640   13.482  1.00 36.15  ? 205 HIS B CG  1 
ATOM   3333 N ND1 . HIS B 1 161 ? 20.798  3.186   14.484  1.00 42.93  ? 205 HIS B ND1 1 
ATOM   3334 C CD2 . HIS B 1 161 ? 22.656  3.440   13.366  1.00 36.81  ? 205 HIS B CD2 1 
ATOM   3335 C CE1 . HIS B 1 161 ? 21.388  4.271   14.953  1.00 35.92  ? 205 HIS B CE1 1 
ATOM   3336 N NE2 . HIS B 1 161 ? 22.518  4.448   14.291  1.00 41.87  ? 205 HIS B NE2 1 
ATOM   3337 N N   . VAL B 1 162 ? 20.535  0.174   9.821   1.00 33.71  ? 206 VAL B N   1 
ATOM   3338 C CA  . VAL B 1 162 ? 20.400  -1.033  9.013   1.00 36.98  ? 206 VAL B CA  1 
ATOM   3339 C C   . VAL B 1 162 ? 21.792  -1.460  8.571   1.00 40.35  ? 206 VAL B C   1 
ATOM   3340 O O   . VAL B 1 162 ? 22.518  -0.693  7.935   1.00 41.64  ? 206 VAL B O   1 
ATOM   3341 C CB  . VAL B 1 162 ? 19.502  -0.808  7.766   1.00 41.09  ? 206 VAL B CB  1 
ATOM   3342 C CG1 . VAL B 1 162 ? 20.069  0.297   6.886   1.00 42.20  ? 206 VAL B CG1 1 
ATOM   3343 C CG2 . VAL B 1 162 ? 19.381  -2.101  6.977   1.00 36.40  ? 206 VAL B CG2 1 
ATOM   3344 N N   . MET B 1 163 ? 22.172  -2.682  8.924   1.00 38.95  ? 207 MET B N   1 
ATOM   3345 C CA  . MET B 1 163 ? 23.488  -3.188  8.566   1.00 38.45  ? 207 MET B CA  1 
ATOM   3346 C C   . MET B 1 163 ? 23.425  -3.901  7.221   1.00 36.90  ? 207 MET B C   1 
ATOM   3347 O O   . MET B 1 163 ? 22.498  -4.659  6.961   1.00 39.79  ? 207 MET B O   1 
ATOM   3348 C CB  . MET B 1 163 ? 23.986  -4.147  9.647   1.00 30.14  ? 207 MET B CB  1 
ATOM   3349 C CG  . MET B 1 163 ? 25.434  -4.540  9.497   1.00 34.85  ? 207 MET B CG  1 
ATOM   3350 S SD  . MET B 1 163 ? 25.900  -5.781  10.699  1.00 43.50  ? 207 MET B SD  1 
ATOM   3351 C CE  . MET B 1 163 ? 26.128  -4.752  12.161  1.00 37.04  ? 207 MET B CE  1 
ATOM   3352 N N   . LEU B 1 164 ? 24.413  -3.658  6.368   1.00 38.84  ? 208 LEU B N   1 
ATOM   3353 C CA  . LEU B 1 164 ? 24.441  -4.286  5.053   1.00 43.43  ? 208 LEU B CA  1 
ATOM   3354 C C   . LEU B 1 164 ? 25.761  -4.984  4.759   1.00 42.98  ? 208 LEU B C   1 
ATOM   3355 O O   . LEU B 1 164 ? 26.815  -4.562  5.231   1.00 43.38  ? 208 LEU B O   1 
ATOM   3356 C CB  . LEU B 1 164 ? 24.157  -3.241  3.977   1.00 39.45  ? 208 LEU B CB  1 
ATOM   3357 C CG  . LEU B 1 164 ? 22.835  -2.508  4.183   1.00 41.36  ? 208 LEU B CG  1 
ATOM   3358 C CD1 . LEU B 1 164 ? 22.644  -1.479  3.078   1.00 44.30  ? 208 LEU B CD1 1 
ATOM   3359 C CD2 . LEU B 1 164 ? 21.690  -3.518  4.191   1.00 39.30  ? 208 LEU B CD2 1 
ATOM   3360 N N   . ASN B 1 165 ? 25.688  -6.055  3.975   1.00 49.61  ? 209 ASN B N   1 
ATOM   3361 C CA  . ASN B 1 165 ? 26.865  -6.841  3.604   1.00 54.94  ? 209 ASN B CA  1 
ATOM   3362 C C   . ASN B 1 165 ? 27.454  -6.311  2.299   1.00 57.93  ? 209 ASN B C   1 
ATOM   3363 O O   . ASN B 1 165 ? 26.857  -6.455  1.230   1.00 57.92  ? 209 ASN B O   1 
ATOM   3364 C CB  . ASN B 1 165 ? 26.467  -8.314  3.458   1.00 56.14  ? 209 ASN B CB  1 
ATOM   3365 C CG  . ASN B 1 165 ? 27.638  -9.206  3.112   1.00 58.27  ? 209 ASN B CG  1 
ATOM   3366 O OD1 . ASN B 1 165 ? 28.794  -8.851  3.342   1.00 56.32  ? 209 ASN B OD1 1 
ATOM   3367 N ND2 . ASN B 1 165 ? 27.343  -10.384 2.570   1.00 56.70  ? 209 ASN B ND2 1 
ATOM   3368 N N   . GLY B 1 166 ? 28.632  -5.701  2.397   1.00 60.93  ? 210 GLY B N   1 
ATOM   3369 C CA  . GLY B 1 166 ? 29.276  -5.127  1.227   1.00 66.30  ? 210 GLY B CA  1 
ATOM   3370 C C   . GLY B 1 166 ? 30.068  -6.072  0.342   1.00 67.07  ? 210 GLY B C   1 
ATOM   3371 O O   . GLY B 1 166 ? 30.968  -5.638  -0.380  1.00 63.61  ? 210 GLY B O   1 
ATOM   3372 N N   . SER B 1 167 ? 29.737  -7.358  0.384   1.00 67.11  ? 211 SER B N   1 
ATOM   3373 C CA  . SER B 1 167 ? 30.435  -8.345  -0.431  1.00 66.56  ? 211 SER B CA  1 
ATOM   3374 C C   . SER B 1 167 ? 29.498  -8.920  -1.485  1.00 66.13  ? 211 SER B C   1 
ATOM   3375 O O   . SER B 1 167 ? 29.925  -9.648  -2.382  1.00 67.33  ? 211 SER B O   1 
ATOM   3376 C CB  . SER B 1 167 ? 30.959  -9.474  0.457   1.00 66.26  ? 211 SER B CB  1 
ATOM   3377 O OG  . SER B 1 167 ? 31.747  -8.959  1.517   1.00 65.42  ? 211 SER B OG  1 
ATOM   3378 N N   . ARG B 1 168 ? 28.222  -8.570  -1.375  1.00 62.03  ? 212 ARG B N   1 
ATOM   3379 C CA  . ARG B 1 168 ? 27.194  -9.064  -2.282  1.00 62.55  ? 212 ARG B CA  1 
ATOM   3380 C C   . ARG B 1 168 ? 27.122  -8.313  -3.608  1.00 61.70  ? 212 ARG B C   1 
ATOM   3381 O O   . ARG B 1 168 ? 27.480  -7.139  -3.689  1.00 62.07  ? 212 ARG B O   1 
ATOM   3382 C CB  . ARG B 1 168 ? 25.843  -9.002  -1.573  1.00 64.84  ? 212 ARG B CB  1 
ATOM   3383 C CG  . ARG B 1 168 ? 25.874  -9.638  -0.187  1.00 63.87  ? 212 ARG B CG  1 
ATOM   3384 C CD  . ARG B 1 168 ? 25.811  -11.147 -0.277  1.00 66.25  ? 212 ARG B CD  1 
ATOM   3385 N NE  . ARG B 1 168 ? 24.457  -11.589 -0.601  1.00 69.57  ? 212 ARG B NE  1 
ATOM   3386 C CZ  . ARG B 1 168 ? 24.143  -12.814 -1.003  1.00 65.26  ? 212 ARG B CZ  1 
ATOM   3387 N NH1 . ARG B 1 168 ? 25.092  -13.733 -1.141  1.00 62.99  ? 212 ARG B NH1 1 
ATOM   3388 N NH2 . ARG B 1 168 ? 22.878  -13.119 -1.261  1.00 65.78  ? 212 ARG B NH2 1 
ATOM   3389 N N   . SER B 1 169 ? 26.651  -9.002  -4.645  1.00 62.73  ? 213 SER B N   1 
ATOM   3390 C CA  . SER B 1 169 ? 26.529  -8.411  -5.973  1.00 65.58  ? 213 SER B CA  1 
ATOM   3391 C C   . SER B 1 169 ? 25.702  -7.135  -5.902  1.00 64.92  ? 213 SER B C   1 
ATOM   3392 O O   . SER B 1 169 ? 25.908  -6.199  -6.676  1.00 68.35  ? 213 SER B O   1 
ATOM   3393 C CB  . SER B 1 169 ? 25.870  -9.403  -6.942  1.00 67.07  ? 213 SER B CB  1 
ATOM   3394 O OG  . SER B 1 169 ? 24.538  -9.700  -6.556  1.00 67.74  ? 213 SER B OG  1 
ATOM   3395 N N   . LYS B 1 170 ? 24.762  -7.112  -4.964  1.00 62.22  ? 214 LYS B N   1 
ATOM   3396 C CA  . LYS B 1 170 ? 23.891  -5.962  -4.756  1.00 57.08  ? 214 LYS B CA  1 
ATOM   3397 C C   . LYS B 1 170 ? 23.797  -5.740  -3.252  1.00 56.05  ? 214 LYS B C   1 
ATOM   3398 O O   . LYS B 1 170 ? 23.064  -6.452  -2.563  1.00 51.73  ? 214 LYS B O   1 
ATOM   3399 C CB  . LYS B 1 170 ? 22.504  -6.249  -5.328  1.00 53.86  ? 214 LYS B CB  1 
ATOM   3400 C CG  . LYS B 1 170 ? 22.535  -6.765  -6.754  1.00 60.74  ? 214 LYS B CG  1 
ATOM   3401 C CD  . LYS B 1 170 ? 21.139  -7.003  -7.302  1.00 65.05  ? 214 LYS B CD  1 
ATOM   3402 C CE  . LYS B 1 170 ? 21.202  -7.473  -8.751  1.00 72.23  ? 214 LYS B CE  1 
ATOM   3403 N NZ  . LYS B 1 170 ? 19.855  -7.590  -9.386  1.00 75.25  ? 214 LYS B NZ  1 
ATOM   3404 N N   . ILE B 1 171 ? 24.546  -4.769  -2.736  1.00 50.45  ? 215 ILE B N   1 
ATOM   3405 C CA  . ILE B 1 171 ? 24.510  -4.509  -1.304  1.00 50.91  ? 215 ILE B CA  1 
ATOM   3406 C C   . ILE B 1 171 ? 23.063  -4.265  -0.890  1.00 48.65  ? 215 ILE B C   1 
ATOM   3407 O O   . ILE B 1 171 ? 22.590  -4.813  0.105   1.00 48.40  ? 215 ILE B O   1 
ATOM   3408 C CB  . ILE B 1 171 ? 25.397  -3.308  -0.922  1.00 51.88  ? 215 ILE B CB  1 
ATOM   3409 C CG1 . ILE B 1 171 ? 26.825  -3.547  -1.419  1.00 48.97  ? 215 ILE B CG1 1 
ATOM   3410 C CG2 . ILE B 1 171 ? 25.424  -3.147  0.595   1.00 47.62  ? 215 ILE B CG2 1 
ATOM   3411 C CD1 . ILE B 1 171 ? 27.801  -2.447  -1.064  1.00 58.58  ? 215 ILE B CD1 1 
ATOM   3412 N N   . PHE B 1 172 ? 22.358  -3.443  -1.654  1.00 45.80  ? 216 PHE B N   1 
ATOM   3413 C CA  . PHE B 1 172 ? 20.957  -3.205  -1.366  1.00 44.41  ? 216 PHE B CA  1 
ATOM   3414 C C   . PHE B 1 172 ? 20.175  -3.935  -2.437  1.00 47.01  ? 216 PHE B C   1 
ATOM   3415 O O   . PHE B 1 172 ? 20.357  -3.674  -3.627  1.00 50.37  ? 216 PHE B O   1 
ATOM   3416 C CB  . PHE B 1 172 ? 20.592  -1.723  -1.427  1.00 46.09  ? 216 PHE B CB  1 
ATOM   3417 C CG  . PHE B 1 172 ? 19.118  -1.481  -1.326  1.00 40.90  ? 216 PHE B CG  1 
ATOM   3418 C CD1 . PHE B 1 172 ? 18.457  -1.645  -0.114  1.00 38.78  ? 216 PHE B CD1 1 
ATOM   3419 C CD2 . PHE B 1 172 ? 18.369  -1.197  -2.463  1.00 41.74  ? 216 PHE B CD2 1 
ATOM   3420 C CE1 . PHE B 1 172 ? 17.072  -1.539  -0.037  1.00 39.25  ? 216 PHE B CE1 1 
ATOM   3421 C CE2 . PHE B 1 172 ? 16.981  -1.089  -2.398  1.00 40.22  ? 216 PHE B CE2 1 
ATOM   3422 C CZ  . PHE B 1 172 ? 16.330  -1.262  -1.183  1.00 42.31  ? 216 PHE B CZ  1 
ATOM   3423 N N   . ASP B 1 173 ? 19.308  -4.849  -2.019  1.00 50.03  ? 217 ASP B N   1 
ATOM   3424 C CA  . ASP B 1 173 ? 18.504  -5.612  -2.963  1.00 51.23  ? 217 ASP B CA  1 
ATOM   3425 C C   . ASP B 1 173 ? 17.031  -5.351  -2.691  1.00 48.46  ? 217 ASP B C   1 
ATOM   3426 O O   . ASP B 1 173 ? 16.479  -5.836  -1.703  1.00 48.02  ? 217 ASP B O   1 
ATOM   3427 C CB  . ASP B 1 173 ? 18.795  -7.109  -2.823  1.00 50.95  ? 217 ASP B CB  1 
ATOM   3428 C CG  . ASP B 1 173 ? 18.223  -7.921  -3.969  1.00 53.99  ? 217 ASP B CG  1 
ATOM   3429 O OD1 . ASP B 1 173 ? 17.068  -7.661  -4.366  1.00 52.42  ? 217 ASP B OD1 1 
ATOM   3430 O OD2 . ASP B 1 173 ? 18.925  -8.825  -4.470  1.00 62.89  ? 217 ASP B OD2 1 
ATOM   3431 N N   . LYS B 1 174 ? 16.392  -4.585  -3.567  1.00 49.65  ? 218 LYS B N   1 
ATOM   3432 C CA  . LYS B 1 174 ? 14.980  -4.274  -3.389  1.00 55.04  ? 218 LYS B CA  1 
ATOM   3433 C C   . LYS B 1 174 ? 14.145  -5.541  -3.274  1.00 54.87  ? 218 LYS B C   1 
ATOM   3434 O O   . LYS B 1 174 ? 13.049  -5.526  -2.712  1.00 52.46  ? 218 LYS B O   1 
ATOM   3435 C CB  . LYS B 1 174 ? 14.468  -3.397  -4.541  1.00 56.17  ? 218 LYS B CB  1 
ATOM   3436 C CG  . LYS B 1 174 ? 15.024  -3.735  -5.915  1.00 64.41  ? 218 LYS B CG  1 
ATOM   3437 C CD  . LYS B 1 174 ? 14.445  -2.797  -6.971  1.00 67.12  ? 218 LYS B CD  1 
ATOM   3438 C CE  . LYS B 1 174 ? 15.133  -2.963  -8.320  1.00 68.88  ? 218 LYS B CE  1 
ATOM   3439 N NZ  . LYS B 1 174 ? 16.547  -2.486  -8.298  1.00 67.39  ? 218 LYS B NZ  1 
ATOM   3440 N N   . ASN B 1 175 ? 14.675  -6.642  -3.795  1.00 54.97  ? 219 ASN B N   1 
ATOM   3441 C CA  . ASN B 1 175 ? 13.974  -7.917  -3.741  1.00 58.08  ? 219 ASN B CA  1 
ATOM   3442 C C   . ASN B 1 175 ? 14.303  -8.673  -2.449  1.00 54.18  ? 219 ASN B C   1 
ATOM   3443 O O   . ASN B 1 175 ? 14.466  -9.894  -2.448  1.00 54.52  ? 219 ASN B O   1 
ATOM   3444 C CB  . ASN B 1 175 ? 14.336  -8.764  -4.966  1.00 61.33  ? 219 ASN B CB  1 
ATOM   3445 C CG  . ASN B 1 175 ? 13.604  -10.091 -4.993  1.00 66.35  ? 219 ASN B CG  1 
ATOM   3446 O OD1 . ASN B 1 175 ? 12.379  -10.138 -4.882  1.00 71.79  ? 219 ASN B OD1 1 
ATOM   3447 N ND2 . ASN B 1 175 ? 14.352  -11.179 -5.146  1.00 71.67  ? 219 ASN B ND2 1 
ATOM   3448 N N   . SER B 1 176 ? 14.407  -7.933  -1.351  1.00 46.42  ? 220 SER B N   1 
ATOM   3449 C CA  . SER B 1 176 ? 14.693  -8.530  -0.053  1.00 42.50  ? 220 SER B CA  1 
ATOM   3450 C C   . SER B 1 176 ? 13.590  -8.100  0.894   1.00 42.66  ? 220 SER B C   1 
ATOM   3451 O O   . SER B 1 176 ? 12.766  -7.253  0.545   1.00 43.39  ? 220 SER B O   1 
ATOM   3452 C CB  . SER B 1 176 ? 16.040  -8.048  0.485   1.00 35.99  ? 220 SER B CB  1 
ATOM   3453 O OG  . SER B 1 176 ? 15.974  -6.692  0.888   1.00 44.40  ? 220 SER B OG  1 
ATOM   3454 N N   . THR B 1 177 ? 13.566  -8.679  2.090   1.00 40.16  ? 221 THR B N   1 
ATOM   3455 C CA  . THR B 1 177 ? 12.544  -8.316  3.063   1.00 41.57  ? 221 THR B CA  1 
ATOM   3456 C C   . THR B 1 177 ? 12.728  -6.851  3.454   1.00 39.80  ? 221 THR B C   1 
ATOM   3457 O O   . THR B 1 177 ? 11.770  -6.079  3.504   1.00 41.93  ? 221 THR B O   1 
ATOM   3458 C CB  . THR B 1 177 ? 12.635  -9.195  4.313   1.00 39.92  ? 221 THR B CB  1 
ATOM   3459 O OG1 . THR B 1 177 ? 12.417  -10.563 3.948   1.00 41.98  ? 221 THR B OG1 1 
ATOM   3460 C CG2 . THR B 1 177 ? 11.590  -8.771  5.331   1.00 39.95  ? 221 THR B CG2 1 
ATOM   3461 N N   . PHE B 1 178 ? 13.970  -6.471  3.722   1.00 35.54  ? 222 PHE B N   1 
ATOM   3462 C CA  . PHE B 1 178 ? 14.270  -5.098  4.086   1.00 38.35  ? 222 PHE B CA  1 
ATOM   3463 C C   . PHE B 1 178 ? 13.822  -4.174  2.961   1.00 37.09  ? 222 PHE B C   1 
ATOM   3464 O O   . PHE B 1 178 ? 13.099  -3.205  3.189   1.00 39.83  ? 222 PHE B O   1 
ATOM   3465 C CB  . PHE B 1 178 ? 15.778  -4.921  4.322   1.00 34.49  ? 222 PHE B CB  1 
ATOM   3466 C CG  . PHE B 1 178 ? 16.219  -3.485  4.370   1.00 37.33  ? 222 PHE B CG  1 
ATOM   3467 C CD1 . PHE B 1 178 ? 15.894  -2.676  5.457   1.00 41.41  ? 222 PHE B CD1 1 
ATOM   3468 C CD2 . PHE B 1 178 ? 16.924  -2.927  3.308   1.00 35.35  ? 222 PHE B CD2 1 
ATOM   3469 C CE1 . PHE B 1 178 ? 16.263  -1.331  5.485   1.00 39.09  ? 222 PHE B CE1 1 
ATOM   3470 C CE2 . PHE B 1 178 ? 17.298  -1.580  3.325   1.00 33.78  ? 222 PHE B CE2 1 
ATOM   3471 C CZ  . PHE B 1 178 ? 16.966  -0.782  4.414   1.00 37.59  ? 222 PHE B CZ  1 
ATOM   3472 N N   . GLY B 1 179 ? 14.248  -4.497  1.746   1.00 32.74  ? 223 GLY B N   1 
ATOM   3473 C CA  . GLY B 1 179 ? 13.916  -3.680  0.596   1.00 36.69  ? 223 GLY B CA  1 
ATOM   3474 C C   . GLY B 1 179 ? 12.482  -3.693  0.106   1.00 38.25  ? 223 GLY B C   1 
ATOM   3475 O O   . GLY B 1 179 ? 12.046  -2.733  -0.529  1.00 39.74  ? 223 GLY B O   1 
ATOM   3476 N N   . SER B 1 180 ? 11.736  -4.755  0.392   1.00 38.86  ? 224 SER B N   1 
ATOM   3477 C CA  . SER B 1 180 ? 10.358  -4.828  -0.082  1.00 39.69  ? 224 SER B CA  1 
ATOM   3478 C C   . SER B 1 180 ? 9.287   -4.577  0.962   1.00 37.00  ? 224 SER B C   1 
ATOM   3479 O O   . SER B 1 180 ? 8.125   -4.373  0.608   1.00 35.40  ? 224 SER B O   1 
ATOM   3480 C CB  . SER B 1 180 ? 10.092  -6.176  -0.753  1.00 39.05  ? 224 SER B CB  1 
ATOM   3481 O OG  . SER B 1 180 ? 10.864  -6.309  -1.929  1.00 41.59  ? 224 SER B OG  1 
ATOM   3482 N N   . VAL B 1 181 ? 9.652   -4.589  2.239   1.00 33.07  ? 225 VAL B N   1 
ATOM   3483 C CA  . VAL B 1 181 ? 8.650   -4.339  3.266   1.00 35.07  ? 225 VAL B CA  1 
ATOM   3484 C C   . VAL B 1 181 ? 9.102   -3.420  4.394   1.00 35.16  ? 225 VAL B C   1 
ATOM   3485 O O   . VAL B 1 181 ? 8.362   -2.518  4.792   1.00 35.19  ? 225 VAL B O   1 
ATOM   3486 C CB  . VAL B 1 181 ? 8.090   -5.684  3.857   1.00 39.13  ? 225 VAL B CB  1 
ATOM   3487 C CG1 . VAL B 1 181 ? 9.039   -6.823  3.562   1.00 31.09  ? 225 VAL B CG1 1 
ATOM   3488 C CG2 . VAL B 1 181 ? 7.851   -5.556  5.371   1.00 31.19  ? 225 VAL B CG2 1 
ATOM   3489 N N   . GLU B 1 182 ? 10.315  -3.624  4.893   1.00 35.72  ? 226 GLU B N   1 
ATOM   3490 C CA  . GLU B 1 182 ? 10.813  -2.810  5.996   1.00 33.41  ? 226 GLU B CA  1 
ATOM   3491 C C   . GLU B 1 182 ? 11.038  -1.347  5.642   1.00 36.09  ? 226 GLU B C   1 
ATOM   3492 O O   . GLU B 1 182 ? 10.539  -0.455  6.331   1.00 36.91  ? 226 GLU B O   1 
ATOM   3493 C CB  . GLU B 1 182 ? 12.105  -3.412  6.558   1.00 35.21  ? 226 GLU B CB  1 
ATOM   3494 C CG  . GLU B 1 182 ? 11.932  -4.842  7.069   1.00 43.25  ? 226 GLU B CG  1 
ATOM   3495 C CD  . GLU B 1 182 ? 13.197  -5.415  7.679   1.00 46.32  ? 226 GLU B CD  1 
ATOM   3496 O OE1 . GLU B 1 182 ? 14.266  -5.298  7.044   1.00 47.53  ? 226 GLU B OE1 1 
ATOM   3497 O OE2 . GLU B 1 182 ? 13.120  -5.990  8.787   1.00 45.00  ? 226 GLU B OE2 1 
ATOM   3498 N N   . VAL B 1 183 ? 11.776  -1.092  4.570   1.00 29.54  ? 227 VAL B N   1 
ATOM   3499 C CA  . VAL B 1 183 ? 12.059  0.283   4.178   1.00 32.33  ? 227 VAL B CA  1 
ATOM   3500 C C   . VAL B 1 183 ? 10.792  1.073   3.843   1.00 32.96  ? 227 VAL B C   1 
ATOM   3501 O O   . VAL B 1 183 ? 10.737  2.285   4.029   1.00 33.52  ? 227 VAL B O   1 
ATOM   3502 C CB  . VAL B 1 183 ? 13.010  0.335   2.962   1.00 38.00  ? 227 VAL B CB  1 
ATOM   3503 C CG1 . VAL B 1 183 ? 12.259  -0.037  1.679   1.00 36.17  ? 227 VAL B CG1 1 
ATOM   3504 C CG2 . VAL B 1 183 ? 13.613  1.716   2.848   1.00 41.68  ? 227 VAL B CG2 1 
ATOM   3505 N N   . HIS B 1 184 ? 9.770   0.383   3.362   1.00 30.06  ? 228 HIS B N   1 
ATOM   3506 C CA  . HIS B 1 184 ? 8.535   1.054   2.998   1.00 33.69  ? 228 HIS B CA  1 
ATOM   3507 C C   . HIS B 1 184 ? 7.624   1.316   4.189   1.00 33.69  ? 228 HIS B C   1 
ATOM   3508 O O   . HIS B 1 184 ? 6.727   2.154   4.111   1.00 28.37  ? 228 HIS B O   1 
ATOM   3509 C CB  . HIS B 1 184 ? 7.777   0.237   1.940   1.00 30.38  ? 228 HIS B CB  1 
ATOM   3510 C CG  . HIS B 1 184 ? 8.563   0.000   0.690   1.00 31.72  ? 228 HIS B CG  1 
ATOM   3511 N ND1 . HIS B 1 184 ? 9.021   1.027   -0.106  1.00 26.79  ? 228 HIS B ND1 1 
ATOM   3512 C CD2 . HIS B 1 184 ? 9.006   -1.145  0.119   1.00 31.62  ? 228 HIS B CD2 1 
ATOM   3513 C CE1 . HIS B 1 184 ? 9.718   0.526   -1.111  1.00 31.99  ? 228 HIS B CE1 1 
ATOM   3514 N NE2 . HIS B 1 184 ? 9.724   -0.791  -0.998  1.00 35.39  ? 228 HIS B NE2 1 
ATOM   3515 N N   . ASN B 1 185 ? 7.845   0.616   5.295   1.00 28.59  ? 229 ASN B N   1 
ATOM   3516 C CA  . ASN B 1 185 ? 6.979   0.825   6.440   1.00 32.35  ? 229 ASN B CA  1 
ATOM   3517 C C   . ASN B 1 185 ? 7.528   1.659   7.590   1.00 31.64  ? 229 ASN B C   1 
ATOM   3518 O O   . ASN B 1 185 ? 6.876   1.796   8.625   1.00 31.26  ? 229 ASN B O   1 
ATOM   3519 C CB  . ASN B 1 185 ? 6.456   -0.517  6.935   1.00 31.08  ? 229 ASN B CB  1 
ATOM   3520 C CG  . ASN B 1 185 ? 5.287   -1.011  6.103   1.00 39.41  ? 229 ASN B CG  1 
ATOM   3521 O OD1 . ASN B 1 185 ? 4.152   -0.545  6.259   1.00 32.27  ? 229 ASN B OD1 1 
ATOM   3522 N ND2 . ASN B 1 185 ? 5.561   -1.941  5.196   1.00 40.81  ? 229 ASN B ND2 1 
ATOM   3523 N N   . LEU B 1 186 ? 8.721   2.218   7.414   1.00 28.76  ? 230 LEU B N   1 
ATOM   3524 C CA  . LEU B 1 186 ? 9.280   3.086   8.438   1.00 30.72  ? 230 LEU B CA  1 
ATOM   3525 C C   . LEU B 1 186 ? 8.368   4.307   8.358   1.00 33.16  ? 230 LEU B C   1 
ATOM   3526 O O   . LEU B 1 186 ? 8.089   4.800   7.265   1.00 33.68  ? 230 LEU B O   1 
ATOM   3527 C CB  . LEU B 1 186 ? 10.714  3.472   8.089   1.00 25.67  ? 230 LEU B CB  1 
ATOM   3528 C CG  . LEU B 1 186 ? 11.702  2.305   8.018   1.00 29.87  ? 230 LEU B CG  1 
ATOM   3529 C CD1 . LEU B 1 186 ? 12.998  2.765   7.384   1.00 21.38  ? 230 LEU B CD1 1 
ATOM   3530 C CD2 . LEU B 1 186 ? 11.941  1.746   9.422   1.00 21.30  ? 230 LEU B CD2 1 
ATOM   3531 N N   . GLN B 1 187 ? 7.881   4.779   9.500   1.00 36.08  ? 231 GLN B N   1 
ATOM   3532 C CA  . GLN B 1 187 ? 6.984   5.928   9.510   1.00 36.03  ? 231 GLN B CA  1 
ATOM   3533 C C   . GLN B 1 187 ? 7.718   7.274   9.447   1.00 37.93  ? 231 GLN B C   1 
ATOM   3534 O O   . GLN B 1 187 ? 8.526   7.599   10.316  1.00 38.74  ? 231 GLN B O   1 
ATOM   3535 C CB  . GLN B 1 187 ? 6.069   5.854   10.738  1.00 38.48  ? 231 GLN B CB  1 
ATOM   3536 C CG  . GLN B 1 187 ? 5.054   4.710   10.654  1.00 45.53  ? 231 GLN B CG  1 
ATOM   3537 C CD  . GLN B 1 187 ? 4.014   4.735   11.769  1.00 53.57  ? 231 GLN B CD  1 
ATOM   3538 O OE1 . GLN B 1 187 ? 4.283   4.326   12.900  1.00 51.54  ? 231 GLN B OE1 1 
ATOM   3539 N NE2 . GLN B 1 187 ? 2.817   5.224   11.449  1.00 52.13  ? 231 GLN B NE2 1 
ATOM   3540 N N   . PRO B 1 188 ? 7.442   8.070   8.397   1.00 41.43  ? 232 PRO B N   1 
ATOM   3541 C CA  . PRO B 1 188 ? 8.041   9.390   8.156   1.00 41.71  ? 232 PRO B CA  1 
ATOM   3542 C C   . PRO B 1 188 ? 7.908   10.329  9.347   1.00 43.20  ? 232 PRO B C   1 
ATOM   3543 O O   . PRO B 1 188 ? 8.752   11.193  9.580   1.00 40.86  ? 232 PRO B O   1 
ATOM   3544 C CB  . PRO B 1 188 ? 7.267   9.898   6.943   1.00 37.01  ? 232 PRO B CB  1 
ATOM   3545 C CG  . PRO B 1 188 ? 6.958   8.646   6.204   1.00 39.48  ? 232 PRO B CG  1 
ATOM   3546 C CD  . PRO B 1 188 ? 6.501   7.732   7.317   1.00 35.56  ? 232 PRO B CD  1 
ATOM   3547 N N   . GLU B 1 189 ? 6.831   10.163  10.096  1.00 43.90  ? 233 GLU B N   1 
ATOM   3548 C CA  . GLU B 1 189 ? 6.605   11.001  11.255  1.00 50.93  ? 233 GLU B CA  1 
ATOM   3549 C C   . GLU B 1 189 ? 7.603   10.606  12.343  1.00 49.84  ? 233 GLU B C   1 
ATOM   3550 O O   . GLU B 1 189 ? 8.468   11.397  12.735  1.00 52.81  ? 233 GLU B O   1 
ATOM   3551 C CB  . GLU B 1 189 ? 5.167   10.812  11.738  1.00 57.77  ? 233 GLU B CB  1 
ATOM   3552 C CG  . GLU B 1 189 ? 4.661   11.879  12.689  1.00 65.11  ? 233 GLU B CG  1 
ATOM   3553 C CD  . GLU B 1 189 ? 3.148   11.843  12.828  1.00 74.08  ? 233 GLU B CD  1 
ATOM   3554 O OE1 . GLU B 1 189 ? 2.598   12.657  13.599  1.00 74.78  ? 233 GLU B OE1 1 
ATOM   3555 O OE2 . GLU B 1 189 ? 2.509   10.999  12.159  1.00 77.20  ? 233 GLU B OE2 1 
ATOM   3556 N N   . LYS B 1 190 ? 7.496   9.363   12.797  1.00 42.16  ? 234 LYS B N   1 
ATOM   3557 C CA  . LYS B 1 190 ? 8.360   8.839   13.849  1.00 37.62  ? 234 LYS B CA  1 
ATOM   3558 C C   . LYS B 1 190 ? 9.847   8.857   13.509  1.00 37.12  ? 234 LYS B C   1 
ATOM   3559 O O   . LYS B 1 190 ? 10.663  9.361   14.280  1.00 37.07  ? 234 LYS B O   1 
ATOM   3560 C CB  . LYS B 1 190 ? 7.953   7.403   14.183  1.00 25.96  ? 234 LYS B CB  1 
ATOM   3561 C CG  . LYS B 1 190 ? 6.484   7.227   14.479  1.00 27.84  ? 234 LYS B CG  1 
ATOM   3562 C CD  . LYS B 1 190 ? 6.155   5.775   14.793  1.00 36.87  ? 234 LYS B CD  1 
ATOM   3563 C CE  . LYS B 1 190 ? 6.897   5.291   16.031  1.00 33.46  ? 234 LYS B CE  1 
ATOM   3564 N NZ  . LYS B 1 190 ? 6.332   4.014   16.549  1.00 46.58  ? 234 LYS B NZ  1 
ATOM   3565 N N   . VAL B 1 191 ? 10.190  8.292   12.357  1.00 38.17  ? 235 VAL B N   1 
ATOM   3566 C CA  . VAL B 1 191 ? 11.577  8.200   11.925  1.00 34.87  ? 235 VAL B CA  1 
ATOM   3567 C C   . VAL B 1 191 ? 12.029  9.429   11.164  1.00 38.49  ? 235 VAL B C   1 
ATOM   3568 O O   . VAL B 1 191 ? 11.282  9.964   10.355  1.00 35.03  ? 235 VAL B O   1 
ATOM   3569 C CB  . VAL B 1 191 ? 11.785  6.973   11.015  1.00 35.00  ? 235 VAL B CB  1 
ATOM   3570 C CG1 . VAL B 1 191 ? 13.252  6.868   10.606  1.00 31.97  ? 235 VAL B CG1 1 
ATOM   3571 C CG2 . VAL B 1 191 ? 11.321  5.712   11.732  1.00 34.53  ? 235 VAL B CG2 1 
ATOM   3572 N N   . GLN B 1 192 ? 13.260  9.865   11.421  1.00 41.08  ? 236 GLN B N   1 
ATOM   3573 C CA  . GLN B 1 192 ? 13.806  11.030  10.737  1.00 47.23  ? 236 GLN B CA  1 
ATOM   3574 C C   . GLN B 1 192 ? 14.983  10.607  9.873   1.00 46.55  ? 236 GLN B C   1 
ATOM   3575 O O   . GLN B 1 192 ? 15.217  11.174  8.805   1.00 49.22  ? 236 GLN B O   1 
ATOM   3576 C CB  . GLN B 1 192 ? 14.279  12.090  11.740  1.00 53.53  ? 236 GLN B CB  1 
ATOM   3577 C CG  . GLN B 1 192 ? 15.489  11.670  12.558  1.00 63.40  ? 236 GLN B CG  1 
ATOM   3578 C CD  . GLN B 1 192 ? 16.279  12.849  13.102  1.00 70.77  ? 236 GLN B CD  1 
ATOM   3579 O OE1 . GLN B 1 192 ? 17.224  12.673  13.877  1.00 70.15  ? 236 GLN B OE1 1 
ATOM   3580 N NE2 . GLN B 1 192 ? 15.901  14.058  12.692  1.00 73.22  ? 236 GLN B NE2 1 
ATOM   3581 N N   . THR B 1 193 ? 15.718  9.600   10.332  1.00 40.05  ? 237 THR B N   1 
ATOM   3582 C CA  . THR B 1 193 ? 16.879  9.134   9.591   1.00 35.42  ? 237 THR B CA  1 
ATOM   3583 C C   . THR B 1 193 ? 17.052  7.622   9.579   1.00 33.20  ? 237 THR B C   1 
ATOM   3584 O O   . THR B 1 193 ? 16.754  6.938   10.558  1.00 34.05  ? 237 THR B O   1 
ATOM   3585 C CB  . THR B 1 193 ? 18.179  9.745   10.162  1.00 34.41  ? 237 THR B CB  1 
ATOM   3586 O OG1 . THR B 1 193 ? 18.082  11.173  10.163  1.00 41.47  ? 237 THR B OG1 1 
ATOM   3587 C CG2 . THR B 1 193 ? 19.374  9.332   9.321   1.00 37.71  ? 237 THR B CG2 1 
ATOM   3588 N N   . LEU B 1 194 ? 17.531  7.117   8.447   1.00 29.93  ? 238 LEU B N   1 
ATOM   3589 C CA  . LEU B 1 194 ? 17.826  5.705   8.262   1.00 26.79  ? 238 LEU B CA  1 
ATOM   3590 C C   . LEU B 1 194 ? 19.319  5.701   7.979   1.00 31.61  ? 238 LEU B C   1 
ATOM   3591 O O   . LEU B 1 194 ? 19.754  6.198   6.941   1.00 32.25  ? 238 LEU B O   1 
ATOM   3592 C CB  . LEU B 1 194 ? 17.081  5.126   7.050   1.00 29.79  ? 238 LEU B CB  1 
ATOM   3593 C CG  . LEU B 1 194 ? 17.592  3.751   6.570   1.00 30.84  ? 238 LEU B CG  1 
ATOM   3594 C CD1 . LEU B 1 194 ? 17.399  2.713   7.667   1.00 26.53  ? 238 LEU B CD1 1 
ATOM   3595 C CD2 . LEU B 1 194 ? 16.869  3.317   5.309   1.00 24.31  ? 238 LEU B CD2 1 
ATOM   3596 N N   . GLU B 1 195 ? 20.110  5.172   8.904   1.00 36.68  ? 239 GLU B N   1 
ATOM   3597 C CA  . GLU B 1 195 ? 21.552  5.132   8.704   1.00 41.82  ? 239 GLU B CA  1 
ATOM   3598 C C   . GLU B 1 195 ? 22.009  3.724   8.331   1.00 42.18  ? 239 GLU B C   1 
ATOM   3599 O O   . GLU B 1 195 ? 21.852  2.777   9.103   1.00 38.59  ? 239 GLU B O   1 
ATOM   3600 C CB  . GLU B 1 195 ? 22.289  5.601   9.964   1.00 41.69  ? 239 GLU B CB  1 
ATOM   3601 C CG  . GLU B 1 195 ? 23.804  5.637   9.794   1.00 44.43  ? 239 GLU B CG  1 
ATOM   3602 C CD  . GLU B 1 195 ? 24.539  5.941   11.080  1.00 49.33  ? 239 GLU B CD  1 
ATOM   3603 O OE1 . GLU B 1 195 ? 25.786  5.961   11.051  1.00 56.08  ? 239 GLU B OE1 1 
ATOM   3604 O OE2 . GLU B 1 195 ? 23.879  6.158   12.120  1.00 50.30  ? 239 GLU B OE2 1 
ATOM   3605 N N   . ALA B 1 196 ? 22.579  3.599   7.138   1.00 44.30  ? 240 ALA B N   1 
ATOM   3606 C CA  . ALA B 1 196 ? 23.053  2.315   6.644   1.00 39.79  ? 240 ALA B CA  1 
ATOM   3607 C C   . ALA B 1 196 ? 24.508  2.075   6.999   1.00 40.67  ? 240 ALA B C   1 
ATOM   3608 O O   . ALA B 1 196 ? 25.308  3.009   7.042   1.00 42.23  ? 240 ALA B O   1 
ATOM   3609 C CB  . ALA B 1 196 ? 22.874  2.248   5.136   1.00 35.49  ? 240 ALA B CB  1 
ATOM   3610 N N   . TRP B 1 197 ? 24.837  0.817   7.267   1.00 40.13  ? 241 TRP B N   1 
ATOM   3611 C CA  . TRP B 1 197 ? 26.205  0.424   7.582   1.00 40.39  ? 241 TRP B CA  1 
ATOM   3612 C C   . TRP B 1 197 ? 26.604  -0.634  6.574   1.00 43.39  ? 241 TRP B C   1 
ATOM   3613 O O   . TRP B 1 197 ? 26.033  -1.721  6.555   1.00 48.65  ? 241 TRP B O   1 
ATOM   3614 C CB  . TRP B 1 197 ? 26.316  -0.191  8.977   1.00 32.96  ? 241 TRP B CB  1 
ATOM   3615 C CG  . TRP B 1 197 ? 26.073  0.743   10.095  1.00 35.50  ? 241 TRP B CG  1 
ATOM   3616 C CD1 . TRP B 1 197 ? 26.099  2.104   10.050  1.00 39.12  ? 241 TRP B CD1 1 
ATOM   3617 C CD2 . TRP B 1 197 ? 25.811  0.388   11.456  1.00 37.02  ? 241 TRP B CD2 1 
ATOM   3618 N NE1 . TRP B 1 197 ? 25.870  2.624   11.304  1.00 41.67  ? 241 TRP B NE1 1 
ATOM   3619 C CE2 . TRP B 1 197 ? 25.691  1.590   12.186  1.00 38.04  ? 241 TRP B CE2 1 
ATOM   3620 C CE3 . TRP B 1 197 ? 25.669  -0.834  12.132  1.00 36.32  ? 241 TRP B CE3 1 
ATOM   3621 C CZ2 . TRP B 1 197 ? 25.433  1.610   13.566  1.00 45.77  ? 241 TRP B CZ2 1 
ATOM   3622 C CZ3 . TRP B 1 197 ? 25.412  -0.817  13.507  1.00 42.13  ? 241 TRP B CZ3 1 
ATOM   3623 C CH2 . TRP B 1 197 ? 25.297  0.400   14.207  1.00 42.69  ? 241 TRP B CH2 1 
ATOM   3624 N N   . VAL B 1 198 ? 27.576  -0.322  5.729   1.00 48.51  ? 242 VAL B N   1 
ATOM   3625 C CA  . VAL B 1 198 ? 28.029  -1.288  4.741   1.00 50.30  ? 242 VAL B CA  1 
ATOM   3626 C C   . VAL B 1 198 ? 29.276  -1.992  5.280   1.00 56.53  ? 242 VAL B C   1 
ATOM   3627 O O   . VAL B 1 198 ? 30.287  -1.349  5.583   1.00 56.10  ? 242 VAL B O   1 
ATOM   3628 C CB  . VAL B 1 198 ? 28.343  -0.601  3.402   1.00 50.09  ? 242 VAL B CB  1 
ATOM   3629 C CG1 . VAL B 1 198 ? 28.602  -1.647  2.330   1.00 53.93  ? 242 VAL B CG1 1 
ATOM   3630 C CG2 . VAL B 1 198 ? 27.186  0.298   3.004   1.00 41.57  ? 242 VAL B CG2 1 
ATOM   3631 N N   . ILE B 1 199 ? 29.189  -3.315  5.405   1.00 57.09  ? 243 ILE B N   1 
ATOM   3632 C CA  . ILE B 1 199 ? 30.289  -4.116  5.929   1.00 63.17  ? 243 ILE B CA  1 
ATOM   3633 C C   . ILE B 1 199 ? 31.208  -4.680  4.847   1.00 64.83  ? 243 ILE B C   1 
ATOM   3634 O O   . ILE B 1 199 ? 30.747  -5.243  3.853   1.00 59.20  ? 243 ILE B O   1 
ATOM   3635 C CB  . ILE B 1 199 ? 29.748  -5.293  6.774   1.00 64.56  ? 243 ILE B CB  1 
ATOM   3636 C CG1 . ILE B 1 199 ? 28.805  -4.763  7.858   1.00 65.49  ? 243 ILE B CG1 1 
ATOM   3637 C CG2 . ILE B 1 199 ? 30.904  -6.062  7.407   1.00 63.28  ? 243 ILE B CG2 1 
ATOM   3638 C CD1 . ILE B 1 199 ? 29.459  -3.804  8.837   1.00 64.73  ? 243 ILE B CD1 1 
ATOM   3639 N N   . HIS B 1 200 ? 32.512  -4.527  5.056   1.00 69.50  ? 244 HIS B N   1 
ATOM   3640 C CA  . HIS B 1 200 ? 33.513  -5.028  4.119   1.00 76.68  ? 244 HIS B CA  1 
ATOM   3641 C C   . HIS B 1 200 ? 34.153  -6.309  4.653   1.00 76.85  ? 244 HIS B C   1 
ATOM   3642 O O   . HIS B 1 200 ? 34.371  -7.268  3.909   1.00 75.83  ? 244 HIS B O   1 
ATOM   3643 C CB  . HIS B 1 200 ? 34.599  -3.972  3.884   1.00 81.06  ? 244 HIS B CB  1 
ATOM   3644 C CG  . HIS B 1 200 ? 34.106  -2.741  3.191   1.00 88.50  ? 244 HIS B CG  1 
ATOM   3645 N ND1 . HIS B 1 200 ? 33.207  -1.870  3.768   1.00 92.38  ? 244 HIS B ND1 1 
ATOM   3646 C CD2 . HIS B 1 200 ? 34.377  -2.240  1.962   1.00 89.86  ? 244 HIS B CD2 1 
ATOM   3647 C CE1 . HIS B 1 200 ? 32.946  -0.886  2.926   1.00 90.97  ? 244 HIS B CE1 1 
ATOM   3648 N NE2 . HIS B 1 200 ? 33.644  -1.087  1.822   1.00 89.39  ? 244 HIS B NE2 1 
ATOM   3649 N N   . ARG B 1 207 ? 37.572  -0.033  -1.126  1.00 76.19  ? 251 ARG B N   1 
ATOM   3650 C CA  . ARG B 1 207 ? 36.842  1.033   -1.808  1.00 78.67  ? 251 ARG B CA  1 
ATOM   3651 C C   . ARG B 1 207 ? 35.706  1.564   -0.924  1.00 79.41  ? 251 ARG B C   1 
ATOM   3652 O O   . ARG B 1 207 ? 35.382  0.963   0.105   1.00 79.38  ? 251 ARG B O   1 
ATOM   3653 C CB  . ARG B 1 207 ? 36.291  0.505   -3.139  1.00 75.42  ? 251 ARG B CB  1 
ATOM   3654 C CG  . ARG B 1 207 ? 35.635  1.554   -4.022  1.00 76.80  ? 251 ARG B CG  1 
ATOM   3655 C CD  . ARG B 1 207 ? 35.648  1.153   -5.502  1.00 78.14  ? 251 ARG B CD  1 
ATOM   3656 N NE  . ARG B 1 207 ? 34.554  0.267   -5.903  1.00 80.03  ? 251 ARG B NE  1 
ATOM   3657 C CZ  . ARG B 1 207 ? 34.407  -0.998  -5.511  1.00 83.38  ? 251 ARG B CZ  1 
ATOM   3658 N NH1 . ARG B 1 207 ? 35.287  -1.555  -4.691  1.00 82.71  ? 251 ARG B NH1 1 
ATOM   3659 N NH2 . ARG B 1 207 ? 33.379  -1.715  -5.953  1.00 81.90  ? 251 ARG B NH2 1 
ATOM   3660 N N   . ASP B 1 208 ? 35.119  2.697   -1.314  1.00 77.54  ? 252 ASP B N   1 
ATOM   3661 C CA  . ASP B 1 208 ? 34.018  3.299   -0.555  1.00 74.89  ? 252 ASP B CA  1 
ATOM   3662 C C   . ASP B 1 208 ? 32.691  2.882   -1.192  1.00 72.92  ? 252 ASP B C   1 
ATOM   3663 O O   . ASP B 1 208 ? 32.266  3.442   -2.202  1.00 70.77  ? 252 ASP B O   1 
ATOM   3664 C CB  . ASP B 1 208 ? 34.149  4.827   -0.548  1.00 75.60  ? 252 ASP B CB  1 
ATOM   3665 C CG  . ASP B 1 208 ? 33.181  5.496   0.418   1.00 76.47  ? 252 ASP B CG  1 
ATOM   3666 O OD1 . ASP B 1 208 ? 31.952  5.431   0.185   1.00 69.37  ? 252 ASP B OD1 1 
ATOM   3667 O OD2 . ASP B 1 208 ? 33.655  6.087   1.416   1.00 74.82  ? 252 ASP B OD2 1 
ATOM   3668 N N   . LEU B 1 209 ? 32.040  1.899   -0.575  1.00 71.34  ? 253 LEU B N   1 
ATOM   3669 C CA  . LEU B 1 209 ? 30.788  1.348   -1.078  1.00 66.24  ? 253 LEU B CA  1 
ATOM   3670 C C   . LEU B 1 209 ? 29.522  2.154   -0.806  1.00 64.12  ? 253 LEU B C   1 
ATOM   3671 O O   . LEU B 1 209 ? 28.447  1.787   -1.279  1.00 59.66  ? 253 LEU B O   1 
ATOM   3672 C CB  . LEU B 1 209 ? 30.618  -0.075  -0.539  1.00 68.02  ? 253 LEU B CB  1 
ATOM   3673 C CG  . LEU B 1 209 ? 31.839  -0.983  -0.734  1.00 66.77  ? 253 LEU B CG  1 
ATOM   3674 C CD1 . LEU B 1 209 ? 31.569  -2.353  -0.133  1.00 69.26  ? 253 LEU B CD1 1 
ATOM   3675 C CD2 . LEU B 1 209 ? 32.165  -1.102  -2.214  1.00 65.99  ? 253 LEU B CD2 1 
ATOM   3676 N N   . CYS B 1 210 ? 29.637  3.244   -0.051  1.00 64.13  ? 254 CYS B N   1 
ATOM   3677 C CA  . CYS B 1 210 ? 28.469  4.073   0.244   1.00 60.52  ? 254 CYS B CA  1 
ATOM   3678 C C   . CYS B 1 210 ? 27.973  4.836   -0.979  1.00 59.27  ? 254 CYS B C   1 
ATOM   3679 O O   . CYS B 1 210 ? 26.926  5.481   -0.934  1.00 56.05  ? 254 CYS B O   1 
ATOM   3680 C CB  . CYS B 1 210 ? 28.774  5.069   1.362   1.00 57.04  ? 254 CYS B CB  1 
ATOM   3681 S SG  . CYS B 1 210 ? 28.472  4.446   3.045   1.00 65.24  ? 254 CYS B SG  1 
ATOM   3682 N N   . GLN B 1 211 ? 28.735  4.768   -2.067  1.00 61.98  ? 255 GLN B N   1 
ATOM   3683 C CA  . GLN B 1 211 ? 28.365  5.447   -3.304  1.00 62.52  ? 255 GLN B CA  1 
ATOM   3684 C C   . GLN B 1 211 ? 27.945  4.425   -4.356  1.00 63.22  ? 255 GLN B C   1 
ATOM   3685 O O   . GLN B 1 211 ? 27.523  4.785   -5.459  1.00 61.17  ? 255 GLN B O   1 
ATOM   3686 C CB  . GLN B 1 211 ? 29.540  6.281   -3.818  1.00 63.54  ? 255 GLN B CB  1 
ATOM   3687 C CG  . GLN B 1 211 ? 29.991  7.370   -2.856  1.00 70.09  ? 255 GLN B CG  1 
ATOM   3688 C CD  . GLN B 1 211 ? 28.939  8.445   -2.645  1.00 73.67  ? 255 GLN B CD  1 
ATOM   3689 O OE1 . GLN B 1 211 ? 27.799  8.154   -2.277  1.00 77.97  ? 255 GLN B OE1 1 
ATOM   3690 N NE2 . GLN B 1 211 ? 29.320  9.699   -2.873  1.00 72.21  ? 255 GLN B NE2 1 
ATOM   3691 N N   . ASP B 1 212 ? 28.065  3.147   -4.004  1.00 63.36  ? 256 ASP B N   1 
ATOM   3692 C CA  . ASP B 1 212 ? 27.690  2.063   -4.903  1.00 60.86  ? 256 ASP B CA  1 
ATOM   3693 C C   . ASP B 1 212 ? 26.248  2.240   -5.361  1.00 57.96  ? 256 ASP B C   1 
ATOM   3694 O O   . ASP B 1 212 ? 25.397  2.686   -4.593  1.00 60.76  ? 256 ASP B O   1 
ATOM   3695 C CB  . ASP B 1 212 ? 27.853  0.712   -4.200  1.00 60.78  ? 256 ASP B CB  1 
ATOM   3696 C CG  . ASP B 1 212 ? 27.236  -0.432  -4.986  1.00 63.01  ? 256 ASP B CG  1 
ATOM   3697 O OD1 . ASP B 1 212 ? 25.994  -0.570  -4.967  1.00 57.73  ? 256 ASP B OD1 1 
ATOM   3698 O OD2 . ASP B 1 212 ? 27.993  -1.186  -5.634  1.00 64.89  ? 256 ASP B OD2 1 
ATOM   3699 N N   . PRO B 1 213 ? 25.957  1.887   -6.621  1.00 56.52  ? 257 PRO B N   1 
ATOM   3700 C CA  . PRO B 1 213 ? 24.614  2.007   -7.197  1.00 57.01  ? 257 PRO B CA  1 
ATOM   3701 C C   . PRO B 1 213 ? 23.461  1.696   -6.240  1.00 56.07  ? 257 PRO B C   1 
ATOM   3702 O O   . PRO B 1 213 ? 22.850  2.613   -5.700  1.00 56.63  ? 257 PRO B O   1 
ATOM   3703 C CB  . PRO B 1 213 ? 24.670  1.051   -8.382  1.00 58.01  ? 257 PRO B CB  1 
ATOM   3704 C CG  . PRO B 1 213 ? 26.067  1.243   -8.864  1.00 57.54  ? 257 PRO B CG  1 
ATOM   3705 C CD  . PRO B 1 213 ? 26.872  1.231   -7.574  1.00 55.39  ? 257 PRO B CD  1 
ATOM   3706 N N   . THR B 1 214 ? 23.169  0.412   -6.032  1.00 55.31  ? 258 THR B N   1 
ATOM   3707 C CA  . THR B 1 214 ? 22.071  -0.002  -5.151  1.00 54.38  ? 258 THR B CA  1 
ATOM   3708 C C   . THR B 1 214 ? 21.870  0.936   -3.971  1.00 52.41  ? 258 THR B C   1 
ATOM   3709 O O   . THR B 1 214 ? 20.739  1.272   -3.624  1.00 51.79  ? 258 THR B O   1 
ATOM   3710 C CB  . THR B 1 214 ? 22.283  -1.418  -4.590  1.00 55.39  ? 258 THR B CB  1 
ATOM   3711 O OG1 . THR B 1 214 ? 23.454  -1.436  -3.764  1.00 61.52  ? 258 THR B OG1 1 
ATOM   3712 C CG2 . THR B 1 214 ? 22.435  -2.418  -5.720  1.00 56.22  ? 258 THR B CG2 1 
ATOM   3713 N N   . ILE B 1 215 ? 22.966  1.357   -3.350  1.00 49.64  ? 259 ILE B N   1 
ATOM   3714 C CA  . ILE B 1 215 ? 22.875  2.268   -2.218  1.00 50.93  ? 259 ILE B CA  1 
ATOM   3715 C C   . ILE B 1 215 ? 22.205  3.576   -2.627  1.00 53.78  ? 259 ILE B C   1 
ATOM   3716 O O   . ILE B 1 215 ? 21.326  4.074   -1.926  1.00 58.01  ? 259 ILE B O   1 
ATOM   3717 C CB  . ILE B 1 215 ? 24.261  2.584   -1.641  1.00 43.18  ? 259 ILE B CB  1 
ATOM   3718 C CG1 . ILE B 1 215 ? 24.898  1.303   -1.099  1.00 45.56  ? 259 ILE B CG1 1 
ATOM   3719 C CG2 . ILE B 1 215 ? 24.142  3.640   -0.554  1.00 37.07  ? 259 ILE B CG2 1 
ATOM   3720 C CD1 . ILE B 1 215 ? 24.050  0.573   -0.073  1.00 46.41  ? 259 ILE B CD1 1 
ATOM   3721 N N   . LYS B 1 216 ? 22.625  4.132   -3.758  1.00 55.27  ? 260 LYS B N   1 
ATOM   3722 C CA  . LYS B 1 216 ? 22.050  5.378   -4.256  1.00 55.65  ? 260 LYS B CA  1 
ATOM   3723 C C   . LYS B 1 216 ? 20.566  5.136   -4.490  1.00 54.31  ? 260 LYS B C   1 
ATOM   3724 O O   . LYS B 1 216 ? 19.743  6.050   -4.397  1.00 51.94  ? 260 LYS B O   1 
ATOM   3725 C CB  . LYS B 1 216 ? 22.728  5.788   -5.567  1.00 56.28  ? 260 LYS B CB  1 
ATOM   3726 C CG  . LYS B 1 216 ? 24.251  5.826   -5.512  1.00 61.59  ? 260 LYS B CG  1 
ATOM   3727 C CD  . LYS B 1 216 ? 24.791  7.030   -4.734  1.00 72.60  ? 260 LYS B CD  1 
ATOM   3728 C CE  . LYS B 1 216 ? 24.552  6.927   -3.229  1.00 76.90  ? 260 LYS B CE  1 
ATOM   3729 N NZ  . LYS B 1 216 ? 25.032  8.139   -2.502  1.00 78.36  ? 260 LYS B NZ  1 
ATOM   3730 N N   . GLU B 1 217 ? 20.238  3.885   -4.791  1.00 53.74  ? 261 GLU B N   1 
ATOM   3731 C CA  . GLU B 1 217 ? 18.857  3.487   -5.026  1.00 60.57  ? 261 GLU B CA  1 
ATOM   3732 C C   . GLU B 1 217 ? 18.155  3.489   -3.668  1.00 57.60  ? 261 GLU B C   1 
ATOM   3733 O O   . GLU B 1 217 ? 17.006  3.920   -3.540  1.00 52.27  ? 261 GLU B O   1 
ATOM   3734 C CB  . GLU B 1 217 ? 18.819  2.082   -5.634  1.00 63.17  ? 261 GLU B CB  1 
ATOM   3735 C CG  . GLU B 1 217 ? 17.518  1.723   -6.325  1.00 65.35  ? 261 GLU B CG  1 
ATOM   3736 C CD  . GLU B 1 217 ? 17.462  0.258   -6.713  1.00 71.28  ? 261 GLU B CD  1 
ATOM   3737 O OE1 . GLU B 1 217 ? 18.498  -0.281  -7.168  1.00 66.13  ? 261 GLU B OE1 1 
ATOM   3738 O OE2 . GLU B 1 217 ? 16.377  -0.349  -6.568  1.00 73.21  ? 261 GLU B OE2 1 
ATOM   3739 N N   . LEU B 1 218 ? 18.872  3.005   -2.659  1.00 56.34  ? 262 LEU B N   1 
ATOM   3740 C CA  . LEU B 1 218 ? 18.364  2.939   -1.294  1.00 54.52  ? 262 LEU B CA  1 
ATOM   3741 C C   . LEU B 1 218 ? 18.092  4.367   -0.829  1.00 52.32  ? 262 LEU B C   1 
ATOM   3742 O O   . LEU B 1 218 ? 17.005  4.680   -0.337  1.00 46.42  ? 262 LEU B O   1 
ATOM   3743 C CB  . LEU B 1 218 ? 19.408  2.279   -0.385  1.00 53.95  ? 262 LEU B CB  1 
ATOM   3744 C CG  . LEU B 1 218 ? 19.034  1.766   1.009   1.00 58.30  ? 262 LEU B CG  1 
ATOM   3745 C CD1 . LEU B 1 218 ? 20.303  1.293   1.698   1.00 54.69  ? 262 LEU B CD1 1 
ATOM   3746 C CD2 . LEU B 1 218 ? 18.368  2.849   1.838   1.00 63.38  ? 262 LEU B CD2 1 
ATOM   3747 N N   . GLU B 1 219 ? 19.087  5.231   -0.994  1.00 49.91  ? 263 GLU B N   1 
ATOM   3748 C CA  . GLU B 1 219 ? 18.949  6.624   -0.594  1.00 51.75  ? 263 GLU B CA  1 
ATOM   3749 C C   . GLU B 1 219 ? 17.771  7.237   -1.320  1.00 49.61  ? 263 GLU B C   1 
ATOM   3750 O O   . GLU B 1 219 ? 16.951  7.927   -0.718  1.00 53.57  ? 263 GLU B O   1 
ATOM   3751 C CB  . GLU B 1 219 ? 20.217  7.411   -0.919  1.00 50.11  ? 263 GLU B CB  1 
ATOM   3752 C CG  . GLU B 1 219 ? 20.055  8.904   -0.735  1.00 59.27  ? 263 GLU B CG  1 
ATOM   3753 C CD  . GLU B 1 219 ? 21.377  9.637   -0.720  1.00 65.61  ? 263 GLU B CD  1 
ATOM   3754 O OE1 . GLU B 1 219 ? 22.182  9.435   -1.656  1.00 65.43  ? 263 GLU B OE1 1 
ATOM   3755 O OE2 . GLU B 1 219 ? 21.606  10.420  0.229   1.00 67.60  ? 263 GLU B OE2 1 
ATOM   3756 N N   . SER B 1 220 ? 17.695  6.982   -2.622  1.00 47.61  ? 264 SER B N   1 
ATOM   3757 C CA  . SER B 1 220 ? 16.607  7.497   -3.434  1.00 42.83  ? 264 SER B CA  1 
ATOM   3758 C C   . SER B 1 220 ? 15.286  7.089   -2.812  1.00 44.27  ? 264 SER B C   1 
ATOM   3759 O O   . SER B 1 220 ? 14.474  7.936   -2.449  1.00 41.43  ? 264 SER B O   1 
ATOM   3760 C CB  . SER B 1 220 ? 16.692  6.938   -4.856  1.00 47.51  ? 264 SER B CB  1 
ATOM   3761 O OG  . SER B 1 220 ? 15.492  7.187   -5.574  1.00 39.09  ? 264 SER B OG  1 
ATOM   3762 N N   . ILE B 1 221 ? 15.088  5.780   -2.689  1.00 47.84  ? 265 ILE B N   1 
ATOM   3763 C CA  . ILE B 1 221 ? 13.865  5.219   -2.120  1.00 46.31  ? 265 ILE B CA  1 
ATOM   3764 C C   . ILE B 1 221 ? 13.495  5.825   -0.772  1.00 41.66  ? 265 ILE B C   1 
ATOM   3765 O O   . ILE B 1 221 ? 12.326  6.098   -0.508  1.00 36.07  ? 265 ILE B O   1 
ATOM   3766 C CB  . ILE B 1 221 ? 13.988  3.680   -1.991  1.00 47.22  ? 265 ILE B CB  1 
ATOM   3767 C CG1 . ILE B 1 221 ? 13.773  3.045   -3.368  1.00 45.77  ? 265 ILE B CG1 1 
ATOM   3768 C CG2 . ILE B 1 221 ? 13.002  3.141   -0.965  1.00 49.75  ? 265 ILE B CG2 1 
ATOM   3769 C CD1 . ILE B 1 221 ? 13.839  1.529   -3.380  1.00 52.44  ? 265 ILE B CD1 1 
ATOM   3770 N N   . ILE B 1 222 ? 14.488  6.043   0.079   1.00 44.24  ? 266 ILE B N   1 
ATOM   3771 C CA  . ILE B 1 222 ? 14.224  6.624   1.388   1.00 42.85  ? 266 ILE B CA  1 
ATOM   3772 C C   . ILE B 1 222 ? 13.789  8.076   1.270   1.00 43.34  ? 266 ILE B C   1 
ATOM   3773 O O   . ILE B 1 222 ? 12.723  8.451   1.763   1.00 43.30  ? 266 ILE B O   1 
ATOM   3774 C CB  . ILE B 1 222 ? 15.461  6.520   2.303   1.00 39.63  ? 266 ILE B CB  1 
ATOM   3775 C CG1 . ILE B 1 222 ? 15.523  5.124   2.908   1.00 42.51  ? 266 ILE B CG1 1 
ATOM   3776 C CG2 . ILE B 1 222 ? 15.380  7.532   3.428   1.00 42.94  ? 266 ILE B CG2 1 
ATOM   3777 C CD1 . ILE B 1 222 ? 14.338  4.813   3.802   1.00 46.68  ? 266 ILE B CD1 1 
ATOM   3778 N N   . SER B 1 223 ? 14.613  8.885   0.612   1.00 44.73  ? 267 SER B N   1 
ATOM   3779 C CA  . SER B 1 223 ? 14.310  10.298  0.424   1.00 43.49  ? 267 SER B CA  1 
ATOM   3780 C C   . SER B 1 223 ? 12.869  10.504  -0.023  1.00 39.85  ? 267 SER B C   1 
ATOM   3781 O O   . SER B 1 223 ? 12.145  11.305  0.560   1.00 42.95  ? 267 SER B O   1 
ATOM   3782 C CB  . SER B 1 223 ? 15.254  10.907  -0.612  1.00 42.15  ? 267 SER B CB  1 
ATOM   3783 O OG  . SER B 1 223 ? 16.595  10.849  -0.167  1.00 51.47  ? 267 SER B OG  1 
ATOM   3784 N N   . LYS B 1 224 ? 12.454  9.775   -1.054  1.00 39.72  ? 268 LYS B N   1 
ATOM   3785 C CA  . LYS B 1 224 ? 11.096  9.904   -1.564  1.00 41.04  ? 268 LYS B CA  1 
ATOM   3786 C C   . LYS B 1 224 ? 10.080  9.709   -0.446  1.00 43.65  ? 268 LYS B C   1 
ATOM   3787 O O   . LYS B 1 224 ? 8.966   10.224  -0.516  1.00 45.63  ? 268 LYS B O   1 
ATOM   3788 C CB  . LYS B 1 224 ? 10.831  8.891   -2.686  1.00 38.92  ? 268 LYS B CB  1 
ATOM   3789 C CG  . LYS B 1 224 ? 9.426   9.016   -3.290  1.00 56.27  ? 268 LYS B CG  1 
ATOM   3790 C CD  . LYS B 1 224 ? 9.152   8.014   -4.412  1.00 57.47  ? 268 LYS B CD  1 
ATOM   3791 C CE  . LYS B 1 224 ? 7.741   8.208   -4.975  1.00 64.71  ? 268 LYS B CE  1 
ATOM   3792 N NZ  . LYS B 1 224 ? 7.405   7.271   -6.092  1.00 67.58  ? 268 LYS B NZ  1 
ATOM   3793 N N   . ARG B 1 225 ? 10.466  8.972   0.591   1.00 44.06  ? 269 ARG B N   1 
ATOM   3794 C CA  . ARG B 1 225 ? 9.567   8.731   1.710   1.00 47.18  ? 269 ARG B CA  1 
ATOM   3795 C C   . ARG B 1 225 ? 9.694   9.805   2.794   1.00 49.28  ? 269 ARG B C   1 
ATOM   3796 O O   . ARG B 1 225 ? 9.119   9.686   3.877   1.00 49.33  ? 269 ARG B O   1 
ATOM   3797 C CB  . ARG B 1 225 ? 9.815   7.337   2.293   1.00 47.79  ? 269 ARG B CB  1 
ATOM   3798 C CG  . ARG B 1 225 ? 9.622   6.223   1.278   1.00 36.92  ? 269 ARG B CG  1 
ATOM   3799 C CD  . ARG B 1 225 ? 9.314   4.891   1.941   1.00 43.27  ? 269 ARG B CD  1 
ATOM   3800 N NE  . ARG B 1 225 ? 8.036   4.924   2.647   1.00 41.77  ? 269 ARG B NE  1 
ATOM   3801 C CZ  . ARG B 1 225 ? 7.911   4.889   3.970   1.00 37.36  ? 269 ARG B CZ  1 
ATOM   3802 N NH1 . ARG B 1 225 ? 8.989   4.811   4.745   1.00 30.96  ? 269 ARG B NH1 1 
ATOM   3803 N NH2 . ARG B 1 225 ? 6.708   4.948   4.519   1.00 34.84  ? 269 ARG B NH2 1 
ATOM   3804 N N   . ASN B 1 226 ? 10.445  10.858  2.481   1.00 50.74  ? 270 ASN B N   1 
ATOM   3805 C CA  . ASN B 1 226 ? 10.647  11.982  3.391   1.00 48.70  ? 270 ASN B CA  1 
ATOM   3806 C C   . ASN B 1 226 ? 11.418  11.630  4.648   1.00 46.69  ? 270 ASN B C   1 
ATOM   3807 O O   . ASN B 1 226 ? 11.057  12.045  5.748   1.00 46.13  ? 270 ASN B O   1 
ATOM   3808 C CB  . ASN B 1 226 ? 9.300   12.607  3.764   1.00 54.09  ? 270 ASN B CB  1 
ATOM   3809 C CG  . ASN B 1 226 ? 8.667   13.355  2.603   1.00 61.88  ? 270 ASN B CG  1 
ATOM   3810 O OD1 . ASN B 1 226 ? 7.483   13.695  2.635   1.00 66.25  ? 270 ASN B OD1 1 
ATOM   3811 N ND2 . ASN B 1 226 ? 9.462   13.623  1.571   1.00 62.17  ? 270 ASN B ND2 1 
ATOM   3812 N N   . ILE B 1 227 ? 12.484  10.860  4.476   1.00 40.74  ? 271 ILE B N   1 
ATOM   3813 C CA  . ILE B 1 227 ? 13.332  10.465  5.586   1.00 39.57  ? 271 ILE B CA  1 
ATOM   3814 C C   . ILE B 1 227 ? 14.765  10.701  5.155   1.00 42.92  ? 271 ILE B C   1 
ATOM   3815 O O   . ILE B 1 227 ? 15.146  10.361  4.037   1.00 47.68  ? 271 ILE B O   1 
ATOM   3816 C CB  . ILE B 1 227 ? 13.169  8.971   5.951   1.00 37.93  ? 271 ILE B CB  1 
ATOM   3817 C CG1 . ILE B 1 227 ? 11.724  8.688   6.370   1.00 35.24  ? 271 ILE B CG1 1 
ATOM   3818 C CG2 . ILE B 1 227 ? 14.147  8.603   7.081   1.00 31.76  ? 271 ILE B CG2 1 
ATOM   3819 C CD1 . ILE B 1 227 ? 11.486  7.266   6.840   1.00 30.51  ? 271 ILE B CD1 1 
ATOM   3820 N N   . GLN B 1 228 ? 15.557  11.293  6.036   1.00 40.50  ? 272 GLN B N   1 
ATOM   3821 C CA  . GLN B 1 228 ? 16.945  11.560  5.711   1.00 46.33  ? 272 GLN B CA  1 
ATOM   3822 C C   . GLN B 1 228 ? 17.689  10.228  5.650   1.00 50.44  ? 272 GLN B C   1 
ATOM   3823 O O   . GLN B 1 228 ? 17.396  9.310   6.417   1.00 47.24  ? 272 GLN B O   1 
ATOM   3824 C CB  . GLN B 1 228 ? 17.565  12.463  6.780   1.00 45.05  ? 272 GLN B CB  1 
ATOM   3825 C CG  . GLN B 1 228 ? 16.704  13.671  7.139   1.00 52.04  ? 272 GLN B CG  1 
ATOM   3826 C CD  . GLN B 1 228 ? 17.310  14.524  8.245   1.00 53.00  ? 272 GLN B CD  1 
ATOM   3827 O OE1 . GLN B 1 228 ? 18.321  15.202  8.042   1.00 52.98  ? 272 GLN B OE1 1 
ATOM   3828 N NE2 . GLN B 1 228 ? 16.695  14.488  9.426   1.00 51.01  ? 272 GLN B NE2 1 
ATOM   3829 N N   . PHE B 1 229 ? 18.632  10.118  4.718   1.00 53.39  ? 273 PHE B N   1 
ATOM   3830 C CA  . PHE B 1 229 ? 19.427  8.905   4.591   1.00 49.66  ? 273 PHE B CA  1 
ATOM   3831 C C   . PHE B 1 229 ? 20.872  9.194   4.957   1.00 49.95  ? 273 PHE B C   1 
ATOM   3832 O O   . PHE B 1 229 ? 21.389  10.280  4.704   1.00 52.58  ? 273 PHE B O   1 
ATOM   3833 C CB  . PHE B 1 229 ? 19.388  8.346   3.170   1.00 47.18  ? 273 PHE B CB  1 
ATOM   3834 C CG  . PHE B 1 229 ? 20.225  7.112   2.998   1.00 47.69  ? 273 PHE B CG  1 
ATOM   3835 C CD1 . PHE B 1 229 ? 19.881  5.930   3.648   1.00 48.16  ? 273 PHE B CD1 1 
ATOM   3836 C CD2 . PHE B 1 229 ? 21.387  7.142   2.235   1.00 52.04  ? 273 PHE B CD2 1 
ATOM   3837 C CE1 . PHE B 1 229 ? 20.683  4.794   3.544   1.00 49.56  ? 273 PHE B CE1 1 
ATOM   3838 C CE2 . PHE B 1 229 ? 22.199  6.010   2.124   1.00 53.10  ? 273 PHE B CE2 1 
ATOM   3839 C CZ  . PHE B 1 229 ? 21.846  4.834   2.781   1.00 50.99  ? 273 PHE B CZ  1 
ATOM   3840 N N   . SER B 1 230 ? 21.526  8.206   5.548   1.00 51.11  ? 274 SER B N   1 
ATOM   3841 C CA  . SER B 1 230 ? 22.909  8.355   5.958   1.00 51.31  ? 274 SER B CA  1 
ATOM   3842 C C   . SER B 1 230 ? 23.586  7.012   5.787   1.00 50.78  ? 274 SER B C   1 
ATOM   3843 O O   . SER B 1 230 ? 23.048  5.986   6.199   1.00 48.72  ? 274 SER B O   1 
ATOM   3844 C CB  . SER B 1 230 ? 22.970  8.796   7.425   1.00 51.67  ? 274 SER B CB  1 
ATOM   3845 O OG  . SER B 1 230 ? 24.296  8.785   7.915   1.00 53.33  ? 274 SER B OG  1 
ATOM   3846 N N   . CYS B 1 231 ? 24.761  7.018   5.171   1.00 49.62  ? 275 CYS B N   1 
ATOM   3847 C CA  . CYS B 1 231 ? 25.499  5.783   4.949   1.00 52.19  ? 275 CYS B CA  1 
ATOM   3848 C C   . CYS B 1 231 ? 26.852  5.858   5.623   1.00 54.79  ? 275 CYS B C   1 
ATOM   3849 O O   . CYS B 1 231 ? 27.301  6.932   6.012   1.00 58.16  ? 275 CYS B O   1 
ATOM   3850 C CB  . CYS B 1 231 ? 25.678  5.535   3.455   1.00 54.89  ? 275 CYS B CB  1 
ATOM   3851 S SG  . CYS B 1 231 ? 26.499  3.967   3.028   1.00 55.02  ? 275 CYS B SG  1 
ATOM   3852 N N   . LYS B 1 232 ? 27.507  4.714   5.762   1.00 59.59  ? 276 LYS B N   1 
ATOM   3853 C CA  . LYS B 1 232 ? 28.805  4.685   6.413   1.00 65.01  ? 276 LYS B CA  1 
ATOM   3854 C C   . LYS B 1 232 ? 29.501  3.346   6.183   1.00 65.63  ? 276 LYS B C   1 
ATOM   3855 O O   . LYS B 1 232 ? 28.965  2.290   6.521   1.00 67.43  ? 276 LYS B O   1 
ATOM   3856 C CB  . LYS B 1 232 ? 28.620  4.952   7.912   1.00 65.01  ? 276 LYS B CB  1 
ATOM   3857 C CG  . LYS B 1 232 ? 29.904  5.098   8.709   1.00 72.25  ? 276 LYS B CG  1 
ATOM   3858 C CD  . LYS B 1 232 ? 29.619  5.575   10.132  1.00 74.49  ? 276 LYS B CD  1 
ATOM   3859 C CE  . LYS B 1 232 ? 28.758  4.581   10.909  1.00 78.82  ? 276 LYS B CE  1 
ATOM   3860 N NZ  . LYS B 1 232 ? 28.540  4.996   12.330  1.00 76.52  ? 276 LYS B NZ  1 
ATOM   3861 N N   . ASN B 1 233 ? 30.692  3.400   5.593   1.00 65.70  ? 277 ASN B N   1 
ATOM   3862 C CA  . ASN B 1 233 ? 31.478  2.202   5.316   1.00 63.78  ? 277 ASN B CA  1 
ATOM   3863 C C   . ASN B 1 233 ? 32.123  1.685   6.591   1.00 65.06  ? 277 ASN B C   1 
ATOM   3864 O O   . ASN B 1 233 ? 32.612  2.466   7.407   1.00 63.87  ? 277 ASN B O   1 
ATOM   3865 C CB  . ASN B 1 233 ? 32.593  2.509   4.313   1.00 62.43  ? 277 ASN B CB  1 
ATOM   3866 C CG  . ASN B 1 233 ? 32.069  2.923   2.960   1.00 63.13  ? 277 ASN B CG  1 
ATOM   3867 O OD1 . ASN B 1 233 ? 31.636  2.090   2.166   1.00 67.08  ? 277 ASN B OD1 1 
ATOM   3868 N ND2 . ASN B 1 233 ? 32.103  4.222   2.688   1.00 64.87  ? 277 ASN B ND2 1 
ATOM   3869 N N   . ILE B 1 234 ? 32.119  0.369   6.757   1.00 65.49  ? 278 ILE B N   1 
ATOM   3870 C CA  . ILE B 1 234 ? 32.748  -0.260  7.907   1.00 68.47  ? 278 ILE B CA  1 
ATOM   3871 C C   . ILE B 1 234 ? 33.790  -1.215  7.334   1.00 70.25  ? 278 ILE B C   1 
ATOM   3872 O O   . ILE B 1 234 ? 33.500  -2.368  7.010   1.00 72.37  ? 278 ILE B O   1 
ATOM   3873 C CB  . ILE B 1 234 ? 31.726  -1.026  8.767   1.00 70.12  ? 278 ILE B CB  1 
ATOM   3874 C CG1 . ILE B 1 234 ? 30.710  -0.040  9.346   1.00 72.82  ? 278 ILE B CG1 1 
ATOM   3875 C CG2 . ILE B 1 234 ? 32.435  -1.764  9.895   1.00 66.93  ? 278 ILE B CG2 1 
ATOM   3876 C CD1 . ILE B 1 234 ? 29.727  -0.660  10.317  1.00 77.02  ? 278 ILE B CD1 1 
ATOM   3877 N N   . TYR B 1 235 ? 35.009  -0.703  7.206   1.00 72.16  ? 279 TYR B N   1 
ATOM   3878 C CA  . TYR B 1 235 ? 36.131  -1.439  6.640   1.00 71.65  ? 279 TYR B CA  1 
ATOM   3879 C C   . TYR B 1 235 ? 36.662  -2.600  7.468   1.00 73.15  ? 279 TYR B C   1 
ATOM   3880 O O   . TYR B 1 235 ? 37.088  -3.613  6.913   1.00 75.60  ? 279 TYR B O   1 
ATOM   3881 C CB  . TYR B 1 235 ? 37.265  -0.458  6.341   1.00 66.67  ? 279 TYR B CB  1 
ATOM   3882 C CG  . TYR B 1 235 ? 36.869  0.630   5.364   1.00 62.73  ? 279 TYR B CG  1 
ATOM   3883 C CD1 . TYR B 1 235 ? 36.542  0.318   4.045   1.00 58.61  ? 279 TYR B CD1 1 
ATOM   3884 C CD2 . TYR B 1 235 ? 36.814  1.968   5.760   1.00 60.76  ? 279 TYR B CD2 1 
ATOM   3885 C CE1 . TYR B 1 235 ? 36.171  1.309   3.142   1.00 61.62  ? 279 TYR B CE1 1 
ATOM   3886 C CE2 . TYR B 1 235 ? 36.441  2.970   4.863   1.00 59.05  ? 279 TYR B CE2 1 
ATOM   3887 C CZ  . TYR B 1 235 ? 36.122  2.630   3.556   1.00 60.84  ? 279 TYR B CZ  1 
ATOM   3888 O OH  . TYR B 1 235 ? 35.753  3.605   2.658   1.00 65.53  ? 279 TYR B OH  1 
ATOM   3889 N N   . ARG B 1 236 ? 36.646  -2.461  8.789   1.00 75.95  ? 280 ARG B N   1 
ATOM   3890 C CA  . ARG B 1 236 ? 37.150  -3.526  9.646   1.00 82.05  ? 280 ARG B CA  1 
ATOM   3891 C C   . ARG B 1 236 ? 36.078  -4.263  10.430  1.00 84.06  ? 280 ARG B C   1 
ATOM   3892 O O   . ARG B 1 236 ? 35.689  -3.841  11.516  1.00 86.22  ? 280 ARG B O   1 
ATOM   3893 C CB  . ARG B 1 236 ? 38.209  -2.976  10.607  1.00 86.96  ? 280 ARG B CB  1 
ATOM   3894 C CG  . ARG B 1 236 ? 39.568  -2.782  9.949   1.00 92.29  ? 280 ARG B CG  1 
ATOM   3895 C CD  . ARG B 1 236 ? 40.010  -4.081  9.288   1.00 96.71  ? 280 ARG B CD  1 
ATOM   3896 N NE  . ARG B 1 236 ? 41.181  -3.916  8.433   1.00 101.60 ? 280 ARG B NE  1 
ATOM   3897 C CZ  . ARG B 1 236 ? 41.590  -4.827  7.554   1.00 103.64 ? 280 ARG B CZ  1 
ATOM   3898 N NH1 . ARG B 1 236 ? 40.919  -5.964  7.418   1.00 102.95 ? 280 ARG B NH1 1 
ATOM   3899 N NH2 . ARG B 1 236 ? 42.664  -4.601  6.807   1.00 103.51 ? 280 ARG B NH2 1 
ATOM   3900 N N   . PRO B 1 237 ? 35.585  -5.383  9.880   1.00 86.02  ? 281 PRO B N   1 
ATOM   3901 C CA  . PRO B 1 237 ? 34.550  -6.190  10.533  1.00 87.36  ? 281 PRO B CA  1 
ATOM   3902 C C   . PRO B 1 237 ? 35.118  -6.873  11.768  1.00 89.87  ? 281 PRO B C   1 
ATOM   3903 O O   . PRO B 1 237 ? 34.566  -6.766  12.863  1.00 91.79  ? 281 PRO B O   1 
ATOM   3904 C CB  . PRO B 1 237 ? 34.166  -7.205  9.455   1.00 87.21  ? 281 PRO B CB  1 
ATOM   3905 C CG  . PRO B 1 237 ? 34.515  -6.503  8.172   1.00 87.40  ? 281 PRO B CG  1 
ATOM   3906 C CD  . PRO B 1 237 ? 35.834  -5.869  8.513   1.00 85.81  ? 281 PRO B CD  1 
ATOM   3907 N N   . ASP B 1 238 ? 36.232  -7.573  11.571  1.00 91.69  ? 282 ASP B N   1 
ATOM   3908 C CA  . ASP B 1 238 ? 36.909  -8.297  12.642  1.00 93.01  ? 282 ASP B CA  1 
ATOM   3909 C C   . ASP B 1 238 ? 37.314  -7.417  13.826  1.00 93.08  ? 282 ASP B C   1 
ATOM   3910 O O   . ASP B 1 238 ? 37.517  -7.916  14.935  1.00 91.22  ? 282 ASP B O   1 
ATOM   3911 C CB  . ASP B 1 238 ? 38.139  -9.008  12.076  1.00 93.68  ? 282 ASP B CB  1 
ATOM   3912 C CG  . ASP B 1 238 ? 38.878  -8.163  11.058  1.00 95.01  ? 282 ASP B CG  1 
ATOM   3913 O OD1 . ASP B 1 238 ? 39.242  -7.014  11.391  1.00 96.12  ? 282 ASP B OD1 1 
ATOM   3914 O OD2 . ASP B 1 238 ? 39.092  -8.650  9.925   1.00 92.38  ? 282 ASP B OD2 1 
ATOM   3915 N N   . LYS B 1 239 ? 37.438  -6.113  13.596  1.00 93.46  ? 283 LYS B N   1 
ATOM   3916 C CA  . LYS B 1 239 ? 37.802  -5.196  14.672  1.00 93.57  ? 283 LYS B CA  1 
ATOM   3917 C C   . LYS B 1 239 ? 36.601  -4.321  15.032  1.00 94.37  ? 283 LYS B C   1 
ATOM   3918 O O   . LYS B 1 239 ? 36.624  -3.588  16.024  1.00 95.09  ? 283 LYS B O   1 
ATOM   3919 C CB  . LYS B 1 239 ? 38.989  -4.315  14.260  1.00 92.97  ? 283 LYS B CB  1 
ATOM   3920 C CG  . LYS B 1 239 ? 39.595  -3.525  15.424  1.00 93.50  ? 283 LYS B CG  1 
ATOM   3921 C CD  . LYS B 1 239 ? 40.840  -2.726  15.024  1.00 91.28  ? 283 LYS B CD  1 
ATOM   3922 C CE  . LYS B 1 239 ? 40.510  -1.494  14.180  1.00 86.43  ? 283 LYS B CE  1 
ATOM   3923 N NZ  . LYS B 1 239 ? 39.980  -1.831  12.831  1.00 81.31  ? 283 LYS B NZ  1 
ATOM   3924 N N   . PHE B 1 240 ? 35.553  -4.407  14.215  1.00 92.08  ? 284 PHE B N   1 
ATOM   3925 C CA  . PHE B 1 240 ? 34.326  -3.645  14.435  1.00 87.69  ? 284 PHE B CA  1 
ATOM   3926 C C   . PHE B 1 240 ? 33.780  -3.951  15.823  1.00 87.94  ? 284 PHE B C   1 
ATOM   3927 O O   . PHE B 1 240 ? 33.544  -3.043  16.625  1.00 87.21  ? 284 PHE B O   1 
ATOM   3928 C CB  . PHE B 1 240 ? 33.286  -4.013  13.374  1.00 86.44  ? 284 PHE B CB  1 
ATOM   3929 C CG  . PHE B 1 240 ? 31.902  -3.502  13.669  1.00 84.42  ? 284 PHE B CG  1 
ATOM   3930 C CD1 . PHE B 1 240 ? 31.680  -2.153  13.924  1.00 81.63  ? 284 PHE B CD1 1 
ATOM   3931 C CD2 . PHE B 1 240 ? 30.815  -4.373  13.674  1.00 81.48  ? 284 PHE B CD2 1 
ATOM   3932 C CE1 . PHE B 1 240 ? 30.396  -1.678  14.179  1.00 79.98  ? 284 PHE B CE1 1 
ATOM   3933 C CE2 . PHE B 1 240 ? 29.528  -3.907  13.926  1.00 79.31  ? 284 PHE B CE2 1 
ATOM   3934 C CZ  . PHE B 1 240 ? 29.318  -2.557  14.179  1.00 78.84  ? 284 PHE B CZ  1 
ATOM   3935 N N   . LEU B 1 241 ? 33.581  -5.238  16.095  1.00 86.72  ? 285 LEU B N   1 
ATOM   3936 C CA  . LEU B 1 241 ? 33.077  -5.681  17.389  1.00 86.51  ? 285 LEU B CA  1 
ATOM   3937 C C   . LEU B 1 241 ? 34.115  -5.367  18.455  1.00 87.38  ? 285 LEU B C   1 
ATOM   3938 O O   . LEU B 1 241 ? 33.799  -4.801  19.501  1.00 87.89  ? 285 LEU B O   1 
ATOM   3939 C CB  . LEU B 1 241 ? 32.808  -7.187  17.367  1.00 82.34  ? 285 LEU B CB  1 
ATOM   3940 C CG  . LEU B 1 241 ? 31.731  -7.684  16.403  1.00 79.18  ? 285 LEU B CG  1 
ATOM   3941 C CD1 . LEU B 1 241 ? 31.637  -9.202  16.487  1.00 75.33  ? 285 LEU B CD1 1 
ATOM   3942 C CD2 . LEU B 1 241 ? 30.397  -7.041  16.750  1.00 72.12  ? 285 LEU B CD2 1 
ATOM   3943 N N   . GLN B 1 242 ? 35.359  -5.743  18.174  1.00 90.26  ? 286 GLN B N   1 
ATOM   3944 C CA  . GLN B 1 242 ? 36.471  -5.513  19.088  1.00 91.62  ? 286 GLN B CA  1 
ATOM   3945 C C   . GLN B 1 242 ? 36.407  -4.097  19.658  1.00 93.54  ? 286 GLN B C   1 
ATOM   3946 O O   . GLN B 1 242 ? 36.386  -3.906  20.876  1.00 93.57  ? 286 GLN B O   1 
ATOM   3947 C CB  . GLN B 1 242 ? 37.798  -5.708  18.347  1.00 92.00  ? 286 GLN B CB  1 
ATOM   3948 C CG  . GLN B 1 242 ? 39.027  -5.725  19.239  1.00 90.59  ? 286 GLN B CG  1 
ATOM   3949 C CD  . GLN B 1 242 ? 39.123  -6.990  20.072  1.00 92.37  ? 286 GLN B CD  1 
ATOM   3950 O OE1 . GLN B 1 242 ? 40.049  -7.154  20.870  1.00 93.00  ? 286 GLN B OE1 1 
ATOM   3951 N NE2 . GLN B 1 242 ? 38.167  -7.895  19.889  1.00 91.11  ? 286 GLN B NE2 1 
ATOM   3952 N N   . CYS B 1 243 ? 36.369  -3.112  18.764  1.00 94.30  ? 287 CYS B N   1 
ATOM   3953 C CA  . CYS B 1 243 ? 36.312  -1.711  19.165  1.00 95.57  ? 287 CYS B CA  1 
ATOM   3954 C C   . CYS B 1 243 ? 35.052  -1.404  19.959  1.00 95.07  ? 287 CYS B C   1 
ATOM   3955 O O   . CYS B 1 243 ? 35.118  -1.092  21.150  1.00 94.17  ? 287 CYS B O   1 
ATOM   3956 C CB  . CYS B 1 243 ? 36.372  -0.802  17.933  1.00 97.85  ? 287 CYS B CB  1 
ATOM   3957 S SG  . CYS B 1 243 ? 37.958  -0.830  17.056  1.00 104.47 ? 287 CYS B SG  1 
ATOM   3958 N N   . VAL B 1 244 ? 33.905  -1.499  19.293  1.00 95.65  ? 288 VAL B N   1 
ATOM   3959 C CA  . VAL B 1 244 ? 32.620  -1.226  19.926  1.00 96.45  ? 288 VAL B CA  1 
ATOM   3960 C C   . VAL B 1 244 ? 32.478  -1.930  21.277  1.00 96.73  ? 288 VAL B C   1 
ATOM   3961 O O   . VAL B 1 244 ? 31.678  -1.517  22.119  1.00 97.33  ? 288 VAL B O   1 
ATOM   3962 C CB  . VAL B 1 244 ? 31.454  -1.650  19.004  1.00 95.54  ? 288 VAL B CB  1 
ATOM   3963 C CG1 . VAL B 1 244 ? 30.117  -1.317  19.656  1.00 94.79  ? 288 VAL B CG1 1 
ATOM   3964 C CG2 . VAL B 1 244 ? 31.577  -0.942  17.663  1.00 92.93  ? 288 VAL B CG2 1 
ATOM   3965 N N   . LYS B 1 245 ? 33.262  -2.986  21.481  1.00 96.63  ? 289 LYS B N   1 
ATOM   3966 C CA  . LYS B 1 245 ? 33.230  -3.745  22.729  1.00 97.00  ? 289 LYS B CA  1 
ATOM   3967 C C   . LYS B 1 245 ? 33.484  -2.842  23.936  1.00 96.84  ? 289 LYS B C   1 
ATOM   3968 O O   . LYS B 1 245 ? 32.588  -2.751  24.802  1.00 95.33  ? 289 LYS B O   1 
ATOM   3969 C CB  . LYS B 1 245 ? 34.281  -4.858  22.696  1.00 97.40  ? 289 LYS B CB  1 
ATOM   3970 C CG  . LYS B 1 245 ? 34.312  -5.725  23.947  1.00 97.09  ? 289 LYS B CG  1 
ATOM   3971 C CD  . LYS B 1 245 ? 35.460  -6.725  23.905  1.00 95.70  ? 289 LYS B CD  1 
ATOM   3972 C CE  . LYS B 1 245 ? 35.347  -7.659  22.708  1.00 93.67  ? 289 LYS B CE  1 
ATOM   3973 N NZ  . LYS B 1 245 ? 36.461  -8.647  22.672  1.00 91.24  ? 289 LYS B NZ  1 
HETATM 3974 N N1  . EPE C 2 .   ? 8.042   13.932  49.060  1.00 81.03  ? 301 EPE A N1  1 
HETATM 3975 C C2  . EPE C 2 .   ? 8.558   14.140  47.680  1.00 79.23  ? 301 EPE A C2  1 
HETATM 3976 C C3  . EPE C 2 .   ? 7.821   15.338  47.045  1.00 82.02  ? 301 EPE A C3  1 
HETATM 3977 N N4  . EPE C 2 .   ? 8.086   16.570  47.846  1.00 83.76  ? 301 EPE A N4  1 
HETATM 3978 C C5  . EPE C 2 .   ? 7.563   16.349  49.229  1.00 81.98  ? 301 EPE A C5  1 
HETATM 3979 C C6  . EPE C 2 .   ? 8.327   15.172  49.858  1.00 82.84  ? 301 EPE A C6  1 
HETATM 3980 C C7  . EPE C 2 .   ? 7.358   17.691  47.205  1.00 83.79  ? 301 EPE A C7  1 
HETATM 3981 C C8  . EPE C 2 .   ? 7.580   19.020  47.943  1.00 81.28  ? 301 EPE A C8  1 
HETATM 3982 O O8  . EPE C 2 .   ? 6.784   20.034  47.332  1.00 80.18  ? 301 EPE A O8  1 
HETATM 3983 C C9  . EPE C 2 .   ? 8.766   12.784  49.642  1.00 77.59  ? 301 EPE A C9  1 
HETATM 3984 C C10 . EPE C 2 .   ? 8.286   12.484  51.076  1.00 71.51  ? 301 EPE A C10 1 
HETATM 3985 S S   . EPE C 2 .   ? 9.212   11.078  51.738  1.00 61.96  ? 301 EPE A S   1 
HETATM 3986 O O1S . EPE C 2 .   ? 8.948   9.890   51.026  1.00 62.29  ? 301 EPE A O1S 1 
HETATM 3987 O O2S . EPE C 2 .   ? 10.580  11.485  51.886  1.00 70.58  ? 301 EPE A O2S 1 
HETATM 3988 O O3S . EPE C 2 .   ? 8.682   10.859  53.148  1.00 59.40  ? 301 EPE A O3S 1 
HETATM 3989 N N1  . EPE D 2 .   ? 14.070  -14.313 4.832   1.00 95.96  ? 302 EPE B N1  1 
HETATM 3990 C C2  . EPE D 2 .   ? 14.156  -14.450 6.313   1.00 96.10  ? 302 EPE B C2  1 
HETATM 3991 C C3  . EPE D 2 .   ? 13.228  -15.604 6.765   1.00 100.34 ? 302 EPE B C3  1 
HETATM 3992 N N4  . EPE D 2 .   ? 13.677  -16.884 6.140   1.00 102.70 ? 302 EPE B N4  1 
HETATM 3993 C C5  . EPE D 2 .   ? 13.599  -16.732 4.656   1.00 100.64 ? 302 EPE B C5  1 
HETATM 3994 C C6  . EPE D 2 .   ? 14.542  -15.597 4.217   1.00 97.82  ? 302 EPE B C6  1 
HETATM 3995 C C7  . EPE D 2 .   ? 12.759  -17.967 6.587   1.00 102.48 ? 302 EPE B C7  1 
HETATM 3996 C C8  . EPE D 2 .   ? 13.155  -19.339 6.003   1.00 101.09 ? 302 EPE B C8  1 
HETATM 3997 O O8  . EPE D 2 .   ? 13.697  -20.165 7.037   1.00 103.51 ? 302 EPE B O8  1 
HETATM 3998 C C9  . EPE D 2 .   ? 14.961  -13.208 4.416   1.00 91.46  ? 302 EPE B C9  1 
HETATM 3999 C C10 . EPE D 2 .   ? 14.901  -13.010 2.887   1.00 85.13  ? 302 EPE B C10 1 
HETATM 4000 S S   . EPE D 2 .   ? 15.988  -11.659 2.379   1.00 74.91  ? 302 EPE B S   1 
HETATM 4001 O O1S . EPE D 2 .   ? 15.556  -10.421 2.901   1.00 80.57  ? 302 EPE B O1S 1 
HETATM 4002 O O2S . EPE D 2 .   ? 17.348  -12.052 2.616   1.00 78.80  ? 302 EPE B O2S 1 
HETATM 4003 O O3S . EPE D 2 .   ? 15.847  -11.562 0.865   1.00 76.17  ? 302 EPE B O3S 1 
HETATM 4004 O O   . HOH E 3 .   ? -5.970  23.838  43.206  1.00 19.62  ? 302 HOH A O   1 
HETATM 4005 O O   . HOH E 3 .   ? 19.013  10.681  37.436  1.00 14.74  ? 303 HOH A O   1 
HETATM 4006 O O   . HOH E 3 .   ? 11.063  5.950   45.205  1.00 23.63  ? 304 HOH A O   1 
HETATM 4007 O O   . HOH E 3 .   ? 4.718   -4.332  40.850  1.00 14.31  ? 305 HOH A O   1 
HETATM 4008 O O   . HOH E 3 .   ? 12.071  5.900   41.962  1.00 17.35  ? 306 HOH A O   1 
HETATM 4009 O O   . HOH E 3 .   ? -1.902  -1.387  43.194  1.00 31.97  ? 307 HOH A O   1 
HETATM 4010 O O   . HOH E 3 .   ? 7.685   8.282   45.343  1.00 30.67  ? 308 HOH A O   1 
HETATM 4011 O O   . HOH E 3 .   ? -6.829  28.418  40.169  1.00 26.89  ? 309 HOH A O   1 
HETATM 4012 O O   . HOH E 3 .   ? 6.056   9.489   32.603  1.00 31.99  ? 310 HOH A O   1 
HETATM 4013 O O   . HOH E 3 .   ? -10.087 27.673  46.850  1.00 29.99  ? 311 HOH A O   1 
HETATM 4014 O O   . HOH E 3 .   ? 5.267   28.679  54.542  1.00 38.18  ? 312 HOH A O   1 
HETATM 4015 O O   . HOH E 3 .   ? 10.801  13.808  44.256  1.00 34.53  ? 313 HOH A O   1 
HETATM 4016 O O   . HOH E 3 .   ? -4.049  5.947   36.267  1.00 59.67  ? 314 HOH A O   1 
HETATM 4017 O O   . HOH E 3 .   ? 16.117  7.447   25.843  1.00 31.40  ? 315 HOH A O   1 
HETATM 4018 O O   . HOH E 3 .   ? 30.503  -0.527  49.652  1.00 40.02  ? 316 HOH A O   1 
HETATM 4019 O O   . HOH E 3 .   ? 14.031  23.216  35.342  1.00 20.42  ? 317 HOH A O   1 
HETATM 4020 O O   . HOH E 3 .   ? 22.395  15.773  49.358  1.00 30.32  ? 318 HOH A O   1 
HETATM 4021 O O   . HOH E 3 .   ? -5.877  28.373  46.742  1.00 37.58  ? 319 HOH A O   1 
HETATM 4022 O O   . HOH E 3 .   ? 11.766  5.853   27.969  1.00 28.12  ? 320 HOH A O   1 
HETATM 4023 O O   . HOH E 3 .   ? 20.199  -6.949  42.920  1.00 30.62  ? 321 HOH A O   1 
HETATM 4024 O O   . HOH E 3 .   ? 7.324   18.377  43.957  1.00 27.59  ? 322 HOH A O   1 
HETATM 4025 O O   . HOH E 3 .   ? 6.409   -12.762 44.941  1.00 23.46  ? 323 HOH A O   1 
HETATM 4026 O O   . HOH E 3 .   ? 4.847   -3.268  33.866  1.00 34.57  ? 324 HOH A O   1 
HETATM 4027 O O   . HOH E 3 .   ? 1.204   21.931  48.624  1.00 31.66  ? 325 HOH A O   1 
HETATM 4028 O O   . HOH E 3 .   ? -3.684  29.091  34.157  1.00 33.66  ? 326 HOH A O   1 
HETATM 4029 O O   . HOH E 3 .   ? 8.037   16.396  22.161  1.00 33.88  ? 327 HOH A O   1 
HETATM 4030 O O   . HOH E 3 .   ? -4.514  15.599  34.563  1.00 34.85  ? 328 HOH A O   1 
HETATM 4031 O O   . HOH E 3 .   ? -1.135  3.905   53.089  1.00 33.89  ? 329 HOH A O   1 
HETATM 4032 O O   . HOH E 3 .   ? 15.909  6.089   54.428  1.00 17.16  ? 330 HOH A O   1 
HETATM 4033 O O   . HOH E 3 .   ? 3.401   23.855  49.384  1.00 33.30  ? 331 HOH A O   1 
HETATM 4034 O O   . HOH E 3 .   ? 15.362  -7.386  37.912  1.00 37.01  ? 332 HOH A O   1 
HETATM 4035 O O   . HOH E 3 .   ? 15.747  -3.080  39.798  1.00 24.72  ? 333 HOH A O   1 
HETATM 4036 O O   . HOH E 3 .   ? 16.587  3.022   61.854  1.00 43.77  ? 334 HOH A O   1 
HETATM 4037 O O   . HOH E 3 .   ? 16.379  12.118  31.771  1.00 30.50  ? 335 HOH A O   1 
HETATM 4038 O O   . HOH E 3 .   ? 12.488  -3.322  39.126  1.00 28.91  ? 336 HOH A O   1 
HETATM 4039 O O   . HOH E 3 .   ? -12.077 30.278  51.576  1.00 40.14  ? 337 HOH A O   1 
HETATM 4040 O O   . HOH E 3 .   ? -3.762  16.079  56.625  1.00 44.38  ? 338 HOH A O   1 
HETATM 4041 O O   . HOH E 3 .   ? 24.346  -3.498  33.125  1.00 49.85  ? 339 HOH A O   1 
HETATM 4042 O O   . HOH E 3 .   ? -2.115  6.113   45.346  1.00 39.61  ? 340 HOH A O   1 
HETATM 4043 O O   . HOH E 3 .   ? -2.583  13.072  49.382  1.00 43.46  ? 341 HOH A O   1 
HETATM 4044 O O   . HOH E 3 .   ? 2.962   5.107   32.347  1.00 45.07  ? 342 HOH A O   1 
HETATM 4045 O O   . HOH E 3 .   ? -3.868  -3.641  41.611  1.00 43.07  ? 343 HOH A O   1 
HETATM 4046 O O   . HOH E 3 .   ? 14.925  14.744  37.484  1.00 32.04  ? 344 HOH A O   1 
HETATM 4047 O O   . HOH E 3 .   ? 11.896  10.344  49.605  1.00 36.49  ? 345 HOH A O   1 
HETATM 4048 O O   . HOH E 3 .   ? 28.841  -4.628  64.580  1.00 29.72  ? 346 HOH A O   1 
HETATM 4049 O O   . HOH E 3 .   ? -1.826  32.254  36.669  1.00 40.23  ? 347 HOH A O   1 
HETATM 4050 O O   . HOH E 3 .   ? -5.601  27.485  32.404  1.00 46.06  ? 348 HOH A O   1 
HETATM 4051 O O   . HOH E 3 .   ? 14.376  -5.212  30.598  1.00 30.56  ? 349 HOH A O   1 
HETATM 4052 O O   . HOH E 3 .   ? 3.338   9.319   26.171  1.00 31.53  ? 350 HOH A O   1 
HETATM 4053 O O   . HOH E 3 .   ? -6.987  12.104  47.277  1.00 34.00  ? 351 HOH A O   1 
HETATM 4054 O O   . HOH E 3 .   ? 29.162  -4.662  59.526  1.00 23.59  ? 352 HOH A O   1 
HETATM 4055 O O   . HOH E 3 .   ? -0.114  21.571  46.393  1.00 28.78  ? 353 HOH A O   1 
HETATM 4056 O O   . HOH E 3 .   ? 14.110  4.108   64.936  1.00 40.18  ? 354 HOH A O   1 
HETATM 4057 O O   . HOH E 3 .   ? 10.177  7.663   50.521  1.00 37.95  ? 355 HOH A O   1 
HETATM 4058 O O   . HOH E 3 .   ? 4.173   6.445   37.066  1.00 36.68  ? 356 HOH A O   1 
HETATM 4059 O O   . HOH E 3 .   ? -13.020 21.898  43.673  1.00 30.43  ? 357 HOH A O   1 
HETATM 4060 O O   . HOH E 3 .   ? -4.442  18.270  27.004  1.00 32.97  ? 358 HOH A O   1 
HETATM 4061 O O   . HOH E 3 .   ? -0.944  34.331  43.405  1.00 33.89  ? 359 HOH A O   1 
HETATM 4062 O O   . HOH E 3 .   ? 1.407   1.062   36.478  1.00 41.60  ? 360 HOH A O   1 
HETATM 4063 O O   . HOH E 3 .   ? 25.238  -8.753  61.139  1.00 37.41  ? 361 HOH A O   1 
HETATM 4064 O O   . HOH E 3 .   ? -5.962  25.342  29.159  1.00 42.53  ? 362 HOH A O   1 
HETATM 4065 O O   . HOH E 3 .   ? -9.782  9.331   42.561  1.00 37.85  ? 363 HOH A O   1 
HETATM 4066 O O   . HOH E 3 .   ? -13.544 23.689  39.048  1.00 44.79  ? 364 HOH A O   1 
HETATM 4067 O O   . HOH E 3 .   ? 18.121  10.282  32.618  1.00 64.84  ? 365 HOH A O   1 
HETATM 4068 O O   . HOH E 3 .   ? -6.862  16.199  55.077  1.00 32.37  ? 366 HOH A O   1 
HETATM 4069 O O   . HOH E 3 .   ? 5.489   -13.106 36.850  1.00 50.52  ? 367 HOH A O   1 
HETATM 4070 O O   . HOH E 3 .   ? 9.904   30.499  43.873  1.00 30.62  ? 368 HOH A O   1 
HETATM 4071 O O   . HOH E 3 .   ? -6.616  23.044  31.070  1.00 39.79  ? 369 HOH A O   1 
HETATM 4072 O O   . HOH E 3 .   ? 25.898  -6.207  53.180  1.00 39.76  ? 370 HOH A O   1 
HETATM 4073 O O   . HOH E 3 .   ? 15.744  6.159   28.535  1.00 51.56  ? 371 HOH A O   1 
HETATM 4074 O O   . HOH E 3 .   ? 13.900  -13.295 39.876  1.00 39.49  ? 372 HOH A O   1 
HETATM 4075 O O   . HOH E 3 .   ? -12.099 29.546  36.317  1.00 39.50  ? 373 HOH A O   1 
HETATM 4076 O O   . HOH E 3 .   ? 0.484   31.636  35.557  1.00 47.91  ? 374 HOH A O   1 
HETATM 4077 O O   . HOH E 3 .   ? 4.976   16.102  19.073  1.00 43.59  ? 375 HOH A O   1 
HETATM 4078 O O   . HOH E 3 .   ? 20.804  14.525  38.157  1.00 37.31  ? 376 HOH A O   1 
HETATM 4079 O O   . HOH E 3 .   ? 21.119  0.000   63.703  1.00 39.33  ? 377 HOH A O   1 
HETATM 4080 O O   . HOH E 3 .   ? 13.800  24.816  33.005  1.00 37.25  ? 378 HOH A O   1 
HETATM 4081 O O   . HOH E 3 .   ? -11.926 16.758  42.588  1.00 33.13  ? 379 HOH A O   1 
HETATM 4082 O O   . HOH E 3 .   ? 5.126   6.243   25.270  1.00 24.68  ? 380 HOH A O   1 
HETATM 4083 O O   . HOH E 3 .   ? 1.685   11.564  24.582  1.00 36.81  ? 381 HOH A O   1 
HETATM 4084 O O   . HOH E 3 .   ? 7.875   10.934  46.426  1.00 33.45  ? 382 HOH A O   1 
HETATM 4085 O O   . HOH E 3 .   ? 21.241  3.215   62.667  1.00 44.65  ? 383 HOH A O   1 
HETATM 4086 O O   . HOH E 3 .   ? 4.244   3.950   35.490  1.00 32.49  ? 384 HOH A O   1 
HETATM 4087 O O   . HOH E 3 .   ? 18.297  13.427  38.372  1.00 45.39  ? 385 HOH A O   1 
HETATM 4088 O O   . HOH E 3 .   ? -0.805  29.382  34.156  1.00 39.84  ? 386 HOH A O   1 
HETATM 4089 O O   . HOH E 3 .   ? 13.666  6.321   29.951  1.00 43.62  ? 387 HOH A O   1 
HETATM 4090 O O   . HOH E 3 .   ? -6.004  12.934  28.436  1.00 31.59  ? 388 HOH A O   1 
HETATM 4091 O O   . HOH E 3 .   ? 16.603  13.173  50.015  1.00 38.03  ? 389 HOH A O   1 
HETATM 4092 O O   . HOH E 3 .   ? 1.282   36.599  43.165  1.00 48.76  ? 390 HOH A O   1 
HETATM 4093 O O   . HOH E 3 .   ? 12.865  -14.219 59.804  1.00 42.56  ? 391 HOH A O   1 
HETATM 4094 O O   . HOH E 3 .   ? 10.832  8.703   44.677  1.00 45.61  ? 392 HOH A O   1 
HETATM 4095 O O   . HOH E 3 .   ? 11.704  -13.026 57.759  1.00 35.40  ? 393 HOH A O   1 
HETATM 4096 O O   . HOH E 3 .   ? -11.218 15.889  49.777  1.00 37.51  ? 394 HOH A O   1 
HETATM 4097 O O   . HOH E 3 .   ? 19.188  4.411   62.209  1.00 45.85  ? 395 HOH A O   1 
HETATM 4098 O O   . HOH E 3 .   ? 11.079  -4.443  64.002  1.00 44.57  ? 396 HOH A O   1 
HETATM 4099 O O   . HOH E 3 .   ? -9.460  12.241  47.670  1.00 48.69  ? 397 HOH A O   1 
HETATM 4100 O O   . HOH E 3 .   ? -0.497  28.632  31.612  1.00 32.17  ? 398 HOH A O   1 
HETATM 4101 O O   . HOH E 3 .   ? 2.240   7.240   33.566  1.00 29.89  ? 399 HOH A O   1 
HETATM 4102 O O   . HOH E 3 .   ? 6.089   -12.736 40.614  1.00 39.86  ? 400 HOH A O   1 
HETATM 4103 O O   . HOH E 3 .   ? -9.050  37.022  40.128  1.00 50.11  ? 401 HOH A O   1 
HETATM 4104 O O   . HOH E 3 .   ? 26.679  2.589   60.932  1.00 47.53  ? 402 HOH A O   1 
HETATM 4105 O O   . HOH E 3 .   ? 25.601  5.218   58.547  1.00 49.54  ? 403 HOH A O   1 
HETATM 4106 O O   . HOH E 3 .   ? 13.753  17.505  37.041  1.00 33.33  ? 404 HOH A O   1 
HETATM 4107 O O   . HOH E 3 .   ? 9.532   17.178  44.497  1.00 28.48  ? 405 HOH A O   1 
HETATM 4108 O O   . HOH E 3 .   ? 14.073  23.263  26.450  1.00 49.64  ? 406 HOH A O   1 
HETATM 4109 O O   . HOH E 3 .   ? 27.047  -5.432  62.883  1.00 35.14  ? 407 HOH A O   1 
HETATM 4110 O O   . HOH F 3 .   ? 3.104   -32.213 15.927  1.00 41.18  ? 303 HOH B O   1 
HETATM 4111 O O   . HOH F 3 .   ? 14.885  -18.306 -11.556 1.00 41.65  ? 304 HOH B O   1 
HETATM 4112 O O   . HOH F 3 .   ? 21.608  -11.427 19.053  1.00 28.19  ? 305 HOH B O   1 
HETATM 4113 O O   . HOH F 3 .   ? 11.987  -6.082  26.064  1.00 27.85  ? 306 HOH B O   1 
HETATM 4114 O O   . HOH F 3 .   ? 16.058  -6.692  12.687  1.00 24.88  ? 307 HOH B O   1 
HETATM 4115 O O   . HOH F 3 .   ? -4.236  -27.809 16.910  1.00 54.86  ? 308 HOH B O   1 
HETATM 4116 O O   . HOH F 3 .   ? -4.239  -28.227 2.350   1.00 38.65  ? 309 HOH B O   1 
HETATM 4117 O O   . HOH F 3 .   ? 11.821  -19.002 9.444   1.00 35.42  ? 310 HOH B O   1 
HETATM 4118 O O   . HOH F 3 .   ? 12.952  -8.971  8.692   1.00 37.07  ? 311 HOH B O   1 
HETATM 4119 O O   . HOH F 3 .   ? -1.350  -24.180 6.921   1.00 30.17  ? 312 HOH B O   1 
HETATM 4120 O O   . HOH F 3 .   ? 15.879  -6.651  9.445   1.00 32.10  ? 313 HOH B O   1 
HETATM 4121 O O   . HOH F 3 .   ? 5.295   -22.076 5.157   1.00 28.68  ? 314 HOH B O   1 
HETATM 4122 O O   . HOH F 3 .   ? 3.258   -16.762 32.622  1.00 36.07  ? 315 HOH B O   1 
HETATM 4123 O O   . HOH F 3 .   ? 15.904  -7.946  29.374  1.00 20.66  ? 316 HOH B O   1 
HETATM 4124 O O   . HOH F 3 .   ? 8.575   3.669   12.080  1.00 26.71  ? 317 HOH B O   1 
HETATM 4125 O O   . HOH F 3 .   ? 19.390  -17.249 23.675  1.00 39.41  ? 318 HOH B O   1 
HETATM 4126 O O   . HOH F 3 .   ? -3.925  -18.722 22.684  1.00 44.02  ? 319 HOH B O   1 
HETATM 4127 O O   . HOH F 3 .   ? 12.911  -29.082 -1.135  1.00 53.90  ? 320 HOH B O   1 
HETATM 4128 O O   . HOH F 3 .   ? 16.045  -23.673 19.453  1.00 32.31  ? 321 HOH B O   1 
HETATM 4129 O O   . HOH F 3 .   ? 17.603  0.117   24.826  1.00 35.67  ? 322 HOH B O   1 
HETATM 4130 O O   . HOH F 3 .   ? -0.759  -12.240 2.853   1.00 40.71  ? 323 HOH B O   1 
HETATM 4131 O O   . HOH F 3 .   ? 18.389  7.956   19.449  1.00 39.26  ? 324 HOH B O   1 
HETATM 4132 O O   . HOH F 3 .   ? -8.170  -22.426 4.381   1.00 27.71  ? 325 HOH B O   1 
HETATM 4133 O O   . HOH F 3 .   ? 14.351  -17.688 9.651   1.00 40.07  ? 326 HOH B O   1 
HETATM 4134 O O   . HOH F 3 .   ? 23.438  7.969   14.715  1.00 44.68  ? 327 HOH B O   1 
HETATM 4135 O O   . HOH F 3 .   ? -10.882 -42.578 -3.321  1.00 52.83  ? 328 HOH B O   1 
HETATM 4136 O O   . HOH F 3 .   ? 15.708  4.543   24.262  1.00 39.92  ? 329 HOH B O   1 
HETATM 4137 O O   . HOH F 3 .   ? -4.191  -23.673 17.909  1.00 47.80  ? 330 HOH B O   1 
HETATM 4138 O O   . HOH F 3 .   ? 3.041   1.339   7.989   1.00 40.63  ? 331 HOH B O   1 
HETATM 4139 O O   . HOH F 3 .   ? 9.076   -20.515 1.035   1.00 40.23  ? 332 HOH B O   1 
HETATM 4140 O O   . HOH F 3 .   ? -3.322  -29.084 9.632   1.00 30.87  ? 333 HOH B O   1 
HETATM 4141 O O   . HOH F 3 .   ? 15.311  -9.219  9.921   1.00 32.32  ? 334 HOH B O   1 
HETATM 4142 O O   . HOH F 3 .   ? 3.924   8.957   13.935  1.00 33.31  ? 335 HOH B O   1 
HETATM 4143 O O   . HOH F 3 .   ? 15.803  -9.957  7.460   1.00 70.01  ? 336 HOH B O   1 
HETATM 4144 O O   . HOH F 3 .   ? 5.696   -31.060 22.303  1.00 42.01  ? 337 HOH B O   1 
HETATM 4145 O O   . HOH F 3 .   ? 12.641  -11.631 7.291   1.00 35.69  ? 338 HOH B O   1 
HETATM 4146 O O   . HOH F 3 .   ? 8.627   -1.013  20.478  1.00 42.47  ? 339 HOH B O   1 
HETATM 4147 O O   . HOH F 3 .   ? 17.624  -11.092 5.207   1.00 54.06  ? 340 HOH B O   1 
HETATM 4148 O O   . HOH F 3 .   ? 15.789  2.821   15.766  1.00 39.98  ? 341 HOH B O   1 
HETATM 4149 O O   . HOH F 3 .   ? 3.316   -9.502  25.704  1.00 33.17  ? 342 HOH B O   1 
HETATM 4150 O O   . HOH F 3 .   ? 5.666   -4.673  -1.279  1.00 45.46  ? 343 HOH B O   1 
HETATM 4151 O O   . HOH F 3 .   ? 0.674   -33.218 13.945  1.00 44.67  ? 344 HOH B O   1 
HETATM 4152 O O   . HOH F 3 .   ? 7.619   -10.103 20.389  1.00 39.78  ? 345 HOH B O   1 
HETATM 4153 O O   . HOH F 3 .   ? 9.980   3.088   22.345  1.00 33.09  ? 346 HOH B O   1 
HETATM 4154 O O   . HOH F 3 .   ? 16.208  -8.262  4.346   1.00 44.26  ? 347 HOH B O   1 
HETATM 4155 O O   . HOH F 3 .   ? -2.022  -16.465 15.562  1.00 23.32  ? 348 HOH B O   1 
HETATM 4156 O O   . HOH F 3 .   ? 13.246  -29.066 7.320   1.00 54.14  ? 349 HOH B O   1 
HETATM 4157 O O   . HOH F 3 .   ? -2.733  -16.961 30.389  1.00 47.68  ? 350 HOH B O   1 
HETATM 4158 O O   . HOH F 3 .   ? 5.047   -6.201  26.549  1.00 50.35  ? 351 HOH B O   1 
HETATM 4159 O O   . HOH F 3 .   ? 26.103  3.035   23.133  1.00 39.32  ? 352 HOH B O   1 
HETATM 4160 O O   . HOH F 3 .   ? 8.804   -34.018 14.615  1.00 33.83  ? 353 HOH B O   1 
HETATM 4161 O O   . HOH F 3 .   ? -4.063  -16.758 -1.050  1.00 44.36  ? 354 HOH B O   1 
HETATM 4162 O O   . HOH F 3 .   ? 18.811  6.197   17.204  1.00 39.30  ? 355 HOH B O   1 
HETATM 4163 O O   . HOH F 3 .   ? 20.876  -14.606 16.308  1.00 48.40  ? 356 HOH B O   1 
HETATM 4164 O O   . HOH F 3 .   ? -11.041 -26.404 8.554   1.00 52.97  ? 357 HOH B O   1 
HETATM 4165 O O   . HOH F 3 .   ? 1.452   -12.319 26.546  1.00 28.86  ? 358 HOH B O   1 
HETATM 4166 O O   . HOH F 3 .   ? -4.334  -13.293 21.367  1.00 30.91  ? 359 HOH B O   1 
HETATM 4167 O O   . HOH F 3 .   ? 9.300   -5.242  26.404  1.00 36.29  ? 360 HOH B O   1 
HETATM 4168 O O   . HOH F 3 .   ? 5.083   -5.578  20.012  1.00 39.82  ? 361 HOH B O   1 
HETATM 4169 O O   . HOH F 3 .   ? 23.930  3.256   24.862  1.00 47.63  ? 362 HOH B O   1 
HETATM 4170 O O   . HOH F 3 .   ? 2.111   -14.940 33.961  1.00 37.57  ? 363 HOH B O   1 
HETATM 4171 O O   . HOH F 3 .   ? -0.590  -18.014 -2.142  1.00 35.08  ? 364 HOH B O   1 
HETATM 4172 O O   . HOH F 3 .   ? 10.842  15.637  3.965   1.00 45.85  ? 365 HOH B O   1 
HETATM 4173 O O   . HOH F 3 .   ? -4.255  -18.691 16.368  1.00 43.62  ? 366 HOH B O   1 
HETATM 4174 O O   . HOH F 3 .   ? -6.133  -33.865 3.102   1.00 54.95  ? 367 HOH B O   1 
HETATM 4175 O O   . HOH F 3 .   ? 4.437   -7.327  16.515  1.00 37.05  ? 368 HOH B O   1 
HETATM 4176 O O   . HOH F 3 .   ? 18.847  2.100   15.567  1.00 27.37  ? 369 HOH B O   1 
HETATM 4177 O O   . HOH F 3 .   ? 4.353   -1.566  14.997  1.00 37.99  ? 370 HOH B O   1 
HETATM 4178 O O   . HOH F 3 .   ? -8.534  -16.302 8.885   1.00 44.63  ? 371 HOH B O   1 
HETATM 4179 O O   . HOH F 3 .   ? -0.513  -17.245 32.993  1.00 37.75  ? 372 HOH B O   1 
HETATM 4180 O O   . HOH F 3 .   ? 14.680  -29.416 15.409  1.00 52.03  ? 373 HOH B O   1 
HETATM 4181 O O   . HOH F 3 .   ? 14.288  -6.552  24.637  1.00 30.74  ? 374 HOH B O   1 
HETATM 4182 O O   . HOH F 3 .   ? 24.798  7.798   0.409   1.00 40.40  ? 375 HOH B O   1 
HETATM 4183 O O   . HOH F 3 .   ? 10.868  12.293  8.429   1.00 31.22  ? 376 HOH B O   1 
HETATM 4184 O O   . HOH F 3 .   ? -5.842  -16.711 0.728   1.00 47.64  ? 377 HOH B O   1 
HETATM 4185 O O   . HOH F 3 .   ? 14.787  -30.511 10.752  1.00 43.43  ? 378 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   45  45  ARG ARG A . n 
A 1 2   TRP 2   46  46  TRP TRP A . n 
A 1 3   ARG 3   47  47  ARG ARG A . n 
A 1 4   GLN 4   48  48  GLN GLN A . n 
A 1 5   THR 5   49  49  THR THR A . n 
A 1 6   TRP 6   50  50  TRP TRP A . n 
A 1 7   SER 7   51  51  SER SER A . n 
A 1 8   GLY 8   52  52  GLY GLY A . n 
A 1 9   PRO 9   53  53  PRO PRO A . n 
A 1 10  GLY 10  54  54  GLY GLY A . n 
A 1 11  THR 11  55  55  THR THR A . n 
A 1 12  THR 12  56  56  THR THR A . n 
A 1 13  LYS 13  57  57  LYS LYS A . n 
A 1 14  ARG 14  58  58  ARG ARG A . n 
A 1 15  PHE 15  59  59  PHE PHE A . n 
A 1 16  PRO 16  60  60  PRO PRO A . n 
A 1 17  GLU 17  61  61  GLU GLU A . n 
A 1 18  THR 18  62  62  THR THR A . n 
A 1 19  VAL 19  63  63  VAL VAL A . n 
A 1 20  LEU 20  64  64  LEU LEU A . n 
A 1 21  ALA 21  65  65  ALA ALA A . n 
A 1 22  ARG 22  66  66  ARG ARG A . n 
A 1 23  CYS 23  67  67  CYS CYS A . n 
A 1 24  VAL 24  68  68  VAL VAL A . n 
A 1 25  LYS 25  69  69  LYS LYS A . n 
A 1 26  TYR 26  70  70  TYR TYR A . n 
A 1 27  THR 27  71  71  THR THR A . n 
A 1 28  GLU 28  72  72  GLU GLU A . n 
A 1 29  ILE 29  73  73  ILE ILE A . n 
A 1 30  HIS 30  74  74  HIS HIS A . n 
A 1 31  PRO 31  75  75  PRO PRO A . n 
A 1 32  GLU 32  76  76  GLU GLU A . n 
A 1 33  MET 33  77  77  MET MET A . n 
A 1 34  ARG 34  78  78  ARG ARG A . n 
A 1 35  HIS 35  79  79  HIS HIS A . n 
A 1 36  VAL 36  80  80  VAL VAL A . n 
A 1 37  ASP 37  81  81  ASP ASP A . n 
A 1 38  CYS 38  82  82  CYS CYS A . n 
A 1 39  GLN 39  83  83  GLN GLN A . n 
A 1 40  SER 40  84  84  SER SER A . n 
A 1 41  VAL 41  85  85  VAL VAL A . n 
A 1 42  TRP 42  86  86  TRP TRP A . n 
A 1 43  ASP 43  87  87  ASP ASP A . n 
A 1 44  ALA 44  88  88  ALA ALA A . n 
A 1 45  PHE 45  89  89  PHE PHE A . n 
A 1 46  LYS 46  90  90  LYS LYS A . n 
A 1 47  GLY 47  91  91  GLY GLY A . n 
A 1 48  ALA 48  92  92  ALA ALA A . n 
A 1 49  PHE 49  93  93  PHE PHE A . n 
A 1 50  ILE 50  94  94  ILE ILE A . n 
A 1 51  SER 51  95  95  SER SER A . n 
A 1 52  LYS 52  96  96  LYS LYS A . n 
A 1 53  HIS 53  97  97  HIS HIS A . n 
A 1 54  PRO 54  98  98  PRO PRO A . n 
A 1 55  CYS 55  99  99  CYS CYS A . n 
A 1 56  ASN 56  100 100 ASN ASN A . n 
A 1 57  ILE 57  101 101 ILE ILE A . n 
A 1 58  THR 58  102 102 THR THR A . n 
A 1 59  GLU 59  103 103 GLU GLU A . n 
A 1 60  GLU 60  104 104 GLU GLU A . n 
A 1 61  ASP 61  105 105 ASP ASP A . n 
A 1 62  TYR 62  106 106 TYR TYR A . n 
A 1 63  GLN 63  107 107 GLN GLN A . n 
A 1 64  PRO 64  108 108 PRO PRO A . n 
A 1 65  LEU 65  109 109 LEU LEU A . n 
A 1 66  MET 66  110 110 MET MET A . n 
A 1 67  LYS 67  111 111 LYS LYS A . n 
A 1 68  LEU 68  112 112 LEU LEU A . n 
A 1 69  GLY 69  113 113 GLY GLY A . n 
A 1 70  THR 70  114 114 THR THR A . n 
A 1 71  GLN 71  115 115 GLN GLN A . n 
A 1 72  THR 72  116 116 THR THR A . n 
A 1 73  VAL 73  117 117 VAL VAL A . n 
A 1 74  PRO 74  118 118 PRO PRO A . n 
A 1 75  CYS 75  119 119 CYS CYS A . n 
A 1 76  ASN 76  120 120 ASN ASN A . n 
A 1 77  LYS 77  121 121 LYS LYS A . n 
A 1 78  ILE 78  122 122 ILE ILE A . n 
A 1 79  LEU 79  123 123 LEU LEU A . n 
A 1 80  LEU 80  124 124 LEU LEU A . n 
A 1 81  TRP 81  125 125 TRP TRP A . n 
A 1 82  SER 82  126 126 SER SER A . n 
A 1 83  ARG 83  127 127 ARG ARG A . n 
A 1 84  ILE 84  128 128 ILE ILE A . n 
A 1 85  LYS 85  129 129 LYS LYS A . n 
A 1 86  ASP 86  130 130 ASP ASP A . n 
A 1 87  LEU 87  131 131 LEU LEU A . n 
A 1 88  ALA 88  132 132 ALA ALA A . n 
A 1 89  HIS 89  133 133 HIS HIS A . n 
A 1 90  GLN 90  134 134 GLN GLN A . n 
A 1 91  PHE 91  135 135 PHE PHE A . n 
A 1 92  THR 92  136 136 THR THR A . n 
A 1 93  GLN 93  137 137 GLN GLN A . n 
A 1 94  VAL 94  138 138 VAL VAL A . n 
A 1 95  GLN 95  139 139 GLN GLN A . n 
A 1 96  ARG 96  140 140 ARG ARG A . n 
A 1 97  ASP 97  141 141 ASP ASP A . n 
A 1 98  MET 98  142 142 MET MET A . n 
A 1 99  PHE 99  143 143 PHE PHE A . n 
A 1 100 THR 100 144 144 THR THR A . n 
A 1 101 LEU 101 145 145 LEU LEU A . n 
A 1 102 GLU 102 146 146 GLU GLU A . n 
A 1 103 ASP 103 147 147 ASP ASP A . n 
A 1 104 THR 104 148 148 THR THR A . n 
A 1 105 LEU 105 149 149 LEU LEU A . n 
A 1 106 LEU 106 150 150 LEU LEU A . n 
A 1 107 GLY 107 151 151 GLY GLY A . n 
A 1 108 TYR 108 152 152 TYR TYR A . n 
A 1 109 LEU 109 153 153 LEU LEU A . n 
A 1 110 ALA 110 154 154 ALA ALA A . n 
A 1 111 ASP 111 155 155 ASP ASP A . n 
A 1 112 ASP 112 156 156 ASP ASP A . n 
A 1 113 LEU 113 157 157 LEU LEU A . n 
A 1 114 THR 114 158 158 THR THR A . n 
A 1 115 TRP 115 159 159 TRP TRP A . n 
A 1 116 CYS 116 160 160 CYS CYS A . n 
A 1 117 GLY 117 161 161 GLY GLY A . n 
A 1 118 GLU 118 162 162 GLU GLU A . n 
A 1 119 PHE 119 163 163 PHE PHE A . n 
A 1 120 ASN 120 164 164 ASN ASN A . n 
A 1 121 THR 121 165 165 THR THR A . n 
A 1 122 SER 122 166 166 SER SER A . n 
A 1 123 LYS 123 167 167 LYS LYS A . n 
A 1 124 ILE 124 168 168 ILE ILE A . n 
A 1 125 ASN 125 169 169 ASN ASN A . n 
A 1 126 TYR 126 170 170 TYR TYR A . n 
A 1 127 GLN 127 171 171 GLN GLN A . n 
A 1 128 SER 128 172 172 SER SER A . n 
A 1 129 CYS 129 173 173 CYS CYS A . n 
A 1 130 PRO 130 174 174 PRO PRO A . n 
A 1 131 ASP 131 175 175 ASP ASP A . n 
A 1 132 TRP 132 176 176 TRP TRP A . n 
A 1 133 ARG 133 177 177 ARG ARG A . n 
A 1 134 LYS 134 178 178 LYS LYS A . n 
A 1 135 ASP 135 179 179 ASP ASP A . n 
A 1 136 CYS 136 180 180 CYS CYS A . n 
A 1 137 SER 137 181 181 SER SER A . n 
A 1 138 ASN 138 182 182 ASN ASN A . n 
A 1 139 ASN 139 183 183 ASN ASN A . n 
A 1 140 PRO 140 184 184 PRO PRO A . n 
A 1 141 VAL 141 185 185 VAL VAL A . n 
A 1 142 SER 142 186 186 SER SER A . n 
A 1 143 VAL 143 187 187 VAL VAL A . n 
A 1 144 PHE 144 188 188 PHE PHE A . n 
A 1 145 TRP 145 189 189 TRP TRP A . n 
A 1 146 LYS 146 190 190 LYS LYS A . n 
A 1 147 THR 147 191 191 THR THR A . n 
A 1 148 VAL 148 192 192 VAL VAL A . n 
A 1 149 SER 149 193 193 SER SER A . n 
A 1 150 ARG 150 194 194 ARG ARG A . n 
A 1 151 ARG 151 195 195 ARG ARG A . n 
A 1 152 PHE 152 196 196 PHE PHE A . n 
A 1 153 ALA 153 197 197 ALA ALA A . n 
A 1 154 GLU 154 198 198 GLU GLU A . n 
A 1 155 ALA 155 199 199 ALA ALA A . n 
A 1 156 ALA 156 200 200 ALA ALA A . n 
A 1 157 CYS 157 201 201 CYS CYS A . n 
A 1 158 ASP 158 202 202 ASP ASP A . n 
A 1 159 VAL 159 203 203 VAL VAL A . n 
A 1 160 VAL 160 204 204 VAL VAL A . n 
A 1 161 HIS 161 205 205 HIS HIS A . n 
A 1 162 VAL 162 206 206 VAL VAL A . n 
A 1 163 MET 163 207 207 MET MET A . n 
A 1 164 LEU 164 208 208 LEU LEU A . n 
A 1 165 ASN 165 209 209 ASN ASN A . n 
A 1 166 GLY 166 210 210 GLY GLY A . n 
A 1 167 SER 167 211 211 SER SER A . n 
A 1 168 ARG 168 212 212 ARG ARG A . n 
A 1 169 SER 169 213 213 SER SER A . n 
A 1 170 LYS 170 214 214 LYS LYS A . n 
A 1 171 ILE 171 215 215 ILE ILE A . n 
A 1 172 PHE 172 216 216 PHE PHE A . n 
A 1 173 ASP 173 217 217 ASP ASP A . n 
A 1 174 LYS 174 218 218 LYS LYS A . n 
A 1 175 ASN 175 219 219 ASN ASN A . n 
A 1 176 SER 176 220 220 SER SER A . n 
A 1 177 THR 177 221 221 THR THR A . n 
A 1 178 PHE 178 222 222 PHE PHE A . n 
A 1 179 GLY 179 223 223 GLY GLY A . n 
A 1 180 SER 180 224 224 SER SER A . n 
A 1 181 VAL 181 225 225 VAL VAL A . n 
A 1 182 GLU 182 226 226 GLU GLU A . n 
A 1 183 VAL 183 227 227 VAL VAL A . n 
A 1 184 HIS 184 228 228 HIS HIS A . n 
A 1 185 ASN 185 229 229 ASN ASN A . n 
A 1 186 LEU 186 230 230 LEU LEU A . n 
A 1 187 GLN 187 231 231 GLN GLN A . n 
A 1 188 PRO 188 232 232 PRO PRO A . n 
A 1 189 GLU 189 233 233 GLU GLU A . n 
A 1 190 LYS 190 234 234 LYS LYS A . n 
A 1 191 VAL 191 235 235 VAL VAL A . n 
A 1 192 GLN 192 236 236 GLN GLN A . n 
A 1 193 THR 193 237 237 THR THR A . n 
A 1 194 LEU 194 238 238 LEU LEU A . n 
A 1 195 GLU 195 239 239 GLU GLU A . n 
A 1 196 ALA 196 240 240 ALA ALA A . n 
A 1 197 TRP 197 241 241 TRP TRP A . n 
A 1 198 VAL 198 242 242 VAL VAL A . n 
A 1 199 ILE 199 243 243 ILE ILE A . n 
A 1 200 HIS 200 244 244 HIS HIS A . n 
A 1 201 GLY 201 245 245 GLY GLY A . n 
A 1 202 GLY 202 246 246 GLY GLY A . n 
A 1 203 ARG 203 247 247 ARG ARG A . n 
A 1 204 GLU 204 248 248 GLU GLU A . n 
A 1 205 ASP 205 249 249 ASP ASP A . n 
A 1 206 SER 206 250 250 SER SER A . n 
A 1 207 ARG 207 251 251 ARG ARG A . n 
A 1 208 ASP 208 252 252 ASP ASP A . n 
A 1 209 LEU 209 253 253 LEU LEU A . n 
A 1 210 CYS 210 254 254 CYS CYS A . n 
A 1 211 GLN 211 255 255 GLN GLN A . n 
A 1 212 ASP 212 256 256 ASP ASP A . n 
A 1 213 PRO 213 257 257 PRO PRO A . n 
A 1 214 THR 214 258 258 THR THR A . n 
A 1 215 ILE 215 259 259 ILE ILE A . n 
A 1 216 LYS 216 260 260 LYS LYS A . n 
A 1 217 GLU 217 261 261 GLU GLU A . n 
A 1 218 LEU 218 262 262 LEU LEU A . n 
A 1 219 GLU 219 263 263 GLU GLU A . n 
A 1 220 SER 220 264 264 SER SER A . n 
A 1 221 ILE 221 265 265 ILE ILE A . n 
A 1 222 ILE 222 266 266 ILE ILE A . n 
A 1 223 SER 223 267 267 SER SER A . n 
A 1 224 LYS 224 268 268 LYS LYS A . n 
A 1 225 ARG 225 269 269 ARG ARG A . n 
A 1 226 ASN 226 270 270 ASN ASN A . n 
A 1 227 ILE 227 271 271 ILE ILE A . n 
A 1 228 GLN 228 272 272 GLN GLN A . n 
A 1 229 PHE 229 273 273 PHE PHE A . n 
A 1 230 SER 230 274 274 SER SER A . n 
A 1 231 CYS 231 275 275 CYS CYS A . n 
A 1 232 LYS 232 276 276 LYS LYS A . n 
A 1 233 ASN 233 277 277 ASN ASN A . n 
A 1 234 ILE 234 278 278 ILE ILE A . n 
A 1 235 TYR 235 279 279 TYR TYR A . n 
A 1 236 ARG 236 280 280 ARG ARG A . n 
A 1 237 PRO 237 281 281 PRO PRO A . n 
A 1 238 ASP 238 282 282 ASP ASP A . n 
A 1 239 LYS 239 283 283 LYS LYS A . n 
A 1 240 PHE 240 284 284 PHE PHE A . n 
A 1 241 LEU 241 285 285 LEU LEU A . n 
A 1 242 GLN 242 286 286 GLN GLN A . n 
A 1 243 CYS 243 287 287 CYS CYS A . n 
A 1 244 VAL 244 288 288 VAL VAL A . n 
A 1 245 LYS 245 289 289 LYS LYS A . n 
A 1 246 ASN 246 290 290 ASN ASN A . n 
A 1 247 PRO 247 291 291 PRO PRO A . n 
A 1 248 GLU 248 292 ?   ?   ?   A . n 
A 1 249 ASP 249 293 ?   ?   ?   A . n 
A 1 250 SER 250 294 ?   ?   ?   A . n 
A 1 251 SER 251 295 ?   ?   ?   A . n 
A 1 252 CYS 252 296 ?   ?   ?   A . n 
A 1 253 THR 253 297 ?   ?   ?   A . n 
A 1 254 SER 254 298 ?   ?   ?   A . n 
A 1 255 GLU 255 299 ?   ?   ?   A . n 
A 1 256 ILE 256 300 ?   ?   ?   A . n 
B 1 1   ARG 1   45  45  ARG ARG B . n 
B 1 2   TRP 2   46  46  TRP TRP B . n 
B 1 3   ARG 3   47  47  ARG ARG B . n 
B 1 4   GLN 4   48  48  GLN GLN B . n 
B 1 5   THR 5   49  49  THR THR B . n 
B 1 6   TRP 6   50  50  TRP TRP B . n 
B 1 7   SER 7   51  51  SER SER B . n 
B 1 8   GLY 8   52  52  GLY GLY B . n 
B 1 9   PRO 9   53  53  PRO PRO B . n 
B 1 10  GLY 10  54  54  GLY GLY B . n 
B 1 11  THR 11  55  55  THR THR B . n 
B 1 12  THR 12  56  56  THR THR B . n 
B 1 13  LYS 13  57  57  LYS LYS B . n 
B 1 14  ARG 14  58  58  ARG ARG B . n 
B 1 15  PHE 15  59  59  PHE PHE B . n 
B 1 16  PRO 16  60  60  PRO PRO B . n 
B 1 17  GLU 17  61  61  GLU GLU B . n 
B 1 18  THR 18  62  62  THR THR B . n 
B 1 19  VAL 19  63  63  VAL VAL B . n 
B 1 20  LEU 20  64  64  LEU LEU B . n 
B 1 21  ALA 21  65  65  ALA ALA B . n 
B 1 22  ARG 22  66  66  ARG ARG B . n 
B 1 23  CYS 23  67  67  CYS CYS B . n 
B 1 24  VAL 24  68  68  VAL VAL B . n 
B 1 25  LYS 25  69  69  LYS LYS B . n 
B 1 26  TYR 26  70  70  TYR TYR B . n 
B 1 27  THR 27  71  71  THR THR B . n 
B 1 28  GLU 28  72  72  GLU GLU B . n 
B 1 29  ILE 29  73  73  ILE ILE B . n 
B 1 30  HIS 30  74  74  HIS HIS B . n 
B 1 31  PRO 31  75  75  PRO PRO B . n 
B 1 32  GLU 32  76  76  GLU GLU B . n 
B 1 33  MET 33  77  77  MET MET B . n 
B 1 34  ARG 34  78  78  ARG ARG B . n 
B 1 35  HIS 35  79  79  HIS HIS B . n 
B 1 36  VAL 36  80  80  VAL VAL B . n 
B 1 37  ASP 37  81  81  ASP ASP B . n 
B 1 38  CYS 38  82  82  CYS CYS B . n 
B 1 39  GLN 39  83  83  GLN GLN B . n 
B 1 40  SER 40  84  84  SER SER B . n 
B 1 41  VAL 41  85  85  VAL VAL B . n 
B 1 42  TRP 42  86  86  TRP TRP B . n 
B 1 43  ASP 43  87  87  ASP ASP B . n 
B 1 44  ALA 44  88  88  ALA ALA B . n 
B 1 45  PHE 45  89  89  PHE PHE B . n 
B 1 46  LYS 46  90  90  LYS LYS B . n 
B 1 47  GLY 47  91  91  GLY GLY B . n 
B 1 48  ALA 48  92  92  ALA ALA B . n 
B 1 49  PHE 49  93  93  PHE PHE B . n 
B 1 50  ILE 50  94  94  ILE ILE B . n 
B 1 51  SER 51  95  95  SER SER B . n 
B 1 52  LYS 52  96  96  LYS LYS B . n 
B 1 53  HIS 53  97  97  HIS HIS B . n 
B 1 54  PRO 54  98  98  PRO PRO B . n 
B 1 55  CYS 55  99  99  CYS CYS B . n 
B 1 56  ASN 56  100 100 ASN ASN B . n 
B 1 57  ILE 57  101 101 ILE ILE B . n 
B 1 58  THR 58  102 102 THR THR B . n 
B 1 59  GLU 59  103 103 GLU GLU B . n 
B 1 60  GLU 60  104 104 GLU GLU B . n 
B 1 61  ASP 61  105 105 ASP ASP B . n 
B 1 62  TYR 62  106 106 TYR TYR B . n 
B 1 63  GLN 63  107 107 GLN GLN B . n 
B 1 64  PRO 64  108 108 PRO PRO B . n 
B 1 65  LEU 65  109 109 LEU LEU B . n 
B 1 66  MET 66  110 110 MET MET B . n 
B 1 67  LYS 67  111 111 LYS LYS B . n 
B 1 68  LEU 68  112 112 LEU LEU B . n 
B 1 69  GLY 69  113 113 GLY GLY B . n 
B 1 70  THR 70  114 114 THR THR B . n 
B 1 71  GLN 71  115 115 GLN GLN B . n 
B 1 72  THR 72  116 116 THR THR B . n 
B 1 73  VAL 73  117 117 VAL VAL B . n 
B 1 74  PRO 74  118 118 PRO PRO B . n 
B 1 75  CYS 75  119 119 CYS CYS B . n 
B 1 76  ASN 76  120 120 ASN ASN B . n 
B 1 77  LYS 77  121 121 LYS LYS B . n 
B 1 78  ILE 78  122 122 ILE ILE B . n 
B 1 79  LEU 79  123 123 LEU LEU B . n 
B 1 80  LEU 80  124 124 LEU LEU B . n 
B 1 81  TRP 81  125 125 TRP TRP B . n 
B 1 82  SER 82  126 126 SER SER B . n 
B 1 83  ARG 83  127 127 ARG ARG B . n 
B 1 84  ILE 84  128 128 ILE ILE B . n 
B 1 85  LYS 85  129 129 LYS LYS B . n 
B 1 86  ASP 86  130 130 ASP ASP B . n 
B 1 87  LEU 87  131 131 LEU LEU B . n 
B 1 88  ALA 88  132 132 ALA ALA B . n 
B 1 89  HIS 89  133 133 HIS HIS B . n 
B 1 90  GLN 90  134 134 GLN GLN B . n 
B 1 91  PHE 91  135 135 PHE PHE B . n 
B 1 92  THR 92  136 136 THR THR B . n 
B 1 93  GLN 93  137 137 GLN GLN B . n 
B 1 94  VAL 94  138 138 VAL VAL B . n 
B 1 95  GLN 95  139 139 GLN GLN B . n 
B 1 96  ARG 96  140 140 ARG ARG B . n 
B 1 97  ASP 97  141 141 ASP ASP B . n 
B 1 98  MET 98  142 142 MET MET B . n 
B 1 99  PHE 99  143 143 PHE PHE B . n 
B 1 100 THR 100 144 144 THR THR B . n 
B 1 101 LEU 101 145 145 LEU LEU B . n 
B 1 102 GLU 102 146 146 GLU GLU B . n 
B 1 103 ASP 103 147 147 ASP ASP B . n 
B 1 104 THR 104 148 148 THR THR B . n 
B 1 105 LEU 105 149 149 LEU LEU B . n 
B 1 106 LEU 106 150 150 LEU LEU B . n 
B 1 107 GLY 107 151 151 GLY GLY B . n 
B 1 108 TYR 108 152 152 TYR TYR B . n 
B 1 109 LEU 109 153 153 LEU LEU B . n 
B 1 110 ALA 110 154 154 ALA ALA B . n 
B 1 111 ASP 111 155 155 ASP ASP B . n 
B 1 112 ASP 112 156 156 ASP ASP B . n 
B 1 113 LEU 113 157 157 LEU LEU B . n 
B 1 114 THR 114 158 158 THR THR B . n 
B 1 115 TRP 115 159 159 TRP TRP B . n 
B 1 116 CYS 116 160 160 CYS CYS B . n 
B 1 117 GLY 117 161 161 GLY GLY B . n 
B 1 118 GLU 118 162 162 GLU GLU B . n 
B 1 119 PHE 119 163 163 PHE PHE B . n 
B 1 120 ASN 120 164 164 ASN ASN B . n 
B 1 121 THR 121 165 165 THR THR B . n 
B 1 122 SER 122 166 166 SER SER B . n 
B 1 123 LYS 123 167 167 LYS LYS B . n 
B 1 124 ILE 124 168 168 ILE ILE B . n 
B 1 125 ASN 125 169 169 ASN ASN B . n 
B 1 126 TYR 126 170 170 TYR TYR B . n 
B 1 127 GLN 127 171 171 GLN GLN B . n 
B 1 128 SER 128 172 172 SER SER B . n 
B 1 129 CYS 129 173 173 CYS CYS B . n 
B 1 130 PRO 130 174 174 PRO PRO B . n 
B 1 131 ASP 131 175 175 ASP ASP B . n 
B 1 132 TRP 132 176 176 TRP TRP B . n 
B 1 133 ARG 133 177 177 ARG ARG B . n 
B 1 134 LYS 134 178 178 LYS LYS B . n 
B 1 135 ASP 135 179 179 ASP ASP B . n 
B 1 136 CYS 136 180 180 CYS CYS B . n 
B 1 137 SER 137 181 181 SER SER B . n 
B 1 138 ASN 138 182 182 ASN ASN B . n 
B 1 139 ASN 139 183 183 ASN ASN B . n 
B 1 140 PRO 140 184 184 PRO PRO B . n 
B 1 141 VAL 141 185 185 VAL VAL B . n 
B 1 142 SER 142 186 186 SER SER B . n 
B 1 143 VAL 143 187 187 VAL VAL B . n 
B 1 144 PHE 144 188 188 PHE PHE B . n 
B 1 145 TRP 145 189 189 TRP TRP B . n 
B 1 146 LYS 146 190 190 LYS LYS B . n 
B 1 147 THR 147 191 191 THR THR B . n 
B 1 148 VAL 148 192 192 VAL VAL B . n 
B 1 149 SER 149 193 193 SER SER B . n 
B 1 150 ARG 150 194 194 ARG ARG B . n 
B 1 151 ARG 151 195 195 ARG ARG B . n 
B 1 152 PHE 152 196 196 PHE PHE B . n 
B 1 153 ALA 153 197 197 ALA ALA B . n 
B 1 154 GLU 154 198 198 GLU GLU B . n 
B 1 155 ALA 155 199 199 ALA ALA B . n 
B 1 156 ALA 156 200 200 ALA ALA B . n 
B 1 157 CYS 157 201 201 CYS CYS B . n 
B 1 158 ASP 158 202 202 ASP ASP B . n 
B 1 159 VAL 159 203 203 VAL VAL B . n 
B 1 160 VAL 160 204 204 VAL VAL B . n 
B 1 161 HIS 161 205 205 HIS HIS B . n 
B 1 162 VAL 162 206 206 VAL VAL B . n 
B 1 163 MET 163 207 207 MET MET B . n 
B 1 164 LEU 164 208 208 LEU LEU B . n 
B 1 165 ASN 165 209 209 ASN ASN B . n 
B 1 166 GLY 166 210 210 GLY GLY B . n 
B 1 167 SER 167 211 211 SER SER B . n 
B 1 168 ARG 168 212 212 ARG ARG B . n 
B 1 169 SER 169 213 213 SER SER B . n 
B 1 170 LYS 170 214 214 LYS LYS B . n 
B 1 171 ILE 171 215 215 ILE ILE B . n 
B 1 172 PHE 172 216 216 PHE PHE B . n 
B 1 173 ASP 173 217 217 ASP ASP B . n 
B 1 174 LYS 174 218 218 LYS LYS B . n 
B 1 175 ASN 175 219 219 ASN ASN B . n 
B 1 176 SER 176 220 220 SER SER B . n 
B 1 177 THR 177 221 221 THR THR B . n 
B 1 178 PHE 178 222 222 PHE PHE B . n 
B 1 179 GLY 179 223 223 GLY GLY B . n 
B 1 180 SER 180 224 224 SER SER B . n 
B 1 181 VAL 181 225 225 VAL VAL B . n 
B 1 182 GLU 182 226 226 GLU GLU B . n 
B 1 183 VAL 183 227 227 VAL VAL B . n 
B 1 184 HIS 184 228 228 HIS HIS B . n 
B 1 185 ASN 185 229 229 ASN ASN B . n 
B 1 186 LEU 186 230 230 LEU LEU B . n 
B 1 187 GLN 187 231 231 GLN GLN B . n 
B 1 188 PRO 188 232 232 PRO PRO B . n 
B 1 189 GLU 189 233 233 GLU GLU B . n 
B 1 190 LYS 190 234 234 LYS LYS B . n 
B 1 191 VAL 191 235 235 VAL VAL B . n 
B 1 192 GLN 192 236 236 GLN GLN B . n 
B 1 193 THR 193 237 237 THR THR B . n 
B 1 194 LEU 194 238 238 LEU LEU B . n 
B 1 195 GLU 195 239 239 GLU GLU B . n 
B 1 196 ALA 196 240 240 ALA ALA B . n 
B 1 197 TRP 197 241 241 TRP TRP B . n 
B 1 198 VAL 198 242 242 VAL VAL B . n 
B 1 199 ILE 199 243 243 ILE ILE B . n 
B 1 200 HIS 200 244 244 HIS HIS B . n 
B 1 201 GLY 201 245 ?   ?   ?   B . n 
B 1 202 GLY 202 246 ?   ?   ?   B . n 
B 1 203 ARG 203 247 ?   ?   ?   B . n 
B 1 204 GLU 204 248 ?   ?   ?   B . n 
B 1 205 ASP 205 249 ?   ?   ?   B . n 
B 1 206 SER 206 250 ?   ?   ?   B . n 
B 1 207 ARG 207 251 251 ARG ARG B . n 
B 1 208 ASP 208 252 252 ASP ASP B . n 
B 1 209 LEU 209 253 253 LEU LEU B . n 
B 1 210 CYS 210 254 254 CYS CYS B . n 
B 1 211 GLN 211 255 255 GLN GLN B . n 
B 1 212 ASP 212 256 256 ASP ASP B . n 
B 1 213 PRO 213 257 257 PRO PRO B . n 
B 1 214 THR 214 258 258 THR THR B . n 
B 1 215 ILE 215 259 259 ILE ILE B . n 
B 1 216 LYS 216 260 260 LYS LYS B . n 
B 1 217 GLU 217 261 261 GLU GLU B . n 
B 1 218 LEU 218 262 262 LEU LEU B . n 
B 1 219 GLU 219 263 263 GLU GLU B . n 
B 1 220 SER 220 264 264 SER SER B . n 
B 1 221 ILE 221 265 265 ILE ILE B . n 
B 1 222 ILE 222 266 266 ILE ILE B . n 
B 1 223 SER 223 267 267 SER SER B . n 
B 1 224 LYS 224 268 268 LYS LYS B . n 
B 1 225 ARG 225 269 269 ARG ARG B . n 
B 1 226 ASN 226 270 270 ASN ASN B . n 
B 1 227 ILE 227 271 271 ILE ILE B . n 
B 1 228 GLN 228 272 272 GLN GLN B . n 
B 1 229 PHE 229 273 273 PHE PHE B . n 
B 1 230 SER 230 274 274 SER SER B . n 
B 1 231 CYS 231 275 275 CYS CYS B . n 
B 1 232 LYS 232 276 276 LYS LYS B . n 
B 1 233 ASN 233 277 277 ASN ASN B . n 
B 1 234 ILE 234 278 278 ILE ILE B . n 
B 1 235 TYR 235 279 279 TYR TYR B . n 
B 1 236 ARG 236 280 280 ARG ARG B . n 
B 1 237 PRO 237 281 281 PRO PRO B . n 
B 1 238 ASP 238 282 282 ASP ASP B . n 
B 1 239 LYS 239 283 283 LYS LYS B . n 
B 1 240 PHE 240 284 284 PHE PHE B . n 
B 1 241 LEU 241 285 285 LEU LEU B . n 
B 1 242 GLN 242 286 286 GLN GLN B . n 
B 1 243 CYS 243 287 287 CYS CYS B . n 
B 1 244 VAL 244 288 288 VAL VAL B . n 
B 1 245 LYS 245 289 289 LYS LYS B . n 
B 1 246 ASN 246 290 ?   ?   ?   B . n 
B 1 247 PRO 247 291 ?   ?   ?   B . n 
B 1 248 GLU 248 292 ?   ?   ?   B . n 
B 1 249 ASP 249 293 ?   ?   ?   B . n 
B 1 250 SER 250 294 ?   ?   ?   B . n 
B 1 251 SER 251 295 ?   ?   ?   B . n 
B 1 252 CYS 252 296 ?   ?   ?   B . n 
B 1 253 THR 253 297 ?   ?   ?   B . n 
B 1 254 SER 254 298 ?   ?   ?   B . n 
B 1 255 GLU 255 299 ?   ?   ?   B . n 
B 1 256 ILE 256 300 ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'NPPSFA, National Project on Protein Structural and Functional Analyses' 
_pdbx_SG_project.full_name_of_center   'RIKEN Structural Genomics/Proteomics Initiative' 
_pdbx_SG_project.initial_of_center     RSGI 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 EPE 1   301 301 EPE EPE A . 
D 2 EPE 1   302 302 EPE EPE B . 
E 3 HOH 1   302 1   HOH TIP A . 
E 3 HOH 2   303 2   HOH TIP A . 
E 3 HOH 3   304 3   HOH TIP A . 
E 3 HOH 4   305 4   HOH TIP A . 
E 3 HOH 5   306 5   HOH TIP A . 
E 3 HOH 6   307 6   HOH TIP A . 
E 3 HOH 7   308 8   HOH TIP A . 
E 3 HOH 8   309 10  HOH TIP A . 
E 3 HOH 9   310 11  HOH TIP A . 
E 3 HOH 10  311 12  HOH TIP A . 
E 3 HOH 11  312 13  HOH TIP A . 
E 3 HOH 12  313 16  HOH TIP A . 
E 3 HOH 13  314 19  HOH TIP A . 
E 3 HOH 14  315 20  HOH TIP A . 
E 3 HOH 15  316 23  HOH TIP A . 
E 3 HOH 16  317 24  HOH TIP A . 
E 3 HOH 17  318 26  HOH TIP A . 
E 3 HOH 18  319 27  HOH TIP A . 
E 3 HOH 19  320 28  HOH TIP A . 
E 3 HOH 20  321 29  HOH TIP A . 
E 3 HOH 21  322 30  HOH TIP A . 
E 3 HOH 22  323 33  HOH TIP A . 
E 3 HOH 23  324 35  HOH TIP A . 
E 3 HOH 24  325 36  HOH TIP A . 
E 3 HOH 25  326 43  HOH TIP A . 
E 3 HOH 26  327 44  HOH TIP A . 
E 3 HOH 27  328 45  HOH TIP A . 
E 3 HOH 28  329 46  HOH TIP A . 
E 3 HOH 29  330 47  HOH TIP A . 
E 3 HOH 30  331 48  HOH TIP A . 
E 3 HOH 31  332 49  HOH TIP A . 
E 3 HOH 32  333 50  HOH TIP A . 
E 3 HOH 33  334 52  HOH TIP A . 
E 3 HOH 34  335 54  HOH TIP A . 
E 3 HOH 35  336 56  HOH TIP A . 
E 3 HOH 36  337 57  HOH TIP A . 
E 3 HOH 37  338 58  HOH TIP A . 
E 3 HOH 38  339 61  HOH TIP A . 
E 3 HOH 39  340 62  HOH TIP A . 
E 3 HOH 40  341 63  HOH TIP A . 
E 3 HOH 41  342 65  HOH TIP A . 
E 3 HOH 42  343 66  HOH TIP A . 
E 3 HOH 43  344 70  HOH TIP A . 
E 3 HOH 44  345 74  HOH TIP A . 
E 3 HOH 45  346 76  HOH TIP A . 
E 3 HOH 46  347 78  HOH TIP A . 
E 3 HOH 47  348 79  HOH TIP A . 
E 3 HOH 48  349 80  HOH TIP A . 
E 3 HOH 49  350 81  HOH TIP A . 
E 3 HOH 50  351 86  HOH TIP A . 
E 3 HOH 51  352 87  HOH TIP A . 
E 3 HOH 52  353 88  HOH TIP A . 
E 3 HOH 53  354 89  HOH TIP A . 
E 3 HOH 54  355 92  HOH TIP A . 
E 3 HOH 55  356 94  HOH TIP A . 
E 3 HOH 56  357 95  HOH TIP A . 
E 3 HOH 57  358 96  HOH TIP A . 
E 3 HOH 58  359 97  HOH TIP A . 
E 3 HOH 59  360 98  HOH TIP A . 
E 3 HOH 60  361 100 HOH TIP A . 
E 3 HOH 61  362 101 HOH TIP A . 
E 3 HOH 62  363 107 HOH TIP A . 
E 3 HOH 63  364 109 HOH TIP A . 
E 3 HOH 64  365 111 HOH TIP A . 
E 3 HOH 65  366 112 HOH TIP A . 
E 3 HOH 66  367 113 HOH TIP A . 
E 3 HOH 67  368 114 HOH TIP A . 
E 3 HOH 68  369 115 HOH TIP A . 
E 3 HOH 69  370 116 HOH TIP A . 
E 3 HOH 70  371 117 HOH TIP A . 
E 3 HOH 71  372 121 HOH TIP A . 
E 3 HOH 72  373 122 HOH TIP A . 
E 3 HOH 73  374 123 HOH TIP A . 
E 3 HOH 74  375 124 HOH TIP A . 
E 3 HOH 75  376 126 HOH TIP A . 
E 3 HOH 76  377 128 HOH TIP A . 
E 3 HOH 77  378 132 HOH TIP A . 
E 3 HOH 78  379 133 HOH TIP A . 
E 3 HOH 79  380 134 HOH TIP A . 
E 3 HOH 80  381 135 HOH TIP A . 
E 3 HOH 81  382 136 HOH TIP A . 
E 3 HOH 82  383 138 HOH TIP A . 
E 3 HOH 83  384 139 HOH TIP A . 
E 3 HOH 84  385 142 HOH TIP A . 
E 3 HOH 85  386 143 HOH TIP A . 
E 3 HOH 86  387 144 HOH TIP A . 
E 3 HOH 87  388 145 HOH TIP A . 
E 3 HOH 88  389 146 HOH TIP A . 
E 3 HOH 89  390 147 HOH TIP A . 
E 3 HOH 90  391 148 HOH TIP A . 
E 3 HOH 91  392 149 HOH TIP A . 
E 3 HOH 92  393 153 HOH TIP A . 
E 3 HOH 93  394 155 HOH TIP A . 
E 3 HOH 94  395 158 HOH TIP A . 
E 3 HOH 95  396 159 HOH TIP A . 
E 3 HOH 96  397 160 HOH TIP A . 
E 3 HOH 97  398 161 HOH TIP A . 
E 3 HOH 98  399 163 HOH TIP A . 
E 3 HOH 99  400 165 HOH TIP A . 
E 3 HOH 100 401 167 HOH TIP A . 
E 3 HOH 101 402 168 HOH TIP A . 
E 3 HOH 102 403 169 HOH TIP A . 
E 3 HOH 103 404 171 HOH TIP A . 
E 3 HOH 104 405 175 HOH TIP A . 
E 3 HOH 105 406 180 HOH TIP A . 
E 3 HOH 106 407 181 HOH TIP A . 
F 3 HOH 1   303 7   HOH TIP B . 
F 3 HOH 2   304 9   HOH TIP B . 
F 3 HOH 3   305 14  HOH TIP B . 
F 3 HOH 4   306 15  HOH TIP B . 
F 3 HOH 5   307 17  HOH TIP B . 
F 3 HOH 6   308 18  HOH TIP B . 
F 3 HOH 7   309 21  HOH TIP B . 
F 3 HOH 8   310 22  HOH TIP B . 
F 3 HOH 9   311 25  HOH TIP B . 
F 3 HOH 10  312 31  HOH TIP B . 
F 3 HOH 11  313 32  HOH TIP B . 
F 3 HOH 12  314 34  HOH TIP B . 
F 3 HOH 13  315 37  HOH TIP B . 
F 3 HOH 14  316 38  HOH TIP B . 
F 3 HOH 15  317 39  HOH TIP B . 
F 3 HOH 16  318 40  HOH TIP B . 
F 3 HOH 17  319 41  HOH TIP B . 
F 3 HOH 18  320 42  HOH TIP B . 
F 3 HOH 19  321 51  HOH TIP B . 
F 3 HOH 20  322 53  HOH TIP B . 
F 3 HOH 21  323 55  HOH TIP B . 
F 3 HOH 22  324 59  HOH TIP B . 
F 3 HOH 23  325 60  HOH TIP B . 
F 3 HOH 24  326 64  HOH TIP B . 
F 3 HOH 25  327 67  HOH TIP B . 
F 3 HOH 26  328 68  HOH TIP B . 
F 3 HOH 27  329 69  HOH TIP B . 
F 3 HOH 28  330 71  HOH TIP B . 
F 3 HOH 29  331 72  HOH TIP B . 
F 3 HOH 30  332 73  HOH TIP B . 
F 3 HOH 31  333 75  HOH TIP B . 
F 3 HOH 32  334 77  HOH TIP B . 
F 3 HOH 33  335 82  HOH TIP B . 
F 3 HOH 34  336 83  HOH TIP B . 
F 3 HOH 35  337 84  HOH TIP B . 
F 3 HOH 36  338 85  HOH TIP B . 
F 3 HOH 37  339 90  HOH TIP B . 
F 3 HOH 38  340 91  HOH TIP B . 
F 3 HOH 39  341 93  HOH TIP B . 
F 3 HOH 40  342 99  HOH TIP B . 
F 3 HOH 41  343 102 HOH TIP B . 
F 3 HOH 42  344 103 HOH TIP B . 
F 3 HOH 43  345 104 HOH TIP B . 
F 3 HOH 44  346 105 HOH TIP B . 
F 3 HOH 45  347 106 HOH TIP B . 
F 3 HOH 46  348 108 HOH TIP B . 
F 3 HOH 47  349 110 HOH TIP B . 
F 3 HOH 48  350 118 HOH TIP B . 
F 3 HOH 49  351 119 HOH TIP B . 
F 3 HOH 50  352 120 HOH TIP B . 
F 3 HOH 51  353 125 HOH TIP B . 
F 3 HOH 52  354 127 HOH TIP B . 
F 3 HOH 53  355 129 HOH TIP B . 
F 3 HOH 54  356 130 HOH TIP B . 
F 3 HOH 55  357 131 HOH TIP B . 
F 3 HOH 56  358 137 HOH TIP B . 
F 3 HOH 57  359 140 HOH TIP B . 
F 3 HOH 58  360 141 HOH TIP B . 
F 3 HOH 59  361 150 HOH TIP B . 
F 3 HOH 60  362 151 HOH TIP B . 
F 3 HOH 61  363 152 HOH TIP B . 
F 3 HOH 62  364 154 HOH TIP B . 
F 3 HOH 63  365 156 HOH TIP B . 
F 3 HOH 64  366 157 HOH TIP B . 
F 3 HOH 65  367 162 HOH TIP B . 
F 3 HOH 66  368 164 HOH TIP B . 
F 3 HOH 67  369 166 HOH TIP B . 
F 3 HOH 68  370 170 HOH TIP B . 
F 3 HOH 69  371 172 HOH TIP B . 
F 3 HOH 70  372 173 HOH TIP B . 
F 3 HOH 71  373 174 HOH TIP B . 
F 3 HOH 72  374 176 HOH TIP B . 
F 3 HOH 73  375 177 HOH TIP B . 
F 3 HOH 74  376 178 HOH TIP B . 
F 3 HOH 75  377 179 HOH TIP B . 
F 3 HOH 76  378 182 HOH TIP B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-02-27 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS      refinement        1.1 ? 1 
HKL-2000 'data collection' .   ? 2 
HKL-2000 'data reduction'  .   ? 3 
HKL-2000 'data scaling'    .   ? 4 
MOLREP   phasing           .   ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 98  ? ? -64.82  15.01   
2  1 PRO A 118 ? ? -49.16  108.64  
3  1 ILE A 128 ? ? -154.48 42.93   
4  1 ASP A 179 ? ? -106.58 -71.07  
5  1 ASN A 182 ? ? -92.07  53.06   
6  1 ASP A 202 ? ? 59.64   -113.90 
7  1 VAL A 225 ? ? -135.47 -42.08  
8  1 ASN A 290 ? ? -142.42 56.20   
9  1 PRO B 98  ? ? -62.98  19.47   
10 1 PRO B 118 ? ? -44.59  108.08  
11 1 ILE B 128 ? ? -161.72 46.92   
12 1 ARG B 140 ? ? -59.76  1.06    
13 1 ASN B 164 ? ? 47.19   25.27   
14 1 ASP B 179 ? ? -109.62 -68.18  
15 1 ASN B 182 ? ? -84.65  46.87   
16 1 ASP B 202 ? ? 58.23   -110.72 
17 1 ASN B 219 ? ? -88.35  38.85   
18 1 VAL B 225 ? ? -137.36 -43.78  
19 1 PRO B 257 ? ? -37.00  -80.28  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 292 ? A GLU 248 
2  1 Y 1 A ASP 293 ? A ASP 249 
3  1 Y 1 A SER 294 ? A SER 250 
4  1 Y 1 A SER 295 ? A SER 251 
5  1 Y 1 A CYS 296 ? A CYS 252 
6  1 Y 1 A THR 297 ? A THR 253 
7  1 Y 1 A SER 298 ? A SER 254 
8  1 Y 1 A GLU 299 ? A GLU 255 
9  1 Y 1 A ILE 300 ? A ILE 256 
10 1 Y 1 B GLY 245 ? B GLY 201 
11 1 Y 1 B GLY 246 ? B GLY 202 
12 1 Y 1 B ARG 247 ? B ARG 203 
13 1 Y 1 B GLU 248 ? B GLU 204 
14 1 Y 1 B ASP 249 ? B ASP 205 
15 1 Y 1 B SER 250 ? B SER 206 
16 1 Y 1 B ASN 290 ? B ASN 246 
17 1 Y 1 B PRO 291 ? B PRO 247 
18 1 Y 1 B GLU 292 ? B GLU 248 
19 1 Y 1 B ASP 293 ? B ASP 249 
20 1 Y 1 B SER 294 ? B SER 250 
21 1 Y 1 B SER 295 ? B SER 251 
22 1 Y 1 B CYS 296 ? B CYS 252 
23 1 Y 1 B THR 297 ? B THR 253 
24 1 Y 1 B SER 298 ? B SER 254 
25 1 Y 1 B GLU 299 ? B GLU 255 
26 1 Y 1 B ILE 300 ? B ILE 256 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' EPE 
3 water                                                 HOH 
#