data_2EHO
# 
_entry.id   2EHO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2EHO         
RCSB  RCSB026677   
WWPDB D_1000026677 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2EHO 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-07 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Choi, J.M.' 1 
'Lim, H.S.'  2 
'Kim, J.J.'  3 
'Song, O.K.' 4 
'Cho, Y.'    5 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the human GINS complex' 
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_volume            21 
_citation.page_first                1316 
_citation.page_last                 1321 
_citation.year                      2007 
_citation.journal_id_ASTM           GEDEEP 
_citation.country                   US 
_citation.journal_id_ISSN           0890-9369 
_citation.journal_id_CSD            2056 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17545466 
_citation.pdbx_database_id_DOI      10.1101/gad.1548107 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Choi, J.M.' 1 
primary 'Lim, H.S.'  2 
primary 'Kim, J.J.'  3 
primary 'Song, O.K.' 4 
primary 'Cho, Y.'    5 
# 
_cell.entry_id           2EHO 
_cell.length_a           164.935 
_cell.length_b           176.995 
_cell.length_c           126.508 
_cell.angle_alpha        90.00 
_cell.angle_beta         105.91 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2EHO 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GINS complex subunit 4'                    24354.615 3   ? ? Sld5 ? 
2 polymer     man 'DNA replication complex GINS protein PSF1' 18278.793 3   ? ? Psf1 ? 
3 polymer     man 'DNA replication complex GINS protein PSF2' 22006.967 3   ? ? ?    ? 
4 polymer     man 'GINS complex subunit 3'                    24843.982 3   ? ? Psf3 ? 
5 non-polymer syn 'SULFATE ION'                               96.063    17  ? ? ?    ? 
6 water       nat water                                       18.015    135 ? ? ?    ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Sld5 homolog' 
2 Psf1           
3 Psf2           
4 'Psf3 homolog' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;DSDGGSEEVVLTPAELIERLEQAW(MSE)NEKFAPELLESKPEIVECV(MSE)EQLEH(MSE)EENLRRAKREDLKVSIH
Q(MSE)E(MSE)ERIRYVLSSYLRCRL(MSE)KIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREF(MSE)ANTESYLK
NVALKH(MSE)PPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAP
;
;DSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKREDLKVSIHQMEMERIRYVLS
SYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSY
VFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAP
;
A,E,I ? 
2 'polypeptide(L)' no yes 
;(MSE)(MSE)FCEKA(MSE)ELIRELHRAPEGQLPAFNEDGLRQVLEE(MSE)KALYEQNQSDVNEAKSGGRSDLIPTIK
FRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFH(MSE)AAEE(MSE)EWFNNYKRSLATY(MSE)RSLGGD
EGLDITQD(MSE)KPPKSLYIEVR
;
;MMFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAY
LYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVR
;
B,F,J ? 
3 'polypeptide(L)' no yes 
;(MSE)(MSE)DAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEW(MSE)D
VEKLEK(MSE)RDHERKEETFTP(MSE)PSPYY(MSE)ELTKLLLNHASDNIPKADEIRTLVKD(MSE)WDTRIAKLRVS
ADSFVRQQEAHAKLDNLTL(MSE)EINTSGTFLTQALNH(MSE)YKLRTNLQPLESTQSQDF
;
;MMDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEKLEKMRDHER
KEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTF
LTQALNHMYKLRTNLQPLESTQSQDF
;
C,G,K ? 
4 'polypeptide(L)' no yes 
;(MSE)SEAYFRVESGALGPEENFLSLDDIL(MSE)SHEKLPVRTETA(MSE)PRLGAFFLERSAGAETDNAVPQGSKLEL
PLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHK(MSE)GPHFYGFGSQLLHFDSPENADISQSLLQTFIG
RFRRI(MSE)DSSQNAYNEDTSALVARLDE(MSE)ERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED
;
;MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNK
RRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNED
TSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED
;
D,H,L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   SER n 
1 3   ASP n 
1 4   GLY n 
1 5   GLY n 
1 6   SER n 
1 7   GLU n 
1 8   GLU n 
1 9   VAL n 
1 10  VAL n 
1 11  LEU n 
1 12  THR n 
1 13  PRO n 
1 14  ALA n 
1 15  GLU n 
1 16  LEU n 
1 17  ILE n 
1 18  GLU n 
1 19  ARG n 
1 20  LEU n 
1 21  GLU n 
1 22  GLN n 
1 23  ALA n 
1 24  TRP n 
1 25  MSE n 
1 26  ASN n 
1 27  GLU n 
1 28  LYS n 
1 29  PHE n 
1 30  ALA n 
1 31  PRO n 
1 32  GLU n 
1 33  LEU n 
1 34  LEU n 
1 35  GLU n 
1 36  SER n 
1 37  LYS n 
1 38  PRO n 
1 39  GLU n 
1 40  ILE n 
1 41  VAL n 
1 42  GLU n 
1 43  CYS n 
1 44  VAL n 
1 45  MSE n 
1 46  GLU n 
1 47  GLN n 
1 48  LEU n 
1 49  GLU n 
1 50  HIS n 
1 51  MSE n 
1 52  GLU n 
1 53  GLU n 
1 54  ASN n 
1 55  LEU n 
1 56  ARG n 
1 57  ARG n 
1 58  ALA n 
1 59  LYS n 
1 60  ARG n 
1 61  GLU n 
1 62  ASP n 
1 63  LEU n 
1 64  LYS n 
1 65  VAL n 
1 66  SER n 
1 67  ILE n 
1 68  HIS n 
1 69  GLN n 
1 70  MSE n 
1 71  GLU n 
1 72  MSE n 
1 73  GLU n 
1 74  ARG n 
1 75  ILE n 
1 76  ARG n 
1 77  TYR n 
1 78  VAL n 
1 79  LEU n 
1 80  SER n 
1 81  SER n 
1 82  TYR n 
1 83  LEU n 
1 84  ARG n 
1 85  CYS n 
1 86  ARG n 
1 87  LEU n 
1 88  MSE n 
1 89  LYS n 
1 90  ILE n 
1 91  GLU n 
1 92  LYS n 
1 93  PHE n 
1 94  PHE n 
1 95  PRO n 
1 96  HIS n 
1 97  VAL n 
1 98  LEU n 
1 99  GLU n 
1 100 LYS n 
1 101 GLU n 
1 102 LYS n 
1 103 THR n 
1 104 ARG n 
1 105 PRO n 
1 106 GLU n 
1 107 GLY n 
1 108 GLU n 
1 109 PRO n 
1 110 SER n 
1 111 SER n 
1 112 LEU n 
1 113 SER n 
1 114 PRO n 
1 115 GLU n 
1 116 GLU n 
1 117 LEU n 
1 118 ALA n 
1 119 PHE n 
1 120 ALA n 
1 121 ARG n 
1 122 GLU n 
1 123 PHE n 
1 124 MSE n 
1 125 ALA n 
1 126 ASN n 
1 127 THR n 
1 128 GLU n 
1 129 SER n 
1 130 TYR n 
1 131 LEU n 
1 132 LYS n 
1 133 ASN n 
1 134 VAL n 
1 135 ALA n 
1 136 LEU n 
1 137 LYS n 
1 138 HIS n 
1 139 MSE n 
1 140 PRO n 
1 141 PRO n 
1 142 ASN n 
1 143 LEU n 
1 144 GLN n 
1 145 LYS n 
1 146 VAL n 
1 147 ASP n 
1 148 LEU n 
1 149 PHE n 
1 150 ARG n 
1 151 ALA n 
1 152 VAL n 
1 153 PRO n 
1 154 LYS n 
1 155 PRO n 
1 156 ASP n 
1 157 LEU n 
1 158 ASP n 
1 159 SER n 
1 160 TYR n 
1 161 VAL n 
1 162 PHE n 
1 163 LEU n 
1 164 ARG n 
1 165 VAL n 
1 166 ARG n 
1 167 GLU n 
1 168 ARG n 
1 169 GLN n 
1 170 GLU n 
1 171 ASN n 
1 172 ILE n 
1 173 LEU n 
1 174 VAL n 
1 175 GLU n 
1 176 PRO n 
1 177 ASP n 
1 178 THR n 
1 179 ASP n 
1 180 GLU n 
1 181 GLN n 
1 182 ARG n 
1 183 ASP n 
1 184 TYR n 
1 185 VAL n 
1 186 ILE n 
1 187 ASP n 
1 188 LEU n 
1 189 GLU n 
1 190 LYS n 
1 191 GLY n 
1 192 SER n 
1 193 GLN n 
1 194 HIS n 
1 195 LEU n 
1 196 ILE n 
1 197 ARG n 
1 198 TYR n 
1 199 LYS n 
1 200 THR n 
1 201 ILE n 
1 202 ALA n 
1 203 PRO n 
2 1   MSE n 
2 2   MSE n 
2 3   PHE n 
2 4   CYS n 
2 5   GLU n 
2 6   LYS n 
2 7   ALA n 
2 8   MSE n 
2 9   GLU n 
2 10  LEU n 
2 11  ILE n 
2 12  ARG n 
2 13  GLU n 
2 14  LEU n 
2 15  HIS n 
2 16  ARG n 
2 17  ALA n 
2 18  PRO n 
2 19  GLU n 
2 20  GLY n 
2 21  GLN n 
2 22  LEU n 
2 23  PRO n 
2 24  ALA n 
2 25  PHE n 
2 26  ASN n 
2 27  GLU n 
2 28  ASP n 
2 29  GLY n 
2 30  LEU n 
2 31  ARG n 
2 32  GLN n 
2 33  VAL n 
2 34  LEU n 
2 35  GLU n 
2 36  GLU n 
2 37  MSE n 
2 38  LYS n 
2 39  ALA n 
2 40  LEU n 
2 41  TYR n 
2 42  GLU n 
2 43  GLN n 
2 44  ASN n 
2 45  GLN n 
2 46  SER n 
2 47  ASP n 
2 48  VAL n 
2 49  ASN n 
2 50  GLU n 
2 51  ALA n 
2 52  LYS n 
2 53  SER n 
2 54  GLY n 
2 55  GLY n 
2 56  ARG n 
2 57  SER n 
2 58  ASP n 
2 59  LEU n 
2 60  ILE n 
2 61  PRO n 
2 62  THR n 
2 63  ILE n 
2 64  LYS n 
2 65  PHE n 
2 66  ARG n 
2 67  HIS n 
2 68  CYS n 
2 69  SER n 
2 70  LEU n 
2 71  LEU n 
2 72  ARG n 
2 73  ASN n 
2 74  ARG n 
2 75  ARG n 
2 76  CYS n 
2 77  THR n 
2 78  VAL n 
2 79  ALA n 
2 80  TYR n 
2 81  LEU n 
2 82  TYR n 
2 83  ASP n 
2 84  ARG n 
2 85  LEU n 
2 86  LEU n 
2 87  ARG n 
2 88  ILE n 
2 89  ARG n 
2 90  ALA n 
2 91  LEU n 
2 92  ARG n 
2 93  TRP n 
2 94  GLU n 
2 95  TYR n 
2 96  GLY n 
2 97  SER n 
2 98  ILE n 
2 99  LEU n 
2 100 PRO n 
2 101 ASN n 
2 102 ALA n 
2 103 LEU n 
2 104 ARG n 
2 105 PHE n 
2 106 HIS n 
2 107 MSE n 
2 108 ALA n 
2 109 ALA n 
2 110 GLU n 
2 111 GLU n 
2 112 MSE n 
2 113 GLU n 
2 114 TRP n 
2 115 PHE n 
2 116 ASN n 
2 117 ASN n 
2 118 TYR n 
2 119 LYS n 
2 120 ARG n 
2 121 SER n 
2 122 LEU n 
2 123 ALA n 
2 124 THR n 
2 125 TYR n 
2 126 MSE n 
2 127 ARG n 
2 128 SER n 
2 129 LEU n 
2 130 GLY n 
2 131 GLY n 
2 132 ASP n 
2 133 GLU n 
2 134 GLY n 
2 135 LEU n 
2 136 ASP n 
2 137 ILE n 
2 138 THR n 
2 139 GLN n 
2 140 ASP n 
2 141 MSE n 
2 142 LYS n 
2 143 PRO n 
2 144 PRO n 
2 145 LYS n 
2 146 SER n 
2 147 LEU n 
2 148 TYR n 
2 149 ILE n 
2 150 GLU n 
2 151 VAL n 
2 152 ARG n 
3 1   MSE n 
3 2   MSE n 
3 3   ASP n 
3 4   ALA n 
3 5   ALA n 
3 6   GLU n 
3 7   VAL n 
3 8   GLU n 
3 9   PHE n 
3 10  LEU n 
3 11  ALA n 
3 12  GLU n 
3 13  LYS n 
3 14  GLU n 
3 15  LEU n 
3 16  VAL n 
3 17  THR n 
3 18  ILE n 
3 19  ILE n 
3 20  PRO n 
3 21  ASN n 
3 22  PHE n 
3 23  SER n 
3 24  LEU n 
3 25  ASP n 
3 26  LYS n 
3 27  ILE n 
3 28  TYR n 
3 29  LEU n 
3 30  ILE n 
3 31  GLY n 
3 32  GLY n 
3 33  ASP n 
3 34  LEU n 
3 35  GLY n 
3 36  PRO n 
3 37  PHE n 
3 38  ASN n 
3 39  PRO n 
3 40  GLY n 
3 41  LEU n 
3 42  PRO n 
3 43  VAL n 
3 44  GLU n 
3 45  VAL n 
3 46  PRO n 
3 47  LEU n 
3 48  TRP n 
3 49  LEU n 
3 50  ALA n 
3 51  ILE n 
3 52  ASN n 
3 53  LEU n 
3 54  LYS n 
3 55  GLN n 
3 56  ARG n 
3 57  GLN n 
3 58  LYS n 
3 59  CYS n 
3 60  ARG n 
3 61  LEU n 
3 62  LEU n 
3 63  PRO n 
3 64  PRO n 
3 65  GLU n 
3 66  TRP n 
3 67  MSE n 
3 68  ASP n 
3 69  VAL n 
3 70  GLU n 
3 71  LYS n 
3 72  LEU n 
3 73  GLU n 
3 74  LYS n 
3 75  MSE n 
3 76  ARG n 
3 77  ASP n 
3 78  HIS n 
3 79  GLU n 
3 80  ARG n 
3 81  LYS n 
3 82  GLU n 
3 83  GLU n 
3 84  THR n 
3 85  PHE n 
3 86  THR n 
3 87  PRO n 
3 88  MSE n 
3 89  PRO n 
3 90  SER n 
3 91  PRO n 
3 92  TYR n 
3 93  TYR n 
3 94  MSE n 
3 95  GLU n 
3 96  LEU n 
3 97  THR n 
3 98  LYS n 
3 99  LEU n 
3 100 LEU n 
3 101 LEU n 
3 102 ASN n 
3 103 HIS n 
3 104 ALA n 
3 105 SER n 
3 106 ASP n 
3 107 ASN n 
3 108 ILE n 
3 109 PRO n 
3 110 LYS n 
3 111 ALA n 
3 112 ASP n 
3 113 GLU n 
3 114 ILE n 
3 115 ARG n 
3 116 THR n 
3 117 LEU n 
3 118 VAL n 
3 119 LYS n 
3 120 ASP n 
3 121 MSE n 
3 122 TRP n 
3 123 ASP n 
3 124 THR n 
3 125 ARG n 
3 126 ILE n 
3 127 ALA n 
3 128 LYS n 
3 129 LEU n 
3 130 ARG n 
3 131 VAL n 
3 132 SER n 
3 133 ALA n 
3 134 ASP n 
3 135 SER n 
3 136 PHE n 
3 137 VAL n 
3 138 ARG n 
3 139 GLN n 
3 140 GLN n 
3 141 GLU n 
3 142 ALA n 
3 143 HIS n 
3 144 ALA n 
3 145 LYS n 
3 146 LEU n 
3 147 ASP n 
3 148 ASN n 
3 149 LEU n 
3 150 THR n 
3 151 LEU n 
3 152 MSE n 
3 153 GLU n 
3 154 ILE n 
3 155 ASN n 
3 156 THR n 
3 157 SER n 
3 158 GLY n 
3 159 THR n 
3 160 PHE n 
3 161 LEU n 
3 162 THR n 
3 163 GLN n 
3 164 ALA n 
3 165 LEU n 
3 166 ASN n 
3 167 HIS n 
3 168 MSE n 
3 169 TYR n 
3 170 LYS n 
3 171 LEU n 
3 172 ARG n 
3 173 THR n 
3 174 ASN n 
3 175 LEU n 
3 176 GLN n 
3 177 PRO n 
3 178 LEU n 
3 179 GLU n 
3 180 SER n 
3 181 THR n 
3 182 GLN n 
3 183 SER n 
3 184 GLN n 
3 185 ASP n 
3 186 PHE n 
4 1   MSE n 
4 2   SER n 
4 3   GLU n 
4 4   ALA n 
4 5   TYR n 
4 6   PHE n 
4 7   ARG n 
4 8   VAL n 
4 9   GLU n 
4 10  SER n 
4 11  GLY n 
4 12  ALA n 
4 13  LEU n 
4 14  GLY n 
4 15  PRO n 
4 16  GLU n 
4 17  GLU n 
4 18  ASN n 
4 19  PHE n 
4 20  LEU n 
4 21  SER n 
4 22  LEU n 
4 23  ASP n 
4 24  ASP n 
4 25  ILE n 
4 26  LEU n 
4 27  MSE n 
4 28  SER n 
4 29  HIS n 
4 30  GLU n 
4 31  LYS n 
4 32  LEU n 
4 33  PRO n 
4 34  VAL n 
4 35  ARG n 
4 36  THR n 
4 37  GLU n 
4 38  THR n 
4 39  ALA n 
4 40  MSE n 
4 41  PRO n 
4 42  ARG n 
4 43  LEU n 
4 44  GLY n 
4 45  ALA n 
4 46  PHE n 
4 47  PHE n 
4 48  LEU n 
4 49  GLU n 
4 50  ARG n 
4 51  SER n 
4 52  ALA n 
4 53  GLY n 
4 54  ALA n 
4 55  GLU n 
4 56  THR n 
4 57  ASP n 
4 58  ASN n 
4 59  ALA n 
4 60  VAL n 
4 61  PRO n 
4 62  GLN n 
4 63  GLY n 
4 64  SER n 
4 65  LYS n 
4 66  LEU n 
4 67  GLU n 
4 68  LEU n 
4 69  PRO n 
4 70  LEU n 
4 71  TRP n 
4 72  LEU n 
4 73  ALA n 
4 74  LYS n 
4 75  GLY n 
4 76  LEU n 
4 77  PHE n 
4 78  ASP n 
4 79  ASN n 
4 80  LYS n 
4 81  ARG n 
4 82  ARG n 
4 83  ILE n 
4 84  LEU n 
4 85  SER n 
4 86  VAL n 
4 87  GLU n 
4 88  LEU n 
4 89  PRO n 
4 90  LYS n 
4 91  ILE n 
4 92  TYR n 
4 93  GLN n 
4 94  GLU n 
4 95  GLY n 
4 96  TRP n 
4 97  ARG n 
4 98  THR n 
4 99  VAL n 
4 100 PHE n 
4 101 SER n 
4 102 ALA n 
4 103 ASP n 
4 104 PRO n 
4 105 ASN n 
4 106 VAL n 
4 107 VAL n 
4 108 ASP n 
4 109 LEU n 
4 110 HIS n 
4 111 LYS n 
4 112 MSE n 
4 113 GLY n 
4 114 PRO n 
4 115 HIS n 
4 116 PHE n 
4 117 TYR n 
4 118 GLY n 
4 119 PHE n 
4 120 GLY n 
4 121 SER n 
4 122 GLN n 
4 123 LEU n 
4 124 LEU n 
4 125 HIS n 
4 126 PHE n 
4 127 ASP n 
4 128 SER n 
4 129 PRO n 
4 130 GLU n 
4 131 ASN n 
4 132 ALA n 
4 133 ASP n 
4 134 ILE n 
4 135 SER n 
4 136 GLN n 
4 137 SER n 
4 138 LEU n 
4 139 LEU n 
4 140 GLN n 
4 141 THR n 
4 142 PHE n 
4 143 ILE n 
4 144 GLY n 
4 145 ARG n 
4 146 PHE n 
4 147 ARG n 
4 148 ARG n 
4 149 ILE n 
4 150 MSE n 
4 151 ASP n 
4 152 SER n 
4 153 SER n 
4 154 GLN n 
4 155 ASN n 
4 156 ALA n 
4 157 TYR n 
4 158 ASN n 
4 159 GLU n 
4 160 ASP n 
4 161 THR n 
4 162 SER n 
4 163 ALA n 
4 164 LEU n 
4 165 VAL n 
4 166 ALA n 
4 167 ARG n 
4 168 LEU n 
4 169 ASP n 
4 170 GLU n 
4 171 MSE n 
4 172 GLU n 
4 173 ARG n 
4 174 GLY n 
4 175 LEU n 
4 176 PHE n 
4 177 GLN n 
4 178 THR n 
4 179 GLY n 
4 180 GLN n 
4 181 LYS n 
4 182 GLY n 
4 183 LEU n 
4 184 ASN n 
4 185 ASP n 
4 186 PHE n 
4 187 GLN n 
4 188 CYS n 
4 189 TRP n 
4 190 GLU n 
4 191 LYS n 
4 192 GLY n 
4 193 GLN n 
4 194 ALA n 
4 195 SER n 
4 196 GLN n 
4 197 ILE n 
4 198 THR n 
4 199 ALA n 
4 200 SER n 
4 201 ASN n 
4 202 LEU n 
4 203 VAL n 
4 204 GLN n 
4 205 ASN n 
4 206 TYR n 
4 207 LYS n 
4 208 LYS n 
4 209 ARG n 
4 210 LYS n 
4 211 PHE n 
4 212 THR n 
4 213 ASP n 
4 214 MET n 
4 215 GLU n 
4 216 ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ?    ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? 
? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pACYC-duet ? ? 
2 1 sample ? ? ? human Homo Psf1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? 
? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pCDF-duet  ? ? 
3 1 sample ? ? ? human Homo PSF2 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? 
? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET-duet   ? ? 
4 1 sample ? ? ? human Homo Psf3 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? 
? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pCOLA-duet ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q9BRT9_HUMAN Q9BRT9 1 
;DSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKREDLKVSIHQMEMERIRYVLS
SYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSY
VFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAP
;
11 ? 
2 UNP PSF1_HUMAN   Q14691 2 
;MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYL
YDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVR
;
1  ? 
3 UNP PSF2_HUMAN   Q9Y248 3 
;MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEKLEKMRDHERK
EETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFL
TQALNHMYKLRTNLQPLESTQSQDF
;
1  ? 
4 UNP Q9BRX5_HUMAN Q9BRX5 4 
;MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNK
RRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNED
TSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED
;
1  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2EHO A 1 ? 203 ? Q9BRT9 11 ? 213 ? 11 213 
2  1 2EHO E 1 ? 203 ? Q9BRT9 11 ? 213 ? 11 213 
3  1 2EHO I 1 ? 203 ? Q9BRT9 11 ? 213 ? 11 213 
4  2 2EHO B 2 ? 152 ? Q14691 1  ? 151 ? 1  151 
5  2 2EHO F 2 ? 152 ? Q14691 1  ? 151 ? 1  151 
6  2 2EHO J 2 ? 152 ? Q14691 1  ? 151 ? 1  151 
7  3 2EHO C 2 ? 186 ? Q9Y248 1  ? 185 ? 1  185 
8  3 2EHO G 2 ? 186 ? Q9Y248 1  ? 185 ? 1  185 
9  3 2EHO K 2 ? 186 ? Q9Y248 1  ? 185 ? 1  185 
10 4 2EHO D 1 ? 216 ? Q9BRX5 1  ? 216 ? 1  216 
11 4 2EHO H 1 ? 216 ? Q9BRX5 1  ? 216 ? 1  216 
12 4 2EHO L 1 ? 216 ? Q9BRX5 1  ? 216 ? 1  216 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  2EHO MSE A 25  ? UNP Q9BRT9 MET 35  'MODIFIED RESIDUE' 35  1  
1  2EHO MSE A 45  ? UNP Q9BRT9 MET 55  'MODIFIED RESIDUE' 55  2  
1  2EHO MSE A 51  ? UNP Q9BRT9 MET 61  'MODIFIED RESIDUE' 61  3  
1  2EHO MSE A 70  ? UNP Q9BRT9 MET 80  'MODIFIED RESIDUE' 80  4  
1  2EHO MSE A 72  ? UNP Q9BRT9 MET 82  'MODIFIED RESIDUE' 82  5  
1  2EHO MSE A 88  ? UNP Q9BRT9 MET 98  'MODIFIED RESIDUE' 98  6  
1  2EHO MSE A 124 ? UNP Q9BRT9 MET 134 'MODIFIED RESIDUE' 134 7  
1  2EHO MSE A 139 ? UNP Q9BRT9 MET 149 'MODIFIED RESIDUE' 149 8  
2  2EHO MSE E 25  ? UNP Q9BRT9 MET 35  'MODIFIED RESIDUE' 35  9  
2  2EHO MSE E 45  ? UNP Q9BRT9 MET 55  'MODIFIED RESIDUE' 55  10 
2  2EHO MSE E 51  ? UNP Q9BRT9 MET 61  'MODIFIED RESIDUE' 61  11 
2  2EHO MSE E 70  ? UNP Q9BRT9 MET 80  'MODIFIED RESIDUE' 80  12 
2  2EHO MSE E 72  ? UNP Q9BRT9 MET 82  'MODIFIED RESIDUE' 82  13 
2  2EHO MSE E 88  ? UNP Q9BRT9 MET 98  'MODIFIED RESIDUE' 98  14 
2  2EHO MSE E 124 ? UNP Q9BRT9 MET 134 'MODIFIED RESIDUE' 134 15 
2  2EHO MSE E 139 ? UNP Q9BRT9 MET 149 'MODIFIED RESIDUE' 149 16 
3  2EHO MSE I 25  ? UNP Q9BRT9 MET 35  'MODIFIED RESIDUE' 35  17 
3  2EHO MSE I 45  ? UNP Q9BRT9 MET 55  'MODIFIED RESIDUE' 55  18 
3  2EHO MSE I 51  ? UNP Q9BRT9 MET 61  'MODIFIED RESIDUE' 61  19 
3  2EHO MSE I 70  ? UNP Q9BRT9 MET 80  'MODIFIED RESIDUE' 80  20 
3  2EHO MSE I 72  ? UNP Q9BRT9 MET 82  'MODIFIED RESIDUE' 82  21 
3  2EHO MSE I 88  ? UNP Q9BRT9 MET 98  'MODIFIED RESIDUE' 98  22 
3  2EHO MSE I 124 ? UNP Q9BRT9 MET 134 'MODIFIED RESIDUE' 134 23 
3  2EHO MSE I 139 ? UNP Q9BRT9 MET 149 'MODIFIED RESIDUE' 149 24 
4  2EHO MSE B 1   ? UNP Q14691 ?   ?   'CLONING ARTIFACT' 0   25 
4  2EHO MSE B 2   ? UNP Q14691 MET 1   'MODIFIED RESIDUE' 1   26 
4  2EHO MSE B 8   ? UNP Q14691 MET 7   'MODIFIED RESIDUE' 7   27 
4  2EHO MSE B 37  ? UNP Q14691 MET 36  'MODIFIED RESIDUE' 36  28 
4  2EHO ILE B 98  ? UNP Q14691 VAL 97  'SEE REMARK 999'   97  29 
4  2EHO MSE B 107 ? UNP Q14691 MET 106 'MODIFIED RESIDUE' 106 30 
4  2EHO MSE B 112 ? UNP Q14691 MET 111 'MODIFIED RESIDUE' 111 31 
4  2EHO MSE B 126 ? UNP Q14691 MET 125 'MODIFIED RESIDUE' 125 32 
4  2EHO MSE B 141 ? UNP Q14691 MET 140 'MODIFIED RESIDUE' 140 33 
5  2EHO MSE F 1   ? UNP Q14691 ?   ?   'CLONING ARTIFACT' 0   34 
5  2EHO MSE F 2   ? UNP Q14691 MET 1   'MODIFIED RESIDUE' 1   35 
5  2EHO MSE F 8   ? UNP Q14691 MET 7   'MODIFIED RESIDUE' 7   36 
5  2EHO MSE F 37  ? UNP Q14691 MET 36  'MODIFIED RESIDUE' 36  37 
5  2EHO ILE F 98  ? UNP Q14691 VAL 97  'SEE REMARK 999'   97  38 
5  2EHO MSE F 107 ? UNP Q14691 MET 106 'MODIFIED RESIDUE' 106 39 
5  2EHO MSE F 112 ? UNP Q14691 MET 111 'MODIFIED RESIDUE' 111 40 
5  2EHO MSE F 126 ? UNP Q14691 MET 125 'MODIFIED RESIDUE' 125 41 
5  2EHO MSE F 141 ? UNP Q14691 MET 140 'MODIFIED RESIDUE' 140 42 
6  2EHO MSE J 1   ? UNP Q14691 ?   ?   'CLONING ARTIFACT' 0   43 
6  2EHO MSE J 2   ? UNP Q14691 MET 1   'MODIFIED RESIDUE' 1   44 
6  2EHO MSE J 8   ? UNP Q14691 MET 7   'MODIFIED RESIDUE' 7   45 
6  2EHO MSE J 37  ? UNP Q14691 MET 36  'MODIFIED RESIDUE' 36  46 
6  2EHO ILE J 98  ? UNP Q14691 VAL 97  'SEE REMARK 999'   97  47 
6  2EHO MSE J 107 ? UNP Q14691 MET 106 'MODIFIED RESIDUE' 106 48 
6  2EHO MSE J 112 ? UNP Q14691 MET 111 'MODIFIED RESIDUE' 111 49 
6  2EHO MSE J 126 ? UNP Q14691 MET 125 'MODIFIED RESIDUE' 125 50 
6  2EHO MSE J 141 ? UNP Q14691 MET 140 'MODIFIED RESIDUE' 140 51 
7  2EHO MSE C 1   ? UNP Q9Y248 ?   ?   'CLONING ARTIFACT' 0   52 
7  2EHO MSE C 2   ? UNP Q9Y248 MET 1   'MODIFIED RESIDUE' 1   53 
7  2EHO MSE C 67  ? UNP Q9Y248 MET 66  'MODIFIED RESIDUE' 66  54 
7  2EHO MSE C 75  ? UNP Q9Y248 MET 74  'MODIFIED RESIDUE' 74  55 
7  2EHO MSE C 88  ? UNP Q9Y248 MET 87  'MODIFIED RESIDUE' 87  56 
7  2EHO MSE C 94  ? UNP Q9Y248 MET 93  'MODIFIED RESIDUE' 93  57 
7  2EHO MSE C 121 ? UNP Q9Y248 MET 120 'MODIFIED RESIDUE' 120 58 
7  2EHO MSE C 152 ? UNP Q9Y248 MET 151 'MODIFIED RESIDUE' 151 59 
7  2EHO MSE C 168 ? UNP Q9Y248 MET 167 'MODIFIED RESIDUE' 167 60 
8  2EHO MSE G 1   ? UNP Q9Y248 ?   ?   'CLONING ARTIFACT' 0   61 
8  2EHO MSE G 2   ? UNP Q9Y248 MET 1   'MODIFIED RESIDUE' 1   62 
8  2EHO MSE G 67  ? UNP Q9Y248 MET 66  'MODIFIED RESIDUE' 66  63 
8  2EHO MSE G 75  ? UNP Q9Y248 MET 74  'MODIFIED RESIDUE' 74  64 
8  2EHO MSE G 88  ? UNP Q9Y248 MET 87  'MODIFIED RESIDUE' 87  65 
8  2EHO MSE G 94  ? UNP Q9Y248 MET 93  'MODIFIED RESIDUE' 93  66 
8  2EHO MSE G 121 ? UNP Q9Y248 MET 120 'MODIFIED RESIDUE' 120 67 
8  2EHO MSE G 152 ? UNP Q9Y248 MET 151 'MODIFIED RESIDUE' 151 68 
8  2EHO MSE G 168 ? UNP Q9Y248 MET 167 'MODIFIED RESIDUE' 167 69 
9  2EHO MSE K 1   ? UNP Q9Y248 ?   ?   'CLONING ARTIFACT' 0   70 
9  2EHO MSE K 2   ? UNP Q9Y248 MET 1   'MODIFIED RESIDUE' 1   71 
9  2EHO MSE K 67  ? UNP Q9Y248 MET 66  'MODIFIED RESIDUE' 66  72 
9  2EHO MSE K 75  ? UNP Q9Y248 MET 74  'MODIFIED RESIDUE' 74  73 
9  2EHO MSE K 88  ? UNP Q9Y248 MET 87  'MODIFIED RESIDUE' 87  74 
9  2EHO MSE K 94  ? UNP Q9Y248 MET 93  'MODIFIED RESIDUE' 93  75 
9  2EHO MSE K 121 ? UNP Q9Y248 MET 120 'MODIFIED RESIDUE' 120 76 
9  2EHO MSE K 152 ? UNP Q9Y248 MET 151 'MODIFIED RESIDUE' 151 77 
9  2EHO MSE K 168 ? UNP Q9Y248 MET 167 'MODIFIED RESIDUE' 167 78 
10 2EHO MSE D 1   ? UNP Q9BRX5 MET 1   'MODIFIED RESIDUE' 1   79 
10 2EHO MSE D 27  ? UNP Q9BRX5 MET 27  'MODIFIED RESIDUE' 27  80 
10 2EHO MSE D 40  ? UNP Q9BRX5 MET 40  'MODIFIED RESIDUE' 40  81 
10 2EHO MSE D 112 ? UNP Q9BRX5 MET 112 'MODIFIED RESIDUE' 112 82 
10 2EHO MSE D 150 ? UNP Q9BRX5 MET 150 'MODIFIED RESIDUE' 150 83 
10 2EHO MSE D 171 ? UNP Q9BRX5 MET 171 'MODIFIED RESIDUE' 171 84 
11 2EHO MSE H 1   ? UNP Q9BRX5 MET 1   'MODIFIED RESIDUE' 1   85 
11 2EHO MSE H 27  ? UNP Q9BRX5 MET 27  'MODIFIED RESIDUE' 27  86 
11 2EHO MSE H 40  ? UNP Q9BRX5 MET 40  'MODIFIED RESIDUE' 40  87 
11 2EHO MSE H 112 ? UNP Q9BRX5 MET 112 'MODIFIED RESIDUE' 112 88 
11 2EHO MSE H 150 ? UNP Q9BRX5 MET 150 'MODIFIED RESIDUE' 150 89 
11 2EHO MSE H 171 ? UNP Q9BRX5 MET 171 'MODIFIED RESIDUE' 171 90 
12 2EHO MSE L 1   ? UNP Q9BRX5 MET 1   'MODIFIED RESIDUE' 1   91 
12 2EHO MSE L 27  ? UNP Q9BRX5 MET 27  'MODIFIED RESIDUE' 27  92 
12 2EHO MSE L 40  ? UNP Q9BRX5 MET 40  'MODIFIED RESIDUE' 40  93 
12 2EHO MSE L 112 ? UNP Q9BRX5 MET 112 'MODIFIED RESIDUE' 112 94 
12 2EHO MSE L 150 ? UNP Q9BRX5 MET 150 'MODIFIED RESIDUE' 150 95 
12 2EHO MSE L 171 ? UNP Q9BRX5 MET 171 'MODIFIED RESIDUE' 171 96 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'    ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2EHO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.31 
_exptl_crystal.density_percent_sol   62.79 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.2 
_exptl_crystal_grow.pdbx_details    
;0.1M Tris HCl, 1.8M ammonium sulfate, 0.2M lithium sulfate, 1.5% 1,2,3,-heptanetriol , pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 93 ? 1 
2 93 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 210' 2006-09-20 ? 
2 CCD 'ADSC QUANTUM 210' 2006-09-30 ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9795 1.0 
2 1      1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'PAL/PLS BEAMLINE 4A' PAL/PLS 4A ? 0.9795 
2 SYNCHROTRON 'PAL/PLS BEAMLINE 4A' PAL/PLS 4A ? 1      
# 
_reflns.entry_id                     2EHO 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.81 
_reflns.number_obs                   77549 
_reflns.number_all                   83938 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0115 
_reflns.pdbx_netI_over_sigmaI        18 
_reflns.B_iso_Wilson_estimate        31.0 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   97.7 
_reflns_shell.Rmerge_I_obs           0.302 
_reflns_shell.pdbx_Rsym_value        0.302 
_reflns_shell.meanI_over_sigI_obs    3 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6734 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2EHO 
_refine.ls_number_reflns_obs                     69327 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_data_cutoff_high_absF               65022.14 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.90 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    91.9 
_refine.ls_R_factor_obs                          0.221 
_refine.ls_R_factor_all                          0.25 
_refine.ls_R_factor_R_work                       0.221 
_refine.ls_R_factor_R_free                       0.274 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3895 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               58.8 
_refine.aniso_B[1][1]                            -1.89 
_refine.aniso_B[2][2]                            8.66 
_refine.aniso_B[3][3]                            -6.77 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -2.03 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.337085 
_refine.solvent_model_param_bsol                 37.4844 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2EHO 
_refine_analyze.Luzzati_coordinate_error_obs    0.34 
_refine_analyze.Luzzati_sigma_a_obs             0.45 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.43 
_refine_analyze.Luzzati_sigma_a_free            0.51 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        16717 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         85 
_refine_hist.number_atoms_solvent             135 
_refine_hist.number_atoms_total               16937 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        29.90 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.5   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 21.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.16  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.43  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.51  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.20  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.41  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.98 
_refine_ls_shell.number_reflns_R_work             9313 
_refine_ls_shell.R_factor_R_work                  0.3 
_refine_ls_shell.percent_reflns_obs               69.1 
_refine_ls_shell.R_factor_R_free                  0.333 
_refine_ls_shell.R_factor_R_free_error            0.015 
_refine_ls_shell.percent_reflns_R_free            5.3 
_refine_ls_shell.number_reflns_R_free             520 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                9313 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 water_rep.param   water.top   'X-RAY DIFFRACTION' 
3 ion.param         ion.top     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2EHO 
_struct.title                     'Crystal structure of human GINS complex' 
_struct.pdbx_descriptor           
;GINS complex subunit 4, DNA replication complex GINS protein PSF1, DNA replication complex GINS protein PSF2, GINS complex subunit 3
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2EHO 
_struct_keywords.pdbx_keywords   REPLICATION 
_struct_keywords.text            'protein-protein complex, 4-helical bundle, hydrophobic interaction, REPLICATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 4 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 3 ? 
H  N N 4 ? 
I  N N 1 ? 
J  N N 2 ? 
K  N N 3 ? 
L  N N 4 ? 
M  N N 5 ? 
N  N N 5 ? 
O  N N 5 ? 
P  N N 5 ? 
Q  N N 5 ? 
R  N N 5 ? 
S  N N 5 ? 
T  N N 5 ? 
U  N N 5 ? 
V  N N 5 ? 
W  N N 5 ? 
X  N N 5 ? 
Y  N N 5 ? 
Z  N N 5 ? 
AA N N 5 ? 
BA N N 5 ? 
CA N N 5 ? 
DA N N 6 ? 
EA N N 6 ? 
FA N N 6 ? 
GA N N 6 ? 
HA N N 6 ? 
IA N N 6 ? 
JA N N 6 ? 
KA N N 6 ? 
LA N N 6 ? 
MA N N 6 ? 
NA N N 6 ? 
OA N N 6 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
1 'The biological assembly is a tetramer constituted by each of 4 chains in the asymmetric unit, A-D,E-H, and I-L.' 
2 ?                                                                                                                 
3 ?                                                                                                                 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 12  ? ALA A 30  ? THR A 22  ALA A 40  1 ? 19 
HELX_P HELX_P2  2  LYS A 37  ? ARG A 56  ? LYS A 47  ARG A 66  1 ? 20 
HELX_P HELX_P3  3  GLU A 61  ? PHE A 93  ? GLU A 71  PHE A 103 1 ? 33 
HELX_P HELX_P4  4  PHE A 94  ? GLU A 99  ? PHE A 104 GLU A 109 1 ? 6  
HELX_P HELX_P5  5  SER A 113 ? ALA A 135 ? SER A 123 ALA A 145 1 ? 23 
HELX_P HELX_P6  6  ASP A 147 ? VAL A 152 ? ASP A 157 VAL A 162 1 ? 6  
HELX_P HELX_P7  7  ARG A 197 ? ALA A 202 ? ARG A 207 ALA A 212 1 ? 6  
HELX_P HELX_P8  8  CYS B 4   ? ARG B 16  ? CYS B 3   ARG B 15  1 ? 13 
HELX_P HELX_P9  9  ASN B 26  ? SER B 53  ? ASN B 25  SER B 52  1 ? 28 
HELX_P HELX_P10 10 LEU B 59  ? GLY B 96  ? LEU B 58  GLY B 95  1 ? 38 
HELX_P HELX_P11 11 PRO B 100 ? PHE B 105 ? PRO B 99  PHE B 104 1 ? 6  
HELX_P HELX_P12 12 ALA B 108 ? ARG B 127 ? ALA B 107 ARG B 126 1 ? 20 
HELX_P HELX_P13 13 ASP C 3   ? GLU C 12  ? ASP C 2   GLU C 11  1 ? 10 
HELX_P HELX_P14 14 LEU C 47  ? ARG C 56  ? LEU C 46  ARG C 55  1 ? 10 
HELX_P HELX_P15 15 ASP C 68  ? GLU C 73  ? ASP C 67  GLU C 72  1 ? 6  
HELX_P HELX_P16 16 LYS C 74  ? ARG C 80  ? LYS C 73  ARG C 79  1 ? 7  
HELX_P HELX_P17 17 TYR C 92  ? ALA C 104 ? TYR C 91  ALA C 103 1 ? 13 
HELX_P HELX_P18 18 SER C 105 ? ILE C 108 ? SER C 104 ILE C 107 5 ? 4  
HELX_P HELX_P19 19 LYS C 110 ? GLN C 139 ? LYS C 109 GLN C 138 1 ? 30 
HELX_P HELX_P20 20 SER C 157 ? ARG C 172 ? SER C 156 ARG C 171 1 ? 16 
HELX_P HELX_P21 21 SER D 21  ? SER D 28  ? SER D 21  SER D 28  1 ? 8  
HELX_P HELX_P22 22 PRO D 69  ? PHE D 77  ? PRO D 69  PHE D 77  1 ? 9  
HELX_P HELX_P23 23 GLY D 95  ? ASP D 103 ? GLY D 95  ASP D 103 1 ? 9  
HELX_P HELX_P24 24 PRO D 104 ? VAL D 107 ? PRO D 104 VAL D 107 5 ? 4  
HELX_P HELX_P25 25 HIS D 115 ? LEU D 123 ? HIS D 115 LEU D 123 1 ? 9  
HELX_P HELX_P26 26 GLU D 130 ? LEU D 139 ? GLU D 130 LEU D 139 1 ? 10 
HELX_P HELX_P27 27 ARG D 145 ? GLN D 154 ? ARG D 145 GLN D 154 1 ? 10 
HELX_P HELX_P28 28 ASP D 160 ? VAL D 165 ? ASP D 160 VAL D 165 1 ? 6  
HELX_P HELX_P29 29 ALA D 166 ? LEU D 168 ? ALA D 166 LEU D 168 5 ? 3  
HELX_P HELX_P30 30 MSE D 171 ? LEU D 183 ? MSE D 171 LEU D 183 1 ? 13 
HELX_P HELX_P31 31 THR E 12  ? ALA E 30  ? THR E 22  ALA E 40  1 ? 19 
HELX_P HELX_P32 32 LYS E 37  ? ASN E 54  ? LYS E 47  ASN E 64  1 ? 18 
HELX_P HELX_P33 33 ASP E 62  ? THR E 103 ? ASP E 72  THR E 113 1 ? 42 
HELX_P HELX_P34 34 SER E 113 ? ALA E 135 ? SER E 123 ALA E 145 1 ? 23 
HELX_P HELX_P35 35 LEU E 136 ? MSE E 139 ? LEU E 146 MSE E 149 5 ? 4  
HELX_P HELX_P36 36 ASP E 147 ? VAL E 152 ? ASP E 157 VAL E 162 1 ? 6  
HELX_P HELX_P37 37 TYR E 198 ? ALA E 202 ? TYR E 208 ALA E 212 1 ? 5  
HELX_P HELX_P38 38 CYS F 4   ? ALA F 17  ? CYS F 3   ALA F 16  1 ? 14 
HELX_P HELX_P39 39 ASN F 26  ? GLU F 50  ? ASN F 25  GLU F 49  1 ? 25 
HELX_P HELX_P40 40 LEU F 59  ? TYR F 95  ? LEU F 58  TYR F 94  1 ? 37 
HELX_P HELX_P41 41 PRO F 100 ? HIS F 106 ? PRO F 99  HIS F 105 1 ? 7  
HELX_P HELX_P42 42 ALA F 108 ? SER F 128 ? ALA F 107 SER F 127 1 ? 21 
HELX_P HELX_P43 43 ASP G 3   ? GLU G 12  ? ASP G 2   GLU G 11  1 ? 10 
HELX_P HELX_P44 44 LEU G 47  ? GLN G 55  ? LEU G 46  GLN G 54  1 ? 9  
HELX_P HELX_P45 45 ASP G 68  ? GLU G 83  ? ASP G 67  GLU G 82  1 ? 16 
HELX_P HELX_P46 46 TYR G 92  ? HIS G 103 ? TYR G 91  HIS G 102 1 ? 12 
HELX_P HELX_P47 47 LYS G 110 ? GLN G 139 ? LYS G 109 GLN G 138 1 ? 30 
HELX_P HELX_P48 48 THR G 150 ? ASN G 155 ? THR G 149 ASN G 154 1 ? 6  
HELX_P HELX_P49 49 SER G 157 ? ARG G 172 ? SER G 156 ARG G 171 1 ? 16 
HELX_P HELX_P50 50 SER H 21  ? SER H 28  ? SER H 21  SER H 28  1 ? 8  
HELX_P HELX_P51 51 LEU H 43  ? PHE H 47  ? LEU H 43  PHE H 47  5 ? 5  
HELX_P HELX_P52 52 LEU H 70  ? PHE H 77  ? LEU H 70  PHE H 77  1 ? 8  
HELX_P HELX_P53 53 PRO H 89  ? TYR H 92  ? PRO H 89  TYR H 92  5 ? 4  
HELX_P HELX_P54 54 GLN H 93  ? ASP H 103 ? GLN H 93  ASP H 103 1 ? 11 
HELX_P HELX_P55 55 PRO H 104 ? VAL H 107 ? PRO H 104 VAL H 107 5 ? 4  
HELX_P HELX_P56 56 HIS H 115 ? LEU H 124 ? HIS H 115 LEU H 124 1 ? 10 
HELX_P HELX_P57 57 HIS H 125 ? ASP H 127 ? HIS H 125 ASP H 127 5 ? 3  
HELX_P HELX_P58 58 GLU H 130 ? GLN H 154 ? GLU H 130 GLN H 154 1 ? 25 
HELX_P HELX_P59 59 ASN H 158 ? ALA H 166 ? ASN H 158 ALA H 166 1 ? 9  
HELX_P HELX_P60 60 ASP H 169 ? GLU H 190 ? ASP H 169 GLU H 190 1 ? 22 
HELX_P HELX_P61 61 THR I 12  ? ALA I 30  ? THR I 22  ALA I 40  1 ? 19 
HELX_P HELX_P62 62 LYS I 37  ? LEU I 55  ? LYS I 47  LEU I 65  1 ? 19 
HELX_P HELX_P63 63 GLU I 61  ? THR I 103 ? GLU I 71  THR I 113 1 ? 43 
HELX_P HELX_P64 64 SER I 113 ? ALA I 135 ? SER I 123 ALA I 145 1 ? 23 
HELX_P HELX_P65 65 LEU I 136 ? MSE I 139 ? LEU I 146 MSE I 149 5 ? 4  
HELX_P HELX_P66 66 ASP I 147 ? VAL I 152 ? ASP I 157 VAL I 162 1 ? 6  
HELX_P HELX_P67 67 CYS J 4   ? ALA J 17  ? CYS J 3   ALA J 16  1 ? 14 
HELX_P HELX_P68 68 ASN J 26  ? SER J 53  ? ASN J 25  SER J 52  1 ? 28 
HELX_P HELX_P69 69 GLY J 54  ? GLY J 55  ? GLY J 53  GLY J 54  5 ? 2  
HELX_P HELX_P70 70 ARG J 56  ? ASP J 58  ? ARG J 55  ASP J 57  5 ? 3  
HELX_P HELX_P71 71 LEU J 59  ? GLY J 96  ? LEU J 58  GLY J 95  1 ? 38 
HELX_P HELX_P72 72 PRO J 100 ? PHE J 105 ? PRO J 99  PHE J 104 1 ? 6  
HELX_P HELX_P73 73 ALA J 108 ? LEU J 129 ? ALA J 107 LEU J 128 1 ? 22 
HELX_P HELX_P74 74 ASP K 3   ? GLU K 12  ? ASP K 2   GLU K 11  1 ? 10 
HELX_P HELX_P75 75 LEU K 47  ? ARG K 56  ? LEU K 46  ARG K 55  1 ? 10 
HELX_P HELX_P76 76 ASP K 68  ? GLU K 82  ? ASP K 67  GLU K 81  1 ? 15 
HELX_P HELX_P77 77 TYR K 92  ? SER K 105 ? TYR K 91  SER K 104 1 ? 14 
HELX_P HELX_P78 78 LYS K 110 ? GLN K 139 ? LYS K 109 GLN K 138 1 ? 30 
HELX_P HELX_P79 79 THR K 150 ? ARG K 172 ? THR K 149 ARG K 171 1 ? 23 
HELX_P HELX_P80 80 SER L 21  ? HIS L 29  ? SER L 21  HIS L 29  1 ? 9  
HELX_P HELX_P81 81 LEU L 43  ? PHE L 47  ? LEU L 43  PHE L 47  5 ? 5  
HELX_P HELX_P82 82 LEU L 70  ? PHE L 77  ? LEU L 70  PHE L 77  1 ? 8  
HELX_P HELX_P83 83 PRO L 89  ? TYR L 92  ? PRO L 89  TYR L 92  5 ? 4  
HELX_P HELX_P84 84 GLN L 93  ? ASP L 103 ? GLN L 93  ASP L 103 1 ? 11 
HELX_P HELX_P85 85 PRO L 104 ? VAL L 107 ? PRO L 104 VAL L 107 5 ? 4  
HELX_P HELX_P86 86 HIS L 115 ? LEU L 124 ? HIS L 115 LEU L 124 1 ? 10 
HELX_P HELX_P87 87 HIS L 125 ? ASP L 127 ? HIS L 125 ASP L 127 5 ? 3  
HELX_P HELX_P88 88 GLU L 130 ? ASN L 155 ? GLU L 130 ASN L 155 1 ? 26 
HELX_P HELX_P89 89 ASP L 160 ? ARG L 167 ? ASP L 160 ARG L 167 1 ? 8  
HELX_P HELX_P90 90 ASP L 169 ? LYS L 191 ? ASP L 169 LYS L 191 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1   covale ? ? A TRP 24  C ? ? ? 1_555 A MSE 25  N ? ? A TRP 34  A MSE 35  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale2   covale ? ? A MSE 25  C ? ? ? 1_555 A ASN 26  N ? ? A MSE 35  A ASN 36  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale3   covale ? ? A VAL 44  C ? ? ? 1_555 A MSE 45  N ? ? A VAL 54  A MSE 55  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale4   covale ? ? A MSE 45  C ? ? ? 1_555 A GLU 46  N ? ? A MSE 55  A GLU 56  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale5   covale ? ? A HIS 50  C ? ? ? 1_555 A MSE 51  N ? ? A HIS 60  A MSE 61  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale6   covale ? ? A MSE 51  C ? ? ? 1_555 A GLU 52  N ? ? A MSE 61  A GLU 62  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale7   covale ? ? A GLN 69  C ? ? ? 1_555 A MSE 70  N ? ? A GLN 79  A MSE 80  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale8   covale ? ? A MSE 70  C ? ? ? 1_555 A GLU 71  N ? ? A MSE 80  A GLU 81  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale9   covale ? ? A GLU 71  C ? ? ? 1_555 A MSE 72  N ? ? A GLU 81  A MSE 82  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale10  covale ? ? A MSE 72  C ? ? ? 1_555 A GLU 73  N ? ? A MSE 82  A GLU 83  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale11  covale ? ? A LEU 87  C ? ? ? 1_555 A MSE 88  N ? ? A LEU 97  A MSE 98  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale12  covale ? ? A MSE 88  C ? ? ? 1_555 A LYS 89  N ? ? A MSE 98  A LYS 99  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale13  covale ? ? A PHE 123 C ? ? ? 1_555 A MSE 124 N ? ? A PHE 133 A MSE 134 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale14  covale ? ? A MSE 124 C ? ? ? 1_555 A ALA 125 N ? ? A MSE 134 A ALA 135 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale15  covale ? ? A HIS 138 C ? ? ? 1_555 A MSE 139 N ? ? A HIS 148 A MSE 149 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale16  covale ? ? A MSE 139 C ? ? ? 1_555 A PRO 140 N ? ? A MSE 149 A PRO 150 1_555 ? ? ? ? ? ? ? 1.345 ? 
covale17  covale ? ? B MSE 2   C ? ? ? 1_555 B PHE 3   N ? ? B MSE 1   B PHE 2   1_555 ? ? ? ? ? ? ? 1.328 ? 
covale18  covale ? ? B ALA 7   C ? ? ? 1_555 B MSE 8   N ? ? B ALA 6   B MSE 7   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale19  covale ? ? B MSE 8   C ? ? ? 1_555 B GLU 9   N ? ? B MSE 7   B GLU 8   1_555 ? ? ? ? ? ? ? 1.319 ? 
covale20  covale ? ? B GLU 36  C ? ? ? 1_555 B MSE 37  N ? ? B GLU 35  B MSE 36  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale21  covale ? ? B MSE 37  C ? ? ? 1_555 B LYS 38  N ? ? B MSE 36  B LYS 37  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale22  covale ? ? B HIS 106 C ? ? ? 1_555 B MSE 107 N ? ? B HIS 105 B MSE 106 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale23  covale ? ? B MSE 107 C ? ? ? 1_555 B ALA 108 N ? ? B MSE 106 B ALA 107 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale24  covale ? ? B GLU 111 C ? ? ? 1_555 B MSE 112 N ? ? B GLU 110 B MSE 111 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale25  covale ? ? B MSE 112 C ? ? ? 1_555 B GLU 113 N ? ? B MSE 111 B GLU 112 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale26  covale ? ? B TYR 125 C ? ? ? 1_555 B MSE 126 N ? ? B TYR 124 B MSE 125 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale27  covale ? ? B MSE 126 C ? ? ? 1_555 B ARG 127 N ? ? B MSE 125 B ARG 126 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale28  covale ? ? B ASP 140 C ? ? ? 1_555 B MSE 141 N ? ? B ASP 139 B MSE 140 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale29  covale ? ? B MSE 141 C ? ? ? 1_555 B LYS 142 N ? ? B MSE 140 B LYS 141 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale30  covale ? ? C MSE 1   C ? ? ? 1_555 C MSE 2   N ? ? C MSE 0   C MSE 1   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale31  covale ? ? C MSE 2   C ? ? ? 1_555 C ASP 3   N ? ? C MSE 1   C ASP 2   1_555 ? ? ? ? ? ? ? 1.327 ? 
covale32  covale ? ? C TRP 66  C ? ? ? 1_555 C MSE 67  N ? ? C TRP 65  C MSE 66  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale33  covale ? ? C MSE 67  C ? ? ? 1_555 C ASP 68  N ? ? C MSE 66  C ASP 67  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale34  covale ? ? C LYS 74  C ? ? ? 1_555 C MSE 75  N ? ? C LYS 73  C MSE 74  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale35  covale ? ? C MSE 75  C ? ? ? 1_555 C ARG 76  N ? ? C MSE 74  C ARG 75  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale36  covale ? ? C PRO 87  C ? ? ? 1_555 C MSE 88  N ? ? C PRO 86  C MSE 87  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale37  covale ? ? C MSE 88  C ? ? ? 1_555 C PRO 89  N ? ? C MSE 87  C PRO 88  1_555 ? ? ? ? ? ? ? 1.348 ? 
covale38  covale ? ? C TYR 93  C ? ? ? 1_555 C MSE 94  N ? ? C TYR 92  C MSE 93  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale39  covale ? ? C MSE 94  C ? ? ? 1_555 C GLU 95  N ? ? C MSE 93  C GLU 94  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale40  covale ? ? C ASP 120 C ? ? ? 1_555 C MSE 121 N ? ? C ASP 119 C MSE 120 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale41  covale ? ? C MSE 121 C ? ? ? 1_555 C TRP 122 N ? ? C MSE 120 C TRP 121 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale42  covale ? ? C LEU 151 C ? ? ? 1_555 C MSE 152 N ? ? C LEU 150 C MSE 151 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale43  covale ? ? C MSE 152 C ? ? ? 1_555 C GLU 153 N ? ? C MSE 151 C GLU 152 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale44  covale ? ? C HIS 167 C ? ? ? 1_555 C MSE 168 N ? ? C HIS 166 C MSE 167 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale45  covale ? ? C MSE 168 C ? ? ? 1_555 C TYR 169 N ? ? C MSE 167 C TYR 168 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale46  covale ? ? D LEU 26  C ? ? ? 1_555 D MSE 27  N ? ? D LEU 26  D MSE 27  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale47  covale ? ? D MSE 27  C ? ? ? 1_555 D SER 28  N ? ? D MSE 27  D SER 28  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale48  covale ? ? D ALA 39  C ? ? ? 1_555 D MSE 40  N ? ? D ALA 39  D MSE 40  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale49  covale ? ? D MSE 40  C ? ? ? 1_555 D PRO 41  N ? ? D MSE 40  D PRO 41  1_555 ? ? ? ? ? ? ? 1.339 ? 
covale50  covale ? ? D LYS 111 C ? ? ? 1_555 D MSE 112 N ? ? D LYS 111 D MSE 112 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale51  covale ? ? D MSE 112 C ? ? ? 1_555 D GLY 113 N ? ? D MSE 112 D GLY 113 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale52  covale ? ? D ILE 149 C ? ? ? 1_555 D MSE 150 N ? ? D ILE 149 D MSE 150 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale53  covale ? ? D MSE 150 C ? ? ? 1_555 D ASP 151 N ? ? D MSE 150 D ASP 151 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale54  covale ? ? D GLU 170 C ? ? ? 1_555 D MSE 171 N ? ? D GLU 170 D MSE 171 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale55  covale ? ? D MSE 171 C ? ? ? 1_555 D GLU 172 N ? ? D MSE 171 D GLU 172 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale56  covale ? ? E TRP 24  C ? ? ? 1_555 E MSE 25  N ? ? E TRP 34  E MSE 35  1_555 ? ? ? ? ? ? ? 1.322 ? 
covale57  covale ? ? E MSE 25  C ? ? ? 1_555 E ASN 26  N ? ? E MSE 35  E ASN 36  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale58  covale ? ? E VAL 44  C ? ? ? 1_555 E MSE 45  N ? ? E VAL 54  E MSE 55  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale59  covale ? ? E MSE 45  C ? ? ? 1_555 E GLU 46  N ? ? E MSE 55  E GLU 56  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale60  covale ? ? E HIS 50  C ? ? ? 1_555 E MSE 51  N ? ? E HIS 60  E MSE 61  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale61  covale ? ? E MSE 51  C ? ? ? 1_555 E GLU 52  N ? ? E MSE 61  E GLU 62  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale62  covale ? ? E GLN 69  C ? ? ? 1_555 E MSE 70  N ? ? E GLN 79  E MSE 80  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale63  covale ? ? E MSE 70  C ? ? ? 1_555 E GLU 71  N ? ? E MSE 80  E GLU 81  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale64  covale ? ? E GLU 71  C ? ? ? 1_555 E MSE 72  N ? ? E GLU 81  E MSE 82  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale65  covale ? ? E MSE 72  C ? ? ? 1_555 E GLU 73  N ? ? E MSE 82  E GLU 83  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale66  covale ? ? E LEU 87  C ? ? ? 1_555 E MSE 88  N ? ? E LEU 97  E MSE 98  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale67  covale ? ? E MSE 88  C ? ? ? 1_555 E LYS 89  N ? ? E MSE 98  E LYS 99  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale68  covale ? ? E PHE 123 C ? ? ? 1_555 E MSE 124 N ? ? E PHE 133 E MSE 134 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale69  covale ? ? E MSE 124 C ? ? ? 1_555 E ALA 125 N ? ? E MSE 134 E ALA 135 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale70  covale ? ? E HIS 138 C ? ? ? 1_555 E MSE 139 N ? ? E HIS 148 E MSE 149 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale71  covale ? ? E MSE 139 C ? ? ? 1_555 E PRO 140 N ? ? E MSE 149 E PRO 150 1_555 ? ? ? ? ? ? ? 1.344 ? 
covale72  covale ? ? F MSE 1   C ? ? ? 1_555 F MSE 2   N ? ? F MSE 0   F MSE 1   1_555 ? ? ? ? ? ? ? 1.324 ? 
covale73  covale ? ? F MSE 2   C ? ? ? 1_555 F PHE 3   N ? ? F MSE 1   F PHE 2   1_555 ? ? ? ? ? ? ? 1.324 ? 
covale74  covale ? ? F ALA 7   C ? ? ? 1_555 F MSE 8   N ? ? F ALA 6   F MSE 7   1_555 ? ? ? ? ? ? ? 1.320 ? 
covale75  covale ? ? F MSE 8   C ? ? ? 1_555 F GLU 9   N ? ? F MSE 7   F GLU 8   1_555 ? ? ? ? ? ? ? 1.324 ? 
covale76  covale ? ? F GLU 36  C ? ? ? 1_555 F MSE 37  N ? ? F GLU 35  F MSE 36  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale77  covale ? ? F MSE 37  C ? ? ? 1_555 F LYS 38  N ? ? F MSE 36  F LYS 37  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale78  covale ? ? F HIS 106 C ? ? ? 1_555 F MSE 107 N ? ? F HIS 105 F MSE 106 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale79  covale ? ? F MSE 107 C ? ? ? 1_555 F ALA 108 N ? ? F MSE 106 F ALA 107 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale80  covale ? ? F GLU 111 C ? ? ? 1_555 F MSE 112 N ? ? F GLU 110 F MSE 111 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale81  covale ? ? F MSE 112 C ? ? ? 1_555 F GLU 113 N ? ? F MSE 111 F GLU 112 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale82  covale ? ? F TYR 125 C ? ? ? 1_555 F MSE 126 N ? ? F TYR 124 F MSE 125 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale83  covale ? ? F MSE 126 C ? ? ? 1_555 F ARG 127 N ? ? F MSE 125 F ARG 126 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale84  covale ? ? F ASP 140 C ? ? ? 1_555 F MSE 141 N ? ? F ASP 139 F MSE 140 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale85  covale ? ? F MSE 141 C ? ? ? 1_555 F LYS 142 N ? ? F MSE 140 F LYS 141 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale86  covale ? ? G MSE 1   C ? ? ? 1_555 G MSE 2   N ? ? G MSE 0   G MSE 1   1_555 ? ? ? ? ? ? ? 1.327 ? 
covale87  covale ? ? G MSE 2   C ? ? ? 1_555 G ASP 3   N ? ? G MSE 1   G ASP 2   1_555 ? ? ? ? ? ? ? 1.326 ? 
covale88  covale ? ? G TRP 66  C ? ? ? 1_555 G MSE 67  N ? ? G TRP 65  G MSE 66  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale89  covale ? ? G MSE 67  C ? ? ? 1_555 G ASP 68  N ? ? G MSE 66  G ASP 67  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale90  covale ? ? G LYS 74  C ? ? ? 1_555 G MSE 75  N ? ? G LYS 73  G MSE 74  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale91  covale ? ? G MSE 75  C ? ? ? 1_555 G ARG 76  N ? ? G MSE 74  G ARG 75  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale92  covale ? ? G PRO 87  C ? ? ? 1_555 G MSE 88  N ? ? G PRO 86  G MSE 87  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale93  covale ? ? G MSE 88  C ? ? ? 1_555 G PRO 89  N ? ? G MSE 87  G PRO 88  1_555 ? ? ? ? ? ? ? 1.344 ? 
covale94  covale ? ? G TYR 93  C ? ? ? 1_555 G MSE 94  N ? ? G TYR 92  G MSE 93  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale95  covale ? ? G MSE 94  C ? ? ? 1_555 G GLU 95  N ? ? G MSE 93  G GLU 94  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale96  covale ? ? G ASP 120 C ? ? ? 1_555 G MSE 121 N ? ? G ASP 119 G MSE 120 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale97  covale ? ? G MSE 121 C ? ? ? 1_555 G TRP 122 N ? ? G MSE 120 G TRP 121 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale98  covale ? ? G LEU 151 C ? ? ? 1_555 G MSE 152 N ? ? G LEU 150 G MSE 151 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale99  covale ? ? G MSE 152 C ? ? ? 1_555 G GLU 153 N ? ? G MSE 151 G GLU 152 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale100 covale ? ? G HIS 167 C ? ? ? 1_555 G MSE 168 N ? ? G HIS 166 G MSE 167 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale101 covale ? ? G MSE 168 C ? ? ? 1_555 G TYR 169 N ? ? G MSE 167 G TYR 168 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale102 covale ? ? H LEU 26  C ? ? ? 1_555 H MSE 27  N ? ? H LEU 26  H MSE 27  1_555 ? ? ? ? ? ? ? 1.323 ? 
covale103 covale ? ? H MSE 27  C ? ? ? 1_555 H SER 28  N ? ? H MSE 27  H SER 28  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale104 covale ? ? H ALA 39  C ? ? ? 1_555 H MSE 40  N ? ? H ALA 39  H MSE 40  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale105 covale ? ? H MSE 40  C ? ? ? 1_555 H PRO 41  N ? ? H MSE 40  H PRO 41  1_555 ? ? ? ? ? ? ? 1.335 ? 
covale106 covale ? ? H LYS 111 C ? ? ? 1_555 H MSE 112 N ? ? H LYS 111 H MSE 112 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale107 covale ? ? H MSE 112 C ? ? ? 1_555 H GLY 113 N ? ? H MSE 112 H GLY 113 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale108 covale ? ? H ILE 149 C ? ? ? 1_555 H MSE 150 N ? ? H ILE 149 H MSE 150 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale109 covale ? ? H MSE 150 C ? ? ? 1_555 H ASP 151 N ? ? H MSE 150 H ASP 151 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale110 covale ? ? H GLU 170 C ? ? ? 1_555 H MSE 171 N ? ? H GLU 170 H MSE 171 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale111 covale ? ? H MSE 171 C ? ? ? 1_555 H GLU 172 N ? ? H MSE 171 H GLU 172 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale112 covale ? ? I TRP 24  C ? ? ? 1_555 I MSE 25  N ? ? I TRP 34  I MSE 35  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale113 covale ? ? I MSE 25  C ? ? ? 1_555 I ASN 26  N ? ? I MSE 35  I ASN 36  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale114 covale ? ? I VAL 44  C ? ? ? 1_555 I MSE 45  N ? ? I VAL 54  I MSE 55  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale115 covale ? ? I MSE 45  C ? ? ? 1_555 I GLU 46  N ? ? I MSE 55  I GLU 56  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale116 covale ? ? I HIS 50  C ? ? ? 1_555 I MSE 51  N ? ? I HIS 60  I MSE 61  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale117 covale ? ? I MSE 51  C ? ? ? 1_555 I GLU 52  N ? ? I MSE 61  I GLU 62  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale118 covale ? ? I GLN 69  C ? ? ? 1_555 I MSE 70  N ? ? I GLN 79  I MSE 80  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale119 covale ? ? I MSE 70  C ? ? ? 1_555 I GLU 71  N ? ? I MSE 80  I GLU 81  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale120 covale ? ? I GLU 71  C ? ? ? 1_555 I MSE 72  N ? ? I GLU 81  I MSE 82  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale121 covale ? ? I MSE 72  C ? ? ? 1_555 I GLU 73  N ? ? I MSE 82  I GLU 83  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale122 covale ? ? I LEU 87  C ? ? ? 1_555 I MSE 88  N ? ? I LEU 97  I MSE 98  1_555 ? ? ? ? ? ? ? 1.322 ? 
covale123 covale ? ? I MSE 88  C ? ? ? 1_555 I LYS 89  N ? ? I MSE 98  I LYS 99  1_555 ? ? ? ? ? ? ? 1.320 ? 
covale124 covale ? ? I PHE 123 C ? ? ? 1_555 I MSE 124 N ? ? I PHE 133 I MSE 134 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale125 covale ? ? I MSE 124 C ? ? ? 1_555 I ALA 125 N ? ? I MSE 134 I ALA 135 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale126 covale ? ? I HIS 138 C ? ? ? 1_555 I MSE 139 N ? ? I HIS 148 I MSE 149 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale127 covale ? ? I MSE 139 C ? ? ? 1_555 I PRO 140 N ? ? I MSE 149 I PRO 150 1_555 ? ? ? ? ? ? ? 1.341 ? 
covale128 covale ? ? J MSE 2   C ? ? ? 1_555 J PHE 3   N ? ? J MSE 1   J PHE 2   1_555 ? ? ? ? ? ? ? 1.330 ? 
covale129 covale ? ? J ALA 7   C ? ? ? 1_555 J MSE 8   N ? ? J ALA 6   J MSE 7   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale130 covale ? ? J MSE 8   C ? ? ? 1_555 J GLU 9   N ? ? J MSE 7   J GLU 8   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale131 covale ? ? J GLU 36  C ? ? ? 1_555 J MSE 37  N ? ? J GLU 35  J MSE 36  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale132 covale ? ? J MSE 37  C ? ? ? 1_555 J LYS 38  N ? ? J MSE 36  J LYS 37  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale133 covale ? ? J HIS 106 C ? ? ? 1_555 J MSE 107 N ? ? J HIS 105 J MSE 106 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale134 covale ? ? J MSE 107 C ? ? ? 1_555 J ALA 108 N ? ? J MSE 106 J ALA 107 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale135 covale ? ? J GLU 111 C ? ? ? 1_555 J MSE 112 N ? ? J GLU 110 J MSE 111 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale136 covale ? ? J MSE 112 C ? ? ? 1_555 J GLU 113 N ? ? J MSE 111 J GLU 112 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale137 covale ? ? J TYR 125 C ? ? ? 1_555 J MSE 126 N ? ? J TYR 124 J MSE 125 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale138 covale ? ? J MSE 126 C ? ? ? 1_555 J ARG 127 N ? ? J MSE 125 J ARG 126 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale139 covale ? ? J ASP 140 C ? ? ? 1_555 J MSE 141 N ? ? J ASP 139 J MSE 140 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale140 covale ? ? J MSE 141 C ? ? ? 1_555 J LYS 142 N ? ? J MSE 140 J LYS 141 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale141 covale ? ? K MSE 1   C ? ? ? 1_555 K MSE 2   N ? ? K MSE 0   K MSE 1   1_555 ? ? ? ? ? ? ? 1.327 ? 
covale142 covale ? ? K MSE 2   C ? ? ? 1_555 K ASP 3   N ? ? K MSE 1   K ASP 2   1_555 ? ? ? ? ? ? ? 1.326 ? 
covale143 covale ? ? K TRP 66  C ? ? ? 1_555 K MSE 67  N ? ? K TRP 65  K MSE 66  1_555 ? ? ? ? ? ? ? 1.322 ? 
covale144 covale ? ? K MSE 67  C ? ? ? 1_555 K ASP 68  N ? ? K MSE 66  K ASP 67  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale145 covale ? ? K LYS 74  C ? ? ? 1_555 K MSE 75  N ? ? K LYS 73  K MSE 74  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale146 covale ? ? K MSE 75  C ? ? ? 1_555 K ARG 76  N ? ? K MSE 74  K ARG 75  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale147 covale ? ? K PRO 87  C ? ? ? 1_555 K MSE 88  N ? ? K PRO 86  K MSE 87  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale148 covale ? ? K MSE 88  C ? ? ? 1_555 K PRO 89  N ? ? K MSE 87  K PRO 88  1_555 ? ? ? ? ? ? ? 1.346 ? 
covale149 covale ? ? K TYR 93  C ? ? ? 1_555 K MSE 94  N ? ? K TYR 92  K MSE 93  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale150 covale ? ? K MSE 94  C ? ? ? 1_555 K GLU 95  N ? ? K MSE 93  K GLU 94  1_555 ? ? ? ? ? ? ? 1.336 ? 
covale151 covale ? ? K ASP 120 C ? ? ? 1_555 K MSE 121 N ? ? K ASP 119 K MSE 120 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale152 covale ? ? K MSE 121 C ? ? ? 1_555 K TRP 122 N ? ? K MSE 120 K TRP 121 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale153 covale ? ? K LEU 151 C ? ? ? 1_555 K MSE 152 N ? ? K LEU 150 K MSE 151 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale154 covale ? ? K MSE 152 C ? ? ? 1_555 K GLU 153 N ? ? K MSE 151 K GLU 152 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale155 covale ? ? K HIS 167 C ? ? ? 1_555 K MSE 168 N ? ? K HIS 166 K MSE 167 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale156 covale ? ? K MSE 168 C ? ? ? 1_555 K TYR 169 N ? ? K MSE 167 K TYR 168 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale157 covale ? ? L LEU 26  C ? ? ? 1_555 L MSE 27  N ? ? L LEU 26  L MSE 27  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale158 covale ? ? L MSE 27  C ? ? ? 1_555 L SER 28  N ? ? L MSE 27  L SER 28  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale159 covale ? ? L ALA 39  C ? ? ? 1_555 L MSE 40  N ? ? L ALA 39  L MSE 40  1_555 ? ? ? ? ? ? ? 1.322 ? 
covale160 covale ? ? L MSE 40  C ? ? ? 1_555 L PRO 41  N ? ? L MSE 40  L PRO 41  1_555 ? ? ? ? ? ? ? 1.342 ? 
covale161 covale ? ? L LYS 111 C ? ? ? 1_555 L MSE 112 N ? ? L LYS 111 L MSE 112 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale162 covale ? ? L MSE 112 C ? ? ? 1_555 L GLY 113 N ? ? L MSE 112 L GLY 113 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale163 covale ? ? L ILE 149 C ? ? ? 1_555 L MSE 150 N ? ? L ILE 149 L MSE 150 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale164 covale ? ? L MSE 150 C ? ? ? 1_555 L ASP 151 N ? ? L MSE 150 L ASP 151 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale165 covale ? ? L GLU 170 C ? ? ? 1_555 L MSE 171 N ? ? L GLU 170 L MSE 171 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale166 covale ? ? L MSE 171 C ? ? ? 1_555 L GLU 172 N ? ? L MSE 171 L GLU 172 1_555 ? ? ? ? ? ? ? 1.327 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
E ? 3 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 3 ? 
J ? 3 ? 
K ? 2 ? 
L ? 3 ? 
M ? 2 ? 
N ? 3 ? 
O ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
O 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL C 43  ? PRO C 46  ? VAL C 42  PRO C 45  
A 2 LEU C 15  ? PRO C 20  ? LEU C 14  PRO C 19  
A 3 CYS C 59  ? LEU C 62  ? CYS C 58  LEU C 61  
B 1 ILE C 27  ? LEU C 29  ? ILE C 26  LEU C 28  
B 2 GLY C 32  ? LEU C 34  ? GLY C 31  LEU C 33  
C 1 LYS D 65  ? GLU D 67  ? LYS D 65  GLU D 67  
C 2 PRO D 33  ? THR D 36  ? PRO D 33  THR D 36  
C 3 LEU D 84  ? VAL D 86  ? LEU D 84  VAL D 86  
D 1 MSE D 40  ? PRO D 41  ? MSE D 40  PRO D 41  
D 2 ALA D 59  ? VAL D 60  ? ALA D 59  VAL D 60  
E 1 TYR E 160 ? ARG E 164 ? TYR E 170 ARG E 174 
E 2 GLN E 193 ? ARG E 197 ? GLN E 203 ARG E 207 
E 3 ALA G 144 ? LYS G 145 ? ALA G 143 LYS G 144 
F 1 GLN E 169 ? VAL E 174 ? GLN E 179 VAL E 184 
F 2 TYR E 184 ? LEU E 188 ? TYR E 194 LEU E 198 
G 1 LEU G 15  ? ILE G 18  ? LEU G 14  ILE G 17  
G 2 VAL G 43  ? PRO G 46  ? VAL G 42  PRO G 45  
H 1 ILE G 27  ? TYR G 28  ? ILE G 26  TYR G 27  
H 2 ASP G 33  ? LEU G 34  ? ASP G 32  LEU G 33  
I 1 LYS H 65  ? PRO H 69  ? LYS H 65  PRO H 69  
I 2 LYS H 31  ? THR H 36  ? LYS H 31  THR H 36  
I 3 LEU H 84  ? VAL H 86  ? LEU H 84  VAL H 86  
J 1 TYR I 160 ? ARG I 164 ? TYR I 170 ARG I 174 
J 2 GLN I 193 ? ARG I 197 ? GLN I 203 ARG I 207 
J 3 ALA K 144 ? LYS K 145 ? ALA K 143 LYS K 144 
K 1 GLU I 170 ? VAL I 174 ? GLU I 180 VAL I 184 
K 2 TYR I 184 ? LEU I 188 ? TYR I 194 LEU I 198 
L 1 VAL K 43  ? PRO K 46  ? VAL K 42  PRO K 45  
L 2 LEU K 15  ? PRO K 20  ? LEU K 14  PRO K 19  
L 3 CYS K 59  ? LEU K 62  ? CYS K 58  LEU K 61  
M 1 ILE K 27  ? LEU K 29  ? ILE K 26  LEU K 28  
M 2 GLY K 32  ? LEU K 34  ? GLY K 31  LEU K 33  
N 1 LYS L 65  ? PRO L 69  ? LYS L 65  PRO L 69  
N 2 LYS L 31  ? THR L 36  ? LYS L 31  THR L 36  
N 3 LEU L 84  ? VAL L 86  ? LEU L 84  VAL L 86  
O 1 MSE L 40  ? PRO L 41  ? MSE L 40  PRO L 41  
O 2 ALA L 59  ? VAL L 60  ? ALA L 59  VAL L 60  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL C 43  ? O VAL C 42  N ILE C 18  ? N ILE C 17  
A 2 3 N THR C 17  ? N THR C 16  O LEU C 62  ? O LEU C 61  
B 1 2 N LEU C 29  ? N LEU C 28  O GLY C 32  ? O GLY C 31  
C 1 2 O LEU D 66  ? O LEU D 66  N VAL D 34  ? N VAL D 34  
C 2 3 N ARG D 35  ? N ARG D 35  O SER D 85  ? O SER D 85  
D 1 2 N MSE D 40  ? N MSE D 40  O VAL D 60  ? O VAL D 60  
E 1 2 N VAL E 161 ? N VAL E 171 O ILE E 196 ? O ILE E 206 
E 2 3 N LEU E 195 ? N LEU E 205 O ALA G 144 ? O ALA G 143 
F 1 2 N VAL E 174 ? N VAL E 184 O TYR E 184 ? O TYR E 194 
G 1 2 N VAL G 16  ? N VAL G 15  O VAL G 45  ? O VAL G 44  
H 1 2 N ILE G 27  ? N ILE G 26  O LEU G 34  ? O LEU G 33  
I 1 2 O LEU H 66  ? O LEU H 66  N VAL H 34  ? N VAL H 34  
I 2 3 N ARG H 35  ? N ARG H 35  O SER H 85  ? O SER H 85  
J 1 2 N LEU I 163 ? N LEU I 173 O HIS I 194 ? O HIS I 204 
J 2 3 N LEU I 195 ? N LEU I 205 O ALA K 144 ? O ALA K 143 
K 1 2 N ILE I 172 ? N ILE I 182 O ILE I 186 ? O ILE I 196 
L 1 2 O VAL K 45  ? O VAL K 44  N VAL K 16  ? N VAL K 15  
L 2 3 N ILE K 19  ? N ILE K 18  O ARG K 60  ? O ARG K 59  
M 1 2 N LEU K 29  ? N LEU K 28  O GLY K 32  ? O GLY K 31  
N 1 2 O LEU L 66  ? O LEU L 66  N VAL L 34  ? N VAL L 34  
N 2 3 N ARG L 35  ? N ARG L 35  O SER L 85  ? O SER L 85  
O 1 2 N MSE L 40  ? N MSE L 40  O VAL L 60  ? O VAL L 60  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 I 1001' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 I 1002' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 I 1003' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 F 1004' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 F 1005' 
AC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 J 1006' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 K 1007' 
AC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 L 1008' 
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 L 1009' 
BC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 F 1010' 
BC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SO4 E 1011' 
BC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SO4 E 1012' 
BC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 E 1013' 
BC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 F 1014' 
BC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 E 1015' 
BC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 B 1016' 
BC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 1017' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 ARG I  197 ? ARG I 207  . ? 1_555 ? 
2  AC1 2 LYS I  199 ? LYS I 209  . ? 1_555 ? 
3  AC2 3 SER I  129 ? SER I 139  . ? 1_555 ? 
4  AC2 3 LYS I  132 ? LYS I 142  . ? 1_555 ? 
5  AC2 3 ASN I  133 ? ASN I 143  . ? 1_555 ? 
6  AC3 5 ASN I  26  ? ASN I 36   . ? 1_555 ? 
7  AC3 5 PHE I  162 ? PHE I 172  . ? 1_555 ? 
8  AC3 5 LEU I  163 ? LEU I 173  . ? 1_555 ? 
9  AC3 5 ARG I  164 ? ARG I 174  . ? 1_555 ? 
10 AC3 5 ARG I  166 ? ARG I 176  . ? 1_555 ? 
11 AC4 3 MSE F  2   ? MSE F 1    . ? 1_555 ? 
12 AC4 3 PHE F  3   ? PHE F 2    . ? 1_555 ? 
13 AC4 3 PHE H  46  ? PHE H 46   . ? 1_555 ? 
14 AC5 4 GLN D  177 ? GLN D 177  . ? 1_555 ? 
15 AC5 4 PRO F  100 ? PRO F 99   . ? 1_555 ? 
16 AC5 4 ASN F  101 ? ASN F 100  . ? 1_555 ? 
17 AC5 4 ALA F  102 ? ALA F 101  . ? 1_555 ? 
18 AC6 3 MSE J  2   ? MSE J 1    . ? 1_555 ? 
19 AC6 3 GLU J  36  ? GLU J 35   . ? 1_555 ? 
20 AC6 3 ALA J  39  ? ALA J 38   . ? 1_555 ? 
21 AC7 4 LEU K  15  ? LEU K 14   . ? 1_555 ? 
22 AC7 4 VAL K  16  ? VAL K 15   . ? 1_555 ? 
23 AC7 4 THR K  17  ? THR K 16   . ? 1_555 ? 
24 AC7 4 GLU K  44  ? GLU K 43   . ? 1_555 ? 
25 AC8 5 ARG L  81  ? ARG L 81   . ? 1_555 ? 
26 AC8 5 VAL L  86  ? VAL L 86   . ? 1_555 ? 
27 AC8 5 PHE L  126 ? PHE L 126  . ? 1_555 ? 
28 AC8 5 SER L  128 ? SER L 128  . ? 1_555 ? 
29 AC8 5 HOH OA .   ? HOH L 1025 . ? 1_555 ? 
30 AC9 4 THR C  17  ? THR C 16   . ? 4_553 ? 
31 AC9 4 LEU C  62  ? LEU C 61   . ? 4_553 ? 
32 AC9 4 GLU C  65  ? GLU C 64   . ? 4_553 ? 
33 AC9 4 ALA L  102 ? ALA L 102  . ? 1_555 ? 
34 BC1 5 ARG E  84  ? ARG E 94   . ? 1_555 ? 
35 BC1 5 MSE E  88  ? MSE E 98   . ? 1_555 ? 
36 BC1 5 ARG F  89  ? ARG F 88   . ? 1_555 ? 
37 BC1 5 TRP F  93  ? TRP F 92   . ? 1_555 ? 
38 BC1 5 PHE H  6   ? PHE H 6    . ? 1_555 ? 
39 BC2 1 PRO E  105 ? PRO E 115  . ? 1_555 ? 
40 BC3 1 ARG E  121 ? ARG E 131  . ? 1_555 ? 
41 BC4 3 SER E  129 ? SER E 139  . ? 1_555 ? 
42 BC4 3 LYS E  132 ? LYS E 142  . ? 1_555 ? 
43 BC4 3 ASN E  133 ? ASN E 143  . ? 1_555 ? 
44 BC5 2 VAL E  134 ? VAL E 144  . ? 1_555 ? 
45 BC5 2 GLU F  110 ? GLU F 109  . ? 1_555 ? 
46 BC6 3 ASP E  158 ? ASP E 168  . ? 1_555 ? 
47 BC6 3 ARG E  197 ? ARG E 207  . ? 1_555 ? 
48 BC6 3 LYS E  199 ? LYS E 209  . ? 1_555 ? 
49 BC7 4 HIS B  15  ? HIS B 14   . ? 1_555 ? 
50 BC7 4 LEU D  26  ? LEU D 26   . ? 1_555 ? 
51 BC7 4 GLU D  170 ? GLU D 170  . ? 1_555 ? 
52 BC7 4 HIS F  106 ? HIS F 105  . ? 1_555 ? 
53 BC8 3 ARG A  150 ? ARG A 160  . ? 1_555 ? 
54 BC8 3 ARG B  74  ? ARG B 73   . ? 1_555 ? 
55 BC8 3 PHE D  19  ? PHE D 19   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2EHO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2EHO 
_atom_sites.fract_transf_matrix[1][1]   0.006063 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001729 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005650 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008220 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . LEU A  1 11  ? 100.789 -73.803  -146.652 1.00 93.84  ? 21   LEU A N   1 
ATOM   2     C  CA  . LEU A  1 11  ? 100.692 -74.692  -147.845 1.00 94.67  ? 21   LEU A CA  1 
ATOM   3     C  C   . LEU A  1 11  ? 99.263  -74.751  -148.405 1.00 95.07  ? 21   LEU A C   1 
ATOM   4     O  O   . LEU A  1 11  ? 98.499  -73.789  -148.277 1.00 94.80  ? 21   LEU A O   1 
ATOM   5     C  CB  . LEU A  1 11  ? 101.204 -76.103  -147.495 1.00 94.59  ? 21   LEU A CB  1 
ATOM   6     C  CG  . LEU A  1 11  ? 100.638 -76.904  -146.308 1.00 94.47  ? 21   LEU A CG  1 
ATOM   7     C  CD1 . LEU A  1 11  ? 101.308 -78.269  -146.271 1.00 93.04  ? 21   LEU A CD1 1 
ATOM   8     C  CD2 . LEU A  1 11  ? 100.874 -76.173  -144.990 1.00 93.74  ? 21   LEU A CD2 1 
ATOM   9     N  N   . THR A  1 12  ? 98.908  -75.876  -149.027 1.00 95.23  ? 22   THR A N   1 
ATOM   10    C  CA  . THR A  1 12  ? 97.577  -76.042  -149.618 1.00 94.92  ? 22   THR A CA  1 
ATOM   11    C  C   . THR A  1 12  ? 96.530  -76.529  -148.625 1.00 94.60  ? 22   THR A C   1 
ATOM   12    O  O   . THR A  1 12  ? 96.808  -77.371  -147.769 1.00 94.96  ? 22   THR A O   1 
ATOM   13    C  CB  . THR A  1 12  ? 97.584  -77.049  -150.779 1.00 94.53  ? 22   THR A CB  1 
ATOM   14    O  OG1 . THR A  1 12  ? 97.412  -78.373  -150.259 1.00 93.66  ? 22   THR A OG1 1 
ATOM   15    C  CG2 . THR A  1 12  ? 98.896  -76.971  -151.544 1.00 94.48  ? 22   THR A CG2 1 
ATOM   16    N  N   . PRO A  1 13  ? 95.298  -76.015  -148.745 1.00 93.77  ? 23   PRO A N   1 
ATOM   17    C  CA  . PRO A  1 13  ? 94.204  -76.405  -147.853 1.00 92.89  ? 23   PRO A CA  1 
ATOM   18    C  C   . PRO A  1 13  ? 94.205  -77.911  -147.646 1.00 92.15  ? 23   PRO A C   1 
ATOM   19    O  O   . PRO A  1 13  ? 94.251  -78.394  -146.517 1.00 92.02  ? 23   PRO A O   1 
ATOM   20    C  CB  . PRO A  1 13  ? 92.968  -75.930  -148.605 1.00 93.08  ? 23   PRO A CB  1 
ATOM   21    C  CG  . PRO A  1 13  ? 93.463  -74.694  -149.282 1.00 93.57  ? 23   PRO A CG  1 
ATOM   22    C  CD  . PRO A  1 13  ? 94.818  -75.105  -149.800 1.00 93.28  ? 23   PRO A CD  1 
ATOM   23    N  N   . ALA A  1 14  ? 94.169  -78.646  -148.752 1.00 91.87  ? 24   ALA A N   1 
ATOM   24    C  CA  . ALA A  1 14  ? 94.164  -80.102  -148.709 1.00 91.80  ? 24   ALA A CA  1 
ATOM   25    C  C   . ALA A  1 14  ? 95.272  -80.630  -147.803 1.00 91.55  ? 24   ALA A C   1 
ATOM   26    O  O   . ALA A  1 14  ? 95.022  -81.447  -146.915 1.00 90.94  ? 24   ALA A O   1 
ATOM   27    C  CB  . ALA A  1 14  ? 94.326  -80.660  -150.116 1.00 91.98  ? 24   ALA A CB  1 
ATOM   28    N  N   . GLU A  1 15  ? 96.495  -80.158  -148.034 1.00 91.14  ? 25   GLU A N   1 
ATOM   29    C  CA  . GLU A  1 15  ? 97.643  -80.581  -147.238 1.00 90.18  ? 25   GLU A CA  1 
ATOM   30    C  C   . GLU A  1 15  ? 97.459  -80.145  -145.789 1.00 89.36  ? 25   GLU A C   1 
ATOM   31    O  O   . GLU A  1 15  ? 97.512  -80.969  -144.875 1.00 88.80  ? 25   GLU A O   1 
ATOM   32    C  CB  . GLU A  1 15  ? 98.934  -79.979  -147.801 1.00 89.94  ? 25   GLU A CB  1 
ATOM   33    C  CG  . GLU A  1 15  ? 99.214  -80.346  -149.250 1.00 89.84  ? 25   GLU A CG  1 
ATOM   34    C  CD  . GLU A  1 15  ? 100.431 -79.632  -149.813 1.00 89.93  ? 25   GLU A CD  1 
ATOM   35    O  OE1 . GLU A  1 15  ? 100.580 -78.417  -149.559 1.00 90.42  ? 25   GLU A OE1 1 
ATOM   36    O  OE2 . GLU A  1 15  ? 101.234 -80.277  -150.522 1.00 88.95  ? 25   GLU A OE2 1 
ATOM   37    N  N   . LEU A  1 16  ? 97.240  -78.849  -145.587 1.00 88.37  ? 26   LEU A N   1 
ATOM   38    C  CA  . LEU A  1 16  ? 97.039  -78.303  -144.250 1.00 87.72  ? 26   LEU A CA  1 
ATOM   39    C  C   . LEU A  1 16  ? 96.173  -79.237  -143.409 1.00 87.40  ? 26   LEU A C   1 
ATOM   40    O  O   . LEU A  1 16  ? 96.665  -79.887  -142.492 1.00 87.18  ? 26   LEU A O   1 
ATOM   41    C  CB  . LEU A  1 16  ? 96.381  -76.926  -144.340 1.00 87.11  ? 26   LEU A CB  1 
ATOM   42    C  CG  . LEU A  1 16  ? 96.007  -76.265  -143.013 1.00 86.27  ? 26   LEU A CG  1 
ATOM   43    C  CD1 . LEU A  1 16  ? 97.191  -76.308  -142.066 1.00 86.53  ? 26   LEU A CD1 1 
ATOM   44    C  CD2 . LEU A  1 16  ? 95.568  -74.834  -143.264 1.00 85.25  ? 26   LEU A CD2 1 
ATOM   45    N  N   . ILE A  1 17  ? 94.886  -79.303  -143.731 1.00 87.31  ? 27   ILE A N   1 
ATOM   46    C  CA  . ILE A  1 17  ? 93.959  -80.173  -143.015 1.00 87.56  ? 27   ILE A CA  1 
ATOM   47    C  C   . ILE A  1 17  ? 94.597  -81.533  -142.728 1.00 88.30  ? 27   ILE A C   1 
ATOM   48    O  O   . ILE A  1 17  ? 94.594  -82.007  -141.591 1.00 88.24  ? 27   ILE A O   1 
ATOM   49    C  CB  . ILE A  1 17  ? 92.676  -80.409  -143.839 1.00 87.05  ? 27   ILE A CB  1 
ATOM   50    C  CG1 . ILE A  1 17  ? 91.986  -79.073  -144.128 1.00 86.42  ? 27   ILE A CG1 1 
ATOM   51    C  CG2 . ILE A  1 17  ? 91.752  -81.368  -143.104 1.00 86.28  ? 27   ILE A CG2 1 
ATOM   52    C  CD1 . ILE A  1 17  ? 91.581  -78.308  -142.893 1.00 86.07  ? 27   ILE A CD1 1 
ATOM   53    N  N   . GLU A  1 18  ? 95.138  -82.155  -143.771 1.00 88.87  ? 28   GLU A N   1 
ATOM   54    C  CA  . GLU A  1 18  ? 95.782  -83.456  -143.642 1.00 89.26  ? 28   GLU A CA  1 
ATOM   55    C  C   . GLU A  1 18  ? 96.771  -83.446  -142.484 1.00 88.91  ? 28   GLU A C   1 
ATOM   56    O  O   . GLU A  1 18  ? 96.883  -84.417  -141.736 1.00 88.68  ? 28   GLU A O   1 
ATOM   57    C  CB  . GLU A  1 18  ? 96.529  -83.809  -144.930 1.00 90.58  ? 28   GLU A CB  1 
ATOM   58    C  CG  . GLU A  1 18  ? 97.283  -85.130  -144.858 1.00 92.23  ? 28   GLU A CG  1 
ATOM   59    C  CD  . GLU A  1 18  ? 98.468  -85.183  -145.806 1.00 93.48  ? 28   GLU A CD  1 
ATOM   60    O  OE1 . GLU A  1 18  ? 99.368  -84.322  -145.681 1.00 93.67  ? 28   GLU A OE1 1 
ATOM   61    O  OE2 . GLU A  1 18  ? 98.505  -86.088  -146.668 1.00 93.75  ? 28   GLU A OE2 1 
ATOM   62    N  N   . ARG A  1 19  ? 97.491  -82.339  -142.351 1.00 88.37  ? 29   ARG A N   1 
ATOM   63    C  CA  . ARG A  1 19  ? 98.485  -82.182  -141.299 1.00 87.93  ? 29   ARG A CA  1 
ATOM   64    C  C   . ARG A  1 19  ? 97.805  -82.128  -139.938 1.00 87.49  ? 29   ARG A C   1 
ATOM   65    O  O   . ARG A  1 19  ? 98.213  -82.816  -139.002 1.00 88.01  ? 29   ARG A O   1 
ATOM   66    C  CB  . ARG A  1 19  ? 99.279  -80.898  -141.538 1.00 88.68  ? 29   ARG A CB  1 
ATOM   67    C  CG  . ARG A  1 19  ? 100.548 -80.771  -140.727 1.00 89.55  ? 29   ARG A CG  1 
ATOM   68    C  CD  . ARG A  1 19  ? 101.671 -80.274  -141.620 1.00 90.12  ? 29   ARG A CD  1 
ATOM   69    N  NE  . ARG A  1 19  ? 101.983 -81.252  -142.660 1.00 91.38  ? 29   ARG A NE  1 
ATOM   70    C  CZ  . ARG A  1 19  ? 102.658 -80.985  -143.775 1.00 91.67  ? 29   ARG A CZ  1 
ATOM   71    N  NH1 . ARG A  1 19  ? 103.099 -79.757  -144.010 1.00 91.90  ? 29   ARG A NH1 1 
ATOM   72    N  NH2 . ARG A  1 19  ? 102.894 -81.950  -144.655 1.00 91.64  ? 29   ARG A NH2 1 
ATOM   73    N  N   . LEU A  1 20  ? 96.763  -81.308  -139.842 1.00 86.15  ? 30   LEU A N   1 
ATOM   74    C  CA  . LEU A  1 20  ? 96.011  -81.147  -138.606 1.00 83.92  ? 30   LEU A CA  1 
ATOM   75    C  C   . LEU A  1 20  ? 95.581  -82.508  -138.082 1.00 82.84  ? 30   LEU A C   1 
ATOM   76    O  O   . LEU A  1 20  ? 95.676  -82.773  -136.893 1.00 82.98  ? 30   LEU A O   1 
ATOM   77    C  CB  . LEU A  1 20  ? 94.775  -80.275  -138.848 1.00 83.82  ? 30   LEU A CB  1 
ATOM   78    C  CG  . LEU A  1 20  ? 93.998  -79.772  -137.629 1.00 83.26  ? 30   LEU A CG  1 
ATOM   79    C  CD1 . LEU A  1 20  ? 94.879  -78.827  -136.836 1.00 82.73  ? 30   LEU A CD1 1 
ATOM   80    C  CD2 . LEU A  1 20  ? 92.728  -79.058  -138.072 1.00 82.11  ? 30   LEU A CD2 1 
ATOM   81    N  N   . GLU A  1 21  ? 95.113  -83.374  -138.973 1.00 82.05  ? 31   GLU A N   1 
ATOM   82    C  CA  . GLU A  1 21  ? 94.677  -84.702  -138.563 1.00 81.76  ? 31   GLU A CA  1 
ATOM   83    C  C   . GLU A  1 21  ? 95.860  -85.530  -138.069 1.00 81.33  ? 31   GLU A C   1 
ATOM   84    O  O   . GLU A  1 21  ? 95.684  -86.614  -137.510 1.00 80.52  ? 31   GLU A O   1 
ATOM   85    C  CB  . GLU A  1 21  ? 93.979  -85.424  -139.719 1.00 82.23  ? 31   GLU A CB  1 
ATOM   86    C  CG  . GLU A  1 21  ? 92.757  -84.702  -140.264 1.00 82.49  ? 31   GLU A CG  1 
ATOM   87    C  CD  . GLU A  1 21  ? 91.994  -85.539  -141.272 1.00 83.84  ? 31   GLU A CD  1 
ATOM   88    O  OE1 . GLU A  1 21  ? 91.050  -85.012  -141.898 1.00 84.14  ? 31   GLU A OE1 1 
ATOM   89    O  OE2 . GLU A  1 21  ? 92.336  -86.730  -141.435 1.00 84.74  ? 31   GLU A OE2 1 
ATOM   90    N  N   . GLN A  1 22  ? 97.069  -85.024  -138.291 1.00 81.40  ? 32   GLN A N   1 
ATOM   91    C  CA  . GLN A  1 22  ? 98.266  -85.718  -137.831 1.00 82.43  ? 32   GLN A CA  1 
ATOM   92    C  C   . GLN A  1 22  ? 98.594  -85.195  -136.443 1.00 82.15  ? 32   GLN A C   1 
ATOM   93    O  O   . GLN A  1 22  ? 98.674  -85.961  -135.478 1.00 82.32  ? 32   GLN A O   1 
ATOM   94    C  CB  . GLN A  1 22  ? 99.448  -85.468  -138.774 1.00 83.19  ? 32   GLN A CB  1 
ATOM   95    C  CG  . GLN A  1 22  ? 99.790  -86.657  -139.668 1.00 84.27  ? 32   GLN A CG  1 
ATOM   96    C  CD  . GLN A  1 22  ? 100.255 -87.880  -138.884 1.00 84.21  ? 32   GLN A CD  1 
ATOM   97    O  OE1 . GLN A  1 22  ? 99.616  -88.298  -137.919 1.00 82.83  ? 32   GLN A OE1 1 
ATOM   98    N  NE2 . GLN A  1 22  ? 101.369 -88.463  -139.310 1.00 84.59  ? 32   GLN A NE2 1 
ATOM   99    N  N   . ALA A  1 23  ? 98.768  -83.880  -136.354 1.00 81.40  ? 33   ALA A N   1 
ATOM   100   C  CA  . ALA A  1 23  ? 99.075  -83.223  -135.092 1.00 81.10  ? 33   ALA A CA  1 
ATOM   101   C  C   . ALA A  1 23  ? 97.950  -83.485  -134.095 1.00 81.42  ? 33   ALA A C   1 
ATOM   102   O  O   . ALA A  1 23  ? 98.139  -83.377  -132.885 1.00 81.81  ? 33   ALA A O   1 
ATOM   103   C  CB  . ALA A  1 23  ? 99.247  -81.731  -135.316 1.00 80.53  ? 33   ALA A CB  1 
ATOM   104   N  N   . TRP A  1 24  ? 96.782  -83.836  -134.623 1.00 81.49  ? 34   TRP A N   1 
ATOM   105   C  CA  . TRP A  1 24  ? 95.608  -84.137  -133.813 1.00 81.14  ? 34   TRP A CA  1 
ATOM   106   C  C   . TRP A  1 24  ? 95.743  -85.532  -133.227 1.00 81.11  ? 34   TRP A C   1 
ATOM   107   O  O   . TRP A  1 24  ? 95.663  -85.714  -132.019 1.00 81.34  ? 34   TRP A O   1 
ATOM   108   C  CB  . TRP A  1 24  ? 94.345  -84.060  -134.673 1.00 80.62  ? 34   TRP A CB  1 
ATOM   109   C  CG  . TRP A  1 24  ? 93.105  -84.572  -134.009 1.00 80.39  ? 34   TRP A CG  1 
ATOM   110   C  CD1 . TRP A  1 24  ? 92.537  -84.109  -132.857 1.00 81.17  ? 34   TRP A CD1 1 
ATOM   111   C  CD2 . TRP A  1 24  ? 92.255  -85.626  -134.480 1.00 79.38  ? 34   TRP A CD2 1 
ATOM   112   N  NE1 . TRP A  1 24  ? 91.382  -84.810  -132.583 1.00 80.41  ? 34   TRP A NE1 1 
ATOM   113   C  CE2 . TRP A  1 24  ? 91.189  -85.745  -133.565 1.00 79.57  ? 34   TRP A CE2 1 
ATOM   114   C  CE3 . TRP A  1 24  ? 92.291  -86.480  -135.588 1.00 79.36  ? 34   TRP A CE3 1 
ATOM   115   C  CZ2 . TRP A  1 24  ? 90.168  -86.682  -133.725 1.00 79.32  ? 34   TRP A CZ2 1 
ATOM   116   C  CZ3 . TRP A  1 24  ? 91.272  -87.412  -135.747 1.00 78.75  ? 34   TRP A CZ3 1 
ATOM   117   C  CH2 . TRP A  1 24  ? 90.226  -87.504  -134.819 1.00 78.21  ? 34   TRP A CH2 1 
HETATM 118   N  N   . MSE A  1 25  ? 95.953  -86.516  -134.090 1.00 82.28  ? 35   MSE A N   1 
HETATM 119   C  CA  . MSE A  1 25  ? 96.094  -87.890  -133.638 1.00 83.54  ? 35   MSE A CA  1 
HETATM 120   C  C   . MSE A  1 25  ? 97.384  -88.123  -132.877 1.00 80.59  ? 35   MSE A C   1 
HETATM 121   O  O   . MSE A  1 25  ? 97.439  -88.968  -131.984 1.00 79.76  ? 35   MSE A O   1 
HETATM 122   C  CB  . MSE A  1 25  ? 96.015  -88.846  -134.816 1.00 89.10  ? 35   MSE A CB  1 
HETATM 123   C  CG  . MSE A  1 25  ? 94.629  -88.984  -135.377 1.00 96.91  ? 35   MSE A CG  1 
HETATM 124   SE SE  . MSE A  1 25  ? 94.630  -90.310  -136.757 1.00 111.12 ? 35   MSE A SE  1 
HETATM 125   C  CE  . MSE A  1 25  ? 94.679  -91.886  -135.634 1.00 107.04 ? 35   MSE A CE  1 
ATOM   126   N  N   . ASN A  1 26  ? 98.427  -87.383  -133.229 1.00 77.48  ? 36   ASN A N   1 
ATOM   127   C  CA  . ASN A  1 26  ? 99.691  -87.531  -132.525 1.00 75.41  ? 36   ASN A CA  1 
ATOM   128   C  C   . ASN A  1 26  ? 99.486  -87.146  -131.066 1.00 74.07  ? 36   ASN A C   1 
ATOM   129   O  O   . ASN A  1 26  ? 99.816  -87.906  -130.157 1.00 73.38  ? 36   ASN A O   1 
ATOM   130   C  CB  . ASN A  1 26  ? 100.765 -86.639  -133.148 1.00 73.60  ? 36   ASN A CB  1 
ATOM   131   C  CG  . ASN A  1 26  ? 101.394 -87.259  -134.377 1.00 72.08  ? 36   ASN A CG  1 
ATOM   132   O  OD1 . ASN A  1 26  ? 102.198 -86.625  -135.049 1.00 71.77  ? 36   ASN A OD1 1 
ATOM   133   N  ND2 . ASN A  1 26  ? 101.036 -88.506  -134.673 1.00 69.87  ? 36   ASN A ND2 1 
ATOM   134   N  N   . GLU A  1 27  ? 98.918  -85.963  -130.855 1.00 72.46  ? 37   GLU A N   1 
ATOM   135   C  CA  . GLU A  1 27  ? 98.659  -85.454  -129.516 1.00 70.62  ? 37   GLU A CA  1 
ATOM   136   C  C   . GLU A  1 27  ? 97.652  -86.325  -128.769 1.00 70.25  ? 37   GLU A C   1 
ATOM   137   O  O   . GLU A  1 27  ? 97.426  -86.130  -127.583 1.00 70.74  ? 37   GLU A O   1 
ATOM   138   C  CB  . GLU A  1 27  ? 98.126  -84.024  -129.606 1.00 69.73  ? 37   GLU A CB  1 
ATOM   139   C  CG  . GLU A  1 27  ? 98.213  -83.227  -128.320 1.00 69.81  ? 37   GLU A CG  1 
ATOM   140   C  CD  . GLU A  1 27  ? 99.346  -82.214  -128.333 1.00 69.88  ? 37   GLU A CD  1 
ATOM   141   O  OE1 . GLU A  1 27  ? 99.294  -81.266  -129.144 1.00 68.81  ? 37   GLU A OE1 1 
ATOM   142   O  OE2 . GLU A  1 27  ? 100.291 -82.366  -127.532 1.00 70.21  ? 37   GLU A OE2 1 
ATOM   143   N  N   . LYS A  1 28  ? 97.055  -87.291  -129.454 1.00 70.61  ? 38   LYS A N   1 
ATOM   144   C  CA  . LYS A  1 28  ? 96.064  -88.148  -128.823 1.00 71.26  ? 38   LYS A CA  1 
ATOM   145   C  C   . LYS A  1 28  ? 96.570  -89.541  -128.473 1.00 72.23  ? 38   LYS A C   1 
ATOM   146   O  O   . LYS A  1 28  ? 95.871  -90.311  -127.817 1.00 73.76  ? 38   LYS A O   1 
ATOM   147   C  CB  . LYS A  1 28  ? 94.823  -88.259  -129.716 1.00 70.50  ? 38   LYS A CB  1 
ATOM   148   C  CG  . LYS A  1 28  ? 93.695  -89.095  -129.116 1.00 70.14  ? 38   LYS A CG  1 
ATOM   149   C  CD  . LYS A  1 28  ? 92.424  -89.018  -129.940 1.00 69.17  ? 38   LYS A CD  1 
ATOM   150   C  CE  . LYS A  1 28  ? 91.813  -87.619  -129.920 1.00 69.14  ? 38   LYS A CE  1 
ATOM   151   N  NZ  . LYS A  1 28  ? 91.330  -87.208  -128.574 1.00 68.18  ? 38   LYS A NZ  1 
ATOM   152   N  N   . PHE A  1 29  ? 97.774  -89.881  -128.915 1.00 73.09  ? 39   PHE A N   1 
ATOM   153   C  CA  . PHE A  1 29  ? 98.333  -91.198  -128.604 1.00 73.67  ? 39   PHE A CA  1 
ATOM   154   C  C   . PHE A  1 29  ? 99.610  -91.045  -127.783 1.00 72.44  ? 39   PHE A C   1 
ATOM   155   O  O   . PHE A  1 29  ? 100.097 -91.999  -127.177 1.00 71.25  ? 39   PHE A O   1 
ATOM   156   C  CB  . PHE A  1 29  ? 98.621  -91.987  -129.890 1.00 76.09  ? 39   PHE A CB  1 
ATOM   157   C  CG  . PHE A  1 29  ? 97.409  -92.662  -130.478 1.00 77.80  ? 39   PHE A CG  1 
ATOM   158   C  CD1 . PHE A  1 29  ? 96.342  -91.915  -130.966 1.00 78.39  ? 39   PHE A CD1 1 
ATOM   159   C  CD2 . PHE A  1 29  ? 97.328  -94.052  -130.527 1.00 79.02  ? 39   PHE A CD2 1 
ATOM   160   C  CE1 . PHE A  1 29  ? 95.206  -92.545  -131.493 1.00 79.77  ? 39   PHE A CE1 1 
ATOM   161   C  CE2 . PHE A  1 29  ? 96.194  -94.691  -131.052 1.00 79.52  ? 39   PHE A CE2 1 
ATOM   162   C  CZ  . PHE A  1 29  ? 95.133  -93.937  -131.535 1.00 78.79  ? 39   PHE A CZ  1 
ATOM   163   N  N   . ALA A  1 30  ? 100.136 -89.826  -127.765 1.00 71.34  ? 40   ALA A N   1 
ATOM   164   C  CA  . ALA A  1 30  ? 101.341 -89.511  -127.019 1.00 70.04  ? 40   ALA A CA  1 
ATOM   165   C  C   . ALA A  1 30  ? 100.954 -89.085  -125.610 1.00 70.07  ? 40   ALA A C   1 
ATOM   166   O  O   . ALA A  1 30  ? 100.232 -88.108  -125.425 1.00 68.19  ? 40   ALA A O   1 
ATOM   167   C  CB  . ALA A  1 30  ? 102.098 -88.396  -127.711 1.00 70.03  ? 40   ALA A CB  1 
ATOM   168   N  N   . PRO A  1 31  ? 101.428 -89.821  -124.592 1.00 71.16  ? 41   PRO A N   1 
ATOM   169   C  CA  . PRO A  1 31  ? 101.127 -89.513  -123.192 1.00 71.25  ? 41   PRO A CA  1 
ATOM   170   C  C   . PRO A  1 31  ? 101.697 -88.204  -122.625 1.00 71.69  ? 41   PRO A C   1 
ATOM   171   O  O   . PRO A  1 31  ? 101.649 -87.981  -121.420 1.00 71.95  ? 41   PRO A O   1 
ATOM   172   C  CB  . PRO A  1 31  ? 101.637 -90.750  -122.452 1.00 70.31  ? 41   PRO A CB  1 
ATOM   173   C  CG  . PRO A  1 31  ? 102.732 -91.241  -123.315 1.00 69.88  ? 41   PRO A CG  1 
ATOM   174   C  CD  . PRO A  1 31  ? 102.154 -91.100  -124.692 1.00 71.06  ? 41   PRO A CD  1 
ATOM   175   N  N   . GLU A  1 32  ? 102.215 -87.329  -123.479 1.00 72.52  ? 42   GLU A N   1 
ATOM   176   C  CA  . GLU A  1 32  ? 102.756 -86.065  -122.988 1.00 73.55  ? 42   GLU A CA  1 
ATOM   177   C  C   . GLU A  1 32  ? 102.497 -84.888  -123.921 1.00 73.41  ? 42   GLU A C   1 
ATOM   178   O  O   . GLU A  1 32  ? 102.497 -85.034  -125.136 1.00 73.45  ? 42   GLU A O   1 
ATOM   179   C  CB  . GLU A  1 32  ? 104.259 -86.197  -122.730 1.00 75.38  ? 42   GLU A CB  1 
ATOM   180   C  CG  . GLU A  1 32  ? 105.121 -86.219  -123.983 1.00 77.31  ? 42   GLU A CG  1 
ATOM   181   C  CD  . GLU A  1 32  ? 106.587 -86.477  -123.676 1.00 78.45  ? 42   GLU A CD  1 
ATOM   182   O  OE1 . GLU A  1 32  ? 107.159 -85.759  -122.823 1.00 79.10  ? 42   GLU A OE1 1 
ATOM   183   O  OE2 . GLU A  1 32  ? 107.166 -87.400  -124.292 1.00 78.72  ? 42   GLU A OE2 1 
ATOM   184   N  N   . LEU A  1 33  ? 102.283 -83.720  -123.326 1.00 73.56  ? 43   LEU A N   1 
ATOM   185   C  CA  . LEU A  1 33  ? 102.016 -82.485  -124.050 1.00 74.46  ? 43   LEU A CA  1 
ATOM   186   C  C   . LEU A  1 33  ? 103.007 -82.209  -125.177 1.00 76.44  ? 43   LEU A C   1 
ATOM   187   O  O   . LEU A  1 33  ? 103.935 -81.413  -125.014 1.00 77.20  ? 43   LEU A O   1 
ATOM   188   C  CB  . LEU A  1 33  ? 102.038 -81.310  -123.080 1.00 73.25  ? 43   LEU A CB  1 
ATOM   189   C  CG  . LEU A  1 33  ? 101.655 -79.962  -123.682 1.00 73.65  ? 43   LEU A CG  1 
ATOM   190   C  CD1 . LEU A  1 33  ? 100.201 -80.020  -124.125 1.00 73.63  ? 43   LEU A CD1 1 
ATOM   191   C  CD2 . LEU A  1 33  ? 101.863 -78.848  -122.662 1.00 73.58  ? 43   LEU A CD2 1 
ATOM   192   N  N   . LEU A  1 34  ? 102.789 -82.854  -126.321 1.00 77.69  ? 44   LEU A N   1 
ATOM   193   C  CA  . LEU A  1 34  ? 103.643 -82.705  -127.494 1.00 78.39  ? 44   LEU A CA  1 
ATOM   194   C  C   . LEU A  1 34  ? 103.960 -81.268  -127.855 1.00 79.86  ? 44   LEU A C   1 
ATOM   195   O  O   . LEU A  1 34  ? 103.416 -80.331  -127.268 1.00 79.39  ? 44   LEU A O   1 
ATOM   196   C  CB  . LEU A  1 34  ? 103.000 -83.396  -128.690 1.00 78.62  ? 44   LEU A CB  1 
ATOM   197   C  CG  . LEU A  1 34  ? 103.424 -84.845  -128.942 1.00 79.82  ? 44   LEU A CG  1 
ATOM   198   C  CD1 . LEU A  1 34  ? 103.624 -85.580  -127.629 1.00 80.20  ? 44   LEU A CD1 1 
ATOM   199   C  CD2 . LEU A  1 34  ? 102.372 -85.537  -129.793 1.00 79.45  ? 44   LEU A CD2 1 
ATOM   200   N  N   . GLU A  1 35  ? 104.848 -81.108  -128.834 1.00 81.83  ? 45   GLU A N   1 
ATOM   201   C  CA  . GLU A  1 35  ? 105.286 -79.792  -129.296 1.00 83.35  ? 45   GLU A CA  1 
ATOM   202   C  C   . GLU A  1 35  ? 104.133 -78.957  -129.842 1.00 82.92  ? 45   GLU A C   1 
ATOM   203   O  O   . GLU A  1 35  ? 103.256 -79.468  -130.540 1.00 82.80  ? 45   GLU A O   1 
ATOM   204   C  CB  . GLU A  1 35  ? 106.338 -79.942  -130.391 1.00 85.54  ? 45   GLU A CB  1 
ATOM   205   C  CG  . GLU A  1 35  ? 107.385 -81.004  -130.124 1.00 88.90  ? 45   GLU A CG  1 
ATOM   206   C  CD  . GLU A  1 35  ? 108.322 -81.189  -131.307 1.00 91.33  ? 45   GLU A CD  1 
ATOM   207   O  OE1 . GLU A  1 35  ? 107.818 -81.459  -132.424 1.00 92.29  ? 45   GLU A OE1 1 
ATOM   208   O  OE2 . GLU A  1 35  ? 109.556 -81.065  -131.125 1.00 91.60  ? 45   GLU A OE2 1 
ATOM   209   N  N   . SER A  1 36  ? 104.142 -77.667  -129.528 1.00 82.24  ? 46   SER A N   1 
ATOM   210   C  CA  . SER A  1 36  ? 103.099 -76.771  -130.003 1.00 82.18  ? 46   SER A CA  1 
ATOM   211   C  C   . SER A  1 36  ? 103.265 -76.553  -131.502 1.00 82.80  ? 46   SER A C   1 
ATOM   212   O  O   . SER A  1 36  ? 104.360 -76.257  -131.977 1.00 83.29  ? 46   SER A O   1 
ATOM   213   C  CB  . SER A  1 36  ? 103.182 -75.424  -129.279 1.00 81.87  ? 46   SER A CB  1 
ATOM   214   O  OG  . SER A  1 36  ? 102.168 -74.536  -129.715 1.00 81.92  ? 46   SER A OG  1 
ATOM   215   N  N   . LYS A  1 37  ? 102.173 -76.710  -132.245 1.00 82.80  ? 47   LYS A N   1 
ATOM   216   C  CA  . LYS A  1 37  ? 102.184 -76.510  -133.689 1.00 81.89  ? 47   LYS A CA  1 
ATOM   217   C  C   . LYS A  1 37  ? 101.277 -75.314  -133.971 1.00 82.55  ? 47   LYS A C   1 
ATOM   218   O  O   . LYS A  1 37  ? 100.297 -75.431  -134.705 1.00 82.23  ? 47   LYS A O   1 
ATOM   219   C  CB  . LYS A  1 37  ? 101.630 -77.746  -134.399 1.00 80.74  ? 47   LYS A CB  1 
ATOM   220   C  CG  . LYS A  1 37  ? 102.285 -79.061  -134.009 1.00 79.21  ? 47   LYS A CG  1 
ATOM   221   C  CD  . LYS A  1 37  ? 103.755 -79.108  -134.401 1.00 79.29  ? 47   LYS A CD  1 
ATOM   222   C  CE  . LYS A  1 37  ? 104.340 -80.501  -134.179 1.00 78.86  ? 47   LYS A CE  1 
ATOM   223   N  NZ  . LYS A  1 37  ? 105.804 -80.563  -134.458 1.00 78.58  ? 47   LYS A NZ  1 
ATOM   224   N  N   . PRO A  1 38  ? 101.597 -74.142  -133.390 1.00 83.41  ? 48   PRO A N   1 
ATOM   225   C  CA  . PRO A  1 38  ? 100.822 -72.906  -133.553 1.00 84.51  ? 48   PRO A CA  1 
ATOM   226   C  C   . PRO A  1 38  ? 100.577 -72.462  -134.983 1.00 85.38  ? 48   PRO A C   1 
ATOM   227   O  O   . PRO A  1 38  ? 99.904  -71.463  -135.212 1.00 84.81  ? 48   PRO A O   1 
ATOM   228   C  CB  . PRO A  1 38  ? 101.637 -71.878  -132.769 1.00 84.47  ? 48   PRO A CB  1 
ATOM   229   C  CG  . PRO A  1 38  ? 103.021 -72.361  -132.947 1.00 84.02  ? 48   PRO A CG  1 
ATOM   230   C  CD  . PRO A  1 38  ? 102.870 -73.847  -132.711 1.00 83.66  ? 48   PRO A CD  1 
ATOM   231   N  N   . GLU A  1 39  ? 101.125 -73.199  -135.940 1.00 86.91  ? 49   GLU A N   1 
ATOM   232   C  CA  . GLU A  1 39  ? 100.936 -72.866  -137.343 1.00 88.16  ? 49   GLU A CA  1 
ATOM   233   C  C   . GLU A  1 39  ? 99.680  -73.563  -137.831 1.00 88.56  ? 49   GLU A C   1 
ATOM   234   O  O   . GLU A  1 39  ? 98.662  -72.917  -138.102 1.00 88.24  ? 49   GLU A O   1 
ATOM   235   C  CB  . GLU A  1 39  ? 102.147 -73.318  -138.157 1.00 89.26  ? 49   GLU A CB  1 
ATOM   236   C  CG  . GLU A  1 39  ? 103.450 -72.727  -137.651 1.00 91.93  ? 49   GLU A CG  1 
ATOM   237   C  CD  . GLU A  1 39  ? 103.264 -71.315  -137.109 1.00 93.72  ? 49   GLU A CD  1 
ATOM   238   O  OE1 . GLU A  1 39  ? 102.697 -70.466  -137.834 1.00 94.43  ? 49   GLU A OE1 1 
ATOM   239   O  OE2 . GLU A  1 39  ? 103.684 -71.053  -135.959 1.00 93.68  ? 49   GLU A OE2 1 
ATOM   240   N  N   . ILE A  1 40  ? 99.764  -74.887  -137.920 1.00 88.12  ? 50   ILE A N   1 
ATOM   241   C  CA  . ILE A  1 40  ? 98.652  -75.719  -138.357 1.00 87.44  ? 50   ILE A CA  1 
ATOM   242   C  C   . ILE A  1 40  ? 97.370  -75.202  -137.720 1.00 88.16  ? 50   ILE A C   1 
ATOM   243   O  O   . ILE A  1 40  ? 96.299  -75.227  -138.321 1.00 88.34  ? 50   ILE A O   1 
ATOM   244   C  CB  . ILE A  1 40  ? 98.864  -77.184  -137.919 1.00 87.17  ? 50   ILE A CB  1 
ATOM   245   C  CG1 . ILE A  1 40  ? 100.199 -77.700  -138.463 1.00 86.45  ? 50   ILE A CG1 1 
ATOM   246   C  CG2 . ILE A  1 40  ? 97.713  -78.051  -138.411 1.00 86.67  ? 50   ILE A CG2 1 
ATOM   247   C  CD1 . ILE A  1 40  ? 100.560 -79.094  -137.988 1.00 84.90  ? 50   ILE A CD1 1 
ATOM   248   N  N   . VAL A  1 41  ? 97.504  -74.713  -136.496 1.00 88.46  ? 51   VAL A N   1 
ATOM   249   C  CA  . VAL A  1 41  ? 96.374  -74.204  -135.744 1.00 90.40  ? 51   VAL A CA  1 
ATOM   250   C  C   . VAL A  1 41  ? 95.851  -72.852  -136.215 1.00 90.94  ? 51   VAL A C   1 
ATOM   251   O  O   . VAL A  1 41  ? 94.676  -72.728  -136.558 1.00 91.90  ? 51   VAL A O   1 
ATOM   252   C  CB  . VAL A  1 41  ? 96.735  -74.125  -134.248 1.00 89.73  ? 51   VAL A CB  1 
ATOM   253   C  CG1 . VAL A  1 41  ? 95.619  -73.447  -133.463 1.00 89.88  ? 51   VAL A CG1 1 
ATOM   254   C  CG2 . VAL A  1 41  ? 96.992  -75.539  -133.715 1.00 91.38  ? 51   VAL A CG2 1 
ATOM   255   N  N   . GLU A  1 42  ? 96.706  -71.837  -136.230 1.00 92.00  ? 52   GLU A N   1 
ATOM   256   C  CA  . GLU A  1 42  ? 96.254  -70.518  -136.652 1.00 93.12  ? 52   GLU A CA  1 
ATOM   257   C  C   . GLU A  1 42  ? 95.858  -70.493  -138.119 1.00 93.31  ? 52   GLU A C   1 
ATOM   258   O  O   . GLU A  1 42  ? 95.043  -69.669  -138.526 1.00 93.54  ? 52   GLU A O   1 
ATOM   259   C  CB  . GLU A  1 42  ? 97.329  -69.466  -136.365 1.00 94.61  ? 52   GLU A CB  1 
ATOM   260   C  CG  . GLU A  1 42  ? 98.697  -69.799  -136.920 1.00 96.44  ? 52   GLU A CG  1 
ATOM   261   C  CD  . GLU A  1 42  ? 99.789  -68.935  -136.311 1.00 96.94  ? 52   GLU A CD  1 
ATOM   262   O  OE1 . GLU A  1 42  ? 99.884  -68.883  -135.063 1.00 96.86  ? 52   GLU A OE1 1 
ATOM   263   O  OE2 . GLU A  1 42  ? 100.554 -68.313  -137.077 1.00 96.84  ? 52   GLU A OE2 1 
ATOM   264   N  N   . CYS A  1 43  ? 96.430  -71.397  -138.910 1.00 92.80  ? 53   CYS A N   1 
ATOM   265   C  CA  . CYS A  1 43  ? 96.103  -71.471  -140.330 1.00 92.05  ? 53   CYS A CA  1 
ATOM   266   C  C   . CYS A  1 43  ? 94.704  -72.037  -140.551 1.00 91.54  ? 53   CYS A C   1 
ATOM   267   O  O   . CYS A  1 43  ? 93.862  -71.387  -141.168 1.00 91.16  ? 53   CYS A O   1 
ATOM   268   C  CB  . CYS A  1 43  ? 97.130  -72.321  -141.083 1.00 92.73  ? 53   CYS A CB  1 
ATOM   269   S  SG  . CYS A  1 43  ? 98.582  -71.388  -141.628 1.00 93.55  ? 53   CYS A SG  1 
ATOM   270   N  N   . VAL A  1 44  ? 94.452  -73.244  -140.053 1.00 90.78  ? 54   VAL A N   1 
ATOM   271   C  CA  . VAL A  1 44  ? 93.134  -73.841  -140.205 1.00 90.41  ? 54   VAL A CA  1 
ATOM   272   C  C   . VAL A  1 44  ? 92.108  -72.879  -139.633 1.00 90.53  ? 54   VAL A C   1 
ATOM   273   O  O   . VAL A  1 44  ? 90.976  -72.823  -140.095 1.00 90.75  ? 54   VAL A O   1 
ATOM   274   C  CB  . VAL A  1 44  ? 93.018  -75.178  -139.459 1.00 89.93  ? 54   VAL A CB  1 
ATOM   275   C  CG1 . VAL A  1 44  ? 93.958  -76.194  -140.062 1.00 90.58  ? 54   VAL A CG1 1 
ATOM   276   C  CG2 . VAL A  1 44  ? 93.326  -74.979  -137.994 1.00 90.92  ? 54   VAL A CG2 1 
HETATM 277   N  N   . MSE A  1 45  ? 92.513  -72.124  -138.620 1.00 91.47  ? 55   MSE A N   1 
HETATM 278   C  CA  . MSE A  1 45  ? 91.630  -71.146  -138.000 1.00 93.25  ? 55   MSE A CA  1 
HETATM 279   C  C   . MSE A  1 45  ? 91.296  -70.084  -139.040 1.00 93.70  ? 55   MSE A C   1 
HETATM 280   O  O   . MSE A  1 45  ? 90.162  -69.601  -139.132 1.00 92.94  ? 55   MSE A O   1 
HETATM 281   C  CB  . MSE A  1 45  ? 92.325  -70.488  -136.803 1.00 95.34  ? 55   MSE A CB  1 
HETATM 282   C  CG  . MSE A  1 45  ? 92.141  -71.209  -135.476 1.00 97.43  ? 55   MSE A CG  1 
HETATM 283   SE SE  . MSE A  1 45  ? 90.289  -71.207  -134.905 1.00 101.79 ? 55   MSE A SE  1 
HETATM 284   C  CE  . MSE A  1 45  ? 90.060  -69.312  -134.583 1.00 100.22 ? 55   MSE A CE  1 
ATOM   285   N  N   . GLU A  1 46  ? 92.307  -69.741  -139.829 1.00 94.24  ? 56   GLU A N   1 
ATOM   286   C  CA  . GLU A  1 46  ? 92.186  -68.740  -140.879 1.00 94.72  ? 56   GLU A CA  1 
ATOM   287   C  C   . GLU A  1 46  ? 91.389  -69.279  -142.071 1.00 94.97  ? 56   GLU A C   1 
ATOM   288   O  O   . GLU A  1 46  ? 90.487  -68.614  -142.579 1.00 94.74  ? 56   GLU A O   1 
ATOM   289   C  CB  . GLU A  1 46  ? 93.586  -68.319  -141.328 1.00 94.45  ? 56   GLU A CB  1 
ATOM   290   C  CG  . GLU A  1 46  ? 93.627  -67.126  -142.252 1.00 94.75  ? 56   GLU A CG  1 
ATOM   291   C  CD  . GLU A  1 46  ? 95.036  -66.815  -142.716 1.00 95.23  ? 56   GLU A CD  1 
ATOM   292   O  OE1 . GLU A  1 46  ? 95.674  -67.709  -143.315 1.00 95.34  ? 56   GLU A OE1 1 
ATOM   293   O  OE2 . GLU A  1 46  ? 95.504  -65.679  -142.485 1.00 94.58  ? 56   GLU A OE2 1 
ATOM   294   N  N   . GLN A  1 47  ? 91.723  -70.488  -142.513 1.00 95.33  ? 57   GLN A N   1 
ATOM   295   C  CA  . GLN A  1 47  ? 91.035  -71.094  -143.643 1.00 95.57  ? 57   GLN A CA  1 
ATOM   296   C  C   . GLN A  1 47  ? 89.540  -71.200  -143.360 1.00 96.29  ? 57   GLN A C   1 
ATOM   297   O  O   . GLN A  1 47  ? 88.715  -70.908  -144.224 1.00 96.66  ? 57   GLN A O   1 
ATOM   298   C  CB  . GLN A  1 47  ? 91.601  -72.484  -143.930 1.00 95.70  ? 57   GLN A CB  1 
ATOM   299   C  CG  . GLN A  1 47  ? 91.289  -72.988  -145.328 1.00 96.31  ? 57   GLN A CG  1 
ATOM   300   C  CD  . GLN A  1 47  ? 92.056  -72.230  -146.396 1.00 96.85  ? 57   GLN A CD  1 
ATOM   301   O  OE1 . GLN A  1 47  ? 91.972  -71.004  -146.491 1.00 97.13  ? 57   GLN A OE1 1 
ATOM   302   N  NE2 . GLN A  1 47  ? 92.809  -72.959  -147.207 1.00 96.32  ? 57   GLN A NE2 1 
ATOM   303   N  N   . LEU A  1 48  ? 89.193  -71.619  -142.147 1.00 96.91  ? 58   LEU A N   1 
ATOM   304   C  CA  . LEU A  1 48  ? 87.793  -71.747  -141.772 1.00 97.59  ? 58   LEU A CA  1 
ATOM   305   C  C   . LEU A  1 48  ? 87.092  -70.400  -141.852 1.00 98.93  ? 58   LEU A C   1 
ATOM   306   O  O   . LEU A  1 48  ? 86.158  -70.242  -142.631 1.00 99.38  ? 58   LEU A O   1 
ATOM   307   C  CB  . LEU A  1 48  ? 87.655  -72.326  -140.363 1.00 96.51  ? 58   LEU A CB  1 
ATOM   308   C  CG  . LEU A  1 48  ? 87.836  -73.842  -140.238 1.00 96.17  ? 58   LEU A CG  1 
ATOM   309   C  CD1 . LEU A  1 48  ? 87.678  -74.269  -138.785 1.00 95.58  ? 58   LEU A CD1 1 
ATOM   310   C  CD2 . LEU A  1 48  ? 86.809  -74.547  -141.109 1.00 95.69  ? 58   LEU A CD2 1 
ATOM   311   N  N   . GLU A  1 49  ? 87.536  -69.426  -141.062 1.00 101.21 ? 59   GLU A N   1 
ATOM   312   C  CA  . GLU A  1 49  ? 86.914  -68.104  -141.087 1.00 103.90 ? 59   GLU A CA  1 
ATOM   313   C  C   . GLU A  1 49  ? 86.721  -67.641  -142.528 1.00 104.97 ? 59   GLU A C   1 
ATOM   314   O  O   . GLU A  1 49  ? 85.709  -67.023  -142.868 1.00 104.95 ? 59   GLU A O   1 
ATOM   315   C  CB  . GLU A  1 49  ? 87.775  -67.090  -140.332 1.00 105.28 ? 59   GLU A CB  1 
ATOM   316   C  CG  . GLU A  1 49  ? 89.204  -66.995  -140.827 1.00 107.89 ? 59   GLU A CG  1 
ATOM   317   C  CD  . GLU A  1 49  ? 89.951  -65.784  -140.290 1.00 109.60 ? 59   GLU A CD  1 
ATOM   318   O  OE1 . GLU A  1 49  ? 91.157  -65.651  -140.598 1.00 110.72 ? 59   GLU A OE1 1 
ATOM   319   O  OE2 . GLU A  1 49  ? 89.339  -64.959  -139.572 1.00 109.63 ? 59   GLU A OE2 1 
ATOM   320   N  N   . HIS A  1 50  ? 87.703  -67.950  -143.369 1.00 106.39 ? 60   HIS A N   1 
ATOM   321   C  CA  . HIS A  1 50  ? 87.666  -67.595  -144.786 1.00 107.51 ? 60   HIS A CA  1 
ATOM   322   C  C   . HIS A  1 50  ? 86.363  -68.117  -145.381 1.00 108.67 ? 60   HIS A C   1 
ATOM   323   O  O   . HIS A  1 50  ? 85.635  -67.387  -146.052 1.00 109.01 ? 60   HIS A O   1 
ATOM   324   C  CB  . HIS A  1 50  ? 88.875  -68.218  -145.500 1.00 106.99 ? 60   HIS A CB  1 
ATOM   325   C  CG  . HIS A  1 50  ? 88.909  -67.986  -146.979 1.00 107.15 ? 60   HIS A CG  1 
ATOM   326   N  ND1 . HIS A  1 50  ? 88.013  -68.573  -147.848 1.00 107.82 ? 60   HIS A ND1 1 
ATOM   327   C  CD2 . HIS A  1 50  ? 89.744  -67.245  -147.744 1.00 106.91 ? 60   HIS A CD2 1 
ATOM   328   C  CE1 . HIS A  1 50  ? 88.296  -68.204  -149.085 1.00 107.10 ? 60   HIS A CE1 1 
ATOM   329   N  NE2 . HIS A  1 50  ? 89.343  -67.398  -149.049 1.00 106.68 ? 60   HIS A NE2 1 
HETATM 330   N  N   . MSE A  1 51  ? 86.069  -69.383  -145.116 1.00 110.34 ? 61   MSE A N   1 
HETATM 331   C  CA  . MSE A  1 51  ? 84.854  -70.008  -145.620 1.00 112.30 ? 61   MSE A CA  1 
HETATM 332   C  C   . MSE A  1 51  ? 83.583  -69.372  -145.066 1.00 112.59 ? 61   MSE A C   1 
HETATM 333   O  O   . MSE A  1 51  ? 82.714  -68.950  -145.829 1.00 112.66 ? 61   MSE A O   1 
HETATM 334   C  CB  . MSE A  1 51  ? 84.858  -71.503  -145.290 1.00 113.94 ? 61   MSE A CB  1 
HETATM 335   C  CG  . MSE A  1 51  ? 85.238  -72.412  -146.452 1.00 116.34 ? 61   MSE A CG  1 
HETATM 336   SE SE  . MSE A  1 51  ? 83.919  -72.392  -147.875 1.00 118.92 ? 61   MSE A SE  1 
HETATM 337   C  CE  . MSE A  1 51  ? 84.601  -70.898  -148.904 1.00 117.72 ? 61   MSE A CE  1 
ATOM   338   N  N   . GLU A  1 52  ? 83.475  -69.313  -143.742 1.00 113.03 ? 62   GLU A N   1 
ATOM   339   C  CA  . GLU A  1 52  ? 82.301  -68.739  -143.095 1.00 113.31 ? 62   GLU A CA  1 
ATOM   340   C  C   . GLU A  1 52  ? 81.906  -67.434  -143.765 1.00 113.14 ? 62   GLU A C   1 
ATOM   341   O  O   . GLU A  1 52  ? 80.746  -67.026  -143.718 1.00 113.07 ? 62   GLU A O   1 
ATOM   342   C  CB  . GLU A  1 52  ? 82.571  -68.510  -141.605 1.00 114.11 ? 62   GLU A CB  1 
ATOM   343   C  CG  . GLU A  1 52  ? 81.404  -67.901  -140.840 1.00 115.41 ? 62   GLU A CG  1 
ATOM   344   C  CD  . GLU A  1 52  ? 81.606  -67.952  -139.341 1.00 116.14 ? 62   GLU A CD  1 
ATOM   345   O  OE1 . GLU A  1 52  ? 81.579  -69.065  -138.767 1.00 115.87 ? 62   GLU A OE1 1 
ATOM   346   O  OE2 . GLU A  1 52  ? 81.803  -66.877  -138.729 1.00 116.63 ? 62   GLU A OE2 1 
ATOM   347   N  N   . GLU A  1 53  ? 82.879  -66.786  -144.397 1.00 112.98 ? 63   GLU A N   1 
ATOM   348   C  CA  . GLU A  1 53  ? 82.638  -65.533  -145.102 1.00 113.16 ? 63   GLU A CA  1 
ATOM   349   C  C   . GLU A  1 53  ? 81.939  -65.814  -146.431 1.00 113.25 ? 63   GLU A C   1 
ATOM   350   O  O   . GLU A  1 53  ? 80.754  -65.515  -146.596 1.00 113.49 ? 63   GLU A O   1 
ATOM   351   C  CB  . GLU A  1 53  ? 83.960  -64.810  -145.372 1.00 113.24 ? 63   GLU A CB  1 
ATOM   352   C  CG  . GLU A  1 53  ? 83.811  -63.526  -146.175 1.00 112.69 ? 63   GLU A CG  1 
ATOM   353   C  CD  . GLU A  1 53  ? 85.138  -63.013  -146.702 1.00 112.55 ? 63   GLU A CD  1 
ATOM   354   O  OE1 . GLU A  1 53  ? 85.794  -63.751  -147.466 1.00 111.89 ? 63   GLU A OE1 1 
ATOM   355   O  OE2 . GLU A  1 53  ? 85.519  -61.875  -146.354 1.00 112.79 ? 63   GLU A OE2 1 
ATOM   356   N  N   . ASN A  1 54  ? 82.684  -66.397  -147.369 1.00 112.92 ? 64   ASN A N   1 
ATOM   357   C  CA  . ASN A  1 54  ? 82.159  -66.727  -148.692 1.00 112.84 ? 64   ASN A CA  1 
ATOM   358   C  C   . ASN A  1 54  ? 80.831  -67.473  -148.599 1.00 113.21 ? 64   ASN A C   1 
ATOM   359   O  O   . ASN A  1 54  ? 80.049  -67.498  -149.550 1.00 113.25 ? 64   ASN A O   1 
ATOM   360   C  CB  . ASN A  1 54  ? 83.170  -67.580  -149.467 1.00 111.88 ? 64   ASN A CB  1 
ATOM   361   C  CG  . ASN A  1 54  ? 84.490  -66.867  -149.688 1.00 111.27 ? 64   ASN A CG  1 
ATOM   362   O  OD1 . ASN A  1 54  ? 85.346  -67.337  -150.437 1.00 110.49 ? 64   ASN A OD1 1 
ATOM   363   N  ND2 . ASN A  1 54  ? 84.663  -65.727  -149.032 1.00 111.39 ? 64   ASN A ND2 1 
ATOM   364   N  N   . LEU A  1 55  ? 80.584  -68.069  -147.437 1.00 113.45 ? 65   LEU A N   1 
ATOM   365   C  CA  . LEU A  1 55  ? 79.368  -68.833  -147.196 1.00 113.43 ? 65   LEU A CA  1 
ATOM   366   C  C   . LEU A  1 55  ? 78.164  -67.941  -146.907 1.00 113.03 ? 65   LEU A C   1 
ATOM   367   O  O   . LEU A  1 55  ? 77.042  -68.253  -147.302 1.00 113.00 ? 65   LEU A O   1 
ATOM   368   C  CB  . LEU A  1 55  ? 79.596  -69.799  -146.031 1.00 113.86 ? 65   LEU A CB  1 
ATOM   369   C  CG  . LEU A  1 55  ? 79.116  -71.240  -146.203 1.00 114.22 ? 65   LEU A CG  1 
ATOM   370   C  CD1 . LEU A  1 55  ? 79.607  -71.813  -147.529 1.00 113.83 ? 65   LEU A CD1 1 
ATOM   371   C  CD2 . LEU A  1 55  ? 79.631  -72.070  -145.036 1.00 114.67 ? 65   LEU A CD2 1 
ATOM   372   N  N   . ARG A  1 56  ? 78.398  -66.832  -146.215 1.00 112.62 ? 66   ARG A N   1 
ATOM   373   C  CA  . ARG A  1 56  ? 77.323  -65.906  -145.886 1.00 112.10 ? 66   ARG A CA  1 
ATOM   374   C  C   . ARG A  1 56  ? 77.844  -64.480  -145.775 1.00 111.95 ? 66   ARG A C   1 
ATOM   375   O  O   . ARG A  1 56  ? 78.308  -63.906  -146.761 1.00 111.62 ? 66   ARG A O   1 
ATOM   376   C  CB  . ARG A  1 56  ? 76.653  -66.322  -144.575 1.00 112.21 ? 66   ARG A CB  1 
ATOM   377   C  CG  . ARG A  1 56  ? 75.883  -67.631  -144.673 1.00 112.30 ? 66   ARG A CG  1 
ATOM   378   C  CD  . ARG A  1 56  ? 75.153  -67.953  -143.382 1.00 112.44 ? 66   ARG A CD  1 
ATOM   379   N  NE  . ARG A  1 56  ? 74.246  -69.087  -143.544 1.00 112.87 ? 66   ARG A NE  1 
ATOM   380   C  CZ  . ARG A  1 56  ? 73.450  -69.555  -142.587 1.00 113.44 ? 66   ARG A CZ  1 
ATOM   381   N  NH1 . ARG A  1 56  ? 73.446  -68.989  -141.388 1.00 113.13 ? 66   ARG A NH1 1 
ATOM   382   N  NH2 . ARG A  1 56  ? 72.650  -70.584  -142.834 1.00 113.15 ? 66   ARG A NH2 1 
ATOM   383   N  N   . GLU A  1 61  ? 72.960  -71.951  -154.787 1.00 89.61  ? 71   GLU A N   1 
ATOM   384   C  CA  . GLU A  1 61  ? 73.557  -71.738  -153.474 1.00 88.71  ? 71   GLU A CA  1 
ATOM   385   C  C   . GLU A  1 61  ? 73.220  -72.851  -152.483 1.00 87.39  ? 71   GLU A C   1 
ATOM   386   O  O   . GLU A  1 61  ? 74.048  -73.719  -152.213 1.00 88.13  ? 71   GLU A O   1 
ATOM   387   C  CB  . GLU A  1 61  ? 73.112  -70.383  -152.907 1.00 89.48  ? 71   GLU A CB  1 
ATOM   388   C  CG  . GLU A  1 61  ? 73.150  -70.288  -151.374 1.00 89.85  ? 71   GLU A CG  1 
ATOM   389   C  CD  . GLU A  1 61  ? 71.792  -69.856  -150.810 1.00 89.95  ? 71   GLU A CD  1 
ATOM   390   O  OE1 . GLU A  1 61  ? 71.482  -70.200  -149.621 1.00 88.45  ? 71   GLU A OE1 1 
ATOM   391   O  OE2 . GLU A  1 61  ? 71.031  -69.156  -151.572 1.00 91.27  ? 71   GLU A OE2 1 
ATOM   392   N  N   . ASP A  1 62  ? 72.002  -72.817  -151.954 1.00 85.60  ? 72   ASP A N   1 
ATOM   393   C  CA  . ASP A  1 62  ? 71.543  -73.793  -150.973 1.00 84.00  ? 72   ASP A CA  1 
ATOM   394   C  C   . ASP A  1 62  ? 72.399  -75.040  -150.754 1.00 83.10  ? 72   ASP A C   1 
ATOM   395   O  O   . ASP A  1 62  ? 73.273  -75.044  -149.889 1.00 83.60  ? 72   ASP A O   1 
ATOM   396   C  CB  . ASP A  1 62  ? 70.110  -74.194  -151.292 1.00 83.08  ? 72   ASP A CB  1 
ATOM   397   C  CG  . ASP A  1 62  ? 69.140  -73.689  -150.256 1.00 82.88  ? 72   ASP A CG  1 
ATOM   398   O  OD1 . ASP A  1 62  ? 68.781  -74.468  -149.349 1.00 83.13  ? 72   ASP A OD1 1 
ATOM   399   O  OD2 . ASP A  1 62  ? 68.755  -72.503  -150.335 1.00 82.34  ? 72   ASP A OD2 1 
ATOM   400   N  N   . LEU A  1 63  ? 72.152  -76.094  -151.528 1.00 81.89  ? 73   LEU A N   1 
ATOM   401   C  CA  . LEU A  1 63  ? 72.902  -77.345  -151.393 1.00 79.48  ? 73   LEU A CA  1 
ATOM   402   C  C   . LEU A  1 63  ? 74.409  -77.142  -151.331 1.00 78.56  ? 73   LEU A C   1 
ATOM   403   O  O   . LEU A  1 63  ? 75.091  -77.771  -150.527 1.00 78.13  ? 73   LEU A O   1 
ATOM   404   C  CB  . LEU A  1 63  ? 72.579  -78.288  -152.551 1.00 79.05  ? 73   LEU A CB  1 
ATOM   405   C  CG  . LEU A  1 63  ? 73.292  -79.642  -152.533 1.00 78.14  ? 73   LEU A CG  1 
ATOM   406   C  CD1 . LEU A  1 63  ? 72.861  -80.439  -151.310 1.00 77.32  ? 73   LEU A CD1 1 
ATOM   407   C  CD2 . LEU A  1 63  ? 72.968  -80.404  -153.806 1.00 77.20  ? 73   LEU A CD2 1 
ATOM   408   N  N   . LYS A  1 64  ? 74.924  -76.268  -152.188 1.00 77.96  ? 74   LYS A N   1 
ATOM   409   C  CA  . LYS A  1 64  ? 76.354  -75.987  -152.228 1.00 78.02  ? 74   LYS A CA  1 
ATOM   410   C  C   . LYS A  1 64  ? 76.839  -75.485  -150.866 1.00 77.55  ? 74   LYS A C   1 
ATOM   411   O  O   . LYS A  1 64  ? 77.765  -76.046  -150.276 1.00 77.36  ? 74   LYS A O   1 
ATOM   412   C  CB  . LYS A  1 64  ? 76.646  -74.944  -153.313 1.00 77.71  ? 74   LYS A CB  1 
ATOM   413   C  CG  . LYS A  1 64  ? 78.105  -74.840  -153.718 1.00 78.69  ? 74   LYS A CG  1 
ATOM   414   C  CD  . LYS A  1 64  ? 78.279  -73.917  -154.918 1.00 80.44  ? 74   LYS A CD  1 
ATOM   415   C  CE  . LYS A  1 64  ? 79.733  -73.839  -155.378 1.00 81.20  ? 74   LYS A CE  1 
ATOM   416   N  NZ  . LYS A  1 64  ? 80.279  -75.157  -155.814 1.00 82.40  ? 74   LYS A NZ  1 
ATOM   417   N  N   . VAL A  1 65  ? 76.207  -74.428  -150.369 1.00 76.80  ? 75   VAL A N   1 
ATOM   418   C  CA  . VAL A  1 65  ? 76.570  -73.868  -149.074 1.00 76.14  ? 75   VAL A CA  1 
ATOM   419   C  C   . VAL A  1 65  ? 76.572  -74.985  -148.040 1.00 75.30  ? 75   VAL A C   1 
ATOM   420   O  O   . VAL A  1 65  ? 77.594  -75.263  -147.414 1.00 75.77  ? 75   VAL A O   1 
ATOM   421   C  CB  . VAL A  1 65  ? 75.568  -72.771  -148.641 1.00 76.19  ? 75   VAL A CB  1 
ATOM   422   C  CG1 . VAL A  1 65  ? 75.792  -72.395  -147.189 1.00 75.49  ? 75   VAL A CG1 1 
ATOM   423   C  CG2 . VAL A  1 65  ? 75.734  -71.548  -149.524 1.00 76.13  ? 75   VAL A CG2 1 
ATOM   424   N  N   . SER A  1 66  ? 75.421  -75.626  -147.875 1.00 73.54  ? 76   SER A N   1 
ATOM   425   C  CA  . SER A  1 66  ? 75.270  -76.718  -146.929 1.00 72.15  ? 76   SER A CA  1 
ATOM   426   C  C   . SER A  1 66  ? 76.446  -77.688  -146.944 1.00 72.25  ? 76   SER A C   1 
ATOM   427   O  O   . SER A  1 66  ? 76.943  -78.087  -145.892 1.00 71.20  ? 76   SER A O   1 
ATOM   428   C  CB  . SER A  1 66  ? 73.990  -77.482  -147.230 1.00 71.80  ? 76   SER A CB  1 
ATOM   429   O  OG  . SER A  1 66  ? 74.063  -78.784  -146.690 1.00 74.06  ? 76   SER A OG  1 
ATOM   430   N  N   . ILE A  1 67  ? 76.891  -78.070  -148.136 1.00 72.28  ? 77   ILE A N   1 
ATOM   431   C  CA  . ILE A  1 67  ? 78.007  -79.000  -148.250 1.00 72.81  ? 77   ILE A CA  1 
ATOM   432   C  C   . ILE A  1 67  ? 79.276  -78.418  -147.645 1.00 73.31  ? 77   ILE A C   1 
ATOM   433   O  O   . ILE A  1 67  ? 80.083  -79.145  -147.070 1.00 73.63  ? 77   ILE A O   1 
ATOM   434   C  CB  . ILE A  1 67  ? 78.283  -79.381  -149.723 1.00 72.98  ? 77   ILE A CB  1 
ATOM   435   C  CG1 . ILE A  1 67  ? 77.072  -80.115  -150.307 1.00 72.50  ? 77   ILE A CG1 1 
ATOM   436   C  CG2 . ILE A  1 67  ? 79.530  -80.256  -149.816 1.00 71.89  ? 77   ILE A CG2 1 
ATOM   437   C  CD1 . ILE A  1 67  ? 76.705  -81.386  -149.578 1.00 71.79  ? 77   ILE A CD1 1 
ATOM   438   N  N   . HIS A  1 68  ? 79.454  -77.109  -147.778 1.00 73.89  ? 78   HIS A N   1 
ATOM   439   C  CA  . HIS A  1 68  ? 80.629  -76.449  -147.222 1.00 74.37  ? 78   HIS A CA  1 
ATOM   440   C  C   . HIS A  1 68  ? 80.553  -76.356  -145.697 1.00 75.64  ? 78   HIS A C   1 
ATOM   441   O  O   . HIS A  1 68  ? 81.572  -76.457  -145.014 1.00 76.58  ? 78   HIS A O   1 
ATOM   442   C  CB  . HIS A  1 68  ? 80.787  -75.053  -147.822 1.00 73.28  ? 78   HIS A CB  1 
ATOM   443   C  CG  . HIS A  1 68  ? 81.416  -75.049  -149.179 1.00 72.94  ? 78   HIS A CG  1 
ATOM   444   N  ND1 . HIS A  1 68  ? 82.725  -75.425  -149.393 1.00 72.56  ? 78   HIS A ND1 1 
ATOM   445   C  CD2 . HIS A  1 68  ? 80.922  -74.701  -150.391 1.00 72.50  ? 78   HIS A CD2 1 
ATOM   446   C  CE1 . HIS A  1 68  ? 83.011  -75.306  -150.678 1.00 71.86  ? 78   HIS A CE1 1 
ATOM   447   N  NE2 . HIS A  1 68  ? 81.934  -74.869  -151.305 1.00 71.62  ? 78   HIS A NE2 1 
ATOM   448   N  N   . GLN A  1 69  ? 79.352  -76.163  -145.157 1.00 76.36  ? 79   GLN A N   1 
ATOM   449   C  CA  . GLN A  1 69  ? 79.200  -76.076  -143.710 1.00 77.18  ? 79   GLN A CA  1 
ATOM   450   C  C   . GLN A  1 69  ? 79.524  -77.413  -143.080 1.00 77.63  ? 79   GLN A C   1 
ATOM   451   O  O   . GLN A  1 69  ? 80.152  -77.471  -142.027 1.00 78.30  ? 79   GLN A O   1 
ATOM   452   C  CB  . GLN A  1 69  ? 77.783  -75.665  -143.336 1.00 77.78  ? 79   GLN A CB  1 
ATOM   453   C  CG  . GLN A  1 69  ? 77.469  -74.236  -143.696 1.00 80.41  ? 79   GLN A CG  1 
ATOM   454   C  CD  . GLN A  1 69  ? 76.093  -73.812  -143.243 1.00 82.32  ? 79   GLN A CD  1 
ATOM   455   O  OE1 . GLN A  1 69  ? 75.081  -74.370  -143.678 1.00 82.50  ? 79   GLN A OE1 1 
ATOM   456   N  NE2 . GLN A  1 69  ? 76.043  -72.815  -142.363 1.00 83.69  ? 79   GLN A NE2 1 
HETATM 457   N  N   . MSE A  1 70  ? 79.093  -78.487  -143.733 1.00 77.62  ? 80   MSE A N   1 
HETATM 458   C  CA  . MSE A  1 70  ? 79.356  -79.828  -143.241 1.00 77.63  ? 80   MSE A CA  1 
HETATM 459   C  C   . MSE A  1 70  ? 80.850  -80.112  -143.204 1.00 77.31  ? 80   MSE A C   1 
HETATM 460   O  O   . MSE A  1 70  ? 81.348  -80.709  -142.252 1.00 77.62  ? 80   MSE A O   1 
HETATM 461   C  CB  . MSE A  1 70  ? 78.684  -80.865  -144.127 1.00 79.68  ? 80   MSE A CB  1 
HETATM 462   C  CG  . MSE A  1 70  ? 77.186  -80.870  -144.056 1.00 83.77  ? 80   MSE A CG  1 
HETATM 463   SE SE  . MSE A  1 70  ? 76.475  -82.398  -144.988 1.00 90.90  ? 80   MSE A SE  1 
HETATM 464   C  CE  . MSE A  1 70  ? 76.181  -83.550  -143.465 1.00 86.45  ? 80   MSE A CE  1 
ATOM   465   N  N   . GLU A  1 71  ? 81.569  -79.704  -144.244 1.00 76.36  ? 81   GLU A N   1 
ATOM   466   C  CA  . GLU A  1 71  ? 83.001  -79.941  -144.263 1.00 75.76  ? 81   GLU A CA  1 
ATOM   467   C  C   . GLU A  1 71  ? 83.644  -79.137  -143.157 1.00 77.06  ? 81   GLU A C   1 
ATOM   468   O  O   . GLU A  1 71  ? 84.714  -79.483  -142.672 1.00 77.28  ? 81   GLU A O   1 
ATOM   469   C  CB  . GLU A  1 71  ? 83.635  -79.531  -145.590 1.00 73.55  ? 81   GLU A CB  1 
ATOM   470   C  CG  . GLU A  1 71  ? 85.148  -79.689  -145.555 1.00 71.15  ? 81   GLU A CG  1 
ATOM   471   C  CD  . GLU A  1 71  ? 85.866  -78.875  -146.605 1.00 70.15  ? 81   GLU A CD  1 
ATOM   472   O  OE1 . GLU A  1 71  ? 85.501  -77.694  -146.806 1.00 69.67  ? 81   GLU A OE1 1 
ATOM   473   O  OE2 . GLU A  1 71  ? 86.811  -79.414  -147.213 1.00 68.60  ? 81   GLU A OE2 1 
HETATM 474   N  N   . MSE A  1 72  ? 82.996  -78.052  -142.761 1.00 78.69  ? 82   MSE A N   1 
HETATM 475   C  CA  . MSE A  1 72  ? 83.543  -77.218  -141.705 1.00 80.84  ? 82   MSE A CA  1 
HETATM 476   C  C   . MSE A  1 72  ? 83.320  -77.768  -140.309 1.00 78.84  ? 82   MSE A C   1 
HETATM 477   O  O   . MSE A  1 72  ? 84.186  -77.643  -139.447 1.00 78.78  ? 82   MSE A O   1 
HETATM 478   C  CB  . MSE A  1 72  ? 82.981  -75.816  -141.808 1.00 85.14  ? 82   MSE A CB  1 
HETATM 479   C  CG  . MSE A  1 72  ? 83.710  -75.009  -142.834 1.00 92.73  ? 82   MSE A CG  1 
HETATM 480   SE SE  . MSE A  1 72  ? 82.989  -73.261  -142.941 1.00 104.87 ? 82   MSE A SE  1 
HETATM 481   C  CE  . MSE A  1 72  ? 82.933  -72.840  -141.052 1.00 101.13 ? 82   MSE A CE  1 
ATOM   482   N  N   . GLU A  1 73  ? 82.159  -78.373  -140.087 1.00 76.31  ? 83   GLU A N   1 
ATOM   483   C  CA  . GLU A  1 73  ? 81.850  -78.956  -138.791 1.00 73.77  ? 83   GLU A CA  1 
ATOM   484   C  C   . GLU A  1 73  ? 82.854  -80.058  -138.486 1.00 71.29  ? 83   GLU A C   1 
ATOM   485   O  O   . GLU A  1 73  ? 83.029  -80.435  -137.331 1.00 71.81  ? 83   GLU A O   1 
ATOM   486   C  CB  . GLU A  1 73  ? 80.438  -79.539  -138.788 1.00 75.59  ? 83   GLU A CB  1 
ATOM   487   C  CG  . GLU A  1 73  ? 79.341  -78.507  -138.944 1.00 78.62  ? 83   GLU A CG  1 
ATOM   488   C  CD  . GLU A  1 73  ? 77.992  -79.140  -139.229 1.00 80.87  ? 83   GLU A CD  1 
ATOM   489   O  OE1 . GLU A  1 73  ? 77.591  -80.056  -138.475 1.00 82.12  ? 83   GLU A OE1 1 
ATOM   490   O  OE2 . GLU A  1 73  ? 77.333  -78.718  -140.207 1.00 81.27  ? 83   GLU A OE2 1 
ATOM   491   N  N   . ARG A  1 74  ? 83.504  -80.583  -139.523 1.00 67.80  ? 84   ARG A N   1 
ATOM   492   C  CA  . ARG A  1 74  ? 84.497  -81.634  -139.333 1.00 64.88  ? 84   ARG A CA  1 
ATOM   493   C  C   . ARG A  1 74  ? 85.840  -80.961  -139.109 1.00 63.96  ? 84   ARG A C   1 
ATOM   494   O  O   . ARG A  1 74  ? 86.613  -81.382  -138.251 1.00 63.59  ? 84   ARG A O   1 
ATOM   495   C  CB  . ARG A  1 74  ? 84.594  -82.540  -140.559 1.00 62.94  ? 84   ARG A CB  1 
ATOM   496   C  CG  . ARG A  1 74  ? 83.272  -82.927  -141.165 1.00 59.99  ? 84   ARG A CG  1 
ATOM   497   C  CD  . ARG A  1 74  ? 83.475  -83.945  -142.273 1.00 57.50  ? 84   ARG A CD  1 
ATOM   498   N  NE  . ARG A  1 74  ? 83.402  -85.319  -141.784 1.00 54.36  ? 84   ARG A NE  1 
ATOM   499   C  CZ  . ARG A  1 74  ? 84.356  -86.225  -141.960 1.00 53.47  ? 84   ARG A CZ  1 
ATOM   500   N  NH1 . ARG A  1 74  ? 85.469  -85.906  -142.612 1.00 52.59  ? 84   ARG A NH1 1 
ATOM   501   N  NH2 . ARG A  1 74  ? 84.190  -87.455  -141.497 1.00 52.11  ? 84   ARG A NH2 1 
ATOM   502   N  N   . ILE A  1 75  ? 86.112  -79.918  -139.894 1.00 63.24  ? 85   ILE A N   1 
ATOM   503   C  CA  . ILE A  1 75  ? 87.359  -79.169  -139.771 1.00 62.42  ? 85   ILE A CA  1 
ATOM   504   C  C   . ILE A  1 75  ? 87.416  -78.636  -138.347 1.00 62.76  ? 85   ILE A C   1 
ATOM   505   O  O   . ILE A  1 75  ? 88.461  -78.689  -137.695 1.00 62.68  ? 85   ILE A O   1 
ATOM   506   C  CB  . ILE A  1 75  ? 87.420  -77.978  -140.756 1.00 62.02  ? 85   ILE A CB  1 
ATOM   507   C  CG1 . ILE A  1 75  ? 87.368  -78.485  -142.199 1.00 62.90  ? 85   ILE A CG1 1 
ATOM   508   C  CG2 . ILE A  1 75  ? 88.697  -77.187  -140.539 1.00 61.21  ? 85   ILE A CG2 1 
ATOM   509   C  CD1 . ILE A  1 75  ? 88.457  -79.477  -142.548 1.00 63.07  ? 85   ILE A CD1 1 
ATOM   510   N  N   . ARG A  1 76  ? 86.281  -78.124  -137.872 1.00 62.15  ? 86   ARG A N   1 
ATOM   511   C  CA  . ARG A  1 76  ? 86.180  -77.609  -136.512 1.00 60.76  ? 86   ARG A CA  1 
ATOM   512   C  C   . ARG A  1 76  ? 86.386  -78.757  -135.535 1.00 58.70  ? 86   ARG A C   1 
ATOM   513   O  O   . ARG A  1 76  ? 87.290  -78.718  -134.702 1.00 58.38  ? 86   ARG A O   1 
ATOM   514   C  CB  . ARG A  1 76  ? 84.806  -76.986  -136.271 1.00 62.23  ? 86   ARG A CB  1 
ATOM   515   C  CG  . ARG A  1 76  ? 84.718  -75.520  -136.620 1.00 65.71  ? 86   ARG A CG  1 
ATOM   516   C  CD  . ARG A  1 76  ? 83.271  -75.032  -136.611 1.00 69.68  ? 86   ARG A CD  1 
ATOM   517   N  NE  . ARG A  1 76  ? 83.188  -73.572  -136.574 1.00 73.49  ? 86   ARG A NE  1 
ATOM   518   C  CZ  . ARG A  1 76  ? 83.754  -72.753  -137.460 1.00 73.77  ? 86   ARG A CZ  1 
ATOM   519   N  NH1 . ARG A  1 76  ? 84.453  -73.238  -138.480 1.00 72.95  ? 86   ARG A NH1 1 
ATOM   520   N  NH2 . ARG A  1 76  ? 83.644  -71.439  -137.306 1.00 74.64  ? 86   ARG A NH2 1 
ATOM   521   N  N   . TYR A  1 77  ? 85.555  -79.787  -135.653 1.00 55.95  ? 87   TYR A N   1 
ATOM   522   C  CA  . TYR A  1 77  ? 85.649  -80.935  -134.766 1.00 54.01  ? 87   TYR A CA  1 
ATOM   523   C  C   . TYR A  1 77  ? 87.077  -81.357  -134.424 1.00 53.58  ? 87   TYR A C   1 
ATOM   524   O  O   . TYR A  1 77  ? 87.396  -81.531  -133.249 1.00 54.50  ? 87   TYR A O   1 
ATOM   525   C  CB  . TYR A  1 77  ? 84.919  -82.147  -135.344 1.00 52.31  ? 87   TYR A CB  1 
ATOM   526   C  CG  . TYR A  1 77  ? 85.182  -83.390  -134.527 1.00 52.55  ? 87   TYR A CG  1 
ATOM   527   C  CD1 . TYR A  1 77  ? 84.613  -83.544  -133.261 1.00 53.03  ? 87   TYR A CD1 1 
ATOM   528   C  CD2 . TYR A  1 77  ? 86.085  -84.358  -134.963 1.00 50.89  ? 87   TYR A CD2 1 
ATOM   529   C  CE1 . TYR A  1 77  ? 84.943  -84.625  -132.447 1.00 52.54  ? 87   TYR A CE1 1 
ATOM   530   C  CE2 . TYR A  1 77  ? 86.426  -85.442  -134.155 1.00 51.93  ? 87   TYR A CE2 1 
ATOM   531   C  CZ  . TYR A  1 77  ? 85.852  -85.571  -132.897 1.00 52.72  ? 87   TYR A CZ  1 
ATOM   532   O  OH  . TYR A  1 77  ? 86.185  -86.638  -132.084 1.00 53.09  ? 87   TYR A OH  1 
ATOM   533   N  N   . VAL A  1 78  ? 87.924  -81.537  -135.437 1.00 52.35  ? 88   VAL A N   1 
ATOM   534   C  CA  . VAL A  1 78  ? 89.305  -81.969  -135.210 1.00 51.08  ? 88   VAL A CA  1 
ATOM   535   C  C   . VAL A  1 78  ? 90.134  -80.887  -134.528 1.00 51.17  ? 88   VAL A C   1 
ATOM   536   O  O   . VAL A  1 78  ? 90.858  -81.163  -133.581 1.00 51.36  ? 88   VAL A O   1 
ATOM   537   C  CB  . VAL A  1 78  ? 89.998  -82.394  -136.530 1.00 49.83  ? 88   VAL A CB  1 
ATOM   538   C  CG1 . VAL A  1 78  ? 91.435  -82.802  -136.259 1.00 48.67  ? 88   VAL A CG1 1 
ATOM   539   C  CG2 . VAL A  1 78  ? 89.248  -83.553  -137.158 1.00 47.66  ? 88   VAL A CG2 1 
ATOM   540   N  N   . LEU A  1 79  ? 90.027  -79.656  -135.002 1.00 51.98  ? 89   LEU A N   1 
ATOM   541   C  CA  . LEU A  1 79  ? 90.764  -78.563  -134.390 1.00 52.67  ? 89   LEU A CA  1 
ATOM   542   C  C   . LEU A  1 79  ? 90.469  -78.547  -132.890 1.00 53.01  ? 89   LEU A C   1 
ATOM   543   O  O   . LEU A  1 79  ? 91.383  -78.459  -132.075 1.00 53.91  ? 89   LEU A O   1 
ATOM   544   C  CB  . LEU A  1 79  ? 90.339  -77.234  -135.005 1.00 53.27  ? 89   LEU A CB  1 
ATOM   545   C  CG  . LEU A  1 79  ? 91.025  -76.015  -134.398 1.00 55.00  ? 89   LEU A CG  1 
ATOM   546   C  CD1 . LEU A  1 79  ? 92.523  -76.066  -134.710 1.00 54.38  ? 89   LEU A CD1 1 
ATOM   547   C  CD2 . LEU A  1 79  ? 90.392  -74.746  -134.957 1.00 54.53  ? 89   LEU A CD2 1 
ATOM   548   N  N   . SER A  1 80  ? 89.188  -78.637  -132.537 1.00 52.64  ? 90   SER A N   1 
ATOM   549   C  CA  . SER A  1 80  ? 88.753  -78.639  -131.142 1.00 51.94  ? 90   SER A CA  1 
ATOM   550   C  C   . SER A  1 80  ? 89.197  -79.896  -130.416 1.00 52.77  ? 90   SER A C   1 
ATOM   551   O  O   . SER A  1 80  ? 89.920  -79.827  -129.431 1.00 53.26  ? 90   SER A O   1 
ATOM   552   C  CB  . SER A  1 80  ? 87.237  -78.528  -131.060 1.00 51.19  ? 90   SER A CB  1 
ATOM   553   O  OG  . SER A  1 80  ? 86.808  -77.260  -131.510 1.00 52.68  ? 90   SER A OG  1 
ATOM   554   N  N   . SER A  1 81  ? 88.755  -81.049  -130.896 1.00 54.42  ? 91   SER A N   1 
ATOM   555   C  CA  . SER A  1 81  ? 89.143  -82.308  -130.277 1.00 55.76  ? 91   SER A CA  1 
ATOM   556   C  C   . SER A  1 81  ? 90.639  -82.254  -130.000 1.00 55.49  ? 91   SER A C   1 
ATOM   557   O  O   . SER A  1 81  ? 91.118  -82.820  -129.023 1.00 55.66  ? 91   SER A O   1 
ATOM   558   C  CB  . SER A  1 81  ? 88.830  -83.486  -131.208 1.00 56.37  ? 91   SER A CB  1 
ATOM   559   O  OG  . SER A  1 81  ? 89.239  -84.718  -130.632 1.00 58.84  ? 91   SER A OG  1 
ATOM   560   N  N   . TYR A  1 82  ? 91.360  -81.554  -130.870 1.00 55.14  ? 92   TYR A N   1 
ATOM   561   C  CA  . TYR A  1 82  ? 92.806  -81.394  -130.756 1.00 54.76  ? 92   TYR A CA  1 
ATOM   562   C  C   . TYR A  1 82  ? 93.189  -80.548  -129.537 1.00 55.37  ? 92   TYR A C   1 
ATOM   563   O  O   . TYR A  1 82  ? 93.731  -81.072  -128.569 1.00 56.05  ? 92   TYR A O   1 
ATOM   564   C  CB  . TYR A  1 82  ? 93.354  -80.770  -132.053 1.00 52.97  ? 92   TYR A CB  1 
ATOM   565   C  CG  . TYR A  1 82  ? 94.820  -80.372  -132.040 1.00 50.03  ? 92   TYR A CG  1 
ATOM   566   C  CD1 . TYR A  1 82  ? 95.812  -81.279  -131.660 1.00 48.78  ? 92   TYR A CD1 1 
ATOM   567   C  CD2 . TYR A  1 82  ? 95.216  -79.086  -132.424 1.00 47.64  ? 92   TYR A CD2 1 
ATOM   568   C  CE1 . TYR A  1 82  ? 97.161  -80.913  -131.660 1.00 45.91  ? 92   TYR A CE1 1 
ATOM   569   C  CE2 . TYR A  1 82  ? 96.558  -78.714  -132.426 1.00 45.26  ? 92   TYR A CE2 1 
ATOM   570   C  CZ  . TYR A  1 82  ? 97.523  -79.633  -132.040 1.00 44.35  ? 92   TYR A CZ  1 
ATOM   571   O  OH  . TYR A  1 82  ? 98.845  -79.270  -132.001 1.00 42.70  ? 92   TYR A OH  1 
ATOM   572   N  N   . LEU A  1 83  ? 92.906  -79.248  -129.575 1.00 55.65  ? 93   LEU A N   1 
ATOM   573   C  CA  . LEU A  1 83  ? 93.245  -78.366  -128.454 1.00 55.64  ? 93   LEU A CA  1 
ATOM   574   C  C   . LEU A  1 83  ? 92.655  -78.866  -127.135 1.00 55.82  ? 93   LEU A C   1 
ATOM   575   O  O   . LEU A  1 83  ? 93.248  -78.713  -126.071 1.00 56.30  ? 93   LEU A O   1 
ATOM   576   C  CB  . LEU A  1 83  ? 92.732  -76.950  -128.722 1.00 54.64  ? 93   LEU A CB  1 
ATOM   577   C  CG  . LEU A  1 83  ? 93.079  -76.373  -130.088 1.00 53.85  ? 93   LEU A CG  1 
ATOM   578   C  CD1 . LEU A  1 83  ? 92.676  -74.909  -130.136 1.00 51.86  ? 93   LEU A CD1 1 
ATOM   579   C  CD2 . LEU A  1 83  ? 94.569  -76.538  -130.343 1.00 52.70  ? 93   LEU A CD2 1 
ATOM   580   N  N   . ARG A  1 84  ? 91.476  -79.458  -127.219 1.00 55.93  ? 94   ARG A N   1 
ATOM   581   C  CA  . ARG A  1 84  ? 90.784  -79.968  -126.052 1.00 56.03  ? 94   ARG A CA  1 
ATOM   582   C  C   . ARG A  1 84  ? 91.623  -81.060  -125.413 1.00 56.18  ? 94   ARG A C   1 
ATOM   583   O  O   . ARG A  1 84  ? 91.561  -81.279  -124.210 1.00 57.81  ? 94   ARG A O   1 
ATOM   584   C  CB  . ARG A  1 84  ? 89.430  -80.521  -126.488 1.00 57.03  ? 94   ARG A CB  1 
ATOM   585   C  CG  . ARG A  1 84  ? 88.334  -80.486  -125.439 1.00 57.55  ? 94   ARG A CG  1 
ATOM   586   C  CD  . ARG A  1 84  ? 86.982  -80.576  -126.133 1.00 57.40  ? 94   ARG A CD  1 
ATOM   587   N  NE  . ARG A  1 84  ? 86.942  -81.701  -127.063 1.00 56.11  ? 94   ARG A NE  1 
ATOM   588   C  CZ  . ARG A  1 84  ? 86.200  -81.734  -128.163 1.00 53.14  ? 94   ARG A CZ  1 
ATOM   589   N  NH1 . ARG A  1 84  ? 85.435  -80.700  -128.468 1.00 52.30  ? 94   ARG A NH1 1 
ATOM   590   N  NH2 . ARG A  1 84  ? 86.233  -82.797  -128.956 1.00 52.13  ? 94   ARG A NH2 1 
ATOM   591   N  N   . CYS A  1 85  ? 92.407  -81.747  -126.231 1.00 55.64  ? 95   CYS A N   1 
ATOM   592   C  CA  . CYS A  1 85  ? 93.262  -82.821  -125.752 1.00 55.45  ? 95   CYS A CA  1 
ATOM   593   C  C   . CYS A  1 85  ? 94.496  -82.213  -125.106 1.00 56.71  ? 95   CYS A C   1 
ATOM   594   O  O   . CYS A  1 85  ? 95.028  -82.748  -124.133 1.00 57.51  ? 95   CYS A O   1 
ATOM   595   C  CB  . CYS A  1 85  ? 93.677  -83.716  -126.920 1.00 55.00  ? 95   CYS A CB  1 
ATOM   596   S  SG  . CYS A  1 85  ? 94.576  -85.213  -126.493 1.00 54.23  ? 95   CYS A SG  1 
ATOM   597   N  N   . ARG A  1 86  ? 94.953  -81.091  -125.652 1.00 56.87  ? 96   ARG A N   1 
ATOM   598   C  CA  . ARG A  1 86  ? 96.122  -80.425  -125.109 1.00 56.80  ? 96   ARG A CA  1 
ATOM   599   C  C   . ARG A  1 86  ? 95.813  -79.873  -123.731 1.00 57.76  ? 96   ARG A C   1 
ATOM   600   O  O   . ARG A  1 86  ? 96.590  -80.083  -122.801 1.00 58.81  ? 96   ARG A O   1 
ATOM   601   C  CB  . ARG A  1 86  ? 96.580  -79.289  -126.022 1.00 56.29  ? 96   ARG A CB  1 
ATOM   602   C  CG  . ARG A  1 86  ? 96.978  -79.722  -127.418 1.00 56.00  ? 96   ARG A CG  1 
ATOM   603   C  CD  . ARG A  1 86  ? 97.847  -78.662  -128.072 1.00 55.13  ? 96   ARG A CD  1 
ATOM   604   N  NE  . ARG A  1 86  ? 99.254  -79.042  -128.030 1.00 54.43  ? 96   ARG A NE  1 
ATOM   605   C  CZ  . ARG A  1 86  ? 100.245 -78.208  -127.741 1.00 54.62  ? 96   ARG A CZ  1 
ATOM   606   N  NH1 . ARG A  1 86  ? 99.990  -76.936  -127.462 1.00 52.02  ? 96   ARG A NH1 1 
ATOM   607   N  NH2 . ARG A  1 86  ? 101.494 -78.652  -127.726 1.00 55.15  ? 96   ARG A NH2 1 
ATOM   608   N  N   . LEU A  1 87  ? 94.689  -79.164  -123.604 1.00 58.28  ? 97   LEU A N   1 
ATOM   609   C  CA  . LEU A  1 87  ? 94.279  -78.587  -122.325 1.00 59.62  ? 97   LEU A CA  1 
ATOM   610   C  C   . LEU A  1 87  ? 94.167  -79.658  -121.258 1.00 61.43  ? 97   LEU A C   1 
ATOM   611   O  O   . LEU A  1 87  ? 94.535  -79.441  -120.112 1.00 61.79  ? 97   LEU A O   1 
ATOM   612   C  CB  . LEU A  1 87  ? 92.928  -77.885  -122.438 1.00 58.90  ? 97   LEU A CB  1 
ATOM   613   C  CG  . LEU A  1 87  ? 92.839  -76.545  -123.157 1.00 59.39  ? 97   LEU A CG  1 
ATOM   614   C  CD1 . LEU A  1 87  ? 91.443  -75.968  -122.953 1.00 59.52  ? 97   LEU A CD1 1 
ATOM   615   C  CD2 . LEU A  1 87  ? 93.881  -75.594  -122.604 1.00 59.22  ? 97   LEU A CD2 1 
HETATM 616   N  N   . MSE A  1 88  ? 93.639  -80.812  -121.636 1.00 64.01  ? 98   MSE A N   1 
HETATM 617   C  CA  . MSE A  1 88  ? 93.490  -81.911  -120.701 1.00 67.30  ? 98   MSE A CA  1 
HETATM 618   C  C   . MSE A  1 88  ? 94.872  -82.322  -120.200 1.00 66.66  ? 98   MSE A C   1 
HETATM 619   O  O   . MSE A  1 88  ? 95.069  -82.570  -119.008 1.00 67.31  ? 98   MSE A O   1 
HETATM 620   C  CB  . MSE A  1 88  ? 92.778  -83.083  -121.388 1.00 72.49  ? 98   MSE A CB  1 
HETATM 621   C  CG  . MSE A  1 88  ? 92.661  -84.348  -120.555 1.00 79.77  ? 98   MSE A CG  1 
HETATM 622   SE SE  . MSE A  1 88  ? 94.115  -85.595  -120.887 1.00 93.05  ? 98   MSE A SE  1 
HETATM 623   C  CE  . MSE A  1 88  ? 93.169  -86.870  -122.011 1.00 87.48  ? 98   MSE A CE  1 
ATOM   624   N  N   . LYS A  1 89  ? 95.834  -82.373  -121.114 1.00 65.61  ? 99   LYS A N   1 
ATOM   625   C  CA  . LYS A  1 89  ? 97.199  -82.742  -120.768 1.00 63.59  ? 99   LYS A CA  1 
ATOM   626   C  C   . LYS A  1 89  ? 97.872  -81.714  -119.858 1.00 62.27  ? 99   LYS A C   1 
ATOM   627   O  O   . LYS A  1 89  ? 98.446  -82.083  -118.833 1.00 61.92  ? 99   LYS A O   1 
ATOM   628   C  CB  . LYS A  1 89  ? 98.040  -82.918  -122.031 1.00 63.82  ? 99   LYS A CB  1 
ATOM   629   C  CG  . LYS A  1 89  ? 97.751  -84.169  -122.833 1.00 63.64  ? 99   LYS A CG  1 
ATOM   630   C  CD  . LYS A  1 89  ? 98.658  -84.195  -124.051 1.00 64.75  ? 99   LYS A CD  1 
ATOM   631   C  CE  . LYS A  1 89  ? 98.529  -85.476  -124.853 1.00 65.16  ? 99   LYS A CE  1 
ATOM   632   N  NZ  . LYS A  1 89  ? 99.488  -85.481  -126.001 1.00 66.34  ? 99   LYS A NZ  1 
ATOM   633   N  N   . ILE A  1 90  ? 97.810  -80.433  -120.225 1.00 60.34  ? 100  ILE A N   1 
ATOM   634   C  CA  . ILE A  1 90  ? 98.438  -79.407  -119.402 1.00 59.47  ? 100  ILE A CA  1 
ATOM   635   C  C   . ILE A  1 90  ? 97.866  -79.395  -117.990 1.00 59.38  ? 100  ILE A C   1 
ATOM   636   O  O   . ILE A  1 90  ? 98.622  -79.322  -117.030 1.00 60.84  ? 100  ILE A O   1 
ATOM   637   C  CB  . ILE A  1 90  ? 98.299  -77.989  -119.996 1.00 59.47  ? 100  ILE A CB  1 
ATOM   638   C  CG1 . ILE A  1 90  ? 96.869  -77.494  -119.863 1.00 60.26  ? 100  ILE A CG1 1 
ATOM   639   C  CG2 . ILE A  1 90  ? 98.723  -77.986  -121.453 1.00 60.22  ? 100  ILE A CG2 1 
ATOM   640   C  CD1 . ILE A  1 90  ? 96.691  -76.093  -120.384 1.00 63.44  ? 100  ILE A CD1 1 
ATOM   641   N  N   . GLU A  1 91  ? 96.543  -79.470  -117.856 1.00 58.25  ? 101  GLU A N   1 
ATOM   642   C  CA  . GLU A  1 91  ? 95.911  -79.478  -116.536 1.00 55.65  ? 101  GLU A CA  1 
ATOM   643   C  C   . GLU A  1 91  ? 96.324  -80.726  -115.774 1.00 54.47  ? 101  GLU A C   1 
ATOM   644   O  O   . GLU A  1 91  ? 96.567  -80.683  -114.578 1.00 54.11  ? 101  GLU A O   1 
ATOM   645   C  CB  . GLU A  1 91  ? 94.388  -79.469  -116.650 1.00 56.63  ? 101  GLU A CB  1 
ATOM   646   C  CG  . GLU A  1 91  ? 93.775  -78.204  -117.226 1.00 60.37  ? 101  GLU A CG  1 
ATOM   647   C  CD  . GLU A  1 91  ? 92.262  -78.316  -117.364 1.00 61.99  ? 101  GLU A CD  1 
ATOM   648   O  OE1 . GLU A  1 91  ? 91.639  -77.392  -117.926 1.00 62.50  ? 101  GLU A OE1 1 
ATOM   649   O  OE2 . GLU A  1 91  ? 91.694  -79.331  -116.905 1.00 63.32  ? 101  GLU A OE2 1 
ATOM   650   N  N   . LYS A  1 92  ? 96.400  -81.848  -116.469 1.00 54.49  ? 102  LYS A N   1 
ATOM   651   C  CA  . LYS A  1 92  ? 96.776  -83.083  -115.813 1.00 55.04  ? 102  LYS A CA  1 
ATOM   652   C  C   . LYS A  1 92  ? 98.234  -83.036  -115.368 1.00 55.86  ? 102  LYS A C   1 
ATOM   653   O  O   . LYS A  1 92  ? 98.678  -83.881  -114.599 1.00 56.78  ? 102  LYS A O   1 
ATOM   654   C  CB  . LYS A  1 92  ? 96.553  -84.269  -116.752 1.00 54.89  ? 102  LYS A CB  1 
ATOM   655   C  CG  . LYS A  1 92  ? 96.654  -85.604  -116.048 1.00 55.18  ? 102  LYS A CG  1 
ATOM   656   C  CD  . LYS A  1 92  ? 96.646  -86.790  -116.993 1.00 55.90  ? 102  LYS A CD  1 
ATOM   657   C  CE  . LYS A  1 92  ? 96.802  -88.086  -116.194 1.00 58.30  ? 102  LYS A CE  1 
ATOM   658   N  NZ  . LYS A  1 92  ? 97.068  -89.306  -117.025 1.00 59.39  ? 102  LYS A NZ  1 
ATOM   659   N  N   . PHE A  1 93  ? 98.977  -82.043  -115.848 1.00 57.06  ? 103  PHE A N   1 
ATOM   660   C  CA  . PHE A  1 93  ? 100.392 -81.901  -115.498 1.00 57.92  ? 103  PHE A CA  1 
ATOM   661   C  C   . PHE A  1 93  ? 100.810 -80.428  -115.382 1.00 60.15  ? 103  PHE A C   1 
ATOM   662   O  O   . PHE A  1 93  ? 101.970 -80.098  -115.625 1.00 60.69  ? 103  PHE A O   1 
ATOM   663   C  CB  . PHE A  1 93  ? 101.271 -82.555  -116.568 1.00 53.77  ? 103  PHE A CB  1 
ATOM   664   C  CG  . PHE A  1 93  ? 100.939 -83.988  -116.852 1.00 51.35  ? 103  PHE A CG  1 
ATOM   665   C  CD1 . PHE A  1 93  ? 101.137 -84.968  -115.898 1.00 51.75  ? 103  PHE A CD1 1 
ATOM   666   C  CD2 . PHE A  1 93  ? 100.472 -84.368  -118.102 1.00 51.45  ? 103  PHE A CD2 1 
ATOM   667   C  CE1 . PHE A  1 93  ? 100.879 -86.315  -116.188 1.00 50.56  ? 103  PHE A CE1 1 
ATOM   668   C  CE2 . PHE A  1 93  ? 100.212 -85.709  -118.397 1.00 50.44  ? 103  PHE A CE2 1 
ATOM   669   C  CZ  . PHE A  1 93  ? 100.418 -86.681  -117.438 1.00 48.94  ? 103  PHE A CZ  1 
ATOM   670   N  N   . PHE A  1 94  ? 99.893  -79.549  -114.985 1.00 62.76  ? 104  PHE A N   1 
ATOM   671   C  CA  . PHE A  1 94  ? 100.211 -78.123  -114.912 1.00 65.65  ? 104  PHE A CA  1 
ATOM   672   C  C   . PHE A  1 94  ? 101.556 -77.750  -114.302 1.00 68.51  ? 104  PHE A C   1 
ATOM   673   O  O   . PHE A  1 94  ? 102.156 -76.753  -114.700 1.00 68.37  ? 104  PHE A O   1 
ATOM   674   C  CB  . PHE A  1 94  ? 99.079  -77.330  -114.228 1.00 64.76  ? 104  PHE A CB  1 
ATOM   675   C  CG  . PHE A  1 94  ? 98.884  -77.643  -112.773 1.00 64.37  ? 104  PHE A CG  1 
ATOM   676   C  CD1 . PHE A  1 94  ? 98.504  -78.915  -112.357 1.00 63.74  ? 104  PHE A CD1 1 
ATOM   677   C  CD2 . PHE A  1 94  ? 99.041  -76.647  -111.815 1.00 64.53  ? 104  PHE A CD2 1 
ATOM   678   C  CE1 . PHE A  1 94  ? 98.283  -79.193  -111.006 1.00 63.13  ? 104  PHE A CE1 1 
ATOM   679   C  CE2 . PHE A  1 94  ? 98.820  -76.914  -110.460 1.00 64.48  ? 104  PHE A CE2 1 
ATOM   680   C  CZ  . PHE A  1 94  ? 98.441  -78.191  -110.057 1.00 63.62  ? 104  PHE A CZ  1 
ATOM   681   N  N   . PRO A  1 95  ? 102.058 -78.536  -113.335 1.00 71.73  ? 105  PRO A N   1 
ATOM   682   C  CA  . PRO A  1 95  ? 103.355 -78.135  -112.786 1.00 74.03  ? 105  PRO A CA  1 
ATOM   683   C  C   . PRO A  1 95  ? 104.534 -78.482  -113.695 1.00 76.32  ? 105  PRO A C   1 
ATOM   684   O  O   . PRO A  1 95  ? 105.407 -77.647  -113.933 1.00 76.82  ? 105  PRO A O   1 
ATOM   685   C  CB  . PRO A  1 95  ? 103.399 -78.873  -111.450 1.00 73.47  ? 105  PRO A CB  1 
ATOM   686   C  CG  . PRO A  1 95  ? 102.639 -80.117  -111.734 1.00 72.32  ? 105  PRO A CG  1 
ATOM   687   C  CD  . PRO A  1 95  ? 101.461 -79.612  -112.523 1.00 72.27  ? 105  PRO A CD  1 
ATOM   688   N  N   . HIS A  1 96  ? 104.541 -79.705  -114.217 1.00 78.54  ? 106  HIS A N   1 
ATOM   689   C  CA  . HIS A  1 96  ? 105.622 -80.172  -115.084 1.00 81.49  ? 106  HIS A CA  1 
ATOM   690   C  C   . HIS A  1 96  ? 105.547 -79.582  -116.490 1.00 82.88  ? 106  HIS A C   1 
ATOM   691   O  O   . HIS A  1 96  ? 106.164 -80.091  -117.430 1.00 82.44  ? 106  HIS A O   1 
ATOM   692   C  CB  . HIS A  1 96  ? 105.593 -81.698  -115.169 1.00 82.34  ? 106  HIS A CB  1 
ATOM   693   C  CG  . HIS A  1 96  ? 105.391 -82.366  -113.847 1.00 84.10  ? 106  HIS A CG  1 
ATOM   694   N  ND1 . HIS A  1 96  ? 105.405 -83.736  -113.693 1.00 84.12  ? 106  HIS A ND1 1 
ATOM   695   C  CD2 . HIS A  1 96  ? 105.140 -81.852  -112.620 1.00 84.19  ? 106  HIS A CD2 1 
ATOM   696   C  CE1 . HIS A  1 96  ? 105.168 -84.034  -112.428 1.00 84.63  ? 106  HIS A CE1 1 
ATOM   697   N  NE2 . HIS A  1 96  ? 105.002 -82.909  -111.756 1.00 84.90  ? 106  HIS A NE2 1 
ATOM   698   N  N   . VAL A  1 97  ? 104.779 -78.512  -116.628 1.00 84.15  ? 107  VAL A N   1 
ATOM   699   C  CA  . VAL A  1 97  ? 104.630 -77.853  -117.911 1.00 85.46  ? 107  VAL A CA  1 
ATOM   700   C  C   . VAL A  1 97  ? 104.923 -76.374  -117.716 1.00 87.23  ? 107  VAL A C   1 
ATOM   701   O  O   . VAL A  1 97  ? 105.777 -75.821  -118.398 1.00 88.10  ? 107  VAL A O   1 
ATOM   702   C  CB  . VAL A  1 97  ? 103.201 -78.039  -118.485 1.00 84.30  ? 107  VAL A CB  1 
ATOM   703   C  CG1 . VAL A  1 97  ? 103.047 -77.246  -119.771 1.00 84.30  ? 107  VAL A CG1 1 
ATOM   704   C  CG2 . VAL A  1 97  ? 102.938 -79.511  -118.755 1.00 82.67  ? 107  VAL A CG2 1 
ATOM   705   N  N   . LEU A  1 98  ? 104.227 -75.742  -116.773 1.00 88.99  ? 108  LEU A N   1 
ATOM   706   C  CA  . LEU A  1 98  ? 104.430 -74.323  -116.500 1.00 90.66  ? 108  LEU A CA  1 
ATOM   707   C  C   . LEU A  1 98  ? 105.903 -74.005  -116.285 1.00 92.70  ? 108  LEU A C   1 
ATOM   708   O  O   . LEU A  1 98  ? 106.337 -72.858  -116.434 1.00 92.73  ? 108  LEU A O   1 
ATOM   709   C  CB  . LEU A  1 98  ? 103.636 -73.897  -115.267 1.00 91.04  ? 108  LEU A CB  1 
ATOM   710   C  CG  . LEU A  1 98  ? 102.228 -73.343  -115.494 1.00 92.22  ? 108  LEU A CG  1 
ATOM   711   C  CD1 . LEU A  1 98  ? 101.641 -72.906  -114.160 1.00 92.31  ? 108  LEU A CD1 1 
ATOM   712   C  CD2 . LEU A  1 98  ? 102.286 -72.162  -116.456 1.00 92.17  ? 108  LEU A CD2 1 
ATOM   713   N  N   . GLU A  1 99  ? 106.666 -75.033  -115.928 1.00 94.53  ? 109  GLU A N   1 
ATOM   714   C  CA  . GLU A  1 99  ? 108.095 -74.889  -115.694 1.00 96.15  ? 109  GLU A CA  1 
ATOM   715   C  C   . GLU A  1 99  ? 108.868 -75.527  -116.840 1.00 96.92  ? 109  GLU A C   1 
ATOM   716   O  O   . GLU A  1 99  ? 109.812 -74.936  -117.365 1.00 97.06  ? 109  GLU A O   1 
ATOM   717   C  CB  . GLU A  1 99  ? 108.467 -75.541  -114.354 1.00 97.08  ? 109  GLU A CB  1 
ATOM   718   C  CG  . GLU A  1 99  ? 109.954 -75.851  -114.135 1.00 97.49  ? 109  GLU A CG  1 
ATOM   719   C  CD  . GLU A  1 99  ? 110.334 -77.284  -114.520 1.00 97.55  ? 109  GLU A CD  1 
ATOM   720   O  OE1 . GLU A  1 99  ? 111.429 -77.733  -114.118 1.00 97.20  ? 109  GLU A OE1 1 
ATOM   721   O  OE2 . GLU A  1 99  ? 109.547 -77.961  -115.221 1.00 96.76  ? 109  GLU A OE2 1 
ATOM   722   N  N   . LYS A  1 100 ? 108.442 -76.724  -117.236 1.00 97.84  ? 110  LYS A N   1 
ATOM   723   C  CA  . LYS A  1 100 ? 109.091 -77.466  -118.314 1.00 99.09  ? 110  LYS A CA  1 
ATOM   724   C  C   . LYS A  1 100 ? 109.473 -76.567  -119.493 1.00 99.17  ? 110  LYS A C   1 
ATOM   725   O  O   . LYS A  1 100 ? 110.426 -76.851  -120.217 1.00 98.85  ? 110  LYS A O   1 
ATOM   726   C  CB  . LYS A  1 100 ? 108.178 -78.600  -118.785 1.00 99.69  ? 110  LYS A CB  1 
ATOM   727   C  CG  . LYS A  1 100 ? 108.895 -79.760  -119.475 1.00 100.28 ? 110  LYS A CG  1 
ATOM   728   C  CD  . LYS A  1 100 ? 109.281 -79.440  -120.912 1.00 100.08 ? 110  LYS A CD  1 
ATOM   729   C  CE  . LYS A  1 100 ? 109.823 -80.678  -121.613 1.00 99.74  ? 110  LYS A CE  1 
ATOM   730   N  NZ  . LYS A  1 100 ? 108.851 -81.813  -121.586 1.00 98.98  ? 110  LYS A NZ  1 
ATOM   731   N  N   . GLU A  1 101 ? 108.727 -75.484  -119.686 1.00 99.71  ? 111  GLU A N   1 
ATOM   732   C  CA  . GLU A  1 101 ? 109.028 -74.560  -120.768 1.00 100.16 ? 111  GLU A CA  1 
ATOM   733   C  C   . GLU A  1 101 ? 110.242 -73.758  -120.339 1.00 100.62 ? 111  GLU A C   1 
ATOM   734   O  O   . GLU A  1 101 ? 111.262 -73.739  -121.029 1.00 100.85 ? 111  GLU A O   1 
ATOM   735   C  CB  . GLU A  1 101 ? 107.855 -73.614  -121.026 1.00 99.82  ? 111  GLU A CB  1 
ATOM   736   C  CG  . GLU A  1 101 ? 108.158 -72.551  -122.071 1.00 99.97  ? 111  GLU A CG  1 
ATOM   737   C  CD  . GLU A  1 101 ? 107.031 -71.552  -122.244 1.00 99.91  ? 111  GLU A CD  1 
ATOM   738   O  OE1 . GLU A  1 101 ? 106.579 -70.975  -121.232 1.00 99.72  ? 111  GLU A OE1 1 
ATOM   739   O  OE2 . GLU A  1 101 ? 106.602 -71.337  -123.396 1.00 99.52  ? 111  GLU A OE2 1 
ATOM   740   N  N   . LYS A  1 102 ? 110.127 -73.098  -119.191 1.00 100.83 ? 112  LYS A N   1 
ATOM   741   C  CA  . LYS A  1 102 ? 111.223 -72.297  -118.661 1.00 101.23 ? 112  LYS A CA  1 
ATOM   742   C  C   . LYS A  1 102 ? 112.511 -73.118  -118.625 1.00 101.86 ? 112  LYS A C   1 
ATOM   743   O  O   . LYS A  1 102 ? 113.608 -72.578  -118.773 1.00 101.06 ? 112  LYS A O   1 
ATOM   744   C  CB  . LYS A  1 102 ? 110.889 -71.819  -117.250 1.00 99.65  ? 112  LYS A CB  1 
ATOM   745   C  CG  . LYS A  1 102 ? 109.620 -70.999  -117.150 1.00 96.96  ? 112  LYS A CG  1 
ATOM   746   C  CD  . LYS A  1 102 ? 109.409 -70.541  -115.719 1.00 95.06  ? 112  LYS A CD  1 
ATOM   747   C  CE  . LYS A  1 102 ? 110.602 -69.736  -115.219 1.00 93.59  ? 112  LYS A CE  1 
ATOM   748   N  NZ  . LYS A  1 102 ? 110.469 -69.351  -113.792 1.00 91.48  ? 112  LYS A NZ  1 
ATOM   749   N  N   . THR A  1 103 ? 112.363 -74.426  -118.432 1.00 103.20 ? 113  THR A N   1 
ATOM   750   C  CA  . THR A  1 103 ? 113.504 -75.333  -118.371 1.00 104.66 ? 113  THR A CA  1 
ATOM   751   C  C   . THR A  1 103 ? 113.731 -76.084  -119.688 1.00 105.60 ? 113  THR A C   1 
ATOM   752   O  O   . THR A  1 103 ? 114.221 -77.217  -119.693 1.00 105.85 ? 113  THR A O   1 
ATOM   753   C  CB  . THR A  1 103 ? 113.342 -76.365  -117.218 1.00 104.81 ? 113  THR A CB  1 
ATOM   754   O  OG1 . THR A  1 103 ? 114.541 -77.141  -117.087 1.00 104.15 ? 113  THR A OG1 1 
ATOM   755   C  CG2 . THR A  1 103 ? 112.178 -77.303  -117.496 1.00 105.04 ? 113  THR A CG2 1 
ATOM   756   N  N   . ARG A  1 104 ? 113.364 -75.460  -120.804 1.00 106.10 ? 114  ARG A N   1 
ATOM   757   C  CA  . ARG A  1 104 ? 113.575 -76.074  -122.107 1.00 106.73 ? 114  ARG A CA  1 
ATOM   758   C  C   . ARG A  1 104 ? 114.662 -75.256  -122.803 1.00 107.35 ? 114  ARG A C   1 
ATOM   759   O  O   . ARG A  1 104 ? 114.613 -74.023  -122.812 1.00 107.56 ? 114  ARG A O   1 
ATOM   760   C  CB  . ARG A  1 104 ? 112.287 -76.060  -122.953 1.00 107.25 ? 114  ARG A CB  1 
ATOM   761   C  CG  . ARG A  1 104 ? 112.117 -74.822  -123.841 1.00 108.33 ? 114  ARG A CG  1 
ATOM   762   C  CD  . ARG A  1 104 ? 111.081 -75.027  -124.949 1.00 108.62 ? 114  ARG A CD  1 
ATOM   763   N  NE  . ARG A  1 104 ? 111.285 -74.097  -126.065 1.00 108.66 ? 114  ARG A NE  1 
ATOM   764   C  CZ  . ARG A  1 104 ? 111.095 -72.780  -126.005 1.00 108.18 ? 114  ARG A CZ  1 
ATOM   765   N  NH1 . ARG A  1 104 ? 111.317 -72.028  -127.076 1.00 107.47 ? 114  ARG A NH1 1 
ATOM   766   N  NH2 . ARG A  1 104 ? 110.671 -72.214  -124.882 1.00 107.27 ? 114  ARG A NH2 1 
ATOM   767   N  N   . PRO A  1 105 ? 115.672 -75.928  -123.376 1.00 107.60 ? 115  PRO A N   1 
ATOM   768   C  CA  . PRO A  1 105 ? 116.751 -75.214  -124.065 1.00 107.77 ? 115  PRO A CA  1 
ATOM   769   C  C   . PRO A  1 105 ? 116.237 -74.304  -125.184 1.00 108.36 ? 115  PRO A C   1 
ATOM   770   O  O   . PRO A  1 105 ? 115.756 -74.785  -126.209 1.00 108.36 ? 115  PRO A O   1 
ATOM   771   C  CB  . PRO A  1 105 ? 117.632 -76.348  -124.585 1.00 107.12 ? 115  PRO A CB  1 
ATOM   772   C  CG  . PRO A  1 105 ? 116.689 -77.508  -124.710 1.00 107.16 ? 115  PRO A CG  1 
ATOM   773   C  CD  . PRO A  1 105 ? 115.873 -77.384  -123.460 1.00 107.44 ? 115  PRO A CD  1 
ATOM   774   N  N   . GLU A  1 106 ? 116.347 -72.992  -124.970 1.00 109.21 ? 116  GLU A N   1 
ATOM   775   C  CA  . GLU A  1 106 ? 115.895 -71.967  -125.921 1.00 109.97 ? 116  GLU A CA  1 
ATOM   776   C  C   . GLU A  1 106 ? 115.821 -72.402  -127.387 1.00 109.89 ? 116  GLU A C   1 
ATOM   777   O  O   . GLU A  1 106 ? 114.921 -71.985  -128.124 1.00 109.46 ? 116  GLU A O   1 
ATOM   778   C  CB  . GLU A  1 106 ? 116.784 -70.718  -125.801 1.00 110.12 ? 116  GLU A CB  1 
ATOM   779   C  CG  . GLU A  1 106 ? 116.499 -69.610  -126.819 1.00 110.04 ? 116  GLU A CG  1 
ATOM   780   C  CD  . GLU A  1 106 ? 115.057 -69.118  -126.797 1.00 110.26 ? 116  GLU A CD  1 
ATOM   781   O  OE1 . GLU A  1 106 ? 114.752 -68.149  -127.523 1.00 109.87 ? 116  GLU A OE1 1 
ATOM   782   O  OE2 . GLU A  1 106 ? 114.225 -69.694  -126.064 1.00 110.38 ? 116  GLU A OE2 1 
ATOM   783   N  N   . GLY A  1 107 ? 116.764 -73.243  -127.798 1.00 109.80 ? 117  GLY A N   1 
ATOM   784   C  CA  . GLY A  1 107 ? 116.799 -73.714  -129.170 1.00 109.76 ? 117  GLY A CA  1 
ATOM   785   C  C   . GLY A  1 107 ? 115.773 -74.756  -129.595 1.00 109.31 ? 117  GLY A C   1 
ATOM   786   O  O   . GLY A  1 107 ? 115.786 -75.169  -130.755 1.00 109.67 ? 117  GLY A O   1 
ATOM   787   N  N   . GLU A  1 108 ? 114.892 -75.190  -128.693 1.00 108.27 ? 118  GLU A N   1 
ATOM   788   C  CA  . GLU A  1 108 ? 113.886 -76.189  -129.060 1.00 107.08 ? 118  GLU A CA  1 
ATOM   789   C  C   . GLU A  1 108 ? 112.452 -75.634  -129.035 1.00 105.74 ? 118  GLU A C   1 
ATOM   790   O  O   . GLU A  1 108 ? 112.207 -74.538  -128.524 1.00 105.60 ? 118  GLU A O   1 
ATOM   791   C  CB  . GLU A  1 108 ? 113.992 -77.423  -128.152 1.00 108.03 ? 118  GLU A CB  1 
ATOM   792   C  CG  . GLU A  1 108 ? 113.411 -77.258  -126.756 1.00 109.55 ? 118  GLU A CG  1 
ATOM   793   C  CD  . GLU A  1 108 ? 113.175 -78.596  -126.065 1.00 110.11 ? 118  GLU A CD  1 
ATOM   794   O  OE1 . GLU A  1 108 ? 112.700 -78.596  -124.908 1.00 110.32 ? 118  GLU A OE1 1 
ATOM   795   O  OE2 . GLU A  1 108 ? 113.461 -79.645  -126.685 1.00 109.59 ? 118  GLU A OE2 1 
ATOM   796   N  N   . PRO A  1 109 ? 111.488 -76.390  -129.595 1.00 104.19 ? 119  PRO A N   1 
ATOM   797   C  CA  . PRO A  1 109 ? 110.070 -76.009  -129.662 1.00 102.95 ? 119  PRO A CA  1 
ATOM   798   C  C   . PRO A  1 109 ? 109.323 -75.963  -128.332 1.00 101.25 ? 119  PRO A C   1 
ATOM   799   O  O   . PRO A  1 109 ? 109.292 -76.946  -127.593 1.00 101.98 ? 119  PRO A O   1 
ATOM   800   C  CB  . PRO A  1 109 ? 109.481 -77.061  -130.597 1.00 103.89 ? 119  PRO A CB  1 
ATOM   801   C  CG  . PRO A  1 109 ? 110.294 -78.271  -130.263 1.00 103.86 ? 119  PRO A CG  1 
ATOM   802   C  CD  . PRO A  1 109 ? 111.695 -77.701  -130.238 1.00 103.78 ? 119  PRO A CD  1 
ATOM   803   N  N   . SER A  1 110 ? 108.708 -74.821  -128.040 1.00 98.40  ? 120  SER A N   1 
ATOM   804   C  CA  . SER A  1 110 ? 107.946 -74.662  -126.807 1.00 95.39  ? 120  SER A CA  1 
ATOM   805   C  C   . SER A  1 110 ? 106.668 -75.488  -126.902 1.00 93.42  ? 120  SER A C   1 
ATOM   806   O  O   . SER A  1 110 ? 105.715 -75.074  -127.558 1.00 93.68  ? 120  SER A O   1 
ATOM   807   C  CB  . SER A  1 110 ? 107.588 -73.192  -126.596 1.00 95.20  ? 120  SER A CB  1 
ATOM   808   O  OG  . SER A  1 110 ? 106.768 -73.032  -125.454 1.00 94.72  ? 120  SER A OG  1 
ATOM   809   N  N   . SER A  1 111 ? 106.650 -76.648  -126.248 1.00 90.50  ? 121  SER A N   1 
ATOM   810   C  CA  . SER A  1 111 ? 105.487 -77.537  -126.272 1.00 87.49  ? 121  SER A CA  1 
ATOM   811   C  C   . SER A  1 111 ? 104.249 -76.920  -125.627 1.00 85.52  ? 121  SER A C   1 
ATOM   812   O  O   . SER A  1 111 ? 103.323 -77.633  -125.247 1.00 85.98  ? 121  SER A O   1 
ATOM   813   C  CB  . SER A  1 111 ? 105.807 -78.855  -125.560 1.00 87.23  ? 121  SER A CB  1 
ATOM   814   O  OG  . SER A  1 111 ? 106.822 -79.580  -126.227 1.00 87.19  ? 121  SER A OG  1 
ATOM   815   N  N   . LEU A  1 112 ? 104.230 -75.599  -125.519 1.00 82.11  ? 122  LEU A N   1 
ATOM   816   C  CA  . LEU A  1 112 ? 103.117 -74.891  -124.908 1.00 80.20  ? 122  LEU A CA  1 
ATOM   817   C  C   . LEU A  1 112 ? 103.124 -73.512  -125.567 1.00 79.56  ? 122  LEU A C   1 
ATOM   818   O  O   . LEU A  1 112 ? 104.180 -72.897  -125.688 1.00 80.78  ? 122  LEU A O   1 
ATOM   819   C  CB  . LEU A  1 112 ? 103.374 -74.811  -123.392 1.00 80.67  ? 122  LEU A CB  1 
ATOM   820   C  CG  . LEU A  1 112 ? 102.448 -74.245  -122.302 1.00 80.00  ? 122  LEU A CG  1 
ATOM   821   C  CD1 . LEU A  1 112 ? 102.370 -72.746  -122.429 1.00 79.10  ? 122  LEU A CD1 1 
ATOM   822   C  CD2 . LEU A  1 112 ? 101.074 -74.886  -122.377 1.00 80.59  ? 122  LEU A CD2 1 
ATOM   823   N  N   . SER A  1 113 ? 101.965 -73.033  -126.011 1.00 77.98  ? 123  SER A N   1 
ATOM   824   C  CA  . SER A  1 113 ? 101.894 -71.730  -126.675 1.00 76.87  ? 123  SER A CA  1 
ATOM   825   C  C   . SER A  1 113 ? 101.643 -70.580  -125.696 1.00 76.65  ? 123  SER A C   1 
ATOM   826   O  O   . SER A  1 113 ? 101.393 -70.803  -124.514 1.00 77.13  ? 123  SER A O   1 
ATOM   827   C  CB  . SER A  1 113 ? 100.794 -71.745  -127.737 1.00 76.98  ? 123  SER A CB  1 
ATOM   828   O  OG  . SER A  1 113 ? 99.550  -71.338  -127.190 1.00 77.63  ? 123  SER A OG  1 
ATOM   829   N  N   . PRO A  1 114 ? 101.708 -69.328  -126.180 1.00 76.20  ? 124  PRO A N   1 
ATOM   830   C  CA  . PRO A  1 114 ? 101.486 -68.150  -125.332 1.00 76.02  ? 124  PRO A CA  1 
ATOM   831   C  C   . PRO A  1 114 ? 100.078 -67.983  -124.755 1.00 75.74  ? 124  PRO A C   1 
ATOM   832   O  O   . PRO A  1 114 ? 99.874  -67.181  -123.843 1.00 75.64  ? 124  PRO A O   1 
ATOM   833   C  CB  . PRO A  1 114 ? 101.893 -66.986  -126.240 1.00 75.25  ? 124  PRO A CB  1 
ATOM   834   C  CG  . PRO A  1 114 ? 101.600 -67.501  -127.597 1.00 75.50  ? 124  PRO A CG  1 
ATOM   835   C  CD  . PRO A  1 114 ? 102.120 -68.915  -127.532 1.00 76.01  ? 124  PRO A CD  1 
ATOM   836   N  N   . GLU A  1 115 ? 99.107  -68.716  -125.290 1.00 75.28  ? 125  GLU A N   1 
ATOM   837   C  CA  . GLU A  1 115 ? 97.742  -68.637  -124.770 1.00 74.67  ? 125  GLU A CA  1 
ATOM   838   C  C   . GLU A  1 115 ? 97.630  -69.750  -123.740 1.00 72.59  ? 125  GLU A C   1 
ATOM   839   O  O   . GLU A  1 115 ? 97.067  -69.568  -122.657 1.00 71.43  ? 125  GLU A O   1 
ATOM   840   C  CB  . GLU A  1 115 ? 96.701  -68.873  -125.870 1.00 77.49  ? 125  GLU A CB  1 
ATOM   841   C  CG  . GLU A  1 115 ? 96.725  -67.881  -127.013 1.00 80.53  ? 125  GLU A CG  1 
ATOM   842   C  CD  . GLU A  1 115 ? 98.015  -67.945  -127.804 1.00 82.89  ? 125  GLU A CD  1 
ATOM   843   O  OE1 . GLU A  1 115 ? 98.416  -69.062  -128.210 1.00 83.83  ? 125  GLU A OE1 1 
ATOM   844   O  OE2 . GLU A  1 115 ? 98.623  -66.875  -128.020 1.00 83.66  ? 125  GLU A OE2 1 
ATOM   845   N  N   . GLU A  1 116 ? 98.172  -70.909  -124.100 1.00 69.93  ? 126  GLU A N   1 
ATOM   846   C  CA  . GLU A  1 116 ? 98.166  -72.061  -123.223 1.00 68.27  ? 126  GLU A CA  1 
ATOM   847   C  C   . GLU A  1 116 ? 99.040  -71.729  -122.012 1.00 68.01  ? 126  GLU A C   1 
ATOM   848   O  O   . GLU A  1 116 ? 98.868  -72.299  -120.933 1.00 68.42  ? 126  GLU A O   1 
ATOM   849   C  CB  . GLU A  1 116 ? 98.693  -73.292  -123.974 1.00 66.69  ? 126  GLU A CB  1 
ATOM   850   C  CG  . GLU A  1 116 ? 97.891  -73.621  -125.240 1.00 66.11  ? 126  GLU A CG  1 
ATOM   851   C  CD  . GLU A  1 116 ? 98.341  -74.904  -125.939 1.00 66.69  ? 126  GLU A CD  1 
ATOM   852   O  OE1 . GLU A  1 116 ? 99.562  -75.076  -126.131 1.00 65.99  ? 126  GLU A OE1 1 
ATOM   853   O  OE2 . GLU A  1 116 ? 97.473  -75.732  -126.311 1.00 66.33  ? 126  GLU A OE2 1 
ATOM   854   N  N   . LEU A  1 117 ? 99.960  -70.782  -122.200 1.00 67.20  ? 127  LEU A N   1 
ATOM   855   C  CA  . LEU A  1 117 ? 100.867 -70.342  -121.140 1.00 65.81  ? 127  LEU A CA  1 
ATOM   856   C  C   . LEU A  1 117 ? 100.109 -69.559  -120.079 1.00 64.50  ? 127  LEU A C   1 
ATOM   857   O  O   . LEU A  1 117 ? 100.115 -69.925  -118.910 1.00 64.73  ? 127  LEU A O   1 
ATOM   858   C  CB  . LEU A  1 117 ? 101.994 -69.473  -121.727 1.00 66.29  ? 127  LEU A CB  1 
ATOM   859   C  CG  . LEU A  1 117 ? 103.191 -69.037  -120.851 1.00 65.92  ? 127  LEU A CG  1 
ATOM   860   C  CD1 . LEU A  1 117 ? 102.823 -67.825  -120.006 1.00 63.58  ? 127  LEU A CD1 1 
ATOM   861   C  CD2 . LEU A  1 117 ? 103.666 -70.215  -119.985 1.00 64.32  ? 127  LEU A CD2 1 
ATOM   862   N  N   . ALA A  1 118 ? 99.464  -68.475  -120.485 1.00 63.71  ? 128  ALA A N   1 
ATOM   863   C  CA  . ALA A  1 118 ? 98.701  -67.665  -119.547 1.00 64.26  ? 128  ALA A CA  1 
ATOM   864   C  C   . ALA A  1 118 ? 97.611  -68.512  -118.879 1.00 65.01  ? 128  ALA A C   1 
ATOM   865   O  O   . ALA A  1 118 ? 97.064  -68.125  -117.841 1.00 65.03  ? 128  ALA A O   1 
ATOM   866   C  CB  . ALA A  1 118 ? 98.073  -66.470  -120.268 1.00 63.10  ? 128  ALA A CB  1 
ATOM   867   N  N   . PHE A  1 119 ? 97.304  -69.666  -119.478 1.00 64.67  ? 129  PHE A N   1 
ATOM   868   C  CA  . PHE A  1 119 ? 96.280  -70.564  -118.949 1.00 62.97  ? 129  PHE A CA  1 
ATOM   869   C  C   . PHE A  1 119 ? 96.871  -71.536  -117.932 1.00 63.61  ? 129  PHE A C   1 
ATOM   870   O  O   . PHE A  1 119 ? 96.385  -71.627  -116.807 1.00 63.64  ? 129  PHE A O   1 
ATOM   871   C  CB  . PHE A  1 119 ? 95.626  -71.350  -120.085 1.00 61.35  ? 129  PHE A CB  1 
ATOM   872   C  CG  . PHE A  1 119 ? 94.515  -72.260  -119.633 1.00 58.75  ? 129  PHE A CG  1 
ATOM   873   C  CD1 . PHE A  1 119 ? 93.294  -71.738  -119.222 1.00 58.35  ? 129  PHE A CD1 1 
ATOM   874   C  CD2 . PHE A  1 119 ? 94.699  -73.638  -119.605 1.00 56.35  ? 129  PHE A CD2 1 
ATOM   875   C  CE1 . PHE A  1 119 ? 92.279  -72.577  -118.791 1.00 57.02  ? 129  PHE A CE1 1 
ATOM   876   C  CE2 . PHE A  1 119 ? 93.692  -74.484  -119.176 1.00 54.53  ? 129  PHE A CE2 1 
ATOM   877   C  CZ  . PHE A  1 119 ? 92.482  -73.957  -118.770 1.00 56.33  ? 129  PHE A CZ  1 
ATOM   878   N  N   . ALA A  1 120 ? 97.908  -72.269  -118.335 1.00 63.85  ? 130  ALA A N   1 
ATOM   879   C  CA  . ALA A  1 120 ? 98.562  -73.221  -117.439 1.00 65.16  ? 130  ALA A CA  1 
ATOM   880   C  C   . ALA A  1 120 ? 99.050  -72.458  -116.214 1.00 66.13  ? 130  ALA A C   1 
ATOM   881   O  O   . ALA A  1 120 ? 99.096  -72.985  -115.103 1.00 66.46  ? 130  ALA A O   1 
ATOM   882   C  CB  . ALA A  1 120 ? 99.739  -73.891  -118.146 1.00 64.09  ? 130  ALA A CB  1 
ATOM   883   N  N   . ARG A  1 121 ? 99.404  -71.200  -116.446 1.00 67.81  ? 131  ARG A N   1 
ATOM   884   C  CA  . ARG A  1 121 ? 99.888  -70.299  -115.414 1.00 68.83  ? 131  ARG A CA  1 
ATOM   885   C  C   . ARG A  1 121 ? 98.717  -69.970  -114.492 1.00 68.41  ? 131  ARG A C   1 
ATOM   886   O  O   . ARG A  1 121 ? 98.792  -70.185  -113.288 1.00 68.66  ? 131  ARG A O   1 
ATOM   887   C  CB  . ARG A  1 121 ? 100.445 -69.036  -116.087 1.00 70.71  ? 131  ARG A CB  1 
ATOM   888   C  CG  . ARG A  1 121 ? 101.282 -68.123  -115.210 1.00 73.76  ? 131  ARG A CG  1 
ATOM   889   C  CD  . ARG A  1 121 ? 102.412 -67.479  -116.022 1.00 76.51  ? 131  ARG A CD  1 
ATOM   890   N  NE  . ARG A  1 121 ? 103.450 -68.453  -116.376 1.00 79.30  ? 131  ARG A NE  1 
ATOM   891   C  CZ  . ARG A  1 121 ? 104.548 -68.174  -117.079 1.00 79.80  ? 131  ARG A CZ  1 
ATOM   892   N  NH1 . ARG A  1 121 ? 104.766 -66.937  -117.521 1.00 78.55  ? 131  ARG A NH1 1 
ATOM   893   N  NH2 . ARG A  1 121 ? 105.434 -69.135  -117.334 1.00 77.72  ? 131  ARG A NH2 1 
ATOM   894   N  N   . GLU A  1 122 ? 97.632  -69.459  -115.067 1.00 68.55  ? 132  GLU A N   1 
ATOM   895   C  CA  . GLU A  1 122 ? 96.438  -69.122  -114.300 1.00 68.41  ? 132  GLU A CA  1 
ATOM   896   C  C   . GLU A  1 122 ? 95.957  -70.336  -113.509 1.00 67.88  ? 132  GLU A C   1 
ATOM   897   O  O   . GLU A  1 122 ? 95.545  -70.220  -112.355 1.00 66.67  ? 132  GLU A O   1 
ATOM   898   C  CB  . GLU A  1 122 ? 95.309  -68.669  -115.237 1.00 70.13  ? 132  GLU A CB  1 
ATOM   899   C  CG  . GLU A  1 122 ? 95.324  -67.193  -115.624 1.00 74.87  ? 132  GLU A CG  1 
ATOM   900   C  CD  . GLU A  1 122 ? 94.151  -66.797  -116.537 1.00 77.93  ? 132  GLU A CD  1 
ATOM   901   O  OE1 . GLU A  1 122 ? 94.192  -67.094  -117.757 1.00 79.48  ? 132  GLU A OE1 1 
ATOM   902   O  OE2 . GLU A  1 122 ? 93.179  -66.190  -116.032 1.00 78.79  ? 132  GLU A OE2 1 
ATOM   903   N  N   . PHE A  1 123 ? 96.016  -71.502  -114.147 1.00 67.45  ? 133  PHE A N   1 
ATOM   904   C  CA  . PHE A  1 123 ? 95.560  -72.741  -113.538 1.00 66.57  ? 133  PHE A CA  1 
ATOM   905   C  C   . PHE A  1 123 ? 96.117  -72.937  -112.153 1.00 67.08  ? 133  PHE A C   1 
ATOM   906   O  O   . PHE A  1 123 ? 95.366  -73.134  -111.205 1.00 68.16  ? 133  PHE A O   1 
ATOM   907   C  CB  . PHE A  1 123 ? 95.939  -73.946  -114.400 1.00 65.23  ? 133  PHE A CB  1 
ATOM   908   C  CG  . PHE A  1 123 ? 95.225  -75.209  -114.010 1.00 63.83  ? 133  PHE A CG  1 
ATOM   909   C  CD1 . PHE A  1 123 ? 93.846  -75.331  -114.199 1.00 63.02  ? 133  PHE A CD1 1 
ATOM   910   C  CD2 . PHE A  1 123 ? 95.921  -76.270  -113.437 1.00 62.49  ? 133  PHE A CD2 1 
ATOM   911   C  CE1 . PHE A  1 123 ? 93.171  -76.490  -113.824 1.00 61.48  ? 133  PHE A CE1 1 
ATOM   912   C  CE2 . PHE A  1 123 ? 95.259  -77.432  -113.057 1.00 61.20  ? 133  PHE A CE2 1 
ATOM   913   C  CZ  . PHE A  1 123 ? 93.880  -77.542  -113.252 1.00 61.78  ? 133  PHE A CZ  1 
HETATM 914   N  N   . MSE A  1 124 ? 97.436  -72.886  -112.035 1.00 68.13  ? 134  MSE A N   1 
HETATM 915   C  CA  . MSE A  1 124 ? 98.082  -73.072  -110.743 1.00 69.15  ? 134  MSE A CA  1 
HETATM 916   C  C   . MSE A  1 124 ? 97.745  -71.972  -109.741 1.00 67.92  ? 134  MSE A C   1 
HETATM 917   O  O   . MSE A  1 124 ? 97.395  -72.247  -108.596 1.00 68.70  ? 134  MSE A O   1 
HETATM 918   C  CB  . MSE A  1 124 ? 99.584  -73.143  -110.931 1.00 72.24  ? 134  MSE A CB  1 
HETATM 919   C  CG  . MSE A  1 124 ? 100.337 -73.425  -109.667 1.00 77.02  ? 134  MSE A CG  1 
HETATM 920   SE SE  . MSE A  1 124 ? 102.104 -73.997  -110.137 1.00 88.66  ? 134  MSE A SE  1 
HETATM 921   C  CE  . MSE A  1 124 ? 101.974 -75.894  -109.729 1.00 83.25  ? 134  MSE A CE  1 
ATOM   922   N  N   . ALA A  1 125 ? 97.852  -70.724  -110.176 1.00 66.01  ? 135  ALA A N   1 
ATOM   923   C  CA  . ALA A  1 125 ? 97.551  -69.586  -109.316 1.00 64.26  ? 135  ALA A CA  1 
ATOM   924   C  C   . ALA A  1 125 ? 96.147  -69.688  -108.720 1.00 62.75  ? 135  ALA A C   1 
ATOM   925   O  O   . ALA A  1 125 ? 95.834  -69.030  -107.729 1.00 63.16  ? 135  ALA A O   1 
ATOM   926   C  CB  . ALA A  1 125 ? 97.688  -68.288  -110.108 1.00 65.41  ? 135  ALA A CB  1 
ATOM   927   N  N   . ASN A  1 126 ? 95.299  -70.506  -109.335 1.00 60.34  ? 136  ASN A N   1 
ATOM   928   C  CA  . ASN A  1 126 ? 93.936  -70.687  -108.852 1.00 56.60  ? 136  ASN A CA  1 
ATOM   929   C  C   . ASN A  1 126 ? 93.930  -71.891  -107.920 1.00 54.90  ? 136  ASN A C   1 
ATOM   930   O  O   . ASN A  1 126 ? 93.397  -71.832  -106.810 1.00 53.94  ? 136  ASN A O   1 
ATOM   931   C  CB  . ASN A  1 126 ? 92.987  -70.910  -110.038 1.00 54.98  ? 136  ASN A CB  1 
ATOM   932   C  CG  . ASN A  1 126 ? 91.523  -70.972  -109.625 1.00 53.97  ? 136  ASN A CG  1 
ATOM   933   O  OD1 . ASN A  1 126 ? 91.019  -70.089  -108.934 1.00 53.97  ? 136  ASN A OD1 1 
ATOM   934   N  ND2 . ASN A  1 126 ? 90.832  -72.012  -110.066 1.00 54.00  ? 136  ASN A ND2 1 
ATOM   935   N  N   . THR A  1 127 ? 94.546  -72.976  -108.374 1.00 52.63  ? 137  THR A N   1 
ATOM   936   C  CA  . THR A  1 127 ? 94.613  -74.195  -107.592 1.00 52.23  ? 137  THR A CA  1 
ATOM   937   C  C   . THR A  1 127 ? 95.365  -73.945  -106.298 1.00 52.39  ? 137  THR A C   1 
ATOM   938   O  O   . THR A  1 127 ? 94.822  -74.164  -105.215 1.00 52.92  ? 137  THR A O   1 
ATOM   939   C  CB  . THR A  1 127 ? 95.292  -75.327  -108.394 1.00 52.00  ? 137  THR A CB  1 
ATOM   940   O  OG1 . THR A  1 127 ? 94.425  -75.730  -109.459 1.00 51.62  ? 137  THR A OG1 1 
ATOM   941   C  CG2 . THR A  1 127 ? 95.573  -76.531  -107.517 1.00 51.20  ? 137  THR A CG2 1 
ATOM   942   N  N   . GLU A  1 128 ? 96.610  -73.484  -106.409 1.00 52.86  ? 138  GLU A N   1 
ATOM   943   C  CA  . GLU A  1 128 ? 97.445  -73.196  -105.235 1.00 52.19  ? 138  GLU A CA  1 
ATOM   944   C  C   . GLU A  1 128 ? 96.721  -72.327  -104.219 1.00 51.00  ? 138  GLU A C   1 
ATOM   945   O  O   . GLU A  1 128 ? 96.762  -72.602  -103.027 1.00 51.37  ? 138  GLU A O   1 
ATOM   946   C  CB  . GLU A  1 128 ? 98.738  -72.498  -105.652 1.00 53.48  ? 138  GLU A CB  1 
ATOM   947   C  CG  . GLU A  1 128 ? 99.975  -73.365  -105.504 1.00 54.49  ? 138  GLU A CG  1 
ATOM   948   C  CD  . GLU A  1 128 ? 101.211 -72.710  -106.085 1.00 53.89  ? 138  GLU A CD  1 
ATOM   949   O  OE1 . GLU A  1 128 ? 102.295 -73.324  -106.008 1.00 53.13  ? 138  GLU A OE1 1 
ATOM   950   O  OE2 . GLU A  1 128 ? 101.093 -71.585  -106.623 1.00 55.13  ? 138  GLU A OE2 1 
ATOM   951   N  N   . SER A  1 129 ? 96.064  -71.273  -104.685 1.00 49.13  ? 139  SER A N   1 
ATOM   952   C  CA  . SER A  1 129 ? 95.332  -70.420  -103.769 1.00 49.17  ? 139  SER A CA  1 
ATOM   953   C  C   . SER A  1 129 ? 94.240  -71.236  -103.084 1.00 50.58  ? 139  SER A C   1 
ATOM   954   O  O   . SER A  1 129 ? 93.979  -71.064  -101.890 1.00 52.57  ? 139  SER A O   1 
ATOM   955   C  CB  . SER A  1 129 ? 94.701  -69.242  -104.509 1.00 48.26  ? 139  SER A CB  1 
ATOM   956   O  OG  . SER A  1 129 ? 93.899  -68.466  -103.627 1.00 46.23  ? 139  SER A OG  1 
ATOM   957   N  N   . TYR A  1 130 ? 93.598  -72.125  -103.837 1.00 50.51  ? 140  TYR A N   1 
ATOM   958   C  CA  . TYR A  1 130 ? 92.544  -72.956  -103.271 1.00 49.17  ? 140  TYR A CA  1 
ATOM   959   C  C   . TYR A  1 130 ? 93.093  -73.800  -102.123 1.00 48.96  ? 140  TYR A C   1 
ATOM   960   O  O   . TYR A  1 130 ? 92.620  -73.682  -100.988 1.00 47.65  ? 140  TYR A O   1 
ATOM   961   C  CB  . TYR A  1 130 ? 91.939  -73.881  -104.327 1.00 48.31  ? 140  TYR A CB  1 
ATOM   962   C  CG  . TYR A  1 130 ? 90.876  -74.774  -103.747 1.00 46.96  ? 140  TYR A CG  1 
ATOM   963   C  CD1 . TYR A  1 130 ? 89.611  -74.269  -103.445 1.00 46.96  ? 140  TYR A CD1 1 
ATOM   964   C  CD2 . TYR A  1 130 ? 91.158  -76.102  -103.417 1.00 46.62  ? 140  TYR A CD2 1 
ATOM   965   C  CE1 . TYR A  1 130 ? 88.654  -75.060  -102.824 1.00 47.19  ? 140  TYR A CE1 1 
ATOM   966   C  CE2 . TYR A  1 130 ? 90.210  -76.902  -102.791 1.00 47.67  ? 140  TYR A CE2 1 
ATOM   967   C  CZ  . TYR A  1 130 ? 88.961  -76.371  -102.499 1.00 48.67  ? 140  TYR A CZ  1 
ATOM   968   O  OH  . TYR A  1 130 ? 88.017  -77.146  -101.875 1.00 52.13  ? 140  TYR A OH  1 
ATOM   969   N  N   . LEU A  1 131 ? 94.078  -74.650  -102.414 1.00 47.91  ? 141  LEU A N   1 
ATOM   970   C  CA  . LEU A  1 131 ? 94.662  -75.487  -101.374 1.00 50.21  ? 141  LEU A CA  1 
ATOM   971   C  C   . LEU A  1 131 ? 94.957  -74.689  -100.105 1.00 51.91  ? 141  LEU A C   1 
ATOM   972   O  O   . LEU A  1 131 ? 94.475  -75.031  -99.023  1.00 53.30  ? 141  LEU A O   1 
ATOM   973   C  CB  . LEU A  1 131 ? 95.954  -76.148  -101.855 1.00 49.57  ? 141  LEU A CB  1 
ATOM   974   C  CG  . LEU A  1 131 ? 95.834  -77.292  -102.858 1.00 50.02  ? 141  LEU A CG  1 
ATOM   975   C  CD1 . LEU A  1 131 ? 94.519  -78.039  -102.640 1.00 49.18  ? 141  LEU A CD1 1 
ATOM   976   C  CD2 . LEU A  1 131 ? 95.896  -76.732  -104.255 1.00 49.74  ? 141  LEU A CD2 1 
ATOM   977   N  N   . LYS A  1 132 ? 95.748  -73.627  -100.248 1.00 52.61  ? 142  LYS A N   1 
ATOM   978   C  CA  . LYS A  1 132 ? 96.118  -72.758  -99.134  1.00 52.00  ? 142  LYS A CA  1 
ATOM   979   C  C   . LYS A  1 132 ? 94.884  -72.308  -98.353  1.00 51.35  ? 142  LYS A C   1 
ATOM   980   O  O   . LYS A  1 132 ? 94.639  -72.771  -97.243  1.00 49.96  ? 142  LYS A O   1 
ATOM   981   C  CB  . LYS A  1 132 ? 96.869  -71.521  -99.655  1.00 53.41  ? 142  LYS A CB  1 
ATOM   982   C  CG  . LYS A  1 132 ? 97.848  -70.912  -98.648  1.00 55.45  ? 142  LYS A CG  1 
ATOM   983   C  CD  . LYS A  1 132 ? 98.461  -69.594  -99.116  1.00 56.93  ? 142  LYS A CD  1 
ATOM   984   C  CE  . LYS A  1 132 ? 97.495  -68.416  -98.926  1.00 59.79  ? 142  LYS A CE  1 
ATOM   985   N  NZ  . LYS A  1 132 ? 98.080  -67.089  -99.329  1.00 59.02  ? 142  LYS A NZ  1 
ATOM   986   N  N   . ASN A  1 133 ? 94.106  -71.413  -98.951  1.00 51.58  ? 143  ASN A N   1 
ATOM   987   C  CA  . ASN A  1 133 ? 92.908  -70.881  -98.312  1.00 54.09  ? 143  ASN A CA  1 
ATOM   988   C  C   . ASN A  1 133 ? 91.975  -71.889  -97.649  1.00 54.13  ? 143  ASN A C   1 
ATOM   989   O  O   . ASN A  1 133 ? 91.606  -71.731  -96.486  1.00 54.12  ? 143  ASN A O   1 
ATOM   990   C  CB  . ASN A  1 133 ? 92.072  -70.074  -99.312  1.00 57.26  ? 143  ASN A CB  1 
ATOM   991   C  CG  . ASN A  1 133 ? 92.861  -68.973  -99.984  1.00 60.47  ? 143  ASN A CG  1 
ATOM   992   O  OD1 . ASN A  1 133 ? 93.607  -68.242  -99.331  1.00 61.79  ? 143  ASN A OD1 1 
ATOM   993   N  ND2 . ASN A  1 133 ? 92.687  -68.836  -101.300 1.00 61.04  ? 143  ASN A ND2 1 
ATOM   994   N  N   . VAL A  1 134 ? 91.588  -72.922  -98.390  1.00 54.93  ? 144  VAL A N   1 
ATOM   995   C  CA  . VAL A  1 134 ? 90.638  -73.908  -97.885  1.00 53.59  ? 144  VAL A CA  1 
ATOM   996   C  C   . VAL A  1 134 ? 91.062  -74.813  -96.730  1.00 53.38  ? 144  VAL A C   1 
ATOM   997   O  O   . VAL A  1 134 ? 90.222  -75.158  -95.892  1.00 53.14  ? 144  VAL A O   1 
ATOM   998   C  CB  . VAL A  1 134 ? 90.128  -74.809  -99.022  1.00 53.87  ? 144  VAL A CB  1 
ATOM   999   C  CG1 . VAL A  1 134 ? 91.122  -75.944  -99.285  1.00 53.46  ? 144  VAL A CG1 1 
ATOM   1000  C  CG2 . VAL A  1 134 ? 88.753  -75.341  -98.674  1.00 52.95  ? 144  VAL A CG2 1 
ATOM   1001  N  N   . ALA A  1 135 ? 92.333  -75.204  -96.669  1.00 51.66  ? 145  ALA A N   1 
ATOM   1002  C  CA  . ALA A  1 135 ? 92.758  -76.086  -95.591  1.00 52.85  ? 145  ALA A CA  1 
ATOM   1003  C  C   . ALA A  1 135 ? 94.261  -76.181  -95.360  1.00 54.72  ? 145  ALA A C   1 
ATOM   1004  O  O   . ALA A  1 135 ? 94.720  -76.371  -94.230  1.00 54.25  ? 145  ALA A O   1 
ATOM   1005  C  CB  . ALA A  1 135 ? 92.194  -77.485  -95.828  1.00 51.81  ? 145  ALA A CB  1 
ATOM   1006  N  N   . LEU A  1 136 ? 95.032  -76.057  -96.429  1.00 56.62  ? 146  LEU A N   1 
ATOM   1007  C  CA  . LEU A  1 136 ? 96.475  -76.166  -96.321  1.00 57.65  ? 146  LEU A CA  1 
ATOM   1008  C  C   . LEU A  1 136 ? 97.135  -75.105  -95.434  1.00 58.68  ? 146  LEU A C   1 
ATOM   1009  O  O   . LEU A  1 136 ? 98.290  -75.266  -95.042  1.00 60.37  ? 146  LEU A O   1 
ATOM   1010  C  CB  . LEU A  1 136 ? 97.087  -76.150  -97.720  1.00 57.59  ? 146  LEU A CB  1 
ATOM   1011  C  CG  . LEU A  1 136 ? 98.496  -76.729  -97.845  1.00 57.93  ? 146  LEU A CG  1 
ATOM   1012  C  CD1 . LEU A  1 136 ? 98.560  -78.112  -97.223  1.00 55.67  ? 146  LEU A CD1 1 
ATOM   1013  C  CD2 . LEU A  1 136 ? 98.878  -76.790  -99.312  1.00 57.95  ? 146  LEU A CD2 1 
ATOM   1014  N  N   . LYS A  1 137 ? 96.414  -74.035  -95.102  1.00 58.90  ? 147  LYS A N   1 
ATOM   1015  C  CA  . LYS A  1 137 ? 96.982  -72.982  -94.253  1.00 58.72  ? 147  LYS A CA  1 
ATOM   1016  C  C   . LYS A  1 137 ? 96.601  -73.116  -92.770  1.00 61.00  ? 147  LYS A C   1 
ATOM   1017  O  O   . LYS A  1 137 ? 97.215  -72.479  -91.916  1.00 63.24  ? 147  LYS A O   1 
ATOM   1018  C  CB  . LYS A  1 137 ? 96.572  -71.591  -94.766  1.00 55.29  ? 147  LYS A CB  1 
ATOM   1019  C  CG  . LYS A  1 137 ? 95.241  -71.086  -94.231  1.00 50.85  ? 147  LYS A CG  1 
ATOM   1020  C  CD  . LYS A  1 137 ? 94.747  -69.850  -94.958  1.00 45.85  ? 147  LYS A CD  1 
ATOM   1021  C  CE  . LYS A  1 137 ? 93.395  -69.427  -94.402  1.00 45.50  ? 147  LYS A CE  1 
ATOM   1022  N  NZ  . LYS A  1 137 ? 92.735  -68.365  -95.217  1.00 48.28  ? 147  LYS A NZ  1 
ATOM   1023  N  N   . HIS A  1 138 ? 95.588  -73.926  -92.465  1.00 62.99  ? 148  HIS A N   1 
ATOM   1024  C  CA  . HIS A  1 138 ? 95.168  -74.138  -91.079  1.00 64.30  ? 148  HIS A CA  1 
ATOM   1025  C  C   . HIS A  1 138 ? 95.943  -75.307  -90.486  1.00 64.70  ? 148  HIS A C   1 
ATOM   1026  O  O   . HIS A  1 138 ? 95.590  -75.825  -89.432  1.00 65.13  ? 148  HIS A O   1 
ATOM   1027  C  CB  . HIS A  1 138 ? 93.679  -74.470  -90.986  1.00 65.96  ? 148  HIS A CB  1 
ATOM   1028  C  CG  . HIS A  1 138 ? 92.779  -73.423  -91.558  1.00 69.05  ? 148  HIS A CG  1 
ATOM   1029  N  ND1 . HIS A  1 138 ? 91.424  -73.394  -91.306  1.00 70.64  ? 148  HIS A ND1 1 
ATOM   1030  C  CD2 . HIS A  1 138 ? 93.026  -72.391  -92.398  1.00 70.84  ? 148  HIS A CD2 1 
ATOM   1031  C  CE1 . HIS A  1 138 ? 90.874  -72.391  -91.967  1.00 71.43  ? 148  HIS A CE1 1 
ATOM   1032  N  NE2 . HIS A  1 138 ? 91.825  -71.767  -92.639  1.00 72.34  ? 148  HIS A NE2 1 
HETATM 1033  N  N   . MSE A  1 139 ? 96.995  -75.728  -91.173  1.00 65.38  ? 149  MSE A N   1 
HETATM 1034  C  CA  . MSE A  1 139 ? 97.799  -76.844  -90.710  1.00 67.73  ? 149  MSE A CA  1 
HETATM 1035  C  C   . MSE A  1 139 ? 98.965  -76.400  -89.815  1.00 69.42  ? 149  MSE A C   1 
HETATM 1036  O  O   . MSE A  1 139 ? 99.378  -75.239  -89.839  1.00 69.91  ? 149  MSE A O   1 
HETATM 1037  C  CB  . MSE A  1 139 ? 98.324  -77.626  -91.920  1.00 68.01  ? 149  MSE A CB  1 
HETATM 1038  C  CG  . MSE A  1 139 ? 97.228  -78.280  -92.770  1.00 69.13  ? 149  MSE A CG  1 
HETATM 1039  SE SE  . MSE A  1 139 ? 97.910  -79.442  -94.175  1.00 71.02  ? 149  MSE A SE  1 
HETATM 1040  C  CE  . MSE A  1 139 ? 99.260  -80.360  -93.157  1.00 71.02  ? 149  MSE A CE  1 
ATOM   1041  N  N   . PRO A  1 140 ? 99.499  -77.323  -88.995  1.00 70.28  ? 150  PRO A N   1 
ATOM   1042  C  CA  . PRO A  1 140 ? 100.617 -77.022  -88.099  1.00 70.73  ? 150  PRO A CA  1 
ATOM   1043  C  C   . PRO A  1 140 ? 101.766 -76.356  -88.848  1.00 71.91  ? 150  PRO A C   1 
ATOM   1044  O  O   . PRO A  1 140 ? 102.196 -76.838  -89.895  1.00 71.91  ? 150  PRO A O   1 
ATOM   1045  C  CB  . PRO A  1 140 ? 101.004 -78.397  -87.574  1.00 70.70  ? 150  PRO A CB  1 
ATOM   1046  C  CG  . PRO A  1 140 ? 99.686  -79.081  -87.484  1.00 70.75  ? 150  PRO A CG  1 
ATOM   1047  C  CD  . PRO A  1 140 ? 99.032  -78.706  -88.792  1.00 70.41  ? 150  PRO A CD  1 
ATOM   1048  N  N   . PRO A  1 141 ? 102.282 -75.237  -88.317  1.00 73.38  ? 151  PRO A N   1 
ATOM   1049  C  CA  . PRO A  1 141 ? 103.388 -74.525  -88.963  1.00 73.61  ? 151  PRO A CA  1 
ATOM   1050  C  C   . PRO A  1 141 ? 104.493 -75.459  -89.454  1.00 74.20  ? 151  PRO A C   1 
ATOM   1051  O  O   . PRO A  1 141 ? 104.652 -76.567  -88.939  1.00 73.50  ? 151  PRO A O   1 
ATOM   1052  C  CB  . PRO A  1 141 ? 103.861 -73.585  -87.865  1.00 72.70  ? 151  PRO A CB  1 
ATOM   1053  C  CG  . PRO A  1 141 ? 102.573 -73.213  -87.200  1.00 73.00  ? 151  PRO A CG  1 
ATOM   1054  C  CD  . PRO A  1 141 ? 101.875 -74.554  -87.075  1.00 73.53  ? 151  PRO A CD  1 
ATOM   1055  N  N   . ASN A  1 142 ? 105.239 -75.013  -90.463  1.00 75.38  ? 152  ASN A N   1 
ATOM   1056  C  CA  . ASN A  1 142 ? 106.338 -75.809  -91.008  1.00 76.42  ? 152  ASN A CA  1 
ATOM   1057  C  C   . ASN A  1 142 ? 105.769 -77.067  -91.676  1.00 76.24  ? 152  ASN A C   1 
ATOM   1058  O  O   . ASN A  1 142 ? 106.405 -78.121  -91.696  1.00 76.20  ? 152  ASN A O   1 
ATOM   1059  C  CB  . ASN A  1 142 ? 107.298 -76.185  -89.861  1.00 77.37  ? 152  ASN A CB  1 
ATOM   1060  C  CG  . ASN A  1 142 ? 108.725 -76.452  -90.332  1.00 78.08  ? 152  ASN A CG  1 
ATOM   1061  O  OD1 . ASN A  1 142 ? 109.312 -75.653  -91.065  1.00 77.69  ? 152  ASN A OD1 1 
ATOM   1062  N  ND2 . ASN A  1 142 ? 109.297 -77.572  -89.887  1.00 78.66  ? 152  ASN A ND2 1 
ATOM   1063  N  N   . LEU A  1 143 ? 104.572 -76.943  -92.240  1.00 75.81  ? 153  LEU A N   1 
ATOM   1064  C  CA  . LEU A  1 143 ? 103.913 -78.077  -92.879  1.00 75.21  ? 153  LEU A CA  1 
ATOM   1065  C  C   . LEU A  1 143 ? 102.654 -77.584  -93.592  1.00 75.13  ? 153  LEU A C   1 
ATOM   1066  O  O   . LEU A  1 143 ? 101.784 -78.375  -93.974  1.00 74.26  ? 153  LEU A O   1 
ATOM   1067  C  CB  . LEU A  1 143 ? 103.533 -79.098  -91.805  1.00 74.19  ? 153  LEU A CB  1 
ATOM   1068  C  CG  . LEU A  1 143 ? 103.034 -80.482  -92.206  1.00 73.80  ? 153  LEU A CG  1 
ATOM   1069  C  CD1 . LEU A  1 143 ? 104.164 -81.262  -92.864  1.00 73.61  ? 153  LEU A CD1 1 
ATOM   1070  C  CD2 . LEU A  1 143 ? 102.534 -81.209  -90.966  1.00 72.87  ? 153  LEU A CD2 1 
ATOM   1071  N  N   . GLN A  1 144 ? 102.572 -76.267  -93.764  1.00 74.67  ? 154  GLN A N   1 
ATOM   1072  C  CA  . GLN A  1 144 ? 101.429 -75.631  -94.407  1.00 74.23  ? 154  GLN A CA  1 
ATOM   1073  C  C   . GLN A  1 144 ? 101.618 -75.457  -95.906  1.00 74.61  ? 154  GLN A C   1 
ATOM   1074  O  O   . GLN A  1 144 ? 100.727 -74.959  -96.591  1.00 75.29  ? 154  GLN A O   1 
ATOM   1075  C  CB  . GLN A  1 144 ? 101.185 -74.249  -93.810  1.00 73.60  ? 154  GLN A CB  1 
ATOM   1076  C  CG  . GLN A  1 144 ? 101.095 -74.188  -92.305  1.00 73.23  ? 154  GLN A CG  1 
ATOM   1077  C  CD  . GLN A  1 144 ? 100.755 -72.791  -91.835  1.00 73.05  ? 154  GLN A CD  1 
ATOM   1078  O  OE1 . GLN A  1 144 ? 101.428 -71.829  -92.199  1.00 73.23  ? 154  GLN A OE1 1 
ATOM   1079  N  NE2 . GLN A  1 144 ? 99.703  -72.668  -91.029  1.00 72.28  ? 154  GLN A NE2 1 
ATOM   1080  N  N   . LYS A  1 145 ? 102.777 -75.842  -96.420  1.00 74.45  ? 155  LYS A N   1 
ATOM   1081  C  CA  . LYS A  1 145 ? 103.035 -75.686  -97.839  1.00 75.25  ? 155  LYS A CA  1 
ATOM   1082  C  C   . LYS A  1 145 ? 103.233 -77.035  -98.490  1.00 76.15  ? 155  LYS A C   1 
ATOM   1083  O  O   . LYS A  1 145 ? 103.689 -77.976  -97.843  1.00 77.62  ? 155  LYS A O   1 
ATOM   1084  C  CB  . LYS A  1 145 ? 104.268 -74.805  -98.045  1.00 76.15  ? 155  LYS A CB  1 
ATOM   1085  C  CG  . LYS A  1 145 ? 104.089 -73.410  -97.468  1.00 78.53  ? 155  LYS A CG  1 
ATOM   1086  C  CD  . LYS A  1 145 ? 105.346 -72.558  -97.550  1.00 80.29  ? 155  LYS A CD  1 
ATOM   1087  C  CE  . LYS A  1 145 ? 105.113 -71.202  -96.880  1.00 81.27  ? 155  LYS A CE  1 
ATOM   1088  N  NZ  . LYS A  1 145 ? 106.330 -70.346  -96.876  1.00 81.69  ? 155  LYS A NZ  1 
ATOM   1089  N  N   . VAL A  1 146 ? 102.874 -77.129  -99.770  1.00 76.07  ? 156  VAL A N   1 
ATOM   1090  C  CA  . VAL A  1 146 ? 103.012 -78.373  -100.522 1.00 75.00  ? 156  VAL A CA  1 
ATOM   1091  C  C   . VAL A  1 146 ? 103.669 -78.115  -101.867 1.00 73.29  ? 156  VAL A C   1 
ATOM   1092  O  O   . VAL A  1 146 ? 103.327 -77.158  -102.562 1.00 73.42  ? 156  VAL A O   1 
ATOM   1093  C  CB  . VAL A  1 146 ? 101.635 -79.039  -100.757 1.00 76.46  ? 156  VAL A CB  1 
ATOM   1094  C  CG1 . VAL A  1 146 ? 101.791 -80.271  -101.644 1.00 77.12  ? 156  VAL A CG1 1 
ATOM   1095  C  CG2 . VAL A  1 146 ? 101.011 -79.428  -99.419  1.00 77.20  ? 156  VAL A CG2 1 
ATOM   1096  N  N   . ASP A  1 147 ? 104.614 -78.974  -102.229 1.00 71.75  ? 157  ASP A N   1 
ATOM   1097  C  CA  . ASP A  1 147 ? 105.323 -78.837  -103.492 1.00 71.56  ? 157  ASP A CA  1 
ATOM   1098  C  C   . ASP A  1 147 ? 104.600 -79.559  -104.619 1.00 70.68  ? 157  ASP A C   1 
ATOM   1099  O  O   . ASP A  1 147 ? 104.924 -80.708  -104.950 1.00 69.85  ? 157  ASP A O   1 
ATOM   1100  C  CB  . ASP A  1 147 ? 106.743 -79.387  -103.358 1.00 73.89  ? 157  ASP A CB  1 
ATOM   1101  C  CG  . ASP A  1 147 ? 107.475 -79.438  -104.684 1.00 74.65  ? 157  ASP A CG  1 
ATOM   1102  O  OD1 . ASP A  1 147 ? 107.599 -78.371  -105.329 1.00 75.52  ? 157  ASP A OD1 1 
ATOM   1103  O  OD2 . ASP A  1 147 ? 107.922 -80.544  -105.071 1.00 73.27  ? 157  ASP A OD2 1 
ATOM   1104  N  N   . LEU A  1 148 ? 103.621 -78.877  -105.208 1.00 69.37  ? 158  LEU A N   1 
ATOM   1105  C  CA  . LEU A  1 148 ? 102.845 -79.447  -106.296 1.00 67.85  ? 158  LEU A CA  1 
ATOM   1106  C  C   . LEU A  1 148 ? 103.775 -80.086  -107.302 1.00 68.30  ? 158  LEU A C   1 
ATOM   1107  O  O   . LEU A  1 148 ? 103.426 -81.065  -107.951 1.00 68.79  ? 158  LEU A O   1 
ATOM   1108  C  CB  . LEU A  1 148 ? 102.004 -78.367  -106.973 1.00 65.80  ? 158  LEU A CB  1 
ATOM   1109  C  CG  . LEU A  1 148 ? 100.863 -77.824  -106.115 1.00 64.97  ? 158  LEU A CG  1 
ATOM   1110  C  CD1 . LEU A  1 148 ? 100.033 -76.828  -106.909 1.00 64.29  ? 158  LEU A CD1 1 
ATOM   1111  C  CD2 . LEU A  1 148 ? 100.001 -78.978  -105.653 1.00 63.54  ? 158  LEU A CD2 1 
ATOM   1112  N  N   . PHE A  1 149 ? 104.976 -79.539  -107.414 1.00 69.36  ? 159  PHE A N   1 
ATOM   1113  C  CA  . PHE A  1 149 ? 105.952 -80.068  -108.348 1.00 69.90  ? 159  PHE A CA  1 
ATOM   1114  C  C   . PHE A  1 149 ? 106.304 -81.523  -108.084 1.00 69.20  ? 159  PHE A C   1 
ATOM   1115  O  O   . PHE A  1 149 ? 107.068 -82.127  -108.835 1.00 69.24  ? 159  PHE A O   1 
ATOM   1116  C  CB  . PHE A  1 149 ? 107.226 -79.239  -108.313 1.00 72.53  ? 159  PHE A CB  1 
ATOM   1117  C  CG  . PHE A  1 149 ? 107.653 -78.762  -109.657 1.00 75.02  ? 159  PHE A CG  1 
ATOM   1118  C  CD1 . PHE A  1 149 ? 107.242 -77.519  -110.129 1.00 76.47  ? 159  PHE A CD1 1 
ATOM   1119  C  CD2 . PHE A  1 149 ? 108.411 -79.581  -110.483 1.00 75.91  ? 159  PHE A CD2 1 
ATOM   1120  C  CE1 . PHE A  1 149 ? 107.580 -77.099  -111.411 1.00 77.09  ? 159  PHE A CE1 1 
ATOM   1121  C  CE2 . PHE A  1 149 ? 108.753 -79.171  -111.766 1.00 77.32  ? 159  PHE A CE2 1 
ATOM   1122  C  CZ  . PHE A  1 149 ? 108.335 -77.929  -112.228 1.00 76.79  ? 159  PHE A CZ  1 
ATOM   1123  N  N   . ARG A  1 150 ? 105.764 -82.087  -107.014 1.00 68.30  ? 160  ARG A N   1 
ATOM   1124  C  CA  . ARG A  1 150 ? 106.046 -83.473  -106.700 1.00 67.79  ? 160  ARG A CA  1 
ATOM   1125  C  C   . ARG A  1 150 ? 104.763 -84.142  -106.244 1.00 66.90  ? 160  ARG A C   1 
ATOM   1126  O  O   . ARG A  1 150 ? 104.689 -85.364  -106.134 1.00 65.89  ? 160  ARG A O   1 
ATOM   1127  C  CB  . ARG A  1 150 ? 107.106 -83.552  -105.612 1.00 69.85  ? 160  ARG A CB  1 
ATOM   1128  C  CG  . ARG A  1 150 ? 108.083 -84.705  -105.774 1.00 71.81  ? 160  ARG A CG  1 
ATOM   1129  C  CD  . ARG A  1 150 ? 109.074 -84.683  -104.638 1.00 74.51  ? 160  ARG A CD  1 
ATOM   1130  N  NE  . ARG A  1 150 ? 109.645 -83.347  -104.483 1.00 77.37  ? 160  ARG A NE  1 
ATOM   1131  C  CZ  . ARG A  1 150 ? 110.257 -82.912  -103.385 1.00 78.40  ? 160  ARG A CZ  1 
ATOM   1132  N  NH1 . ARG A  1 150 ? 110.745 -81.677  -103.345 1.00 79.03  ? 160  ARG A NH1 1 
ATOM   1133  N  NH2 . ARG A  1 150 ? 110.372 -83.707  -102.326 1.00 78.94  ? 160  ARG A NH2 1 
ATOM   1134  N  N   . ALA A  1 151 ? 103.749 -83.325  -105.986 1.00 66.60  ? 161  ALA A N   1 
ATOM   1135  C  CA  . ALA A  1 151 ? 102.442 -83.822  -105.563 1.00 65.97  ? 161  ALA A CA  1 
ATOM   1136  C  C   . ALA A  1 151 ? 101.715 -84.400  -106.775 1.00 64.81  ? 161  ALA A C   1 
ATOM   1137  O  O   . ALA A  1 151 ? 101.149 -85.494  -106.715 1.00 64.15  ? 161  ALA A O   1 
ATOM   1138  C  CB  . ALA A  1 151 ? 101.622 -82.686  -104.950 1.00 65.74  ? 161  ALA A CB  1 
ATOM   1139  N  N   . VAL A  1 152 ? 101.742 -83.650  -107.874 1.00 64.05  ? 162  VAL A N   1 
ATOM   1140  C  CA  . VAL A  1 152 ? 101.104 -84.054  -109.123 1.00 63.02  ? 162  VAL A CA  1 
ATOM   1141  C  C   . VAL A  1 152 ? 102.027 -84.963  -109.920 1.00 63.18  ? 162  VAL A C   1 
ATOM   1142  O  O   . VAL A  1 152 ? 103.161 -84.600  -110.212 1.00 63.62  ? 162  VAL A O   1 
ATOM   1143  C  CB  . VAL A  1 152 ? 100.786 -82.837  -109.995 1.00 61.60  ? 162  VAL A CB  1 
ATOM   1144  C  CG1 . VAL A  1 152 ? 100.248 -83.295  -111.336 1.00 63.07  ? 162  VAL A CG1 1 
ATOM   1145  C  CG2 . VAL A  1 152 ? 99.793  -81.938  -109.289 1.00 60.41  ? 162  VAL A CG2 1 
ATOM   1146  N  N   . PRO A  1 153 ? 101.554 -86.158  -110.291 1.00 63.60  ? 163  PRO A N   1 
ATOM   1147  C  CA  . PRO A  1 153 ? 102.424 -87.051  -111.060 1.00 65.02  ? 163  PRO A CA  1 
ATOM   1148  C  C   . PRO A  1 153 ? 102.787 -86.484  -112.430 1.00 67.02  ? 163  PRO A C   1 
ATOM   1149  O  O   . PRO A  1 153 ? 102.083 -85.616  -112.961 1.00 68.02  ? 163  PRO A O   1 
ATOM   1150  C  CB  . PRO A  1 153 ? 101.614 -88.342  -111.144 1.00 63.23  ? 163  PRO A CB  1 
ATOM   1151  C  CG  . PRO A  1 153 ? 100.208 -87.865  -111.079 1.00 64.25  ? 163  PRO A CG  1 
ATOM   1152  C  CD  . PRO A  1 153 ? 100.248 -86.782  -110.032 1.00 63.48  ? 163  PRO A CD  1 
ATOM   1153  N  N   . LYS A  1 154 ? 103.896 -86.975  -112.981 1.00 68.36  ? 164  LYS A N   1 
ATOM   1154  C  CA  . LYS A  1 154 ? 104.402 -86.546  -114.284 1.00 68.86  ? 164  LYS A CA  1 
ATOM   1155  C  C   . LYS A  1 154 ? 104.014 -87.551  -115.358 1.00 68.82  ? 164  LYS A C   1 
ATOM   1156  O  O   . LYS A  1 154 ? 103.799 -88.727  -115.065 1.00 68.59  ? 164  LYS A O   1 
ATOM   1157  C  CB  . LYS A  1 154 ? 105.933 -86.428  -114.247 1.00 70.68  ? 164  LYS A CB  1 
ATOM   1158  C  CG  . LYS A  1 154 ? 106.645 -87.671  -113.692 1.00 73.03  ? 164  LYS A CG  1 
ATOM   1159  C  CD  . LYS A  1 154 ? 108.064 -87.834  -114.248 1.00 73.47  ? 164  LYS A CD  1 
ATOM   1160  C  CE  . LYS A  1 154 ? 108.954 -86.642  -113.923 1.00 74.28  ? 164  LYS A CE  1 
ATOM   1161  N  NZ  . LYS A  1 154 ? 110.305 -86.771  -114.548 1.00 74.38  ? 164  LYS A NZ  1 
ATOM   1162  N  N   . PRO A  1 155 ? 103.926 -87.103  -116.622 1.00 68.82  ? 165  PRO A N   1 
ATOM   1163  C  CA  . PRO A  1 155 ? 103.559 -88.046  -117.676 1.00 69.02  ? 165  PRO A CA  1 
ATOM   1164  C  C   . PRO A  1 155 ? 104.499 -89.232  -117.680 1.00 69.38  ? 165  PRO A C   1 
ATOM   1165  O  O   . PRO A  1 155 ? 105.716 -89.069  -117.658 1.00 70.05  ? 165  PRO A O   1 
ATOM   1166  C  CB  . PRO A  1 155 ? 103.657 -87.205  -118.948 1.00 68.88  ? 165  PRO A CB  1 
ATOM   1167  C  CG  . PRO A  1 155 ? 104.629 -86.134  -118.594 1.00 68.64  ? 165  PRO A CG  1 
ATOM   1168  C  CD  . PRO A  1 155 ? 104.218 -85.778  -117.190 1.00 68.80  ? 165  PRO A CD  1 
ATOM   1169  N  N   . ASP A  1 156 ? 103.915 -90.424  -117.679 1.00 70.82  ? 166  ASP A N   1 
ATOM   1170  C  CA  . ASP A  1 156 ? 104.667 -91.668  -117.690 1.00 71.45  ? 166  ASP A CA  1 
ATOM   1171  C  C   . ASP A  1 156 ? 105.100 -91.938  -119.123 1.00 72.60  ? 166  ASP A C   1 
ATOM   1172  O  O   . ASP A  1 156 ? 104.302 -92.391  -119.942 1.00 72.62  ? 166  ASP A O   1 
ATOM   1173  C  CB  . ASP A  1 156 ? 103.784 -92.811  -117.186 1.00 71.47  ? 166  ASP A CB  1 
ATOM   1174  C  CG  . ASP A  1 156 ? 104.468 -94.162  -117.265 1.00 73.10  ? 166  ASP A CG  1 
ATOM   1175  O  OD1 . ASP A  1 156 ? 104.875 -94.556  -118.377 1.00 74.84  ? 166  ASP A OD1 1 
ATOM   1176  O  OD2 . ASP A  1 156 ? 104.594 -94.839  -116.221 1.00 73.99  ? 166  ASP A OD2 1 
ATOM   1177  N  N   . LEU A  1 157 ? 106.364 -91.646  -119.419 1.00 73.68  ? 167  LEU A N   1 
ATOM   1178  C  CA  . LEU A  1 157 ? 106.914 -91.853  -120.754 1.00 74.67  ? 167  LEU A CA  1 
ATOM   1179  C  C   . LEU A  1 157 ? 107.025 -93.342  -121.059 1.00 77.27  ? 167  LEU A C   1 
ATOM   1180  O  O   . LEU A  1 157 ? 106.871 -93.762  -122.199 1.00 78.65  ? 167  LEU A O   1 
ATOM   1181  C  CB  . LEU A  1 157 ? 108.306 -91.229  -120.856 1.00 72.02  ? 167  LEU A CB  1 
ATOM   1182  C  CG  . LEU A  1 157 ? 108.552 -89.867  -120.205 1.00 71.16  ? 167  LEU A CG  1 
ATOM   1183  C  CD1 . LEU A  1 157 ? 110.029 -89.524  -120.329 1.00 69.99  ? 167  LEU A CD1 1 
ATOM   1184  C  CD2 . LEU A  1 157 ? 107.691 -88.798  -120.851 1.00 69.74  ? 167  LEU A CD2 1 
ATOM   1185  N  N   . ASP A  1 158 ? 107.285 -94.135  -120.026 1.00 80.47  ? 168  ASP A N   1 
ATOM   1186  C  CA  . ASP A  1 158 ? 107.458 -95.579  -120.167 1.00 83.55  ? 168  ASP A CA  1 
ATOM   1187  C  C   . ASP A  1 158 ? 106.163 -96.373  -120.328 1.00 84.78  ? 168  ASP A C   1 
ATOM   1188  O  O   . ASP A  1 158 ? 106.120 -97.569  -120.030 1.00 84.25  ? 168  ASP A O   1 
ATOM   1189  C  CB  . ASP A  1 158 ? 108.247 -96.113  -118.963 1.00 85.22  ? 168  ASP A CB  1 
ATOM   1190  C  CG  . ASP A  1 158 ? 109.644 -95.497  -118.850 1.00 86.12  ? 168  ASP A CG  1 
ATOM   1191  O  OD1 . ASP A  1 158 ? 110.535 -95.889  -119.634 1.00 86.93  ? 168  ASP A OD1 1 
ATOM   1192  O  OD2 . ASP A  1 158 ? 109.847 -94.617  -117.983 1.00 85.61  ? 168  ASP A OD2 1 
ATOM   1193  N  N   . SER A  1 159 ? 105.111 -95.716  -120.803 1.00 86.91  ? 169  SER A N   1 
ATOM   1194  C  CA  . SER A  1 159 ? 103.830 -96.389  -120.993 1.00 90.06  ? 169  SER A CA  1 
ATOM   1195  C  C   . SER A  1 159 ? 103.632 -96.878  -122.430 1.00 91.77  ? 169  SER A C   1 
ATOM   1196  O  O   . SER A  1 159 ? 104.027 -96.213  -123.387 1.00 92.01  ? 169  SER A O   1 
ATOM   1197  C  CB  . SER A  1 159 ? 102.674 -95.464  -120.580 1.00 89.83  ? 169  SER A CB  1 
ATOM   1198  O  OG  . SER A  1 159 ? 102.769 -94.192  -121.198 1.00 89.82  ? 169  SER A OG  1 
ATOM   1199  N  N   . TYR A  1 160 ? 103.021 -98.050  -122.567 1.00 93.93  ? 170  TYR A N   1 
ATOM   1200  C  CA  . TYR A  1 160 ? 102.773 -98.649  -123.872 1.00 96.55  ? 170  TYR A CA  1 
ATOM   1201  C  C   . TYR A  1 160 ? 101.727 -97.899  -124.685 1.00 97.33  ? 170  TYR A C   1 
ATOM   1202  O  O   . TYR A  1 160 ? 100.695 -97.489  -124.161 1.00 97.72  ? 170  TYR A O   1 
ATOM   1203  C  CB  . TYR A  1 160 ? 102.336 -100.106 -123.706 1.00 99.08  ? 170  TYR A CB  1 
ATOM   1204  C  CG  . TYR A  1 160 ? 103.432 -101.022 -123.210 1.00 102.35 ? 170  TYR A CG  1 
ATOM   1205  C  CD1 . TYR A  1 160 ? 103.998 -100.846 -121.944 1.00 103.57 ? 170  TYR A CD1 1 
ATOM   1206  C  CD2 . TYR A  1 160 ? 103.918 -102.055 -124.013 1.00 103.07 ? 170  TYR A CD2 1 
ATOM   1207  C  CE1 . TYR A  1 160 ? 105.018 -101.676 -121.494 1.00 103.98 ? 170  TYR A CE1 1 
ATOM   1208  C  CE2 . TYR A  1 160 ? 104.938 -102.889 -123.572 1.00 103.60 ? 170  TYR A CE2 1 
ATOM   1209  C  CZ  . TYR A  1 160 ? 105.483 -102.694 -122.314 1.00 104.02 ? 170  TYR A CZ  1 
ATOM   1210  O  OH  . TYR A  1 160 ? 106.494 -103.515 -121.875 1.00 104.90 ? 170  TYR A OH  1 
ATOM   1211  N  N   . VAL A  1 161 ? 101.998 -97.735  -125.974 1.00 98.23  ? 171  VAL A N   1 
ATOM   1212  C  CA  . VAL A  1 161 ? 101.082 -97.036  -126.861 1.00 98.84  ? 171  VAL A CA  1 
ATOM   1213  C  C   . VAL A  1 161 ? 100.886 -97.829  -128.152 1.00 100.43 ? 171  VAL A C   1 
ATOM   1214  O  O   . VAL A  1 161 ? 101.017 -99.054  -128.171 1.00 100.14 ? 171  VAL A O   1 
ATOM   1215  C  CB  . VAL A  1 161 ? 101.624 -95.637  -127.211 1.00 97.42  ? 171  VAL A CB  1 
ATOM   1216  C  CG1 . VAL A  1 161 ? 100.518 -94.780  -127.800 1.00 97.79  ? 171  VAL A CG1 1 
ATOM   1217  C  CG2 . VAL A  1 161 ? 102.195 -94.981  -125.973 1.00 96.74  ? 171  VAL A CG2 1 
ATOM   1218  N  N   . PHE A  1 162 ? 100.554 -97.116  -129.222 1.00 102.40 ? 172  PHE A N   1 
ATOM   1219  C  CA  . PHE A  1 162 ? 100.348 -97.707  -130.535 1.00 104.29 ? 172  PHE A CA  1 
ATOM   1220  C  C   . PHE A  1 162 ? 100.870 -96.735  -131.588 1.00 104.60 ? 172  PHE A C   1 
ATOM   1221  O  O   . PHE A  1 162 ? 100.387 -95.606  -131.694 1.00 104.16 ? 172  PHE A O   1 
ATOM   1222  C  CB  . PHE A  1 162 ? 98.866  -97.971  -130.792 1.00 105.97 ? 172  PHE A CB  1 
ATOM   1223  C  CG  . PHE A  1 162 ? 98.499  -97.918  -132.246 1.00 109.40 ? 172  PHE A CG  1 
ATOM   1224  C  CD1 . PHE A  1 162 ? 98.988  -98.868  -133.136 1.00 110.59 ? 172  PHE A CD1 1 
ATOM   1225  C  CD2 . PHE A  1 162 ? 97.729  -96.869  -132.744 1.00 110.70 ? 172  PHE A CD2 1 
ATOM   1226  C  CE1 . PHE A  1 162 ? 98.719  -98.771  -134.505 1.00 111.31 ? 172  PHE A CE1 1 
ATOM   1227  C  CE2 . PHE A  1 162 ? 97.454  -96.761  -134.108 1.00 110.85 ? 172  PHE A CE2 1 
ATOM   1228  C  CZ  . PHE A  1 162 ? 97.951  -97.712  -134.990 1.00 111.17 ? 172  PHE A CZ  1 
ATOM   1229  N  N   . LEU A  1 163 ? 101.853 -97.179  -132.365 1.00 105.30 ? 173  LEU A N   1 
ATOM   1230  C  CA  . LEU A  1 163 ? 102.444 -96.349  -133.408 1.00 105.95 ? 173  LEU A CA  1 
ATOM   1231  C  C   . LEU A  1 163 ? 102.245 -96.975  -134.778 1.00 106.27 ? 173  LEU A C   1 
ATOM   1232  O  O   . LEU A  1 163 ? 102.322 -98.193  -134.932 1.00 106.25 ? 173  LEU A O   1 
ATOM   1233  C  CB  . LEU A  1 163 ? 103.936 -96.148  -133.140 1.00 106.48 ? 173  LEU A CB  1 
ATOM   1234  C  CG  . LEU A  1 163 ? 104.748 -95.367  -134.176 1.00 107.18 ? 173  LEU A CG  1 
ATOM   1235  C  CD1 . LEU A  1 163 ? 106.017 -94.852  -133.530 1.00 107.52 ? 173  LEU A CD1 1 
ATOM   1236  C  CD2 . LEU A  1 163 ? 105.077 -96.250  -135.373 1.00 107.87 ? 173  LEU A CD2 1 
ATOM   1237  N  N   . ARG A  1 164 ? 102.004 -96.125  -135.771 1.00 106.68 ? 174  ARG A N   1 
ATOM   1238  C  CA  . ARG A  1 164 ? 101.777 -96.570  -137.141 1.00 107.10 ? 174  ARG A CA  1 
ATOM   1239  C  C   . ARG A  1 164 ? 102.978 -96.264  -138.030 1.00 106.56 ? 174  ARG A C   1 
ATOM   1240  O  O   . ARG A  1 164 ? 103.496 -95.147  -138.029 1.00 106.47 ? 174  ARG A O   1 
ATOM   1241  C  CB  . ARG A  1 164 ? 100.522 -95.882  -137.687 1.00 108.22 ? 174  ARG A CB  1 
ATOM   1242  C  CG  . ARG A  1 164 ? 100.103 -96.286  -139.093 1.00 109.01 ? 174  ARG A CG  1 
ATOM   1243  C  CD  . ARG A  1 164 ? 98.761  -95.651  -139.436 1.00 109.00 ? 174  ARG A CD  1 
ATOM   1244  N  NE  . ARG A  1 164 ? 98.401  -95.812  -140.841 1.00 109.06 ? 174  ARG A NE  1 
ATOM   1245  C  CZ  . ARG A  1 164 ? 97.276  -95.354  -141.377 1.00 108.88 ? 174  ARG A CZ  1 
ATOM   1246  N  NH1 . ARG A  1 164 ? 97.027  -95.541  -142.666 1.00 108.75 ? 174  ARG A NH1 1 
ATOM   1247  N  NH2 . ARG A  1 164 ? 96.396  -94.711  -140.620 1.00 108.66 ? 174  ARG A NH2 1 
ATOM   1248  N  N   . SER A  1 192 ? 102.877 -100.377 -141.800 1.00 104.72 ? 202  SER A N   1 
ATOM   1249  C  CA  . SER A  1 192 ? 103.634 -101.019 -140.732 1.00 105.19 ? 202  SER A CA  1 
ATOM   1250  C  C   . SER A  1 192 ? 103.313 -100.404 -139.368 1.00 105.61 ? 202  SER A C   1 
ATOM   1251  O  O   . SER A  1 192 ? 104.025 -99.515  -138.892 1.00 105.97 ? 202  SER A O   1 
ATOM   1252  C  CB  . SER A  1 192 ? 105.131 -100.898 -141.014 1.00 104.67 ? 202  SER A CB  1 
ATOM   1253  O  OG  . SER A  1 192 ? 105.887 -101.517 -139.992 1.00 104.37 ? 202  SER A OG  1 
ATOM   1254  N  N   . GLN A  1 193 ? 102.240 -100.884 -138.745 1.00 105.46 ? 203  GLN A N   1 
ATOM   1255  C  CA  . GLN A  1 193 ? 101.817 -100.381 -137.441 1.00 105.22 ? 203  GLN A CA  1 
ATOM   1256  C  C   . GLN A  1 193 ? 101.923 -101.442 -136.342 1.00 104.90 ? 203  GLN A C   1 
ATOM   1257  O  O   . GLN A  1 193 ? 101.707 -102.631 -136.580 1.00 104.62 ? 203  GLN A O   1 
ATOM   1258  C  CB  . GLN A  1 193 ? 100.385 -99.839  -137.529 1.00 105.52 ? 203  GLN A CB  1 
ATOM   1259  C  CG  . GLN A  1 193 ? 99.411  -100.742 -138.276 1.00 105.88 ? 203  GLN A CG  1 
ATOM   1260  C  CD  . GLN A  1 193 ? 97.998  -100.183 -138.308 1.00 105.65 ? 203  GLN A CD  1 
ATOM   1261  O  OE1 . GLN A  1 193 ? 97.783  -99.021  -138.665 1.00 104.68 ? 203  GLN A OE1 1 
ATOM   1262  N  NE2 . GLN A  1 193 ? 97.025  -101.013 -137.940 1.00 105.07 ? 203  GLN A NE2 1 
ATOM   1263  N  N   . HIS A  1 194 ? 102.247 -100.993 -135.132 1.00 104.44 ? 204  HIS A N   1 
ATOM   1264  C  CA  . HIS A  1 194 ? 102.421 -101.889 -133.991 1.00 103.28 ? 204  HIS A CA  1 
ATOM   1265  C  C   . HIS A  1 194 ? 102.365 -101.135 -132.656 1.00 102.02 ? 204  HIS A C   1 
ATOM   1266  O  O   . HIS A  1 194 ? 102.080 -99.936  -132.626 1.00 101.58 ? 204  HIS A O   1 
ATOM   1267  C  CB  . HIS A  1 194 ? 103.764 -102.612 -134.129 1.00 103.43 ? 204  HIS A CB  1 
ATOM   1268  C  CG  . HIS A  1 194 ? 104.897 -101.708 -134.510 1.00 103.49 ? 204  HIS A CG  1 
ATOM   1269  N  ND1 . HIS A  1 194 ? 106.140 -102.183 -134.866 1.00 103.54 ? 204  HIS A ND1 1 
ATOM   1270  C  CD2 . HIS A  1 194 ? 104.970 -100.358 -134.601 1.00 103.38 ? 204  HIS A CD2 1 
ATOM   1271  C  CE1 . HIS A  1 194 ? 106.930 -101.166 -135.163 1.00 103.48 ? 204  HIS A CE1 1 
ATOM   1272  N  NE2 . HIS A  1 194 ? 106.244 -100.048 -135.010 1.00 103.43 ? 204  HIS A NE2 1 
ATOM   1273  N  N   . LEU A  1 195 ? 102.637 -101.846 -131.560 1.00 100.62 ? 205  LEU A N   1 
ATOM   1274  C  CA  . LEU A  1 195 ? 102.618 -101.252 -130.220 1.00 98.91  ? 205  LEU A CA  1 
ATOM   1275  C  C   . LEU A  1 195 ? 103.874 -101.569 -129.411 1.00 97.92  ? 205  LEU A C   1 
ATOM   1276  O  O   . LEU A  1 195 ? 104.461 -102.643 -129.553 1.00 97.67  ? 205  LEU A O   1 
ATOM   1277  C  CB  . LEU A  1 195 ? 101.374 -101.718 -129.444 1.00 98.16  ? 205  LEU A CB  1 
ATOM   1278  C  CG  . LEU A  1 195 ? 101.108 -103.211 -129.207 1.00 96.87  ? 205  LEU A CG  1 
ATOM   1279  C  CD1 . LEU A  1 195 ? 102.112 -103.793 -128.231 1.00 95.55  ? 205  LEU A CD1 1 
ATOM   1280  C  CD2 . LEU A  1 195 ? 99.701  -103.374 -128.658 1.00 95.79  ? 205  LEU A CD2 1 
ATOM   1281  N  N   . ILE A  1 196 ? 104.273 -100.625 -128.558 1.00 96.73  ? 206  ILE A N   1 
ATOM   1282  C  CA  . ILE A  1 196 ? 105.455 -100.782 -127.715 1.00 95.08  ? 206  ILE A CA  1 
ATOM   1283  C  C   . ILE A  1 196 ? 105.682 -99.536  -126.854 1.00 93.44  ? 206  ILE A C   1 
ATOM   1284  O  O   . ILE A  1 196 ? 105.270 -98.440  -127.228 1.00 93.81  ? 206  ILE A O   1 
ATOM   1285  C  CB  . ILE A  1 196 ? 106.709 -101.032 -128.578 1.00 95.98  ? 206  ILE A CB  1 
ATOM   1286  C  CG1 . ILE A  1 196 ? 107.893 -101.409 -127.679 1.00 96.69  ? 206  ILE A CG1 1 
ATOM   1287  C  CG2 . ILE A  1 196 ? 107.012 -99.795  -129.419 1.00 94.19  ? 206  ILE A CG2 1 
ATOM   1288  C  CD1 . ILE A  1 196 ? 109.100 -101.940 -128.435 1.00 96.97  ? 206  ILE A CD1 1 
ATOM   1289  N  N   . ARG A  1 197 ? 106.343 -99.704  -125.710 1.00 90.69  ? 207  ARG A N   1 
ATOM   1290  C  CA  . ARG A  1 197 ? 106.614 -98.588  -124.805 1.00 87.56  ? 207  ARG A CA  1 
ATOM   1291  C  C   . ARG A  1 197 ? 106.926 -97.306  -125.562 1.00 85.15  ? 207  ARG A C   1 
ATOM   1292  O  O   . ARG A  1 197 ? 107.715 -97.302  -126.498 1.00 83.93  ? 207  ARG A O   1 
ATOM   1293  C  CB  . ARG A  1 197 ? 107.777 -98.926  -123.869 1.00 88.31  ? 207  ARG A CB  1 
ATOM   1294  C  CG  . ARG A  1 197 ? 107.543 -100.170 -123.034 1.00 88.43  ? 207  ARG A CG  1 
ATOM   1295  C  CD  . ARG A  1 197 ? 108.572 -100.339 -121.918 1.00 88.94  ? 207  ARG A CD  1 
ATOM   1296  N  NE  . ARG A  1 197 ? 109.941 -100.527 -122.398 1.00 90.11  ? 207  ARG A NE  1 
ATOM   1297  C  CZ  . ARG A  1 197 ? 110.840 -99.553  -122.514 1.00 90.45  ? 207  ARG A CZ  1 
ATOM   1298  N  NH1 . ARG A  1 197 ? 110.522 -98.308  -122.183 1.00 90.74  ? 207  ARG A NH1 1 
ATOM   1299  N  NH2 . ARG A  1 197 ? 112.061 -99.826  -122.956 1.00 90.58  ? 207  ARG A NH2 1 
ATOM   1300  N  N   . TYR A  1 198 ? 106.298 -96.217  -125.142 1.00 83.59  ? 208  TYR A N   1 
ATOM   1301  C  CA  . TYR A  1 198 ? 106.485 -94.925  -125.781 1.00 82.72  ? 208  TYR A CA  1 
ATOM   1302  C  C   . TYR A  1 198 ? 107.874 -94.333  -125.623 1.00 84.19  ? 208  TYR A C   1 
ATOM   1303  O  O   . TYR A  1 198 ? 108.383 -93.712  -126.549 1.00 84.24  ? 208  TYR A O   1 
ATOM   1304  C  CB  . TYR A  1 198 ? 105.443 -93.933  -125.255 1.00 79.41  ? 208  TYR A CB  1 
ATOM   1305  C  CG  . TYR A  1 198 ? 105.698 -92.485  -125.622 1.00 76.67  ? 208  TYR A CG  1 
ATOM   1306  C  CD1 . TYR A  1 198 ? 106.599 -91.710  -124.897 1.00 76.24  ? 208  TYR A CD1 1 
ATOM   1307  C  CD2 . TYR A  1 198 ? 105.034 -91.885  -126.689 1.00 75.46  ? 208  TYR A CD2 1 
ATOM   1308  C  CE1 . TYR A  1 198 ? 106.832 -90.375  -125.223 1.00 74.67  ? 208  TYR A CE1 1 
ATOM   1309  C  CE2 . TYR A  1 198 ? 105.263 -90.551  -127.024 1.00 73.61  ? 208  TYR A CE2 1 
ATOM   1310  C  CZ  . TYR A  1 198 ? 106.164 -89.805  -126.286 1.00 73.33  ? 208  TYR A CZ  1 
ATOM   1311  O  OH  . TYR A  1 198 ? 106.412 -88.493  -126.616 1.00 73.25  ? 208  TYR A OH  1 
ATOM   1312  N  N   . LYS A  1 199 ? 108.486 -94.511  -124.457 1.00 86.78  ? 209  LYS A N   1 
ATOM   1313  C  CA  . LYS A  1 199 ? 109.815 -93.948  -124.211 1.00 89.36  ? 209  LYS A CA  1 
ATOM   1314  C  C   . LYS A  1 199 ? 110.799 -94.263  -125.329 1.00 90.13  ? 209  LYS A C   1 
ATOM   1315  O  O   . LYS A  1 199 ? 111.368 -93.355  -125.943 1.00 90.04  ? 209  LYS A O   1 
ATOM   1316  C  CB  . LYS A  1 199 ? 110.388 -94.444  -122.872 1.00 90.40  ? 209  LYS A CB  1 
ATOM   1317  C  CG  . LYS A  1 199 ? 111.832 -93.983  -122.611 1.00 91.23  ? 209  LYS A CG  1 
ATOM   1318  C  CD  . LYS A  1 199 ? 112.303 -94.241  -121.178 1.00 90.75  ? 209  LYS A CD  1 
ATOM   1319  C  CE  . LYS A  1 199 ? 111.766 -93.200  -120.200 1.00 90.71  ? 209  LYS A CE  1 
ATOM   1320  N  NZ  . LYS A  1 199 ? 112.209 -91.812  -120.536 1.00 89.87  ? 209  LYS A NZ  1 
ATOM   1321  N  N   . THR A  1 200 ? 110.995 -95.550  -125.586 1.00 90.14  ? 210  THR A N   1 
ATOM   1322  C  CA  . THR A  1 200 ? 111.912 -95.988  -126.623 1.00 90.63  ? 210  THR A CA  1 
ATOM   1323  C  C   . THR A  1 200 ? 111.681 -95.225  -127.925 1.00 91.86  ? 210  THR A C   1 
ATOM   1324  O  O   . THR A  1 200 ? 112.620 -94.700  -128.524 1.00 92.24  ? 210  THR A O   1 
ATOM   1325  C  CB  . THR A  1 200 ? 111.758 -97.494  -126.872 1.00 90.15  ? 210  THR A CB  1 
ATOM   1326  O  OG1 . THR A  1 200 ? 110.469 -97.763  -127.438 1.00 89.03  ? 210  THR A OG1 1 
ATOM   1327  C  CG2 . THR A  1 200 ? 111.903 -98.250  -125.556 1.00 89.00  ? 210  THR A CG2 1 
ATOM   1328  N  N   . ILE A  1 201 ? 110.427 -95.153  -128.351 1.00 92.99  ? 211  ILE A N   1 
ATOM   1329  C  CA  . ILE A  1 201 ? 110.081 -94.450  -129.579 1.00 94.24  ? 211  ILE A CA  1 
ATOM   1330  C  C   . ILE A  1 201 ? 110.267 -92.942  -129.405 1.00 95.26  ? 211  ILE A C   1 
ATOM   1331  O  O   . ILE A  1 201 ? 110.879 -92.282  -130.247 1.00 95.26  ? 211  ILE A O   1 
ATOM   1332  C  CB  . ILE A  1 201 ? 108.618 -94.733  -129.979 1.00 94.20  ? 211  ILE A CB  1 
ATOM   1333  C  CG1 . ILE A  1 201 ? 108.385 -96.245  -130.078 1.00 93.75  ? 211  ILE A CG1 1 
ATOM   1334  C  CG2 . ILE A  1 201 ? 108.306 -94.058  -131.301 1.00 94.11  ? 211  ILE A CG2 1 
ATOM   1335  C  CD1 . ILE A  1 201 ? 106.941 -96.636  -130.328 1.00 92.46  ? 211  ILE A CD1 1 
ATOM   1336  N  N   . ALA A  1 202 ? 109.733 -92.417  -128.304 1.00 96.16  ? 212  ALA A N   1 
ATOM   1337  C  CA  . ALA A  1 202 ? 109.804 -90.997  -127.961 1.00 96.87  ? 212  ALA A CA  1 
ATOM   1338  C  C   . ALA A  1 202 ? 110.995 -90.275  -128.578 1.00 97.54  ? 212  ALA A C   1 
ATOM   1339  O  O   . ALA A  1 202 ? 110.764 -89.252  -129.258 1.00 97.97  ? 212  ALA A O   1 
ATOM   1340  C  CB  . ALA A  1 202 ? 109.836 -90.834  -126.448 1.00 97.23  ? 212  ALA A CB  1 
HETATM 1341  N  N   . MSE B  2 2   ? 94.713  -90.490  -84.199  1.00 86.98  ? 1    MSE B N   1 
HETATM 1342  C  CA  . MSE B  2 2   ? 96.157  -90.857  -84.098  1.00 87.88  ? 1    MSE B CA  1 
HETATM 1343  C  C   . MSE B  2 2   ? 96.514  -91.974  -85.082  1.00 85.56  ? 1    MSE B C   1 
HETATM 1344  O  O   . MSE B  2 2   ? 97.621  -92.510  -85.062  1.00 83.71  ? 1    MSE B O   1 
HETATM 1345  C  CB  . MSE B  2 2   ? 96.487  -91.290  -82.661  1.00 92.37  ? 1    MSE B CB  1 
HETATM 1346  C  CG  . MSE B  2 2   ? 97.708  -90.588  -82.028  1.00 97.25  ? 1    MSE B CG  1 
HETATM 1347  SE SE  . MSE B  2 2   ? 99.441  -91.502  -82.206  1.00 105.29 ? 1    MSE B SE  1 
HETATM 1348  C  CE  . MSE B  2 2   ? 100.369 -90.290  -83.390  1.00 102.42 ? 1    MSE B CE  1 
ATOM   1349  N  N   . PHE B  2 3   ? 95.562  -92.330  -85.937  1.00 84.39  ? 2    PHE B N   1 
ATOM   1350  C  CA  . PHE B  2 3   ? 95.788  -93.363  -86.944  1.00 82.30  ? 2    PHE B CA  1 
ATOM   1351  C  C   . PHE B  2 3   ? 95.282  -92.844  -88.283  1.00 79.76  ? 2    PHE B C   1 
ATOM   1352  O  O   . PHE B  2 3   ? 95.138  -93.596  -89.249  1.00 79.11  ? 2    PHE B O   1 
ATOM   1353  C  CB  . PHE B  2 3   ? 95.067  -94.660  -86.568  1.00 82.80  ? 2    PHE B CB  1 
ATOM   1354  C  CG  . PHE B  2 3   ? 95.975  -95.869  -86.515  1.00 82.98  ? 2    PHE B CG  1 
ATOM   1355  C  CD1 . PHE B  2 3   ? 97.245  -95.780  -85.944  1.00 82.33  ? 2    PHE B CD1 1 
ATOM   1356  C  CD2 . PHE B  2 3   ? 95.539  -97.108  -86.983  1.00 82.66  ? 2    PHE B CD2 1 
ATOM   1357  C  CE1 . PHE B  2 3   ? 98.062  -96.905  -85.838  1.00 82.01  ? 2    PHE B CE1 1 
ATOM   1358  C  CE2 . PHE B  2 3   ? 96.351  -98.240  -86.880  1.00 81.91  ? 2    PHE B CE2 1 
ATOM   1359  C  CZ  . PHE B  2 3   ? 97.612  -98.138  -86.306  1.00 81.97  ? 2    PHE B CZ  1 
ATOM   1360  N  N   . CYS B  2 4   ? 95.014  -91.543  -88.316  1.00 76.95  ? 3    CYS B N   1 
ATOM   1361  C  CA  . CYS B  2 4   ? 94.544  -90.881  -89.519  1.00 74.25  ? 3    CYS B CA  1 
ATOM   1362  C  C   . CYS B  2 4   ? 93.311  -91.598  -90.039  1.00 72.79  ? 3    CYS B C   1 
ATOM   1363  O  O   . CYS B  2 4   ? 93.027  -91.582  -91.234  1.00 72.57  ? 3    CYS B O   1 
ATOM   1364  C  CB  . CYS B  2 4   ? 95.641  -90.908  -90.583  1.00 74.46  ? 3    CYS B CB  1 
ATOM   1365  S  SG  . CYS B  2 4   ? 97.277  -90.426  -89.989  1.00 71.22  ? 3    CYS B SG  1 
ATOM   1366  N  N   . GLU B  2 5   ? 92.581  -92.232  -89.134  1.00 70.68  ? 4    GLU B N   1 
ATOM   1367  C  CA  . GLU B  2 5   ? 91.383  -92.961  -89.515  1.00 68.12  ? 4    GLU B CA  1 
ATOM   1368  C  C   . GLU B  2 5   ? 90.308  -91.983  -89.997  1.00 65.49  ? 4    GLU B C   1 
ATOM   1369  O  O   . GLU B  2 5   ? 89.584  -92.267  -90.948  1.00 65.12  ? 4    GLU B O   1 
ATOM   1370  C  CB  . GLU B  2 5   ? 90.876  -93.772  -88.317  1.00 69.56  ? 4    GLU B CB  1 
ATOM   1371  C  CG  . GLU B  2 5   ? 90.050  -94.995  -88.673  1.00 71.46  ? 4    GLU B CG  1 
ATOM   1372  C  CD  . GLU B  2 5   ? 90.853  -96.062  -89.402  1.00 73.29  ? 4    GLU B CD  1 
ATOM   1373  O  OE1 . GLU B  2 5   ? 91.822  -96.606  -88.817  1.00 72.19  ? 4    GLU B OE1 1 
ATOM   1374  O  OE2 . GLU B  2 5   ? 90.506  -96.356  -90.568  1.00 74.65  ? 4    GLU B OE2 1 
ATOM   1375  N  N   . LYS B  2 6   ? 90.218  -90.826  -89.348  1.00 62.17  ? 5    LYS B N   1 
ATOM   1376  C  CA  . LYS B  2 6   ? 89.226  -89.827  -89.718  1.00 59.20  ? 5    LYS B CA  1 
ATOM   1377  C  C   . LYS B  2 6   ? 89.456  -89.348  -91.137  1.00 58.29  ? 5    LYS B C   1 
ATOM   1378  O  O   . LYS B  2 6   ? 88.515  -89.142  -91.901  1.00 58.17  ? 5    LYS B O   1 
ATOM   1379  C  CB  . LYS B  2 6   ? 89.301  -88.633  -88.778  1.00 58.80  ? 5    LYS B CB  1 
ATOM   1380  C  CG  . LYS B  2 6   ? 87.979  -88.265  -88.137  1.00 61.08  ? 5    LYS B CG  1 
ATOM   1381  C  CD  . LYS B  2 6   ? 86.860  -88.038  -89.150  1.00 62.24  ? 5    LYS B CD  1 
ATOM   1382  C  CE  . LYS B  2 6   ? 85.497  -87.957  -88.436  1.00 63.37  ? 5    LYS B CE  1 
ATOM   1383  N  NZ  . LYS B  2 6   ? 84.324  -87.838  -89.358  1.00 63.11  ? 5    LYS B NZ  1 
ATOM   1384  N  N   . ALA B  2 7   ? 90.721  -89.158  -91.483  1.00 56.91  ? 6    ALA B N   1 
ATOM   1385  C  CA  . ALA B  2 7   ? 91.075  -88.694  -92.810  1.00 56.37  ? 6    ALA B CA  1 
ATOM   1386  C  C   . ALA B  2 7   ? 90.616  -89.700  -93.851  1.00 56.32  ? 6    ALA B C   1 
ATOM   1387  O  O   . ALA B  2 7   ? 90.175  -89.324  -94.930  1.00 55.86  ? 6    ALA B O   1 
ATOM   1388  C  CB  . ALA B  2 7   ? 92.580  -88.493  -92.902  1.00 57.32  ? 6    ALA B CB  1 
HETATM 1389  N  N   . MSE B  2 8   ? 90.727  -90.980  -93.510  1.00 56.87  ? 7    MSE B N   1 
HETATM 1390  C  CA  . MSE B  2 8   ? 90.337  -92.083  -94.385  1.00 56.98  ? 7    MSE B CA  1 
HETATM 1391  C  C   . MSE B  2 8   ? 88.868  -92.053  -94.777  1.00 55.65  ? 7    MSE B C   1 
HETATM 1392  O  O   . MSE B  2 8   ? 88.514  -92.253  -95.929  1.00 54.28  ? 7    MSE B O   1 
HETATM 1393  C  CB  . MSE B  2 8   ? 90.630  -93.415  -93.701  1.00 60.01  ? 7    MSE B CB  1 
HETATM 1394  C  CG  . MSE B  2 8   ? 92.094  -93.727  -93.579  1.00 65.19  ? 7    MSE B CG  1 
HETATM 1395  SE SE  . MSE B  2 8   ? 92.870  -93.915  -95.323  1.00 72.82  ? 7    MSE B SE  1 
HETATM 1396  C  CE  . MSE B  2 8   ? 92.072  -95.623  -95.737  1.00 70.47  ? 7    MSE B CE  1 
ATOM   1397  N  N   . GLU B  2 9   ? 88.007  -91.813  -93.807  1.00 55.11  ? 8    GLU B N   1 
ATOM   1398  C  CA  . GLU B  2 9   ? 86.589  -91.779  -94.084  1.00 55.83  ? 8    GLU B CA  1 
ATOM   1399  C  C   . GLU B  2 9   ? 86.294  -90.641  -95.059  1.00 53.43  ? 8    GLU B C   1 
ATOM   1400  O  O   . GLU B  2 9   ? 85.178  -90.512  -95.561  1.00 54.43  ? 8    GLU B O   1 
ATOM   1401  C  CB  . GLU B  2 9   ? 85.814  -91.601  -92.774  1.00 59.12  ? 8    GLU B CB  1 
ATOM   1402  C  CG  . GLU B  2 9   ? 84.440  -92.278  -92.755  1.00 65.86  ? 8    GLU B CG  1 
ATOM   1403  C  CD  . GLU B  2 9   ? 84.512  -93.810  -92.775  1.00 68.27  ? 8    GLU B CD  1 
ATOM   1404  O  OE1 . GLU B  2 9   ? 85.196  -94.374  -93.662  1.00 68.13  ? 8    GLU B OE1 1 
ATOM   1405  O  OE2 . GLU B  2 9   ? 83.872  -94.447  -91.903  1.00 69.28  ? 8    GLU B OE2 1 
ATOM   1406  N  N   . LEU B  2 10  ? 87.309  -89.830  -95.334  1.00 50.19  ? 9    LEU B N   1 
ATOM   1407  C  CA  . LEU B  2 10  ? 87.177  -88.702  -96.248  1.00 47.81  ? 9    LEU B CA  1 
ATOM   1408  C  C   . LEU B  2 10  ? 87.528  -89.126  -97.681  1.00 47.49  ? 9    LEU B C   1 
ATOM   1409  O  O   . LEU B  2 10  ? 86.836  -88.759  -98.636  1.00 46.44  ? 9    LEU B O   1 
ATOM   1410  C  CB  . LEU B  2 10  ? 88.097  -87.564  -95.797  1.00 46.87  ? 9    LEU B CB  1 
ATOM   1411  C  CG  . LEU B  2 10  ? 87.661  -86.110  -95.975  1.00 46.38  ? 9    LEU B CG  1 
ATOM   1412  C  CD1 . LEU B  2 10  ? 86.260  -85.900  -95.416  1.00 44.20  ? 9    LEU B CD1 1 
ATOM   1413  C  CD2 . LEU B  2 10  ? 88.660  -85.209  -95.254  1.00 45.45  ? 9    LEU B CD2 1 
ATOM   1414  N  N   . ILE B  2 11  ? 88.596  -89.900  -97.849  1.00 46.08  ? 10   ILE B N   1 
ATOM   1415  C  CA  . ILE B  2 11  ? 88.930  -90.315  -99.196  1.00 47.35  ? 10   ILE B CA  1 
ATOM   1416  C  C   . ILE B  2 11  ? 87.955  -91.422  -99.625  1.00 47.40  ? 10   ILE B C   1 
ATOM   1417  O  O   . ILE B  2 11  ? 87.817  -91.727  -100.810 1.00 47.01  ? 10   ILE B O   1 
ATOM   1418  C  CB  . ILE B  2 11  ? 90.434  -90.791  -99.332  1.00 49.02  ? 10   ILE B CB  1 
ATOM   1419  C  CG1 . ILE B  2 11  ? 90.548  -92.317  -99.250  1.00 47.87  ? 10   ILE B CG1 1 
ATOM   1420  C  CG2 . ILE B  2 11  ? 91.304  -90.094  -98.295  1.00 47.35  ? 10   ILE B CG2 1 
ATOM   1421  C  CD1 . ILE B  2 11  ? 90.177  -92.893  -97.924  1.00 50.85  ? 10   ILE B CD1 1 
ATOM   1422  N  N   . ARG B  2 12  ? 87.266  -92.005  -98.648  1.00 47.25  ? 11   ARG B N   1 
ATOM   1423  C  CA  . ARG B  2 12  ? 86.302  -93.062  -98.912  1.00 45.68  ? 11   ARG B CA  1 
ATOM   1424  C  C   . ARG B  2 12  ? 85.022  -92.430  -99.395  1.00 46.55  ? 11   ARG B C   1 
ATOM   1425  O  O   . ARG B  2 12  ? 84.377  -92.941  -100.302 1.00 47.27  ? 11   ARG B O   1 
ATOM   1426  C  CB  . ARG B  2 12  ? 86.040  -93.874  -97.648  1.00 44.44  ? 11   ARG B CB  1 
ATOM   1427  C  CG  . ARG B  2 12  ? 87.080  -94.932  -97.400  1.00 45.25  ? 11   ARG B CG  1 
ATOM   1428  C  CD  . ARG B  2 12  ? 86.936  -95.582  -96.040  1.00 44.97  ? 11   ARG B CD  1 
ATOM   1429  N  NE  . ARG B  2 12  ? 87.942  -96.627  -95.870  1.00 47.01  ? 11   ARG B NE  1 
ATOM   1430  C  CZ  . ARG B  2 12  ? 88.515  -96.943  -94.711  1.00 47.95  ? 11   ARG B CZ  1 
ATOM   1431  N  NH1 . ARG B  2 12  ? 89.421  -97.915  -94.662  1.00 49.13  ? 11   ARG B NH1 1 
ATOM   1432  N  NH2 . ARG B  2 12  ? 88.193  -96.284  -93.604  1.00 46.72  ? 11   ARG B NH2 1 
ATOM   1433  N  N   . GLU B  2 13  ? 84.646  -91.311  -98.793  1.00 47.07  ? 12   GLU B N   1 
ATOM   1434  C  CA  . GLU B  2 13  ? 83.437  -90.630  -99.219  1.00 48.79  ? 12   GLU B CA  1 
ATOM   1435  C  C   . GLU B  2 13  ? 83.576  -90.373  -100.719 1.00 48.43  ? 12   GLU B C   1 
ATOM   1436  O  O   . GLU B  2 13  ? 82.590  -90.102  -101.405 1.00 49.75  ? 12   GLU B O   1 
ATOM   1437  C  CB  . GLU B  2 13  ? 83.284  -89.302  -98.480  1.00 52.50  ? 12   GLU B CB  1 
ATOM   1438  C  CG  . GLU B  2 13  ? 82.081  -88.481  -98.920  1.00 59.12  ? 12   GLU B CG  1 
ATOM   1439  C  CD  . GLU B  2 13  ? 82.167  -87.012  -98.498  1.00 63.12  ? 12   GLU B CD  1 
ATOM   1440  O  OE1 . GLU B  2 13  ? 83.051  -86.287  -99.018  1.00 64.55  ? 12   GLU B OE1 1 
ATOM   1441  O  OE2 . GLU B  2 13  ? 81.345  -86.588  -97.651  1.00 64.22  ? 12   GLU B OE2 1 
ATOM   1442  N  N   . LEU B  2 14  ? 84.809  -90.467  -101.218 1.00 46.74  ? 13   LEU B N   1 
ATOM   1443  C  CA  . LEU B  2 14  ? 85.102  -90.248  -102.627 1.00 44.23  ? 13   LEU B CA  1 
ATOM   1444  C  C   . LEU B  2 14  ? 85.286  -91.537  -103.416 1.00 45.29  ? 13   LEU B C   1 
ATOM   1445  O  O   . LEU B  2 14  ? 85.024  -91.553  -104.609 1.00 46.71  ? 13   LEU B O   1 
ATOM   1446  C  CB  . LEU B  2 14  ? 86.349  -89.378  -102.774 1.00 42.88  ? 13   LEU B CB  1 
ATOM   1447  C  CG  . LEU B  2 14  ? 86.169  -87.894  -103.122 1.00 41.63  ? 13   LEU B CG  1 
ATOM   1448  C  CD1 . LEU B  2 14  ? 85.072  -87.267  -102.271 1.00 41.01  ? 13   LEU B CD1 1 
ATOM   1449  C  CD2 . LEU B  2 14  ? 87.494  -87.173  -102.916 1.00 38.56  ? 13   LEU B CD2 1 
ATOM   1450  N  N   . HIS B  2 15  ? 85.748  -92.607  -102.767 1.00 45.62  ? 14   HIS B N   1 
ATOM   1451  C  CA  . HIS B  2 15  ? 85.937  -93.896  -103.444 1.00 45.48  ? 14   HIS B CA  1 
ATOM   1452  C  C   . HIS B  2 15  ? 84.573  -94.548  -103.637 1.00 46.29  ? 14   HIS B C   1 
ATOM   1453  O  O   . HIS B  2 15  ? 84.380  -95.368  -104.528 1.00 47.28  ? 14   HIS B O   1 
ATOM   1454  C  CB  . HIS B  2 15  ? 86.838  -94.826  -102.615 1.00 44.95  ? 14   HIS B CB  1 
ATOM   1455  C  CG  . HIS B  2 15  ? 86.795  -96.271  -103.038 1.00 46.32  ? 14   HIS B CG  1 
ATOM   1456  N  ND1 . HIS B  2 15  ? 87.352  -96.729  -104.214 1.00 43.31  ? 14   HIS B ND1 1 
ATOM   1457  C  CD2 . HIS B  2 15  ? 86.276  -97.364  -102.420 1.00 45.63  ? 14   HIS B CD2 1 
ATOM   1458  C  CE1 . HIS B  2 15  ? 87.182  -98.038  -104.300 1.00 45.39  ? 14   HIS B CE1 1 
ATOM   1459  N  NE2 . HIS B  2 15  ? 86.533  -98.450  -103.223 1.00 45.76  ? 14   HIS B NE2 1 
ATOM   1460  N  N   . ARG B  2 16  ? 83.620  -94.174  -102.799 1.00 46.67  ? 15   ARG B N   1 
ATOM   1461  C  CA  . ARG B  2 16  ? 82.290  -94.735  -102.903 1.00 47.27  ? 15   ARG B CA  1 
ATOM   1462  C  C   . ARG B  2 16  ? 81.395  -93.864  -103.794 1.00 49.03  ? 15   ARG B C   1 
ATOM   1463  O  O   . ARG B  2 16  ? 80.172  -93.971  -103.753 1.00 49.66  ? 15   ARG B O   1 
ATOM   1464  C  CB  . ARG B  2 16  ? 81.672  -94.884  -101.508 1.00 45.66  ? 15   ARG B CB  1 
ATOM   1465  C  CG  . ARG B  2 16  ? 82.518  -95.652  -100.511 1.00 44.08  ? 15   ARG B CG  1 
ATOM   1466  C  CD  . ARG B  2 16  ? 81.710  -95.924  -99.262  1.00 45.76  ? 15   ARG B CD  1 
ATOM   1467  N  NE  . ARG B  2 16  ? 82.492  -95.992  -98.022  1.00 46.00  ? 15   ARG B NE  1 
ATOM   1468  C  CZ  . ARG B  2 16  ? 83.413  -96.912  -97.724  1.00 46.95  ? 15   ARG B CZ  1 
ATOM   1469  N  NH1 . ARG B  2 16  ? 83.738  -97.902  -98.568  1.00 42.32  ? 15   ARG B NH1 1 
ATOM   1470  N  NH2 . ARG B  2 16  ? 83.998  -96.852  -96.533  1.00 48.56  ? 15   ARG B NH2 1 
ATOM   1471  N  N   . ALA B  2 17  ? 82.006  -92.992  -104.590 1.00 51.20  ? 16   ALA B N   1 
ATOM   1472  C  CA  . ALA B  2 17  ? 81.246  -92.131  -105.496 1.00 54.02  ? 16   ALA B CA  1 
ATOM   1473  C  C   . ALA B  2 17  ? 81.451  -92.689  -106.902 1.00 56.72  ? 16   ALA B C   1 
ATOM   1474  O  O   . ALA B  2 17  ? 82.440  -92.386  -107.574 1.00 56.08  ? 16   ALA B O   1 
ATOM   1475  C  CB  . ALA B  2 17  ? 81.730  -90.695  -105.410 1.00 52.98  ? 16   ALA B CB  1 
ATOM   1476  N  N   . PRO B  2 18  ? 80.495  -93.515  -107.357 1.00 58.94  ? 17   PRO B N   1 
ATOM   1477  C  CA  . PRO B  2 18  ? 80.393  -94.219  -108.631 1.00 59.87  ? 17   PRO B CA  1 
ATOM   1478  C  C   . PRO B  2 18  ? 81.218  -93.767  -109.821 1.00 61.88  ? 17   PRO B C   1 
ATOM   1479  O  O   . PRO B  2 18  ? 82.357  -94.208  -109.988 1.00 63.31  ? 17   PRO B O   1 
ATOM   1480  C  CB  . PRO B  2 18  ? 78.903  -94.197  -108.892 1.00 60.37  ? 17   PRO B CB  1 
ATOM   1481  C  CG  . PRO B  2 18  ? 78.384  -94.506  -107.533 1.00 59.54  ? 17   PRO B CG  1 
ATOM   1482  C  CD  . PRO B  2 18  ? 79.197  -93.571  -106.656 1.00 59.07  ? 17   PRO B CD  1 
ATOM   1483  N  N   . GLU B  2 19  ? 80.664  -92.908  -110.664 1.00 63.03  ? 18   GLU B N   1 
ATOM   1484  C  CA  . GLU B  2 19  ? 81.413  -92.494  -111.840 1.00 64.00  ? 18   GLU B CA  1 
ATOM   1485  C  C   . GLU B  2 19  ? 82.528  -91.532  -111.483 1.00 63.70  ? 18   GLU B C   1 
ATOM   1486  O  O   . GLU B  2 19  ? 83.710  -91.839  -111.640 1.00 64.73  ? 18   GLU B O   1 
ATOM   1487  C  CB  . GLU B  2 19  ? 80.471  -91.872  -112.878 1.00 66.11  ? 18   GLU B CB  1 
ATOM   1488  C  CG  . GLU B  2 19  ? 79.804  -90.559  -112.469 1.00 68.96  ? 18   GLU B CG  1 
ATOM   1489  C  CD  . GLU B  2 19  ? 80.633  -89.322  -112.816 1.00 69.03  ? 18   GLU B CD  1 
ATOM   1490  O  OE1 . GLU B  2 19  ? 80.132  -88.194  -112.608 1.00 70.74  ? 18   GLU B OE1 1 
ATOM   1491  O  OE2 . GLU B  2 19  ? 81.779  -89.471  -113.294 1.00 68.39  ? 18   GLU B OE2 1 
ATOM   1492  N  N   . GLY B  2 20  ? 82.129  -90.376  -110.977 1.00 62.30  ? 19   GLY B N   1 
ATOM   1493  C  CA  . GLY B  2 20  ? 83.054  -89.331  -110.594 1.00 59.72  ? 19   GLY B CA  1 
ATOM   1494  C  C   . GLY B  2 20  ? 82.119  -88.276  -110.059 1.00 58.09  ? 19   GLY B C   1 
ATOM   1495  O  O   . GLY B  2 20  ? 82.356  -87.073  -110.165 1.00 57.88  ? 19   GLY B O   1 
ATOM   1496  N  N   . GLN B  2 21  ? 81.015  -88.762  -109.506 1.00 56.67  ? 20   GLN B N   1 
ATOM   1497  C  CA  . GLN B  2 21  ? 79.995  -87.912  -108.929 1.00 55.03  ? 20   GLN B CA  1 
ATOM   1498  C  C   . GLN B  2 21  ? 80.650  -87.090  -107.833 1.00 52.97  ? 20   GLN B C   1 
ATOM   1499  O  O   . GLN B  2 21  ? 81.700  -87.458  -107.302 1.00 52.76  ? 20   GLN B O   1 
ATOM   1500  C  CB  . GLN B  2 21  ? 78.880  -88.774  -108.346 1.00 57.77  ? 20   GLN B CB  1 
ATOM   1501  C  CG  . GLN B  2 21  ? 78.492  -89.935  -109.250 1.00 62.06  ? 20   GLN B CG  1 
ATOM   1502  C  CD  . GLN B  2 21  ? 77.175  -90.575  -108.853 1.00 65.00  ? 20   GLN B CD  1 
ATOM   1503  O  OE1 . GLN B  2 21  ? 76.674  -91.464  -109.544 1.00 65.65  ? 20   GLN B OE1 1 
ATOM   1504  N  NE2 . GLN B  2 21  ? 76.604  -90.125  -107.735 1.00 65.61  ? 20   GLN B NE2 1 
ATOM   1505  N  N   . LEU B  2 22  ? 80.034  -85.972  -107.491 1.00 49.75  ? 21   LEU B N   1 
ATOM   1506  C  CA  . LEU B  2 22  ? 80.594  -85.125  -106.467 1.00 46.44  ? 21   LEU B CA  1 
ATOM   1507  C  C   . LEU B  2 22  ? 79.710  -85.121  -105.230 1.00 45.09  ? 21   LEU B C   1 
ATOM   1508  O  O   . LEU B  2 22  ? 78.610  -84.551  -105.235 1.00 44.43  ? 21   LEU B O   1 
ATOM   1509  C  CB  . LEU B  2 22  ? 80.758  -83.695  -107.001 1.00 45.84  ? 21   LEU B CB  1 
ATOM   1510  C  CG  . LEU B  2 22  ? 81.555  -82.720  -106.129 1.00 44.93  ? 21   LEU B CG  1 
ATOM   1511  C  CD1 . LEU B  2 22  ? 83.039  -83.051  -106.219 1.00 42.85  ? 21   LEU B CD1 1 
ATOM   1512  C  CD2 . LEU B  2 22  ? 81.295  -81.296  -106.586 1.00 44.63  ? 21   LEU B CD2 1 
ATOM   1513  N  N   . PRO B  2 23  ? 80.162  -85.791  -104.158 1.00 43.20  ? 22   PRO B N   1 
ATOM   1514  C  CA  . PRO B  2 23  ? 79.357  -85.808  -102.935 1.00 42.62  ? 22   PRO B CA  1 
ATOM   1515  C  C   . PRO B  2 23  ? 79.526  -84.448  -102.265 1.00 43.05  ? 22   PRO B C   1 
ATOM   1516  O  O   . PRO B  2 23  ? 80.432  -83.706  -102.614 1.00 44.50  ? 22   PRO B O   1 
ATOM   1517  C  CB  . PRO B  2 23  ? 79.975  -86.955  -102.132 1.00 41.87  ? 22   PRO B CB  1 
ATOM   1518  C  CG  . PRO B  2 23  ? 81.399  -86.966  -102.583 1.00 41.88  ? 22   PRO B CG  1 
ATOM   1519  C  CD  . PRO B  2 23  ? 81.298  -86.726  -104.063 1.00 41.49  ? 22   PRO B CD  1 
ATOM   1520  N  N   . ALA B  2 24  ? 78.662  -84.099  -101.323 1.00 43.48  ? 23   ALA B N   1 
ATOM   1521  C  CA  . ALA B  2 24  ? 78.799  -82.811  -100.660 1.00 43.53  ? 23   ALA B CA  1 
ATOM   1522  C  C   . ALA B  2 24  ? 80.169  -82.699  -99.982  1.00 45.24  ? 23   ALA B C   1 
ATOM   1523  O  O   . ALA B  2 24  ? 80.714  -83.694  -99.485  1.00 44.88  ? 23   ALA B O   1 
ATOM   1524  C  CB  . ALA B  2 24  ? 77.696  -82.634  -99.641  1.00 40.93  ? 23   ALA B CB  1 
ATOM   1525  N  N   . PHE B  2 25  ? 80.730  -81.490  -99.984  1.00 45.84  ? 24   PHE B N   1 
ATOM   1526  C  CA  . PHE B  2 25  ? 82.019  -81.245  -99.349  1.00 46.79  ? 24   PHE B CA  1 
ATOM   1527  C  C   . PHE B  2 25  ? 81.875  -81.625  -97.879  1.00 47.36  ? 24   PHE B C   1 
ATOM   1528  O  O   . PHE B  2 25  ? 80.858  -81.317  -97.259  1.00 47.27  ? 24   PHE B O   1 
ATOM   1529  C  CB  . PHE B  2 25  ? 82.386  -79.763  -99.457  1.00 47.65  ? 24   PHE B CB  1 
ATOM   1530  C  CG  . PHE B  2 25  ? 83.718  -79.420  -98.845  1.00 48.66  ? 24   PHE B CG  1 
ATOM   1531  C  CD1 . PHE B  2 25  ? 84.899  -79.943  -99.370  1.00 49.37  ? 24   PHE B CD1 1 
ATOM   1532  C  CD2 . PHE B  2 25  ? 83.794  -78.587  -97.737  1.00 48.22  ? 24   PHE B CD2 1 
ATOM   1533  C  CE1 . PHE B  2 25  ? 86.139  -79.641  -98.797  1.00 49.26  ? 24   PHE B CE1 1 
ATOM   1534  C  CE2 . PHE B  2 25  ? 85.031  -78.280  -97.158  1.00 48.80  ? 24   PHE B CE2 1 
ATOM   1535  C  CZ  . PHE B  2 25  ? 86.202  -78.808  -97.689  1.00 48.76  ? 24   PHE B CZ  1 
ATOM   1536  N  N   . ASN B  2 26  ? 82.876  -82.288  -97.314  1.00 47.89  ? 25   ASN B N   1 
ATOM   1537  C  CA  . ASN B  2 26  ? 82.789  -82.684  -95.908  1.00 49.57  ? 25   ASN B CA  1 
ATOM   1538  C  C   . ASN B  2 26  ? 83.450  -81.673  -94.955  1.00 50.88  ? 25   ASN B C   1 
ATOM   1539  O  O   . ASN B  2 26  ? 84.501  -81.958  -94.373  1.00 51.04  ? 25   ASN B O   1 
ATOM   1540  C  CB  . ASN B  2 26  ? 83.418  -84.071  -95.713  1.00 48.41  ? 25   ASN B CB  1 
ATOM   1541  C  CG  . ASN B  2 26  ? 83.088  -84.689  -94.361  1.00 47.52  ? 25   ASN B CG  1 
ATOM   1542  O  OD1 . ASN B  2 26  ? 83.611  -85.742  -94.012  1.00 47.32  ? 25   ASN B OD1 1 
ATOM   1543  N  ND2 . ASN B  2 26  ? 82.212  -84.042  -93.601  1.00 48.80  ? 25   ASN B ND2 1 
ATOM   1544  N  N   . GLU B  2 27  ? 82.829  -80.503  -94.797  1.00 51.68  ? 26   GLU B N   1 
ATOM   1545  C  CA  . GLU B  2 27  ? 83.341  -79.458  -93.913  1.00 52.83  ? 26   GLU B CA  1 
ATOM   1546  C  C   . GLU B  2 27  ? 83.744  -80.002  -92.562  1.00 52.21  ? 26   GLU B C   1 
ATOM   1547  O  O   . GLU B  2 27  ? 84.865  -79.799  -92.102  1.00 51.62  ? 26   GLU B O   1 
ATOM   1548  C  CB  . GLU B  2 27  ? 82.292  -78.378  -93.686  1.00 56.16  ? 26   GLU B CB  1 
ATOM   1549  C  CG  . GLU B  2 27  ? 82.369  -77.227  -94.664  1.00 64.15  ? 26   GLU B CG  1 
ATOM   1550  C  CD  . GLU B  2 27  ? 82.066  -75.885  -94.007  1.00 68.82  ? 26   GLU B CD  1 
ATOM   1551  O  OE1 . GLU B  2 27  ? 80.966  -75.731  -93.415  1.00 70.23  ? 26   GLU B OE1 1 
ATOM   1552  O  OE2 . GLU B  2 27  ? 82.937  -74.984  -94.086  1.00 71.64  ? 26   GLU B OE2 1 
ATOM   1553  N  N   . ASP B  2 28  ? 82.805  -80.690  -91.931  1.00 52.11  ? 27   ASP B N   1 
ATOM   1554  C  CA  . ASP B  2 28  ? 83.008  -81.282  -90.620  1.00 51.90  ? 27   ASP B CA  1 
ATOM   1555  C  C   . ASP B  2 28  ? 84.196  -82.229  -90.570  1.00 50.35  ? 27   ASP B C   1 
ATOM   1556  O  O   . ASP B  2 28  ? 85.043  -82.127  -89.694  1.00 49.62  ? 27   ASP B O   1 
ATOM   1557  C  CB  . ASP B  2 28  ? 81.754  -82.043  -90.219  1.00 55.66  ? 27   ASP B CB  1 
ATOM   1558  C  CG  . ASP B  2 28  ? 81.431  -81.884  -88.763  1.00 58.55  ? 27   ASP B CG  1 
ATOM   1559  O  OD1 . ASP B  2 28  ? 81.235  -80.721  -88.344  1.00 60.59  ? 27   ASP B OD1 1 
ATOM   1560  O  OD2 . ASP B  2 28  ? 81.374  -82.910  -88.044  1.00 61.00  ? 27   ASP B OD2 1 
ATOM   1561  N  N   . GLY B  2 29  ? 84.245  -83.160  -91.513  1.00 49.47  ? 28   GLY B N   1 
ATOM   1562  C  CA  . GLY B  2 29  ? 85.329  -84.120  -91.543  1.00 48.54  ? 28   GLY B CA  1 
ATOM   1563  C  C   . GLY B  2 29  ? 86.693  -83.484  -91.656  1.00 48.42  ? 28   GLY B C   1 
ATOM   1564  O  O   . GLY B  2 29  ? 87.629  -83.899  -90.988  1.00 47.09  ? 28   GLY B O   1 
ATOM   1565  N  N   . LEU B  2 30  ? 86.804  -82.477  -92.513  1.00 50.26  ? 29   LEU B N   1 
ATOM   1566  C  CA  . LEU B  2 30  ? 88.066  -81.780  -92.728  1.00 52.01  ? 29   LEU B CA  1 
ATOM   1567  C  C   . LEU B  2 30  ? 88.539  -81.108  -91.453  1.00 54.39  ? 29   LEU B C   1 
ATOM   1568  O  O   . LEU B  2 30  ? 89.724  -81.144  -91.119  1.00 54.39  ? 29   LEU B O   1 
ATOM   1569  C  CB  . LEU B  2 30  ? 87.907  -80.722  -93.818  1.00 49.91  ? 29   LEU B CB  1 
ATOM   1570  C  CG  . LEU B  2 30  ? 89.142  -79.865  -94.085  1.00 48.40  ? 29   LEU B CG  1 
ATOM   1571  C  CD1 . LEU B  2 30  ? 90.311  -80.746  -94.527  1.00 46.83  ? 29   LEU B CD1 1 
ATOM   1572  C  CD2 . LEU B  2 30  ? 88.809  -78.836  -95.142  1.00 47.29  ? 29   LEU B CD2 1 
ATOM   1573  N  N   . ARG B  2 31  ? 87.601  -80.489  -90.747  1.00 57.09  ? 30   ARG B N   1 
ATOM   1574  C  CA  . ARG B  2 31  ? 87.907  -79.798  -89.501  1.00 60.42  ? 30   ARG B CA  1 
ATOM   1575  C  C   . ARG B  2 31  ? 88.458  -80.787  -88.465  1.00 60.10  ? 30   ARG B C   1 
ATOM   1576  O  O   . ARG B  2 31  ? 89.466  -80.517  -87.815  1.00 60.77  ? 30   ARG B O   1 
ATOM   1577  C  CB  . ARG B  2 31  ? 86.641  -79.095  -88.988  1.00 63.28  ? 30   ARG B CB  1 
ATOM   1578  C  CG  . ARG B  2 31  ? 86.820  -78.217  -87.757  1.00 69.01  ? 30   ARG B CG  1 
ATOM   1579  C  CD  . ARG B  2 31  ? 85.743  -77.125  -87.715  1.00 74.39  ? 30   ARG B CD  1 
ATOM   1580  N  NE  . ARG B  2 31  ? 85.953  -76.109  -88.755  1.00 78.60  ? 30   ARG B NE  1 
ATOM   1581  C  CZ  . ARG B  2 31  ? 86.882  -75.152  -88.702  1.00 79.88  ? 30   ARG B CZ  1 
ATOM   1582  N  NH1 . ARG B  2 31  ? 87.690  -75.064  -87.652  1.00 80.14  ? 30   ARG B NH1 1 
ATOM   1583  N  NH2 . ARG B  2 31  ? 87.026  -74.296  -89.710  1.00 80.25  ? 30   ARG B NH2 1 
ATOM   1584  N  N   . GLN B  2 32  ? 87.807  -81.937  -88.329  1.00 59.14  ? 31   GLN B N   1 
ATOM   1585  C  CA  . GLN B  2 32  ? 88.250  -82.950  -87.382  1.00 58.85  ? 31   GLN B CA  1 
ATOM   1586  C  C   . GLN B  2 32  ? 89.612  -83.495  -87.782  1.00 58.20  ? 31   GLN B C   1 
ATOM   1587  O  O   . GLN B  2 32  ? 90.341  -84.022  -86.952  1.00 58.93  ? 31   GLN B O   1 
ATOM   1588  C  CB  . GLN B  2 32  ? 87.257  -84.109  -87.333  1.00 60.24  ? 31   GLN B CB  1 
ATOM   1589  C  CG  . GLN B  2 32  ? 85.833  -83.716  -86.993  1.00 62.95  ? 31   GLN B CG  1 
ATOM   1590  C  CD  . GLN B  2 32  ? 84.908  -84.913  -86.991  1.00 64.50  ? 31   GLN B CD  1 
ATOM   1591  O  OE1 . GLN B  2 32  ? 85.134  -85.875  -86.254  1.00 66.10  ? 31   GLN B OE1 1 
ATOM   1592  N  NE2 . GLN B  2 32  ? 83.863  -84.870  -87.822  1.00 64.24  ? 31   GLN B NE2 1 
ATOM   1593  N  N   . VAL B  2 33  ? 89.947  -83.378  -89.059  1.00 58.08  ? 32   VAL B N   1 
ATOM   1594  C  CA  . VAL B  2 33  ? 91.221  -83.879  -89.549  1.00 58.68  ? 32   VAL B CA  1 
ATOM   1595  C  C   . VAL B  2 33  ? 92.353  -82.909  -89.231  1.00 59.35  ? 32   VAL B C   1 
ATOM   1596  O  O   . VAL B  2 33  ? 93.466  -83.326  -88.909  1.00 60.16  ? 32   VAL B O   1 
ATOM   1597  C  CB  . VAL B  2 33  ? 91.169  -84.128  -91.066  1.00 58.22  ? 32   VAL B CB  1 
ATOM   1598  C  CG1 . VAL B  2 33  ? 92.492  -84.703  -91.550  1.00 58.65  ? 32   VAL B CG1 1 
ATOM   1599  C  CG2 . VAL B  2 33  ? 90.046  -85.086  -91.384  1.00 57.55  ? 32   VAL B CG2 1 
ATOM   1600  N  N   . LEU B  2 34  ? 92.069  -81.615  -89.324  1.00 59.51  ? 33   LEU B N   1 
ATOM   1601  C  CA  . LEU B  2 34  ? 93.069  -80.593  -89.023  1.00 58.81  ? 33   LEU B CA  1 
ATOM   1602  C  C   . LEU B  2 34  ? 93.268  -80.537  -87.501  1.00 59.94  ? 33   LEU B C   1 
ATOM   1603  O  O   . LEU B  2 34  ? 94.378  -80.738  -86.997  1.00 59.74  ? 33   LEU B O   1 
ATOM   1604  C  CB  . LEU B  2 34  ? 92.613  -79.220  -89.550  1.00 55.86  ? 33   LEU B CB  1 
ATOM   1605  C  CG  . LEU B  2 34  ? 92.601  -78.955  -91.061  1.00 53.02  ? 33   LEU B CG  1 
ATOM   1606  C  CD1 . LEU B  2 34  ? 92.044  -77.573  -91.340  1.00 51.46  ? 33   LEU B CD1 1 
ATOM   1607  C  CD2 . LEU B  2 34  ? 94.003  -79.082  -91.615  1.00 51.04  ? 33   LEU B CD2 1 
ATOM   1608  N  N   . GLU B  2 35  ? 92.186  -80.269  -86.775  1.00 60.50  ? 34   GLU B N   1 
ATOM   1609  C  CA  . GLU B  2 35  ? 92.245  -80.208  -85.324  1.00 61.13  ? 34   GLU B CA  1 
ATOM   1610  C  C   . GLU B  2 35  ? 93.012  -81.409  -84.770  1.00 60.51  ? 34   GLU B C   1 
ATOM   1611  O  O   . GLU B  2 35  ? 93.602  -81.344  -83.692  1.00 60.98  ? 34   GLU B O   1 
ATOM   1612  C  CB  . GLU B  2 35  ? 90.828  -80.152  -84.748  1.00 62.68  ? 34   GLU B CB  1 
ATOM   1613  C  CG  . GLU B  2 35  ? 90.216  -78.750  -84.775  1.00 66.73  ? 34   GLU B CG  1 
ATOM   1614  C  CD  . GLU B  2 35  ? 88.774  -78.715  -84.280  1.00 70.10  ? 34   GLU B CD  1 
ATOM   1615  O  OE1 . GLU B  2 35  ? 88.460  -79.428  -83.300  1.00 70.98  ? 34   GLU B OE1 1 
ATOM   1616  O  OE2 . GLU B  2 35  ? 87.956  -77.963  -84.862  1.00 71.68  ? 34   GLU B OE2 1 
ATOM   1617  N  N   . GLU B  2 36  ? 93.018  -82.497  -85.528  1.00 60.10  ? 35   GLU B N   1 
ATOM   1618  C  CA  . GLU B  2 36  ? 93.725  -83.703  -85.130  1.00 59.17  ? 35   GLU B CA  1 
ATOM   1619  C  C   . GLU B  2 36  ? 95.216  -83.551  -85.374  1.00 58.60  ? 35   GLU B C   1 
ATOM   1620  O  O   . GLU B  2 36  ? 96.037  -84.164  -84.698  1.00 58.12  ? 35   GLU B O   1 
ATOM   1621  C  CB  . GLU B  2 36  ? 93.211  -84.901  -85.920  1.00 59.57  ? 35   GLU B CB  1 
ATOM   1622  C  CG  . GLU B  2 36  ? 92.354  -85.834  -85.110  1.00 61.56  ? 35   GLU B CG  1 
ATOM   1623  C  CD  . GLU B  2 36  ? 92.295  -87.215  -85.713  1.00 63.75  ? 35   GLU B CD  1 
ATOM   1624  O  OE1 . GLU B  2 36  ? 93.373  -87.761  -86.056  1.00 64.13  ? 35   GLU B OE1 1 
ATOM   1625  O  OE2 . GLU B  2 36  ? 91.174  -87.755  -85.833  1.00 64.87  ? 35   GLU B OE2 1 
HETATM 1626  N  N   . MSE B  2 37  ? 95.559  -82.746  -86.367  1.00 59.10  ? 36   MSE B N   1 
HETATM 1627  C  CA  . MSE B  2 37  ? 96.952  -82.514  -86.703  1.00 59.79  ? 36   MSE B CA  1 
HETATM 1628  C  C   . MSE B  2 37  ? 97.546  -81.565  -85.672  1.00 59.34  ? 36   MSE B C   1 
HETATM 1629  O  O   . MSE B  2 37  ? 98.684  -81.744  -85.226  1.00 56.55  ? 36   MSE B O   1 
HETATM 1630  C  CB  . MSE B  2 37  ? 97.060  -81.896  -88.095  1.00 61.49  ? 36   MSE B CB  1 
HETATM 1631  C  CG  . MSE B  2 37  ? 96.445  -82.732  -89.209  1.00 63.53  ? 36   MSE B CG  1 
HETATM 1632  SE SE  . MSE B  2 37  ? 96.887  -82.009  -90.950  1.00 66.48  ? 36   MSE B SE  1 
HETATM 1633  C  CE  . MSE B  2 37  ? 98.607  -82.866  -91.178  1.00 60.80  ? 36   MSE B CE  1 
ATOM   1634  N  N   . LYS B  2 38  ? 96.761  -80.550  -85.314  1.00 58.96  ? 37   LYS B N   1 
ATOM   1635  C  CA  . LYS B  2 38  ? 97.166  -79.559  -84.329  1.00 59.30  ? 37   LYS B CA  1 
ATOM   1636  C  C   . LYS B  2 38  ? 97.543  -80.317  -83.066  1.00 60.54  ? 37   LYS B C   1 
ATOM   1637  O  O   . LYS B  2 38  ? 98.626  -80.125  -82.501  1.00 60.36  ? 37   LYS B O   1 
ATOM   1638  C  CB  . LYS B  2 38  ? 96.010  -78.596  -84.040  1.00 58.44  ? 37   LYS B CB  1 
ATOM   1639  C  CG  . LYS B  2 38  ? 96.273  -77.635  -82.900  1.00 59.53  ? 37   LYS B CG  1 
ATOM   1640  C  CD  . LYS B  2 38  ? 95.056  -76.787  -82.542  1.00 59.97  ? 37   LYS B CD  1 
ATOM   1641  C  CE  . LYS B  2 38  ? 94.937  -75.570  -83.435  1.00 61.92  ? 37   LYS B CE  1 
ATOM   1642  N  NZ  . LYS B  2 38  ? 93.818  -74.664  -83.022  1.00 62.35  ? 37   LYS B NZ  1 
ATOM   1643  N  N   . ALA B  2 39  ? 96.639  -81.191  -82.639  1.00 61.66  ? 38   ALA B N   1 
ATOM   1644  C  CA  . ALA B  2 39  ? 96.859  -82.006  -81.456  1.00 62.55  ? 38   ALA B CA  1 
ATOM   1645  C  C   . ALA B  2 39  ? 98.140  -82.823  -81.643  1.00 63.59  ? 38   ALA B C   1 
ATOM   1646  O  O   . ALA B  2 39  ? 99.036  -82.796  -80.802  1.00 64.15  ? 38   ALA B O   1 
ATOM   1647  C  CB  . ALA B  2 39  ? 95.662  -82.924  -81.231  1.00 60.46  ? 38   ALA B CB  1 
ATOM   1648  N  N   . LEU B  2 40  ? 98.223  -83.545  -82.753  1.00 65.46  ? 39   LEU B N   1 
ATOM   1649  C  CA  . LEU B  2 40  ? 99.398  -84.353  -83.053  1.00 67.31  ? 39   LEU B CA  1 
ATOM   1650  C  C   . LEU B  2 40  ? 100.679 -83.527  -83.059  1.00 68.51  ? 39   LEU B C   1 
ATOM   1651  O  O   . LEU B  2 40  ? 101.764 -84.061  -82.849  1.00 67.76  ? 39   LEU B O   1 
ATOM   1652  C  CB  . LEU B  2 40  ? 99.236  -85.024  -84.416  1.00 67.43  ? 39   LEU B CB  1 
ATOM   1653  C  CG  . LEU B  2 40  ? 98.426  -86.313  -84.457  1.00 66.94  ? 39   LEU B CG  1 
ATOM   1654  C  CD1 . LEU B  2 40  ? 98.237  -86.762  -85.898  1.00 67.39  ? 39   LEU B CD1 1 
ATOM   1655  C  CD2 . LEU B  2 40  ? 99.158  -87.369  -83.649  1.00 66.08  ? 39   LEU B CD2 1 
ATOM   1656  N  N   . TYR B  2 41  ? 100.541 -82.226  -83.309  1.00 70.81  ? 40   TYR B N   1 
ATOM   1657  C  CA  . TYR B  2 41  ? 101.679 -81.309  -83.370  1.00 72.51  ? 40   TYR B CA  1 
ATOM   1658  C  C   . TYR B  2 41  ? 102.210 -80.959  -81.989  1.00 73.61  ? 40   TYR B C   1 
ATOM   1659  O  O   . TYR B  2 41  ? 103.327 -81.340  -81.628  1.00 73.18  ? 40   TYR B O   1 
ATOM   1660  C  CB  . TYR B  2 41  ? 101.269 -80.026  -84.100  1.00 73.21  ? 40   TYR B CB  1 
ATOM   1661  C  CG  . TYR B  2 41  ? 102.402 -79.051  -84.355  1.00 74.38  ? 40   TYR B CG  1 
ATOM   1662  C  CD1 . TYR B  2 41  ? 103.607 -79.482  -84.918  1.00 74.82  ? 40   TYR B CD1 1 
ATOM   1663  C  CD2 . TYR B  2 41  ? 102.255 -77.689  -84.078  1.00 73.50  ? 40   TYR B CD2 1 
ATOM   1664  C  CE1 . TYR B  2 41  ? 104.637 -78.583  -85.202  1.00 75.28  ? 40   TYR B CE1 1 
ATOM   1665  C  CE2 . TYR B  2 41  ? 103.278 -76.782  -84.361  1.00 74.60  ? 40   TYR B CE2 1 
ATOM   1666  C  CZ  . TYR B  2 41  ? 104.467 -77.236  -84.925  1.00 74.98  ? 40   TYR B CZ  1 
ATOM   1667  O  OH  . TYR B  2 41  ? 105.480 -76.349  -85.222  1.00 74.28  ? 40   TYR B OH  1 
ATOM   1668  N  N   . GLU B  2 42  ? 101.401 -80.221  -81.233  1.00 75.13  ? 41   GLU B N   1 
ATOM   1669  C  CA  . GLU B  2 42  ? 101.749 -79.796  -79.880  1.00 76.18  ? 41   GLU B CA  1 
ATOM   1670  C  C   . GLU B  2 42  ? 102.324 -80.958  -79.082  1.00 76.86  ? 41   GLU B C   1 
ATOM   1671  O  O   . GLU B  2 42  ? 103.467 -80.928  -78.631  1.00 77.65  ? 41   GLU B O   1 
ATOM   1672  C  CB  . GLU B  2 42  ? 100.503 -79.273  -79.166  1.00 75.91  ? 41   GLU B CB  1 
ATOM   1673  C  CG  . GLU B  2 42  ? 99.683  -78.304  -79.989  1.00 78.37  ? 41   GLU B CG  1 
ATOM   1674  C  CD  . GLU B  2 42  ? 98.381  -77.933  -79.311  1.00 80.35  ? 41   GLU B CD  1 
ATOM   1675  O  OE1 . GLU B  2 42  ? 97.679  -78.852  -78.838  1.00 81.06  ? 41   GLU B OE1 1 
ATOM   1676  O  OE2 . GLU B  2 42  ? 98.051  -76.728  -79.257  1.00 81.98  ? 41   GLU B OE2 1 
ATOM   1677  N  N   . GLN B  2 43  ? 101.514 -81.991  -78.922  1.00 77.31  ? 42   GLN B N   1 
ATOM   1678  C  CA  . GLN B  2 43  ? 101.916 -83.158  -78.170  1.00 78.60  ? 42   GLN B CA  1 
ATOM   1679  C  C   . GLN B  2 43  ? 103.134 -83.875  -78.737  1.00 78.54  ? 42   GLN B C   1 
ATOM   1680  O  O   . GLN B  2 43  ? 103.554 -84.902  -78.208  1.00 80.17  ? 42   GLN B O   1 
ATOM   1681  C  CB  . GLN B  2 43  ? 100.728 -84.105  -78.071  1.00 80.21  ? 42   GLN B CB  1 
ATOM   1682  C  CG  . GLN B  2 43  ? 99.511  -83.425  -77.459  1.00 83.20  ? 42   GLN B CG  1 
ATOM   1683  C  CD  . GLN B  2 43  ? 98.299  -84.326  -77.405  1.00 85.00  ? 42   GLN B CD  1 
ATOM   1684  O  OE1 . GLN B  2 43  ? 98.356  -85.425  -76.853  1.00 86.78  ? 42   GLN B OE1 1 
ATOM   1685  N  NE2 . GLN B  2 43  ? 97.190  -83.865  -77.974  1.00 84.51  ? 42   GLN B NE2 1 
ATOM   1686  N  N   . ASN B  2 44  ? 103.708 -83.340  -79.808  1.00 77.70  ? 43   ASN B N   1 
ATOM   1687  C  CA  . ASN B  2 44  ? 104.886 -83.957  -80.412  1.00 76.66  ? 43   ASN B CA  1 
ATOM   1688  C  C   . ASN B  2 44  ? 106.011 -82.952  -80.274  1.00 76.35  ? 43   ASN B C   1 
ATOM   1689  O  O   . ASN B  2 44  ? 107.166 -83.314  -80.074  1.00 76.50  ? 43   ASN B O   1 
ATOM   1690  C  CB  . ASN B  2 44  ? 104.638 -84.279  -81.891  1.00 75.70  ? 43   ASN B CB  1 
ATOM   1691  C  CG  . ASN B  2 44  ? 105.612 -85.317  -82.443  1.00 75.58  ? 43   ASN B CG  1 
ATOM   1692  O  OD1 . ASN B  2 44  ? 105.723 -86.427  -81.922  1.00 75.51  ? 43   ASN B OD1 1 
ATOM   1693  N  ND2 . ASN B  2 44  ? 106.314 -84.958  -83.510  1.00 74.75  ? 43   ASN B ND2 1 
ATOM   1694  N  N   . GLN B  2 45  ? 105.658 -81.679  -80.378  1.00 76.45  ? 44   GLN B N   1 
ATOM   1695  C  CA  . GLN B  2 45  ? 106.634 -80.606  -80.245  1.00 76.72  ? 44   GLN B CA  1 
ATOM   1696  C  C   . GLN B  2 45  ? 107.109 -80.635  -78.788  1.00 74.94  ? 44   GLN B C   1 
ATOM   1697  O  O   . GLN B  2 45  ? 108.301 -80.511  -78.500  1.00 73.39  ? 44   GLN B O   1 
ATOM   1698  C  CB  . GLN B  2 45  ? 105.970 -79.265  -80.579  1.00 78.12  ? 44   GLN B CB  1 
ATOM   1699  C  CG  . GLN B  2 45  ? 106.924 -78.101  -80.737  1.00 80.07  ? 44   GLN B CG  1 
ATOM   1700  C  CD  . GLN B  2 45  ? 106.189 -76.790  -80.929  1.00 82.02  ? 44   GLN B CD  1 
ATOM   1701  O  OE1 . GLN B  2 45  ? 105.375 -76.394  -80.090  1.00 82.38  ? 44   GLN B OE1 1 
ATOM   1702  N  NE2 . GLN B  2 45  ? 106.469 -76.106  -82.038  1.00 82.85  ? 44   GLN B NE2 1 
ATOM   1703  N  N   . SER B  2 46  ? 106.155 -80.813  -77.880  1.00 73.80  ? 45   SER B N   1 
ATOM   1704  C  CA  . SER B  2 46  ? 106.438 -80.894  -76.454  1.00 72.15  ? 45   SER B CA  1 
ATOM   1705  C  C   . SER B  2 46  ? 107.511 -81.948  -76.220  1.00 72.22  ? 45   SER B C   1 
ATOM   1706  O  O   . SER B  2 46  ? 108.610 -81.633  -75.782  1.00 72.99  ? 45   SER B O   1 
ATOM   1707  C  CB  . SER B  2 46  ? 105.173 -81.275  -75.693  1.00 70.46  ? 45   SER B CB  1 
ATOM   1708  O  OG  . SER B  2 46  ? 105.479 -81.583  -74.352  1.00 68.11  ? 45   SER B OG  1 
ATOM   1709  N  N   . ASP B  2 47  ? 107.182 -83.200  -76.517  1.00 72.36  ? 46   ASP B N   1 
ATOM   1710  C  CA  . ASP B  2 47  ? 108.123 -84.303  -76.365  1.00 72.29  ? 46   ASP B CA  1 
ATOM   1711  C  C   . ASP B  2 47  ? 109.451 -83.952  -77.009  1.00 71.76  ? 46   ASP B C   1 
ATOM   1712  O  O   . ASP B  2 47  ? 110.491 -84.475  -76.623  1.00 71.97  ? 46   ASP B O   1 
ATOM   1713  C  CB  . ASP B  2 47  ? 107.577 -85.563  -77.029  1.00 74.80  ? 46   ASP B CB  1 
ATOM   1714  C  CG  . ASP B  2 47  ? 106.413 -86.162  -76.278  1.00 77.19  ? 46   ASP B CG  1 
ATOM   1715  O  OD1 . ASP B  2 47  ? 105.445 -85.426  -75.984  1.00 77.95  ? 46   ASP B OD1 1 
ATOM   1716  O  OD2 . ASP B  2 47  ? 106.471 -87.378  -75.990  1.00 79.17  ? 46   ASP B OD2 1 
ATOM   1717  N  N   . VAL B  2 48  ? 109.408 -83.082  -78.012  1.00 71.72  ? 47   VAL B N   1 
ATOM   1718  C  CA  . VAL B  2 48  ? 110.622 -82.661  -78.696  1.00 71.69  ? 47   VAL B CA  1 
ATOM   1719  C  C   . VAL B  2 48  ? 111.397 -81.744  -77.758  1.00 70.93  ? 47   VAL B C   1 
ATOM   1720  O  O   . VAL B  2 48  ? 112.599 -81.910  -77.565  1.00 70.20  ? 47   VAL B O   1 
ATOM   1721  C  CB  . VAL B  2 48  ? 110.295 -81.927  -80.025  1.00 72.24  ? 47   VAL B CB  1 
ATOM   1722  C  CG1 . VAL B  2 48  ? 111.523 -81.193  -80.545  1.00 72.04  ? 47   VAL B CG1 1 
ATOM   1723  C  CG2 . VAL B  2 48  ? 109.828 -82.935  -81.065  1.00 71.30  ? 47   VAL B CG2 1 
ATOM   1724  N  N   . ASN B  2 49  ? 110.705 -80.781  -77.164  1.00 70.88  ? 48   ASN B N   1 
ATOM   1725  C  CA  . ASN B  2 49  ? 111.359 -79.876  -76.232  1.00 71.88  ? 48   ASN B CA  1 
ATOM   1726  C  C   . ASN B  2 49  ? 111.797 -80.670  -75.010  1.00 72.15  ? 48   ASN B C   1 
ATOM   1727  O  O   . ASN B  2 49  ? 112.954 -80.606  -74.603  1.00 72.60  ? 48   ASN B O   1 
ATOM   1728  C  CB  . ASN B  2 49  ? 110.408 -78.751  -75.820  1.00 71.41  ? 48   ASN B CB  1 
ATOM   1729  C  CG  . ASN B  2 49  ? 110.064 -77.838  -76.978  1.00 71.63  ? 48   ASN B CG  1 
ATOM   1730  O  OD1 . ASN B  2 49  ? 110.955 -77.361  -77.683  1.00 70.61  ? 48   ASN B OD1 1 
ATOM   1731  N  ND2 . ASN B  2 49  ? 108.772 -77.588  -77.184  1.00 71.88  ? 48   ASN B ND2 1 
ATOM   1732  N  N   . GLU B  2 50  ? 110.866 -81.437  -74.452  1.00 72.57  ? 49   GLU B N   1 
ATOM   1733  C  CA  . GLU B  2 50  ? 111.126 -82.260  -73.276  1.00 72.76  ? 49   GLU B CA  1 
ATOM   1734  C  C   . GLU B  2 50  ? 112.300 -83.208  -73.500  1.00 72.70  ? 49   GLU B C   1 
ATOM   1735  O  O   . GLU B  2 50  ? 112.789 -83.835  -72.562  1.00 73.87  ? 49   GLU B O   1 
ATOM   1736  C  CB  . GLU B  2 50  ? 109.869 -83.062  -72.909  1.00 72.97  ? 49   GLU B CB  1 
ATOM   1737  C  CG  . GLU B  2 50  ? 109.776 -83.462  -71.439  1.00 75.04  ? 49   GLU B CG  1 
ATOM   1738  C  CD  . GLU B  2 50  ? 110.044 -84.940  -71.193  1.00 76.55  ? 49   GLU B CD  1 
ATOM   1739  O  OE1 . GLU B  2 50  ? 111.080 -85.452  -71.672  1.00 77.98  ? 49   GLU B OE1 1 
ATOM   1740  O  OE2 . GLU B  2 50  ? 109.221 -85.590  -70.506  1.00 76.94  ? 49   GLU B OE2 1 
ATOM   1741  N  N   . ALA B  2 51  ? 112.763 -83.310  -74.739  1.00 72.66  ? 50   ALA B N   1 
ATOM   1742  C  CA  . ALA B  2 51  ? 113.879 -84.193  -75.041  1.00 73.43  ? 50   ALA B CA  1 
ATOM   1743  C  C   . ALA B  2 51  ? 115.177 -83.412  -75.184  1.00 73.76  ? 50   ALA B C   1 
ATOM   1744  O  O   . ALA B  2 51  ? 116.234 -83.889  -74.782  1.00 73.50  ? 50   ALA B O   1 
ATOM   1745  C  CB  . ALA B  2 51  ? 113.594 -84.990  -76.315  1.00 72.84  ? 50   ALA B CB  1 
ATOM   1746  N  N   . LYS B  2 52  ? 115.092 -82.214  -75.757  1.00 74.94  ? 51   LYS B N   1 
ATOM   1747  C  CA  . LYS B  2 52  ? 116.267 -81.363  -75.947  1.00 76.09  ? 51   LYS B CA  1 
ATOM   1748  C  C   . LYS B  2 52  ? 116.816 -80.873  -74.607  1.00 77.17  ? 51   LYS B C   1 
ATOM   1749  O  O   . LYS B  2 52  ? 118.025 -80.686  -74.443  1.00 76.54  ? 51   LYS B O   1 
ATOM   1750  C  CB  . LYS B  2 52  ? 115.910 -80.156  -76.817  1.00 75.01  ? 51   LYS B CB  1 
ATOM   1751  C  CG  . LYS B  2 52  ? 115.693 -80.475  -78.282  1.00 74.59  ? 51   LYS B CG  1 
ATOM   1752  C  CD  . LYS B  2 52  ? 115.174 -79.251  -79.016  1.00 75.26  ? 51   LYS B CD  1 
ATOM   1753  C  CE  . LYS B  2 52  ? 114.909 -79.527  -80.489  1.00 75.09  ? 51   LYS B CE  1 
ATOM   1754  N  NZ  . LYS B  2 52  ? 114.141 -78.410  -81.116  1.00 75.17  ? 51   LYS B NZ  1 
ATOM   1755  N  N   . SER B  2 53  ? 115.912 -80.667  -73.656  1.00 78.07  ? 52   SER B N   1 
ATOM   1756  C  CA  . SER B  2 53  ? 116.280 -80.202  -72.329  1.00 79.50  ? 52   SER B CA  1 
ATOM   1757  C  C   . SER B  2 53  ? 116.036 -81.280  -71.270  1.00 81.42  ? 52   SER B C   1 
ATOM   1758  O  O   . SER B  2 53  ? 116.958 -81.678  -70.556  1.00 82.43  ? 52   SER B O   1 
ATOM   1759  C  CB  . SER B  2 53  ? 115.480 -78.947  -71.980  1.00 78.34  ? 52   SER B CB  1 
ATOM   1760  O  OG  . SER B  2 53  ? 114.094 -79.227  -71.959  1.00 76.53  ? 52   SER B OG  1 
ATOM   1761  N  N   . GLY B  2 54  ? 114.795 -81.753  -71.182  1.00 82.63  ? 53   GLY B N   1 
ATOM   1762  C  CA  . GLY B  2 54  ? 114.430 -82.771  -70.208  1.00 83.32  ? 53   GLY B CA  1 
ATOM   1763  C  C   . GLY B  2 54  ? 115.265 -84.043  -70.192  1.00 84.21  ? 53   GLY B C   1 
ATOM   1764  O  O   . GLY B  2 54  ? 114.962 -84.961  -69.431  1.00 83.64  ? 53   GLY B O   1 
ATOM   1765  N  N   . GLY B  2 55  ? 116.300 -84.107  -71.030  1.00 84.85  ? 54   GLY B N   1 
ATOM   1766  C  CA  . GLY B  2 55  ? 117.168 -85.276  -71.071  1.00 86.06  ? 54   GLY B CA  1 
ATOM   1767  C  C   . GLY B  2 55  ? 116.589 -86.556  -71.661  1.00 86.95  ? 54   GLY B C   1 
ATOM   1768  O  O   . GLY B  2 55  ? 117.166 -87.133  -72.590  1.00 85.86  ? 54   GLY B O   1 
ATOM   1769  N  N   . ARG B  2 56  ? 115.459 -86.999  -71.109  1.00 87.78  ? 55   ARG B N   1 
ATOM   1770  C  CA  . ARG B  2 56  ? 114.762 -88.214  -71.545  1.00 88.67  ? 55   ARG B CA  1 
ATOM   1771  C  C   . ARG B  2 56  ? 114.819 -88.384  -73.073  1.00 90.26  ? 55   ARG B C   1 
ATOM   1772  O  O   . ARG B  2 56  ? 114.067 -87.730  -73.804  1.00 91.05  ? 55   ARG B O   1 
ATOM   1773  C  CB  . ARG B  2 56  ? 113.300 -88.159  -71.070  1.00 86.55  ? 55   ARG B CB  1 
ATOM   1774  C  CG  . ARG B  2 56  ? 112.547 -89.471  -71.199  1.00 84.76  ? 55   ARG B CG  1 
ATOM   1775  C  CD  . ARG B  2 56  ? 111.103 -89.365  -70.725  1.00 82.55  ? 55   ARG B CD  1 
ATOM   1776  N  NE  . ARG B  2 56  ? 110.415 -90.654  -70.814  1.00 80.36  ? 55   ARG B NE  1 
ATOM   1777  C  CZ  . ARG B  2 56  ? 109.137 -90.850  -70.497  1.00 79.21  ? 55   ARG B CZ  1 
ATOM   1778  N  NH1 . ARG B  2 56  ? 108.394 -89.839  -70.069  1.00 78.68  ? 55   ARG B NH1 1 
ATOM   1779  N  NH2 . ARG B  2 56  ? 108.603 -92.060  -70.603  1.00 77.67  ? 55   ARG B NH2 1 
ATOM   1780  N  N   . SER B  2 57  ? 115.703 -89.267  -73.546  1.00 91.04  ? 56   SER B N   1 
ATOM   1781  C  CA  . SER B  2 57  ? 115.874 -89.509  -74.985  1.00 91.87  ? 56   SER B CA  1 
ATOM   1782  C  C   . SER B  2 57  ? 115.062 -90.675  -75.554  1.00 91.82  ? 56   SER B C   1 
ATOM   1783  O  O   . SER B  2 57  ? 114.898 -90.792  -76.771  1.00 91.72  ? 56   SER B O   1 
ATOM   1784  C  CB  . SER B  2 57  ? 117.355 -89.736  -75.308  1.00 92.83  ? 56   SER B CB  1 
ATOM   1785  O  OG  . SER B  2 57  ? 117.553 -89.926  -76.703  1.00 93.21  ? 56   SER B OG  1 
ATOM   1786  N  N   . ASP B  2 58  ? 114.561 -91.535  -74.677  1.00 91.38  ? 57   ASP B N   1 
ATOM   1787  C  CA  . ASP B  2 58  ? 113.767 -92.689  -75.088  1.00 91.13  ? 57   ASP B CA  1 
ATOM   1788  C  C   . ASP B  2 58  ? 112.547 -92.282  -75.917  1.00 90.56  ? 57   ASP B C   1 
ATOM   1789  O  O   . ASP B  2 58  ? 111.725 -93.131  -76.266  1.00 91.00  ? 57   ASP B O   1 
ATOM   1790  C  CB  . ASP B  2 58  ? 113.281 -93.438  -73.847  1.00 91.79  ? 57   ASP B CB  1 
ATOM   1791  C  CG  . ASP B  2 58  ? 112.362 -92.584  -72.977  1.00 93.02  ? 57   ASP B CG  1 
ATOM   1792  O  OD1 . ASP B  2 58  ? 111.848 -93.095  -71.959  1.00 93.09  ? 57   ASP B OD1 1 
ATOM   1793  O  OD2 . ASP B  2 58  ? 112.151 -91.396  -73.312  1.00 93.49  ? 57   ASP B OD2 1 
ATOM   1794  N  N   . LEU B  2 59  ? 112.432 -90.992  -76.228  1.00 88.77  ? 58   LEU B N   1 
ATOM   1795  C  CA  . LEU B  2 59  ? 111.287 -90.476  -76.973  1.00 86.72  ? 58   LEU B CA  1 
ATOM   1796  C  C   . LEU B  2 59  ? 111.332 -90.486  -78.504  1.00 85.39  ? 58   LEU B C   1 
ATOM   1797  O  O   . LEU B  2 59  ? 110.276 -90.551  -79.133  1.00 85.14  ? 58   LEU B O   1 
ATOM   1798  C  CB  . LEU B  2 59  ? 110.963 -89.056  -76.495  1.00 86.89  ? 58   LEU B CB  1 
ATOM   1799  C  CG  . LEU B  2 59  ? 110.516 -88.865  -75.042  1.00 86.27  ? 58   LEU B CG  1 
ATOM   1800  C  CD1 . LEU B  2 59  ? 110.269 -87.391  -74.788  1.00 85.83  ? 58   LEU B CD1 1 
ATOM   1801  C  CD2 . LEU B  2 59  ? 109.250 -89.651  -74.768  1.00 85.51  ? 58   LEU B CD2 1 
ATOM   1802  N  N   . ILE B  2 60  ? 112.520 -90.418  -79.108  1.00 83.74  ? 59   ILE B N   1 
ATOM   1803  C  CA  . ILE B  2 60  ? 112.627 -90.413  -80.575  1.00 81.99  ? 59   ILE B CA  1 
ATOM   1804  C  C   . ILE B  2 60  ? 111.537 -91.251  -81.251  1.00 80.81  ? 59   ILE B C   1 
ATOM   1805  O  O   . ILE B  2 60  ? 110.810 -90.751  -82.110  1.00 80.20  ? 59   ILE B O   1 
ATOM   1806  C  CB  . ILE B  2 60  ? 114.018 -90.918  -81.070  1.00 82.45  ? 59   ILE B CB  1 
ATOM   1807  C  CG1 . ILE B  2 60  ? 115.029 -89.770  -81.083  1.00 81.10  ? 59   ILE B CG1 1 
ATOM   1808  C  CG2 . ILE B  2 60  ? 113.905 -91.497  -82.477  1.00 82.41  ? 59   ILE B CG2 1 
ATOM   1809  C  CD1 . ILE B  2 60  ? 115.405 -89.282  -79.731  1.00 81.43  ? 59   ILE B CD1 1 
ATOM   1810  N  N   . PRO B  2 61  ? 111.417 -92.540  -80.880  1.00 79.46  ? 60   PRO B N   1 
ATOM   1811  C  CA  . PRO B  2 61  ? 110.391 -93.396  -81.483  1.00 77.94  ? 60   PRO B CA  1 
ATOM   1812  C  C   . PRO B  2 61  ? 109.020 -92.735  -81.464  1.00 76.11  ? 60   PRO B C   1 
ATOM   1813  O  O   . PRO B  2 61  ? 108.402 -92.525  -82.508  1.00 75.67  ? 60   PRO B O   1 
ATOM   1814  C  CB  . PRO B  2 61  ? 110.438 -94.644  -80.612  1.00 77.69  ? 60   PRO B CB  1 
ATOM   1815  C  CG  . PRO B  2 61  ? 111.890 -94.753  -80.316  1.00 78.77  ? 60   PRO B CG  1 
ATOM   1816  C  CD  . PRO B  2 61  ? 112.261 -93.323  -79.960  1.00 79.00  ? 60   PRO B CD  1 
ATOM   1817  N  N   . THR B  2 62  ? 108.558 -92.402  -80.266  1.00 73.80  ? 61   THR B N   1 
ATOM   1818  C  CA  . THR B  2 62  ? 107.262 -91.767  -80.098  1.00 71.98  ? 61   THR B CA  1 
ATOM   1819  C  C   . THR B  2 62  ? 107.098 -90.516  -80.954  1.00 71.59  ? 61   THR B C   1 
ATOM   1820  O  O   . THR B  2 62  ? 105.990 -90.190  -81.381  1.00 70.62  ? 61   THR B O   1 
ATOM   1821  C  CB  . THR B  2 62  ? 107.037 -91.388  -78.634  1.00 71.17  ? 61   THR B CB  1 
ATOM   1822  O  OG1 . THR B  2 62  ? 107.176 -92.560  -77.823  1.00 69.98  ? 61   THR B OG1 1 
ATOM   1823  C  CG2 . THR B  2 62  ? 105.646 -90.785  -78.442  1.00 69.55  ? 61   THR B CG2 1 
ATOM   1824  N  N   . ILE B  2 63  ? 108.201 -89.817  -81.209  1.00 71.58  ? 62   ILE B N   1 
ATOM   1825  C  CA  . ILE B  2 63  ? 108.140 -88.597  -82.006  1.00 70.78  ? 62   ILE B CA  1 
ATOM   1826  C  C   . ILE B  2 63  ? 107.988 -88.930  -83.489  1.00 70.37  ? 62   ILE B C   1 
ATOM   1827  O  O   . ILE B  2 63  ? 107.074 -88.422  -84.140  1.00 71.58  ? 62   ILE B O   1 
ATOM   1828  C  CB  . ILE B  2 63  ? 109.403 -87.707  -81.824  1.00 70.19  ? 62   ILE B CB  1 
ATOM   1829  C  CG1 . ILE B  2 63  ? 109.953 -87.814  -80.396  1.00 70.28  ? 62   ILE B CG1 1 
ATOM   1830  C  CG2 . ILE B  2 63  ? 109.043 -86.257  -82.108  1.00 68.61  ? 62   ILE B CG2 1 
ATOM   1831  C  CD1 . ILE B  2 63  ? 109.065 -87.231  -79.326  1.00 70.09  ? 62   ILE B CD1 1 
ATOM   1832  N  N   . LYS B  2 64  ? 108.874 -89.775  -84.020  1.00 68.96  ? 63   LYS B N   1 
ATOM   1833  C  CA  . LYS B  2 64  ? 108.804 -90.158  -85.431  1.00 68.13  ? 63   LYS B CA  1 
ATOM   1834  C  C   . LYS B  2 64  ? 107.407 -90.677  -85.738  1.00 68.01  ? 63   LYS B C   1 
ATOM   1835  O  O   . LYS B  2 64  ? 106.767 -90.248  -86.699  1.00 67.43  ? 63   LYS B O   1 
ATOM   1836  C  CB  . LYS B  2 64  ? 109.839 -91.237  -85.768  1.00 66.98  ? 63   LYS B CB  1 
ATOM   1837  C  CG  . LYS B  2 64  ? 111.280 -90.750  -85.721  1.00 68.97  ? 63   LYS B CG  1 
ATOM   1838  C  CD  . LYS B  2 64  ? 112.265 -91.793  -86.248  1.00 69.78  ? 63   LYS B CD  1 
ATOM   1839  C  CE  . LYS B  2 64  ? 112.163 -91.974  -87.765  1.00 71.24  ? 63   LYS B CE  1 
ATOM   1840  N  NZ  . LYS B  2 64  ? 112.702 -90.805  -88.525  1.00 70.67  ? 63   LYS B NZ  1 
ATOM   1841  N  N   . PHE B  2 65  ? 106.939 -91.599  -84.907  1.00 67.64  ? 64   PHE B N   1 
ATOM   1842  C  CA  . PHE B  2 65  ? 105.615 -92.163  -85.072  1.00 66.14  ? 64   PHE B CA  1 
ATOM   1843  C  C   . PHE B  2 65  ? 104.639 -91.025  -85.335  1.00 65.63  ? 64   PHE B C   1 
ATOM   1844  O  O   . PHE B  2 65  ? 104.032 -90.973  -86.395  1.00 67.58  ? 64   PHE B O   1 
ATOM   1845  C  CB  . PHE B  2 65  ? 105.203 -92.915  -83.810  1.00 66.97  ? 64   PHE B CB  1 
ATOM   1846  C  CG  . PHE B  2 65  ? 103.869 -93.593  -83.916  1.00 67.27  ? 64   PHE B CG  1 
ATOM   1847  C  CD1 . PHE B  2 65  ? 103.787 -94.946  -84.214  1.00 67.04  ? 64   PHE B CD1 1 
ATOM   1848  C  CD2 . PHE B  2 65  ? 102.689 -92.878  -83.718  1.00 66.90  ? 64   PHE B CD2 1 
ATOM   1849  C  CE1 . PHE B  2 65  ? 102.546 -95.577  -84.312  1.00 66.92  ? 64   PHE B CE1 1 
ATOM   1850  C  CE2 . PHE B  2 65  ? 101.449 -93.505  -83.817  1.00 65.72  ? 64   PHE B CE2 1 
ATOM   1851  C  CZ  . PHE B  2 65  ? 101.377 -94.853  -84.112  1.00 65.26  ? 64   PHE B CZ  1 
ATOM   1852  N  N   . ARG B  2 66  ? 104.496 -90.106  -84.382  1.00 64.44  ? 65   ARG B N   1 
ATOM   1853  C  CA  . ARG B  2 66  ? 103.568 -88.987  -84.559  1.00 63.82  ? 65   ARG B CA  1 
ATOM   1854  C  C   . ARG B  2 66  ? 103.823 -88.197  -85.836  1.00 62.39  ? 65   ARG B C   1 
ATOM   1855  O  O   . ARG B  2 66  ? 102.898 -87.621  -86.411  1.00 60.75  ? 65   ARG B O   1 
ATOM   1856  C  CB  . ARG B  2 66  ? 103.622 -88.017  -83.372  1.00 65.59  ? 65   ARG B CB  1 
ATOM   1857  C  CG  . ARG B  2 66  ? 103.014 -88.535  -82.085  1.00 68.00  ? 65   ARG B CG  1 
ATOM   1858  C  CD  . ARG B  2 66  ? 102.658 -87.386  -81.149  1.00 70.11  ? 65   ARG B CD  1 
ATOM   1859  N  NE  . ARG B  2 66  ? 102.566 -87.814  -79.751  1.00 73.77  ? 65   ARG B NE  1 
ATOM   1860  C  CZ  . ARG B  2 66  ? 103.615 -88.088  -78.974  1.00 75.09  ? 65   ARG B CZ  1 
ATOM   1861  N  NH1 . ARG B  2 66  ? 104.853 -87.979  -79.445  1.00 75.76  ? 65   ARG B NH1 1 
ATOM   1862  N  NH2 . ARG B  2 66  ? 103.428 -88.482  -77.722  1.00 75.25  ? 65   ARG B NH2 1 
ATOM   1863  N  N   . HIS B  2 67  ? 105.076 -88.159  -86.275  1.00 61.12  ? 66   HIS B N   1 
ATOM   1864  C  CA  . HIS B  2 67  ? 105.407 -87.424  -87.489  1.00 60.40  ? 66   HIS B CA  1 
ATOM   1865  C  C   . HIS B  2 67  ? 104.696 -88.071  -88.680  1.00 60.86  ? 66   HIS B C   1 
ATOM   1866  O  O   . HIS B  2 67  ? 104.117 -87.381  -89.523  1.00 60.02  ? 66   HIS B O   1 
ATOM   1867  C  CB  . HIS B  2 67  ? 106.924 -87.401  -87.705  1.00 57.89  ? 66   HIS B CB  1 
ATOM   1868  C  CG  . HIS B  2 67  ? 107.371 -86.386  -88.712  1.00 56.29  ? 66   HIS B CG  1 
ATOM   1869  N  ND1 . HIS B  2 67  ? 106.892 -85.091  -88.725  1.00 55.18  ? 66   HIS B ND1 1 
ATOM   1870  C  CD2 . HIS B  2 67  ? 108.249 -86.473  -89.739  1.00 54.38  ? 66   HIS B CD2 1 
ATOM   1871  C  CE1 . HIS B  2 67  ? 107.453 -84.428  -89.720  1.00 54.04  ? 66   HIS B CE1 1 
ATOM   1872  N  NE2 . HIS B  2 67  ? 108.280 -85.244  -90.350  1.00 53.93  ? 66   HIS B NE2 1 
ATOM   1873  N  N   . CYS B  2 68  ? 104.743 -89.400  -88.742  1.00 61.16  ? 67   CYS B N   1 
ATOM   1874  C  CA  . CYS B  2 68  ? 104.072 -90.134  -89.801  1.00 61.21  ? 67   CYS B CA  1 
ATOM   1875  C  C   . CYS B  2 68  ? 102.611 -89.708  -89.827  1.00 61.48  ? 67   CYS B C   1 
ATOM   1876  O  O   . CYS B  2 68  ? 102.067 -89.421  -90.889  1.00 63.15  ? 67   CYS B O   1 
ATOM   1877  C  CB  . CYS B  2 68  ? 104.163 -91.634  -89.550  1.00 60.78  ? 67   CYS B CB  1 
ATOM   1878  S  SG  . CYS B  2 68  ? 105.809 -92.292  -89.798  1.00 64.66  ? 67   CYS B SG  1 
ATOM   1879  N  N   . SER B  2 69  ? 101.979 -89.661  -88.660  1.00 59.79  ? 68   SER B N   1 
ATOM   1880  C  CA  . SER B  2 69  ? 100.587 -89.253  -88.587  1.00 59.80  ? 68   SER B CA  1 
ATOM   1881  C  C   . SER B  2 69  ? 100.358 -87.892  -89.225  1.00 60.66  ? 68   SER B C   1 
ATOM   1882  O  O   . SER B  2 69  ? 99.467  -87.742  -90.061  1.00 62.55  ? 68   SER B O   1 
ATOM   1883  C  CB  . SER B  2 69  ? 100.112 -89.224  -87.142  1.00 59.57  ? 68   SER B CB  1 
ATOM   1884  O  OG  . SER B  2 69  ? 99.888  -90.537  -86.677  1.00 60.39  ? 68   SER B OG  1 
ATOM   1885  N  N   . LEU B  2 70  ? 101.146 -86.896  -88.831  1.00 60.44  ? 69   LEU B N   1 
ATOM   1886  C  CA  . LEU B  2 70  ? 100.999 -85.566  -89.413  1.00 58.91  ? 69   LEU B CA  1 
ATOM   1887  C  C   . LEU B  2 70  ? 101.049 -85.649  -90.944  1.00 57.14  ? 69   LEU B C   1 
ATOM   1888  O  O   . LEU B  2 70  ? 100.167 -85.127  -91.625  1.00 56.22  ? 69   LEU B O   1 
ATOM   1889  C  CB  . LEU B  2 70  ? 102.107 -84.621  -88.919  1.00 60.65  ? 69   LEU B CB  1 
ATOM   1890  C  CG  . LEU B  2 70  ? 102.053 -83.992  -87.523  1.00 61.19  ? 69   LEU B CG  1 
ATOM   1891  C  CD1 . LEU B  2 70  ? 100.652 -83.429  -87.267  1.00 61.37  ? 69   LEU B CD1 1 
ATOM   1892  C  CD2 . LEU B  2 70  ? 102.428 -85.021  -86.477  1.00 61.70  ? 69   LEU B CD2 1 
ATOM   1893  N  N   . LEU B  2 71  ? 102.082 -86.306  -91.473  1.00 54.88  ? 70   LEU B N   1 
ATOM   1894  C  CA  . LEU B  2 71  ? 102.242 -86.459  -92.916  1.00 54.03  ? 70   LEU B CA  1 
ATOM   1895  C  C   . LEU B  2 71  ? 101.039 -87.176  -93.537  1.00 54.86  ? 70   LEU B C   1 
ATOM   1896  O  O   . LEU B  2 71  ? 100.401 -86.651  -94.449  1.00 55.09  ? 70   LEU B O   1 
ATOM   1897  C  CB  . LEU B  2 71  ? 103.537 -87.224  -93.239  1.00 51.99  ? 70   LEU B CB  1 
ATOM   1898  C  CG  . LEU B  2 71  ? 104.876 -86.562  -92.856  1.00 51.44  ? 70   LEU B CG  1 
ATOM   1899  C  CD1 . LEU B  2 71  ? 106.059 -87.381  -93.371  1.00 46.60  ? 70   LEU B CD1 1 
ATOM   1900  C  CD2 . LEU B  2 71  ? 104.926 -85.157  -93.432  1.00 51.18  ? 70   LEU B CD2 1 
ATOM   1901  N  N   . ARG B  2 72  ? 100.725 -88.370  -93.040  1.00 55.45  ? 71   ARG B N   1 
ATOM   1902  C  CA  . ARG B  2 72  ? 99.587  -89.131  -93.548  1.00 54.71  ? 71   ARG B CA  1 
ATOM   1903  C  C   . ARG B  2 72  ? 98.372  -88.211  -93.558  1.00 53.98  ? 71   ARG B C   1 
ATOM   1904  O  O   . ARG B  2 72  ? 97.858  -87.871  -94.612  1.00 54.25  ? 71   ARG B O   1 
ATOM   1905  C  CB  . ARG B  2 72  ? 99.312  -90.341  -92.657  1.00 54.24  ? 71   ARG B CB  1 
ATOM   1906  C  CG  . ARG B  2 72  ? 98.837  -91.577  -93.400  1.00 54.79  ? 71   ARG B CG  1 
ATOM   1907  C  CD  . ARG B  2 72  ? 97.548  -91.320  -94.151  1.00 55.83  ? 71   ARG B CD  1 
ATOM   1908  N  NE  . ARG B  2 72  ? 96.994  -92.530  -94.760  1.00 56.05  ? 71   ARG B NE  1 
ATOM   1909  C  CZ  . ARG B  2 72  ? 97.633  -93.281  -95.650  1.00 56.55  ? 71   ARG B CZ  1 
ATOM   1910  N  NH1 . ARG B  2 72  ? 98.858  -92.957  -96.043  1.00 56.94  ? 71   ARG B NH1 1 
ATOM   1911  N  NH2 . ARG B  2 72  ? 97.045  -94.354  -96.150  1.00 56.73  ? 71   ARG B NH2 1 
ATOM   1912  N  N   . ASN B  2 73  ? 97.925  -87.792  -92.385  1.00 54.01  ? 72   ASN B N   1 
ATOM   1913  C  CA  . ASN B  2 73  ? 96.776  -86.896  -92.298  1.00 55.57  ? 72   ASN B CA  1 
ATOM   1914  C  C   . ASN B  2 73  ? 96.805  -85.812  -93.370  1.00 54.55  ? 72   ASN B C   1 
ATOM   1915  O  O   . ASN B  2 73  ? 95.761  -85.339  -93.819  1.00 54.03  ? 72   ASN B O   1 
ATOM   1916  C  CB  . ASN B  2 73  ? 96.721  -86.224  -90.920  1.00 58.34  ? 72   ASN B CB  1 
ATOM   1917  C  CG  . ASN B  2 73  ? 95.934  -87.029  -89.910  1.00 60.34  ? 72   ASN B CG  1 
ATOM   1918  O  OD1 . ASN B  2 73  ? 94.745  -87.291  -90.106  1.00 62.01  ? 72   ASN B OD1 1 
ATOM   1919  N  ND2 . ASN B  2 73  ? 96.589  -87.425  -88.819  1.00 60.23  ? 72   ASN B ND2 1 
ATOM   1920  N  N   . ARG B  2 74  ? 98.005  -85.417  -93.776  1.00 54.04  ? 73   ARG B N   1 
ATOM   1921  C  CA  . ARG B  2 74  ? 98.155  -84.373  -94.782  1.00 54.03  ? 73   ARG B CA  1 
ATOM   1922  C  C   . ARG B  2 74  ? 97.982  -84.930  -96.197  1.00 52.35  ? 73   ARG B C   1 
ATOM   1923  O  O   . ARG B  2 74  ? 97.210  -84.395  -96.992  1.00 51.34  ? 73   ARG B O   1 
ATOM   1924  C  CB  . ARG B  2 74  ? 99.524  -83.709  -94.642  1.00 56.09  ? 73   ARG B CB  1 
ATOM   1925  C  CG  . ARG B  2 74  ? 99.637  -82.389  -95.366  1.00 58.10  ? 73   ARG B CG  1 
ATOM   1926  C  CD  . ARG B  2 74  ? 101.068 -81.914  -95.365  1.00 59.88  ? 73   ARG B CD  1 
ATOM   1927  N  NE  . ARG B  2 74  ? 101.938 -82.948  -95.909  1.00 60.62  ? 73   ARG B NE  1 
ATOM   1928  C  CZ  . ARG B  2 74  ? 102.903 -82.711  -96.789  1.00 62.05  ? 73   ARG B CZ  1 
ATOM   1929  N  NH1 . ARG B  2 74  ? 103.652 -83.713  -97.238  1.00 61.01  ? 73   ARG B NH1 1 
ATOM   1930  N  NH2 . ARG B  2 74  ? 103.110 -81.468  -97.220  1.00 60.15  ? 73   ARG B NH2 1 
ATOM   1931  N  N   . ARG B  2 75  ? 98.707  -86.001  -96.503  1.00 50.19  ? 74   ARG B N   1 
ATOM   1932  C  CA  . ARG B  2 75  ? 98.619  -86.644  -97.807  1.00 47.25  ? 74   ARG B CA  1 
ATOM   1933  C  C   . ARG B  2 75  ? 97.141  -86.824  -98.158  1.00 47.27  ? 74   ARG B C   1 
ATOM   1934  O  O   . ARG B  2 75  ? 96.686  -86.463  -99.245  1.00 48.05  ? 74   ARG B O   1 
ATOM   1935  C  CB  . ARG B  2 75  ? 99.299  -88.012  -97.753  1.00 44.74  ? 74   ARG B CB  1 
ATOM   1936  C  CG  . ARG B  2 75  ? 99.313  -88.745  -99.076  1.00 44.23  ? 74   ARG B CG  1 
ATOM   1937  C  CD  . ARG B  2 75  ? 99.673  -90.221  -98.936  1.00 40.94  ? 74   ARG B CD  1 
ATOM   1938  N  NE  . ARG B  2 75  ? 99.937  -90.803  -100.246 1.00 43.48  ? 74   ARG B NE  1 
ATOM   1939  C  CZ  . ARG B  2 75  ? 99.938  -92.104  -100.518 1.00 44.82  ? 74   ARG B CZ  1 
ATOM   1940  N  NH1 . ARG B  2 75  ? 99.691  -92.991  -99.570  1.00 45.46  ? 74   ARG B NH1 1 
ATOM   1941  N  NH2 . ARG B  2 75  ? 100.167 -92.519  -101.753 1.00 46.18  ? 74   ARG B NH2 1 
ATOM   1942  N  N   . CYS B  2 76  ? 96.393  -87.372  -97.210  1.00 45.72  ? 75   CYS B N   1 
ATOM   1943  C  CA  . CYS B  2 76  ? 94.977  -87.625  -97.392  1.00 44.93  ? 75   CYS B CA  1 
ATOM   1944  C  C   . CYS B  2 76  ? 94.147  -86.370  -97.535  1.00 45.37  ? 75   CYS B C   1 
ATOM   1945  O  O   . CYS B  2 76  ? 93.297  -86.269  -98.424  1.00 46.99  ? 75   CYS B O   1 
ATOM   1946  C  CB  . CYS B  2 76  ? 94.433  -88.438  -96.220  1.00 44.00  ? 75   CYS B CB  1 
ATOM   1947  S  SG  . CYS B  2 76  ? 95.178  -90.057  -96.051  1.00 43.83  ? 75   CYS B SG  1 
ATOM   1948  N  N   . THR B  2 77  ? 94.370  -85.408  -96.659  1.00 44.62  ? 76   THR B N   1 
ATOM   1949  C  CA  . THR B  2 77  ? 93.573  -84.207  -96.743  1.00 44.55  ? 76   THR B CA  1 
ATOM   1950  C  C   . THR B  2 77  ? 93.873  -83.403  -98.025  1.00 44.58  ? 76   THR B C   1 
ATOM   1951  O  O   . THR B  2 77  ? 93.069  -82.565  -98.436  1.00 45.30  ? 76   THR B O   1 
ATOM   1952  C  CB  . THR B  2 77  ? 93.741  -83.352  -95.458  1.00 44.01  ? 76   THR B CB  1 
ATOM   1953  O  OG1 . THR B  2 77  ? 92.802  -82.269  -95.480  1.00 45.62  ? 76   THR B OG1 1 
ATOM   1954  C  CG2 . THR B  2 77  ? 95.146  -82.809  -95.343  1.00 43.32  ? 76   THR B CG2 1 
ATOM   1955  N  N   . VAL B  2 78  ? 95.007  -83.673  -98.675  1.00 43.24  ? 77   VAL B N   1 
ATOM   1956  C  CA  . VAL B  2 78  ? 95.354  -82.958  -99.907  1.00 42.23  ? 77   VAL B CA  1 
ATOM   1957  C  C   . VAL B  2 78  ? 94.768  -83.702  -101.100 1.00 43.46  ? 77   VAL B C   1 
ATOM   1958  O  O   . VAL B  2 78  ? 94.120  -83.096  -101.971 1.00 43.10  ? 77   VAL B O   1 
ATOM   1959  C  CB  . VAL B  2 78  ? 96.897  -82.816  -100.095 1.00 41.14  ? 77   VAL B CB  1 
ATOM   1960  C  CG1 . VAL B  2 78  ? 97.214  -82.253  -101.462 1.00 38.83  ? 77   VAL B CG1 1 
ATOM   1961  C  CG2 . VAL B  2 78  ? 97.464  -81.879  -99.043  1.00 40.72  ? 77   VAL B CG2 1 
ATOM   1962  N  N   . ALA B  2 79  ? 94.997  -85.017  -101.125 1.00 42.18  ? 78   ALA B N   1 
ATOM   1963  C  CA  . ALA B  2 79  ? 94.491  -85.883  -102.189 1.00 40.48  ? 78   ALA B CA  1 
ATOM   1964  C  C   . ALA B  2 79  ? 92.966  -85.726  -102.319 1.00 39.76  ? 78   ALA B C   1 
ATOM   1965  O  O   . ALA B  2 79  ? 92.416  -85.678  -103.422 1.00 39.64  ? 78   ALA B O   1 
ATOM   1966  C  CB  . ALA B  2 79  ? 94.855  -87.328  -101.884 1.00 38.90  ? 78   ALA B CB  1 
ATOM   1967  N  N   . TYR B  2 80  ? 92.298  -85.647  -101.177 1.00 38.68  ? 79   TYR B N   1 
ATOM   1968  C  CA  . TYR B  2 80  ? 90.860  -85.469  -101.124 1.00 38.53  ? 79   TYR B CA  1 
ATOM   1969  C  C   . TYR B  2 80  ? 90.459  -84.159  -101.808 1.00 40.64  ? 79   TYR B C   1 
ATOM   1970  O  O   . TYR B  2 80  ? 89.671  -84.155  -102.760 1.00 42.58  ? 79   TYR B O   1 
ATOM   1971  C  CB  . TYR B  2 80  ? 90.412  -85.462  -99.658  1.00 36.11  ? 79   TYR B CB  1 
ATOM   1972  C  CG  . TYR B  2 80  ? 89.001  -84.975  -99.416  1.00 33.77  ? 79   TYR B CG  1 
ATOM   1973  C  CD1 . TYR B  2 80  ? 87.935  -85.861  -99.319  1.00 33.24  ? 79   TYR B CD1 1 
ATOM   1974  C  CD2 . TYR B  2 80  ? 88.739  -83.622  -99.276  1.00 33.63  ? 79   TYR B CD2 1 
ATOM   1975  C  CE1 . TYR B  2 80  ? 86.640  -85.402  -99.085  1.00 33.14  ? 79   TYR B CE1 1 
ATOM   1976  C  CE2 . TYR B  2 80  ? 87.455  -83.154  -99.047  1.00 34.07  ? 79   TYR B CE2 1 
ATOM   1977  C  CZ  . TYR B  2 80  ? 86.410  -84.043  -98.951  1.00 33.35  ? 79   TYR B CZ  1 
ATOM   1978  O  OH  . TYR B  2 80  ? 85.144  -83.549  -98.722  1.00 33.32  ? 79   TYR B OH  1 
ATOM   1979  N  N   . LEU B  2 81  ? 91.006  -83.047  -101.330 1.00 41.33  ? 80   LEU B N   1 
ATOM   1980  C  CA  . LEU B  2 81  ? 90.674  -81.744  -101.893 1.00 42.36  ? 80   LEU B CA  1 
ATOM   1981  C  C   . LEU B  2 81  ? 91.022  -81.602  -103.370 1.00 43.14  ? 80   LEU B C   1 
ATOM   1982  O  O   . LEU B  2 81  ? 90.448  -80.765  -104.071 1.00 44.86  ? 80   LEU B O   1 
ATOM   1983  C  CB  . LEU B  2 81  ? 91.360  -80.632  -101.098 1.00 41.61  ? 80   LEU B CB  1 
ATOM   1984  C  CG  . LEU B  2 81  ? 90.831  -80.348  -99.689  1.00 42.04  ? 80   LEU B CG  1 
ATOM   1985  C  CD1 . LEU B  2 81  ? 91.577  -79.155  -99.136  1.00 43.68  ? 80   LEU B CD1 1 
ATOM   1986  C  CD2 . LEU B  2 81  ? 89.330  -80.046  -99.704  1.00 41.64  ? 80   LEU B CD2 1 
ATOM   1987  N  N   . TYR B  2 82  ? 91.961  -82.415  -103.840 1.00 42.78  ? 81   TYR B N   1 
ATOM   1988  C  CA  . TYR B  2 82  ? 92.385  -82.360  -105.235 1.00 42.54  ? 81   TYR B CA  1 
ATOM   1989  C  C   . TYR B  2 82  ? 91.455  -83.163  -106.135 1.00 42.83  ? 81   TYR B C   1 
ATOM   1990  O  O   . TYR B  2 82  ? 91.098  -82.721  -107.234 1.00 42.48  ? 81   TYR B O   1 
ATOM   1991  C  CB  . TYR B  2 82  ? 93.805  -82.903  -105.375 1.00 42.38  ? 81   TYR B CB  1 
ATOM   1992  C  CG  . TYR B  2 82  ? 94.411  -82.671  -106.736 1.00 42.51  ? 81   TYR B CG  1 
ATOM   1993  C  CD1 . TYR B  2 82  ? 94.632  -81.377  -107.214 1.00 41.13  ? 81   TYR B CD1 1 
ATOM   1994  C  CD2 . TYR B  2 82  ? 94.779  -83.748  -107.546 1.00 44.07  ? 81   TYR B CD2 1 
ATOM   1995  C  CE1 . TYR B  2 82  ? 95.209  -81.165  -108.465 1.00 41.80  ? 81   TYR B CE1 1 
ATOM   1996  C  CE2 . TYR B  2 82  ? 95.357  -83.547  -108.799 1.00 43.46  ? 81   TYR B CE2 1 
ATOM   1997  C  CZ  . TYR B  2 82  ? 95.567  -82.254  -109.252 1.00 42.90  ? 81   TYR B CZ  1 
ATOM   1998  O  OH  . TYR B  2 82  ? 96.120  -82.060  -110.496 1.00 42.55  ? 81   TYR B OH  1 
ATOM   1999  N  N   . ASP B  2 83  ? 91.068  -84.347  -105.668 1.00 41.66  ? 82   ASP B N   1 
ATOM   2000  C  CA  . ASP B  2 83  ? 90.183  -85.193  -106.442 1.00 40.90  ? 82   ASP B CA  1 
ATOM   2001  C  C   . ASP B  2 83  ? 88.845  -84.511  -106.643 1.00 40.17  ? 82   ASP B C   1 
ATOM   2002  O  O   . ASP B  2 83  ? 88.190  -84.732  -107.648 1.00 41.81  ? 82   ASP B O   1 
ATOM   2003  C  CB  . ASP B  2 83  ? 89.975  -86.537  -105.763 1.00 41.27  ? 82   ASP B CB  1 
ATOM   2004  C  CG  . ASP B  2 83  ? 89.741  -87.646  -106.760 1.00 42.98  ? 82   ASP B CG  1 
ATOM   2005  O  OD1 . ASP B  2 83  ? 90.712  -88.046  -107.452 1.00 40.84  ? 82   ASP B OD1 1 
ATOM   2006  O  OD2 . ASP B  2 83  ? 88.584  -88.103  -106.860 1.00 44.48  ? 82   ASP B OD2 1 
ATOM   2007  N  N   . ARG B  2 84  ? 88.433  -83.685  -105.690 1.00 38.72  ? 83   ARG B N   1 
ATOM   2008  C  CA  . ARG B  2 84  ? 87.177  -82.972  -105.843 1.00 38.01  ? 83   ARG B CA  1 
ATOM   2009  C  C   . ARG B  2 84  ? 87.371  -81.915  -106.926 1.00 38.76  ? 83   ARG B C   1 
ATOM   2010  O  O   . ARG B  2 84  ? 86.470  -81.637  -107.713 1.00 40.06  ? 83   ARG B O   1 
ATOM   2011  C  CB  . ARG B  2 84  ? 86.768  -82.309  -104.533 1.00 37.42  ? 83   ARG B CB  1 
ATOM   2012  C  CG  . ARG B  2 84  ? 86.517  -83.287  -103.395 1.00 37.57  ? 83   ARG B CG  1 
ATOM   2013  C  CD  . ARG B  2 84  ? 86.061  -82.544  -102.156 1.00 37.39  ? 83   ARG B CD  1 
ATOM   2014  N  NE  . ARG B  2 84  ? 84.880  -81.728  -102.429 1.00 37.39  ? 83   ARG B NE  1 
ATOM   2015  C  CZ  . ARG B  2 84  ? 83.629  -82.153  -102.302 1.00 36.98  ? 83   ARG B CZ  1 
ATOM   2016  N  NH1 . ARG B  2 84  ? 83.385  -83.394  -101.896 1.00 38.47  ? 83   ARG B NH1 1 
ATOM   2017  N  NH2 . ARG B  2 84  ? 82.625  -81.340  -102.599 1.00 37.07  ? 83   ARG B NH2 1 
ATOM   2018  N  N   . LEU B  2 85  ? 88.560  -81.327  -106.977 1.00 39.14  ? 84   LEU B N   1 
ATOM   2019  C  CA  . LEU B  2 85  ? 88.831  -80.327  -107.994 1.00 38.43  ? 84   LEU B CA  1 
ATOM   2020  C  C   . LEU B  2 85  ? 88.847  -80.979  -109.377 1.00 37.18  ? 84   LEU B C   1 
ATOM   2021  O  O   . LEU B  2 85  ? 88.385  -80.384  -110.344 1.00 35.90  ? 84   LEU B O   1 
ATOM   2022  C  CB  . LEU B  2 85  ? 90.168  -79.629  -107.731 1.00 38.41  ? 84   LEU B CB  1 
ATOM   2023  C  CG  . LEU B  2 85  ? 90.274  -78.594  -106.606 1.00 37.40  ? 84   LEU B CG  1 
ATOM   2024  C  CD1 . LEU B  2 85  ? 91.589  -77.875  -106.802 1.00 38.30  ? 84   LEU B CD1 1 
ATOM   2025  C  CD2 . LEU B  2 85  ? 89.139  -77.582  -106.634 1.00 34.38  ? 84   LEU B CD2 1 
ATOM   2026  N  N   . LEU B  2 86  ? 89.377  -82.197  -109.462 1.00 36.28  ? 85   LEU B N   1 
ATOM   2027  C  CA  . LEU B  2 86  ? 89.436  -82.924  -110.725 1.00 35.35  ? 85   LEU B CA  1 
ATOM   2028  C  C   . LEU B  2 86  ? 88.027  -83.206  -111.208 1.00 36.77  ? 85   LEU B C   1 
ATOM   2029  O  O   . LEU B  2 86  ? 87.747  -83.176  -112.409 1.00 37.32  ? 85   LEU B O   1 
ATOM   2030  C  CB  . LEU B  2 86  ? 90.190  -84.246  -110.561 1.00 34.91  ? 85   LEU B CB  1 
ATOM   2031  C  CG  . LEU B  2 86  ? 91.711  -84.147  -110.375 1.00 34.96  ? 85   LEU B CG  1 
ATOM   2032  C  CD1 . LEU B  2 86  ? 92.321  -85.533  -110.377 1.00 33.33  ? 85   LEU B CD1 1 
ATOM   2033  C  CD2 . LEU B  2 86  ? 92.315  -83.311  -111.489 1.00 34.23  ? 85   LEU B CD2 1 
ATOM   2034  N  N   . ARG B  2 87  ? 87.138  -83.481  -110.262 1.00 36.66  ? 86   ARG B N   1 
ATOM   2035  C  CA  . ARG B  2 87  ? 85.749  -83.747  -110.584 1.00 36.45  ? 86   ARG B CA  1 
ATOM   2036  C  C   . ARG B  2 87  ? 85.033  -82.452  -110.919 1.00 37.87  ? 86   ARG B C   1 
ATOM   2037  O  O   . ARG B  2 87  ? 84.354  -82.362  -111.937 1.00 37.93  ? 86   ARG B O   1 
ATOM   2038  C  CB  . ARG B  2 87  ? 85.064  -84.437  -109.414 1.00 33.07  ? 86   ARG B CB  1 
ATOM   2039  C  CG  . ARG B  2 87  ? 85.729  -85.734  -109.090 1.00 30.97  ? 86   ARG B CG  1 
ATOM   2040  C  CD  . ARG B  2 87  ? 84.981  -86.526  -108.054 1.00 31.09  ? 86   ARG B CD  1 
ATOM   2041  N  NE  . ARG B  2 87  ? 85.672  -87.780  -107.783 1.00 30.05  ? 86   ARG B NE  1 
ATOM   2042  C  CZ  . ARG B  2 87  ? 85.096  -88.850  -107.256 1.00 29.51  ? 86   ARG B CZ  1 
ATOM   2043  N  NH1 . ARG B  2 87  ? 83.808  -88.821  -106.944 1.00 28.24  ? 86   ARG B NH1 1 
ATOM   2044  N  NH2 . ARG B  2 87  ? 85.812  -89.945  -107.044 1.00 30.13  ? 86   ARG B NH2 1 
ATOM   2045  N  N   . ILE B  2 88  ? 85.186  -81.445  -110.071 1.00 39.64  ? 87   ILE B N   1 
ATOM   2046  C  CA  . ILE B  2 88  ? 84.534  -80.175  -110.332 1.00 42.07  ? 87   ILE B CA  1 
ATOM   2047  C  C   . ILE B  2 88  ? 84.938  -79.651  -111.710 1.00 43.24  ? 87   ILE B C   1 
ATOM   2048  O  O   . ILE B  2 88  ? 84.109  -79.124  -112.450 1.00 43.53  ? 87   ILE B O   1 
ATOM   2049  C  CB  . ILE B  2 88  ? 84.892  -79.134  -109.269 1.00 42.59  ? 87   ILE B CB  1 
ATOM   2050  C  CG1 . ILE B  2 88  ? 84.469  -79.636  -107.887 1.00 44.91  ? 87   ILE B CG1 1 
ATOM   2051  C  CG2 . ILE B  2 88  ? 84.177  -77.831  -109.568 1.00 42.69  ? 87   ILE B CG2 1 
ATOM   2052  C  CD1 . ILE B  2 88  ? 84.839  -78.696  -106.745 1.00 45.41  ? 87   ILE B CD1 1 
ATOM   2053  N  N   . ARG B  2 89  ? 86.210  -79.805  -112.058 1.00 43.91  ? 88   ARG B N   1 
ATOM   2054  C  CA  . ARG B  2 89  ? 86.702  -79.355  -113.354 1.00 45.74  ? 88   ARG B CA  1 
ATOM   2055  C  C   . ARG B  2 89  ? 85.837  -79.937  -114.480 1.00 47.22  ? 88   ARG B C   1 
ATOM   2056  O  O   . ARG B  2 89  ? 85.369  -79.205  -115.364 1.00 47.03  ? 88   ARG B O   1 
ATOM   2057  C  CB  . ARG B  2 89  ? 88.165  -79.783  -113.516 1.00 46.66  ? 88   ARG B CB  1 
ATOM   2058  C  CG  . ARG B  2 89  ? 88.813  -79.476  -114.858 1.00 50.31  ? 88   ARG B CG  1 
ATOM   2059  C  CD  . ARG B  2 89  ? 88.669  -80.650  -115.828 1.00 53.72  ? 88   ARG B CD  1 
ATOM   2060  N  NE  . ARG B  2 89  ? 89.448  -80.462  -117.053 1.00 56.21  ? 88   ARG B NE  1 
ATOM   2061  C  CZ  . ARG B  2 89  ? 89.392  -81.273  -118.105 1.00 57.96  ? 88   ARG B CZ  1 
ATOM   2062  N  NH1 . ARG B  2 89  ? 88.594  -82.329  -118.087 1.00 59.31  ? 88   ARG B NH1 1 
ATOM   2063  N  NH2 . ARG B  2 89  ? 90.133  -81.033  -119.176 1.00 59.89  ? 88   ARG B NH2 1 
ATOM   2064  N  N   . ALA B  2 90  ? 85.619  -81.251  -114.434 1.00 46.85  ? 89   ALA B N   1 
ATOM   2065  C  CA  . ALA B  2 90  ? 84.814  -81.932  -115.439 1.00 46.04  ? 89   ALA B CA  1 
ATOM   2066  C  C   . ALA B  2 90  ? 83.447  -81.265  -115.586 1.00 46.71  ? 89   ALA B C   1 
ATOM   2067  O  O   . ALA B  2 90  ? 82.952  -81.082  -116.693 1.00 47.16  ? 89   ALA B O   1 
ATOM   2068  C  CB  . ALA B  2 90  ? 84.650  -83.403  -115.068 1.00 43.94  ? 89   ALA B CB  1 
ATOM   2069  N  N   . LEU B  2 91  ? 82.846  -80.896  -114.464 1.00 47.69  ? 90   LEU B N   1 
ATOM   2070  C  CA  . LEU B  2 91  ? 81.540  -80.254  -114.470 1.00 49.35  ? 90   LEU B CA  1 
ATOM   2071  C  C   . LEU B  2 91  ? 81.433  -79.124  -115.477 1.00 51.05  ? 90   LEU B C   1 
ATOM   2072  O  O   . LEU B  2 91  ? 80.334  -78.755  -115.883 1.00 51.74  ? 90   LEU B O   1 
ATOM   2073  C  CB  . LEU B  2 91  ? 81.220  -79.711  -113.081 1.00 49.77  ? 90   LEU B CB  1 
ATOM   2074  C  CG  . LEU B  2 91  ? 80.431  -80.600  -112.126 1.00 49.27  ? 90   LEU B CG  1 
ATOM   2075  C  CD1 . LEU B  2 91  ? 80.924  -82.041  -112.174 1.00 47.98  ? 90   LEU B CD1 1 
ATOM   2076  C  CD2 . LEU B  2 91  ? 80.551  -80.000  -110.735 1.00 49.01  ? 90   LEU B CD2 1 
ATOM   2077  N  N   . ARG B  2 92  ? 82.572  -78.562  -115.865 1.00 52.75  ? 91   ARG B N   1 
ATOM   2078  C  CA  . ARG B  2 92  ? 82.584  -77.476  -116.834 1.00 54.28  ? 91   ARG B CA  1 
ATOM   2079  C  C   . ARG B  2 92  ? 82.314  -78.028  -118.230 1.00 55.60  ? 91   ARG B C   1 
ATOM   2080  O  O   . ARG B  2 92  ? 81.456  -77.526  -118.957 1.00 54.39  ? 91   ARG B O   1 
ATOM   2081  C  CB  . ARG B  2 92  ? 83.942  -76.767  -116.826 1.00 54.67  ? 91   ARG B CB  1 
ATOM   2082  C  CG  . ARG B  2 92  ? 84.087  -75.698  -117.911 1.00 54.71  ? 91   ARG B CG  1 
ATOM   2083  C  CD  . ARG B  2 92  ? 83.193  -74.522  -117.608 1.00 56.71  ? 91   ARG B CD  1 
ATOM   2084  N  NE  . ARG B  2 92  ? 83.156  -73.549  -118.693 1.00 59.28  ? 91   ARG B NE  1 
ATOM   2085  C  CZ  . ARG B  2 92  ? 82.647  -73.796  -119.893 1.00 59.49  ? 91   ARG B CZ  1 
ATOM   2086  N  NH1 . ARG B  2 92  ? 82.649  -72.852  -120.826 1.00 57.13  ? 91   ARG B NH1 1 
ATOM   2087  N  NH2 . ARG B  2 92  ? 82.135  -74.991  -120.154 1.00 59.69  ? 91   ARG B NH2 1 
ATOM   2088  N  N   . TRP B  2 93  ? 83.056  -79.070  -118.591 1.00 57.51  ? 92   TRP B N   1 
ATOM   2089  C  CA  . TRP B  2 93  ? 82.924  -79.691  -119.897 1.00 60.21  ? 92   TRP B CA  1 
ATOM   2090  C  C   . TRP B  2 93  ? 81.691  -80.577  -120.000 1.00 62.46  ? 92   TRP B C   1 
ATOM   2091  O  O   . TRP B  2 93  ? 81.498  -81.282  -120.992 1.00 62.16  ? 92   TRP B O   1 
ATOM   2092  C  CB  . TRP B  2 93  ? 84.174  -80.510  -120.206 1.00 60.73  ? 92   TRP B CB  1 
ATOM   2093  C  CG  . TRP B  2 93  ? 85.437  -79.735  -120.031 1.00 62.80  ? 92   TRP B CG  1 
ATOM   2094  C  CD1 . TRP B  2 93  ? 86.142  -79.574  -118.877 1.00 63.15  ? 92   TRP B CD1 1 
ATOM   2095  C  CD2 . TRP B  2 93  ? 86.127  -78.975  -121.033 1.00 63.64  ? 92   TRP B CD2 1 
ATOM   2096  N  NE1 . TRP B  2 93  ? 87.229  -78.763  -119.094 1.00 64.36  ? 92   TRP B NE1 1 
ATOM   2097  C  CE2 . TRP B  2 93  ? 87.244  -78.379  -120.408 1.00 63.94  ? 92   TRP B CE2 1 
ATOM   2098  C  CE3 . TRP B  2 93  ? 85.909  -78.739  -122.397 1.00 62.82  ? 92   TRP B CE3 1 
ATOM   2099  C  CZ2 . TRP B  2 93  ? 88.143  -77.560  -121.099 1.00 63.95  ? 92   TRP B CZ2 1 
ATOM   2100  C  CZ3 . TRP B  2 93  ? 86.801  -77.925  -123.083 1.00 63.38  ? 92   TRP B CZ3 1 
ATOM   2101  C  CH2 . TRP B  2 93  ? 87.906  -77.345  -122.430 1.00 64.00  ? 92   TRP B CH2 1 
ATOM   2102  N  N   . GLU B  2 94  ? 80.848  -80.538  -118.975 1.00 64.72  ? 93   GLU B N   1 
ATOM   2103  C  CA  . GLU B  2 94  ? 79.651  -81.350  -118.982 1.00 66.60  ? 93   GLU B CA  1 
ATOM   2104  C  C   . GLU B  2 94  ? 78.372  -80.549  -119.013 1.00 67.88  ? 93   GLU B C   1 
ATOM   2105  O  O   . GLU B  2 94  ? 77.639  -80.602  -119.990 1.00 68.59  ? 93   GLU B O   1 
ATOM   2106  C  CB  . GLU B  2 94  ? 79.648  -82.296  -117.787 1.00 67.62  ? 93   GLU B CB  1 
ATOM   2107  C  CG  . GLU B  2 94  ? 79.877  -83.723  -118.204 1.00 72.60  ? 93   GLU B CG  1 
ATOM   2108  C  CD  . GLU B  2 94  ? 80.986  -83.841  -119.241 1.00 76.22  ? 93   GLU B CD  1 
ATOM   2109  O  OE1 . GLU B  2 94  ? 82.168  -83.657  -118.876 1.00 79.13  ? 93   GLU B OE1 1 
ATOM   2110  O  OE2 . GLU B  2 94  ? 80.679  -84.104  -120.427 1.00 78.33  ? 93   GLU B OE2 1 
ATOM   2111  N  N   . TYR B  2 95  ? 78.100  -79.793  -117.959 1.00 69.33  ? 94   TYR B N   1 
ATOM   2112  C  CA  . TYR B  2 95  ? 76.866  -79.028  -117.924 1.00 70.85  ? 94   TYR B CA  1 
ATOM   2113  C  C   . TYR B  2 95  ? 76.967  -77.633  -118.518 1.00 71.70  ? 94   TYR B C   1 
ATOM   2114  O  O   . TYR B  2 95  ? 75.969  -76.919  -118.594 1.00 72.04  ? 94   TYR B O   1 
ATOM   2115  C  CB  . TYR B  2 95  ? 76.339  -78.963  -116.492 1.00 71.54  ? 94   TYR B CB  1 
ATOM   2116  C  CG  . TYR B  2 95  ? 76.136  -80.328  -115.878 1.00 72.93  ? 94   TYR B CG  1 
ATOM   2117  C  CD1 . TYR B  2 95  ? 77.222  -81.099  -115.477 1.00 73.19  ? 94   TYR B CD1 1 
ATOM   2118  C  CD2 . TYR B  2 95  ? 74.855  -80.853  -115.698 1.00 73.84  ? 94   TYR B CD2 1 
ATOM   2119  C  CE1 . TYR B  2 95  ? 77.042  -82.359  -114.909 1.00 74.50  ? 94   TYR B CE1 1 
ATOM   2120  C  CE2 . TYR B  2 95  ? 74.662  -82.113  -115.127 1.00 74.31  ? 94   TYR B CE2 1 
ATOM   2121  C  CZ  . TYR B  2 95  ? 75.761  -82.859  -114.734 1.00 74.64  ? 94   TYR B CZ  1 
ATOM   2122  O  OH  . TYR B  2 95  ? 75.586  -84.094  -114.152 1.00 74.11  ? 94   TYR B OH  1 
ATOM   2123  N  N   . GLY B  2 96  ? 78.165  -77.241  -118.939 1.00 72.52  ? 95   GLY B N   1 
ATOM   2124  C  CA  . GLY B  2 96  ? 78.327  -75.927  -119.536 1.00 74.52  ? 95   GLY B CA  1 
ATOM   2125  C  C   . GLY B  2 96  ? 78.924  -74.864  -118.637 1.00 75.72  ? 95   GLY B C   1 
ATOM   2126  O  O   . GLY B  2 96  ? 79.755  -75.169  -117.786 1.00 75.54  ? 95   GLY B O   1 
ATOM   2127  N  N   . SER B  2 97  ? 78.494  -73.616  -118.826 1.00 77.66  ? 96   SER B N   1 
ATOM   2128  C  CA  . SER B  2 97  ? 79.006  -72.494  -118.042 1.00 79.62  ? 96   SER B CA  1 
ATOM   2129  C  C   . SER B  2 97  ? 78.307  -72.285  -116.699 1.00 81.15  ? 96   SER B C   1 
ATOM   2130  O  O   . SER B  2 97  ? 78.969  -72.025  -115.692 1.00 81.09  ? 96   SER B O   1 
ATOM   2131  C  CB  . SER B  2 97  ? 78.932  -71.208  -118.856 1.00 80.12  ? 96   SER B CB  1 
ATOM   2132  O  OG  . SER B  2 97  ? 79.562  -70.147  -118.160 1.00 81.42  ? 96   SER B OG  1 
ATOM   2133  N  N   . ILE B  2 98  ? 76.978  -72.372  -116.679 1.00 82.65  ? 97   ILE B N   1 
ATOM   2134  C  CA  . ILE B  2 98  ? 76.243  -72.217  -115.422 1.00 83.22  ? 97   ILE B CA  1 
ATOM   2135  C  C   . ILE B  2 98  ? 76.167  -73.603  -114.782 1.00 83.61  ? 97   ILE B C   1 
ATOM   2136  O  O   . ILE B  2 98  ? 75.961  -74.605  -115.466 1.00 83.12  ? 97   ILE B O   1 
ATOM   2137  C  CB  . ILE B  2 98  ? 74.805  -71.654  -115.637 1.00 83.46  ? 97   ILE B CB  1 
ATOM   2138  C  CG1 . ILE B  2 98  ? 73.860  -72.741  -116.176 1.00 84.01  ? 97   ILE B CG1 1 
ATOM   2139  C  CG2 . ILE B  2 98  ? 74.858  -70.456  -116.579 1.00 82.43  ? 97   ILE B CG2 1 
ATOM   2140  C  CD1 . ILE B  2 98  ? 74.224  -73.304  -117.544 1.00 84.49  ? 97   ILE B CD1 1 
ATOM   2141  N  N   . LEU B  2 99  ? 76.342  -73.663  -113.470 1.00 84.63  ? 98   LEU B N   1 
ATOM   2142  C  CA  . LEU B  2 99  ? 76.323  -74.944  -112.778 1.00 84.98  ? 98   LEU B CA  1 
ATOM   2143  C  C   . LEU B  2 99  ? 74.962  -75.384  -112.294 1.00 84.47  ? 98   LEU B C   1 
ATOM   2144  O  O   . LEU B  2 99  ? 74.181  -74.581  -111.777 1.00 84.92  ? 98   LEU B O   1 
ATOM   2145  C  CB  . LEU B  2 99  ? 77.269  -74.916  -111.576 1.00 86.10  ? 98   LEU B CB  1 
ATOM   2146  C  CG  . LEU B  2 99  ? 78.748  -74.778  -111.911 1.00 87.26  ? 98   LEU B CG  1 
ATOM   2147  C  CD1 . LEU B  2 99  ? 79.192  -75.987  -112.724 1.00 87.00  ? 98   LEU B CD1 1 
ATOM   2148  C  CD2 . LEU B  2 99  ? 78.973  -73.472  -112.677 1.00 88.15  ? 98   LEU B CD2 1 
ATOM   2149  N  N   . PRO B  2 100 ? 74.654  -76.677  -112.463 1.00 83.75  ? 99   PRO B N   1 
ATOM   2150  C  CA  . PRO B  2 100 ? 73.357  -77.167  -112.002 1.00 82.49  ? 99   PRO B CA  1 
ATOM   2151  C  C   . PRO B  2 100 ? 73.322  -76.787  -110.529 1.00 81.96  ? 99   PRO B C   1 
ATOM   2152  O  O   . PRO B  2 100 ? 74.184  -77.211  -109.759 1.00 81.18  ? 99   PRO B O   1 
ATOM   2153  C  CB  . PRO B  2 100 ? 73.473  -78.671  -112.206 1.00 82.61  ? 99   PRO B CB  1 
ATOM   2154  C  CG  . PRO B  2 100 ? 74.390  -78.778  -113.382 1.00 81.74  ? 99   PRO B CG  1 
ATOM   2155  C  CD  . PRO B  2 100 ? 75.444  -77.759  -113.077 1.00 82.81  ? 99   PRO B CD  1 
ATOM   2156  N  N   . ASN B  2 101 ? 72.351  -75.972  -110.141 1.00 81.75  ? 100  ASN B N   1 
ATOM   2157  C  CA  . ASN B  2 101 ? 72.257  -75.536  -108.756 1.00 81.45  ? 100  ASN B CA  1 
ATOM   2158  C  C   . ASN B  2 101 ? 72.350  -76.717  -107.792 1.00 81.00  ? 100  ASN B C   1 
ATOM   2159  O  O   . ASN B  2 101 ? 72.419  -76.533  -106.577 1.00 82.73  ? 100  ASN B O   1 
ATOM   2160  C  CB  . ASN B  2 101 ? 70.950  -74.780  -108.527 1.00 81.80  ? 100  ASN B CB  1 
ATOM   2161  C  CG  . ASN B  2 101 ? 70.997  -73.909  -107.292 1.00 82.92  ? 100  ASN B CG  1 
ATOM   2162  O  OD1 . ASN B  2 101 ? 71.771  -72.953  -107.227 1.00 83.97  ? 100  ASN B OD1 1 
ATOM   2163  N  ND2 . ASN B  2 101 ? 70.172  -74.235  -106.300 1.00 83.07  ? 100  ASN B ND2 1 
ATOM   2164  N  N   . ALA B  2 102 ? 72.355  -77.928  -108.341 1.00 79.05  ? 101  ALA B N   1 
ATOM   2165  C  CA  . ALA B  2 102 ? 72.448  -79.141  -107.544 1.00 77.58  ? 101  ALA B CA  1 
ATOM   2166  C  C   . ALA B  2 102 ? 73.880  -79.372  -107.069 1.00 77.22  ? 101  ALA B C   1 
ATOM   2167  O  O   . ALA B  2 102 ? 74.107  -79.855  -105.958 1.00 76.50  ? 101  ALA B O   1 
ATOM   2168  C  CB  . ALA B  2 102 ? 71.975  -80.328  -108.366 1.00 77.77  ? 101  ALA B CB  1 
ATOM   2169  N  N   . LEU B  2 103 ? 74.842  -79.023  -107.919 1.00 76.93  ? 102  LEU B N   1 
ATOM   2170  C  CA  . LEU B  2 103 ? 76.253  -79.195  -107.598 1.00 76.10  ? 102  LEU B CA  1 
ATOM   2171  C  C   . LEU B  2 103 ? 76.758  -78.099  -106.680 1.00 76.09  ? 102  LEU B C   1 
ATOM   2172  O  O   . LEU B  2 103 ? 77.517  -78.375  -105.758 1.00 76.85  ? 102  LEU B O   1 
ATOM   2173  C  CB  . LEU B  2 103 ? 77.096  -79.228  -108.873 1.00 75.60  ? 102  LEU B CB  1 
ATOM   2174  C  CG  . LEU B  2 103 ? 76.935  -80.441  -109.796 1.00 75.32  ? 102  LEU B CG  1 
ATOM   2175  C  CD1 . LEU B  2 103 ? 77.354  -81.693  -109.055 1.00 74.84  ? 102  LEU B CD1 1 
ATOM   2176  C  CD2 . LEU B  2 103 ? 75.496  -80.559  -110.275 1.00 75.16  ? 102  LEU B CD2 1 
ATOM   2177  N  N   . ARG B  2 104 ? 76.349  -76.858  -106.933 1.00 76.13  ? 103  ARG B N   1 
ATOM   2178  C  CA  . ARG B  2 104 ? 76.763  -75.742  -106.082 1.00 75.43  ? 103  ARG B CA  1 
ATOM   2179  C  C   . ARG B  2 104 ? 76.474  -76.149  -104.652 1.00 73.23  ? 103  ARG B C   1 
ATOM   2180  O  O   . ARG B  2 104 ? 77.225  -75.838  -103.736 1.00 72.91  ? 103  ARG B O   1 
ATOM   2181  C  CB  . ARG B  2 104 ? 75.952  -74.475  -106.378 1.00 77.50  ? 103  ARG B CB  1 
ATOM   2182  C  CG  . ARG B  2 104 ? 76.249  -73.770  -107.691 1.00 80.81  ? 103  ARG B CG  1 
ATOM   2183  C  CD  . ARG B  2 104 ? 75.471  -72.450  -107.762 1.00 83.63  ? 103  ARG B CD  1 
ATOM   2184  N  NE  . ARG B  2 104 ? 75.706  -71.710  -109.001 1.00 86.11  ? 103  ARG B NE  1 
ATOM   2185  C  CZ  . ARG B  2 104 ? 76.886  -71.220  -109.374 1.00 88.09  ? 103  ARG B CZ  1 
ATOM   2186  N  NH1 . ARG B  2 104 ? 77.955  -71.386  -108.602 1.00 89.06  ? 103  ARG B NH1 1 
ATOM   2187  N  NH2 . ARG B  2 104 ? 77.000  -70.569  -110.527 1.00 88.85  ? 103  ARG B NH2 1 
ATOM   2188  N  N   . PHE B  2 105 ? 75.370  -76.865  -104.487 1.00 71.82  ? 104  PHE B N   1 
ATOM   2189  C  CA  . PHE B  2 105 ? 74.910  -77.324  -103.188 1.00 71.20  ? 104  PHE B CA  1 
ATOM   2190  C  C   . PHE B  2 105 ? 75.800  -78.375  -102.519 1.00 69.71  ? 104  PHE B C   1 
ATOM   2191  O  O   . PHE B  2 105 ? 75.643  -78.655  -101.335 1.00 69.13  ? 104  PHE B O   1 
ATOM   2192  C  CB  . PHE B  2 105 ? 73.479  -77.849  -103.332 1.00 72.69  ? 104  PHE B CB  1 
ATOM   2193  C  CG  . PHE B  2 105 ? 72.724  -77.924  -102.039 1.00 75.14  ? 104  PHE B CG  1 
ATOM   2194  C  CD1 . PHE B  2 105 ? 72.740  -79.086  -101.270 1.00 76.45  ? 104  PHE B CD1 1 
ATOM   2195  C  CD2 . PHE B  2 105 ? 72.001  -76.823  -101.581 1.00 76.57  ? 104  PHE B CD2 1 
ATOM   2196  C  CE1 . PHE B  2 105 ? 72.045  -79.153  -100.063 1.00 77.10  ? 104  PHE B CE1 1 
ATOM   2197  C  CE2 . PHE B  2 105 ? 71.301  -76.877  -100.372 1.00 77.31  ? 104  PHE B CE2 1 
ATOM   2198  C  CZ  . PHE B  2 105 ? 71.323  -78.045  -99.612  1.00 77.34  ? 104  PHE B CZ  1 
ATOM   2199  N  N   . HIS B  2 106 ? 76.732  -78.955  -103.267 1.00 68.69  ? 105  HIS B N   1 
ATOM   2200  C  CA  . HIS B  2 106 ? 77.630  -79.960  -102.701 1.00 67.78  ? 105  HIS B CA  1 
ATOM   2201  C  C   . HIS B  2 106 ? 79.063  -79.476  -102.636 1.00 67.08  ? 105  HIS B C   1 
ATOM   2202  O  O   . HIS B  2 106 ? 79.956  -80.201  -102.199 1.00 67.39  ? 105  HIS B O   1 
ATOM   2203  C  CB  . HIS B  2 106 ? 77.587  -81.246  -103.519 1.00 67.90  ? 105  HIS B CB  1 
ATOM   2204  C  CG  . HIS B  2 106 ? 76.381  -82.085  -103.255 1.00 68.86  ? 105  HIS B CG  1 
ATOM   2205  N  ND1 . HIS B  2 106 ? 76.237  -83.359  -103.757 1.00 68.72  ? 105  HIS B ND1 1 
ATOM   2206  C  CD2 . HIS B  2 106 ? 75.262  -81.835  -102.534 1.00 69.73  ? 105  HIS B CD2 1 
ATOM   2207  C  CE1 . HIS B  2 106 ? 75.082  -83.859  -103.356 1.00 69.82  ? 105  HIS B CE1 1 
ATOM   2208  N  NE2 . HIS B  2 106 ? 74.470  -82.954  -102.612 1.00 69.09  ? 105  HIS B NE2 1 
HETATM 2209  N  N   . MSE B  2 107 ? 79.277  -78.243  -103.071 1.00 65.89  ? 106  MSE B N   1 
HETATM 2210  C  CA  . MSE B  2 107 ? 80.606  -77.666  -103.084 1.00 64.63  ? 106  MSE B CA  1 
HETATM 2211  C  C   . MSE B  2 107 ? 80.821  -76.683  -101.939 1.00 63.66  ? 106  MSE B C   1 
HETATM 2212  O  O   . MSE B  2 107 ? 79.867  -76.169  -101.352 1.00 63.10  ? 106  MSE B O   1 
HETATM 2213  C  CB  . MSE B  2 107 ? 80.832  -76.948  -104.417 1.00 64.84  ? 106  MSE B CB  1 
HETATM 2214  C  CG  . MSE B  2 107 ? 80.706  -77.838  -105.639 1.00 65.37  ? 106  MSE B CG  1 
HETATM 2215  SE SE  . MSE B  2 107 ? 80.500  -76.816  -107.264 1.00 65.99  ? 106  MSE B SE  1 
HETATM 2216  C  CE  . MSE B  2 107 ? 82.342  -76.414  -107.594 1.00 64.50  ? 106  MSE B CE  1 
ATOM   2217  N  N   . ALA B  2 108 ? 82.089  -76.435  -101.628 1.00 61.87  ? 107  ALA B N   1 
ATOM   2218  C  CA  . ALA B  2 108 ? 82.463  -75.486  -100.592 1.00 60.40  ? 107  ALA B CA  1 
ATOM   2219  C  C   . ALA B  2 108 ? 82.590  -74.130  -101.281 1.00 60.23  ? 107  ALA B C   1 
ATOM   2220  O  O   . ALA B  2 108 ? 82.951  -74.063  -102.457 1.00 59.84  ? 107  ALA B O   1 
ATOM   2221  C  CB  . ALA B  2 108 ? 83.794  -75.886  -99.977  1.00 59.96  ? 107  ALA B CB  1 
ATOM   2222  N  N   . ALA B  2 109 ? 82.295  -73.055  -100.558 1.00 60.43  ? 108  ALA B N   1 
ATOM   2223  C  CA  . ALA B  2 109 ? 82.378  -71.709  -101.122 1.00 60.36  ? 108  ALA B CA  1 
ATOM   2224  C  C   . ALA B  2 109 ? 83.737  -71.481  -101.770 1.00 60.40  ? 108  ALA B C   1 
ATOM   2225  O  O   . ALA B  2 109 ? 83.876  -70.655  -102.670 1.00 59.92  ? 108  ALA B O   1 
ATOM   2226  C  CB  . ALA B  2 109 ? 82.135  -70.673  -100.040 1.00 60.26  ? 108  ALA B CB  1 
ATOM   2227  N  N   . GLU B  2 110 ? 84.735  -72.223  -101.304 1.00 61.11  ? 109  GLU B N   1 
ATOM   2228  C  CA  . GLU B  2 110 ? 86.088  -72.131  -101.836 1.00 62.27  ? 109  GLU B CA  1 
ATOM   2229  C  C   . GLU B  2 110 ? 86.180  -72.826  -103.192 1.00 61.79  ? 109  GLU B C   1 
ATOM   2230  O  O   . GLU B  2 110 ? 86.952  -72.410  -104.056 1.00 61.31  ? 109  GLU B O   1 
ATOM   2231  C  CB  . GLU B  2 110 ? 87.088  -72.768  -100.861 1.00 64.49  ? 109  GLU B CB  1 
ATOM   2232  C  CG  . GLU B  2 110 ? 87.557  -71.866  -99.710  1.00 68.49  ? 109  GLU B CG  1 
ATOM   2233  C  CD  . GLU B  2 110 ? 86.429  -71.383  -98.795  1.00 70.86  ? 109  GLU B CD  1 
ATOM   2234  O  OE1 . GLU B  2 110 ? 85.643  -72.227  -98.310  1.00 71.15  ? 109  GLU B OE1 1 
ATOM   2235  O  OE2 . GLU B  2 110 ? 86.338  -70.156  -98.549  1.00 71.43  ? 109  GLU B OE2 1 
ATOM   2236  N  N   . GLU B  2 111 ? 85.390  -73.882  -103.376 1.00 61.67  ? 110  GLU B N   1 
ATOM   2237  C  CA  . GLU B  2 111 ? 85.397  -74.629  -104.629 1.00 61.71  ? 110  GLU B CA  1 
ATOM   2238  C  C   . GLU B  2 111 ? 84.671  -73.890  -105.748 1.00 62.86  ? 110  GLU B C   1 
ATOM   2239  O  O   . GLU B  2 111 ? 85.152  -73.856  -106.880 1.00 61.45  ? 110  GLU B O   1 
ATOM   2240  C  CB  . GLU B  2 111 ? 84.805  -76.028  -104.420 1.00 60.66  ? 110  GLU B CB  1 
ATOM   2241  C  CG  . GLU B  2 111 ? 85.687  -76.917  -103.546 1.00 58.63  ? 110  GLU B CG  1 
ATOM   2242  C  CD  . GLU B  2 111 ? 85.067  -78.268  -103.220 1.00 57.48  ? 110  GLU B CD  1 
ATOM   2243  O  OE1 . GLU B  2 111 ? 83.855  -78.319  -102.909 1.00 55.65  ? 110  GLU B OE1 1 
ATOM   2244  O  OE2 . GLU B  2 111 ? 85.803  -79.278  -103.255 1.00 56.08  ? 110  GLU B OE2 1 
HETATM 2245  N  N   . MSE B  2 112 ? 83.518  -73.300  -105.446 1.00 65.23  ? 111  MSE B N   1 
HETATM 2246  C  CA  . MSE B  2 112 ? 82.793  -72.541  -106.460 1.00 68.59  ? 111  MSE B CA  1 
HETATM 2247  C  C   . MSE B  2 112 ? 83.705  -71.389  -106.893 1.00 67.06  ? 111  MSE B C   1 
HETATM 2248  O  O   . MSE B  2 112 ? 83.669  -70.950  -108.042 1.00 66.48  ? 111  MSE B O   1 
HETATM 2249  C  CB  . MSE B  2 112 ? 81.493  -71.963  -105.892 1.00 75.68  ? 111  MSE B CB  1 
HETATM 2250  C  CG  . MSE B  2 112 ? 80.397  -72.976  -105.581 1.00 85.71  ? 111  MSE B CG  1 
HETATM 2251  SE SE  . MSE B  2 112 ? 79.069  -72.290  -104.289 1.00 101.26 ? 111  MSE B SE  1 
HETATM 2252  C  CE  . MSE B  2 112 ? 77.869  -71.373  -105.514 1.00 96.90  ? 111  MSE B CE  1 
ATOM   2253  N  N   . GLU B  2 113 ? 84.526  -70.907  -105.959 1.00 65.81  ? 112  GLU B N   1 
ATOM   2254  C  CA  . GLU B  2 113 ? 85.447  -69.806  -106.228 1.00 63.44  ? 112  GLU B CA  1 
ATOM   2255  C  C   . GLU B  2 113 ? 86.508  -70.282  -107.211 1.00 59.30  ? 112  GLU B C   1 
ATOM   2256  O  O   . GLU B  2 113 ? 86.774  -69.629  -108.211 1.00 59.13  ? 112  GLU B O   1 
ATOM   2257  C  CB  . GLU B  2 113 ? 86.092  -69.322  -104.921 1.00 67.52  ? 112  GLU B CB  1 
ATOM   2258  C  CG  . GLU B  2 113 ? 86.840  -67.980  -105.031 1.00 73.17  ? 112  GLU B CG  1 
ATOM   2259  C  CD  . GLU B  2 113 ? 87.388  -67.461  -103.686 1.00 76.18  ? 112  GLU B CD  1 
ATOM   2260  O  OE1 . GLU B  2 113 ? 88.073  -66.411  -103.690 1.00 77.46  ? 112  GLU B OE1 1 
ATOM   2261  O  OE2 . GLU B  2 113 ? 87.139  -68.089  -102.629 1.00 77.37  ? 112  GLU B OE2 1 
ATOM   2262  N  N   . TRP B  2 114 ? 87.102  -71.432  -106.930 1.00 55.10  ? 113  TRP B N   1 
ATOM   2263  C  CA  . TRP B  2 114 ? 88.113  -72.008  -107.811 1.00 51.78  ? 113  TRP B CA  1 
ATOM   2264  C  C   . TRP B  2 114 ? 87.531  -72.252  -109.206 1.00 51.12  ? 113  TRP B C   1 
ATOM   2265  O  O   . TRP B  2 114 ? 88.195  -72.042  -110.214 1.00 49.89  ? 113  TRP B O   1 
ATOM   2266  C  CB  . TRP B  2 114 ? 88.595  -73.340  -107.238 1.00 48.25  ? 113  TRP B CB  1 
ATOM   2267  C  CG  . TRP B  2 114 ? 89.587  -74.044  -108.095 1.00 44.28  ? 113  TRP B CG  1 
ATOM   2268  C  CD1 . TRP B  2 114 ? 90.944  -73.973  -108.005 1.00 43.18  ? 113  TRP B CD1 1 
ATOM   2269  C  CD2 . TRP B  2 114 ? 89.302  -74.910  -109.201 1.00 43.45  ? 113  TRP B CD2 1 
ATOM   2270  N  NE1 . TRP B  2 114 ? 91.529  -74.739  -108.985 1.00 42.05  ? 113  TRP B NE1 1 
ATOM   2271  C  CE2 . TRP B  2 114 ? 90.543  -75.327  -109.735 1.00 42.62  ? 113  TRP B CE2 1 
ATOM   2272  C  CE3 . TRP B  2 114 ? 88.121  -75.377  -109.792 1.00 39.77  ? 113  TRP B CE3 1 
ATOM   2273  C  CZ2 . TRP B  2 114 ? 90.635  -76.192  -110.839 1.00 40.80  ? 113  TRP B CZ2 1 
ATOM   2274  C  CZ3 . TRP B  2 114 ? 88.216  -76.234  -110.885 1.00 38.49  ? 113  TRP B CZ3 1 
ATOM   2275  C  CH2 . TRP B  2 114 ? 89.464  -76.632  -111.396 1.00 37.59  ? 113  TRP B CH2 1 
ATOM   2276  N  N   . PHE B  2 115 ? 86.284  -72.706  -109.245 1.00 51.93  ? 114  PHE B N   1 
ATOM   2277  C  CA  . PHE B  2 115 ? 85.593  -73.013  -110.495 1.00 52.57  ? 114  PHE B CA  1 
ATOM   2278  C  C   . PHE B  2 115 ? 85.360  -71.788  -111.356 1.00 53.60  ? 114  PHE B C   1 
ATOM   2279  O  O   . PHE B  2 115 ? 85.685  -71.791  -112.542 1.00 53.63  ? 114  PHE B O   1 
ATOM   2280  C  CB  . PHE B  2 115 ? 84.241  -73.676  -110.207 1.00 51.93  ? 114  PHE B CB  1 
ATOM   2281  C  CG  . PHE B  2 115 ? 83.546  -74.201  -111.433 1.00 49.68  ? 114  PHE B CG  1 
ATOM   2282  C  CD1 . PHE B  2 115 ? 83.935  -75.407  -112.005 1.00 48.42  ? 114  PHE B CD1 1 
ATOM   2283  C  CD2 . PHE B  2 115 ? 82.522  -73.473  -112.034 1.00 47.52  ? 114  PHE B CD2 1 
ATOM   2284  C  CE1 . PHE B  2 115 ? 83.313  -75.880  -113.159 1.00 47.90  ? 114  PHE B CE1 1 
ATOM   2285  C  CE2 . PHE B  2 115 ? 81.900  -73.938  -113.188 1.00 46.12  ? 114  PHE B CE2 1 
ATOM   2286  C  CZ  . PHE B  2 115 ? 82.293  -75.139  -113.751 1.00 46.18  ? 114  PHE B CZ  1 
ATOM   2287  N  N   . ASN B  2 116 ? 84.779  -70.746  -110.766 1.00 55.32  ? 115  ASN B N   1 
ATOM   2288  C  CA  . ASN B  2 116 ? 84.509  -69.525  -111.509 1.00 57.00  ? 115  ASN B CA  1 
ATOM   2289  C  C   . ASN B  2 116 ? 85.791  -68.884  -111.986 1.00 57.98  ? 115  ASN B C   1 
ATOM   2290  O  O   . ASN B  2 116 ? 85.798  -68.190  -112.999 1.00 59.32  ? 115  ASN B O   1 
ATOM   2291  C  CB  . ASN B  2 116 ? 83.708  -68.541  -110.668 1.00 58.07  ? 115  ASN B CB  1 
ATOM   2292  C  CG  . ASN B  2 116 ? 82.296  -69.017  -110.433 1.00 60.66  ? 115  ASN B CG  1 
ATOM   2293  O  OD1 . ASN B  2 116 ? 81.619  -69.462  -111.365 1.00 61.10  ? 115  ASN B OD1 1 
ATOM   2294  N  ND2 . ASN B  2 116 ? 81.838  -68.931  -109.190 1.00 62.29  ? 115  ASN B ND2 1 
ATOM   2295  N  N   . ASN B  2 117 ? 86.881  -69.112  -111.261 1.00 58.72  ? 116  ASN B N   1 
ATOM   2296  C  CA  . ASN B  2 117 ? 88.161  -68.565  -111.681 1.00 58.92  ? 116  ASN B CA  1 
ATOM   2297  C  C   . ASN B  2 117 ? 88.665  -69.434  -112.815 1.00 58.01  ? 116  ASN B C   1 
ATOM   2298  O  O   . ASN B  2 117 ? 89.315  -68.951  -113.739 1.00 58.08  ? 116  ASN B O   1 
ATOM   2299  C  CB  . ASN B  2 117 ? 89.172  -68.565  -110.534 1.00 61.15  ? 116  ASN B CB  1 
ATOM   2300  C  CG  . ASN B  2 117 ? 88.893  -67.477  -109.514 1.00 63.05  ? 116  ASN B CG  1 
ATOM   2301  O  OD1 . ASN B  2 117 ? 88.441  -66.377  -109.865 1.00 62.70  ? 116  ASN B OD1 1 
ATOM   2302  N  ND2 . ASN B  2 117 ? 89.171  -67.769  -108.244 1.00 64.14  ? 116  ASN B ND2 1 
ATOM   2303  N  N   . TYR B  2 118 ? 88.352  -70.723  -112.741 1.00 57.72  ? 117  TYR B N   1 
ATOM   2304  C  CA  . TYR B  2 118 ? 88.760  -71.654  -113.779 1.00 57.07  ? 117  TYR B CA  1 
ATOM   2305  C  C   . TYR B  2 118 ? 88.015  -71.339  -115.063 1.00 57.80  ? 117  TYR B C   1 
ATOM   2306  O  O   . TYR B  2 118 ? 88.631  -71.178  -116.110 1.00 58.06  ? 117  TYR B O   1 
ATOM   2307  C  CB  . TYR B  2 118 ? 88.479  -73.096  -113.361 1.00 54.44  ? 117  TYR B CB  1 
ATOM   2308  C  CG  . TYR B  2 118 ? 88.656  -74.100  -114.479 1.00 52.92  ? 117  TYR B CG  1 
ATOM   2309  C  CD1 . TYR B  2 118 ? 87.554  -74.610  -115.170 1.00 53.32  ? 117  TYR B CD1 1 
ATOM   2310  C  CD2 . TYR B  2 118 ? 89.924  -74.553  -114.841 1.00 52.56  ? 117  TYR B CD2 1 
ATOM   2311  C  CE1 . TYR B  2 118 ? 87.710  -75.556  -116.191 1.00 52.31  ? 117  TYR B CE1 1 
ATOM   2312  C  CE2 . TYR B  2 118 ? 90.093  -75.491  -115.856 1.00 52.81  ? 117  TYR B CE2 1 
ATOM   2313  C  CZ  . TYR B  2 118 ? 88.981  -75.990  -116.524 1.00 53.12  ? 117  TYR B CZ  1 
ATOM   2314  O  OH  . TYR B  2 118 ? 89.148  -76.939  -117.504 1.00 53.43  ? 117  TYR B OH  1 
ATOM   2315  N  N   . LYS B  2 119 ? 86.691  -71.243  -114.991 1.00 58.68  ? 118  LYS B N   1 
ATOM   2316  C  CA  . LYS B  2 119 ? 85.931  -70.947  -116.194 1.00 59.93  ? 118  LYS B CA  1 
ATOM   2317  C  C   . LYS B  2 119 ? 86.423  -69.615  -116.732 1.00 60.24  ? 118  LYS B C   1 
ATOM   2318  O  O   . LYS B  2 119 ? 86.786  -69.502  -117.900 1.00 60.94  ? 118  LYS B O   1 
ATOM   2319  C  CB  . LYS B  2 119 ? 84.423  -70.882  -115.904 1.00 59.82  ? 118  LYS B CB  1 
ATOM   2320  C  CG  . LYS B  2 119 ? 83.995  -69.701  -115.056 1.00 62.44  ? 118  LYS B CG  1 
ATOM   2321  C  CD  . LYS B  2 119 ? 82.495  -69.464  -115.111 1.00 62.53  ? 118  LYS B CD  1 
ATOM   2322  C  CE  . LYS B  2 119 ? 81.728  -70.652  -114.579 1.00 64.32  ? 118  LYS B CE  1 
ATOM   2323  N  NZ  . LYS B  2 119 ? 80.268  -70.360  -114.506 1.00 67.08  ? 118  LYS B NZ  1 
ATOM   2324  N  N   . ARG B  2 120 ? 86.474  -68.620  -115.856 1.00 61.69  ? 119  ARG B N   1 
ATOM   2325  C  CA  . ARG B  2 120 ? 86.908  -67.272  -116.220 1.00 63.39  ? 119  ARG B CA  1 
ATOM   2326  C  C   . ARG B  2 120 ? 88.197  -67.222  -117.059 1.00 63.68  ? 119  ARG B C   1 
ATOM   2327  O  O   . ARG B  2 120 ? 88.383  -66.300  -117.863 1.00 63.41  ? 119  ARG B O   1 
ATOM   2328  C  CB  . ARG B  2 120 ? 87.064  -66.434  -114.947 1.00 63.19  ? 119  ARG B CB  1 
ATOM   2329  C  CG  . ARG B  2 120 ? 87.168  -64.942  -115.170 1.00 63.76  ? 119  ARG B CG  1 
ATOM   2330  C  CD  . ARG B  2 120 ? 86.537  -64.188  -114.004 1.00 65.51  ? 119  ARG B CD  1 
ATOM   2331  N  NE  . ARG B  2 120 ? 85.076  -64.100  -114.100 1.00 65.57  ? 119  ARG B NE  1 
ATOM   2332  C  CZ  . ARG B  2 120 ? 84.419  -63.108  -114.705 1.00 66.14  ? 119  ARG B CZ  1 
ATOM   2333  N  NH1 . ARG B  2 120 ? 85.094  -62.110  -115.268 1.00 65.40  ? 119  ARG B NH1 1 
ATOM   2334  N  NH2 . ARG B  2 120 ? 83.087  -63.109  -114.748 1.00 64.89  ? 119  ARG B NH2 1 
ATOM   2335  N  N   . SER B  2 121 ? 89.077  -68.206  -116.888 1.00 63.18  ? 120  SER B N   1 
ATOM   2336  C  CA  . SER B  2 121 ? 90.316  -68.219  -117.656 1.00 64.01  ? 120  SER B CA  1 
ATOM   2337  C  C   . SER B  2 121 ? 90.139  -69.011  -118.950 1.00 64.45  ? 120  SER B C   1 
ATOM   2338  O  O   . SER B  2 121 ? 90.535  -68.553  -120.025 1.00 65.46  ? 120  SER B O   1 
ATOM   2339  C  CB  . SER B  2 121 ? 91.476  -68.797  -116.823 1.00 63.67  ? 120  SER B CB  1 
ATOM   2340  O  OG  . SER B  2 121 ? 91.448  -70.213  -116.743 1.00 64.30  ? 120  SER B OG  1 
ATOM   2341  N  N   . LEU B  2 122 ? 89.547  -70.198  -118.844 1.00 64.32  ? 121  LEU B N   1 
ATOM   2342  C  CA  . LEU B  2 122 ? 89.304  -71.040  -120.009 1.00 63.28  ? 121  LEU B CA  1 
ATOM   2343  C  C   . LEU B  2 122 ? 88.602  -70.140  -121.013 1.00 63.75  ? 121  LEU B C   1 
ATOM   2344  O  O   . LEU B  2 122 ? 88.881  -70.189  -122.208 1.00 63.39  ? 121  LEU B O   1 
ATOM   2345  C  CB  . LEU B  2 122 ? 88.407  -72.227  -119.625 1.00 62.19  ? 121  LEU B CB  1 
ATOM   2346  C  CG  . LEU B  2 122 ? 87.894  -73.213  -120.682 1.00 60.68  ? 121  LEU B CG  1 
ATOM   2347  C  CD1 . LEU B  2 122 ? 89.045  -73.975  -121.339 1.00 58.63  ? 121  LEU B CD1 1 
ATOM   2348  C  CD2 . LEU B  2 122 ? 86.926  -74.172  -120.003 1.00 59.89  ? 121  LEU B CD2 1 
ATOM   2349  N  N   . ALA B  2 123 ? 87.702  -69.303  -120.503 1.00 64.13  ? 122  ALA B N   1 
ATOM   2350  C  CA  . ALA B  2 123 ? 86.964  -68.359  -121.331 1.00 65.21  ? 122  ALA B CA  1 
ATOM   2351  C  C   . ALA B  2 123 ? 87.969  -67.507  -122.093 1.00 66.93  ? 122  ALA B C   1 
ATOM   2352  O  O   . ALA B  2 123 ? 87.913  -67.412  -123.319 1.00 68.26  ? 122  ALA B O   1 
ATOM   2353  C  CB  . ALA B  2 123 ? 86.091  -67.477  -120.461 1.00 63.94  ? 122  ALA B CB  1 
ATOM   2354  N  N   . THR B  2 124 ? 88.890  -66.888  -121.361 1.00 67.70  ? 123  THR B N   1 
ATOM   2355  C  CA  . THR B  2 124 ? 89.910  -66.060  -121.984 1.00 67.94  ? 123  THR B CA  1 
ATOM   2356  C  C   . THR B  2 124 ? 90.670  -66.874  -123.013 1.00 68.96  ? 123  THR B C   1 
ATOM   2357  O  O   . THR B  2 124 ? 90.710  -66.511  -124.182 1.00 70.01  ? 123  THR B O   1 
ATOM   2358  C  CB  . THR B  2 124 ? 90.920  -65.514  -120.954 1.00 67.44  ? 123  THR B CB  1 
ATOM   2359  O  OG1 . THR B  2 124 ? 90.298  -64.499  -120.160 1.00 67.12  ? 123  THR B OG1 1 
ATOM   2360  C  CG2 . THR B  2 124 ? 92.128  -64.927  -121.652 1.00 66.20  ? 123  THR B CG2 1 
ATOM   2361  N  N   . TYR B  2 125 ? 91.267  -67.980  -122.588 1.00 70.13  ? 124  TYR B N   1 
ATOM   2362  C  CA  . TYR B  2 125 ? 92.031  -68.797  -123.518 1.00 72.74  ? 124  TYR B CA  1 
ATOM   2363  C  C   . TYR B  2 125 ? 91.349  -68.946  -124.872 1.00 75.06  ? 124  TYR B C   1 
ATOM   2364  O  O   . TYR B  2 125 ? 91.839  -68.421  -125.870 1.00 75.59  ? 124  TYR B O   1 
ATOM   2365  C  CB  . TYR B  2 125 ? 92.303  -70.178  -122.936 1.00 71.42  ? 124  TYR B CB  1 
ATOM   2366  C  CG  . TYR B  2 125 ? 92.997  -71.106  -123.909 1.00 71.20  ? 124  TYR B CG  1 
ATOM   2367  C  CD1 . TYR B  2 125 ? 94.177  -70.728  -124.545 1.00 69.91  ? 124  TYR B CD1 1 
ATOM   2368  C  CD2 . TYR B  2 125 ? 92.475  -72.368  -124.190 1.00 71.57  ? 124  TYR B CD2 1 
ATOM   2369  C  CE1 . TYR B  2 125 ? 94.818  -71.589  -125.438 1.00 70.97  ? 124  TYR B CE1 1 
ATOM   2370  C  CE2 . TYR B  2 125 ? 93.110  -73.232  -125.079 1.00 71.26  ? 124  TYR B CE2 1 
ATOM   2371  C  CZ  . TYR B  2 125 ? 94.278  -72.839  -125.700 1.00 70.81  ? 124  TYR B CZ  1 
ATOM   2372  O  OH  . TYR B  2 125 ? 94.896  -73.698  -126.583 1.00 71.55  ? 124  TYR B OH  1 
HETATM 2373  N  N   . MSE B  2 126 ? 90.222  -69.654  -124.906 1.00 77.58  ? 125  MSE B N   1 
HETATM 2374  C  CA  . MSE B  2 126 ? 89.486  -69.865  -126.155 1.00 79.72  ? 125  MSE B CA  1 
HETATM 2375  C  C   . MSE B  2 126 ? 89.357  -68.562  -126.953 1.00 80.59  ? 125  MSE B C   1 
HETATM 2376  O  O   . MSE B  2 126 ? 89.758  -68.494  -128.116 1.00 80.41  ? 125  MSE B O   1 
HETATM 2377  C  CB  . MSE B  2 126 ? 88.082  -70.446  -125.872 1.00 80.40  ? 125  MSE B CB  1 
HETATM 2378  C  CG  . MSE B  2 126 ? 88.079  -71.787  -125.107 1.00 81.56  ? 125  MSE B CG  1 
HETATM 2379  SE SE  . MSE B  2 126 ? 86.334  -72.650  -124.802 1.00 81.55  ? 125  MSE B SE  1 
HETATM 2380  C  CE  . MSE B  2 126 ? 85.257  -71.081  -124.434 1.00 79.77  ? 125  MSE B CE  1 
ATOM   2381  N  N   . ARG B  2 127 ? 88.818  -67.527  -126.314 1.00 81.68  ? 126  ARG B N   1 
ATOM   2382  C  CA  . ARG B  2 127 ? 88.615  -66.229  -126.956 1.00 82.49  ? 126  ARG B CA  1 
ATOM   2383  C  C   . ARG B  2 127 ? 89.861  -65.593  -127.561 1.00 82.76  ? 126  ARG B C   1 
ATOM   2384  O  O   . ARG B  2 127 ? 89.796  -64.481  -128.077 1.00 82.87  ? 126  ARG B O   1 
ATOM   2385  C  CB  . ARG B  2 127 ? 87.994  -65.251  -125.960 1.00 82.70  ? 126  ARG B CB  1 
ATOM   2386  C  CG  . ARG B  2 127 ? 86.687  -65.734  -125.373 1.00 85.08  ? 126  ARG B CG  1 
ATOM   2387  C  CD  . ARG B  2 127 ? 86.052  -64.678  -124.490 1.00 86.79  ? 126  ARG B CD  1 
ATOM   2388  N  NE  . ARG B  2 127 ? 84.841  -65.176  -123.842 1.00 88.93  ? 126  ARG B NE  1 
ATOM   2389  C  CZ  . ARG B  2 127 ? 84.014  -64.425  -123.119 1.00 89.72  ? 126  ARG B CZ  1 
ATOM   2390  N  NH1 . ARG B  2 127 ? 84.267  -63.132  -122.952 1.00 90.24  ? 126  ARG B NH1 1 
ATOM   2391  N  NH2 . ARG B  2 127 ? 82.935  -64.966  -122.560 1.00 89.25  ? 126  ARG B NH2 1 
ATOM   2392  N  N   . SER B  2 128 ? 90.991  -66.287  -127.505 1.00 83.36  ? 127  SER B N   1 
ATOM   2393  C  CA  . SER B  2 128 ? 92.230  -65.749  -128.053 1.00 84.32  ? 127  SER B CA  1 
ATOM   2394  C  C   . SER B  2 128 ? 92.734  -66.624  -129.188 1.00 85.77  ? 127  SER B C   1 
ATOM   2395  O  O   . SER B  2 128 ? 93.817  -66.402  -129.724 1.00 86.37  ? 127  SER B O   1 
ATOM   2396  C  CB  . SER B  2 128 ? 93.300  -65.673  -126.964 1.00 83.40  ? 127  SER B CB  1 
ATOM   2397  O  OG  . SER B  2 128 ? 93.749  -66.969  -126.606 1.00 82.25  ? 127  SER B OG  1 
ATOM   2398  N  N   . LEU B  2 129 ? 91.943  -67.621  -129.554 1.00 87.32  ? 128  LEU B N   1 
ATOM   2399  C  CA  . LEU B  2 129 ? 92.329  -68.534  -130.616 1.00 89.96  ? 128  LEU B CA  1 
ATOM   2400  C  C   . LEU B  2 129 ? 92.086  -67.973  -132.022 1.00 92.52  ? 128  LEU B C   1 
ATOM   2401  O  O   . LEU B  2 129 ? 92.538  -68.547  -133.017 1.00 92.50  ? 128  LEU B O   1 
ATOM   2402  C  CB  . LEU B  2 129 ? 91.594  -69.866  -130.429 1.00 89.52  ? 128  LEU B CB  1 
ATOM   2403  C  CG  . LEU B  2 129 ? 92.205  -70.869  -129.437 1.00 88.88  ? 128  LEU B CG  1 
ATOM   2404  C  CD1 . LEU B  2 129 ? 92.639  -70.169  -128.169 1.00 89.49  ? 128  LEU B CD1 1 
ATOM   2405  C  CD2 . LEU B  2 129 ? 91.195  -71.961  -129.130 1.00 88.57  ? 128  LEU B CD2 1 
ATOM   2406  N  N   . GLY B  2 130 ? 91.386  -66.844  -132.102 1.00 95.11  ? 129  GLY B N   1 
ATOM   2407  C  CA  . GLY B  2 130 ? 91.108  -66.235  -133.394 1.00 97.45  ? 129  GLY B CA  1 
ATOM   2408  C  C   . GLY B  2 130 ? 90.375  -64.909  -133.282 1.00 99.01  ? 129  GLY B C   1 
ATOM   2409  O  O   . GLY B  2 130 ? 89.969  -64.507  -132.191 1.00 99.57  ? 129  GLY B O   1 
ATOM   2410  N  N   . GLY B  2 131 ? 90.203  -64.220  -134.405 1.00 99.80  ? 130  GLY B N   1 
ATOM   2411  C  CA  . GLY B  2 131 ? 89.506  -62.950  -134.367 1.00 101.17 ? 130  GLY B CA  1 
ATOM   2412  C  C   . GLY B  2 131 ? 88.120  -63.110  -133.771 1.00 102.47 ? 130  GLY B C   1 
ATOM   2413  O  O   . GLY B  2 131 ? 87.674  -64.232  -133.526 1.00 102.62 ? 130  GLY B O   1 
ATOM   2414  N  N   . ASP B  2 132 ? 87.445  -61.987  -133.532 1.00 103.37 ? 131  ASP B N   1 
ATOM   2415  C  CA  . ASP B  2 132 ? 86.091  -61.964  -132.974 1.00 104.08 ? 131  ASP B CA  1 
ATOM   2416  C  C   . ASP B  2 132 ? 85.701  -63.159  -132.093 1.00 103.46 ? 131  ASP B C   1 
ATOM   2417  O  O   . ASP B  2 132 ? 84.811  -63.941  -132.441 1.00 103.41 ? 131  ASP B O   1 
ATOM   2418  C  CB  . ASP B  2 132 ? 85.068  -61.796  -134.111 1.00 106.16 ? 131  ASP B CB  1 
ATOM   2419  C  CG  . ASP B  2 132 ? 85.281  -62.785  -135.258 1.00 107.71 ? 131  ASP B CG  1 
ATOM   2420  O  OD1 . ASP B  2 132 ? 85.176  -64.011  -135.027 1.00 108.45 ? 131  ASP B OD1 1 
ATOM   2421  O  OD2 . ASP B  2 132 ? 85.549  -62.333  -136.395 1.00 107.56 ? 131  ASP B OD2 1 
ATOM   2422  N  N   . GLU B  2 133 ? 86.364  -63.274  -130.942 1.00 102.41 ? 132  GLU B N   1 
ATOM   2423  C  CA  . GLU B  2 133 ? 86.127  -64.350  -129.972 1.00 100.56 ? 132  GLU B CA  1 
ATOM   2424  C  C   . GLU B  2 133 ? 86.609  -65.723  -130.446 1.00 98.23  ? 132  GLU B C   1 
ATOM   2425  O  O   . GLU B  2 133 ? 85.810  -66.627  -130.686 1.00 98.33  ? 132  GLU B O   1 
ATOM   2426  C  CB  . GLU B  2 133 ? 84.638  -64.417  -129.584 1.00 101.79 ? 132  GLU B CB  1 
ATOM   2427  C  CG  . GLU B  2 133 ? 84.162  -63.254  -128.708 1.00 102.56 ? 132  GLU B CG  1 
ATOM   2428  C  CD  . GLU B  2 133 ? 82.689  -63.352  -128.331 1.00 102.89 ? 132  GLU B CD  1 
ATOM   2429  O  OE1 . GLU B  2 133 ? 82.302  -64.336  -127.662 1.00 102.92 ? 132  GLU B OE1 1 
ATOM   2430  O  OE2 . GLU B  2 133 ? 81.919  -62.442  -128.704 1.00 102.78 ? 132  GLU B OE2 1 
ATOM   2431  N  N   . GLY B  2 134 ? 87.928  -65.855  -130.561 1.00 95.52  ? 133  GLY B N   1 
ATOM   2432  C  CA  . GLY B  2 134 ? 88.569  -67.091  -130.985 1.00 91.96  ? 133  GLY B CA  1 
ATOM   2433  C  C   . GLY B  2 134 ? 87.703  -68.260  -131.413 1.00 89.57  ? 133  GLY B C   1 
ATOM   2434  O  O   . GLY B  2 134 ? 86.875  -68.128  -132.311 1.00 90.60  ? 133  GLY B O   1 
ATOM   2435  N  N   . LEU B  2 135 ? 87.899  -69.410  -130.771 1.00 86.24  ? 134  LEU B N   1 
ATOM   2436  C  CA  . LEU B  2 135 ? 87.147  -70.610  -131.107 1.00 82.75  ? 134  LEU B CA  1 
ATOM   2437  C  C   . LEU B  2 135 ? 86.765  -71.428  -129.881 1.00 81.42  ? 134  LEU B C   1 
ATOM   2438  O  O   . LEU B  2 135 ? 87.627  -71.960  -129.182 1.00 81.40  ? 134  LEU B O   1 
ATOM   2439  C  CB  . LEU B  2 135 ? 87.969  -71.467  -132.074 1.00 81.63  ? 134  LEU B CB  1 
ATOM   2440  C  CG  . LEU B  2 135 ? 87.404  -72.785  -132.610 1.00 80.80  ? 134  LEU B CG  1 
ATOM   2441  C  CD1 . LEU B  2 135 ? 87.624  -73.901  -131.615 1.00 79.97  ? 134  LEU B CD1 1 
ATOM   2442  C  CD2 . LEU B  2 135 ? 85.930  -72.607  -132.934 1.00 80.89  ? 134  LEU B CD2 1 
ATOM   2443  N  N   . ASP B  2 136 ? 85.463  -71.527  -129.630 1.00 79.48  ? 135  ASP B N   1 
ATOM   2444  C  CA  . ASP B  2 136 ? 84.953  -72.285  -128.494 1.00 78.39  ? 135  ASP B CA  1 
ATOM   2445  C  C   . ASP B  2 136 ? 85.198  -73.780  -128.712 1.00 77.52  ? 135  ASP B C   1 
ATOM   2446  O  O   . ASP B  2 136 ? 84.618  -74.394  -129.606 1.00 78.93  ? 135  ASP B O   1 
ATOM   2447  C  CB  . ASP B  2 136 ? 83.452  -72.011  -128.311 1.00 78.27  ? 135  ASP B CB  1 
ATOM   2448  C  CG  . ASP B  2 136 ? 82.854  -72.764  -127.131 1.00 78.82  ? 135  ASP B CG  1 
ATOM   2449  O  OD1 . ASP B  2 136 ? 82.921  -74.011  -127.123 1.00 79.74  ? 135  ASP B OD1 1 
ATOM   2450  O  OD2 . ASP B  2 136 ? 82.313  -72.113  -126.211 1.00 78.61  ? 135  ASP B OD2 1 
ATOM   2451  N  N   . ILE B  2 137 ? 86.058  -74.363  -127.886 1.00 75.58  ? 136  ILE B N   1 
ATOM   2452  C  CA  . ILE B  2 137 ? 86.382  -75.773  -128.007 1.00 73.71  ? 136  ILE B CA  1 
ATOM   2453  C  C   . ILE B  2 137 ? 85.591  -76.651  -127.050 1.00 72.85  ? 136  ILE B C   1 
ATOM   2454  O  O   . ILE B  2 137 ? 85.924  -77.822  -126.865 1.00 71.43  ? 136  ILE B O   1 
ATOM   2455  C  CB  . ILE B  2 137 ? 87.876  -76.002  -127.762 1.00 74.28  ? 136  ILE B CB  1 
ATOM   2456  C  CG1 . ILE B  2 137 ? 88.228  -75.674  -126.313 1.00 74.08  ? 136  ILE B CG1 1 
ATOM   2457  C  CG2 . ILE B  2 137 ? 88.683  -75.100  -128.673 1.00 74.31  ? 136  ILE B CG2 1 
ATOM   2458  C  CD1 . ILE B  2 137 ? 89.682  -75.913  -125.986 1.00 73.28  ? 136  ILE B CD1 1 
ATOM   2459  N  N   . THR B  2 138 ? 84.552  -76.084  -126.442 1.00 72.84  ? 137  THR B N   1 
ATOM   2460  C  CA  . THR B  2 138 ? 83.710  -76.830  -125.508 1.00 73.71  ? 137  THR B CA  1 
ATOM   2461  C  C   . THR B  2 138 ? 82.579  -77.471  -126.288 1.00 75.03  ? 137  THR B C   1 
ATOM   2462  O  O   . THR B  2 138 ? 82.018  -78.485  -125.879 1.00 73.75  ? 137  THR B O   1 
ATOM   2463  C  CB  . THR B  2 138 ? 83.110  -75.924  -124.407 1.00 72.59  ? 137  THR B CB  1 
ATOM   2464  O  OG1 . THR B  2 138 ? 82.217  -74.965  -124.984 1.00 71.39  ? 137  THR B OG1 1 
ATOM   2465  C  CG2 . THR B  2 138 ? 84.217  -75.190  -123.679 1.00 73.85  ? 137  THR B CG2 1 
ATOM   2466  N  N   . GLN B  2 139 ? 82.247  -76.858  -127.417 1.00 77.80  ? 138  GLN B N   1 
ATOM   2467  C  CA  . GLN B  2 139 ? 81.204  -77.377  -128.285 1.00 80.68  ? 138  GLN B CA  1 
ATOM   2468  C  C   . GLN B  2 139 ? 81.866  -78.408  -129.186 1.00 81.39  ? 138  GLN B C   1 
ATOM   2469  O  O   . GLN B  2 139 ? 83.082  -78.587  -129.133 1.00 82.30  ? 138  GLN B O   1 
ATOM   2470  C  CB  . GLN B  2 139 ? 80.600  -76.252  -129.125 1.00 82.26  ? 138  GLN B CB  1 
ATOM   2471  C  CG  . GLN B  2 139 ? 79.682  -75.322  -128.354 1.00 84.54  ? 138  GLN B CG  1 
ATOM   2472  C  CD  . GLN B  2 139 ? 79.135  -74.205  -129.220 1.00 87.11  ? 138  GLN B CD  1 
ATOM   2473  O  OE1 . GLN B  2 139 ? 78.204  -73.499  -128.828 1.00 88.58  ? 138  GLN B OE1 1 
ATOM   2474  N  NE2 . GLN B  2 139 ? 79.717  -74.033  -130.405 1.00 88.09  ? 138  GLN B NE2 1 
ATOM   2475  N  N   . ASP B  2 140 ? 81.080  -79.091  -130.009 1.00 81.69  ? 139  ASP B N   1 
ATOM   2476  C  CA  . ASP B  2 140 ? 81.647  -80.092  -130.899 1.00 82.04  ? 139  ASP B CA  1 
ATOM   2477  C  C   . ASP B  2 140 ? 82.367  -81.139  -130.062 1.00 81.44  ? 139  ASP B C   1 
ATOM   2478  O  O   . ASP B  2 140 ? 83.474  -81.545  -130.391 1.00 81.78  ? 139  ASP B O   1 
ATOM   2479  C  CB  . ASP B  2 140 ? 82.647  -79.439  -131.860 1.00 82.67  ? 139  ASP B CB  1 
ATOM   2480  C  CG  . ASP B  2 140 ? 82.044  -78.284  -132.637 1.00 83.97  ? 139  ASP B CG  1 
ATOM   2481  O  OD1 . ASP B  2 140 ? 82.804  -77.568  -133.323 1.00 84.51  ? 139  ASP B OD1 1 
ATOM   2482  O  OD2 . ASP B  2 140 ? 80.811  -78.093  -132.564 1.00 84.86  ? 139  ASP B OD2 1 
HETATM 2483  N  N   . MSE B  2 141 ? 81.744  -81.571  -128.975 1.00 81.27  ? 140  MSE B N   1 
HETATM 2484  C  CA  . MSE B  2 141 ? 82.364  -82.567  -128.115 1.00 82.73  ? 140  MSE B CA  1 
HETATM 2485  C  C   . MSE B  2 141 ? 82.451  -83.942  -128.779 1.00 83.21  ? 140  MSE B C   1 
HETATM 2486  O  O   . MSE B  2 141 ? 83.404  -84.687  -128.548 1.00 83.07  ? 140  MSE B O   1 
HETATM 2487  C  CB  . MSE B  2 141 ? 81.598  -82.680  -126.793 1.00 83.42  ? 140  MSE B CB  1 
HETATM 2488  C  CG  . MSE B  2 141 ? 81.650  -81.431  -125.908 1.00 83.88  ? 140  MSE B CG  1 
HETATM 2489  SE SE  . MSE B  2 141 ? 83.408  -80.995  -125.200 1.00 82.93  ? 140  MSE B SE  1 
HETATM 2490  C  CE  . MSE B  2 141 ? 83.524  -82.349  -123.821 1.00 81.95  ? 140  MSE B CE  1 
ATOM   2491  N  N   . LYS B  2 142 ? 81.456  -84.277  -129.599 1.00 83.63  ? 141  LYS B N   1 
ATOM   2492  C  CA  . LYS B  2 142 ? 81.431  -85.565  -130.291 1.00 83.55  ? 141  LYS B CA  1 
ATOM   2493  C  C   . LYS B  2 142 ? 81.453  -85.341  -131.795 1.00 83.59  ? 141  LYS B C   1 
ATOM   2494  O  O   . LYS B  2 142 ? 80.822  -84.412  -132.296 1.00 83.55  ? 141  LYS B O   1 
ATOM   2495  C  CB  . LYS B  2 142 ? 80.166  -86.346  -129.933 1.00 83.35  ? 141  LYS B CB  1 
ATOM   2496  C  CG  . LYS B  2 142 ? 79.876  -86.446  -128.450 1.00 83.70  ? 141  LYS B CG  1 
ATOM   2497  C  CD  . LYS B  2 142 ? 78.597  -87.238  -128.209 1.00 85.18  ? 141  LYS B CD  1 
ATOM   2498  C  CE  . LYS B  2 142 ? 78.087  -87.082  -126.777 1.00 85.82  ? 141  LYS B CE  1 
ATOM   2499  N  NZ  . LYS B  2 142 ? 77.616  -85.690  -126.479 1.00 85.80  ? 141  LYS B NZ  1 
ATOM   2500  N  N   . PRO B  2 143 ? 82.175  -86.195  -132.540 1.00 84.04  ? 142  PRO B N   1 
ATOM   2501  C  CA  . PRO B  2 143 ? 82.227  -86.025  -133.997 1.00 84.41  ? 142  PRO B CA  1 
ATOM   2502  C  C   . PRO B  2 143 ? 80.817  -86.003  -134.582 1.00 84.89  ? 142  PRO B C   1 
ATOM   2503  O  O   . PRO B  2 143 ? 79.975  -86.820  -134.210 1.00 84.16  ? 142  PRO B O   1 
ATOM   2504  C  CB  . PRO B  2 143 ? 83.052  -87.228  -134.458 1.00 84.04  ? 142  PRO B CB  1 
ATOM   2505  C  CG  . PRO B  2 143 ? 82.815  -88.250  -133.375 1.00 83.82  ? 142  PRO B CG  1 
ATOM   2506  C  CD  . PRO B  2 143 ? 82.873  -87.424  -132.124 1.00 83.50  ? 142  PRO B CD  1 
ATOM   2507  N  N   . PRO B  2 144 ? 80.543  -85.055  -135.497 1.00 86.14  ? 143  PRO B N   1 
ATOM   2508  C  CA  . PRO B  2 144 ? 79.237  -84.892  -136.152 1.00 87.90  ? 143  PRO B CA  1 
ATOM   2509  C  C   . PRO B  2 144 ? 78.661  -86.177  -136.768 1.00 89.74  ? 143  PRO B C   1 
ATOM   2510  O  O   . PRO B  2 144 ? 79.398  -86.991  -137.325 1.00 90.31  ? 143  PRO B O   1 
ATOM   2511  C  CB  . PRO B  2 144 ? 79.515  -83.819  -137.207 1.00 86.72  ? 143  PRO B CB  1 
ATOM   2512  C  CG  . PRO B  2 144 ? 80.606  -83.010  -136.589 1.00 85.30  ? 143  PRO B CG  1 
ATOM   2513  C  CD  . PRO B  2 144 ? 81.509  -84.076  -136.026 1.00 85.50  ? 143  PRO B CD  1 
ATOM   2514  N  N   . LYS B  2 145 ? 77.346  -86.355  -136.661 1.00 91.61  ? 144  LYS B N   1 
ATOM   2515  C  CA  . LYS B  2 145 ? 76.692  -87.538  -137.221 1.00 94.98  ? 144  LYS B CA  1 
ATOM   2516  C  C   . LYS B  2 145 ? 75.773  -87.103  -138.360 1.00 97.10  ? 144  LYS B C   1 
ATOM   2517  O  O   . LYS B  2 145 ? 75.043  -87.912  -138.946 1.00 97.01  ? 144  LYS B O   1 
ATOM   2518  C  CB  . LYS B  2 145 ? 75.879  -88.274  -136.145 1.00 95.20  ? 144  LYS B CB  1 
ATOM   2519  C  CG  . LYS B  2 145 ? 75.511  -89.709  -136.532 1.00 95.96  ? 144  LYS B CG  1 
ATOM   2520  C  CD  . LYS B  2 145 ? 74.764  -90.464  -135.429 1.00 95.71  ? 144  LYS B CD  1 
ATOM   2521  C  CE  . LYS B  2 145 ? 73.316  -90.014  -135.297 1.00 94.95  ? 144  LYS B CE  1 
ATOM   2522  N  NZ  . LYS B  2 145 ? 72.559  -90.902  -134.367 1.00 93.74  ? 144  LYS B NZ  1 
ATOM   2523  N  N   . SER B  2 146 ? 75.822  -85.810  -138.667 1.00 99.01  ? 145  SER B N   1 
ATOM   2524  C  CA  . SER B  2 146 ? 75.009  -85.234  -139.733 1.00 100.70 ? 145  SER B CA  1 
ATOM   2525  C  C   . SER B  2 146 ? 75.592  -83.870  -140.127 1.00 100.88 ? 145  SER B C   1 
ATOM   2526  O  O   . SER B  2 146 ? 74.871  -82.853  -140.014 1.00 101.31 ? 145  SER B O   1 
ATOM   2527  C  CB  . SER B  2 146 ? 73.553  -85.085  -139.257 1.00 100.80 ? 145  SER B CB  1 
ATOM   2528  O  OG  . SER B  2 146 ? 72.672  -84.817  -140.334 1.00 99.57  ? 145  SER B OG  1 
HETATM 2529  N  N   . MSE C  3 1   ? 94.140  -92.514  -126.867 1.00 97.00  ? 0    MSE C N   1 
HETATM 2530  C  CA  . MSE C  3 1   ? 93.483  -93.552  -127.712 1.00 97.01  ? 0    MSE C CA  1 
HETATM 2531  C  C   . MSE C  3 1   ? 92.278  -92.932  -128.404 1.00 95.37  ? 0    MSE C C   1 
HETATM 2532  O  O   . MSE C  3 1   ? 91.940  -91.771  -128.162 1.00 95.12  ? 0    MSE C O   1 
HETATM 2533  C  CB  . MSE C  3 1   ? 93.018  -94.724  -126.843 1.00 100.54 ? 0    MSE C CB  1 
HETATM 2534  C  CG  . MSE C  3 1   ? 92.910  -96.059  -127.576 1.00 105.02 ? 0    MSE C CG  1 
HETATM 2535  SE SE  . MSE C  3 1   ? 94.650  -96.866  -127.955 1.00 112.54 ? 0    MSE C SE  1 
HETATM 2536  C  CE  . MSE C  3 1   ? 95.057  -97.510  -126.175 1.00 110.19 ? 0    MSE C CE  1 
HETATM 2537  N  N   . MSE C  3 2   ? 91.632  -93.711  -129.265 1.00 93.17  ? 1    MSE C N   1 
HETATM 2538  C  CA  . MSE C  3 2   ? 90.457  -93.240  -129.986 1.00 90.14  ? 1    MSE C CA  1 
HETATM 2539  C  C   . MSE C  3 2   ? 89.268  -94.147  -129.742 1.00 87.26  ? 1    MSE C C   1 
HETATM 2540  O  O   . MSE C  3 2   ? 89.416  -95.360  -129.611 1.00 86.59  ? 1    MSE C O   1 
HETATM 2541  C  CB  . MSE C  3 2   ? 90.733  -93.184  -131.486 1.00 91.78  ? 1    MSE C CB  1 
HETATM 2542  C  CG  . MSE C  3 2   ? 91.714  -92.116  -131.892 1.00 94.18  ? 1    MSE C CG  1 
HETATM 2543  SE SE  . MSE C  3 2   ? 91.905  -92.035  -133.804 1.00 99.17  ? 1    MSE C SE  1 
HETATM 2544  C  CE  . MSE C  3 2   ? 90.475  -90.810  -134.210 1.00 97.19  ? 1    MSE C CE  1 
ATOM   2545  N  N   . ASP C  3 3   ? 88.085  -93.549  -129.678 1.00 84.30  ? 2    ASP C N   1 
ATOM   2546  C  CA  . ASP C  3 3   ? 86.859  -94.309  -129.475 1.00 81.96  ? 2    ASP C CA  1 
ATOM   2547  C  C   . ASP C  3 3   ? 86.147  -94.514  -130.815 1.00 79.78  ? 2    ASP C C   1 
ATOM   2548  O  O   . ASP C  3 3   ? 86.465  -93.855  -131.811 1.00 79.57  ? 2    ASP C O   1 
ATOM   2549  C  CB  . ASP C  3 3   ? 85.933  -93.581  -128.492 1.00 82.27  ? 2    ASP C CB  1 
ATOM   2550  C  CG  . ASP C  3 3   ? 85.714  -92.128  -128.864 1.00 82.76  ? 2    ASP C CG  1 
ATOM   2551  O  OD1 . ASP C  3 3   ? 84.956  -91.434  -128.155 1.00 83.22  ? 2    ASP C OD1 1 
ATOM   2552  O  OD2 . ASP C  3 3   ? 86.305  -91.678  -129.864 1.00 82.42  ? 2    ASP C OD2 1 
ATOM   2553  N  N   . ALA C  3 4   ? 85.190  -95.435  -130.832 1.00 76.53  ? 3    ALA C N   1 
ATOM   2554  C  CA  . ALA C  3 4   ? 84.438  -95.734  -132.042 1.00 73.74  ? 3    ALA C CA  1 
ATOM   2555  C  C   . ALA C  3 4   ? 84.116  -94.464  -132.817 1.00 71.82  ? 3    ALA C C   1 
ATOM   2556  O  O   . ALA C  3 4   ? 84.536  -94.303  -133.962 1.00 71.91  ? 3    ALA C O   1 
ATOM   2557  C  CB  . ALA C  3 4   ? 83.155  -96.469  -131.685 1.00 74.00  ? 3    ALA C CB  1 
ATOM   2558  N  N   . ALA C  3 5   ? 83.371  -93.565  -132.184 1.00 69.33  ? 4    ALA C N   1 
ATOM   2559  C  CA  . ALA C  3 5   ? 82.995  -92.313  -132.816 1.00 67.27  ? 4    ALA C CA  1 
ATOM   2560  C  C   . ALA C  3 5   ? 84.175  -91.698  -133.554 1.00 66.69  ? 4    ALA C C   1 
ATOM   2561  O  O   . ALA C  3 5   ? 84.137  -91.529  -134.771 1.00 66.45  ? 4    ALA C O   1 
ATOM   2562  C  CB  . ALA C  3 5   ? 82.481  -91.354  -131.775 1.00 67.39  ? 4    ALA C CB  1 
ATOM   2563  N  N   . GLU C  3 6   ? 85.230  -91.381  -132.811 1.00 66.38  ? 5    GLU C N   1 
ATOM   2564  C  CA  . GLU C  3 6   ? 86.419  -90.774  -133.390 1.00 66.02  ? 5    GLU C CA  1 
ATOM   2565  C  C   . GLU C  3 6   ? 87.010  -91.574  -134.545 1.00 64.69  ? 5    GLU C C   1 
ATOM   2566  O  O   . GLU C  3 6   ? 87.453  -90.993  -135.539 1.00 64.27  ? 5    GLU C O   1 
ATOM   2567  C  CB  . GLU C  3 6   ? 87.474  -90.547  -132.304 1.00 68.67  ? 5    GLU C CB  1 
ATOM   2568  C  CG  . GLU C  3 6   ? 87.095  -89.456  -131.293 1.00 71.85  ? 5    GLU C CG  1 
ATOM   2569  C  CD  . GLU C  3 6   ? 88.155  -89.238  -130.220 1.00 72.72  ? 5    GLU C CD  1 
ATOM   2570  O  OE1 . GLU C  3 6   ? 88.548  -90.221  -129.553 1.00 72.64  ? 5    GLU C OE1 1 
ATOM   2571  O  OE2 . GLU C  3 6   ? 88.588  -88.078  -130.041 1.00 74.16  ? 5    GLU C OE2 1 
ATOM   2572  N  N   . VAL C  3 7   ? 87.027  -92.898  -134.422 1.00 63.38  ? 6    VAL C N   1 
ATOM   2573  C  CA  . VAL C  3 7   ? 87.553  -93.737  -135.498 1.00 62.17  ? 6    VAL C CA  1 
ATOM   2574  C  C   . VAL C  3 7   ? 86.600  -93.690  -136.698 1.00 61.71  ? 6    VAL C C   1 
ATOM   2575  O  O   . VAL C  3 7   ? 87.043  -93.541  -137.840 1.00 62.06  ? 6    VAL C O   1 
ATOM   2576  C  CB  . VAL C  3 7   ? 87.746  -95.208  -135.041 1.00 61.51  ? 6    VAL C CB  1 
ATOM   2577  C  CG1 . VAL C  3 7   ? 88.011  -96.108  -136.235 1.00 59.88  ? 6    VAL C CG1 1 
ATOM   2578  C  CG2 . VAL C  3 7   ? 88.914  -95.290  -134.086 1.00 62.12  ? 6    VAL C CG2 1 
ATOM   2579  N  N   . GLU C  3 8   ? 85.296  -93.798  -136.440 1.00 59.92  ? 7    GLU C N   1 
ATOM   2580  C  CA  . GLU C  3 8   ? 84.315  -93.754  -137.519 1.00 58.28  ? 7    GLU C CA  1 
ATOM   2581  C  C   . GLU C  3 8   ? 84.517  -92.493  -138.337 1.00 56.72  ? 7    GLU C C   1 
ATOM   2582  O  O   . GLU C  3 8   ? 84.442  -92.527  -139.556 1.00 57.60  ? 7    GLU C O   1 
ATOM   2583  C  CB  . GLU C  3 8   ? 82.887  -93.773  -136.975 1.00 57.92  ? 7    GLU C CB  1 
ATOM   2584  C  CG  . GLU C  3 8   ? 81.826  -93.697  -138.067 1.00 60.02  ? 7    GLU C CG  1 
ATOM   2585  C  CD  . GLU C  3 8   ? 80.401  -93.883  -137.534 1.00 63.24  ? 7    GLU C CD  1 
ATOM   2586  O  OE1 . GLU C  3 8   ? 79.626  -92.893  -137.482 1.00 62.19  ? 7    GLU C OE1 1 
ATOM   2587  O  OE2 . GLU C  3 8   ? 80.058  -95.030  -137.162 1.00 63.92  ? 7    GLU C OE2 1 
ATOM   2588  N  N   . PHE C  3 9   ? 84.780  -91.385  -137.654 1.00 54.39  ? 8    PHE C N   1 
ATOM   2589  C  CA  . PHE C  3 9   ? 84.990  -90.106  -138.314 1.00 52.13  ? 8    PHE C CA  1 
ATOM   2590  C  C   . PHE C  3 9   ? 86.040  -90.233  -139.404 1.00 53.13  ? 8    PHE C C   1 
ATOM   2591  O  O   . PHE C  3 9   ? 86.033  -89.477  -140.381 1.00 53.58  ? 8    PHE C O   1 
ATOM   2592  C  CB  . PHE C  3 9   ? 85.414  -89.053  -137.284 1.00 48.97  ? 8    PHE C CB  1 
ATOM   2593  C  CG  . PHE C  3 9   ? 85.762  -87.723  -137.877 1.00 44.36  ? 8    PHE C CG  1 
ATOM   2594  C  CD1 . PHE C  3 9   ? 87.022  -87.495  -138.417 1.00 44.37  ? 8    PHE C CD1 1 
ATOM   2595  C  CD2 . PHE C  3 9   ? 84.834  -86.695  -137.891 1.00 44.25  ? 8    PHE C CD2 1 
ATOM   2596  C  CE1 . PHE C  3 9   ? 87.356  -86.249  -138.964 1.00 44.87  ? 8    PHE C CE1 1 
ATOM   2597  C  CE2 . PHE C  3 9   ? 85.155  -85.443  -138.436 1.00 45.27  ? 8    PHE C CE2 1 
ATOM   2598  C  CZ  . PHE C  3 9   ? 86.418  -85.221  -138.972 1.00 43.97  ? 8    PHE C CZ  1 
ATOM   2599  N  N   . LEU C  3 10  ? 86.942  -91.195  -139.241 1.00 53.49  ? 9    LEU C N   1 
ATOM   2600  C  CA  . LEU C  3 10  ? 88.000  -91.413  -140.223 1.00 54.13  ? 9    LEU C CA  1 
ATOM   2601  C  C   . LEU C  3 10  ? 87.509  -92.287  -141.366 1.00 53.16  ? 9    LEU C C   1 
ATOM   2602  O  O   . LEU C  3 10  ? 87.934  -92.136  -142.507 1.00 53.07  ? 9    LEU C O   1 
ATOM   2603  C  CB  . LEU C  3 10  ? 89.212  -92.057  -139.547 1.00 55.03  ? 9    LEU C CB  1 
ATOM   2604  C  CG  . LEU C  3 10  ? 90.474  -91.191  -139.426 1.00 56.30  ? 9    LEU C CG  1 
ATOM   2605  C  CD1 . LEU C  3 10  ? 90.113  -89.725  -139.147 1.00 55.77  ? 9    LEU C CD1 1 
ATOM   2606  C  CD2 . LEU C  3 10  ? 91.359  -91.768  -138.319 1.00 55.25  ? 9    LEU C CD2 1 
ATOM   2607  N  N   . ALA C  3 11  ? 86.607  -93.202  -141.045 1.00 52.91  ? 10   ALA C N   1 
ATOM   2608  C  CA  . ALA C  3 11  ? 86.041  -94.097  -142.035 1.00 54.12  ? 10   ALA C CA  1 
ATOM   2609  C  C   . ALA C  3 11  ? 85.217  -93.257  -143.002 1.00 56.01  ? 10   ALA C C   1 
ATOM   2610  O  O   . ALA C  3 11  ? 85.086  -93.583  -144.186 1.00 57.18  ? 10   ALA C O   1 
ATOM   2611  C  CB  . ALA C  3 11  ? 85.161  -95.132  -141.349 1.00 52.36  ? 10   ALA C CB  1 
ATOM   2612  N  N   . GLU C  3 12  ? 84.677  -92.160  -142.478 1.00 57.08  ? 11   GLU C N   1 
ATOM   2613  C  CA  . GLU C  3 12  ? 83.846  -91.240  -143.241 1.00 57.08  ? 11   GLU C CA  1 
ATOM   2614  C  C   . GLU C  3 12  ? 84.629  -90.358  -144.200 1.00 56.76  ? 11   GLU C C   1 
ATOM   2615  O  O   . GLU C  3 12  ? 84.052  -89.507  -144.866 1.00 57.04  ? 11   GLU C O   1 
ATOM   2616  C  CB  . GLU C  3 12  ? 83.048  -90.348  -142.294 1.00 58.69  ? 11   GLU C CB  1 
ATOM   2617  C  CG  . GLU C  3 12  ? 81.945  -91.049  -141.520 1.00 61.39  ? 11   GLU C CG  1 
ATOM   2618  C  CD  . GLU C  3 12  ? 81.270  -90.113  -140.533 1.00 62.60  ? 11   GLU C CD  1 
ATOM   2619  O  OE1 . GLU C  3 12  ? 80.236  -90.496  -139.948 1.00 63.82  ? 11   GLU C OE1 1 
ATOM   2620  O  OE2 . GLU C  3 12  ? 81.783  -88.989  -140.340 1.00 62.95  ? 11   GLU C OE2 1 
ATOM   2621  N  N   . LYS C  3 13  ? 85.940  -90.527  -144.256 1.00 56.33  ? 12   LYS C N   1 
ATOM   2622  C  CA  . LYS C  3 13  ? 86.729  -89.730  -145.179 1.00 57.53  ? 12   LYS C CA  1 
ATOM   2623  C  C   . LYS C  3 13  ? 86.902  -90.603  -146.409 1.00 58.09  ? 12   LYS C C   1 
ATOM   2624  O  O   . LYS C  3 13  ? 87.211  -90.135  -147.507 1.00 57.90  ? 12   LYS C O   1 
ATOM   2625  C  CB  . LYS C  3 13  ? 88.074  -89.357  -144.544 1.00 58.70  ? 12   LYS C CB  1 
ATOM   2626  C  CG  . LYS C  3 13  ? 87.949  -88.199  -143.541 1.00 61.01  ? 12   LYS C CG  1 
ATOM   2627  C  CD  . LYS C  3 13  ? 89.258  -87.802  -142.868 1.00 61.28  ? 12   LYS C CD  1 
ATOM   2628  C  CE  . LYS C  3 13  ? 90.321  -87.385  -143.864 1.00 61.18  ? 12   LYS C CE  1 
ATOM   2629  N  NZ  . LYS C  3 13  ? 90.913  -88.565  -144.552 1.00 63.82  ? 12   LYS C NZ  1 
ATOM   2630  N  N   . GLU C  3 14  ? 86.645  -91.888  -146.195 1.00 58.57  ? 13   GLU C N   1 
ATOM   2631  C  CA  . GLU C  3 14  ? 86.743  -92.913  -147.219 1.00 58.82  ? 13   GLU C CA  1 
ATOM   2632  C  C   . GLU C  3 14  ? 85.826  -92.590  -148.402 1.00 58.20  ? 13   GLU C C   1 
ATOM   2633  O  O   . GLU C  3 14  ? 84.702  -92.118  -148.208 1.00 57.63  ? 13   GLU C O   1 
ATOM   2634  C  CB  . GLU C  3 14  ? 86.359  -94.257  -146.595 1.00 60.67  ? 13   GLU C CB  1 
ATOM   2635  C  CG  . GLU C  3 14  ? 87.290  -95.396  -146.951 1.00 65.39  ? 13   GLU C CG  1 
ATOM   2636  C  CD  . GLU C  3 14  ? 88.753  -95.024  -146.782 1.00 67.38  ? 13   GLU C CD  1 
ATOM   2637  O  OE1 . GLU C  3 14  ? 89.126  -94.577  -145.674 1.00 69.21  ? 13   GLU C OE1 1 
ATOM   2638  O  OE2 . GLU C  3 14  ? 89.525  -95.180  -147.756 1.00 67.69  ? 13   GLU C OE2 1 
ATOM   2639  N  N   . LEU C  3 15  ? 86.313  -92.845  -149.621 1.00 56.79  ? 14   LEU C N   1 
ATOM   2640  C  CA  . LEU C  3 15  ? 85.546  -92.580  -150.841 1.00 53.88  ? 14   LEU C CA  1 
ATOM   2641  C  C   . LEU C  3 15  ? 84.638  -93.724  -151.233 1.00 52.73  ? 14   LEU C C   1 
ATOM   2642  O  O   . LEU C  3 15  ? 85.046  -94.884  -151.225 1.00 52.48  ? 14   LEU C O   1 
ATOM   2643  C  CB  . LEU C  3 15  ? 86.470  -92.283  -152.015 1.00 52.98  ? 14   LEU C CB  1 
ATOM   2644  C  CG  . LEU C  3 15  ? 87.170  -90.929  -152.004 1.00 53.03  ? 14   LEU C CG  1 
ATOM   2645  C  CD1 . LEU C  3 15  ? 87.932  -90.757  -153.318 1.00 50.39  ? 14   LEU C CD1 1 
ATOM   2646  C  CD2 . LEU C  3 15  ? 86.138  -89.818  -151.813 1.00 52.20  ? 14   LEU C CD2 1 
ATOM   2647  N  N   . VAL C  3 16  ? 83.407  -93.374  -151.588 1.00 51.62  ? 15   VAL C N   1 
ATOM   2648  C  CA  . VAL C  3 16  ? 82.391  -94.335  -151.992 1.00 50.54  ? 15   VAL C CA  1 
ATOM   2649  C  C   . VAL C  3 16  ? 81.766  -93.798  -153.283 1.00 51.22  ? 15   VAL C C   1 
ATOM   2650  O  O   . VAL C  3 16  ? 81.934  -92.618  -153.604 1.00 51.22  ? 15   VAL C O   1 
ATOM   2651  C  CB  . VAL C  3 16  ? 81.316  -94.455  -150.902 1.00 49.13  ? 15   VAL C CB  1 
ATOM   2652  C  CG1 . VAL C  3 16  ? 80.508  -93.192  -150.842 1.00 48.97  ? 15   VAL C CG1 1 
ATOM   2653  C  CG2 . VAL C  3 16  ? 80.431  -95.629  -151.166 1.00 51.11  ? 15   VAL C CG2 1 
ATOM   2654  N  N   . THR C  3 17  ? 81.060  -94.643  -154.033 1.00 51.50  ? 16   THR C N   1 
ATOM   2655  C  CA  . THR C  3 17  ? 80.436  -94.185  -155.282 1.00 51.78  ? 16   THR C CA  1 
ATOM   2656  C  C   . THR C  3 17  ? 78.917  -93.995  -155.220 1.00 50.80  ? 16   THR C C   1 
ATOM   2657  O  O   . THR C  3 17  ? 78.191  -94.894  -154.813 1.00 49.75  ? 16   THR C O   1 
ATOM   2658  C  CB  . THR C  3 17  ? 80.734  -95.144  -156.442 1.00 51.66  ? 16   THR C CB  1 
ATOM   2659  O  OG1 . THR C  3 17  ? 82.136  -95.129  -156.734 1.00 51.99  ? 16   THR C OG1 1 
ATOM   2660  C  CG2 . THR C  3 17  ? 79.975  -94.717  -157.673 1.00 52.58  ? 16   THR C CG2 1 
ATOM   2661  N  N   . ILE C  3 18  ? 78.433  -92.823  -155.623 1.00 51.74  ? 17   ILE C N   1 
ATOM   2662  C  CA  . ILE C  3 18  ? 76.989  -92.585  -155.609 1.00 53.32  ? 17   ILE C CA  1 
ATOM   2663  C  C   . ILE C  3 18  ? 76.487  -91.993  -156.921 1.00 53.32  ? 17   ILE C C   1 
ATOM   2664  O  O   . ILE C  3 18  ? 77.208  -91.257  -157.595 1.00 52.92  ? 17   ILE C O   1 
ATOM   2665  C  CB  . ILE C  3 18  ? 76.551  -91.626  -154.457 1.00 53.22  ? 17   ILE C CB  1 
ATOM   2666  C  CG1 . ILE C  3 18  ? 76.815  -90.162  -154.831 1.00 53.09  ? 17   ILE C CG1 1 
ATOM   2667  C  CG2 . ILE C  3 18  ? 77.275  -91.984  -153.190 1.00 54.29  ? 17   ILE C CG2 1 
ATOM   2668  C  CD1 . ILE C  3 18  ? 78.256  -89.846  -155.127 1.00 54.76  ? 17   ILE C CD1 1 
ATOM   2669  N  N   . ILE C  3 19  ? 75.255  -92.341  -157.286 1.00 53.37  ? 18   ILE C N   1 
ATOM   2670  C  CA  . ILE C  3 19  ? 74.630  -91.807  -158.488 1.00 54.17  ? 18   ILE C CA  1 
ATOM   2671  C  C   . ILE C  3 19  ? 73.557  -90.841  -157.987 1.00 53.40  ? 18   ILE C C   1 
ATOM   2672  O  O   . ILE C  3 19  ? 72.522  -91.244  -157.453 1.00 52.07  ? 18   ILE C O   1 
ATOM   2673  C  CB  . ILE C  3 19  ? 74.003  -92.923  -159.376 1.00 55.55  ? 18   ILE C CB  1 
ATOM   2674  C  CG1 . ILE C  3 19  ? 72.938  -93.704  -158.601 1.00 55.89  ? 18   ILE C CG1 1 
ATOM   2675  C  CG2 . ILE C  3 19  ? 75.105  -93.861  -159.865 1.00 57.09  ? 18   ILE C CG2 1 
ATOM   2676  C  CD1 . ILE C  3 19  ? 72.105  -94.634  -159.456 1.00 55.95  ? 18   ILE C CD1 1 
ATOM   2677  N  N   . PRO C  3 20  ? 73.817  -89.538  -158.121 1.00 53.60  ? 19   PRO C N   1 
ATOM   2678  C  CA  . PRO C  3 20  ? 72.892  -88.499  -157.680 1.00 55.06  ? 19   PRO C CA  1 
ATOM   2679  C  C   . PRO C  3 20  ? 71.696  -88.299  -158.599 1.00 56.93  ? 19   PRO C C   1 
ATOM   2680  O  O   . PRO C  3 20  ? 71.714  -88.705  -159.757 1.00 58.30  ? 19   PRO C O   1 
ATOM   2681  C  CB  . PRO C  3 20  ? 73.786  -87.267  -157.617 1.00 54.32  ? 19   PRO C CB  1 
ATOM   2682  C  CG  . PRO C  3 20  ? 74.702  -87.482  -158.763 1.00 53.82  ? 19   PRO C CG  1 
ATOM   2683  C  CD  . PRO C  3 20  ? 75.063  -88.944  -158.636 1.00 53.52  ? 19   PRO C CD  1 
ATOM   2684  N  N   . ASN C  3 21  ? 70.655  -87.666  -158.071 1.00 57.90  ? 20   ASN C N   1 
ATOM   2685  C  CA  . ASN C  3 21  ? 69.453  -87.392  -158.845 1.00 58.56  ? 20   ASN C CA  1 
ATOM   2686  C  C   . ASN C  3 21  ? 69.359  -85.888  -159.085 1.00 58.40  ? 20   ASN C C   1 
ATOM   2687  O  O   . ASN C  3 21  ? 68.277  -85.334  -159.263 1.00 57.60  ? 20   ASN C O   1 
ATOM   2688  C  CB  . ASN C  3 21  ? 68.220  -87.873  -158.079 1.00 59.48  ? 20   ASN C CB  1 
ATOM   2689  C  CG  . ASN C  3 21  ? 67.961  -87.068  -156.823 1.00 59.42  ? 20   ASN C CG  1 
ATOM   2690  O  OD1 . ASN C  3 21  ? 67.051  -87.382  -156.058 1.00 60.19  ? 20   ASN C OD1 1 
ATOM   2691  N  ND2 . ASN C  3 21  ? 68.754  -86.020  -156.606 1.00 59.58  ? 20   ASN C ND2 1 
ATOM   2692  N  N   . PHE C  3 22  ? 70.507  -85.231  -159.079 1.00 58.58  ? 21   PHE C N   1 
ATOM   2693  C  CA  . PHE C  3 22  ? 70.540  -83.798  -159.267 1.00 59.70  ? 21   PHE C CA  1 
ATOM   2694  C  C   . PHE C  3 22  ? 71.788  -83.353  -160.018 1.00 61.33  ? 21   PHE C C   1 
ATOM   2695  O  O   . PHE C  3 22  ? 72.713  -84.137  -160.251 1.00 60.68  ? 21   PHE C O   1 
ATOM   2696  C  CB  . PHE C  3 22  ? 70.482  -83.101  -157.906 1.00 59.65  ? 21   PHE C CB  1 
ATOM   2697  C  CG  . PHE C  3 22  ? 71.604  -83.494  -156.967 1.00 60.40  ? 21   PHE C CG  1 
ATOM   2698  C  CD1 . PHE C  3 22  ? 71.501  -84.633  -156.169 1.00 58.51  ? 21   PHE C CD1 1 
ATOM   2699  C  CD2 . PHE C  3 22  ? 72.778  -82.736  -156.905 1.00 59.26  ? 21   PHE C CD2 1 
ATOM   2700  C  CE1 . PHE C  3 22  ? 72.542  -85.005  -155.334 1.00 57.13  ? 21   PHE C CE1 1 
ATOM   2701  C  CE2 . PHE C  3 22  ? 73.821  -83.106  -156.071 1.00 57.64  ? 21   PHE C CE2 1 
ATOM   2702  C  CZ  . PHE C  3 22  ? 73.703  -84.240  -155.286 1.00 56.96  ? 21   PHE C CZ  1 
ATOM   2703  N  N   . SER C  3 23  ? 71.800  -82.082  -160.399 1.00 63.08  ? 22   SER C N   1 
ATOM   2704  C  CA  . SER C  3 23  ? 72.929  -81.512  -161.113 1.00 65.56  ? 22   SER C CA  1 
ATOM   2705  C  C   . SER C  3 23  ? 73.505  -80.344  -160.323 1.00 66.72  ? 22   SER C C   1 
ATOM   2706  O  O   . SER C  3 23  ? 72.813  -79.370  -160.029 1.00 67.62  ? 22   SER C O   1 
ATOM   2707  C  CB  . SER C  3 23  ? 72.500  -81.064  -162.518 1.00 65.94  ? 22   SER C CB  1 
ATOM   2708  O  OG  . SER C  3 23  ? 71.221  -80.455  -162.501 1.00 66.91  ? 22   SER C OG  1 
ATOM   2709  N  N   . LEU C  3 24  ? 74.777  -80.460  -159.968 1.00 67.63  ? 23   LEU C N   1 
ATOM   2710  C  CA  . LEU C  3 24  ? 75.452  -79.427  -159.208 1.00 68.31  ? 23   LEU C CA  1 
ATOM   2711  C  C   . LEU C  3 24  ? 76.847  -79.231  -159.766 1.00 68.93  ? 23   LEU C C   1 
ATOM   2712  O  O   . LEU C  3 24  ? 77.517  -80.194  -160.122 1.00 69.23  ? 23   LEU C O   1 
ATOM   2713  C  CB  . LEU C  3 24  ? 75.545  -79.839  -157.743 1.00 68.88  ? 23   LEU C CB  1 
ATOM   2714  C  CG  . LEU C  3 24  ? 76.259  -78.847  -156.826 1.00 68.39  ? 23   LEU C CG  1 
ATOM   2715  C  CD1 . LEU C  3 24  ? 75.363  -77.647  -156.568 1.00 67.32  ? 23   LEU C CD1 1 
ATOM   2716  C  CD2 . LEU C  3 24  ? 76.616  -79.542  -155.528 1.00 68.99  ? 23   LEU C CD2 1 
ATOM   2717  N  N   . ASP C  3 25  ? 77.283  -77.983  -159.841 1.00 70.76  ? 24   ASP C N   1 
ATOM   2718  C  CA  . ASP C  3 25  ? 78.609  -77.678  -160.358 1.00 72.73  ? 24   ASP C CA  1 
ATOM   2719  C  C   . ASP C  3 25  ? 79.665  -78.262  -159.429 1.00 74.06  ? 24   ASP C C   1 
ATOM   2720  O  O   . ASP C  3 25  ? 79.350  -78.756  -158.344 1.00 74.28  ? 24   ASP C O   1 
ATOM   2721  C  CB  . ASP C  3 25  ? 78.809  -76.165  -160.450 1.00 73.51  ? 24   ASP C CB  1 
ATOM   2722  C  CG  . ASP C  3 25  ? 77.638  -75.458  -161.104 1.00 74.44  ? 24   ASP C CG  1 
ATOM   2723  O  OD1 . ASP C  3 25  ? 76.507  -75.560  -160.572 1.00 74.42  ? 24   ASP C OD1 1 
ATOM   2724  O  OD2 . ASP C  3 25  ? 77.850  -74.797  -162.144 1.00 74.89  ? 24   ASP C OD2 1 
ATOM   2725  N  N   . LYS C  3 26  ? 80.919  -78.195  -159.860 1.00 75.11  ? 25   LYS C N   1 
ATOM   2726  C  CA  . LYS C  3 26  ? 82.034  -78.705  -159.072 1.00 75.64  ? 25   LYS C CA  1 
ATOM   2727  C  C   . LYS C  3 26  ? 82.254  -77.846  -157.827 1.00 76.08  ? 25   LYS C C   1 
ATOM   2728  O  O   . LYS C  3 26  ? 82.616  -76.674  -157.928 1.00 77.21  ? 25   LYS C O   1 
ATOM   2729  C  CB  . LYS C  3 26  ? 83.311  -78.717  -159.923 1.00 74.85  ? 25   LYS C CB  1 
ATOM   2730  C  CG  . LYS C  3 26  ? 84.574  -79.063  -159.153 1.00 74.34  ? 25   LYS C CG  1 
ATOM   2731  C  CD  . LYS C  3 26  ? 85.811  -79.025  -160.036 1.00 73.85  ? 25   LYS C CD  1 
ATOM   2732  C  CE  . LYS C  3 26  ? 85.792  -80.119  -161.093 1.00 74.52  ? 25   LYS C CE  1 
ATOM   2733  N  NZ  . LYS C  3 26  ? 87.054  -80.156  -161.890 1.00 74.71  ? 25   LYS C NZ  1 
ATOM   2734  N  N   . ILE C  3 27  ? 82.026  -78.425  -156.653 1.00 76.08  ? 26   ILE C N   1 
ATOM   2735  C  CA  . ILE C  3 27  ? 82.233  -77.698  -155.409 1.00 75.80  ? 26   ILE C CA  1 
ATOM   2736  C  C   . ILE C  3 27  ? 83.695  -77.824  -155.014 1.00 76.32  ? 26   ILE C C   1 
ATOM   2737  O  O   . ILE C  3 27  ? 84.238  -78.928  -154.945 1.00 75.65  ? 26   ILE C O   1 
ATOM   2738  C  CB  . ILE C  3 27  ? 81.373  -78.263  -154.276 1.00 75.34  ? 26   ILE C CB  1 
ATOM   2739  C  CG1 . ILE C  3 27  ? 81.545  -79.776  -154.203 1.00 74.83  ? 26   ILE C CG1 1 
ATOM   2740  C  CG2 . ILE C  3 27  ? 79.923  -77.907  -154.503 1.00 77.18  ? 26   ILE C CG2 1 
ATOM   2741  C  CD1 . ILE C  3 27  ? 80.710  -80.418  -153.136 1.00 76.13  ? 26   ILE C CD1 1 
ATOM   2742  N  N   . TYR C  3 28  ? 84.333  -76.686  -154.771 1.00 76.97  ? 27   TYR C N   1 
ATOM   2743  C  CA  . TYR C  3 28  ? 85.733  -76.669  -154.377 1.00 77.37  ? 27   TYR C CA  1 
ATOM   2744  C  C   . TYR C  3 28  ? 85.814  -76.699  -152.864 1.00 77.16  ? 27   TYR C C   1 
ATOM   2745  O  O   . TYR C  3 28  ? 85.730  -75.662  -152.204 1.00 76.79  ? 27   TYR C O   1 
ATOM   2746  C  CB  . TYR C  3 28  ? 86.414  -75.416  -154.921 1.00 78.40  ? 27   TYR C CB  1 
ATOM   2747  C  CG  . TYR C  3 28  ? 86.494  -75.404  -156.426 1.00 80.71  ? 27   TYR C CG  1 
ATOM   2748  C  CD1 . TYR C  3 28  ? 87.559  -76.013  -157.089 1.00 81.91  ? 27   TYR C CD1 1 
ATOM   2749  C  CD2 . TYR C  3 28  ? 85.478  -74.832  -157.193 1.00 81.57  ? 27   TYR C CD2 1 
ATOM   2750  C  CE1 . TYR C  3 28  ? 87.612  -76.054  -158.485 1.00 83.01  ? 27   TYR C CE1 1 
ATOM   2751  C  CE2 . TYR C  3 28  ? 85.518  -74.869  -158.588 1.00 82.90  ? 27   TYR C CE2 1 
ATOM   2752  C  CZ  . TYR C  3 28  ? 86.588  -75.482  -159.228 1.00 83.52  ? 27   TYR C CZ  1 
ATOM   2753  O  OH  . TYR C  3 28  ? 86.633  -75.529  -160.606 1.00 84.12  ? 27   TYR C OH  1 
ATOM   2754  N  N   . LEU C  3 29  ? 85.955  -77.903  -152.321 1.00 76.15  ? 28   LEU C N   1 
ATOM   2755  C  CA  . LEU C  3 29  ? 86.049  -78.079  -150.885 1.00 75.27  ? 28   LEU C CA  1 
ATOM   2756  C  C   . LEU C  3 29  ? 87.487  -77.943  -150.419 1.00 76.33  ? 28   LEU C C   1 
ATOM   2757  O  O   . LEU C  3 29  ? 88.428  -78.222  -151.166 1.00 76.89  ? 28   LEU C O   1 
ATOM   2758  C  CB  . LEU C  3 29  ? 85.504  -79.446  -150.470 1.00 73.90  ? 28   LEU C CB  1 
ATOM   2759  C  CG  . LEU C  3 29  ? 83.990  -79.643  -150.526 1.00 73.11  ? 28   LEU C CG  1 
ATOM   2760  C  CD1 . LEU C  3 29  ? 83.635  -81.010  -149.962 1.00 71.84  ? 28   LEU C CD1 1 
ATOM   2761  C  CD2 . LEU C  3 29  ? 83.298  -78.552  -149.726 1.00 72.84  ? 28   LEU C CD2 1 
ATOM   2762  N  N   . ILE C  3 30  ? 87.639  -77.504  -149.175 1.00 76.41  ? 29   ILE C N   1 
ATOM   2763  C  CA  . ILE C  3 30  ? 88.942  -77.319  -148.555 1.00 77.02  ? 29   ILE C CA  1 
ATOM   2764  C  C   . ILE C  3 30  ? 89.828  -78.557  -148.682 1.00 75.82  ? 29   ILE C C   1 
ATOM   2765  O  O   . ILE C  3 30  ? 91.020  -78.446  -148.961 1.00 76.14  ? 29   ILE C O   1 
ATOM   2766  C  CB  . ILE C  3 30  ? 88.777  -76.987  -147.061 1.00 76.98  ? 29   ILE C CB  1 
ATOM   2767  C  CG1 . ILE C  3 30  ? 88.050  -75.647  -146.901 1.00 77.45  ? 29   ILE C CG1 1 
ATOM   2768  C  CG2 . ILE C  3 30  ? 90.132  -76.963  -146.385 1.00 80.77  ? 29   ILE C CG2 1 
ATOM   2769  C  CD1 . ILE C  3 30  ? 87.757  -75.266  -145.451 1.00 75.50  ? 29   ILE C CD1 1 
ATOM   2770  N  N   . GLY C  3 31  ? 89.239  -79.730  -148.475 1.00 74.89  ? 30   GLY C N   1 
ATOM   2771  C  CA  . GLY C  3 31  ? 89.998  -80.962  -148.561 1.00 75.24  ? 30   GLY C CA  1 
ATOM   2772  C  C   . GLY C  3 31  ? 89.880  -81.696  -149.883 1.00 75.26  ? 30   GLY C C   1 
ATOM   2773  O  O   . GLY C  3 31  ? 89.771  -82.923  -149.909 1.00 75.10  ? 30   GLY C O   1 
ATOM   2774  N  N   . GLY C  3 32  ? 89.905  -80.951  -150.983 1.00 75.48  ? 31   GLY C N   1 
ATOM   2775  C  CA  . GLY C  3 32  ? 89.805  -81.570  -152.296 1.00 75.98  ? 31   GLY C CA  1 
ATOM   2776  C  C   . GLY C  3 32  ? 88.595  -81.128  -153.101 1.00 75.56  ? 31   GLY C C   1 
ATOM   2777  O  O   . GLY C  3 32  ? 87.853  -80.234  -152.693 1.00 75.83  ? 31   GLY C O   1 
ATOM   2778  N  N   . ASP C  3 33  ? 88.394  -81.752  -154.255 1.00 75.00  ? 32   ASP C N   1 
ATOM   2779  C  CA  . ASP C  3 33  ? 87.263  -81.405  -155.104 1.00 74.09  ? 32   ASP C CA  1 
ATOM   2780  C  C   . ASP C  3 33  ? 86.269  -82.535  -155.230 1.00 72.56  ? 32   ASP C C   1 
ATOM   2781  O  O   . ASP C  3 33  ? 86.596  -83.700  -155.012 1.00 73.08  ? 32   ASP C O   1 
ATOM   2782  C  CB  . ASP C  3 33  ? 87.730  -81.019  -156.502 1.00 76.13  ? 32   ASP C CB  1 
ATOM   2783  C  CG  . ASP C  3 33  ? 88.557  -79.760  -156.507 1.00 78.91  ? 32   ASP C CG  1 
ATOM   2784  O  OD1 . ASP C  3 33  ? 88.142  -78.782  -155.840 1.00 80.44  ? 32   ASP C OD1 1 
ATOM   2785  O  OD2 . ASP C  3 33  ? 89.611  -79.748  -157.184 1.00 79.50  ? 32   ASP C OD2 1 
ATOM   2786  N  N   . LEU C  3 34  ? 85.045  -82.177  -155.588 1.00 69.75  ? 33   LEU C N   1 
ATOM   2787  C  CA  . LEU C  3 34  ? 83.997  -83.157  -155.765 1.00 67.44  ? 33   LEU C CA  1 
ATOM   2788  C  C   . LEU C  3 34  ? 83.367  -82.949  -157.126 1.00 67.29  ? 33   LEU C C   1 
ATOM   2789  O  O   . LEU C  3 34  ? 82.476  -82.116  -157.302 1.00 65.83  ? 33   LEU C O   1 
ATOM   2790  C  CB  . LEU C  3 34  ? 82.971  -83.034  -154.646 1.00 66.46  ? 33   LEU C CB  1 
ATOM   2791  C  CG  . LEU C  3 34  ? 83.517  -83.581  -153.324 1.00 65.24  ? 33   LEU C CG  1 
ATOM   2792  C  CD1 . LEU C  3 34  ? 82.471  -83.460  -152.236 1.00 65.00  ? 33   LEU C CD1 1 
ATOM   2793  C  CD2 . LEU C  3 34  ? 83.926  -85.034  -153.508 1.00 64.79  ? 33   LEU C CD2 1 
ATOM   2794  N  N   . GLY C  3 35  ? 83.875  -83.720  -158.084 1.00 67.94  ? 34   GLY C N   1 
ATOM   2795  C  CA  . GLY C  3 35  ? 83.426  -83.658  -159.463 1.00 68.87  ? 34   GLY C CA  1 
ATOM   2796  C  C   . GLY C  3 35  ? 81.982  -83.252  -159.675 1.00 69.16  ? 34   GLY C C   1 
ATOM   2797  O  O   . GLY C  3 35  ? 81.109  -83.584  -158.864 1.00 71.06  ? 34   GLY C O   1 
ATOM   2798  N  N   . PRO C  3 36  ? 81.698  -82.535  -160.775 1.00 67.22  ? 35   PRO C N   1 
ATOM   2799  C  CA  . PRO C  3 36  ? 80.338  -82.089  -161.080 1.00 65.19  ? 35   PRO C CA  1 
ATOM   2800  C  C   . PRO C  3 36  ? 79.312  -83.201  -160.913 1.00 63.05  ? 35   PRO C C   1 
ATOM   2801  O  O   . PRO C  3 36  ? 79.568  -84.356  -161.236 1.00 61.56  ? 35   PRO C O   1 
ATOM   2802  C  CB  . PRO C  3 36  ? 80.453  -81.586  -162.519 1.00 65.97  ? 35   PRO C CB  1 
ATOM   2803  C  CG  . PRO C  3 36  ? 81.634  -82.339  -163.063 1.00 66.27  ? 35   PRO C CG  1 
ATOM   2804  C  CD  . PRO C  3 36  ? 82.592  -82.297  -161.918 1.00 66.55  ? 35   PRO C CD  1 
ATOM   2805  N  N   . PHE C  3 37  ? 78.150  -82.837  -160.390 1.00 62.14  ? 36   PHE C N   1 
ATOM   2806  C  CA  . PHE C  3 37  ? 77.080  -83.791  -160.153 1.00 61.61  ? 36   PHE C CA  1 
ATOM   2807  C  C   . PHE C  3 37  ? 76.057  -83.771  -161.268 1.00 60.74  ? 36   PHE C C   1 
ATOM   2808  O  O   . PHE C  3 37  ? 75.528  -82.723  -161.617 1.00 61.53  ? 36   PHE C O   1 
ATOM   2809  C  CB  . PHE C  3 37  ? 76.413  -83.475  -158.817 1.00 61.72  ? 36   PHE C CB  1 
ATOM   2810  C  CG  . PHE C  3 37  ? 77.331  -83.643  -157.647 1.00 62.16  ? 36   PHE C CG  1 
ATOM   2811  C  CD1 . PHE C  3 37  ? 77.340  -84.829  -156.918 1.00 60.78  ? 36   PHE C CD1 1 
ATOM   2812  C  CD2 . PHE C  3 37  ? 78.233  -82.638  -157.307 1.00 60.27  ? 36   PHE C CD2 1 
ATOM   2813  C  CE1 . PHE C  3 37  ? 78.229  -85.009  -155.875 1.00 58.92  ? 36   PHE C CE1 1 
ATOM   2814  C  CE2 . PHE C  3 37  ? 79.127  -82.812  -156.265 1.00 58.27  ? 36   PHE C CE2 1 
ATOM   2815  C  CZ  . PHE C  3 37  ? 79.126  -83.996  -155.549 1.00 58.08  ? 36   PHE C CZ  1 
ATOM   2816  N  N   . ASN C  3 38  ? 75.786  -84.944  -161.823 1.00 59.65  ? 37   ASN C N   1 
ATOM   2817  C  CA  . ASN C  3 38  ? 74.834  -85.085  -162.908 1.00 57.50  ? 37   ASN C CA  1 
ATOM   2818  C  C   . ASN C  3 38  ? 73.971  -86.288  -162.583 1.00 56.49  ? 37   ASN C C   1 
ATOM   2819  O  O   . ASN C  3 38  ? 74.482  -87.350  -162.255 1.00 55.48  ? 37   ASN C O   1 
ATOM   2820  C  CB  . ASN C  3 38  ? 75.591  -85.309  -164.209 1.00 57.71  ? 37   ASN C CB  1 
ATOM   2821  C  CG  . ASN C  3 38  ? 76.674  -84.263  -164.434 1.00 60.25  ? 37   ASN C CG  1 
ATOM   2822  O  OD1 . ASN C  3 38  ? 77.736  -84.554  -164.995 1.00 61.81  ? 37   ASN C OD1 1 
ATOM   2823  N  ND2 . ASN C  3 38  ? 76.406  -83.035  -164.005 1.00 61.22  ? 37   ASN C ND2 1 
ATOM   2824  N  N   . PRO C  3 39  ? 72.644  -86.136  -162.656 1.00 56.49  ? 38   PRO C N   1 
ATOM   2825  C  CA  . PRO C  3 39  ? 71.770  -87.271  -162.349 1.00 55.90  ? 38   PRO C CA  1 
ATOM   2826  C  C   . PRO C  3 39  ? 72.120  -88.520  -163.147 1.00 55.66  ? 38   PRO C C   1 
ATOM   2827  O  O   . PRO C  3 39  ? 72.704  -88.435  -164.224 1.00 55.81  ? 38   PRO C O   1 
ATOM   2828  C  CB  . PRO C  3 39  ? 70.370  -86.730  -162.653 1.00 55.28  ? 38   PRO C CB  1 
ATOM   2829  C  CG  . PRO C  3 39  ? 70.621  -85.628  -163.633 1.00 55.97  ? 38   PRO C CG  1 
ATOM   2830  C  CD  . PRO C  3 39  ? 71.863  -84.972  -163.105 1.00 56.06  ? 38   PRO C CD  1 
ATOM   2831  N  N   . GLY C  3 40  ? 71.775  -89.680  -162.599 1.00 55.59  ? 39   GLY C N   1 
ATOM   2832  C  CA  . GLY C  3 40  ? 72.074  -90.932  -163.263 1.00 55.27  ? 39   GLY C CA  1 
ATOM   2833  C  C   . GLY C  3 40  ? 73.506  -91.048  -163.760 1.00 55.93  ? 39   GLY C C   1 
ATOM   2834  O  O   . GLY C  3 40  ? 73.775  -91.813  -164.683 1.00 57.05  ? 39   GLY C O   1 
ATOM   2835  N  N   . LEU C  3 41  ? 74.431  -90.305  -163.156 1.00 55.94  ? 40   LEU C N   1 
ATOM   2836  C  CA  . LEU C  3 41  ? 75.831  -90.355  -163.576 1.00 56.37  ? 40   LEU C CA  1 
ATOM   2837  C  C   . LEU C  3 41  ? 76.773  -90.476  -162.372 1.00 57.69  ? 40   LEU C C   1 
ATOM   2838  O  O   . LEU C  3 41  ? 76.962  -89.516  -161.627 1.00 59.44  ? 40   LEU C O   1 
ATOM   2839  C  CB  . LEU C  3 41  ? 76.175  -89.100  -164.371 1.00 54.45  ? 40   LEU C CB  1 
ATOM   2840  C  CG  . LEU C  3 41  ? 77.306  -89.222  -165.388 1.00 55.40  ? 40   LEU C CG  1 
ATOM   2841  C  CD1 . LEU C  3 41  ? 77.679  -87.830  -165.875 1.00 55.06  ? 40   LEU C CD1 1 
ATOM   2842  C  CD2 . LEU C  3 41  ? 78.511  -89.910  -164.770 1.00 55.85  ? 40   LEU C CD2 1 
ATOM   2843  N  N   . PRO C  3 42  ? 77.390  -91.656  -162.184 1.00 57.80  ? 41   PRO C N   1 
ATOM   2844  C  CA  . PRO C  3 42  ? 78.320  -91.991  -161.103 1.00 57.39  ? 41   PRO C CA  1 
ATOM   2845  C  C   . PRO C  3 42  ? 79.391  -90.966  -160.763 1.00 57.05  ? 41   PRO C C   1 
ATOM   2846  O  O   . PRO C  3 42  ? 80.074  -90.449  -161.647 1.00 56.30  ? 41   PRO C O   1 
ATOM   2847  C  CB  . PRO C  3 42  ? 78.917  -93.307  -161.574 1.00 58.67  ? 41   PRO C CB  1 
ATOM   2848  C  CG  . PRO C  3 42  ? 77.743  -93.959  -162.209 1.00 59.21  ? 41   PRO C CG  1 
ATOM   2849  C  CD  . PRO C  3 42  ? 77.202  -92.825  -163.061 1.00 58.95  ? 41   PRO C CD  1 
ATOM   2850  N  N   . VAL C  3 43  ? 79.531  -90.703  -159.461 1.00 56.83  ? 42   VAL C N   1 
ATOM   2851  C  CA  . VAL C  3 43  ? 80.507  -89.756  -158.914 1.00 56.08  ? 42   VAL C CA  1 
ATOM   2852  C  C   . VAL C  3 43  ? 81.074  -90.332  -157.607 1.00 55.47  ? 42   VAL C C   1 
ATOM   2853  O  O   . VAL C  3 43  ? 80.337  -90.936  -156.823 1.00 55.22  ? 42   VAL C O   1 
ATOM   2854  C  CB  . VAL C  3 43  ? 79.841  -88.391  -158.584 1.00 56.45  ? 42   VAL C CB  1 
ATOM   2855  C  CG1 . VAL C  3 43  ? 80.898  -87.333  -158.339 1.00 56.73  ? 42   VAL C CG1 1 
ATOM   2856  C  CG2 . VAL C  3 43  ? 78.919  -87.966  -159.714 1.00 59.31  ? 42   VAL C CG2 1 
ATOM   2857  N  N   . GLU C  3 44  ? 82.378  -90.164  -157.386 1.00 54.97  ? 43   GLU C N   1 
ATOM   2858  C  CA  . GLU C  3 44  ? 83.022  -90.632  -156.156 1.00 54.87  ? 43   GLU C CA  1 
ATOM   2859  C  C   . GLU C  3 44  ? 83.105  -89.440  -155.215 1.00 53.74  ? 43   GLU C C   1 
ATOM   2860  O  O   . GLU C  3 44  ? 83.699  -88.415  -155.541 1.00 52.23  ? 43   GLU C O   1 
ATOM   2861  C  CB  . GLU C  3 44  ? 84.433  -91.153  -156.422 1.00 56.57  ? 43   GLU C CB  1 
ATOM   2862  C  CG  . GLU C  3 44  ? 84.495  -92.461  -157.179 1.00 59.94  ? 43   GLU C CG  1 
ATOM   2863  C  CD  . GLU C  3 44  ? 85.929  -92.900  -157.456 1.00 62.63  ? 43   GLU C CD  1 
ATOM   2864  O  OE1 . GLU C  3 44  ? 86.128  -93.886  -158.205 1.00 62.92  ? 43   GLU C OE1 1 
ATOM   2865  O  OE2 . GLU C  3 44  ? 86.860  -92.259  -156.918 1.00 64.12  ? 43   GLU C OE2 1 
ATOM   2866  N  N   . VAL C  3 45  ? 82.520  -89.601  -154.038 1.00 53.91  ? 44   VAL C N   1 
ATOM   2867  C  CA  . VAL C  3 45  ? 82.459  -88.552  -153.033 1.00 54.49  ? 44   VAL C CA  1 
ATOM   2868  C  C   . VAL C  3 45  ? 82.719  -89.208  -151.661 1.00 54.86  ? 44   VAL C C   1 
ATOM   2869  O  O   . VAL C  3 45  ? 82.599  -90.428  -151.527 1.00 57.03  ? 44   VAL C O   1 
ATOM   2870  C  CB  . VAL C  3 45  ? 81.040  -87.928  -153.088 1.00 54.96  ? 44   VAL C CB  1 
ATOM   2871  C  CG1 . VAL C  3 45  ? 80.043  -88.863  -152.430 1.00 54.00  ? 44   VAL C CG1 1 
ATOM   2872  C  CG2 . VAL C  3 45  ? 81.020  -86.563  -152.457 1.00 58.29  ? 44   VAL C CG2 1 
ATOM   2873  N  N   . PRO C  3 46  ? 83.087  -88.420  -150.629 1.00 53.72  ? 45   PRO C N   1 
ATOM   2874  C  CA  . PRO C  3 46  ? 83.348  -88.988  -149.290 1.00 52.24  ? 45   PRO C CA  1 
ATOM   2875  C  C   . PRO C  3 46  ? 82.114  -89.627  -148.617 1.00 51.29  ? 45   PRO C C   1 
ATOM   2876  O  O   . PRO C  3 46  ? 81.002  -89.124  -148.756 1.00 51.61  ? 45   PRO C O   1 
ATOM   2877  C  CB  . PRO C  3 46  ? 83.860  -87.785  -148.504 1.00 51.51  ? 45   PRO C CB  1 
ATOM   2878  C  CG  . PRO C  3 46  ? 84.503  -86.938  -149.551 1.00 51.95  ? 45   PRO C CG  1 
ATOM   2879  C  CD  . PRO C  3 46  ? 83.524  -87.015  -150.691 1.00 52.40  ? 45   PRO C CD  1 
ATOM   2880  N  N   . LEU C  3 47  ? 82.314  -90.713  -147.870 1.00 50.29  ? 46   LEU C N   1 
ATOM   2881  C  CA  . LEU C  3 47  ? 81.207  -91.406  -147.198 1.00 48.74  ? 46   LEU C CA  1 
ATOM   2882  C  C   . LEU C  3 47  ? 80.297  -90.483  -146.396 1.00 48.94  ? 46   LEU C C   1 
ATOM   2883  O  O   . LEU C  3 47  ? 79.112  -90.773  -146.240 1.00 49.84  ? 46   LEU C O   1 
ATOM   2884  C  CB  . LEU C  3 47  ? 81.725  -92.496  -146.251 1.00 48.58  ? 46   LEU C CB  1 
ATOM   2885  C  CG  . LEU C  3 47  ? 80.932  -93.819  -146.175 1.00 50.22  ? 46   LEU C CG  1 
ATOM   2886  C  CD1 . LEU C  3 47  ? 81.366  -94.597  -144.945 1.00 50.32  ? 46   LEU C CD1 1 
ATOM   2887  C  CD2 . LEU C  3 47  ? 79.441  -93.576  -146.123 1.00 48.05  ? 46   LEU C CD2 1 
ATOM   2888  N  N   . TRP C  3 48  ? 80.835  -89.389  -145.859 1.00 48.34  ? 47   TRP C N   1 
ATOM   2889  C  CA  . TRP C  3 48  ? 79.990  -88.492  -145.086 1.00 46.34  ? 47   TRP C CA  1 
ATOM   2890  C  C   . TRP C  3 48  ? 79.043  -87.758  -146.012 1.00 47.14  ? 47   TRP C C   1 
ATOM   2891  O  O   . TRP C  3 48  ? 77.846  -87.655  -145.728 1.00 48.69  ? 47   TRP C O   1 
ATOM   2892  C  CB  . TRP C  3 48  ? 80.804  -87.498  -144.248 1.00 42.66  ? 47   TRP C CB  1 
ATOM   2893  C  CG  . TRP C  3 48  ? 81.716  -86.576  -144.989 1.00 41.62  ? 47   TRP C CG  1 
ATOM   2894  C  CD1 . TRP C  3 48  ? 83.044  -86.771  -145.257 1.00 41.49  ? 47   TRP C CD1 1 
ATOM   2895  C  CD2 . TRP C  3 48  ? 81.395  -85.275  -145.498 1.00 41.15  ? 47   TRP C CD2 1 
ATOM   2896  N  NE1 . TRP C  3 48  ? 83.572  -85.669  -145.893 1.00 40.49  ? 47   TRP C NE1 1 
ATOM   2897  C  CE2 . TRP C  3 48  ? 82.581  -84.737  -146.054 1.00 41.41  ? 47   TRP C CE2 1 
ATOM   2898  C  CE3 . TRP C  3 48  ? 80.225  -84.511  -145.536 1.00 39.54  ? 47   TRP C CE3 1 
ATOM   2899  C  CZ2 . TRP C  3 48  ? 82.624  -83.467  -146.643 1.00 40.51  ? 47   TRP C CZ2 1 
ATOM   2900  C  CZ3 . TRP C  3 48  ? 80.274  -83.247  -146.121 1.00 39.26  ? 47   TRP C CZ3 1 
ATOM   2901  C  CH2 . TRP C  3 48  ? 81.465  -82.741  -146.666 1.00 38.54  ? 47   TRP C CH2 1 
ATOM   2902  N  N   . LEU C  3 49  ? 79.555  -87.263  -147.130 1.00 45.91  ? 48   LEU C N   1 
ATOM   2903  C  CA  . LEU C  3 49  ? 78.672  -86.571  -148.052 1.00 46.43  ? 48   LEU C CA  1 
ATOM   2904  C  C   . LEU C  3 49  ? 77.651  -87.583  -148.577 1.00 47.05  ? 48   LEU C C   1 
ATOM   2905  O  O   . LEU C  3 49  ? 76.450  -87.311  -148.600 1.00 47.28  ? 48   LEU C O   1 
ATOM   2906  C  CB  . LEU C  3 49  ? 79.455  -85.957  -149.213 1.00 44.49  ? 48   LEU C CB  1 
ATOM   2907  C  CG  . LEU C  3 49  ? 78.940  -84.557  -149.564 1.00 40.84  ? 48   LEU C CG  1 
ATOM   2908  C  CD1 . LEU C  3 49  ? 79.623  -84.029  -150.810 1.00 40.02  ? 48   LEU C CD1 1 
ATOM   2909  C  CD2 . LEU C  3 49  ? 77.450  -84.618  -149.755 1.00 40.14  ? 48   LEU C CD2 1 
ATOM   2910  N  N   . ALA C  3 50  ? 78.137  -88.756  -148.979 1.00 46.77  ? 49   ALA C N   1 
ATOM   2911  C  CA  . ALA C  3 50  ? 77.272  -89.815  -149.488 1.00 46.11  ? 49   ALA C CA  1 
ATOM   2912  C  C   . ALA C  3 50  ? 76.103  -90.018  -148.538 1.00 47.22  ? 49   ALA C C   1 
ATOM   2913  O  O   . ALA C  3 50  ? 74.949  -89.833  -148.920 1.00 47.67  ? 49   ALA C O   1 
ATOM   2914  C  CB  . ALA C  3 50  ? 78.048  -91.114  -149.631 1.00 42.13  ? 49   ALA C CB  1 
ATOM   2915  N  N   . ILE C  3 51  ? 76.405  -90.388  -147.298 1.00 48.65  ? 50   ILE C N   1 
ATOM   2916  C  CA  . ILE C  3 51  ? 75.365  -90.628  -146.313 1.00 51.06  ? 50   ILE C CA  1 
ATOM   2917  C  C   . ILE C  3 51  ? 74.456  -89.426  -146.124 1.00 52.69  ? 50   ILE C C   1 
ATOM   2918  O  O   . ILE C  3 51  ? 73.269  -89.589  -145.839 1.00 51.97  ? 50   ILE C O   1 
ATOM   2919  C  CB  . ILE C  3 51  ? 75.951  -91.008  -144.947 1.00 51.67  ? 50   ILE C CB  1 
ATOM   2920  C  CG1 . ILE C  3 51  ? 76.654  -92.360  -145.040 1.00 51.71  ? 50   ILE C CG1 1 
ATOM   2921  C  CG2 . ILE C  3 51  ? 74.837  -91.071  -143.911 1.00 52.06  ? 50   ILE C CG2 1 
ATOM   2922  C  CD1 . ILE C  3 51  ? 77.342  -92.774  -143.763 1.00 54.12  ? 50   ILE C CD1 1 
ATOM   2923  N  N   . ASN C  3 52  ? 75.005  -88.222  -146.274 1.00 53.99  ? 51   ASN C N   1 
ATOM   2924  C  CA  . ASN C  3 52  ? 74.195  -87.017  -146.124 1.00 54.85  ? 51   ASN C CA  1 
ATOM   2925  C  C   . ASN C  3 52  ? 73.192  -86.969  -147.271 1.00 54.11  ? 51   ASN C C   1 
ATOM   2926  O  O   . ASN C  3 52  ? 71.985  -86.909  -147.053 1.00 53.95  ? 51   ASN C O   1 
ATOM   2927  C  CB  . ASN C  3 52  ? 75.073  -85.764  -146.151 1.00 57.33  ? 51   ASN C CB  1 
ATOM   2928  C  CG  . ASN C  3 52  ? 74.263  -84.475  -146.011 1.00 60.01  ? 51   ASN C CG  1 
ATOM   2929  O  OD1 . ASN C  3 52  ? 73.645  -84.221  -144.976 1.00 61.08  ? 51   ASN C OD1 1 
ATOM   2930  N  ND2 . ASN C  3 52  ? 74.269  -83.654  -147.058 1.00 60.93  ? 51   ASN C ND2 1 
ATOM   2931  N  N   . LEU C  3 53  ? 73.704  -87.005  -148.495 1.00 53.79  ? 52   LEU C N   1 
ATOM   2932  C  CA  . LEU C  3 53  ? 72.859  -86.978  -149.680 1.00 53.21  ? 52   LEU C CA  1 
ATOM   2933  C  C   . LEU C  3 53  ? 71.892  -88.154  -149.679 1.00 55.07  ? 52   LEU C C   1 
ATOM   2934  O  O   . LEU C  3 53  ? 70.726  -87.991  -150.007 1.00 54.96  ? 52   LEU C O   1 
ATOM   2935  C  CB  . LEU C  3 53  ? 73.727  -87.009  -150.937 1.00 49.15  ? 52   LEU C CB  1 
ATOM   2936  C  CG  . LEU C  3 53  ? 74.193  -85.677  -151.534 1.00 46.41  ? 52   LEU C CG  1 
ATOM   2937  C  CD1 . LEU C  3 53  ? 74.197  -84.574  -150.501 1.00 45.36  ? 52   LEU C CD1 1 
ATOM   2938  C  CD2 . LEU C  3 53  ? 75.576  -85.867  -152.139 1.00 44.55  ? 52   LEU C CD2 1 
ATOM   2939  N  N   . LYS C  3 54  ? 72.371  -89.335  -149.296 1.00 57.82  ? 53   LYS C N   1 
ATOM   2940  C  CA  . LYS C  3 54  ? 71.523  -90.524  -149.259 1.00 60.72  ? 53   LYS C CA  1 
ATOM   2941  C  C   . LYS C  3 54  ? 70.267  -90.323  -148.415 1.00 63.66  ? 53   LYS C C   1 
ATOM   2942  O  O   . LYS C  3 54  ? 69.150  -90.558  -148.887 1.00 64.30  ? 53   LYS C O   1 
ATOM   2943  C  CB  . LYS C  3 54  ? 72.303  -91.722  -148.724 1.00 60.16  ? 53   LYS C CB  1 
ATOM   2944  C  CG  . LYS C  3 54  ? 71.453  -92.968  -148.534 1.00 60.28  ? 53   LYS C CG  1 
ATOM   2945  C  CD  . LYS C  3 54  ? 70.848  -93.445  -149.847 1.00 60.76  ? 53   LYS C CD  1 
ATOM   2946  C  CE  . LYS C  3 54  ? 69.996  -94.684  -149.633 1.00 60.84  ? 53   LYS C CE  1 
ATOM   2947  N  NZ  . LYS C  3 54  ? 69.593  -95.324  -150.910 1.00 60.60  ? 53   LYS C NZ  1 
ATOM   2948  N  N   . GLN C  3 55  ? 70.439  -89.899  -147.166 1.00 67.12  ? 54   GLN C N   1 
ATOM   2949  C  CA  . GLN C  3 55  ? 69.282  -89.671  -146.307 1.00 69.61  ? 54   GLN C CA  1 
ATOM   2950  C  C   . GLN C  3 55  ? 68.507  -88.417  -146.732 1.00 69.72  ? 54   GLN C C   1 
ATOM   2951  O  O   . GLN C  3 55  ? 67.298  -88.330  -146.512 1.00 70.49  ? 54   GLN C O   1 
ATOM   2952  C  CB  . GLN C  3 55  ? 69.696  -89.612  -144.823 1.00 70.92  ? 54   GLN C CB  1 
ATOM   2953  C  CG  . GLN C  3 55  ? 70.869  -88.709  -144.468 1.00 74.03  ? 54   GLN C CG  1 
ATOM   2954  C  CD  . GLN C  3 55  ? 71.445  -89.031  -143.082 1.00 76.14  ? 54   GLN C CD  1 
ATOM   2955  O  OE1 . GLN C  3 55  ? 71.924  -90.143  -142.841 1.00 76.70  ? 54   GLN C OE1 1 
ATOM   2956  N  NE2 . GLN C  3 55  ? 71.393  -88.061  -142.170 1.00 76.66  ? 54   GLN C NE2 1 
ATOM   2957  N  N   . ARG C  3 56  ? 69.194  -87.459  -147.354 1.00 68.95  ? 55   ARG C N   1 
ATOM   2958  C  CA  . ARG C  3 56  ? 68.534  -86.251  -147.853 1.00 68.14  ? 55   ARG C CA  1 
ATOM   2959  C  C   . ARG C  3 56  ? 67.736  -86.669  -149.089 1.00 67.94  ? 55   ARG C C   1 
ATOM   2960  O  O   . ARG C  3 56  ? 67.279  -85.832  -149.878 1.00 66.80  ? 55   ARG C O   1 
ATOM   2961  C  CB  . ARG C  3 56  ? 69.562  -85.194  -148.245 1.00 68.31  ? 55   ARG C CB  1 
ATOM   2962  C  CG  . ARG C  3 56  ? 70.000  -84.277  -147.126 1.00 68.99  ? 55   ARG C CG  1 
ATOM   2963  C  CD  . ARG C  3 56  ? 71.443  -83.865  -147.346 1.00 69.86  ? 55   ARG C CD  1 
ATOM   2964  N  NE  . ARG C  3 56  ? 71.754  -82.547  -146.808 1.00 69.53  ? 55   ARG C NE  1 
ATOM   2965  C  CZ  . ARG C  3 56  ? 71.249  -81.418  -147.289 1.00 69.99  ? 55   ARG C CZ  1 
ATOM   2966  N  NH1 . ARG C  3 56  ? 70.406  -81.451  -148.313 1.00 71.31  ? 55   ARG C NH1 1 
ATOM   2967  N  NH2 . ARG C  3 56  ? 71.599  -80.257  -146.760 1.00 69.86  ? 55   ARG C NH2 1 
ATOM   2968  N  N   . GLN C  3 57  ? 67.618  -87.986  -149.250 1.00 67.25  ? 56   GLN C N   1 
ATOM   2969  C  CA  . GLN C  3 57  ? 66.882  -88.616  -150.337 1.00 66.65  ? 56   GLN C CA  1 
ATOM   2970  C  C   . GLN C  3 57  ? 67.322  -88.234  -151.760 1.00 65.76  ? 56   GLN C C   1 
ATOM   2971  O  O   . GLN C  3 57  ? 66.659  -88.601  -152.731 1.00 65.40  ? 56   GLN C O   1 
ATOM   2972  C  CB  . GLN C  3 57  ? 65.386  -88.333  -150.140 1.00 67.18  ? 56   GLN C CB  1 
ATOM   2973  C  CG  . GLN C  3 57  ? 64.448  -89.254  -150.897 1.00 69.62  ? 56   GLN C CG  1 
ATOM   2974  C  CD  . GLN C  3 57  ? 63.270  -89.702  -150.048 1.00 71.17  ? 56   GLN C CD  1 
ATOM   2975  O  OE1 . GLN C  3 57  ? 62.637  -88.892  -149.369 1.00 71.53  ? 56   GLN C OE1 1 
ATOM   2976  N  NE2 . GLN C  3 57  ? 62.966  -90.999  -150.088 1.00 70.93  ? 56   GLN C NE2 1 
ATOM   2977  N  N   . LYS C  3 58  ? 68.445  -87.530  -151.901 1.00 64.22  ? 57   LYS C N   1 
ATOM   2978  C  CA  . LYS C  3 58  ? 68.881  -87.136  -153.234 1.00 62.68  ? 57   LYS C CA  1 
ATOM   2979  C  C   . LYS C  3 58  ? 70.073  -87.834  -153.878 1.00 62.38  ? 57   LYS C C   1 
ATOM   2980  O  O   . LYS C  3 58  ? 70.951  -87.181  -154.446 1.00 61.47  ? 57   LYS C O   1 
ATOM   2981  C  CB  . LYS C  3 58  ? 69.094  -85.623  -153.304 1.00 62.81  ? 57   LYS C CB  1 
ATOM   2982  C  CG  . LYS C  3 58  ? 69.795  -84.995  -152.136 1.00 61.98  ? 57   LYS C CG  1 
ATOM   2983  C  CD  . LYS C  3 58  ? 70.220  -83.573  -152.493 1.00 64.46  ? 57   LYS C CD  1 
ATOM   2984  C  CE  . LYS C  3 58  ? 69.078  -82.748  -153.098 1.00 64.70  ? 57   LYS C CE  1 
ATOM   2985  N  NZ  . LYS C  3 58  ? 67.933  -82.577  -152.163 1.00 66.08  ? 57   LYS C NZ  1 
ATOM   2986  N  N   . CYS C  3 59  ? 70.093  -89.160  -153.813 1.00 62.24  ? 58   CYS C N   1 
ATOM   2987  C  CA  . CYS C  3 59  ? 71.156  -89.931  -154.438 1.00 63.68  ? 58   CYS C CA  1 
ATOM   2988  C  C   . CYS C  3 59  ? 71.006  -91.412  -154.143 1.00 65.31  ? 58   CYS C C   1 
ATOM   2989  O  O   . CYS C  3 59  ? 70.171  -91.820  -153.341 1.00 65.26  ? 58   CYS C O   1 
ATOM   2990  C  CB  . CYS C  3 59  ? 72.538  -89.448  -153.978 1.00 64.40  ? 58   CYS C CB  1 
ATOM   2991  S  SG  . CYS C  3 59  ? 73.210  -90.231  -152.482 1.00 65.29  ? 58   CYS C SG  1 
ATOM   2992  N  N   . ARG C  3 60  ? 71.818  -92.214  -154.816 1.00 68.10  ? 59   ARG C N   1 
ATOM   2993  C  CA  . ARG C  3 60  ? 71.811  -93.654  -154.639 1.00 70.35  ? 59   ARG C CA  1 
ATOM   2994  C  C   . ARG C  3 60  ? 73.249  -94.087  -154.396 1.00 71.00  ? 59   ARG C C   1 
ATOM   2995  O  O   . ARG C  3 60  ? 74.151  -93.705  -155.140 1.00 71.31  ? 59   ARG C O   1 
ATOM   2996  C  CB  . ARG C  3 60  ? 71.267  -94.320  -155.895 1.00 72.96  ? 59   ARG C CB  1 
ATOM   2997  C  CG  . ARG C  3 60  ? 71.038  -95.805  -155.762 1.00 77.33  ? 59   ARG C CG  1 
ATOM   2998  C  CD  . ARG C  3 60  ? 69.875  -96.224  -156.650 1.00 81.22  ? 59   ARG C CD  1 
ATOM   2999  N  NE  . ARG C  3 60  ? 68.793  -95.240  -156.579 1.00 83.70  ? 59   ARG C NE  1 
ATOM   3000  C  CZ  . ARG C  3 60  ? 67.497  -95.519  -156.691 1.00 84.14  ? 59   ARG C CZ  1 
ATOM   3001  N  NH1 . ARG C  3 60  ? 67.085  -96.769  -156.879 1.00 83.66  ? 59   ARG C NH1 1 
ATOM   3002  N  NH2 . ARG C  3 60  ? 66.608  -94.538  -156.614 1.00 84.48  ? 59   ARG C NH2 1 
ATOM   3003  N  N   . LEU C  3 61  ? 73.464  -94.871  -153.346 1.00 71.58  ? 60   LEU C N   1 
ATOM   3004  C  CA  . LEU C  3 61  ? 74.804  -95.345  -153.005 1.00 71.30  ? 60   LEU C CA  1 
ATOM   3005  C  C   . LEU C  3 61  ? 75.172  -96.654  -153.688 1.00 71.50  ? 60   LEU C C   1 
ATOM   3006  O  O   . LEU C  3 61  ? 74.363  -97.577  -153.766 1.00 71.26  ? 60   LEU C O   1 
ATOM   3007  C  CB  . LEU C  3 61  ? 74.928  -95.504  -151.490 1.00 70.40  ? 60   LEU C CB  1 
ATOM   3008  C  CG  . LEU C  3 61  ? 75.358  -94.236  -150.757 1.00 70.33  ? 60   LEU C CG  1 
ATOM   3009  C  CD1 . LEU C  3 61  ? 74.676  -94.144  -149.408 1.00 70.40  ? 60   LEU C CD1 1 
ATOM   3010  C  CD2 . LEU C  3 61  ? 76.873  -94.243  -150.616 1.00 70.29  ? 60   LEU C CD2 1 
ATOM   3011  N  N   . LEU C  3 62  ? 76.397  -96.722  -154.193 1.00 71.92  ? 61   LEU C N   1 
ATOM   3012  C  CA  . LEU C  3 62  ? 76.879  -97.925  -154.851 1.00 73.17  ? 61   LEU C CA  1 
ATOM   3013  C  C   . LEU C  3 62  ? 77.779  -98.701  -153.898 1.00 75.22  ? 61   LEU C C   1 
ATOM   3014  O  O   . LEU C  3 62  ? 78.814  -98.200  -153.449 1.00 74.82  ? 61   LEU C O   1 
ATOM   3015  C  CB  . LEU C  3 62  ? 77.655  -97.583  -156.125 1.00 72.28  ? 61   LEU C CB  1 
ATOM   3016  C  CG  . LEU C  3 62  ? 76.858  -97.431  -157.423 1.00 72.19  ? 61   LEU C CG  1 
ATOM   3017  C  CD1 . LEU C  3 62  ? 75.979  -96.192  -157.380 1.00 72.16  ? 61   LEU C CD1 1 
ATOM   3018  C  CD2 . LEU C  3 62  ? 77.831  -97.347  -158.583 1.00 72.65  ? 61   LEU C CD2 1 
ATOM   3019  N  N   . PRO C  3 63  ? 77.387  -99.942  -153.572 1.00 76.98  ? 62   PRO C N   1 
ATOM   3020  C  CA  . PRO C  3 63  ? 78.150  -100.803 -152.669 1.00 77.86  ? 62   PRO C CA  1 
ATOM   3021  C  C   . PRO C  3 63  ? 79.576  -101.008 -153.156 1.00 78.60  ? 62   PRO C C   1 
ATOM   3022  O  O   . PRO C  3 63  ? 79.805  -101.276 -154.335 1.00 78.08  ? 62   PRO C O   1 
ATOM   3023  C  CB  . PRO C  3 63  ? 77.350  -102.100 -152.680 1.00 78.18  ? 62   PRO C CB  1 
ATOM   3024  C  CG  . PRO C  3 63  ? 75.945  -101.619 -152.886 1.00 78.43  ? 62   PRO C CG  1 
ATOM   3025  C  CD  . PRO C  3 63  ? 76.134  -100.599 -153.980 1.00 77.85  ? 62   PRO C CD  1 
ATOM   3026  N  N   . PRO C  3 64  ? 80.557  -100.871 -152.253 1.00 79.66  ? 63   PRO C N   1 
ATOM   3027  C  CA  . PRO C  3 64  ? 81.946  -101.059 -152.659 1.00 80.54  ? 63   PRO C CA  1 
ATOM   3028  C  C   . PRO C  3 64  ? 82.108  -102.420 -153.335 1.00 82.17  ? 63   PRO C C   1 
ATOM   3029  O  O   . PRO C  3 64  ? 81.418  -103.386 -152.992 1.00 81.57  ? 63   PRO C O   1 
ATOM   3030  C  CB  . PRO C  3 64  ? 82.698  -100.970 -151.337 1.00 80.01  ? 63   PRO C CB  1 
ATOM   3031  C  CG  . PRO C  3 64  ? 81.869  -100.023 -150.549 1.00 78.94  ? 63   PRO C CG  1 
ATOM   3032  C  CD  . PRO C  3 64  ? 80.476  -100.523 -150.825 1.00 79.41  ? 63   PRO C CD  1 
ATOM   3033  N  N   . GLU C  3 65  ? 83.016  -102.486 -154.299 1.00 83.57  ? 64   GLU C N   1 
ATOM   3034  C  CA  . GLU C  3 65  ? 83.278  -103.716 -155.028 1.00 85.61  ? 64   GLU C CA  1 
ATOM   3035  C  C   . GLU C  3 65  ? 83.292  -104.940 -154.108 1.00 86.70  ? 64   GLU C C   1 
ATOM   3036  O  O   . GLU C  3 65  ? 82.619  -105.938 -154.382 1.00 87.60  ? 64   GLU C O   1 
ATOM   3037  C  CB  . GLU C  3 65  ? 84.620  -103.592 -155.756 1.00 86.75  ? 64   GLU C CB  1 
ATOM   3038  C  CG  . GLU C  3 65  ? 84.896  -104.664 -156.803 1.00 89.76  ? 64   GLU C CG  1 
ATOM   3039  C  CD  . GLU C  3 65  ? 85.312  -106.002 -156.213 1.00 91.79  ? 64   GLU C CD  1 
ATOM   3040  O  OE1 . GLU C  3 65  ? 85.506  -106.952 -157.001 1.00 93.16  ? 64   GLU C OE1 1 
ATOM   3041  O  OE2 . GLU C  3 65  ? 85.453  -106.110 -154.974 1.00 92.57  ? 64   GLU C OE2 1 
ATOM   3042  N  N   . TRP C  3 66  ? 84.051  -104.846 -153.014 1.00 86.73  ? 65   TRP C N   1 
ATOM   3043  C  CA  . TRP C  3 66  ? 84.206  -105.938 -152.051 1.00 86.06  ? 65   TRP C CA  1 
ATOM   3044  C  C   . TRP C  3 66  ? 83.006  -106.317 -151.191 1.00 87.12  ? 65   TRP C C   1 
ATOM   3045  O  O   . TRP C  3 66  ? 82.948  -107.434 -150.677 1.00 86.54  ? 65   TRP C O   1 
ATOM   3046  C  CB  . TRP C  3 66  ? 85.391  -105.661 -151.112 1.00 84.14  ? 65   TRP C CB  1 
ATOM   3047  C  CG  . TRP C  3 66  ? 85.304  -104.363 -150.347 1.00 82.32  ? 65   TRP C CG  1 
ATOM   3048  C  CD1 . TRP C  3 66  ? 85.788  -103.150 -150.738 1.00 81.23  ? 65   TRP C CD1 1 
ATOM   3049  C  CD2 . TRP C  3 66  ? 84.670  -104.148 -149.076 1.00 81.25  ? 65   TRP C CD2 1 
ATOM   3050  N  NE1 . TRP C  3 66  ? 85.496  -102.194 -149.796 1.00 80.52  ? 65   TRP C NE1 1 
ATOM   3051  C  CE2 . TRP C  3 66  ? 84.809  -102.778 -148.766 1.00 80.21  ? 65   TRP C CE2 1 
ATOM   3052  C  CE3 . TRP C  3 66  ? 83.996  -104.980 -148.172 1.00 80.65  ? 65   TRP C CE3 1 
ATOM   3053  C  CZ2 . TRP C  3 66  ? 84.300  -102.219 -147.592 1.00 79.43  ? 65   TRP C CZ2 1 
ATOM   3054  C  CZ3 . TRP C  3 66  ? 83.488  -104.421 -147.002 1.00 79.46  ? 65   TRP C CZ3 1 
ATOM   3055  C  CH2 . TRP C  3 66  ? 83.644  -103.053 -146.725 1.00 79.18  ? 65   TRP C CH2 1 
HETATM 3056  N  N   . MSE C  3 67  ? 82.051  -105.415 -151.022 1.00 88.80  ? 66   MSE C N   1 
HETATM 3057  C  CA  . MSE C  3 67  ? 80.908  -105.737 -150.178 1.00 91.64  ? 66   MSE C CA  1 
HETATM 3058  C  C   . MSE C  3 67  ? 79.954  -106.766 -150.798 1.00 93.28  ? 66   MSE C C   1 
HETATM 3059  O  O   . MSE C  3 67  ? 78.756  -106.768 -150.511 1.00 93.12  ? 66   MSE C O   1 
HETATM 3060  C  CB  . MSE C  3 67  ? 80.150  -104.457 -149.812 1.00 91.74  ? 66   MSE C CB  1 
HETATM 3061  C  CG  . MSE C  3 67  ? 79.328  -104.576 -148.536 1.00 92.62  ? 66   MSE C CG  1 
HETATM 3062  SE SE  . MSE C  3 67  ? 78.483  -102.921 -148.020 1.00 95.40  ? 66   MSE C SE  1 
HETATM 3063  C  CE  . MSE C  3 67  ? 80.075  -101.880 -147.706 1.00 93.78  ? 66   MSE C CE  1 
ATOM   3064  N  N   . ASP C  3 68  ? 80.494  -107.648 -151.637 1.00 95.96  ? 67   ASP C N   1 
ATOM   3065  C  CA  . ASP C  3 68  ? 79.692  -108.690 -152.289 1.00 98.71  ? 67   ASP C CA  1 
ATOM   3066  C  C   . ASP C  3 68  ? 79.612  -109.919 -151.388 1.00 99.63  ? 67   ASP C C   1 
ATOM   3067  O  O   . ASP C  3 68  ? 80.633  -110.386 -150.881 1.00 99.52  ? 67   ASP C O   1 
ATOM   3068  C  CB  . ASP C  3 68  ? 80.314  -109.083 -153.641 1.00 99.62  ? 67   ASP C CB  1 
ATOM   3069  C  CG  . ASP C  3 68  ? 79.538  -110.189 -154.352 1.00 99.97  ? 67   ASP C CG  1 
ATOM   3070  O  OD1 . ASP C  3 68  ? 78.382  -109.946 -154.761 1.00 100.11 ? 67   ASP C OD1 1 
ATOM   3071  O  OD2 . ASP C  3 68  ? 80.084  -111.304 -154.500 1.00 100.40 ? 67   ASP C OD2 1 
ATOM   3072  N  N   . VAL C  3 69  ? 78.401  -110.440 -151.200 1.00 100.80 ? 68   VAL C N   1 
ATOM   3073  C  CA  . VAL C  3 69  ? 78.186  -111.609 -150.349 1.00 102.00 ? 68   VAL C CA  1 
ATOM   3074  C  C   . VAL C  3 69  ? 79.257  -112.679 -150.537 1.00 102.97 ? 68   VAL C C   1 
ATOM   3075  O  O   . VAL C  3 69  ? 80.253  -112.692 -149.822 1.00 104.50 ? 68   VAL C O   1 
ATOM   3076  C  CB  . VAL C  3 69  ? 76.814  -112.262 -150.604 1.00 101.41 ? 68   VAL C CB  1 
ATOM   3077  C  CG1 . VAL C  3 69  ? 76.545  -113.302 -149.535 1.00 101.25 ? 68   VAL C CG1 1 
ATOM   3078  C  CG2 . VAL C  3 69  ? 75.721  -111.209 -150.616 1.00 101.42 ? 68   VAL C CG2 1 
ATOM   3079  N  N   . GLU C  3 70  ? 79.055  -113.572 -151.498 1.00 103.67 ? 69   GLU C N   1 
ATOM   3080  C  CA  . GLU C  3 70  ? 80.016  -114.636 -151.744 1.00 105.00 ? 69   GLU C CA  1 
ATOM   3081  C  C   . GLU C  3 70  ? 81.452  -114.129 -151.795 1.00 105.77 ? 69   GLU C C   1 
ATOM   3082  O  O   . GLU C  3 70  ? 82.387  -114.898 -151.576 1.00 106.07 ? 69   GLU C O   1 
ATOM   3083  C  CB  . GLU C  3 70  ? 79.671  -115.379 -153.039 1.00 106.39 ? 69   GLU C CB  1 
ATOM   3084  C  CG  . GLU C  3 70  ? 78.350  -116.147 -152.972 1.00 107.89 ? 69   GLU C CG  1 
ATOM   3085  C  CD  . GLU C  3 70  ? 78.084  -116.989 -154.210 1.00 108.61 ? 69   GLU C CD  1 
ATOM   3086  O  OE1 . GLU C  3 70  ? 78.844  -117.951 -154.455 1.00 109.09 ? 69   GLU C OE1 1 
ATOM   3087  O  OE2 . GLU C  3 70  ? 77.113  -116.687 -154.938 1.00 109.23 ? 69   GLU C OE2 1 
ATOM   3088  N  N   . LYS C  3 71  ? 81.635  -112.841 -152.078 1.00 106.25 ? 70   LYS C N   1 
ATOM   3089  C  CA  . LYS C  3 71  ? 82.980  -112.277 -152.123 1.00 107.38 ? 70   LYS C CA  1 
ATOM   3090  C  C   . LYS C  3 71  ? 83.623  -112.281 -150.738 1.00 108.51 ? 70   LYS C C   1 
ATOM   3091  O  O   . LYS C  3 71  ? 84.723  -112.802 -150.559 1.00 108.89 ? 70   LYS C O   1 
ATOM   3092  C  CB  . LYS C  3 71  ? 82.959  -110.849 -152.665 1.00 106.92 ? 70   LYS C CB  1 
ATOM   3093  C  CG  . LYS C  3 71  ? 83.301  -110.740 -154.135 1.00 106.76 ? 70   LYS C CG  1 
ATOM   3094  C  CD  . LYS C  3 71  ? 83.587  -109.298 -154.510 1.00 106.97 ? 70   LYS C CD  1 
ATOM   3095  C  CE  . LYS C  3 71  ? 84.006  -109.175 -155.960 1.00 107.09 ? 70   LYS C CE  1 
ATOM   3096  N  NZ  . LYS C  3 71  ? 82.926  -109.589 -156.892 1.00 107.51 ? 70   LYS C NZ  1 
ATOM   3097  N  N   . LEU C  3 72  ? 82.942  -111.689 -149.761 1.00 109.70 ? 71   LEU C N   1 
ATOM   3098  C  CA  . LEU C  3 72  ? 83.454  -111.646 -148.393 1.00 110.77 ? 71   LEU C CA  1 
ATOM   3099  C  C   . LEU C  3 72  ? 83.358  -113.036 -147.791 1.00 111.50 ? 71   LEU C C   1 
ATOM   3100  O  O   . LEU C  3 72  ? 84.244  -113.479 -147.064 1.00 111.36 ? 71   LEU C O   1 
ATOM   3101  C  CB  . LEU C  3 72  ? 82.638  -110.670 -147.543 1.00 111.03 ? 71   LEU C CB  1 
ATOM   3102  C  CG  . LEU C  3 72  ? 82.784  -109.182 -147.858 1.00 111.19 ? 71   LEU C CG  1 
ATOM   3103  C  CD1 . LEU C  3 72  ? 81.882  -108.381 -146.940 1.00 110.88 ? 71   LEU C CD1 1 
ATOM   3104  C  CD2 . LEU C  3 72  ? 84.235  -108.761 -147.680 1.00 111.05 ? 71   LEU C CD2 1 
ATOM   3105  N  N   . GLU C  3 73  ? 82.261  -113.712 -148.101 1.00 112.92 ? 72   GLU C N   1 
ATOM   3106  C  CA  . GLU C  3 73  ? 82.007  -115.064 -147.625 1.00 114.54 ? 72   GLU C CA  1 
ATOM   3107  C  C   . GLU C  3 73  ? 83.174  -115.961 -148.028 1.00 114.97 ? 72   GLU C C   1 
ATOM   3108  O  O   . GLU C  3 73  ? 83.314  -117.077 -147.533 1.00 115.15 ? 72   GLU C O   1 
ATOM   3109  C  CB  . GLU C  3 73  ? 80.705  -115.573 -148.242 1.00 115.36 ? 72   GLU C CB  1 
ATOM   3110  C  CG  . GLU C  3 73  ? 80.270  -116.954 -147.816 1.00 116.22 ? 72   GLU C CG  1 
ATOM   3111  C  CD  . GLU C  3 73  ? 78.954  -117.345 -148.458 1.00 117.02 ? 72   GLU C CD  1 
ATOM   3112  O  OE1 . GLU C  3 73  ? 77.923  -116.707 -148.151 1.00 116.88 ? 72   GLU C OE1 1 
ATOM   3113  O  OE2 . GLU C  3 73  ? 78.953  -118.283 -149.281 1.00 118.37 ? 72   GLU C OE2 1 
ATOM   3114  N  N   . LYS C  3 74  ? 84.004  -115.453 -148.933 1.00 115.36 ? 73   LYS C N   1 
ATOM   3115  C  CA  . LYS C  3 74  ? 85.171  -116.177 -149.416 1.00 115.91 ? 73   LYS C CA  1 
ATOM   3116  C  C   . LYS C  3 74  ? 86.406  -115.612 -148.715 1.00 116.61 ? 73   LYS C C   1 
ATOM   3117  O  O   . LYS C  3 74  ? 87.496  -116.177 -148.791 1.00 116.69 ? 73   LYS C O   1 
ATOM   3118  C  CB  . LYS C  3 74  ? 85.290  -116.011 -150.935 1.00 115.50 ? 73   LYS C CB  1 
ATOM   3119  C  CG  . LYS C  3 74  ? 86.284  -116.944 -151.615 1.00 115.17 ? 73   LYS C CG  1 
ATOM   3120  C  CD  . LYS C  3 74  ? 86.251  -116.756 -153.129 1.00 115.10 ? 73   LYS C CD  1 
ATOM   3121  C  CE  . LYS C  3 74  ? 87.207  -117.698 -153.847 1.00 114.49 ? 73   LYS C CE  1 
ATOM   3122  N  NZ  . LYS C  3 74  ? 87.216  -117.454 -155.318 1.00 113.42 ? 73   LYS C NZ  1 
HETATM 3123  N  N   . MSE C  3 75  ? 86.220  -114.489 -148.030 1.00 117.57 ? 74   MSE C N   1 
HETATM 3124  C  CA  . MSE C  3 75  ? 87.302  -113.842 -147.297 1.00 118.57 ? 74   MSE C CA  1 
HETATM 3125  C  C   . MSE C  3 75  ? 87.306  -114.320 -145.850 1.00 119.11 ? 74   MSE C C   1 
HETATM 3126  O  O   . MSE C  3 75  ? 88.367  -114.534 -145.261 1.00 119.34 ? 74   MSE C O   1 
HETATM 3127  C  CB  . MSE C  3 75  ? 87.142  -112.319 -147.318 1.00 118.72 ? 74   MSE C CB  1 
HETATM 3128  C  CG  . MSE C  3 75  ? 87.251  -111.683 -148.689 1.00 119.04 ? 74   MSE C CG  1 
HETATM 3129  SE SE  . MSE C  3 75  ? 87.367  -109.759 -148.568 1.00 119.54 ? 74   MSE C SE  1 
HETATM 3130  C  CE  . MSE C  3 75  ? 89.285  -109.563 -148.750 1.00 118.21 ? 74   MSE C CE  1 
ATOM   3131  N  N   . ARG C  3 76  ? 86.114  -114.473 -145.279 1.00 119.20 ? 75   ARG C N   1 
ATOM   3132  C  CA  . ARG C  3 76  ? 85.986  -114.931 -143.902 1.00 119.48 ? 75   ARG C CA  1 
ATOM   3133  C  C   . ARG C  3 76  ? 86.730  -116.247 -143.771 1.00 120.34 ? 75   ARG C C   1 
ATOM   3134  O  O   . ARG C  3 76  ? 87.435  -116.484 -142.788 1.00 120.50 ? 75   ARG C O   1 
ATOM   3135  C  CB  . ARG C  3 76  ? 84.516  -115.142 -143.537 1.00 118.99 ? 75   ARG C CB  1 
ATOM   3136  C  CG  . ARG C  3 76  ? 84.305  -115.604 -142.101 1.00 118.59 ? 75   ARG C CG  1 
ATOM   3137  C  CD  . ARG C  3 76  ? 82.839  -115.814 -141.761 1.00 117.89 ? 75   ARG C CD  1 
ATOM   3138  N  NE  . ARG C  3 76  ? 82.350  -117.137 -142.140 1.00 117.77 ? 75   ARG C NE  1 
ATOM   3139  C  CZ  . ARG C  3 76  ? 82.168  -117.551 -143.390 1.00 117.85 ? 75   ARG C CZ  1 
ATOM   3140  N  NH1 . ARG C  3 76  ? 82.433  -116.750 -144.410 1.00 118.15 ? 75   ARG C NH1 1 
ATOM   3141  N  NH2 . ARG C  3 76  ? 81.708  -118.773 -143.620 1.00 117.98 ? 75   ARG C NH2 1 
ATOM   3142  N  N   . ASP C  3 77  ? 86.569  -117.098 -144.778 1.00 121.05 ? 76   ASP C N   1 
ATOM   3143  C  CA  . ASP C  3 77  ? 87.222  -118.397 -144.796 1.00 121.32 ? 76   ASP C CA  1 
ATOM   3144  C  C   . ASP C  3 77  ? 88.733  -118.252 -144.956 1.00 121.17 ? 76   ASP C C   1 
ATOM   3145  O  O   . ASP C  3 77  ? 89.494  -118.995 -144.341 1.00 121.19 ? 76   ASP C O   1 
ATOM   3146  C  CB  . ASP C  3 77  ? 86.633  -119.257 -145.917 1.00 121.48 ? 76   ASP C CB  1 
ATOM   3147  C  CG  . ASP C  3 77  ? 85.179  -119.625 -145.661 1.00 121.39 ? 76   ASP C CG  1 
ATOM   3148  O  OD1 . ASP C  3 77  ? 84.371  -118.712 -145.390 1.00 121.28 ? 76   ASP C OD1 1 
ATOM   3149  O  OD2 . ASP C  3 77  ? 84.844  -120.826 -145.730 1.00 121.37 ? 76   ASP C OD2 1 
ATOM   3150  N  N   . HIS C  3 78  ? 89.169  -117.299 -145.775 1.00 121.16 ? 77   HIS C N   1 
ATOM   3151  C  CA  . HIS C  3 78  ? 90.598  -117.081 -145.958 1.00 121.35 ? 77   HIS C CA  1 
ATOM   3152  C  C   . HIS C  3 78  ? 91.174  -116.543 -144.654 1.00 121.23 ? 77   HIS C C   1 
ATOM   3153  O  O   . HIS C  3 78  ? 92.377  -116.637 -144.408 1.00 121.27 ? 77   HIS C O   1 
ATOM   3154  C  CB  . HIS C  3 78  ? 90.864  -116.089 -147.092 1.00 122.44 ? 77   HIS C CB  1 
ATOM   3155  C  CG  . HIS C  3 78  ? 92.295  -115.653 -147.185 1.00 124.17 ? 77   HIS C CG  1 
ATOM   3156  N  ND1 . HIS C  3 78  ? 93.349  -116.537 -147.104 1.00 124.69 ? 77   HIS C ND1 1 
ATOM   3157  C  CD2 . HIS C  3 78  ? 92.846  -114.426 -147.349 1.00 124.95 ? 77   HIS C CD2 1 
ATOM   3158  C  CE1 . HIS C  3 78  ? 94.488  -115.875 -147.212 1.00 124.77 ? 77   HIS C CE1 1 
ATOM   3159  N  NE2 . HIS C  3 78  ? 94.211  -114.592 -147.362 1.00 124.73 ? 77   HIS C NE2 1 
ATOM   3160  N  N   . GLU C  3 79  ? 90.303  -115.972 -143.824 1.00 120.85 ? 78   GLU C N   1 
ATOM   3161  C  CA  . GLU C  3 79  ? 90.707  -115.436 -142.527 1.00 120.21 ? 78   GLU C CA  1 
ATOM   3162  C  C   . GLU C  3 79  ? 90.790  -116.607 -141.553 1.00 119.87 ? 78   GLU C C   1 
ATOM   3163  O  O   . GLU C  3 79  ? 91.810  -116.807 -140.891 1.00 119.47 ? 78   GLU C O   1 
ATOM   3164  C  CB  . GLU C  3 79  ? 89.679  -114.420 -142.020 1.00 119.94 ? 78   GLU C CB  1 
ATOM   3165  C  CG  . GLU C  3 79  ? 89.997  -113.848 -140.647 1.00 118.49 ? 78   GLU C CG  1 
ATOM   3166  C  CD  . GLU C  3 79  ? 91.253  -113.007 -140.648 1.00 118.05 ? 78   GLU C CD  1 
ATOM   3167  O  OE1 . GLU C  3 79  ? 91.272  -111.972 -141.344 1.00 117.87 ? 78   GLU C OE1 1 
ATOM   3168  O  OE2 . GLU C  3 79  ? 92.221  -113.379 -139.956 1.00 117.67 ? 78   GLU C OE2 1 
ATOM   3169  N  N   . ARG C  3 80  ? 89.707  -117.378 -141.479 1.00 119.13 ? 79   ARG C N   1 
ATOM   3170  C  CA  . ARG C  3 80  ? 89.648  -118.547 -140.609 1.00 118.33 ? 79   ARG C CA  1 
ATOM   3171  C  C   . ARG C  3 80  ? 90.610  -119.606 -141.140 1.00 118.12 ? 79   ARG C C   1 
ATOM   3172  O  O   . ARG C  3 80  ? 90.651  -120.735 -140.651 1.00 117.77 ? 79   ARG C O   1 
ATOM   3173  C  CB  . ARG C  3 80  ? 88.219  -119.098 -140.555 1.00 117.65 ? 79   ARG C CB  1 
ATOM   3174  C  CG  . ARG C  3 80  ? 87.246  -118.196 -139.805 1.00 117.00 ? 79   ARG C CG  1 
ATOM   3175  C  CD  . ARG C  3 80  ? 85.814  -118.707 -139.879 1.00 116.87 ? 79   ARG C CD  1 
ATOM   3176  N  NE  . ARG C  3 80  ? 85.650  -120.027 -139.274 1.00 116.50 ? 79   ARG C NE  1 
ATOM   3177  C  CZ  . ARG C  3 80  ? 84.505  -120.705 -139.262 1.00 116.42 ? 79   ARG C CZ  1 
ATOM   3178  N  NH1 . ARG C  3 80  ? 83.417  -120.190 -139.820 1.00 116.20 ? 79   ARG C NH1 1 
ATOM   3179  N  NH2 . ARG C  3 80  ? 84.447  -121.903 -138.697 1.00 116.02 ? 79   ARG C NH2 1 
ATOM   3180  N  N   . LYS C  3 81  ? 91.380  -119.218 -142.152 1.00 118.02 ? 80   LYS C N   1 
ATOM   3181  C  CA  . LYS C  3 81  ? 92.371  -120.090 -142.770 1.00 117.57 ? 80   LYS C CA  1 
ATOM   3182  C  C   . LYS C  3 81  ? 93.710  -119.740 -142.135 1.00 117.10 ? 80   LYS C C   1 
ATOM   3183  O  O   . LYS C  3 81  ? 94.046  -120.257 -141.067 1.00 117.22 ? 80   LYS C O   1 
ATOM   3184  C  CB  . LYS C  3 81  ? 92.421  -119.848 -144.284 1.00 117.84 ? 80   LYS C CB  1 
ATOM   3185  C  CG  . LYS C  3 81  ? 93.340  -120.788 -145.054 1.00 117.66 ? 80   LYS C CG  1 
ATOM   3186  C  CD  . LYS C  3 81  ? 93.180  -120.595 -146.556 1.00 118.11 ? 80   LYS C CD  1 
ATOM   3187  C  CE  . LYS C  3 81  ? 93.922  -121.663 -147.343 1.00 118.40 ? 80   LYS C CE  1 
ATOM   3188  N  NZ  . LYS C  3 81  ? 93.603  -121.594 -148.797 1.00 118.20 ? 80   LYS C NZ  1 
ATOM   3189  N  N   . GLU C  3 82  ? 94.462  -118.854 -142.787 1.00 116.13 ? 81   GLU C N   1 
ATOM   3190  C  CA  . GLU C  3 82  ? 95.758  -118.424 -142.273 1.00 115.13 ? 81   GLU C CA  1 
ATOM   3191  C  C   . GLU C  3 82  ? 95.664  -118.304 -140.760 1.00 114.57 ? 81   GLU C C   1 
ATOM   3192  O  O   . GLU C  3 82  ? 94.705  -117.742 -140.232 1.00 115.43 ? 81   GLU C O   1 
ATOM   3193  C  CB  . GLU C  3 82  ? 96.147  -117.070 -142.867 1.00 115.21 ? 81   GLU C CB  1 
ATOM   3194  C  CG  . GLU C  3 82  ? 96.557  -117.118 -144.325 1.00 115.43 ? 81   GLU C CG  1 
ATOM   3195  C  CD  . GLU C  3 82  ? 97.915  -117.758 -144.523 1.00 115.25 ? 81   GLU C CD  1 
ATOM   3196  O  OE1 . GLU C  3 82  ? 98.906  -117.226 -143.978 1.00 114.82 ? 81   GLU C OE1 1 
ATOM   3197  O  OE2 . GLU C  3 82  ? 97.989  -118.790 -145.222 1.00 115.43 ? 81   GLU C OE2 1 
ATOM   3198  N  N   . GLU C  3 83  ? 96.654  -118.844 -140.064 1.00 113.00 ? 82   GLU C N   1 
ATOM   3199  C  CA  . GLU C  3 83  ? 96.663  -118.797 -138.614 1.00 110.89 ? 82   GLU C CA  1 
ATOM   3200  C  C   . GLU C  3 83  ? 96.704  -117.352 -138.131 1.00 108.84 ? 82   GLU C C   1 
ATOM   3201  O  O   . GLU C  3 83  ? 96.092  -117.018 -137.118 1.00 108.62 ? 82   GLU C O   1 
ATOM   3202  C  CB  . GLU C  3 83  ? 97.871  -119.569 -138.075 1.00 112.38 ? 82   GLU C CB  1 
ATOM   3203  C  CG  . GLU C  3 83  ? 97.875  -119.762 -136.565 1.00 113.32 ? 82   GLU C CG  1 
ATOM   3204  C  CD  . GLU C  3 83  ? 99.102  -120.514 -136.076 1.00 113.91 ? 82   GLU C CD  1 
ATOM   3205  O  OE1 . GLU C  3 83  ? 99.199  -120.767 -134.855 1.00 114.18 ? 82   GLU C OE1 1 
ATOM   3206  O  OE2 . GLU C  3 83  ? 99.970  -120.850 -136.912 1.00 114.21 ? 82   GLU C OE2 1 
ATOM   3207  N  N   . THR C  3 84  ? 97.408  -116.495 -138.869 1.00 106.27 ? 83   THR C N   1 
ATOM   3208  C  CA  . THR C  3 84  ? 97.539  -115.086 -138.501 1.00 104.14 ? 83   THR C CA  1 
ATOM   3209  C  C   . THR C  3 84  ? 96.430  -114.186 -139.048 1.00 102.80 ? 83   THR C C   1 
ATOM   3210  O  O   . THR C  3 84  ? 95.441  -114.664 -139.595 1.00 101.79 ? 83   THR C O   1 
ATOM   3211  C  CB  . THR C  3 84  ? 98.892  -114.518 -138.966 1.00 103.97 ? 83   THR C CB  1 
ATOM   3212  O  OG1 . THR C  3 84  ? 99.068  -113.204 -138.425 1.00 103.56 ? 83   THR C OG1 1 
ATOM   3213  C  CG2 . THR C  3 84  ? 98.948  -114.447 -140.487 1.00 103.41 ? 83   THR C CG2 1 
ATOM   3214  N  N   . PHE C  3 85  ? 96.617  -112.876 -138.898 1.00 101.88 ? 84   PHE C N   1 
ATOM   3215  C  CA  . PHE C  3 85  ? 95.651  -111.873 -139.351 1.00 101.10 ? 84   PHE C CA  1 
ATOM   3216  C  C   . PHE C  3 85  ? 95.664  -111.626 -140.860 1.00 100.13 ? 84   PHE C C   1 
ATOM   3217  O  O   . PHE C  3 85  ? 96.712  -111.349 -141.452 1.00 99.65  ? 84   PHE C O   1 
ATOM   3218  C  CB  . PHE C  3 85  ? 95.894  -110.546 -138.617 1.00 101.26 ? 84   PHE C CB  1 
ATOM   3219  C  CG  . PHE C  3 85  ? 95.441  -110.550 -137.180 1.00 101.63 ? 84   PHE C CG  1 
ATOM   3220  C  CD1 . PHE C  3 85  ? 96.070  -109.742 -136.240 1.00 101.47 ? 84   PHE C CD1 1 
ATOM   3221  C  CD2 . PHE C  3 85  ? 94.372  -111.347 -136.768 1.00 102.24 ? 84   PHE C CD2 1 
ATOM   3222  C  CE1 . PHE C  3 85  ? 95.646  -109.727 -134.915 1.00 101.88 ? 84   PHE C CE1 1 
ATOM   3223  C  CE2 . PHE C  3 85  ? 93.938  -111.339 -135.442 1.00 101.71 ? 84   PHE C CE2 1 
ATOM   3224  C  CZ  . PHE C  3 85  ? 94.576  -110.529 -134.516 1.00 101.99 ? 84   PHE C CZ  1 
ATOM   3225  N  N   . THR C  3 86  ? 94.481  -111.714 -141.466 1.00 98.58  ? 85   THR C N   1 
ATOM   3226  C  CA  . THR C  3 86  ? 94.316  -111.515 -142.902 1.00 96.65  ? 85   THR C CA  1 
ATOM   3227  C  C   . THR C  3 86  ? 94.116  -110.044 -143.245 1.00 95.63  ? 85   THR C C   1 
ATOM   3228  O  O   . THR C  3 86  ? 93.260  -109.381 -142.667 1.00 94.90  ? 85   THR C O   1 
ATOM   3229  C  CB  . THR C  3 86  ? 93.090  -112.288 -143.436 1.00 96.05  ? 85   THR C CB  1 
ATOM   3230  O  OG1 . THR C  3 86  ? 93.216  -113.682 -143.127 1.00 94.19  ? 85   THR C OG1 1 
ATOM   3231  C  CG2 . THR C  3 86  ? 92.972  -112.116 -144.937 1.00 96.59  ? 85   THR C CG2 1 
ATOM   3232  N  N   . PRO C  3 87  ? 94.905  -109.514 -144.194 1.00 95.22  ? 86   PRO C N   1 
ATOM   3233  C  CA  . PRO C  3 87  ? 94.755  -108.105 -144.573 1.00 95.00  ? 86   PRO C CA  1 
ATOM   3234  C  C   . PRO C  3 87  ? 93.338  -107.824 -145.093 1.00 94.44  ? 86   PRO C C   1 
ATOM   3235  O  O   . PRO C  3 87  ? 92.839  -108.515 -145.983 1.00 93.19  ? 86   PRO C O   1 
ATOM   3236  C  CB  . PRO C  3 87  ? 95.841  -107.913 -145.637 1.00 94.85  ? 86   PRO C CB  1 
ATOM   3237  C  CG  . PRO C  3 87  ? 96.002  -109.283 -146.219 1.00 94.88  ? 86   PRO C CG  1 
ATOM   3238  C  CD  . PRO C  3 87  ? 95.952  -110.166 -144.998 1.00 95.10  ? 86   PRO C CD  1 
HETATM 3239  N  N   . MSE C  3 88  ? 92.701  -106.805 -144.524 1.00 94.03  ? 87   MSE C N   1 
HETATM 3240  C  CA  . MSE C  3 88  ? 91.334  -106.440 -144.886 1.00 93.74  ? 87   MSE C CA  1 
HETATM 3241  C  C   . MSE C  3 88  ? 91.174  -105.579 -146.146 1.00 92.21  ? 87   MSE C C   1 
HETATM 3242  O  O   . MSE C  3 88  ? 92.097  -104.870 -146.558 1.00 91.80  ? 87   MSE C O   1 
HETATM 3243  C  CB  . MSE C  3 88  ? 90.671  -105.739 -143.697 1.00 94.87  ? 87   MSE C CB  1 
HETATM 3244  C  CG  . MSE C  3 88  ? 90.568  -106.603 -142.452 1.00 96.18  ? 87   MSE C CG  1 
HETATM 3245  SE SE  . MSE C  3 88  ? 89.298  -108.064 -142.610 1.00 100.79 ? 87   MSE C SE  1 
HETATM 3246  C  CE  . MSE C  3 88  ? 90.435  -109.360 -143.497 1.00 98.93  ? 87   MSE C CE  1 
ATOM   3247  N  N   . PRO C  3 89  ? 89.981  -105.636 -146.770 1.00 90.49  ? 88   PRO C N   1 
ATOM   3248  C  CA  . PRO C  3 89  ? 89.637  -104.885 -147.984 1.00 89.16  ? 88   PRO C CA  1 
ATOM   3249  C  C   . PRO C  3 89  ? 89.789  -103.396 -147.730 1.00 88.15  ? 88   PRO C C   1 
ATOM   3250  O  O   . PRO C  3 89  ? 90.721  -102.749 -148.207 1.00 87.55  ? 88   PRO C O   1 
ATOM   3251  C  CB  . PRO C  3 89  ? 88.173  -105.255 -148.216 1.00 89.39  ? 88   PRO C CB  1 
ATOM   3252  C  CG  . PRO C  3 89  ? 88.054  -106.607 -147.598 1.00 89.33  ? 88   PRO C CG  1 
ATOM   3253  C  CD  . PRO C  3 89  ? 88.840  -106.458 -146.331 1.00 89.49  ? 88   PRO C CD  1 
ATOM   3254  N  N   . SER C  3 90  ? 88.840  -102.873 -146.963 1.00 87.48  ? 89   SER C N   1 
ATOM   3255  C  CA  . SER C  3 90  ? 88.801  -101.474 -146.577 1.00 85.79  ? 89   SER C CA  1 
ATOM   3256  C  C   . SER C  3 90  ? 89.360  -101.371 -145.161 1.00 84.11  ? 89   SER C C   1 
ATOM   3257  O  O   . SER C  3 90  ? 88.968  -102.131 -144.273 1.00 84.82  ? 89   SER C O   1 
ATOM   3258  C  CB  . SER C  3 90  ? 87.354  -100.975 -146.608 1.00 86.16  ? 89   SER C CB  1 
ATOM   3259  O  OG  . SER C  3 90  ? 87.260  -99.627  -146.189 1.00 87.80  ? 89   SER C OG  1 
ATOM   3260  N  N   . PRO C  3 91  ? 90.299  -100.442 -144.934 1.00 82.05  ? 90   PRO C N   1 
ATOM   3261  C  CA  . PRO C  3 91  ? 90.894  -100.265 -143.607 1.00 80.40  ? 90   PRO C CA  1 
ATOM   3262  C  C   . PRO C  3 91  ? 89.899  -99.730  -142.570 1.00 78.86  ? 90   PRO C C   1 
ATOM   3263  O  O   . PRO C  3 91  ? 90.288  -99.183  -141.539 1.00 79.80  ? 90   PRO C O   1 
ATOM   3264  C  CB  . PRO C  3 91  ? 92.050  -99.302  -143.876 1.00 81.16  ? 90   PRO C CB  1 
ATOM   3265  C  CG  . PRO C  3 91  ? 91.559  -98.501  -145.039 1.00 81.82  ? 90   PRO C CG  1 
ATOM   3266  C  CD  . PRO C  3 91  ? 90.947  -99.562  -145.919 1.00 81.88  ? 90   PRO C CD  1 
ATOM   3267  N  N   . TYR C  3 92  ? 88.614  -99.891  -142.861 1.00 76.24  ? 91   TYR C N   1 
ATOM   3268  C  CA  . TYR C  3 92  ? 87.538  -99.462  -141.975 1.00 74.04  ? 91   TYR C CA  1 
ATOM   3269  C  C   . TYR C  3 92  ? 86.379  -100.370 -142.336 1.00 73.43  ? 91   TYR C C   1 
ATOM   3270  O  O   . TYR C  3 92  ? 85.218  -100.037 -142.115 1.00 73.33  ? 91   TYR C O   1 
ATOM   3271  C  CB  . TYR C  3 92  ? 87.133  -98.012  -142.257 1.00 71.78  ? 91   TYR C CB  1 
ATOM   3272  C  CG  . TYR C  3 92  ? 88.209  -96.988  -142.016 1.00 68.93  ? 91   TYR C CG  1 
ATOM   3273  C  CD1 . TYR C  3 92  ? 88.552  -96.590  -140.724 1.00 67.67  ? 91   TYR C CD1 1 
ATOM   3274  C  CD2 . TYR C  3 92  ? 88.886  -96.412  -143.082 1.00 69.03  ? 91   TYR C CD2 1 
ATOM   3275  C  CE1 . TYR C  3 92  ? 89.546  -95.638  -140.504 1.00 66.69  ? 91   TYR C CE1 1 
ATOM   3276  C  CE2 . TYR C  3 92  ? 89.882  -95.463  -142.875 1.00 68.87  ? 91   TYR C CE2 1 
ATOM   3277  C  CZ  . TYR C  3 92  ? 90.205  -95.081  -141.589 1.00 67.82  ? 91   TYR C CZ  1 
ATOM   3278  O  OH  . TYR C  3 92  ? 91.192  -94.142  -141.408 1.00 69.16  ? 91   TYR C OH  1 
ATOM   3279  N  N   . TYR C  3 93  ? 86.708  -101.521 -142.904 1.00 73.13  ? 92   TYR C N   1 
ATOM   3280  C  CA  . TYR C  3 93  ? 85.702  -102.469 -143.342 1.00 73.87  ? 92   TYR C CA  1 
ATOM   3281  C  C   . TYR C  3 93  ? 84.504  -102.551 -142.402 1.00 74.44  ? 92   TYR C C   1 
ATOM   3282  O  O   . TYR C  3 93  ? 83.365  -102.685 -142.854 1.00 74.93  ? 92   TYR C O   1 
ATOM   3283  C  CB  . TYR C  3 93  ? 86.336  -103.852 -143.536 1.00 72.98  ? 92   TYR C CB  1 
ATOM   3284  C  CG  . TYR C  3 93  ? 86.451  -104.687 -142.286 1.00 72.69  ? 92   TYR C CG  1 
ATOM   3285  C  CD1 . TYR C  3 93  ? 85.324  -105.281 -141.717 1.00 73.19  ? 92   TYR C CD1 1 
ATOM   3286  C  CD2 . TYR C  3 93  ? 87.685  -104.897 -141.677 1.00 72.78  ? 92   TYR C CD2 1 
ATOM   3287  C  CE1 . TYR C  3 93  ? 85.423  -106.062 -140.573 1.00 73.95  ? 92   TYR C CE1 1 
ATOM   3288  C  CE2 . TYR C  3 93  ? 87.797  -105.679 -140.530 1.00 72.47  ? 92   TYR C CE2 1 
ATOM   3289  C  CZ  . TYR C  3 93  ? 86.661  -106.258 -139.985 1.00 73.47  ? 92   TYR C CZ  1 
ATOM   3290  O  OH  . TYR C  3 93  ? 86.757  -107.034 -138.854 1.00 74.52  ? 92   TYR C OH  1 
HETATM 3291  N  N   . MSE C  3 94  ? 84.759  -102.459 -141.101 1.00 74.73  ? 93   MSE C N   1 
HETATM 3292  C  CA  . MSE C  3 94  ? 83.695  -102.535 -140.102 1.00 74.81  ? 93   MSE C CA  1 
HETATM 3293  C  C   . MSE C  3 94  ? 82.776  -101.319 -140.096 1.00 72.86  ? 93   MSE C C   1 
HETATM 3294  O  O   . MSE C  3 94  ? 81.560  -101.450 -139.975 1.00 71.23  ? 93   MSE C O   1 
HETATM 3295  C  CB  . MSE C  3 94  ? 84.300  -102.705 -138.712 1.00 78.56  ? 93   MSE C CB  1 
HETATM 3296  C  CG  . MSE C  3 94  ? 84.177  -104.096 -138.141 1.00 83.27  ? 93   MSE C CG  1 
HETATM 3297  SE SE  . MSE C  3 94  ? 82.360  -104.635 -137.775 1.00 93.60  ? 93   MSE C SE  1 
HETATM 3298  C  CE  . MSE C  3 94  ? 81.704  -103.039 -136.904 1.00 89.14  ? 93   MSE C CE  1 
ATOM   3299  N  N   . GLU C  3 95  ? 83.370  -100.137 -140.209 1.00 71.52  ? 94   GLU C N   1 
ATOM   3300  C  CA  . GLU C  3 95  ? 82.614  -98.895  -140.209 1.00 70.39  ? 94   GLU C CA  1 
ATOM   3301  C  C   . GLU C  3 95  ? 81.723  -98.832  -141.443 1.00 69.53  ? 94   GLU C C   1 
ATOM   3302  O  O   . GLU C  3 95  ? 80.497  -98.806  -141.331 1.00 70.54  ? 94   GLU C O   1 
ATOM   3303  C  CB  . GLU C  3 95  ? 83.559  -97.685  -140.203 1.00 71.23  ? 94   GLU C CB  1 
ATOM   3304  C  CG  . GLU C  3 95  ? 84.503  -97.589  -139.007 1.00 72.17  ? 94   GLU C CG  1 
ATOM   3305  C  CD  . GLU C  3 95  ? 85.620  -98.621  -139.039 1.00 72.74  ? 94   GLU C CD  1 
ATOM   3306  O  OE1 . GLU C  3 95  ? 85.328  -99.827  -138.901 1.00 72.41  ? 94   GLU C OE1 1 
ATOM   3307  O  OE2 . GLU C  3 95  ? 86.797  -98.228  -139.206 1.00 73.45  ? 94   GLU C OE2 1 
ATOM   3308  N  N   . LEU C  3 96  ? 82.348  -98.808  -142.619 1.00 66.70  ? 95   LEU C N   1 
ATOM   3309  C  CA  . LEU C  3 96  ? 81.615  -98.742  -143.872 1.00 63.81  ? 95   LEU C CA  1 
ATOM   3310  C  C   . LEU C  3 96  ? 80.441  -99.707  -143.904 1.00 62.72  ? 95   LEU C C   1 
ATOM   3311  O  O   . LEU C  3 96  ? 79.395  -99.392  -144.461 1.00 63.13  ? 95   LEU C O   1 
ATOM   3312  C  CB  . LEU C  3 96  ? 82.556  -99.003  -145.051 1.00 62.63  ? 95   LEU C CB  1 
ATOM   3313  C  CG  . LEU C  3 96  ? 83.343  -97.774  -145.534 1.00 62.48  ? 95   LEU C CG  1 
ATOM   3314  C  CD1 . LEU C  3 96  ? 83.994  -97.073  -144.355 1.00 62.66  ? 95   LEU C CD1 1 
ATOM   3315  C  CD2 . LEU C  3 96  ? 84.389  -98.192  -146.545 1.00 60.51  ? 95   LEU C CD2 1 
ATOM   3316  N  N   . THR C  3 97  ? 80.602  -100.874 -143.293 1.00 61.90  ? 96   THR C N   1 
ATOM   3317  C  CA  . THR C  3 97  ? 79.528  -101.862 -143.265 1.00 61.78  ? 96   THR C CA  1 
ATOM   3318  C  C   . THR C  3 97  ? 78.393  -101.390 -142.364 1.00 62.41  ? 96   THR C C   1 
ATOM   3319  O  O   . THR C  3 97  ? 77.214  -101.589 -142.664 1.00 61.95  ? 96   THR C O   1 
ATOM   3320  C  CB  . THR C  3 97  ? 80.025  -103.219 -142.741 1.00 61.38  ? 96   THR C CB  1 
ATOM   3321  O  OG1 . THR C  3 97  ? 81.103  -103.683 -143.564 1.00 61.65  ? 96   THR C OG1 1 
ATOM   3322  C  CG2 . THR C  3 97  ? 78.895  -104.242 -142.759 1.00 61.08  ? 96   THR C CG2 1 
ATOM   3323  N  N   . LYS C  3 98  ? 78.764  -100.760 -141.256 1.00 62.76  ? 97   LYS C N   1 
ATOM   3324  C  CA  . LYS C  3 98  ? 77.795  -100.256 -140.296 1.00 63.63  ? 97   LYS C CA  1 
ATOM   3325  C  C   . LYS C  3 98  ? 77.087  -99.025  -140.839 1.00 64.08  ? 97   LYS C C   1 
ATOM   3326  O  O   . LYS C  3 98  ? 75.864  -98.909  -140.744 1.00 64.35  ? 97   LYS C O   1 
ATOM   3327  C  CB  . LYS C  3 98  ? 78.499  -99.940  -138.968 1.00 64.62  ? 97   LYS C CB  1 
ATOM   3328  C  CG  . LYS C  3 98  ? 77.668  -99.164  -137.952 1.00 64.44  ? 97   LYS C CG  1 
ATOM   3329  C  CD  . LYS C  3 98  ? 77.967  -97.675  -138.026 1.00 64.85  ? 97   LYS C CD  1 
ATOM   3330  C  CE  . LYS C  3 98  ? 77.122  -96.895  -137.041 1.00 65.83  ? 97   LYS C CE  1 
ATOM   3331  N  NZ  . LYS C  3 98  ? 77.475  -95.446  -137.038 1.00 67.16  ? 97   LYS C NZ  1 
ATOM   3332  N  N   . LEU C  3 99  ? 77.855  -98.112  -141.421 1.00 64.06  ? 98   LEU C N   1 
ATOM   3333  C  CA  . LEU C  3 99  ? 77.281  -96.898  -141.974 1.00 64.92  ? 98   LEU C CA  1 
ATOM   3334  C  C   . LEU C  3 99  ? 76.417  -97.159  -143.199 1.00 66.11  ? 98   LEU C C   1 
ATOM   3335  O  O   . LEU C  3 99  ? 75.361  -96.547  -143.351 1.00 66.50  ? 98   LEU C O   1 
ATOM   3336  C  CB  . LEU C  3 99  ? 78.387  -95.898  -142.312 1.00 64.49  ? 98   LEU C CB  1 
ATOM   3337  C  CG  . LEU C  3 99  ? 78.859  -95.067  -141.117 1.00 64.09  ? 98   LEU C CG  1 
ATOM   3338  C  CD1 . LEU C  3 99  ? 80.077  -94.239  -141.488 1.00 63.05  ? 98   LEU C CD1 1 
ATOM   3339  C  CD2 . LEU C  3 99  ? 77.711  -94.177  -140.658 1.00 62.52  ? 98   LEU C CD2 1 
ATOM   3340  N  N   . LEU C  3 100 ? 76.850  -98.071  -144.065 1.00 67.70  ? 99   LEU C N   1 
ATOM   3341  C  CA  . LEU C  3 100 ? 76.087  -98.383  -145.271 1.00 70.33  ? 99   LEU C CA  1 
ATOM   3342  C  C   . LEU C  3 100 ? 74.878  -99.285  -145.053 1.00 72.31  ? 99   LEU C C   1 
ATOM   3343  O  O   . LEU C  3 100 ? 73.882  -99.162  -145.763 1.00 72.82  ? 99   LEU C O   1 
ATOM   3344  C  CB  . LEU C  3 100 ? 76.980  -99.023  -146.332 1.00 69.55  ? 99   LEU C CB  1 
ATOM   3345  C  CG  . LEU C  3 100 ? 78.044  -98.132  -146.961 1.00 69.83  ? 99   LEU C CG  1 
ATOM   3346  C  CD1 . LEU C  3 100 ? 78.661  -98.864  -148.143 1.00 69.37  ? 99   LEU C CD1 1 
ATOM   3347  C  CD2 . LEU C  3 100 ? 77.420  -96.820  -147.412 1.00 70.75  ? 99   LEU C CD2 1 
ATOM   3348  N  N   . LEU C  3 101 ? 74.957  -100.194 -144.087 1.00 74.29  ? 100  LEU C N   1 
ATOM   3349  C  CA  . LEU C  3 101 ? 73.840  -101.095 -143.837 1.00 76.22  ? 100  LEU C CA  1 
ATOM   3350  C  C   . LEU C  3 101 ? 72.767  -100.483 -142.959 1.00 77.67  ? 100  LEU C C   1 
ATOM   3351  O  O   . LEU C  3 101 ? 71.671  -101.023 -142.837 1.00 78.43  ? 100  LEU C O   1 
ATOM   3352  C  CB  . LEU C  3 101 ? 74.338  -102.402 -143.226 1.00 76.45  ? 100  LEU C CB  1 
ATOM   3353  C  CG  . LEU C  3 101 ? 74.700  -103.483 -144.252 1.00 76.73  ? 100  LEU C CG  1 
ATOM   3354  C  CD1 . LEU C  3 101 ? 75.574  -102.906 -145.365 1.00 77.19  ? 100  LEU C CD1 1 
ATOM   3355  C  CD2 . LEU C  3 101 ? 75.408  -104.622 -143.542 1.00 77.55  ? 100  LEU C CD2 1 
ATOM   3356  N  N   . ASN C  3 102 ? 73.081  -99.351  -142.349 1.00 79.22  ? 101  ASN C N   1 
ATOM   3357  C  CA  . ASN C  3 102 ? 72.117  -98.677  -141.499 1.00 81.34  ? 101  ASN C CA  1 
ATOM   3358  C  C   . ASN C  3 102 ? 71.493  -97.535  -142.278 1.00 81.88  ? 101  ASN C C   1 
ATOM   3359  O  O   . ASN C  3 102 ? 70.323  -97.204  -142.090 1.00 82.55  ? 101  ASN C O   1 
ATOM   3360  C  CB  . ASN C  3 102 ? 72.794  -98.121  -140.238 1.00 82.90  ? 101  ASN C CB  1 
ATOM   3361  C  CG  . ASN C  3 102 ? 73.103  -99.197  -139.204 1.00 84.70  ? 101  ASN C CG  1 
ATOM   3362  O  OD1 . ASN C  3 102 ? 73.637  -98.904  -138.132 1.00 85.24  ? 101  ASN C OD1 1 
ATOM   3363  N  ND2 . ASN C  3 102 ? 72.765  -100.445 -139.518 1.00 85.72  ? 101  ASN C ND2 1 
ATOM   3364  N  N   . HIS C  3 103 ? 72.280  -96.945  -143.168 1.00 81.88  ? 102  HIS C N   1 
ATOM   3365  C  CA  . HIS C  3 103 ? 71.815  -95.814  -143.953 1.00 82.13  ? 102  HIS C CA  1 
ATOM   3366  C  C   . HIS C  3 103 ? 71.398  -96.093  -145.384 1.00 82.82  ? 102  HIS C C   1 
ATOM   3367  O  O   . HIS C  3 103 ? 70.595  -95.351  -145.945 1.00 83.04  ? 102  HIS C O   1 
ATOM   3368  C  CB  . HIS C  3 103 ? 72.884  -94.730  -143.968 1.00 81.80  ? 102  HIS C CB  1 
ATOM   3369  C  CG  . HIS C  3 103 ? 72.958  -93.942  -142.704 1.00 80.88  ? 102  HIS C CG  1 
ATOM   3370  N  ND1 . HIS C  3 103 ? 71.887  -93.231  -142.212 1.00 80.48  ? 102  HIS C ND1 1 
ATOM   3371  C  CD2 . HIS C  3 103 ? 73.981  -93.730  -141.844 1.00 81.22  ? 102  HIS C CD2 1 
ATOM   3372  C  CE1 . HIS C  3 103 ? 72.246  -92.612  -141.102 1.00 81.27  ? 102  HIS C CE1 1 
ATOM   3373  N  NE2 . HIS C  3 103 ? 73.512  -92.898  -140.857 1.00 81.76  ? 102  HIS C NE2 1 
ATOM   3374  N  N   . ALA C  3 104 ? 71.932  -97.148  -145.987 1.00 83.47  ? 103  ALA C N   1 
ATOM   3375  C  CA  . ALA C  3 104 ? 71.586  -97.429  -147.370 1.00 84.08  ? 103  ALA C CA  1 
ATOM   3376  C  C   . ALA C  3 104 ? 71.408  -98.896  -147.717 1.00 85.06  ? 103  ALA C C   1 
ATOM   3377  O  O   . ALA C  3 104 ? 71.857  -99.334  -148.769 1.00 85.32  ? 103  ALA C O   1 
ATOM   3378  C  CB  . ALA C  3 104 ? 72.631  -96.807  -148.283 1.00 83.52  ? 103  ALA C CB  1 
ATOM   3379  N  N   . SER C  3 105 ? 70.747  -99.659  -146.853 1.00 87.17  ? 104  SER C N   1 
ATOM   3380  C  CA  . SER C  3 105 ? 70.529  -101.075 -147.136 1.00 89.51  ? 104  SER C CA  1 
ATOM   3381  C  C   . SER C  3 105 ? 69.766  -101.233 -148.457 1.00 91.22  ? 104  SER C C   1 
ATOM   3382  O  O   . SER C  3 105 ? 69.890  -102.250 -149.142 1.00 91.15  ? 104  SER C O   1 
ATOM   3383  C  CB  . SER C  3 105 ? 69.755  -101.735 -145.990 1.00 89.09  ? 104  SER C CB  1 
ATOM   3384  O  OG  . SER C  3 105 ? 68.546  -101.048 -145.719 1.00 90.47  ? 104  SER C OG  1 
ATOM   3385  N  N   . ASP C  3 106 ? 68.990  -100.210 -148.809 1.00 93.18  ? 105  ASP C N   1 
ATOM   3386  C  CA  . ASP C  3 106 ? 68.205  -100.202 -150.043 1.00 95.20  ? 105  ASP C CA  1 
ATOM   3387  C  C   . ASP C  3 106 ? 69.076  -100.496 -151.251 1.00 96.22  ? 105  ASP C C   1 
ATOM   3388  O  O   . ASP C  3 106 ? 68.662  -101.189 -152.178 1.00 96.94  ? 105  ASP C O   1 
ATOM   3389  C  CB  . ASP C  3 106 ? 67.570  -98.829  -150.268 1.00 96.07  ? 105  ASP C CB  1 
ATOM   3390  C  CG  . ASP C  3 106 ? 66.714  -98.385  -149.112 1.00 97.75  ? 105  ASP C CG  1 
ATOM   3391  O  OD1 . ASP C  3 106 ? 66.244  -97.225  -149.145 1.00 97.84  ? 105  ASP C OD1 1 
ATOM   3392  O  OD2 . ASP C  3 106 ? 66.512  -99.193  -148.178 1.00 98.24  ? 105  ASP C OD2 1 
ATOM   3393  N  N   . ASN C  3 107 ? 70.284  -99.951  -151.230 1.00 96.74  ? 106  ASN C N   1 
ATOM   3394  C  CA  . ASN C  3 107 ? 71.215  -100.102 -152.332 1.00 97.75  ? 106  ASN C CA  1 
ATOM   3395  C  C   . ASN C  3 107 ? 72.132  -101.308 -152.192 1.00 99.14  ? 106  ASN C C   1 
ATOM   3396  O  O   . ASN C  3 107 ? 72.824  -101.676 -153.139 1.00 99.48  ? 106  ASN C O   1 
ATOM   3397  C  CB  . ASN C  3 107 ? 72.045  -98.825  -152.464 1.00 97.41  ? 106  ASN C CB  1 
ATOM   3398  C  CG  . ASN C  3 107 ? 71.192  -97.564  -152.403 1.00 97.04  ? 106  ASN C CG  1 
ATOM   3399  O  OD1 . ASN C  3 107 ? 71.705  -96.450  -152.506 1.00 96.52  ? 106  ASN C OD1 1 
ATOM   3400  N  ND2 . ASN C  3 107 ? 69.885  -97.737  -152.230 1.00 96.45  ? 106  ASN C ND2 1 
ATOM   3401  N  N   . ILE C  3 108 ? 72.145  -101.923 -151.015 1.00 101.13 ? 107  ILE C N   1 
ATOM   3402  C  CA  . ILE C  3 108 ? 72.990  -103.093 -150.797 1.00 102.92 ? 107  ILE C CA  1 
ATOM   3403  C  C   . ILE C  3 108 ? 72.246  -104.385 -151.124 1.00 103.59 ? 107  ILE C C   1 
ATOM   3404  O  O   . ILE C  3 108 ? 71.181  -104.667 -150.569 1.00 103.74 ? 107  ILE C O   1 
ATOM   3405  C  CB  . ILE C  3 108 ? 73.513  -103.180 -149.331 1.00 103.55 ? 107  ILE C CB  1 
ATOM   3406  C  CG1 . ILE C  3 108 ? 74.657  -102.186 -149.106 1.00 103.75 ? 107  ILE C CG1 1 
ATOM   3407  C  CG2 . ILE C  3 108 ? 74.034  -104.585 -149.044 1.00 103.61 ? 107  ILE C CG2 1 
ATOM   3408  C  CD1 . ILE C  3 108 ? 74.278  -100.741 -149.282 1.00 103.64 ? 107  ILE C CD1 1 
ATOM   3409  N  N   . PRO C  3 109 ? 72.802  -105.183 -152.045 1.00 104.16 ? 108  PRO C N   1 
ATOM   3410  C  CA  . PRO C  3 109 ? 72.214  -106.456 -152.463 1.00 104.83 ? 108  PRO C CA  1 
ATOM   3411  C  C   . PRO C  3 109 ? 72.057  -107.435 -151.292 1.00 105.71 ? 108  PRO C C   1 
ATOM   3412  O  O   . PRO C  3 109 ? 73.016  -108.108 -150.904 1.00 105.13 ? 108  PRO C O   1 
ATOM   3413  C  CB  . PRO C  3 109 ? 73.206  -106.954 -153.509 1.00 104.55 ? 108  PRO C CB  1 
ATOM   3414  C  CG  . PRO C  3 109 ? 73.706  -105.677 -154.120 1.00 103.74 ? 108  PRO C CG  1 
ATOM   3415  C  CD  . PRO C  3 109 ? 73.951  -104.833 -152.901 1.00 103.83 ? 108  PRO C CD  1 
ATOM   3416  N  N   . LYS C  3 110 ? 70.847  -107.510 -150.740 1.00 107.14 ? 109  LYS C N   1 
ATOM   3417  C  CA  . LYS C  3 110 ? 70.559  -108.398 -149.613 1.00 108.66 ? 109  LYS C CA  1 
ATOM   3418  C  C   . LYS C  3 110 ? 71.480  -108.071 -148.443 1.00 109.15 ? 109  LYS C C   1 
ATOM   3419  O  O   . LYS C  3 110 ? 72.601  -108.578 -148.361 1.00 109.10 ? 109  LYS C O   1 
ATOM   3420  C  CB  . LYS C  3 110 ? 70.753  -109.860 -150.020 1.00 109.39 ? 109  LYS C CB  1 
ATOM   3421  C  CG  . LYS C  3 110 ? 70.231  -110.861 -148.999 1.00 110.31 ? 109  LYS C CG  1 
ATOM   3422  C  CD  . LYS C  3 110 ? 68.722  -110.750 -148.856 1.00 110.74 ? 109  LYS C CD  1 
ATOM   3423  C  CE  . LYS C  3 110 ? 68.155  -111.850 -147.975 1.00 110.48 ? 109  LYS C CE  1 
ATOM   3424  N  NZ  . LYS C  3 110 ? 66.666  -111.792 -147.937 1.00 110.14 ? 109  LYS C NZ  1 
ATOM   3425  N  N   . ALA C  3 111 ? 70.993  -107.230 -147.537 1.00 109.63 ? 110  ALA C N   1 
ATOM   3426  C  CA  . ALA C  3 111 ? 71.767  -106.799 -146.376 1.00 109.78 ? 110  ALA C CA  1 
ATOM   3427  C  C   . ALA C  3 111 ? 71.876  -107.844 -145.272 1.00 109.99 ? 110  ALA C C   1 
ATOM   3428  O  O   . ALA C  3 111 ? 72.968  -108.319 -144.959 1.00 109.73 ? 110  ALA C O   1 
ATOM   3429  C  CB  . ALA C  3 111 ? 71.170  -105.514 -145.814 1.00 109.68 ? 110  ALA C CB  1 
ATOM   3430  N  N   . ASP C  3 112 ? 70.739  -108.185 -144.677 1.00 110.31 ? 111  ASP C N   1 
ATOM   3431  C  CA  . ASP C  3 112 ? 70.684  -109.162 -143.598 1.00 110.95 ? 111  ASP C CA  1 
ATOM   3432  C  C   . ASP C  3 112 ? 71.741  -110.258 -143.723 1.00 111.27 ? 111  ASP C C   1 
ATOM   3433  O  O   . ASP C  3 112 ? 72.335  -110.679 -142.729 1.00 111.49 ? 111  ASP C O   1 
ATOM   3434  C  CB  . ASP C  3 112 ? 69.293  -109.790 -143.553 1.00 111.57 ? 111  ASP C CB  1 
ATOM   3435  C  CG  . ASP C  3 112 ? 68.198  -108.756 -143.390 1.00 112.90 ? 111  ASP C CG  1 
ATOM   3436  O  OD1 . ASP C  3 112 ? 68.235  -108.003 -142.392 1.00 113.32 ? 111  ASP C OD1 1 
ATOM   3437  O  OD2 . ASP C  3 112 ? 67.302  -108.695 -144.261 1.00 113.19 ? 111  ASP C OD2 1 
ATOM   3438  N  N   . GLU C  3 113 ? 71.978  -110.711 -144.947 1.00 111.04 ? 112  GLU C N   1 
ATOM   3439  C  CA  . GLU C  3 113 ? 72.955  -111.761 -145.191 1.00 110.86 ? 112  GLU C CA  1 
ATOM   3440  C  C   . GLU C  3 113 ? 74.389  -111.246 -145.111 1.00 110.46 ? 112  GLU C C   1 
ATOM   3441  O  O   . GLU C  3 113 ? 75.224  -111.821 -144.415 1.00 110.79 ? 112  GLU C O   1 
ATOM   3442  C  CB  . GLU C  3 113 ? 72.707  -112.383 -146.565 1.00 111.47 ? 112  GLU C CB  1 
ATOM   3443  C  CG  . GLU C  3 113 ? 73.505  -113.646 -146.833 1.00 112.09 ? 112  GLU C CG  1 
ATOM   3444  C  CD  . GLU C  3 113 ? 73.194  -114.243 -148.190 1.00 112.30 ? 112  GLU C CD  1 
ATOM   3445  O  OE1 . GLU C  3 113 ? 71.994  -114.372 -148.514 1.00 112.27 ? 112  GLU C OE1 1 
ATOM   3446  O  OE2 . GLU C  3 113 ? 74.141  -114.589 -148.929 1.00 112.13 ? 112  GLU C OE2 1 
ATOM   3447  N  N   . ILE C  3 114 ? 74.670  -110.163 -145.828 1.00 109.97 ? 113  ILE C N   1 
ATOM   3448  C  CA  . ILE C  3 114 ? 76.007  -109.577 -145.844 1.00 108.90 ? 113  ILE C CA  1 
ATOM   3449  C  C   . ILE C  3 114 ? 76.414  -109.039 -144.475 1.00 107.83 ? 113  ILE C C   1 
ATOM   3450  O  O   . ILE C  3 114 ? 77.567  -109.160 -144.066 1.00 107.22 ? 113  ILE C O   1 
ATOM   3451  C  CB  . ILE C  3 114 ? 76.101  -108.433 -146.889 1.00 109.21 ? 113  ILE C CB  1 
ATOM   3452  C  CG1 . ILE C  3 114 ? 77.448  -107.723 -146.770 1.00 109.22 ? 113  ILE C CG1 1 
ATOM   3453  C  CG2 . ILE C  3 114 ? 74.974  -107.441 -146.688 1.00 108.40 ? 113  ILE C CG2 1 
ATOM   3454  C  CD1 . ILE C  3 114 ? 78.631  -108.648 -146.899 1.00 110.20 ? 113  ILE C CD1 1 
ATOM   3455  N  N   . ARG C  3 115 ? 75.457  -108.445 -143.775 1.00 106.85 ? 114  ARG C N   1 
ATOM   3456  C  CA  . ARG C  3 115 ? 75.694  -107.890 -142.449 1.00 106.03 ? 114  ARG C CA  1 
ATOM   3457  C  C   . ARG C  3 115 ? 76.396  -108.904 -141.558 1.00 105.33 ? 114  ARG C C   1 
ATOM   3458  O  O   . ARG C  3 115 ? 77.563  -108.738 -141.210 1.00 105.01 ? 114  ARG C O   1 
ATOM   3459  C  CB  . ARG C  3 115 ? 74.358  -107.488 -141.826 1.00 106.55 ? 114  ARG C CB  1 
ATOM   3460  C  CG  . ARG C  3 115 ? 74.430  -106.960 -140.408 1.00 105.94 ? 114  ARG C CG  1 
ATOM   3461  C  CD  . ARG C  3 115 ? 73.039  -106.558 -139.951 1.00 106.42 ? 114  ARG C CD  1 
ATOM   3462  N  NE  . ARG C  3 115 ? 72.492  -105.476 -140.768 1.00 106.80 ? 114  ARG C NE  1 
ATOM   3463  C  CZ  . ARG C  3 115 ? 71.247  -105.441 -141.236 1.00 107.15 ? 114  ARG C CZ  1 
ATOM   3464  N  NH1 . ARG C  3 115 ? 70.406  -106.434 -140.977 1.00 106.68 ? 114  ARG C NH1 1 
ATOM   3465  N  NH2 . ARG C  3 115 ? 70.841  -104.406 -141.960 1.00 107.79 ? 114  ARG C NH2 1 
ATOM   3466  N  N   . THR C  3 116 ? 75.671  -109.955 -141.194 1.00 104.99 ? 115  THR C N   1 
ATOM   3467  C  CA  . THR C  3 116 ? 76.208  -111.008 -140.344 1.00 104.75 ? 115  THR C CA  1 
ATOM   3468  C  C   . THR C  3 116 ? 77.563  -111.498 -140.857 1.00 104.45 ? 115  THR C C   1 
ATOM   3469  O  O   . THR C  3 116 ? 78.534  -111.565 -140.104 1.00 104.48 ? 115  THR C O   1 
ATOM   3470  C  CB  . THR C  3 116 ? 75.223  -112.201 -140.258 1.00 104.63 ? 115  THR C CB  1 
ATOM   3471  O  OG1 . THR C  3 116 ? 75.771  -113.218 -139.410 1.00 104.70 ? 115  THR C OG1 1 
ATOM   3472  C  CG2 . THR C  3 116 ? 74.958  -112.781 -141.640 1.00 104.46 ? 115  THR C CG2 1 
ATOM   3473  N  N   . LEU C  3 117 ? 77.622  -111.829 -142.141 1.00 104.14 ? 116  LEU C N   1 
ATOM   3474  C  CA  . LEU C  3 117 ? 78.851  -112.309 -142.763 1.00 104.28 ? 116  LEU C CA  1 
ATOM   3475  C  C   . LEU C  3 117 ? 80.068  -111.467 -142.369 1.00 104.42 ? 116  LEU C C   1 
ATOM   3476  O  O   . LEU C  3 117 ? 81.162  -111.994 -142.153 1.00 103.72 ? 116  LEU C O   1 
ATOM   3477  C  CB  . LEU C  3 117 ? 78.689  -112.296 -144.286 1.00 104.15 ? 116  LEU C CB  1 
ATOM   3478  C  CG  . LEU C  3 117 ? 79.903  -112.712 -145.119 1.00 103.97 ? 116  LEU C CG  1 
ATOM   3479  C  CD1 . LEU C  3 117 ? 80.220  -114.171 -144.855 1.00 104.08 ? 116  LEU C CD1 1 
ATOM   3480  C  CD2 . LEU C  3 117 ? 79.620  -112.488 -146.592 1.00 103.73 ? 116  LEU C CD2 1 
ATOM   3481  N  N   . VAL C  3 118 ? 79.870  -110.157 -142.274 1.00 105.04 ? 117  VAL C N   1 
ATOM   3482  C  CA  . VAL C  3 118 ? 80.951  -109.244 -141.923 1.00 105.49 ? 117  VAL C CA  1 
ATOM   3483  C  C   . VAL C  3 118 ? 81.438  -109.417 -140.490 1.00 105.76 ? 117  VAL C C   1 
ATOM   3484  O  O   . VAL C  3 118 ? 82.636  -109.567 -140.259 1.00 105.87 ? 117  VAL C O   1 
ATOM   3485  C  CB  . VAL C  3 118 ? 80.532  -107.764 -142.121 1.00 105.59 ? 117  VAL C CB  1 
ATOM   3486  C  CG1 . VAL C  3 118 ? 81.692  -106.839 -141.769 1.00 105.13 ? 117  VAL C CG1 1 
ATOM   3487  C  CG2 . VAL C  3 118 ? 80.098  -107.534 -143.559 1.00 105.14 ? 117  VAL C CG2 1 
ATOM   3488  N  N   . LYS C  3 119 ? 80.515  -109.401 -139.529 1.00 106.13 ? 118  LYS C N   1 
ATOM   3489  C  CA  . LYS C  3 119 ? 80.892  -109.539 -138.123 1.00 106.30 ? 118  LYS C CA  1 
ATOM   3490  C  C   . LYS C  3 119 ? 81.548  -110.885 -137.810 1.00 106.24 ? 118  LYS C C   1 
ATOM   3491  O  O   . LYS C  3 119 ? 82.421  -110.971 -136.944 1.00 106.15 ? 118  LYS C O   1 
ATOM   3492  C  CB  . LYS C  3 119 ? 79.677  -109.328 -137.209 1.00 106.17 ? 118  LYS C CB  1 
ATOM   3493  C  CG  . LYS C  3 119 ? 78.727  -110.506 -137.099 1.00 106.22 ? 118  LYS C CG  1 
ATOM   3494  C  CD  . LYS C  3 119 ? 77.752  -110.298 -135.942 1.00 107.07 ? 118  LYS C CD  1 
ATOM   3495  C  CE  . LYS C  3 119 ? 78.489  -110.113 -134.612 1.00 107.20 ? 118  LYS C CE  1 
ATOM   3496  N  NZ  . LYS C  3 119 ? 77.564  -109.867 -133.469 1.00 107.08 ? 118  LYS C NZ  1 
ATOM   3497  N  N   . ASP C  3 120 ? 81.129  -111.933 -138.511 1.00 105.94 ? 119  ASP C N   1 
ATOM   3498  C  CA  . ASP C  3 120 ? 81.704  -113.253 -138.298 1.00 105.36 ? 119  ASP C CA  1 
ATOM   3499  C  C   . ASP C  3 120 ? 83.188  -113.186 -138.600 1.00 104.92 ? 119  ASP C C   1 
ATOM   3500  O  O   . ASP C  3 120 ? 83.942  -114.094 -138.264 1.00 104.89 ? 119  ASP C O   1 
ATOM   3501  C  CB  . ASP C  3 120 ? 81.027  -114.274 -139.205 1.00 105.67 ? 119  ASP C CB  1 
ATOM   3502  C  CG  . ASP C  3 120 ? 79.591  -114.542 -138.802 1.00 106.40 ? 119  ASP C CG  1 
ATOM   3503  O  OD1 . ASP C  3 120 ? 78.865  -113.567 -138.508 1.00 106.16 ? 119  ASP C OD1 1 
ATOM   3504  O  OD2 . ASP C  3 120 ? 79.187  -115.725 -138.782 1.00 106.39 ? 119  ASP C OD2 1 
HETATM 3505  N  N   . MSE C  3 121 ? 83.595  -112.094 -139.237 1.00 105.07 ? 120  MSE C N   1 
HETATM 3506  C  CA  . MSE C  3 121 ? 84.991  -111.876 -139.588 1.00 105.30 ? 120  MSE C CA  1 
HETATM 3507  C  C   . MSE C  3 121 ? 85.648  -110.936 -138.587 1.00 103.32 ? 120  MSE C C   1 
HETATM 3508  O  O   . MSE C  3 121 ? 86.870  -110.818 -138.542 1.00 103.27 ? 120  MSE C O   1 
HETATM 3509  C  CB  . MSE C  3 121 ? 85.103  -111.280 -140.988 1.00 108.53 ? 120  MSE C CB  1 
HETATM 3510  C  CG  . MSE C  3 121 ? 86.536  -111.144 -141.469 1.00 112.74 ? 120  MSE C CG  1 
HETATM 3511  SE SE  . MSE C  3 121 ? 86.619  -110.297 -143.186 1.00 119.14 ? 120  MSE C SE  1 
HETATM 3512  C  CE  . MSE C  3 121 ? 85.643  -111.614 -144.201 1.00 116.86 ? 120  MSE C CE  1 
ATOM   3513  N  N   . TRP C  3 122 ? 84.826  -110.247 -137.804 1.00 101.16 ? 121  TRP C N   1 
ATOM   3514  C  CA  . TRP C  3 122 ? 85.330  -109.340 -136.782 1.00 98.77  ? 121  TRP C CA  1 
ATOM   3515  C  C   . TRP C  3 122 ? 85.453  -110.160 -135.510 1.00 97.56  ? 121  TRP C C   1 
ATOM   3516  O  O   . TRP C  3 122 ? 86.342  -109.930 -134.695 1.00 97.44  ? 121  TRP C O   1 
ATOM   3517  C  CB  . TRP C  3 122 ? 84.367  -108.156 -136.579 1.00 97.82  ? 121  TRP C CB  1 
ATOM   3518  C  CG  . TRP C  3 122 ? 84.510  -107.428 -135.249 1.00 95.80  ? 121  TRP C CG  1 
ATOM   3519  C  CD1 . TRP C  3 122 ? 84.001  -107.820 -134.043 1.00 95.63  ? 121  TRP C CD1 1 
ATOM   3520  C  CD2 . TRP C  3 122 ? 85.201  -106.191 -135.006 1.00 94.10  ? 121  TRP C CD2 1 
ATOM   3521  N  NE1 . TRP C  3 122 ? 84.328  -106.907 -133.069 1.00 94.68  ? 121  TRP C NE1 1 
ATOM   3522  C  CE2 . TRP C  3 122 ? 85.064  -105.899 -133.632 1.00 93.82  ? 121  TRP C CE2 1 
ATOM   3523  C  CE3 . TRP C  3 122 ? 85.920  -105.304 -135.814 1.00 93.23  ? 121  TRP C CE3 1 
ATOM   3524  C  CZ2 . TRP C  3 122 ? 85.621  -104.757 -133.051 1.00 93.40  ? 121  TRP C CZ2 1 
ATOM   3525  C  CZ3 . TRP C  3 122 ? 86.471  -104.168 -135.235 1.00 92.50  ? 121  TRP C CZ3 1 
ATOM   3526  C  CH2 . TRP C  3 122 ? 86.318  -103.906 -133.867 1.00 93.09  ? 121  TRP C CH2 1 
ATOM   3527  N  N   . ASP C  3 123 ? 84.562  -111.130 -135.350 1.00 95.87  ? 122  ASP C N   1 
ATOM   3528  C  CA  . ASP C  3 123 ? 84.598  -111.977 -134.174 1.00 94.50  ? 122  ASP C CA  1 
ATOM   3529  C  C   . ASP C  3 123 ? 85.791  -112.914 -134.236 1.00 93.41  ? 122  ASP C C   1 
ATOM   3530  O  O   . ASP C  3 123 ? 86.625  -112.918 -133.334 1.00 93.51  ? 122  ASP C O   1 
ATOM   3531  C  CB  . ASP C  3 123 ? 83.301  -112.772 -134.045 1.00 94.41  ? 122  ASP C CB  1 
ATOM   3532  C  CG  . ASP C  3 123 ? 82.105  -111.880 -133.788 1.00 95.06  ? 122  ASP C CG  1 
ATOM   3533  O  OD1 . ASP C  3 123 ? 82.229  -110.953 -132.958 1.00 94.27  ? 122  ASP C OD1 1 
ATOM   3534  O  OD2 . ASP C  3 123 ? 81.043  -112.105 -134.405 1.00 95.87  ? 122  ASP C OD2 1 
ATOM   3535  N  N   . THR C  3 124 ? 85.888  -113.702 -135.300 1.00 92.09  ? 123  THR C N   1 
ATOM   3536  C  CA  . THR C  3 124 ? 87.014  -114.618 -135.423 1.00 90.44  ? 123  THR C CA  1 
ATOM   3537  C  C   . THR C  3 124 ? 88.298  -113.868 -135.765 1.00 88.47  ? 123  THR C C   1 
ATOM   3538  O  O   . THR C  3 124 ? 89.292  -114.469 -136.167 1.00 88.25  ? 123  THR C O   1 
ATOM   3539  C  CB  . THR C  3 124 ? 86.751  -115.718 -136.480 1.00 90.98  ? 123  THR C CB  1 
ATOM   3540  O  OG1 . THR C  3 124 ? 86.240  -115.129 -137.682 1.00 90.69  ? 123  THR C OG1 1 
ATOM   3541  C  CG2 . THR C  3 124 ? 85.756  -116.738 -135.941 1.00 91.43  ? 123  THR C CG2 1 
ATOM   3542  N  N   . ARG C  3 125 ? 88.266  -112.548 -135.601 1.00 86.10  ? 124  ARG C N   1 
ATOM   3543  C  CA  . ARG C  3 125 ? 89.435  -111.711 -135.858 1.00 84.40  ? 124  ARG C CA  1 
ATOM   3544  C  C   . ARG C  3 125 ? 89.859  -111.153 -134.500 1.00 84.36  ? 124  ARG C C   1 
ATOM   3545  O  O   . ARG C  3 125 ? 91.048  -110.952 -134.225 1.00 83.14  ? 124  ARG C O   1 
ATOM   3546  C  CB  . ARG C  3 125 ? 89.080  -110.578 -136.826 1.00 81.98  ? 124  ARG C CB  1 
ATOM   3547  C  CG  . ARG C  3 125 ? 90.286  -109.944 -137.493 1.00 79.13  ? 124  ARG C CG  1 
ATOM   3548  C  CD  . ARG C  3 125 ? 89.962  -109.472 -138.900 1.00 75.63  ? 124  ARG C CD  1 
ATOM   3549  N  NE  . ARG C  3 125 ? 91.170  -109.134 -139.650 1.00 73.70  ? 124  ARG C NE  1 
ATOM   3550  C  CZ  . ARG C  3 125 ? 91.913  -108.050 -139.445 1.00 72.62  ? 124  ARG C CZ  1 
ATOM   3551  N  NH1 . ARG C  3 125 ? 92.996  -107.833 -140.177 1.00 72.40  ? 124  ARG C NH1 1 
ATOM   3552  N  NH2 . ARG C  3 125 ? 91.572  -107.172 -138.519 1.00 73.40  ? 124  ARG C NH2 1 
ATOM   3553  N  N   . ILE C  3 126 ? 88.855  -110.913 -133.659 1.00 84.45  ? 125  ILE C N   1 
ATOM   3554  C  CA  . ILE C  3 126 ? 89.055  -110.422 -132.302 1.00 84.34  ? 125  ILE C CA  1 
ATOM   3555  C  C   . ILE C  3 126 ? 89.580  -111.627 -131.543 1.00 84.32  ? 125  ILE C C   1 
ATOM   3556  O  O   . ILE C  3 126 ? 90.628  -111.565 -130.910 1.00 85.06  ? 125  ILE C O   1 
ATOM   3557  C  CB  . ILE C  3 126 ? 87.707  -109.945 -131.661 1.00 84.23  ? 125  ILE C CB  1 
ATOM   3558  C  CG1 . ILE C  3 126 ? 87.412  -108.493 -132.059 1.00 83.93  ? 125  ILE C CG1 1 
ATOM   3559  C  CG2 . ILE C  3 126 ? 87.750  -110.091 -130.150 1.00 83.68  ? 125  ILE C CG2 1 
ATOM   3560  C  CD1 . ILE C  3 126 ? 88.424  -107.478 -131.546 1.00 84.27  ? 125  ILE C CD1 1 
ATOM   3561  N  N   . ALA C  3 127 ? 88.842  -112.729 -131.628 1.00 84.01  ? 126  ALA C N   1 
ATOM   3562  C  CA  . ALA C  3 127 ? 89.231  -113.963 -130.965 1.00 83.25  ? 126  ALA C CA  1 
ATOM   3563  C  C   . ALA C  3 127 ? 90.728  -114.153 -131.166 1.00 82.83  ? 126  ALA C C   1 
ATOM   3564  O  O   . ALA C  3 127 ? 91.484  -114.279 -130.209 1.00 83.20  ? 126  ALA C O   1 
ATOM   3565  C  CB  . ALA C  3 127 ? 88.462  -115.139 -131.560 1.00 82.41  ? 126  ALA C CB  1 
ATOM   3566  N  N   . LYS C  3 128 ? 91.150  -114.148 -132.422 1.00 82.80  ? 127  LYS C N   1 
ATOM   3567  C  CA  . LYS C  3 128 ? 92.557  -114.320 -132.752 1.00 83.08  ? 127  LYS C CA  1 
ATOM   3568  C  C   . LYS C  3 128 ? 93.426  -113.201 -132.180 1.00 82.94  ? 127  LYS C C   1 
ATOM   3569  O  O   . LYS C  3 128 ? 94.644  -113.343 -132.076 1.00 83.55  ? 127  LYS C O   1 
ATOM   3570  C  CB  . LYS C  3 128 ? 92.728  -114.390 -134.272 1.00 83.26  ? 127  LYS C CB  1 
ATOM   3571  C  CG  . LYS C  3 128 ? 92.124  -115.635 -134.909 1.00 82.36  ? 127  LYS C CG  1 
ATOM   3572  C  CD  . LYS C  3 128 ? 92.110  -115.533 -136.427 1.00 82.98  ? 127  LYS C CD  1 
ATOM   3573  C  CE  . LYS C  3 128 ? 93.504  -115.328 -137.004 1.00 82.82  ? 127  LYS C CE  1 
ATOM   3574  N  NZ  . LYS C  3 128 ? 93.450  -115.011 -138.456 1.00 82.06  ? 127  LYS C NZ  1 
ATOM   3575  N  N   . LEU C  3 129 ? 92.804  -112.086 -131.815 1.00 82.05  ? 128  LEU C N   1 
ATOM   3576  C  CA  . LEU C  3 129 ? 93.543  -110.967 -131.249 1.00 80.84  ? 128  LEU C CA  1 
ATOM   3577  C  C   . LEU C  3 129 ? 93.721  -111.192 -129.752 1.00 80.99  ? 128  LEU C C   1 
ATOM   3578  O  O   . LEU C  3 129 ? 94.654  -110.669 -129.148 1.00 81.70  ? 128  LEU C O   1 
ATOM   3579  C  CB  . LEU C  3 129 ? 92.800  -109.651 -131.489 1.00 79.66  ? 128  LEU C CB  1 
ATOM   3580  C  CG  . LEU C  3 129 ? 93.543  -108.366 -131.110 1.00 78.74  ? 128  LEU C CG  1 
ATOM   3581  C  CD1 . LEU C  3 129 ? 94.717  -108.159 -132.047 1.00 77.44  ? 128  LEU C CD1 1 
ATOM   3582  C  CD2 . LEU C  3 129 ? 92.598  -107.181 -131.188 1.00 78.40  ? 128  LEU C CD2 1 
ATOM   3583  N  N   . ARG C  3 130 ? 92.822  -111.974 -129.158 1.00 80.65  ? 129  ARG C N   1 
ATOM   3584  C  CA  . ARG C  3 130 ? 92.889  -112.269 -127.731 1.00 80.21  ? 129  ARG C CA  1 
ATOM   3585  C  C   . ARG C  3 130 ? 93.905  -113.365 -127.432 1.00 80.35  ? 129  ARG C C   1 
ATOM   3586  O  O   . ARG C  3 130 ? 94.718  -113.235 -126.522 1.00 79.98  ? 129  ARG C O   1 
ATOM   3587  C  CB  . ARG C  3 130 ? 91.508  -112.668 -127.195 1.00 80.17  ? 129  ARG C CB  1 
ATOM   3588  C  CG  . ARG C  3 130 ? 90.530  -111.494 -127.114 1.00 80.58  ? 129  ARG C CG  1 
ATOM   3589  C  CD  . ARG C  3 130 ? 89.479  -111.676 -126.026 1.00 80.99  ? 129  ARG C CD  1 
ATOM   3590  N  NE  . ARG C  3 130 ? 88.203  -112.154 -126.542 1.00 83.01  ? 129  ARG C NE  1 
ATOM   3591  C  CZ  . ARG C  3 130 ? 88.015  -113.343 -127.105 1.00 84.71  ? 129  ARG C CZ  1 
ATOM   3592  N  NH1 . ARG C  3 130 ? 89.024  -114.195 -127.230 1.00 85.28  ? 129  ARG C NH1 1 
ATOM   3593  N  NH2 . ARG C  3 130 ? 86.810  -113.683 -127.544 1.00 85.95  ? 129  ARG C NH2 1 
ATOM   3594  N  N   . VAL C  3 131 ? 93.862  -114.444 -128.204 1.00 80.76  ? 130  VAL C N   1 
ATOM   3595  C  CA  . VAL C  3 131 ? 94.798  -115.541 -128.020 1.00 80.66  ? 130  VAL C CA  1 
ATOM   3596  C  C   . VAL C  3 131 ? 96.212  -115.055 -128.323 1.00 81.09  ? 130  VAL C C   1 
ATOM   3597  O  O   . VAL C  3 131 ? 97.174  -115.489 -127.695 1.00 81.23  ? 130  VAL C O   1 
ATOM   3598  C  CB  . VAL C  3 131 ? 94.453  -116.730 -128.947 1.00 80.49  ? 130  VAL C CB  1 
ATOM   3599  C  CG1 . VAL C  3 131 ? 95.519  -117.807 -128.842 1.00 80.46  ? 130  VAL C CG1 1 
ATOM   3600  C  CG2 . VAL C  3 131 ? 93.100  -117.307 -128.564 1.00 80.44  ? 130  VAL C CG2 1 
ATOM   3601  N  N   . SER C  3 132 ? 96.336  -114.148 -129.283 1.00 81.69  ? 131  SER C N   1 
ATOM   3602  C  CA  . SER C  3 132 ? 97.643  -113.616 -129.643 1.00 83.48  ? 131  SER C CA  1 
ATOM   3603  C  C   . SER C  3 132 ? 98.125  -112.613 -128.603 1.00 85.45  ? 131  SER C C   1 
ATOM   3604  O  O   . SER C  3 132 ? 99.283  -112.199 -128.619 1.00 86.05  ? 131  SER C O   1 
ATOM   3605  C  CB  . SER C  3 132 ? 97.587  -112.940 -131.013 1.00 83.27  ? 131  SER C CB  1 
ATOM   3606  O  OG  . SER C  3 132 ? 98.859  -112.432 -131.383 1.00 81.98  ? 131  SER C OG  1 
ATOM   3607  N  N   . ALA C  3 133 ? 97.230  -112.215 -127.703 1.00 87.53  ? 132  ALA C N   1 
ATOM   3608  C  CA  . ALA C  3 133 ? 97.576  -111.262 -126.648 1.00 88.94  ? 132  ALA C CA  1 
ATOM   3609  C  C   . ALA C  3 133 ? 98.181  -112.032 -125.477 1.00 89.79  ? 132  ALA C C   1 
ATOM   3610  O  O   . ALA C  3 133 ? 99.244  -111.680 -124.962 1.00 89.57  ? 132  ALA C O   1 
ATOM   3611  C  CB  . ALA C  3 133 ? 96.330  -110.506 -126.198 1.00 89.07  ? 132  ALA C CB  1 
ATOM   3612  N  N   . ASP C  3 134 ? 97.480  -113.086 -125.071 1.00 90.93  ? 133  ASP C N   1 
ATOM   3613  C  CA  . ASP C  3 134 ? 97.900  -113.966 -123.988 1.00 91.83  ? 133  ASP C CA  1 
ATOM   3614  C  C   . ASP C  3 134 ? 99.401  -114.211 -124.140 1.00 93.21  ? 133  ASP C C   1 
ATOM   3615  O  O   . ASP C  3 134 ? 100.140 -114.289 -123.158 1.00 93.56  ? 133  ASP C O   1 
ATOM   3616  C  CB  . ASP C  3 134 ? 97.142  -115.291 -124.113 1.00 91.57  ? 133  ASP C CB  1 
ATOM   3617  C  CG  . ASP C  3 134 ? 97.058  -116.047 -122.812 1.00 91.54  ? 133  ASP C CG  1 
ATOM   3618  O  OD1 . ASP C  3 134 ? 96.361  -115.570 -121.894 1.00 91.94  ? 133  ASP C OD1 1 
ATOM   3619  O  OD2 . ASP C  3 134 ? 97.684  -117.122 -122.709 1.00 91.80  ? 133  ASP C OD2 1 
ATOM   3620  N  N   . SER C  3 135 ? 99.838  -114.309 -125.393 1.00 94.46  ? 134  SER C N   1 
ATOM   3621  C  CA  . SER C  3 135 ? 101.234 -114.557 -125.733 1.00 95.55  ? 134  SER C CA  1 
ATOM   3622  C  C   . SER C  3 135 ? 102.189 -113.401 -125.444 1.00 96.22  ? 134  SER C C   1 
ATOM   3623  O  O   . SER C  3 135 ? 103.030 -113.510 -124.557 1.00 96.66  ? 134  SER C O   1 
ATOM   3624  C  CB  . SER C  3 135 ? 101.343 -114.944 -127.209 1.00 95.85  ? 134  SER C CB  1 
ATOM   3625  O  OG  . SER C  3 135 ? 102.686 -115.206 -127.569 1.00 96.45  ? 134  SER C OG  1 
ATOM   3626  N  N   . PHE C  3 136 ? 102.069 -112.306 -126.193 1.00 97.08  ? 135  PHE C N   1 
ATOM   3627  C  CA  . PHE C  3 136 ? 102.948 -111.148 -126.004 1.00 98.37  ? 135  PHE C CA  1 
ATOM   3628  C  C   . PHE C  3 136 ? 103.140 -110.824 -124.521 1.00 99.26  ? 135  PHE C C   1 
ATOM   3629  O  O   . PHE C  3 136 ? 104.217 -110.394 -124.108 1.00 98.79  ? 135  PHE C O   1 
ATOM   3630  C  CB  . PHE C  3 136 ? 102.390 -109.919 -126.740 1.00 98.32  ? 135  PHE C CB  1 
ATOM   3631  C  CG  . PHE C  3 136 ? 103.384 -108.786 -126.892 1.00 98.59  ? 135  PHE C CG  1 
ATOM   3632  C  CD1 . PHE C  3 136 ? 103.895 -108.122 -125.778 1.00 98.84  ? 135  PHE C CD1 1 
ATOM   3633  C  CD2 . PHE C  3 136 ? 103.811 -108.385 -128.155 1.00 98.76  ? 135  PHE C CD2 1 
ATOM   3634  C  CE1 . PHE C  3 136 ? 104.815 -107.079 -125.919 1.00 98.44  ? 135  PHE C CE1 1 
ATOM   3635  C  CE2 . PHE C  3 136 ? 104.731 -107.341 -128.305 1.00 98.95  ? 135  PHE C CE2 1 
ATOM   3636  C  CZ  . PHE C  3 136 ? 105.232 -106.689 -127.182 1.00 98.27  ? 135  PHE C CZ  1 
ATOM   3637  N  N   . VAL C  3 137 ? 102.092 -111.030 -123.727 1.00 100.34 ? 136  VAL C N   1 
ATOM   3638  C  CA  . VAL C  3 137 ? 102.159 -110.774 -122.291 1.00 101.38 ? 136  VAL C CA  1 
ATOM   3639  C  C   . VAL C  3 137 ? 103.029 -111.836 -121.637 1.00 102.02 ? 136  VAL C C   1 
ATOM   3640  O  O   . VAL C  3 137 ? 104.013 -111.519 -120.968 1.00 102.05 ? 136  VAL C O   1 
ATOM   3641  C  CB  . VAL C  3 137 ? 100.759 -110.828 -121.633 1.00 101.60 ? 136  VAL C CB  1 
ATOM   3642  C  CG1 . VAL C  3 137 ? 100.893 -110.823 -120.120 1.00 100.85 ? 136  VAL C CG1 1 
ATOM   3643  C  CG2 . VAL C  3 137 ? 99.926  -109.645 -122.085 1.00 102.02 ? 136  VAL C CG2 1 
ATOM   3644  N  N   . ARG C  3 138 ? 102.653 -113.098 -121.842 1.00 102.74 ? 137  ARG C N   1 
ATOM   3645  C  CA  . ARG C  3 138 ? 103.373 -114.237 -121.283 1.00 102.90 ? 137  ARG C CA  1 
ATOM   3646  C  C   . ARG C  3 138 ? 104.834 -114.283 -121.719 1.00 103.69 ? 137  ARG C C   1 
ATOM   3647  O  O   . ARG C  3 138 ? 105.734 -114.108 -120.898 1.00 103.60 ? 137  ARG C O   1 
ATOM   3648  C  CB  . ARG C  3 138 ? 102.647 -115.528 -121.658 1.00 101.63 ? 137  ARG C CB  1 
ATOM   3649  C  CG  . ARG C  3 138 ? 101.355 -115.706 -120.874 1.00 101.71 ? 137  ARG C CG  1 
ATOM   3650  C  CD  . ARG C  3 138 ? 100.379 -116.687 -121.504 1.00 101.92 ? 137  ARG C CD  1 
ATOM   3651  N  NE  . ARG C  3 138 ? 100.949 -118.010 -121.731 1.00 102.65 ? 137  ARG C NE  1 
ATOM   3652  C  CZ  . ARG C  3 138 ? 101.733 -118.322 -122.759 1.00 102.77 ? 137  ARG C CZ  1 
ATOM   3653  N  NH1 . ARG C  3 138 ? 102.045 -117.403 -123.662 1.00 103.02 ? 137  ARG C NH1 1 
ATOM   3654  N  NH2 . ARG C  3 138 ? 102.200 -119.556 -122.888 1.00 102.99 ? 137  ARG C NH2 1 
ATOM   3655  N  N   . GLN C  3 139 ? 105.079 -114.510 -123.004 1.00 104.82 ? 138  GLN C N   1 
ATOM   3656  C  CA  . GLN C  3 139 ? 106.453 -114.541 -123.490 1.00 106.40 ? 138  GLN C CA  1 
ATOM   3657  C  C   . GLN C  3 139 ? 107.055 -113.148 -123.288 1.00 106.75 ? 138  GLN C C   1 
ATOM   3658  O  O   . GLN C  3 139 ? 108.246 -112.935 -123.501 1.00 106.57 ? 138  GLN C O   1 
ATOM   3659  C  CB  . GLN C  3 139 ? 106.492 -114.923 -124.976 1.00 107.29 ? 138  GLN C CB  1 
ATOM   3660  C  CG  . GLN C  3 139 ? 106.008 -113.840 -125.932 1.00 108.57 ? 138  GLN C CG  1 
ATOM   3661  C  CD  . GLN C  3 139 ? 106.050 -114.287 -127.383 1.00 109.90 ? 138  GLN C CD  1 
ATOM   3662  O  OE1 . GLN C  3 139 ? 107.065 -114.798 -127.859 1.00 110.85 ? 138  GLN C OE1 1 
ATOM   3663  N  NE2 . GLN C  3 139 ? 104.947 -114.091 -128.096 1.00 110.46 ? 138  GLN C NE2 1 
ATOM   3664  N  N   . GLN C  3 140 ? 106.208 -112.209 -122.873 1.00 107.40 ? 139  GLN C N   1 
ATOM   3665  C  CA  . GLN C  3 140 ? 106.602 -110.824 -122.621 1.00 107.84 ? 139  GLN C CA  1 
ATOM   3666  C  C   . GLN C  3 140 ? 107.281 -110.158 -123.818 1.00 108.15 ? 139  GLN C C   1 
ATOM   3667  O  O   . GLN C  3 140 ? 106.830 -109.115 -124.306 1.00 107.75 ? 139  GLN C O   1 
ATOM   3668  C  CB  . GLN C  3 140 ? 107.515 -110.753 -121.389 1.00 107.59 ? 139  GLN C CB  1 
ATOM   3669  C  CG  . GLN C  3 140 ? 106.884 -111.322 -120.116 1.00 106.98 ? 139  GLN C CG  1 
ATOM   3670  C  CD  . GLN C  3 140 ? 107.632 -110.937 -118.846 1.00 106.35 ? 139  GLN C CD  1 
ATOM   3671  O  OE1 . GLN C  3 140 ? 108.822 -111.217 -118.696 1.00 104.99 ? 139  GLN C OE1 1 
ATOM   3672  N  NE2 . GLN C  3 140 ? 106.929 -110.292 -117.923 1.00 106.63 ? 139  GLN C NE2 1 
ATOM   3673  N  N   . ASP C  3 147 ? 100.467 -106.051 -136.587 1.00 95.50  ? 146  ASP C N   1 
ATOM   3674  C  CA  . ASP C  3 147 ? 99.908  -105.202 -137.635 1.00 95.42  ? 146  ASP C CA  1 
ATOM   3675  C  C   . ASP C  3 147 ? 98.943  -105.972 -138.532 1.00 95.05  ? 146  ASP C C   1 
ATOM   3676  O  O   . ASP C  3 147 ? 98.801  -107.191 -138.399 1.00 94.81  ? 146  ASP C O   1 
ATOM   3677  C  CB  . ASP C  3 147 ? 101.030 -104.597 -138.489 1.00 95.67  ? 146  ASP C CB  1 
ATOM   3678  C  CG  . ASP C  3 147 ? 101.726 -105.627 -139.366 1.00 95.17  ? 146  ASP C CG  1 
ATOM   3679  O  OD1 . ASP C  3 147 ? 102.760 -105.280 -139.980 1.00 94.12  ? 146  ASP C OD1 1 
ATOM   3680  O  OD2 . ASP C  3 147 ? 101.239 -106.775 -139.447 1.00 94.61  ? 146  ASP C OD2 1 
ATOM   3681  N  N   . ASN C  3 148 ? 98.303  -105.239 -139.446 1.00 94.55  ? 147  ASN C N   1 
ATOM   3682  C  CA  . ASN C  3 148 ? 97.320  -105.764 -140.403 1.00 93.56  ? 147  ASN C CA  1 
ATOM   3683  C  C   . ASN C  3 148 ? 95.902  -105.601 -139.833 1.00 92.82  ? 147  ASN C C   1 
ATOM   3684  O  O   . ASN C  3 148 ? 94.924  -106.069 -140.423 1.00 92.04  ? 147  ASN C O   1 
ATOM   3685  C  CB  . ASN C  3 148 ? 97.584  -107.244 -140.720 1.00 93.79  ? 147  ASN C CB  1 
ATOM   3686  C  CG  . ASN C  3 148 ? 97.326  -107.588 -142.178 1.00 93.94  ? 147  ASN C CG  1 
ATOM   3687  O  OD1 . ASN C  3 148 ? 97.202  -108.761 -142.539 1.00 93.65  ? 147  ASN C OD1 1 
ATOM   3688  N  ND2 . ASN C  3 148 ? 97.262  -106.567 -143.026 1.00 94.24  ? 147  ASN C ND2 1 
ATOM   3689  N  N   . LEU C  3 149 ? 95.807  -104.934 -138.682 1.00 91.53  ? 148  LEU C N   1 
ATOM   3690  C  CA  . LEU C  3 149 ? 94.528  -104.694 -138.013 1.00 89.59  ? 148  LEU C CA  1 
ATOM   3691  C  C   . LEU C  3 149 ? 93.991  -103.308 -138.348 1.00 87.82  ? 148  LEU C C   1 
ATOM   3692  O  O   . LEU C  3 149 ? 94.744  -102.415 -138.743 1.00 87.59  ? 148  LEU C O   1 
ATOM   3693  C  CB  . LEU C  3 149 ? 94.678  -104.794 -136.488 1.00 90.83  ? 148  LEU C CB  1 
ATOM   3694  C  CG  . LEU C  3 149 ? 95.019  -106.109 -135.777 1.00 91.15  ? 148  LEU C CG  1 
ATOM   3695  C  CD1 . LEU C  3 149 ? 93.967  -107.154 -136.116 1.00 91.12  ? 148  LEU C CD1 1 
ATOM   3696  C  CD2 . LEU C  3 149 ? 96.411  -106.574 -136.172 1.00 91.07  ? 148  LEU C CD2 1 
ATOM   3697  N  N   . THR C  3 150 ? 92.686  -103.135 -138.169 1.00 85.43  ? 149  THR C N   1 
ATOM   3698  C  CA  . THR C  3 150 ? 92.030  -101.861 -138.433 1.00 83.21  ? 149  THR C CA  1 
ATOM   3699  C  C   . THR C  3 150 ? 91.963  -101.049 -137.137 1.00 81.90  ? 149  THR C C   1 
ATOM   3700  O  O   . THR C  3 150 ? 91.780  -101.612 -136.058 1.00 82.18  ? 149  THR C O   1 
ATOM   3701  C  CB  . THR C  3 150 ? 90.601  -102.089 -138.976 1.00 82.96  ? 149  THR C CB  1 
ATOM   3702  O  OG1 . THR C  3 150 ? 89.822  -102.801 -138.011 1.00 82.18  ? 149  THR C OG1 1 
ATOM   3703  C  CG2 . THR C  3 150 ? 90.648  -102.907 -140.246 1.00 82.93  ? 149  THR C CG2 1 
ATOM   3704  N  N   . LEU C  3 151 ? 92.118  -99.731  -137.238 1.00 79.70  ? 150  LEU C N   1 
ATOM   3705  C  CA  . LEU C  3 151 ? 92.075  -98.878  -136.054 1.00 77.73  ? 150  LEU C CA  1 
ATOM   3706  C  C   . LEU C  3 151 ? 90.891  -99.210  -135.164 1.00 77.29  ? 150  LEU C C   1 
ATOM   3707  O  O   . LEU C  3 151 ? 90.962  -99.083  -133.950 1.00 77.82  ? 150  LEU C O   1 
ATOM   3708  C  CB  . LEU C  3 151 ? 91.981  -97.405  -136.442 1.00 76.32  ? 150  LEU C CB  1 
ATOM   3709  C  CG  . LEU C  3 151 ? 93.092  -96.793  -137.284 1.00 76.10  ? 150  LEU C CG  1 
ATOM   3710  C  CD1 . LEU C  3 151 ? 92.924  -95.285  -137.261 1.00 75.95  ? 150  LEU C CD1 1 
ATOM   3711  C  CD2 . LEU C  3 151 ? 94.454  -97.177  -136.736 1.00 75.72  ? 150  LEU C CD2 1 
HETATM 3712  N  N   . MSE C  3 152 ? 89.795  -99.632  -135.771 1.00 77.00  ? 151  MSE C N   1 
HETATM 3713  C  CA  . MSE C  3 152 ? 88.606  -99.958  -135.009 1.00 77.66  ? 151  MSE C CA  1 
HETATM 3714  C  C   . MSE C  3 152 ? 88.799  -101.200 -134.152 1.00 78.05  ? 151  MSE C C   1 
HETATM 3715  O  O   . MSE C  3 152 ? 88.019  -101.461 -133.236 1.00 78.22  ? 151  MSE C O   1 
HETATM 3716  C  CB  . MSE C  3 152 ? 87.423  -100.164 -135.953 1.00 78.63  ? 151  MSE C CB  1 
HETATM 3717  C  CG  . MSE C  3 152 ? 86.082  -100.238 -135.251 1.00 79.65  ? 151  MSE C CG  1 
HETATM 3718  SE SE  . MSE C  3 152 ? 85.753  -98.663  -134.182 1.00 83.15  ? 151  MSE C SE  1 
HETATM 3719  C  CE  . MSE C  3 152 ? 84.235  -99.326  -133.196 1.00 80.66  ? 151  MSE C CE  1 
ATOM   3720  N  N   . GLU C  3 153 ? 89.841  -101.967 -134.444 1.00 77.94  ? 152  GLU C N   1 
ATOM   3721  C  CA  . GLU C  3 153 ? 90.109  -103.184 -133.689 1.00 78.60  ? 152  GLU C CA  1 
ATOM   3722  C  C   . GLU C  3 153 ? 91.140  -102.948 -132.584 1.00 78.66  ? 152  GLU C C   1 
ATOM   3723  O  O   . GLU C  3 153 ? 90.998  -103.447 -131.461 1.00 78.55  ? 152  GLU C O   1 
ATOM   3724  C  CB  . GLU C  3 153 ? 90.588  -104.276 -134.645 1.00 78.23  ? 152  GLU C CB  1 
ATOM   3725  C  CG  . GLU C  3 153 ? 89.600  -104.519 -135.760 1.00 79.12  ? 152  GLU C CG  1 
ATOM   3726  C  CD  . GLU C  3 153 ? 90.172  -105.325 -136.899 1.00 80.00  ? 152  GLU C CD  1 
ATOM   3727  O  OE1 . GLU C  3 153 ? 91.239  -104.940 -137.426 1.00 79.66  ? 152  GLU C OE1 1 
ATOM   3728  O  OE2 . GLU C  3 153 ? 89.542  -106.337 -137.275 1.00 79.64  ? 152  GLU C OE2 1 
ATOM   3729  N  N   . ILE C  3 154 ? 92.161  -102.161 -132.903 1.00 78.10  ? 153  ILE C N   1 
ATOM   3730  C  CA  . ILE C  3 154 ? 93.219  -101.870 -131.955 1.00 77.55  ? 153  ILE C CA  1 
ATOM   3731  C  C   . ILE C  3 154 ? 92.849  -100.808 -130.922 1.00 77.65  ? 153  ILE C C   1 
ATOM   3732  O  O   . ILE C  3 154 ? 93.695  -100.385 -130.138 1.00 78.49  ? 153  ILE C O   1 
ATOM   3733  C  CB  . ILE C  3 154 ? 94.505  -101.442 -132.691 1.00 77.77  ? 153  ILE C CB  1 
ATOM   3734  C  CG1 . ILE C  3 154 ? 94.399  -99.993  -133.152 1.00 77.75  ? 153  ILE C CG1 1 
ATOM   3735  C  CG2 . ILE C  3 154 ? 94.720  -102.329 -133.913 1.00 78.16  ? 153  ILE C CG2 1 
ATOM   3736  C  CD1 . ILE C  3 154 ? 95.630  -99.509  -133.870 1.00 76.43  ? 153  ILE C CD1 1 
ATOM   3737  N  N   . ASN C  3 155 ? 91.595  -100.370 -130.919 1.00 77.74  ? 154  ASN C N   1 
ATOM   3738  C  CA  . ASN C  3 155 ? 91.156  -99.376  -129.946 1.00 77.61  ? 154  ASN C CA  1 
ATOM   3739  C  C   . ASN C  3 155 ? 90.040  -99.937  -129.086 1.00 78.80  ? 154  ASN C C   1 
ATOM   3740  O  O   . ASN C  3 155 ? 89.917  -99.591  -127.913 1.00 79.41  ? 154  ASN C O   1 
ATOM   3741  C  CB  . ASN C  3 155 ? 90.686  -98.096  -130.633 1.00 76.40  ? 154  ASN C CB  1 
ATOM   3742  C  CG  . ASN C  3 155 ? 91.831  -97.302  -131.227 1.00 76.11  ? 154  ASN C CG  1 
ATOM   3743  O  OD1 . ASN C  3 155 ? 91.726  -96.093  -131.432 1.00 76.10  ? 154  ASN C OD1 1 
ATOM   3744  N  ND2 . ASN C  3 155 ? 92.932  -97.981  -131.513 1.00 75.42  ? 154  ASN C ND2 1 
ATOM   3745  N  N   . THR C  3 156 ? 89.226  -100.809 -129.668 1.00 80.04  ? 155  THR C N   1 
ATOM   3746  C  CA  . THR C  3 156 ? 88.139  -101.418 -128.916 1.00 81.75  ? 155  THR C CA  1 
ATOM   3747  C  C   . THR C  3 156 ? 88.750  -102.414 -127.942 1.00 81.61  ? 155  THR C C   1 
ATOM   3748  O  O   . THR C  3 156 ? 88.064  -102.960 -127.076 1.00 82.32  ? 155  THR C O   1 
ATOM   3749  C  CB  . THR C  3 156 ? 87.160  -102.161 -129.841 1.00 83.26  ? 155  THR C CB  1 
ATOM   3750  O  OG1 . THR C  3 156 ? 87.867  -103.166 -130.581 1.00 85.08  ? 155  THR C OG1 1 
ATOM   3751  C  CG2 . THR C  3 156 ? 86.497  -101.186 -130.804 1.00 84.09  ? 155  THR C CG2 1 
ATOM   3752  N  N   . SER C  3 157 ? 90.049  -102.647 -128.101 1.00 81.20  ? 156  SER C N   1 
ATOM   3753  C  CA  . SER C  3 157 ? 90.785  -103.566 -127.243 1.00 80.95  ? 156  SER C CA  1 
ATOM   3754  C  C   . SER C  3 157 ? 92.077  -102.892 -126.798 1.00 80.18  ? 156  SER C C   1 
ATOM   3755  O  O   . SER C  3 157 ? 92.673  -103.260 -125.784 1.00 79.36  ? 156  SER C O   1 
ATOM   3756  C  CB  . SER C  3 157 ? 91.101  -104.857 -128.000 1.00 81.42  ? 156  SER C CB  1 
ATOM   3757  O  OG  . SER C  3 157 ? 89.910  -105.522 -128.392 1.00 82.89  ? 156  SER C OG  1 
ATOM   3758  N  N   . GLY C  3 158 ? 92.491  -101.896 -127.576 1.00 79.17  ? 157  GLY C N   1 
ATOM   3759  C  CA  . GLY C  3 158 ? 93.702  -101.155 -127.279 1.00 77.40  ? 157  GLY C CA  1 
ATOM   3760  C  C   . GLY C  3 158 ? 93.872  -100.844 -125.810 1.00 76.62  ? 157  GLY C C   1 
ATOM   3761  O  O   . GLY C  3 158 ? 94.628  -101.521 -125.121 1.00 77.04  ? 157  GLY C O   1 
ATOM   3762  N  N   . THR C  3 159 ? 93.161  -99.829  -125.330 1.00 76.30  ? 158  THR C N   1 
ATOM   3763  C  CA  . THR C  3 159 ? 93.239  -99.410  -123.929 1.00 76.28  ? 158  THR C CA  1 
ATOM   3764  C  C   . THR C  3 159 ? 93.490  -100.535 -122.908 1.00 75.26  ? 158  THR C C   1 
ATOM   3765  O  O   . THR C  3 159 ? 94.352  -100.400 -122.045 1.00 75.23  ? 158  THR C O   1 
ATOM   3766  C  CB  . THR C  3 159 ? 91.970  -98.607  -123.520 1.00 76.30  ? 158  THR C CB  1 
ATOM   3767  O  OG1 . THR C  3 159 ? 90.816  -99.159  -124.171 1.00 76.13  ? 158  THR C OG1 1 
ATOM   3768  C  CG2 . THR C  3 159 ? 92.123  -97.139  -123.907 1.00 75.52  ? 158  THR C CG2 1 
ATOM   3769  N  N   . PHE C  3 160 ? 92.747  -101.635 -123.002 1.00 74.49  ? 159  PHE C N   1 
ATOM   3770  C  CA  . PHE C  3 160 ? 92.927  -102.762 -122.085 1.00 73.33  ? 159  PHE C CA  1 
ATOM   3771  C  C   . PHE C  3 160 ? 94.341  -103.314 -122.231 1.00 73.51  ? 159  PHE C C   1 
ATOM   3772  O  O   . PHE C  3 160 ? 95.137  -103.263 -121.295 1.00 74.19  ? 159  PHE C O   1 
ATOM   3773  C  CB  . PHE C  3 160 ? 91.901  -103.858 -122.393 1.00 72.99  ? 159  PHE C CB  1 
ATOM   3774  C  CG  . PHE C  3 160 ? 92.103  -105.138 -121.620 1.00 72.27  ? 159  PHE C CG  1 
ATOM   3775  C  CD1 . PHE C  3 160 ? 93.172  -105.983 -121.900 1.00 71.55  ? 159  PHE C CD1 1 
ATOM   3776  C  CD2 . PHE C  3 160 ? 91.192  -105.522 -120.642 1.00 72.53  ? 159  PHE C CD2 1 
ATOM   3777  C  CE1 . PHE C  3 160 ? 93.326  -107.190 -121.222 1.00 70.93  ? 159  PHE C CE1 1 
ATOM   3778  C  CE2 . PHE C  3 160 ? 91.340  -106.732 -119.957 1.00 71.83  ? 159  PHE C CE2 1 
ATOM   3779  C  CZ  . PHE C  3 160 ? 92.408  -107.565 -120.251 1.00 70.81  ? 159  PHE C CZ  1 
ATOM   3780  N  N   . LEU C  3 161 ? 94.648  -103.845 -123.408 1.00 73.07  ? 160  LEU C N   1 
ATOM   3781  C  CA  . LEU C  3 161 ? 95.968  -104.395 -123.662 1.00 72.53  ? 160  LEU C CA  1 
ATOM   3782  C  C   . LEU C  3 161 ? 97.019  -103.363 -123.263 1.00 72.46  ? 160  LEU C C   1 
ATOM   3783  O  O   . LEU C  3 161 ? 98.083  -103.710 -122.773 1.00 72.78  ? 160  LEU C O   1 
ATOM   3784  C  CB  . LEU C  3 161 ? 96.117  -104.753 -125.144 1.00 72.63  ? 160  LEU C CB  1 
ATOM   3785  C  CG  . LEU C  3 161 ? 95.010  -105.601 -125.791 1.00 72.99  ? 160  LEU C CG  1 
ATOM   3786  C  CD1 . LEU C  3 161 ? 95.398  -105.862 -127.236 1.00 72.33  ? 160  LEU C CD1 1 
ATOM   3787  C  CD2 . LEU C  3 161 ? 94.798  -106.925 -125.049 1.00 71.18  ? 160  LEU C CD2 1 
ATOM   3788  N  N   . THR C  3 162 ? 96.708  -102.089 -123.469 1.00 72.91  ? 161  THR C N   1 
ATOM   3789  C  CA  . THR C  3 162 ? 97.630  -101.012 -123.119 1.00 73.63  ? 161  THR C CA  1 
ATOM   3790  C  C   . THR C  3 162 ? 97.957  -101.075 -121.630 1.00 74.80  ? 161  THR C C   1 
ATOM   3791  O  O   . THR C  3 162 ? 99.125  -101.050 -121.238 1.00 74.52  ? 161  THR C O   1 
ATOM   3792  C  CB  . THR C  3 162 ? 97.016  -99.626  -123.409 1.00 72.97  ? 161  THR C CB  1 
ATOM   3793  O  OG1 . THR C  3 162 ? 96.627  -99.553  -124.781 1.00 73.24  ? 161  THR C OG1 1 
ATOM   3794  C  CG2 . THR C  3 162 ? 98.019  -98.523  -123.121 1.00 72.17  ? 161  THR C CG2 1 
ATOM   3795  N  N   . GLN C  3 163 ? 96.917  -101.147 -120.803 1.00 75.34  ? 162  GLN C N   1 
ATOM   3796  C  CA  . GLN C  3 163 ? 97.106  -101.200 -119.363 1.00 75.42  ? 162  GLN C CA  1 
ATOM   3797  C  C   . GLN C  3 163 ? 97.910  -102.418 -118.973 1.00 74.98  ? 162  GLN C C   1 
ATOM   3798  O  O   . GLN C  3 163 ? 98.957  -102.296 -118.348 1.00 75.63  ? 162  GLN C O   1 
ATOM   3799  C  CB  . GLN C  3 163 ? 95.768  -101.241 -118.631 1.00 76.59  ? 162  GLN C CB  1 
ATOM   3800  C  CG  . GLN C  3 163 ? 94.947  -99.972  -118.719 1.00 77.51  ? 162  GLN C CG  1 
ATOM   3801  C  CD  . GLN C  3 163 ? 93.947  -99.871  -117.580 1.00 79.04  ? 162  GLN C CD  1 
ATOM   3802  O  OE1 . GLN C  3 163 ? 93.358  -100.873 -117.155 1.00 78.15  ? 162  GLN C OE1 1 
ATOM   3803  N  NE2 . GLN C  3 163 ? 93.744  -98.655  -117.081 1.00 80.08  ? 162  GLN C NE2 1 
ATOM   3804  N  N   . ALA C  3 164 ? 97.413  -103.593 -119.339 1.00 74.16  ? 163  ALA C N   1 
ATOM   3805  C  CA  . ALA C  3 164 ? 98.096  -104.836 -119.015 1.00 74.67  ? 163  ALA C CA  1 
ATOM   3806  C  C   . ALA C  3 164 ? 99.606  -104.700 -119.212 1.00 75.38  ? 163  ALA C C   1 
ATOM   3807  O  O   . ALA C  3 164 ? 100.390 -105.058 -118.329 1.00 75.76  ? 163  ALA C O   1 
ATOM   3808  C  CB  . ALA C  3 164 ? 97.548  -105.974 -119.870 1.00 73.83  ? 163  ALA C CB  1 
ATOM   3809  N  N   . LEU C  3 165 ? 100.014 -104.173 -120.361 1.00 75.62  ? 164  LEU C N   1 
ATOM   3810  C  CA  . LEU C  3 165 ? 101.433 -104.001 -120.648 1.00 76.69  ? 164  LEU C CA  1 
ATOM   3811  C  C   . LEU C  3 165 ? 102.078 -102.970 -119.717 1.00 77.84  ? 164  LEU C C   1 
ATOM   3812  O  O   . LEU C  3 165 ? 103.266 -103.062 -119.411 1.00 78.55  ? 164  LEU C O   1 
ATOM   3813  C  CB  . LEU C  3 165 ? 101.632 -103.601 -122.118 1.00 75.85  ? 164  LEU C CB  1 
ATOM   3814  C  CG  . LEU C  3 165 ? 101.523 -104.702 -123.186 1.00 75.29  ? 164  LEU C CG  1 
ATOM   3815  C  CD1 . LEU C  3 165 ? 102.731 -105.608 -123.105 1.00 75.37  ? 164  LEU C CD1 1 
ATOM   3816  C  CD2 . LEU C  3 165 ? 100.251 -105.516 -122.999 1.00 74.85  ? 164  LEU C CD2 1 
ATOM   3817  N  N   . ASN C  3 166 ? 101.297 -101.993 -119.265 1.00 79.06  ? 165  ASN C N   1 
ATOM   3818  C  CA  . ASN C  3 166 ? 101.814 -100.974 -118.358 1.00 80.45  ? 165  ASN C CA  1 
ATOM   3819  C  C   . ASN C  3 166 ? 101.979 -101.539 -116.963 1.00 81.69  ? 165  ASN C C   1 
ATOM   3820  O  O   . ASN C  3 166 ? 102.586 -100.909 -116.103 1.00 82.50  ? 165  ASN C O   1 
ATOM   3821  C  CB  . ASN C  3 166 ? 100.882 -99.767  -118.288 1.00 79.84  ? 165  ASN C CB  1 
ATOM   3822  C  CG  . ASN C  3 166 ? 101.071 -98.828  -119.447 1.00 79.52  ? 165  ASN C CG  1 
ATOM   3823  O  OD1 . ASN C  3 166 ? 102.196 -98.583  -119.876 1.00 79.54  ? 165  ASN C OD1 1 
ATOM   3824  N  ND2 . ASN C  3 166 ? 99.974  -98.280  -119.954 1.00 79.85  ? 165  ASN C ND2 1 
ATOM   3825  N  N   . HIS C  3 167 ? 101.417 -102.721 -116.738 1.00 82.86  ? 166  HIS C N   1 
ATOM   3826  C  CA  . HIS C  3 167 ? 101.514 -103.380 -115.445 1.00 84.36  ? 166  HIS C CA  1 
ATOM   3827  C  C   . HIS C  3 167 ? 102.605 -104.429 -115.519 1.00 86.81  ? 166  HIS C C   1 
ATOM   3828  O  O   . HIS C  3 167 ? 103.146 -104.846 -114.503 1.00 87.69  ? 166  HIS C O   1 
ATOM   3829  C  CB  . HIS C  3 167 ? 100.185 -104.036 -115.074 1.00 82.76  ? 166  HIS C CB  1 
ATOM   3830  C  CG  . HIS C  3 167 ? 99.099  -103.058 -114.747 1.00 81.28  ? 166  HIS C CG  1 
ATOM   3831  N  ND1 . HIS C  3 167 ? 97.832  -103.451 -114.375 1.00 80.33  ? 166  HIS C ND1 1 
ATOM   3832  C  CD2 . HIS C  3 167 ? 99.095  -101.704 -114.726 1.00 80.09  ? 166  HIS C CD2 1 
ATOM   3833  C  CE1 . HIS C  3 167 ? 97.093  -102.382 -114.137 1.00 79.64  ? 166  HIS C CE1 1 
ATOM   3834  N  NE2 . HIS C  3 167 ? 97.836  -101.309 -114.343 1.00 79.47  ? 166  HIS C NE2 1 
HETATM 3835  N  N   . MSE C  3 168 ? 102.922 -104.856 -116.735 1.00 90.11  ? 167  MSE C N   1 
HETATM 3836  C  CA  . MSE C  3 168 ? 103.969 -105.844 -116.950 1.00 93.23  ? 167  MSE C CA  1 
HETATM 3837  C  C   . MSE C  3 168 ? 105.279 -105.199 -116.563 1.00 92.74  ? 167  MSE C C   1 
HETATM 3838  O  O   . MSE C  3 168 ? 105.822 -105.444 -115.490 1.00 92.53  ? 167  MSE C O   1 
HETATM 3839  C  CB  . MSE C  3 168 ? 104.050 -106.231 -118.425 1.00 98.48  ? 167  MSE C CB  1 
HETATM 3840  C  CG  . MSE C  3 168 ? 103.866 -107.701 -118.682 1.00 104.41 ? 167  MSE C CG  1 
HETATM 3841  SE SE  . MSE C  3 168 ? 102.117 -108.189 -118.091 1.00 113.67 ? 167  MSE C SE  1 
HETATM 3842  C  CE  . MSE C  3 168 ? 101.127 -107.670 -119.668 1.00 111.83 ? 167  MSE C CE  1 
ATOM   3843  N  N   . TYR C  3 169 ? 105.770 -104.367 -117.473 1.00 92.27  ? 168  TYR C N   1 
ATOM   3844  C  CA  . TYR C  3 169 ? 107.018 -103.638 -117.312 1.00 92.32  ? 168  TYR C CA  1 
ATOM   3845  C  C   . TYR C  3 169 ? 107.127 -102.958 -115.949 1.00 93.51  ? 168  TYR C C   1 
ATOM   3846  O  O   . TYR C  3 169 ? 108.226 -102.618 -115.503 1.00 94.73  ? 168  TYR C O   1 
ATOM   3847  C  CB  . TYR C  3 169 ? 107.134 -102.626 -118.460 1.00 89.64  ? 168  TYR C CB  1 
ATOM   3848  C  CG  . TYR C  3 169 ? 108.146 -101.515 -118.301 1.00 87.08  ? 168  TYR C CG  1 
ATOM   3849  C  CD1 . TYR C  3 169 ? 107.821 -100.347 -117.612 1.00 86.36  ? 168  TYR C CD1 1 
ATOM   3850  C  CD2 . TYR C  3 169 ? 109.397 -101.596 -118.909 1.00 85.94  ? 168  TYR C CD2 1 
ATOM   3851  C  CE1 . TYR C  3 169 ? 108.711 -99.279  -117.540 1.00 86.05  ? 168  TYR C CE1 1 
ATOM   3852  C  CE2 . TYR C  3 169 ? 110.297 -100.536 -118.844 1.00 85.94  ? 168  TYR C CE2 1 
ATOM   3853  C  CZ  . TYR C  3 169 ? 109.947 -99.377  -118.160 1.00 86.06  ? 168  TYR C CZ  1 
ATOM   3854  O  OH  . TYR C  3 169 ? 110.822 -98.314  -118.109 1.00 83.77  ? 168  TYR C OH  1 
ATOM   3855  N  N   . LYS C  3 170 ? 105.994 -102.780 -115.278 1.00 93.63  ? 169  LYS C N   1 
ATOM   3856  C  CA  . LYS C  3 170 ? 105.994 -102.143 -113.971 1.00 93.87  ? 169  LYS C CA  1 
ATOM   3857  C  C   . LYS C  3 170 ? 106.219 -103.191 -112.882 1.00 94.48  ? 169  LYS C C   1 
ATOM   3858  O  O   . LYS C  3 170 ? 106.863 -102.915 -111.874 1.00 94.12  ? 169  LYS C O   1 
ATOM   3859  C  CB  . LYS C  3 170 ? 104.674 -101.407 -113.752 1.00 93.51  ? 169  LYS C CB  1 
ATOM   3860  C  CG  . LYS C  3 170 ? 104.721 -100.379 -112.643 1.00 94.03  ? 169  LYS C CG  1 
ATOM   3861  C  CD  . LYS C  3 170 ? 104.309 -98.998  -113.137 1.00 94.29  ? 169  LYS C CD  1 
ATOM   3862  C  CE  . LYS C  3 170 ? 105.282 -98.458  -114.176 1.00 94.38  ? 169  LYS C CE  1 
ATOM   3863  N  NZ  . LYS C  3 170 ? 104.885 -97.099  -114.648 1.00 93.92  ? 169  LYS C NZ  1 
ATOM   3864  N  N   . LEU C  3 171 ? 105.685 -104.392 -113.090 1.00 95.65  ? 170  LEU C N   1 
ATOM   3865  C  CA  . LEU C  3 171 ? 105.853 -105.489 -112.137 1.00 97.12  ? 170  LEU C CA  1 
ATOM   3866  C  C   . LEU C  3 171 ? 107.076 -106.320 -112.505 1.00 99.18  ? 170  LEU C C   1 
ATOM   3867  O  O   . LEU C  3 171 ? 107.693 -106.958 -111.650 1.00 99.84  ? 170  LEU C O   1 
ATOM   3868  C  CB  . LEU C  3 171 ? 104.625 -106.403 -112.122 1.00 95.20  ? 170  LEU C CB  1 
ATOM   3869  C  CG  . LEU C  3 171 ? 103.450 -106.018 -111.225 1.00 94.21  ? 170  LEU C CG  1 
ATOM   3870  C  CD1 . LEU C  3 171 ? 102.430 -107.145 -111.242 1.00 93.59  ? 170  LEU C CD1 1 
ATOM   3871  C  CD2 . LEU C  3 171 ? 103.937 -105.767 -109.804 1.00 93.82  ? 170  LEU C CD2 1 
ATOM   3872  N  N   . ARG C  3 172 ? 107.414 -106.315 -113.789 1.00 101.09 ? 171  ARG C N   1 
ATOM   3873  C  CA  . ARG C  3 172 ? 108.562 -107.055 -114.293 1.00 102.37 ? 171  ARG C CA  1 
ATOM   3874  C  C   . ARG C  3 172 ? 109.834 -106.325 -113.861 1.00 102.40 ? 171  ARG C C   1 
ATOM   3875  O  O   . ARG C  3 172 ? 110.947 -106.748 -114.164 1.00 102.69 ? 171  ARG C O   1 
ATOM   3876  C  CB  . ARG C  3 172 ? 108.463 -107.150 -115.819 1.00 104.06 ? 171  ARG C CB  1 
ATOM   3877  C  CG  . ARG C  3 172 ? 109.526 -107.986 -116.520 1.00 105.96 ? 171  ARG C CG  1 
ATOM   3878  C  CD  . ARG C  3 172 ? 109.078 -108.279 -117.950 1.00 107.50 ? 171  ARG C CD  1 
ATOM   3879  N  NE  . ARG C  3 172 ? 108.537 -107.084 -118.602 1.00 109.75 ? 171  ARG C NE  1 
ATOM   3880  C  CZ  . ARG C  3 172 ? 107.588 -107.093 -119.538 1.00 110.69 ? 171  ARG C CZ  1 
ATOM   3881  N  NH1 . ARG C  3 172 ? 107.165 -105.950 -120.066 1.00 110.68 ? 171  ARG C NH1 1 
ATOM   3882  N  NH2 . ARG C  3 172 ? 107.051 -108.237 -119.943 1.00 111.08 ? 171  ARG C NH2 1 
ATOM   3883  N  N   . THR C  3 173 ? 109.649 -105.223 -113.143 1.00 102.29 ? 172  THR C N   1 
ATOM   3884  C  CA  . THR C  3 173 ? 110.757 -104.427 -112.636 1.00 102.59 ? 172  THR C CA  1 
ATOM   3885  C  C   . THR C  3 173 ? 110.506 -104.153 -111.152 1.00 104.11 ? 172  THR C C   1 
ATOM   3886  O  O   . THR C  3 173 ? 111.411 -104.286 -110.324 1.00 104.61 ? 172  THR C O   1 
ATOM   3887  C  CB  . THR C  3 173 ? 110.867 -103.088 -113.380 1.00 101.69 ? 172  THR C CB  1 
ATOM   3888  O  OG1 . THR C  3 173 ? 109.657 -102.344 -113.208 1.00 101.35 ? 172  THR C OG1 1 
ATOM   3889  C  CG2 . THR C  3 173 ? 111.095 -103.325 -114.857 1.00 101.58 ? 172  THR C CG2 1 
ATOM   3890  N  N   . ASN C  3 174 ? 109.262 -103.783 -110.837 1.00 104.89 ? 173  ASN C N   1 
ATOM   3891  C  CA  . ASN C  3 174 ? 108.796 -103.478 -109.475 1.00 104.25 ? 173  ASN C CA  1 
ATOM   3892  C  C   . ASN C  3 174 ? 109.698 -102.585 -108.618 1.00 103.80 ? 173  ASN C C   1 
ATOM   3893  O  O   . ASN C  3 174 ? 110.755 -102.133 -109.110 1.00 103.05 ? 173  ASN C O   1 
ATOM   3894  C  CB  . ASN C  3 174 ? 108.481 -104.781 -108.719 1.00 103.32 ? 173  ASN C CB  1 
ATOM   3895  C  CG  . ASN C  3 174 ? 109.606 -105.797 -108.803 1.00 103.36 ? 173  ASN C CG  1 
ATOM   3896  O  OD1 . ASN C  3 174 ? 110.700 -105.577 -108.287 1.00 102.89 ? 173  ASN C OD1 1 
ATOM   3897  N  ND2 . ASN C  3 174 ? 109.340 -106.917 -109.465 1.00 103.41 ? 173  ASN C ND2 1 
ATOM   3898  N  N   . GLU D  4 3   ? 85.860  -89.529  -118.849 1.00 69.66  ? 3    GLU D N   1 
ATOM   3899  C  CA  . GLU D  4 3   ? 85.250  -88.274  -119.378 1.00 70.16  ? 3    GLU D CA  1 
ATOM   3900  C  C   . GLU D  4 3   ? 86.202  -87.086  -119.270 1.00 69.00  ? 3    GLU D C   1 
ATOM   3901  O  O   . GLU D  4 3   ? 87.310  -87.104  -119.812 1.00 67.54  ? 3    GLU D O   1 
ATOM   3902  C  CB  . GLU D  4 3   ? 83.952  -87.954  -118.618 1.00 71.36  ? 3    GLU D CB  1 
ATOM   3903  C  CG  . GLU D  4 3   ? 84.054  -88.072  -117.094 1.00 71.88  ? 3    GLU D CG  1 
ATOM   3904  C  CD  . GLU D  4 3   ? 83.043  -87.195  -116.361 1.00 72.89  ? 3    GLU D CD  1 
ATOM   3905  O  OE1 . GLU D  4 3   ? 82.633  -87.555  -115.234 1.00 71.26  ? 3    GLU D OE1 1 
ATOM   3906  O  OE2 . GLU D  4 3   ? 82.669  -86.133  -116.907 1.00 72.33  ? 3    GLU D OE2 1 
ATOM   3907  N  N   . ALA D  4 4   ? 85.739  -86.044  -118.585 1.00 68.25  ? 4    ALA D N   1 
ATOM   3908  C  CA  . ALA D  4 4   ? 86.520  -84.838  -118.363 1.00 67.64  ? 4    ALA D CA  1 
ATOM   3909  C  C   . ALA D  4 4   ? 87.126  -84.970  -116.968 1.00 68.13  ? 4    ALA D C   1 
ATOM   3910  O  O   . ALA D  4 4   ? 87.932  -84.139  -116.539 1.00 68.94  ? 4    ALA D O   1 
ATOM   3911  C  CB  . ALA D  4 4   ? 85.626  -83.611  -118.441 1.00 66.09  ? 4    ALA D CB  1 
ATOM   3912  N  N   . TYR D  4 5   ? 86.725  -86.026  -116.263 1.00 67.61  ? 5    TYR D N   1 
ATOM   3913  C  CA  . TYR D  4 5   ? 87.237  -86.285  -114.925 1.00 66.99  ? 5    TYR D CA  1 
ATOM   3914  C  C   . TYR D  4 5   ? 88.362  -87.313  -114.957 1.00 67.52  ? 5    TYR D C   1 
ATOM   3915  O  O   . TYR D  4 5   ? 88.110  -88.514  -114.929 1.00 67.37  ? 5    TYR D O   1 
ATOM   3916  C  CB  . TYR D  4 5   ? 86.116  -86.775  -113.998 1.00 64.09  ? 5    TYR D CB  1 
ATOM   3917  C  CG  . TYR D  4 5   ? 86.624  -87.437  -112.728 1.00 62.42  ? 5    TYR D CG  1 
ATOM   3918  C  CD1 . TYR D  4 5   ? 87.482  -86.766  -111.853 1.00 61.81  ? 5    TYR D CD1 1 
ATOM   3919  C  CD2 . TYR D  4 5   ? 86.277  -88.753  -112.425 1.00 60.83  ? 5    TYR D CD2 1 
ATOM   3920  C  CE1 . TYR D  4 5   ? 87.983  -87.398  -110.710 1.00 61.07  ? 5    TYR D CE1 1 
ATOM   3921  C  CE2 . TYR D  4 5   ? 86.769  -89.390  -111.292 1.00 59.19  ? 5    TYR D CE2 1 
ATOM   3922  C  CZ  . TYR D  4 5   ? 87.619  -88.713  -110.440 1.00 59.66  ? 5    TYR D CZ  1 
ATOM   3923  O  OH  . TYR D  4 5   ? 88.102  -89.361  -109.325 1.00 58.31  ? 5    TYR D OH  1 
ATOM   3924  N  N   . PHE D  4 6   ? 89.601  -86.838  -115.029 1.00 68.43  ? 6    PHE D N   1 
ATOM   3925  C  CA  . PHE D  4 6   ? 90.747  -87.737  -115.041 1.00 69.01  ? 6    PHE D CA  1 
ATOM   3926  C  C   . PHE D  4 6   ? 91.432  -87.741  -113.681 1.00 68.79  ? 6    PHE D C   1 
ATOM   3927  O  O   . PHE D  4 6   ? 92.204  -86.836  -113.360 1.00 69.48  ? 6    PHE D O   1 
ATOM   3928  C  CB  . PHE D  4 6   ? 91.755  -87.352  -116.139 1.00 70.56  ? 6    PHE D CB  1 
ATOM   3929  C  CG  . PHE D  4 6   ? 91.842  -85.875  -116.412 1.00 71.95  ? 6    PHE D CG  1 
ATOM   3930  C  CD1 . PHE D  4 6   ? 90.907  -85.250  -117.233 1.00 72.05  ? 6    PHE D CD1 1 
ATOM   3931  C  CD2 . PHE D  4 6   ? 92.875  -85.109  -115.870 1.00 72.73  ? 6    PHE D CD2 1 
ATOM   3932  C  CE1 . PHE D  4 6   ? 91.000  -83.881  -117.515 1.00 72.54  ? 6    PHE D CE1 1 
ATOM   3933  C  CE2 . PHE D  4 6   ? 92.978  -83.736  -116.145 1.00 72.53  ? 6    PHE D CE2 1 
ATOM   3934  C  CZ  . PHE D  4 6   ? 92.037  -83.122  -116.970 1.00 72.23  ? 6    PHE D CZ  1 
ATOM   3935  N  N   . ARG D  4 7   ? 91.135  -88.770  -112.890 1.00 67.59  ? 7    ARG D N   1 
ATOM   3936  C  CA  . ARG D  4 7   ? 91.686  -88.943  -111.548 1.00 65.91  ? 7    ARG D CA  1 
ATOM   3937  C  C   . ARG D  4 7   ? 93.194  -89.195  -111.556 1.00 64.36  ? 7    ARG D C   1 
ATOM   3938  O  O   . ARG D  4 7   ? 93.817  -89.260  -112.613 1.00 64.60  ? 7    ARG D O   1 
ATOM   3939  C  CB  . ARG D  4 7   ? 91.004  -90.128  -110.872 1.00 68.11  ? 7    ARG D CB  1 
ATOM   3940  C  CG  . ARG D  4 7   ? 91.303  -91.440  -111.568 1.00 70.98  ? 7    ARG D CG  1 
ATOM   3941  C  CD  . ARG D  4 7   ? 91.060  -92.649  -110.681 1.00 73.57  ? 7    ARG D CD  1 
ATOM   3942  N  NE  . ARG D  4 7   ? 91.729  -93.829  -111.229 1.00 77.16  ? 7    ARG D NE  1 
ATOM   3943  C  CZ  . ARG D  4 7   ? 91.746  -95.029  -110.653 1.00 79.86  ? 7    ARG D CZ  1 
ATOM   3944  N  NH1 . ARG D  4 7   ? 91.122  -95.225  -109.496 1.00 80.48  ? 7    ARG D NH1 1 
ATOM   3945  N  NH2 . ARG D  4 7   ? 92.400  -96.034  -111.229 1.00 81.36  ? 7    ARG D NH2 1 
ATOM   3946  N  N   . VAL D  4 8   ? 93.782  -89.338  -110.371 1.00 62.71  ? 8    VAL D N   1 
ATOM   3947  C  CA  . VAL D  4 8   ? 95.211  -89.618  -110.282 1.00 60.09  ? 8    VAL D CA  1 
ATOM   3948  C  C   . VAL D  4 8   ? 95.375  -91.129  -110.219 1.00 59.31  ? 8    VAL D C   1 
ATOM   3949  O  O   . VAL D  4 8   ? 95.017  -91.778  -109.235 1.00 56.33  ? 8    VAL D O   1 
ATOM   3950  C  CB  . VAL D  4 8   ? 95.871  -88.978  -109.034 1.00 59.16  ? 8    VAL D CB  1 
ATOM   3951  C  CG1 . VAL D  4 8   ? 97.337  -89.375  -108.969 1.00 57.47  ? 8    VAL D CG1 1 
ATOM   3952  C  CG2 . VAL D  4 8   ? 95.753  -87.459  -109.089 1.00 57.27  ? 8    VAL D CG2 1 
ATOM   3953  N  N   . GLU D  4 9   ? 95.907  -91.684  -111.297 1.00 60.71  ? 9    GLU D N   1 
ATOM   3954  C  CA  . GLU D  4 9   ? 96.106  -93.116  -111.395 1.00 62.88  ? 9    GLU D CA  1 
ATOM   3955  C  C   . GLU D  4 9   ? 97.092  -93.632  -110.358 1.00 62.28  ? 9    GLU D C   1 
ATOM   3956  O  O   . GLU D  4 9   ? 97.892  -92.874  -109.816 1.00 61.79  ? 9    GLU D O   1 
ATOM   3957  C  CB  . GLU D  4 9   ? 96.576  -93.484  -112.806 1.00 64.98  ? 9    GLU D CB  1 
ATOM   3958  C  CG  . GLU D  4 9   ? 97.827  -92.747  -113.266 1.00 70.16  ? 9    GLU D CG  1 
ATOM   3959  C  CD  . GLU D  4 9   ? 97.562  -91.296  -113.652 1.00 73.08  ? 9    GLU D CD  1 
ATOM   3960  O  OE1 . GLU D  4 9   ? 96.895  -91.068  -114.688 1.00 75.17  ? 9    GLU D OE1 1 
ATOM   3961  O  OE2 . GLU D  4 9   ? 98.020  -90.386  -112.920 1.00 74.03  ? 9    GLU D OE2 1 
ATOM   3962  N  N   . SER D  4 10  ? 97.007  -94.933  -110.091 1.00 62.37  ? 10   SER D N   1 
ATOM   3963  C  CA  . SER D  4 10  ? 97.859  -95.628  -109.133 1.00 62.19  ? 10   SER D CA  1 
ATOM   3964  C  C   . SER D  4 10  ? 99.337  -95.628  -109.539 1.00 63.42  ? 10   SER D C   1 
ATOM   3965  O  O   . SER D  4 10  ? 99.688  -95.214  -110.649 1.00 64.55  ? 10   SER D O   1 
ATOM   3966  C  CB  . SER D  4 10  ? 97.363  -97.067  -108.985 1.00 61.32  ? 10   SER D CB  1 
ATOM   3967  O  OG  . SER D  4 10  ? 98.339  -97.902  -108.393 1.00 62.24  ? 10   SER D OG  1 
ATOM   3968  N  N   . GLY D  4 11  ? 100.198 -96.091  -108.631 1.00 63.18  ? 11   GLY D N   1 
ATOM   3969  C  CA  . GLY D  4 11  ? 101.628 -96.152  -108.901 1.00 61.03  ? 11   GLY D CA  1 
ATOM   3970  C  C   . GLY D  4 11  ? 102.297 -97.194  -108.027 1.00 59.71  ? 11   GLY D C   1 
ATOM   3971  O  O   . GLY D  4 11  ? 103.476 -97.518  -108.186 1.00 58.35  ? 11   GLY D O   1 
ATOM   3972  N  N   . ALA D  4 12  ? 101.512 -97.732  -107.104 1.00 59.52  ? 12   ALA D N   1 
ATOM   3973  C  CA  . ALA D  4 12  ? 101.973 -98.733  -106.154 1.00 59.85  ? 12   ALA D CA  1 
ATOM   3974  C  C   . ALA D  4 12  ? 102.739 -99.910  -106.754 1.00 59.42  ? 12   ALA D C   1 
ATOM   3975  O  O   . ALA D  4 12  ? 103.430 -100.630 -106.030 1.00 59.23  ? 12   ALA D O   1 
ATOM   3976  C  CB  . ALA D  4 12  ? 100.787 -99.251  -105.348 1.00 59.40  ? 12   ALA D CB  1 
ATOM   3977  N  N   . LEU D  4 13  ? 102.620 -100.108 -108.063 1.00 59.25  ? 13   LEU D N   1 
ATOM   3978  C  CA  . LEU D  4 13  ? 103.297 -101.220 -108.719 1.00 59.38  ? 13   LEU D CA  1 
ATOM   3979  C  C   . LEU D  4 13  ? 104.696 -100.852 -109.190 1.00 60.08  ? 13   LEU D C   1 
ATOM   3980  O  O   . LEU D  4 13  ? 105.536 -101.725 -109.429 1.00 58.88  ? 13   LEU D O   1 
ATOM   3981  C  CB  . LEU D  4 13  ? 102.452 -101.738 -109.892 1.00 59.54  ? 13   LEU D CB  1 
ATOM   3982  C  CG  . LEU D  4 13  ? 101.349 -102.752 -109.551 1.00 59.60  ? 13   LEU D CG  1 
ATOM   3983  C  CD1 . LEU D  4 13  ? 100.425 -102.198 -108.478 1.00 61.36  ? 13   LEU D CD1 1 
ATOM   3984  C  CD2 . LEU D  4 13  ? 100.562 -103.087 -110.805 1.00 59.44  ? 13   LEU D CD2 1 
ATOM   3985  N  N   . GLY D  4 14  ? 104.942 -99.553  -109.318 1.00 61.91  ? 14   GLY D N   1 
ATOM   3986  C  CA  . GLY D  4 14  ? 106.250 -99.093  -109.742 1.00 64.00  ? 14   GLY D CA  1 
ATOM   3987  C  C   . GLY D  4 14  ? 107.100 -98.974  -108.501 1.00 65.59  ? 14   GLY D C   1 
ATOM   3988  O  O   . GLY D  4 14  ? 106.998 -99.811  -107.608 1.00 67.35  ? 14   GLY D O   1 
ATOM   3989  N  N   . PRO D  4 15  ? 107.957 -97.956  -108.407 1.00 66.65  ? 15   PRO D N   1 
ATOM   3990  C  CA  . PRO D  4 15  ? 108.776 -97.838  -107.197 1.00 67.05  ? 15   PRO D CA  1 
ATOM   3991  C  C   . PRO D  4 15  ? 107.893 -97.406  -106.023 1.00 67.88  ? 15   PRO D C   1 
ATOM   3992  O  O   . PRO D  4 15  ? 107.346 -98.246  -105.305 1.00 67.78  ? 15   PRO D O   1 
ATOM   3993  C  CB  . PRO D  4 15  ? 109.799 -96.776  -107.581 1.00 67.67  ? 15   PRO D CB  1 
ATOM   3994  C  CG  . PRO D  4 15  ? 109.903 -96.926  -109.082 1.00 67.52  ? 15   PRO D CG  1 
ATOM   3995  C  CD  . PRO D  4 15  ? 108.462 -97.077  -109.473 1.00 66.91  ? 15   PRO D CD  1 
ATOM   3996  N  N   . GLU D  4 16  ? 107.746 -96.096  -105.844 1.00 68.70  ? 16   GLU D N   1 
ATOM   3997  C  CA  . GLU D  4 16  ? 106.913 -95.558  -104.770 1.00 69.62  ? 16   GLU D CA  1 
ATOM   3998  C  C   . GLU D  4 16  ? 105.440 -95.462  -105.184 1.00 68.17  ? 16   GLU D C   1 
ATOM   3999  O  O   . GLU D  4 16  ? 105.057 -95.902  -106.271 1.00 68.47  ? 16   GLU D O   1 
ATOM   4000  C  CB  . GLU D  4 16  ? 107.410 -94.171  -104.348 1.00 71.35  ? 16   GLU D CB  1 
ATOM   4001  C  CG  . GLU D  4 16  ? 107.986 -94.119  -102.934 1.00 75.77  ? 16   GLU D CG  1 
ATOM   4002  C  CD  . GLU D  4 16  ? 107.056 -94.734  -101.879 1.00 78.33  ? 16   GLU D CD  1 
ATOM   4003  O  OE1 . GLU D  4 16  ? 105.889 -94.292  -101.757 1.00 78.06  ? 16   GLU D OE1 1 
ATOM   4004  O  OE2 . GLU D  4 16  ? 107.499 -95.662  -101.162 1.00 79.66  ? 16   GLU D OE2 1 
ATOM   4005  N  N   . GLU D  4 17  ? 104.623 -94.899  -104.296 1.00 66.09  ? 17   GLU D N   1 
ATOM   4006  C  CA  . GLU D  4 17  ? 103.194 -94.711  -104.537 1.00 63.05  ? 17   GLU D CA  1 
ATOM   4007  C  C   . GLU D  4 17  ? 103.057 -93.346  -105.188 1.00 61.08  ? 17   GLU D C   1 
ATOM   4008  O  O   . GLU D  4 17  ? 104.050 -92.718  -105.542 1.00 61.12  ? 17   GLU D O   1 
ATOM   4009  C  CB  . GLU D  4 17  ? 102.416 -94.694  -103.212 1.00 62.87  ? 17   GLU D CB  1 
ATOM   4010  C  CG  . GLU D  4 17  ? 102.389 -96.003  -102.425 1.00 65.34  ? 17   GLU D CG  1 
ATOM   4011  C  CD  . GLU D  4 17  ? 101.970 -95.809  -100.959 1.00 67.35  ? 17   GLU D CD  1 
ATOM   4012  O  OE1 . GLU D  4 17  ? 101.009 -95.047  -100.702 1.00 66.54  ? 17   GLU D OE1 1 
ATOM   4013  O  OE2 . GLU D  4 17  ? 102.595 -96.428  -100.062 1.00 67.31  ? 17   GLU D OE2 1 
ATOM   4014  N  N   . ASN D  4 18  ? 101.824 -92.891  -105.350 1.00 58.87  ? 18   ASN D N   1 
ATOM   4015  C  CA  . ASN D  4 18  ? 101.577 -91.575  -105.913 1.00 55.38  ? 18   ASN D CA  1 
ATOM   4016  C  C   . ASN D  4 18  ? 100.910 -90.790  -104.810 1.00 52.91  ? 18   ASN D C   1 
ATOM   4017  O  O   . ASN D  4 18  ? 99.815  -91.112  -104.364 1.00 52.52  ? 18   ASN D O   1 
ATOM   4018  C  CB  . ASN D  4 18  ? 100.646 -91.636  -107.125 1.00 58.11  ? 18   ASN D CB  1 
ATOM   4019  C  CG  . ASN D  4 18  ? 101.391 -91.551  -108.447 1.00 57.32  ? 18   ASN D CG  1 
ATOM   4020  O  OD1 . ASN D  4 18  ? 101.910 -92.544  -108.953 1.00 57.47  ? 18   ASN D OD1 1 
ATOM   4021  N  ND2 . ASN D  4 18  ? 101.450 -90.352  -109.009 1.00 58.50  ? 18   ASN D ND2 1 
ATOM   4022  N  N   . PHE D  4 19  ? 101.597 -89.765  -104.353 1.00 50.52  ? 19   PHE D N   1 
ATOM   4023  C  CA  . PHE D  4 19  ? 101.095 -88.918  -103.290 1.00 47.45  ? 19   PHE D CA  1 
ATOM   4024  C  C   . PHE D  4 19  ? 99.587  -88.625  -103.354 1.00 46.32  ? 19   PHE D C   1 
ATOM   4025  O  O   . PHE D  4 19  ? 98.880  -88.765  -102.357 1.00 44.64  ? 19   PHE D O   1 
ATOM   4026  C  CB  . PHE D  4 19  ? 101.867 -87.604  -103.313 1.00 43.84  ? 19   PHE D CB  1 
ATOM   4027  C  CG  . PHE D  4 19  ? 101.576 -86.721  -102.157 1.00 43.08  ? 19   PHE D CG  1 
ATOM   4028  C  CD1 . PHE D  4 19  ? 102.025 -87.058  -100.884 1.00 41.07  ? 19   PHE D CD1 1 
ATOM   4029  C  CD2 . PHE D  4 19  ? 100.873 -85.538  -102.336 1.00 42.24  ? 19   PHE D CD2 1 
ATOM   4030  C  CE1 . PHE D  4 19  ? 101.780 -86.225  -99.809  1.00 41.47  ? 19   PHE D CE1 1 
ATOM   4031  C  CE2 . PHE D  4 19  ? 100.623 -84.691  -101.260 1.00 43.13  ? 19   PHE D CE2 1 
ATOM   4032  C  CZ  . PHE D  4 19  ? 101.077 -85.032  -99.996  1.00 42.07  ? 19   PHE D CZ  1 
ATOM   4033  N  N   . LEU D  4 20  ? 99.104  -88.228  -104.531 1.00 45.76  ? 20   LEU D N   1 
ATOM   4034  C  CA  . LEU D  4 20  ? 97.698  -87.864  -104.706 1.00 43.65  ? 20   LEU D CA  1 
ATOM   4035  C  C   . LEU D  4 20  ? 96.723  -88.969  -105.143 1.00 42.67  ? 20   LEU D C   1 
ATOM   4036  O  O   . LEU D  4 20  ? 95.529  -88.714  -105.324 1.00 42.95  ? 20   LEU D O   1 
ATOM   4037  C  CB  . LEU D  4 20  ? 97.608  -86.688  -105.681 1.00 42.64  ? 20   LEU D CB  1 
ATOM   4038  C  CG  . LEU D  4 20  ? 98.243  -85.365  -105.248 1.00 42.16  ? 20   LEU D CG  1 
ATOM   4039  C  CD1 . LEU D  4 20  ? 98.079  -84.342  -106.363 1.00 41.29  ? 20   LEU D CD1 1 
ATOM   4040  C  CD2 . LEU D  4 20  ? 97.589  -84.865  -103.970 1.00 40.54  ? 20   LEU D CD2 1 
ATOM   4041  N  N   . SER D  4 21  ? 97.230  -90.183  -105.305 1.00 39.92  ? 21   SER D N   1 
ATOM   4042  C  CA  . SER D  4 21  ? 96.418  -91.316  -105.707 1.00 39.57  ? 21   SER D CA  1 
ATOM   4043  C  C   . SER D  4 21  ? 95.507  -91.829  -104.607 1.00 40.03  ? 21   SER D C   1 
ATOM   4044  O  O   . SER D  4 21  ? 95.989  -92.353  -103.618 1.00 39.83  ? 21   SER D O   1 
ATOM   4045  C  CB  . SER D  4 21  ? 97.318  -92.463  -106.150 1.00 40.20  ? 21   SER D CB  1 
ATOM   4046  O  OG  . SER D  4 21  ? 96.635  -93.703  -106.033 1.00 43.01  ? 21   SER D OG  1 
ATOM   4047  N  N   . LEU D  4 22  ? 94.193  -91.704  -104.780 1.00 42.39  ? 22   LEU D N   1 
ATOM   4048  C  CA  . LEU D  4 22  ? 93.264  -92.205  -103.765 1.00 43.66  ? 22   LEU D CA  1 
ATOM   4049  C  C   . LEU D  4 22  ? 93.476  -93.706  -103.621 1.00 44.62  ? 22   LEU D C   1 
ATOM   4050  O  O   . LEU D  4 22  ? 93.477  -94.253  -102.524 1.00 42.98  ? 22   LEU D O   1 
ATOM   4051  C  CB  . LEU D  4 22  ? 91.806  -91.947  -104.163 1.00 42.37  ? 22   LEU D CB  1 
ATOM   4052  C  CG  . LEU D  4 22  ? 91.315  -90.514  -104.376 1.00 43.04  ? 22   LEU D CG  1 
ATOM   4053  C  CD1 . LEU D  4 22  ? 89.812  -90.561  -104.594 1.00 42.45  ? 22   LEU D CD1 1 
ATOM   4054  C  CD2 . LEU D  4 22  ? 91.644  -89.633  -103.186 1.00 41.89  ? 22   LEU D CD2 1 
ATOM   4055  N  N   . ASP D  4 23  ? 93.662  -94.373  -104.749 1.00 48.25  ? 23   ASP D N   1 
ATOM   4056  C  CA  . ASP D  4 23  ? 93.873  -95.810  -104.735 1.00 51.40  ? 23   ASP D CA  1 
ATOM   4057  C  C   . ASP D  4 23  ? 95.069  -96.187  -103.891 1.00 51.08  ? 23   ASP D C   1 
ATOM   4058  O  O   . ASP D  4 23  ? 94.991  -97.111  -103.086 1.00 51.44  ? 23   ASP D O   1 
ATOM   4059  C  CB  . ASP D  4 23  ? 94.067  -96.346  -106.155 1.00 55.26  ? 23   ASP D CB  1 
ATOM   4060  C  CG  . ASP D  4 23  ? 92.810  -96.997  -106.706 1.00 58.36  ? 23   ASP D CG  1 
ATOM   4061  O  OD1 . ASP D  4 23  ? 92.022  -96.309  -107.397 1.00 59.51  ? 23   ASP D OD1 1 
ATOM   4062  O  OD2 . ASP D  4 23  ? 92.610  -98.203  -106.427 1.00 60.53  ? 23   ASP D OD2 1 
ATOM   4063  N  N   . ASP D  4 24  ? 96.170  -95.466  -104.074 1.00 50.49  ? 24   ASP D N   1 
ATOM   4064  C  CA  . ASP D  4 24  ? 97.391  -95.740  -103.327 1.00 50.17  ? 24   ASP D CA  1 
ATOM   4065  C  C   . ASP D  4 24  ? 97.291  -95.503  -101.820 1.00 50.08  ? 24   ASP D C   1 
ATOM   4066  O  O   . ASP D  4 24  ? 97.845  -96.273  -101.037 1.00 49.44  ? 24   ASP D O   1 
ATOM   4067  C  CB  . ASP D  4 24  ? 98.559  -94.925  -103.892 1.00 49.81  ? 24   ASP D CB  1 
ATOM   4068  C  CG  . ASP D  4 24  ? 99.157  -95.549  -105.135 1.00 49.91  ? 24   ASP D CG  1 
ATOM   4069  O  OD1 . ASP D  4 24  ? 99.004  -96.778  -105.310 1.00 47.23  ? 24   ASP D OD1 1 
ATOM   4070  O  OD2 . ASP D  4 24  ? 99.794  -94.812  -105.921 1.00 48.87  ? 24   ASP D OD2 1 
ATOM   4071  N  N   . ILE D  4 25  ? 96.600  -94.448  -101.400 1.00 50.27  ? 25   ILE D N   1 
ATOM   4072  C  CA  . ILE D  4 25  ? 96.485  -94.194  -99.973  1.00 50.98  ? 25   ILE D CA  1 
ATOM   4073  C  C   . ILE D  4 25  ? 95.642  -95.314  -99.383  1.00 52.10  ? 25   ILE D C   1 
ATOM   4074  O  O   . ILE D  4 25  ? 95.920  -95.815  -98.302  1.00 54.24  ? 25   ILE D O   1 
ATOM   4075  C  CB  . ILE D  4 25  ? 95.841  -92.796  -99.664  1.00 49.85  ? 25   ILE D CB  1 
ATOM   4076  C  CG1 . ILE D  4 25  ? 94.322  -92.874  -99.707  1.00 51.19  ? 25   ILE D CG1 1 
ATOM   4077  C  CG2 . ILE D  4 25  ? 96.333  -91.744  -100.661 1.00 48.92  ? 25   ILE D CG2 1 
ATOM   4078  C  CD1 . ILE D  4 25  ? 93.704  -93.375  -98.435  1.00 52.68  ? 25   ILE D CD1 1 
ATOM   4079  N  N   . LEU D  4 26  ? 94.627  -95.723  -100.130 1.00 54.36  ? 26   LEU D N   1 
ATOM   4080  C  CA  . LEU D  4 26  ? 93.710  -96.780  -99.723  1.00 55.21  ? 26   LEU D CA  1 
ATOM   4081  C  C   . LEU D  4 26  ? 94.438  -98.111  -99.577  1.00 55.89  ? 26   LEU D C   1 
ATOM   4082  O  O   . LEU D  4 26  ? 94.163  -98.890  -98.666  1.00 56.28  ? 26   LEU D O   1 
ATOM   4083  C  CB  . LEU D  4 26  ? 92.612  -96.908  -100.774 1.00 55.88  ? 26   LEU D CB  1 
ATOM   4084  C  CG  . LEU D  4 26  ? 91.179  -97.111  -100.299 1.00 56.78  ? 26   LEU D CG  1 
ATOM   4085  C  CD1 . LEU D  4 26  ? 90.775  -95.973  -99.380  1.00 55.37  ? 26   LEU D CD1 1 
ATOM   4086  C  CD2 . LEU D  4 26  ? 90.262  -97.183  -101.521 1.00 56.04  ? 26   LEU D CD2 1 
HETATM 4087  N  N   . MSE D  4 27  ? 95.361  -98.367  -100.494 1.00 56.70  ? 27   MSE D N   1 
HETATM 4088  C  CA  . MSE D  4 27  ? 96.146  -99.591  -100.495 1.00 59.99  ? 27   MSE D CA  1 
HETATM 4089  C  C   . MSE D  4 27  ? 97.058  -99.637  -99.274  1.00 62.22  ? 27   MSE D C   1 
HETATM 4090  O  O   . MSE D  4 27  ? 97.035  -100.582 -98.484  1.00 62.61  ? 27   MSE D O   1 
HETATM 4091  C  CB  . MSE D  4 27  ? 96.981  -99.637  -101.776 1.00 62.02  ? 27   MSE D CB  1 
HETATM 4092  C  CG  . MSE D  4 27  ? 97.989  -100.774 -101.878 1.00 66.57  ? 27   MSE D CG  1 
HETATM 4093  SE SE  . MSE D  4 27  ? 99.609  -100.496 -100.858 1.00 72.83  ? 27   MSE D SE  1 
HETATM 4094  C  CE  . MSE D  4 27  ? 100.526 -99.207  -101.974 1.00 69.13  ? 27   MSE D CE  1 
ATOM   4095  N  N   . SER D  4 28  ? 97.858  -98.589  -99.136  1.00 64.06  ? 28   SER D N   1 
ATOM   4096  C  CA  . SER D  4 28  ? 98.816  -98.448  -98.053  1.00 64.40  ? 28   SER D CA  1 
ATOM   4097  C  C   . SER D  4 28  ? 98.203  -98.366  -96.658  1.00 66.01  ? 28   SER D C   1 
ATOM   4098  O  O   . SER D  4 28  ? 98.931  -98.173  -95.679  1.00 67.29  ? 28   SER D O   1 
ATOM   4099  C  CB  . SER D  4 28  ? 99.670  -97.200  -98.293  1.00 64.42  ? 28   SER D CB  1 
ATOM   4100  O  OG  . SER D  4 28  ? 98.873  -96.024  -98.268  1.00 61.91  ? 28   SER D OG  1 
ATOM   4101  N  N   . HIS D  4 29  ? 96.885  -98.508  -96.545  1.00 66.14  ? 29   HIS D N   1 
ATOM   4102  C  CA  . HIS D  4 29  ? 96.263  -98.427  -95.230  1.00 66.69  ? 29   HIS D CA  1 
ATOM   4103  C  C   . HIS D  4 29  ? 95.996  -99.787  -94.583  1.00 67.71  ? 29   HIS D C   1 
ATOM   4104  O  O   . HIS D  4 29  ? 95.367  -99.872  -93.525  1.00 66.60  ? 29   HIS D O   1 
ATOM   4105  C  CB  . HIS D  4 29  ? 94.971  -97.620  -95.302  1.00 66.01  ? 29   HIS D CB  1 
ATOM   4106  C  CG  . HIS D  4 29  ? 94.470  -97.191  -93.962  1.00 68.55  ? 29   HIS D CG  1 
ATOM   4107  N  ND1 . HIS D  4 29  ? 93.752  -98.027  -93.134  1.00 69.83  ? 29   HIS D ND1 1 
ATOM   4108  C  CD2 . HIS D  4 29  ? 94.651  -96.042  -93.269  1.00 70.05  ? 29   HIS D CD2 1 
ATOM   4109  C  CE1 . HIS D  4 29  ? 93.515  -97.413  -91.988  1.00 69.85  ? 29   HIS D CE1 1 
ATOM   4110  N  NE2 . HIS D  4 29  ? 94.050  -96.207  -92.044  1.00 70.61  ? 29   HIS D NE2 1 
ATOM   4111  N  N   . GLU D  4 30  ? 96.495  -100.847 -95.211  1.00 69.25  ? 30   GLU D N   1 
ATOM   4112  C  CA  . GLU D  4 30  ? 96.312  -102.204 -94.701  1.00 71.13  ? 30   GLU D CA  1 
ATOM   4113  C  C   . GLU D  4 30  ? 97.365  -102.537 -93.638  1.00 70.92  ? 30   GLU D C   1 
ATOM   4114  O  O   . GLU D  4 30  ? 98.565  -102.414 -93.888  1.00 70.90  ? 30   GLU D O   1 
ATOM   4115  C  CB  . GLU D  4 30  ? 96.408  -103.212 -95.849  1.00 73.19  ? 30   GLU D CB  1 
ATOM   4116  C  CG  . GLU D  4 30  ? 95.550  -102.884 -97.067  1.00 75.94  ? 30   GLU D CG  1 
ATOM   4117  C  CD  . GLU D  4 30  ? 94.070  -102.793 -96.744  1.00 77.88  ? 30   GLU D CD  1 
ATOM   4118  O  OE1 . GLU D  4 30  ? 93.628  -101.731 -96.246  1.00 78.48  ? 30   GLU D OE1 1 
ATOM   4119  O  OE2 . GLU D  4 30  ? 93.350  -103.790 -96.983  1.00 78.12  ? 30   GLU D OE2 1 
ATOM   4120  N  N   . LYS D  4 31  ? 96.908  -102.971 -92.464  1.00 70.82  ? 31   LYS D N   1 
ATOM   4121  C  CA  . LYS D  4 31  ? 97.800  -103.306 -91.359  1.00 69.92  ? 31   LYS D CA  1 
ATOM   4122  C  C   . LYS D  4 31  ? 98.882  -104.260 -91.823  1.00 70.38  ? 31   LYS D C   1 
ATOM   4123  O  O   . LYS D  4 31  ? 98.805  -104.809 -92.915  1.00 69.51  ? 31   LYS D O   1 
ATOM   4124  C  CB  . LYS D  4 31  ? 97.030  -103.946 -90.205  1.00 69.02  ? 31   LYS D CB  1 
ATOM   4125  C  CG  . LYS D  4 31  ? 95.681  -103.317 -89.901  1.00 69.98  ? 31   LYS D CG  1 
ATOM   4126  C  CD  . LYS D  4 31  ? 95.739  -101.815 -89.698  1.00 70.26  ? 31   LYS D CD  1 
ATOM   4127  C  CE  . LYS D  4 31  ? 94.331  -101.271 -89.465  1.00 72.21  ? 31   LYS D CE  1 
ATOM   4128  N  NZ  . LYS D  4 31  ? 94.249  -99.781  -89.477  1.00 72.96  ? 31   LYS D NZ  1 
ATOM   4129  N  N   . LEU D  4 32  ? 99.885  -104.460 -90.977  1.00 72.32  ? 32   LEU D N   1 
ATOM   4130  C  CA  . LEU D  4 32  ? 101.006 -105.331 -91.305  1.00 73.26  ? 32   LEU D CA  1 
ATOM   4131  C  C   . LEU D  4 32  ? 101.609 -105.939 -90.038  1.00 74.70  ? 32   LEU D C   1 
ATOM   4132  O  O   . LEU D  4 32  ? 101.614 -105.305 -88.983  1.00 74.97  ? 32   LEU D O   1 
ATOM   4133  C  CB  . LEU D  4 32  ? 102.074 -104.517 -92.041  1.00 71.99  ? 32   LEU D CB  1 
ATOM   4134  C  CG  . LEU D  4 32  ? 103.304 -105.251 -92.569  1.00 70.65  ? 32   LEU D CG  1 
ATOM   4135  C  CD1 . LEU D  4 32  ? 102.912 -106.090 -93.766  1.00 70.25  ? 32   LEU D CD1 1 
ATOM   4136  C  CD2 . LEU D  4 32  ? 104.366 -104.248 -92.962  1.00 70.14  ? 32   LEU D CD2 1 
ATOM   4137  N  N   . PRO D  4 33  ? 102.106 -107.188 -90.124  1.00 76.51  ? 33   PRO D N   1 
ATOM   4138  C  CA  . PRO D  4 33  ? 102.721 -107.889 -88.990  1.00 77.21  ? 33   PRO D CA  1 
ATOM   4139  C  C   . PRO D  4 33  ? 104.038 -107.206 -88.625  1.00 77.93  ? 33   PRO D C   1 
ATOM   4140  O  O   . PRO D  4 33  ? 105.041 -107.360 -89.330  1.00 78.08  ? 33   PRO D O   1 
ATOM   4141  C  CB  . PRO D  4 33  ? 102.948 -109.297 -89.537  1.00 77.27  ? 33   PRO D CB  1 
ATOM   4142  C  CG  . PRO D  4 33  ? 101.853 -109.454 -90.528  1.00 77.49  ? 33   PRO D CG  1 
ATOM   4143  C  CD  . PRO D  4 33  ? 101.888 -108.124 -91.240  1.00 77.45  ? 33   PRO D CD  1 
ATOM   4144  N  N   . VAL D  4 34  ? 104.039 -106.465 -87.521  1.00 78.52  ? 34   VAL D N   1 
ATOM   4145  C  CA  . VAL D  4 34  ? 105.233 -105.746 -87.101  1.00 79.39  ? 34   VAL D CA  1 
ATOM   4146  C  C   . VAL D  4 34  ? 105.594 -105.958 -85.630  1.00 80.61  ? 34   VAL D C   1 
ATOM   4147  O  O   . VAL D  4 34  ? 104.715 -106.018 -84.774  1.00 80.22  ? 34   VAL D O   1 
ATOM   4148  C  CB  . VAL D  4 34  ? 105.061 -104.233 -87.372  1.00 78.91  ? 34   VAL D CB  1 
ATOM   4149  C  CG1 . VAL D  4 34  ? 103.909 -103.675 -86.552  1.00 77.84  ? 34   VAL D CG1 1 
ATOM   4150  C  CG2 . VAL D  4 34  ? 106.334 -103.508 -87.061  1.00 79.10  ? 34   VAL D CG2 1 
ATOM   4151  N  N   . ARG D  4 35  ? 106.895 -106.071 -85.353  1.00 82.43  ? 35   ARG D N   1 
ATOM   4152  C  CA  . ARG D  4 35  ? 107.415 -106.263 -83.993  1.00 84.08  ? 35   ARG D CA  1 
ATOM   4153  C  C   . ARG D  4 35  ? 108.138 -105.003 -83.491  1.00 83.56  ? 35   ARG D C   1 
ATOM   4154  O  O   . ARG D  4 35  ? 108.765 -104.282 -84.272  1.00 83.58  ? 35   ARG D O   1 
ATOM   4155  C  CB  . ARG D  4 35  ? 108.390 -107.451 -83.950  1.00 85.87  ? 35   ARG D CB  1 
ATOM   4156  C  CG  . ARG D  4 35  ? 108.988 -107.721 -82.565  1.00 88.75  ? 35   ARG D CG  1 
ATOM   4157  C  CD  . ARG D  4 35  ? 110.072 -108.793 -82.602  1.00 91.57  ? 35   ARG D CD  1 
ATOM   4158  N  NE  . ARG D  4 35  ? 109.564 -110.098 -83.026  1.00 94.15  ? 35   ARG D NE  1 
ATOM   4159  C  CZ  . ARG D  4 35  ? 110.328 -111.171 -83.228  1.00 94.79  ? 35   ARG D CZ  1 
ATOM   4160  N  NH1 . ARG D  4 35  ? 111.642 -111.099 -83.044  1.00 94.08  ? 35   ARG D NH1 1 
ATOM   4161  N  NH2 . ARG D  4 35  ? 109.780 -112.317 -83.620  1.00 94.90  ? 35   ARG D NH2 1 
ATOM   4162  N  N   . THR D  4 36  ? 108.053 -104.750 -82.184  1.00 82.93  ? 36   THR D N   1 
ATOM   4163  C  CA  . THR D  4 36  ? 108.691 -103.583 -81.573  1.00 81.78  ? 36   THR D CA  1 
ATOM   4164  C  C   . THR D  4 36  ? 110.152 -103.850 -81.208  1.00 82.17  ? 36   THR D C   1 
ATOM   4165  O  O   . THR D  4 36  ? 110.545 -104.989 -80.960  1.00 81.56  ? 36   THR D O   1 
ATOM   4166  C  CB  . THR D  4 36  ? 107.943 -103.152 -80.296  1.00 79.90  ? 36   THR D CB  1 
ATOM   4167  O  OG1 . THR D  4 36  ? 106.553 -103.002 -80.589  1.00 78.20  ? 36   THR D OG1 1 
ATOM   4168  C  CG2 . THR D  4 36  ? 108.471 -101.828 -79.787  1.00 79.59  ? 36   THR D CG2 1 
ATOM   4169  N  N   . GLU D  4 37  ? 110.950 -102.787 -81.183  1.00 83.68  ? 37   GLU D N   1 
ATOM   4170  C  CA  . GLU D  4 37  ? 112.368 -102.877 -80.837  1.00 85.47  ? 37   GLU D CA  1 
ATOM   4171  C  C   . GLU D  4 37  ? 112.677 -102.012 -79.617  1.00 86.37  ? 37   GLU D C   1 
ATOM   4172  O  O   . GLU D  4 37  ? 113.122 -102.518 -78.590  1.00 87.11  ? 37   GLU D O   1 
ATOM   4173  C  CB  . GLU D  4 37  ? 113.226 -102.450 -82.025  1.00 84.85  ? 37   GLU D CB  1 
ATOM   4174  C  CG  . GLU D  4 37  ? 113.051 -103.371 -83.204  1.00 84.33  ? 37   GLU D CG  1 
ATOM   4175  C  CD  . GLU D  4 37  ? 113.478 -104.785 -82.882  1.00 84.03  ? 37   GLU D CD  1 
ATOM   4176  O  OE1 . GLU D  4 37  ? 114.678 -105.093 -83.041  1.00 84.34  ? 37   GLU D OE1 1 
ATOM   4177  O  OE2 . GLU D  4 37  ? 112.616 -105.582 -82.456  1.00 83.27  ? 37   GLU D OE2 1 
ATOM   4178  N  N   . THR D  4 38  ? 112.452 -100.708 -79.729  1.00 87.21  ? 38   THR D N   1 
ATOM   4179  C  CA  . THR D  4 38  ? 112.678 -99.823  -78.595  1.00 88.39  ? 38   THR D CA  1 
ATOM   4180  C  C   . THR D  4 38  ? 111.295 -99.478  -78.067  1.00 88.82  ? 38   THR D C   1 
ATOM   4181  O  O   . THR D  4 38  ? 110.334 -99.419  -78.830  1.00 88.94  ? 38   THR D O   1 
ATOM   4182  C  CB  . THR D  4 38  ? 113.403 -98.522  -79.000  1.00 88.70  ? 38   THR D CB  1 
ATOM   4183  O  OG1 . THR D  4 38  ? 112.523 -97.704  -79.781  1.00 89.50  ? 38   THR D OG1 1 
ATOM   4184  C  CG2 . THR D  4 38  ? 114.655 -98.838  -79.810  1.00 89.10  ? 38   THR D CG2 1 
ATOM   4185  N  N   . ALA D  4 39  ? 111.186 -99.270  -76.762  1.00 89.24  ? 39   ALA D N   1 
ATOM   4186  C  CA  . ALA D  4 39  ? 109.901 -98.934  -76.172  1.00 89.75  ? 39   ALA D CA  1 
ATOM   4187  C  C   . ALA D  4 39  ? 109.443 -97.594  -76.727  1.00 90.26  ? 39   ALA D C   1 
ATOM   4188  O  O   . ALA D  4 39  ? 110.265 -96.786  -77.159  1.00 90.50  ? 39   ALA D O   1 
ATOM   4189  C  CB  . ALA D  4 39  ? 110.026 -98.860  -74.662  1.00 89.82  ? 39   ALA D CB  1 
HETATM 4190  N  N   . MSE D  4 40  ? 108.133 -97.369  -76.728  1.00 90.50  ? 40   MSE D N   1 
HETATM 4191  C  CA  . MSE D  4 40  ? 107.573 -96.115  -77.220  1.00 90.45  ? 40   MSE D CA  1 
HETATM 4192  C  C   . MSE D  4 40  ? 106.605 -95.548  -76.189  1.00 89.60  ? 40   MSE D C   1 
HETATM 4193  O  O   . MSE D  4 40  ? 105.452 -95.972  -76.103  1.00 88.97  ? 40   MSE D O   1 
HETATM 4194  C  CB  . MSE D  4 40  ? 106.834 -96.326  -78.542  1.00 92.10  ? 40   MSE D CB  1 
HETATM 4195  C  CG  . MSE D  4 40  ? 107.661 -96.982  -79.631  1.00 94.49  ? 40   MSE D CG  1 
HETATM 4196  SE SE  . MSE D  4 40  ? 106.706 -97.107  -81.313  1.00 96.67  ? 40   MSE D SE  1 
HETATM 4197  C  CE  . MSE D  4 40  ? 105.164 -98.100  -80.722  1.00 93.99  ? 40   MSE D CE  1 
ATOM   4198  N  N   . PRO D  4 41  ? 107.067 -94.584  -75.383  1.00 89.00  ? 41   PRO D N   1 
ATOM   4199  C  CA  . PRO D  4 41  ? 106.210 -93.977  -74.360  1.00 88.70  ? 41   PRO D CA  1 
ATOM   4200  C  C   . PRO D  4 41  ? 104.967 -93.295  -74.926  1.00 88.30  ? 41   PRO D C   1 
ATOM   4201  O  O   . PRO D  4 41  ? 104.840 -93.123  -76.136  1.00 87.73  ? 41   PRO D O   1 
ATOM   4202  C  CB  . PRO D  4 41  ? 107.151 -92.995  -73.654  1.00 88.76  ? 41   PRO D CB  1 
ATOM   4203  C  CG  . PRO D  4 41  ? 108.186 -92.682  -74.703  1.00 88.60  ? 41   PRO D CG  1 
ATOM   4204  C  CD  . PRO D  4 41  ? 108.429 -94.021  -75.335  1.00 88.38  ? 41   PRO D CD  1 
ATOM   4205  N  N   . ARG D  4 42  ? 104.056 -92.920  -74.032  1.00 88.41  ? 42   ARG D N   1 
ATOM   4206  C  CA  . ARG D  4 42  ? 102.814 -92.239  -74.389  1.00 88.53  ? 42   ARG D CA  1 
ATOM   4207  C  C   . ARG D  4 42  ? 101.887 -93.104  -75.248  1.00 88.32  ? 42   ARG D C   1 
ATOM   4208  O  O   . ARG D  4 42  ? 100.681 -93.157  -75.012  1.00 88.00  ? 42   ARG D O   1 
ATOM   4209  C  CB  . ARG D  4 42  ? 103.117 -90.932  -75.136  1.00 89.49  ? 42   ARG D CB  1 
ATOM   4210  C  CG  . ARG D  4 42  ? 104.441 -90.245  -74.772  1.00 90.94  ? 42   ARG D CG  1 
ATOM   4211  C  CD  . ARG D  4 42  ? 104.490 -89.706  -73.342  1.00 92.41  ? 42   ARG D CD  1 
ATOM   4212  N  NE  . ARG D  4 42  ? 105.774 -89.055  -73.058  1.00 93.94  ? 42   ARG D NE  1 
ATOM   4213  C  CZ  . ARG D  4 42  ? 106.101 -88.491  -71.895  1.00 94.35  ? 42   ARG D CZ  1 
ATOM   4214  N  NH1 . ARG D  4 42  ? 105.240 -88.488  -70.884  1.00 94.80  ? 42   ARG D NH1 1 
ATOM   4215  N  NH2 . ARG D  4 42  ? 107.294 -87.929  -71.742  1.00 93.75  ? 42   ARG D NH2 1 
ATOM   4216  N  N   . LEU D  4 43  ? 102.463 -93.775  -76.243  1.00 88.44  ? 43   LEU D N   1 
ATOM   4217  C  CA  . LEU D  4 43  ? 101.721 -94.629  -77.174  1.00 88.25  ? 43   LEU D CA  1 
ATOM   4218  C  C   . LEU D  4 43  ? 101.198 -95.928  -76.575  1.00 89.44  ? 43   LEU D C   1 
ATOM   4219  O  O   . LEU D  4 43  ? 101.610 -97.013  -76.984  1.00 89.56  ? 43   LEU D O   1 
ATOM   4220  C  CB  . LEU D  4 43  ? 102.602 -94.967  -78.380  1.00 86.24  ? 43   LEU D CB  1 
ATOM   4221  C  CG  . LEU D  4 43  ? 102.685 -94.023  -79.582  1.00 84.74  ? 43   LEU D CG  1 
ATOM   4222  C  CD1 . LEU D  4 43  ? 102.810 -92.568  -79.153  1.00 84.20  ? 43   LEU D CD1 1 
ATOM   4223  C  CD2 . LEU D  4 43  ? 103.873 -94.458  -80.426  1.00 83.65  ? 43   LEU D CD2 1 
ATOM   4224  N  N   . GLY D  4 44  ? 100.281 -95.821  -75.621  1.00 90.92  ? 44   GLY D N   1 
ATOM   4225  C  CA  . GLY D  4 44  ? 99.726  -97.009  -75.003  1.00 92.27  ? 44   GLY D CA  1 
ATOM   4226  C  C   . GLY D  4 44  ? 98.216  -96.947  -74.910  1.00 93.53  ? 44   GLY D C   1 
ATOM   4227  O  O   . GLY D  4 44  ? 97.561  -97.947  -74.624  1.00 93.50  ? 44   GLY D O   1 
ATOM   4228  N  N   . ALA D  4 45  ? 97.661  -95.765  -75.155  1.00 95.16  ? 45   ALA D N   1 
ATOM   4229  C  CA  . ALA D  4 45  ? 96.217  -95.567  -75.097  1.00 97.47  ? 45   ALA D CA  1 
ATOM   4230  C  C   . ALA D  4 45  ? 95.527  -96.027  -76.380  1.00 98.87  ? 45   ALA D C   1 
ATOM   4231  O  O   . ALA D  4 45  ? 94.397  -96.517  -76.347  1.00 98.03  ? 45   ALA D O   1 
ATOM   4232  C  CB  . ALA D  4 45  ? 95.905  -94.090  -74.838  1.00 97.44  ? 45   ALA D CB  1 
ATOM   4233  N  N   . PHE D  4 46  ? 96.210  -95.863  -77.509  1.00 101.09 ? 46   PHE D N   1 
ATOM   4234  C  CA  . PHE D  4 46  ? 95.646  -96.253  -78.794  1.00 103.13 ? 46   PHE D CA  1 
ATOM   4235  C  C   . PHE D  4 46  ? 95.700  -97.767  -78.925  1.00 103.67 ? 46   PHE D C   1 
ATOM   4236  O  O   . PHE D  4 46  ? 94.756  -98.394  -79.407  1.00 104.10 ? 46   PHE D O   1 
ATOM   4237  C  CB  . PHE D  4 46  ? 96.419  -95.592  -79.943  1.00 103.86 ? 46   PHE D CB  1 
ATOM   4238  C  CG  . PHE D  4 46  ? 95.552  -95.209  -81.117  1.00 104.60 ? 46   PHE D CG  1 
ATOM   4239  C  CD1 . PHE D  4 46  ? 94.531  -94.271  -80.968  1.00 104.25 ? 46   PHE D CD1 1 
ATOM   4240  C  CD2 . PHE D  4 46  ? 95.746  -95.792  -82.367  1.00 104.79 ? 46   PHE D CD2 1 
ATOM   4241  C  CE1 . PHE D  4 46  ? 93.714  -93.922  -82.048  1.00 104.41 ? 46   PHE D CE1 1 
ATOM   4242  C  CE2 . PHE D  4 46  ? 94.933  -95.448  -83.450  1.00 104.61 ? 46   PHE D CE2 1 
ATOM   4243  C  CZ  . PHE D  4 46  ? 93.916  -94.513  -83.291  1.00 104.28 ? 46   PHE D CZ  1 
ATOM   4244  N  N   . PHE D  4 47  ? 96.811  -98.346  -78.489  1.00 103.99 ? 47   PHE D N   1 
ATOM   4245  C  CA  . PHE D  4 47  ? 96.990  -99.790  -78.535  1.00 105.33 ? 47   PHE D CA  1 
ATOM   4246  C  C   . PHE D  4 47  ? 96.554  -100.385 -77.195  1.00 106.79 ? 47   PHE D C   1 
ATOM   4247  O  O   . PHE D  4 47  ? 97.390  -100.820 -76.399  1.00 106.77 ? 47   PHE D O   1 
ATOM   4248  C  CB  . PHE D  4 47  ? 98.456  -100.121 -78.796  1.00 104.42 ? 47   PHE D CB  1 
ATOM   4249  C  CG  . PHE D  4 47  ? 98.964  -99.630  -80.118  1.00 103.55 ? 47   PHE D CG  1 
ATOM   4250  C  CD1 . PHE D  4 47  ? 98.763  -100.374 -81.274  1.00 102.92 ? 47   PHE D CD1 1 
ATOM   4251  C  CD2 . PHE D  4 47  ? 99.657  -98.426  -80.206  1.00 103.14 ? 47   PHE D CD2 1 
ATOM   4252  C  CE1 . PHE D  4 47  ? 99.247  -99.930  -82.498  1.00 103.33 ? 47   PHE D CE1 1 
ATOM   4253  C  CE2 . PHE D  4 47  ? 100.145 -97.970  -81.426  1.00 102.76 ? 47   PHE D CE2 1 
ATOM   4254  C  CZ  . PHE D  4 47  ? 99.941  -98.723  -82.574  1.00 103.45 ? 47   PHE D CZ  1 
ATOM   4255  N  N   . LEU D  4 48  ? 95.244  -100.397 -76.952  1.00 108.37 ? 48   LEU D N   1 
ATOM   4256  C  CA  . LEU D  4 48  ? 94.678  -100.922 -75.706  1.00 109.63 ? 48   LEU D CA  1 
ATOM   4257  C  C   . LEU D  4 48  ? 95.049  -102.384 -75.436  1.00 110.73 ? 48   LEU D C   1 
ATOM   4258  O  O   . LEU D  4 48  ? 94.491  -103.307 -76.043  1.00 110.71 ? 48   LEU D O   1 
ATOM   4259  C  CB  . LEU D  4 48  ? 93.150  -100.777 -75.713  1.00 108.91 ? 48   LEU D CB  1 
ATOM   4260  C  CG  . LEU D  4 48  ? 92.557  -99.366  -75.763  1.00 108.28 ? 48   LEU D CG  1 
ATOM   4261  C  CD1 . LEU D  4 48  ? 93.181  -98.523  -74.661  1.00 107.70 ? 48   LEU D CD1 1 
ATOM   4262  C  CD2 . LEU D  4 48  ? 92.800  -98.738  -77.128  1.00 107.94 ? 48   LEU D CD2 1 
ATOM   4263  N  N   . GLU D  4 49  ? 95.983  -102.583 -74.508  1.00 111.27 ? 49   GLU D N   1 
ATOM   4264  C  CA  . GLU D  4 49  ? 96.450  -103.918 -74.147  1.00 111.86 ? 49   GLU D CA  1 
ATOM   4265  C  C   . GLU D  4 49  ? 96.276  -104.183 -72.652  1.00 111.61 ? 49   GLU D C   1 
ATOM   4266  O  O   . GLU D  4 49  ? 95.367  -104.907 -72.240  1.00 111.73 ? 49   GLU D O   1 
ATOM   4267  C  CB  . GLU D  4 49  ? 97.926  -104.071 -74.539  1.00 112.61 ? 49   GLU D CB  1 
ATOM   4268  C  CG  . GLU D  4 49  ? 98.872  -103.114 -73.812  1.00 114.29 ? 49   GLU D CG  1 
ATOM   4269  C  CD  . GLU D  4 49  ? 100.024 -102.634 -74.688  1.00 114.81 ? 49   GLU D CD  1 
ATOM   4270  O  OE1 . GLU D  4 49  ? 100.932 -101.951 -74.165  1.00 114.42 ? 49   GLU D OE1 1 
ATOM   4271  O  OE2 . GLU D  4 49  ? 100.015 -102.932 -75.903  1.00 115.41 ? 49   GLU D OE2 1 
ATOM   4272  N  N   . ASN D  4 58  ? 100.422 -96.030  -71.139  1.00 102.71 ? 58   ASN D N   1 
ATOM   4273  C  CA  . ASN D  4 58  ? 101.444 -94.999  -71.015  1.00 102.33 ? 58   ASN D CA  1 
ATOM   4274  C  C   . ASN D  4 58  ? 102.658 -95.271  -71.904  1.00 102.09 ? 58   ASN D C   1 
ATOM   4275  O  O   . ASN D  4 58  ? 103.552 -94.429  -72.013  1.00 102.61 ? 58   ASN D O   1 
ATOM   4276  C  CB  . ASN D  4 58  ? 101.897 -94.866  -69.551  1.00 102.43 ? 58   ASN D CB  1 
ATOM   4277  C  CG  . ASN D  4 58  ? 102.469 -96.163  -68.982  1.00 102.15 ? 58   ASN D CG  1 
ATOM   4278  O  OD1 . ASN D  4 58  ? 103.152 -96.150  -67.958  1.00 101.75 ? 58   ASN D OD1 1 
ATOM   4279  N  ND2 . ASN D  4 58  ? 102.181 -97.284  -69.634  1.00 101.91 ? 58   ASN D ND2 1 
ATOM   4280  N  N   . ALA D  4 59  ? 102.685 -96.443  -72.534  1.00 101.38 ? 59   ALA D N   1 
ATOM   4281  C  CA  . ALA D  4 59  ? 103.792 -96.827  -73.411  1.00 100.83 ? 59   ALA D CA  1 
ATOM   4282  C  C   . ALA D  4 59  ? 103.591 -98.221  -74.000  1.00 100.52 ? 59   ALA D C   1 
ATOM   4283  O  O   . ALA D  4 59  ? 102.584 -98.877  -73.741  1.00 101.05 ? 59   ALA D O   1 
ATOM   4284  C  CB  . ALA D  4 59  ? 105.104 -96.782  -72.646  1.00 100.63 ? 59   ALA D CB  1 
ATOM   4285  N  N   . VAL D  4 60  ? 104.556 -98.670  -74.795  1.00 99.47  ? 60   VAL D N   1 
ATOM   4286  C  CA  . VAL D  4 60  ? 104.482 -99.986  -75.411  1.00 98.77  ? 60   VAL D CA  1 
ATOM   4287  C  C   . VAL D  4 60  ? 105.833 -100.681 -75.353  1.00 98.13  ? 60   VAL D C   1 
ATOM   4288  O  O   . VAL D  4 60  ? 106.785 -100.280 -76.023  1.00 98.09  ? 60   VAL D O   1 
ATOM   4289  C  CB  . VAL D  4 60  ? 104.026 -99.892  -76.874  1.00 99.42  ? 60   VAL D CB  1 
ATOM   4290  C  CG1 . VAL D  4 60  ? 102.533 -99.625  -76.939  1.00 98.74  ? 60   VAL D CG1 1 
ATOM   4291  C  CG2 . VAL D  4 60  ? 104.782 -98.783  -77.571  1.00 100.16 ? 60   VAL D CG2 1 
ATOM   4292  N  N   . PRO D  4 61  ? 105.923 -101.751 -74.553  1.00 97.69  ? 61   PRO D N   1 
ATOM   4293  C  CA  . PRO D  4 61  ? 107.143 -102.541 -74.368  1.00 97.39  ? 61   PRO D CA  1 
ATOM   4294  C  C   . PRO D  4 61  ? 107.861 -102.894 -75.656  1.00 97.48  ? 61   PRO D C   1 
ATOM   4295  O  O   . PRO D  4 61  ? 107.296 -102.801 -76.742  1.00 98.08  ? 61   PRO D O   1 
ATOM   4296  C  CB  . PRO D  4 61  ? 106.646 -103.776 -73.623  1.00 97.67  ? 61   PRO D CB  1 
ATOM   4297  C  CG  . PRO D  4 61  ? 105.204 -103.878 -74.043  1.00 97.82  ? 61   PRO D CG  1 
ATOM   4298  C  CD  . PRO D  4 61  ? 104.765 -102.448 -73.970  1.00 97.30  ? 61   PRO D CD  1 
ATOM   4299  N  N   . GLN D  4 62  ? 109.115 -103.305 -75.522  1.00 97.92  ? 62   GLN D N   1 
ATOM   4300  C  CA  . GLN D  4 62  ? 109.927 -103.675 -76.671  1.00 98.58  ? 62   GLN D CA  1 
ATOM   4301  C  C   . GLN D  4 62  ? 109.699 -105.142 -77.014  1.00 97.85  ? 62   GLN D C   1 
ATOM   4302  O  O   . GLN D  4 62  ? 109.879 -106.016 -76.163  1.00 98.27  ? 62   GLN D O   1 
ATOM   4303  C  CB  . GLN D  4 62  ? 111.412 -103.447 -76.366  1.00 100.16 ? 62   GLN D CB  1 
ATOM   4304  C  CG  . GLN D  4 62  ? 111.726 -102.084 -75.749  1.00 103.27 ? 62   GLN D CG  1 
ATOM   4305  C  CD  . GLN D  4 62  ? 113.220 -101.842 -75.564  1.00 104.45 ? 62   GLN D CD  1 
ATOM   4306  O  OE1 . GLN D  4 62  ? 113.951 -102.720 -75.103  1.00 104.97 ? 62   GLN D OE1 1 
ATOM   4307  N  NE2 . GLN D  4 62  ? 113.676 -100.639 -75.912  1.00 104.91 ? 62   GLN D NE2 1 
ATOM   4308  N  N   . GLY D  4 63  ? 109.301 -105.406 -78.258  1.00 96.61  ? 63   GLY D N   1 
ATOM   4309  C  CA  . GLY D  4 63  ? 109.068 -106.774 -78.692  1.00 94.38  ? 63   GLY D CA  1 
ATOM   4310  C  C   . GLY D  4 63  ? 107.618 -107.075 -79.018  1.00 92.95  ? 63   GLY D C   1 
ATOM   4311  O  O   . GLY D  4 63  ? 107.313 -108.089 -79.649  1.00 93.85  ? 63   GLY D O   1 
ATOM   4312  N  N   . SER D  4 64  ? 106.724 -106.189 -78.592  1.00 90.56  ? 64   SER D N   1 
ATOM   4313  C  CA  . SER D  4 64  ? 105.292 -106.348 -78.828  1.00 88.22  ? 64   SER D CA  1 
ATOM   4314  C  C   . SER D  4 64  ? 104.968 -106.647 -80.296  1.00 86.99  ? 64   SER D C   1 
ATOM   4315  O  O   . SER D  4 64  ? 105.510 -106.009 -81.199  1.00 87.61  ? 64   SER D O   1 
ATOM   4316  C  CB  . SER D  4 64  ? 104.566 -105.076 -78.394  1.00 87.41  ? 64   SER D CB  1 
ATOM   4317  O  OG  . SER D  4 64  ? 105.043 -104.633 -77.137  1.00 86.14  ? 64   SER D OG  1 
ATOM   4318  N  N   . LYS D  4 65  ? 104.088 -107.618 -80.528  1.00 84.82  ? 65   LYS D N   1 
ATOM   4319  C  CA  . LYS D  4 65  ? 103.684 -107.989 -81.885  1.00 82.34  ? 65   LYS D CA  1 
ATOM   4320  C  C   . LYS D  4 65  ? 102.546 -107.050 -82.279  1.00 80.06  ? 65   LYS D C   1 
ATOM   4321  O  O   . LYS D  4 65  ? 101.505 -107.025 -81.624  1.00 80.01  ? 65   LYS D O   1 
ATOM   4322  C  CB  . LYS D  4 65  ? 103.191 -109.438 -81.916  1.00 83.21  ? 65   LYS D CB  1 
ATOM   4323  C  CG  . LYS D  4 65  ? 104.057 -110.415 -81.127  1.00 85.29  ? 65   LYS D CG  1 
ATOM   4324  C  CD  . LYS D  4 65  ? 105.412 -110.665 -81.777  1.00 86.79  ? 65   LYS D CD  1 
ATOM   4325  C  CE  . LYS D  4 65  ? 105.308 -111.657 -82.927  1.00 87.12  ? 65   LYS D CE  1 
ATOM   4326  N  NZ  . LYS D  4 65  ? 106.652 -112.045 -83.441  1.00 86.99  ? 65   LYS D NZ  1 
ATOM   4327  N  N   . LEU D  4 66  ? 102.740 -106.285 -83.351  1.00 77.28  ? 66   LEU D N   1 
ATOM   4328  C  CA  . LEU D  4 66  ? 101.730 -105.328 -83.791  1.00 73.93  ? 66   LEU D CA  1 
ATOM   4329  C  C   . LEU D  4 66  ? 101.243 -105.430 -85.233  1.00 71.53  ? 66   LEU D C   1 
ATOM   4330  O  O   . LEU D  4 66  ? 101.882 -106.038 -86.089  1.00 70.60  ? 66   LEU D O   1 
ATOM   4331  C  CB  . LEU D  4 66  ? 102.241 -103.910 -83.551  1.00 73.60  ? 66   LEU D CB  1 
ATOM   4332  C  CG  . LEU D  4 66  ? 102.369 -103.491 -82.091  1.00 73.29  ? 66   LEU D CG  1 
ATOM   4333  C  CD1 . LEU D  4 66  ? 103.104 -102.167 -82.004  1.00 73.01  ? 66   LEU D CD1 1 
ATOM   4334  C  CD2 . LEU D  4 66  ? 100.980 -103.388 -81.473  1.00 73.10  ? 66   LEU D CD2 1 
ATOM   4335  N  N   . GLU D  4 67  ? 100.095 -104.802 -85.471  1.00 69.67  ? 67   GLU D N   1 
ATOM   4336  C  CA  . GLU D  4 67  ? 99.439  -104.748 -86.776  1.00 67.53  ? 67   GLU D CA  1 
ATOM   4337  C  C   . GLU D  4 67  ? 99.370  -103.278 -87.165  1.00 65.76  ? 67   GLU D C   1 
ATOM   4338  O  O   . GLU D  4 67  ? 98.466  -102.565 -86.724  1.00 64.48  ? 67   GLU D O   1 
ATOM   4339  C  CB  . GLU D  4 67  ? 98.018  -105.291 -86.663  1.00 67.89  ? 67   GLU D CB  1 
ATOM   4340  C  CG  . GLU D  4 67  ? 97.940  -106.690 -86.094  1.00 69.31  ? 67   GLU D CG  1 
ATOM   4341  C  CD  . GLU D  4 67  ? 98.196  -107.755 -87.136  1.00 70.50  ? 67   GLU D CD  1 
ATOM   4342  O  OE1 . GLU D  4 67  ? 99.206  -107.652 -87.873  1.00 71.24  ? 67   GLU D OE1 1 
ATOM   4343  O  OE2 . GLU D  4 67  ? 97.380  -108.699 -87.211  1.00 71.23  ? 67   GLU D OE2 1 
ATOM   4344  N  N   . LEU D  4 68  ? 100.313 -102.822 -87.985  1.00 64.38  ? 68   LEU D N   1 
ATOM   4345  C  CA  . LEU D  4 68  ? 100.334 -101.416 -88.384  1.00 63.17  ? 68   LEU D CA  1 
ATOM   4346  C  C   . LEU D  4 68  ? 100.169 -101.132 -89.870  1.00 61.79  ? 68   LEU D C   1 
ATOM   4347  O  O   . LEU D  4 68  ? 100.654 -101.879 -90.723  1.00 60.03  ? 68   LEU D O   1 
ATOM   4348  C  CB  . LEU D  4 68  ? 101.634 -100.752 -87.924  1.00 63.60  ? 68   LEU D CB  1 
ATOM   4349  C  CG  . LEU D  4 68  ? 101.934 -100.641 -86.431  1.00 63.80  ? 68   LEU D CG  1 
ATOM   4350  C  CD1 . LEU D  4 68  ? 103.272 -99.955  -86.266  1.00 64.18  ? 68   LEU D CD1 1 
ATOM   4351  C  CD2 . LEU D  4 68  ? 100.837 -99.863  -85.717  1.00 63.48  ? 68   LEU D CD2 1 
ATOM   4352  N  N   . PRO D  4 69  ? 99.477  -100.029 -90.194  1.00 61.33  ? 69   PRO D N   1 
ATOM   4353  C  CA  . PRO D  4 69  ? 99.252  -99.627  -91.580  1.00 62.00  ? 69   PRO D CA  1 
ATOM   4354  C  C   . PRO D  4 69  ? 100.578 -99.695  -92.324  1.00 62.05  ? 69   PRO D C   1 
ATOM   4355  O  O   . PRO D  4 69  ? 101.623 -99.372  -91.759  1.00 62.75  ? 69   PRO D O   1 
ATOM   4356  C  CB  . PRO D  4 69  ? 98.736  -98.200  -91.435  1.00 61.27  ? 69   PRO D CB  1 
ATOM   4357  C  CG  . PRO D  4 69  ? 97.893  -98.305  -90.216  1.00 61.15  ? 69   PRO D CG  1 
ATOM   4358  C  CD  . PRO D  4 69  ? 98.775  -99.117  -89.272  1.00 61.38  ? 69   PRO D CD  1 
ATOM   4359  N  N   . LEU D  4 70  ? 100.541 -100.129 -93.579  1.00 61.37  ? 70   LEU D N   1 
ATOM   4360  C  CA  . LEU D  4 70  ? 101.765 -100.234 -94.356  1.00 59.61  ? 70   LEU D CA  1 
ATOM   4361  C  C   . LEU D  4 70  ? 102.464 -98.878  -94.426  1.00 58.85  ? 70   LEU D C   1 
ATOM   4362  O  O   . LEU D  4 70  ? 103.687 -98.817  -94.541  1.00 57.52  ? 70   LEU D O   1 
ATOM   4363  C  CB  . LEU D  4 70  ? 101.463 -100.755 -95.762  1.00 58.48  ? 70   LEU D CB  1 
ATOM   4364  C  CG  . LEU D  4 70  ? 102.692 -101.087 -96.609  1.00 58.63  ? 70   LEU D CG  1 
ATOM   4365  C  CD1 . LEU D  4 70  ? 103.494 -102.211 -95.972  1.00 57.53  ? 70   LEU D CD1 1 
ATOM   4366  C  CD2 . LEU D  4 70  ? 102.251 -101.487 -97.995  1.00 58.51  ? 70   LEU D CD2 1 
ATOM   4367  N  N   . TRP D  4 71  ? 101.696 -97.794  -94.344  1.00 58.38  ? 71   TRP D N   1 
ATOM   4368  C  CA  . TRP D  4 71  ? 102.301 -96.472  -94.393  1.00 59.81  ? 71   TRP D CA  1 
ATOM   4369  C  C   . TRP D  4 71  ? 103.071 -96.172  -93.114  1.00 61.13  ? 71   TRP D C   1 
ATOM   4370  O  O   . TRP D  4 71  ? 104.166 -95.613  -93.156  1.00 61.85  ? 71   TRP D O   1 
ATOM   4371  C  CB  . TRP D  4 71  ? 101.251 -95.379  -94.635  1.00 60.06  ? 71   TRP D CB  1 
ATOM   4372  C  CG  . TRP D  4 71  ? 100.169 -95.235  -93.597  1.00 61.59  ? 71   TRP D CG  1 
ATOM   4373  C  CD1 . TRP D  4 71  ? 98.887  -95.695  -93.687  1.00 61.89  ? 71   TRP D CD1 1 
ATOM   4374  C  CD2 . TRP D  4 71  ? 100.248 -94.518  -92.355  1.00 62.09  ? 71   TRP D CD2 1 
ATOM   4375  N  NE1 . TRP D  4 71  ? 98.160  -95.305  -92.589  1.00 61.81  ? 71   TRP D NE1 1 
ATOM   4376  C  CE2 . TRP D  4 71  ? 98.970  -94.581  -91.753  1.00 62.27  ? 71   TRP D CE2 1 
ATOM   4377  C  CE3 . TRP D  4 71  ? 101.273 -93.826  -91.692  1.00 62.14  ? 71   TRP D CE3 1 
ATOM   4378  C  CZ2 . TRP D  4 71  ? 98.686  -93.976  -90.517  1.00 62.07  ? 71   TRP D CZ2 1 
ATOM   4379  C  CZ3 . TRP D  4 71  ? 100.990 -93.225  -90.460  1.00 62.11  ? 71   TRP D CZ3 1 
ATOM   4380  C  CH2 . TRP D  4 71  ? 99.706  -93.306  -89.889  1.00 61.44  ? 71   TRP D CH2 1 
ATOM   4381  N  N   . LEU D  4 72  ? 102.501 -96.554  -91.978  1.00 61.93  ? 72   LEU D N   1 
ATOM   4382  C  CA  . LEU D  4 72  ? 103.142 -96.331  -90.689  1.00 61.95  ? 72   LEU D CA  1 
ATOM   4383  C  C   . LEU D  4 72  ? 104.374 -97.212  -90.546  1.00 62.71  ? 72   LEU D C   1 
ATOM   4384  O  O   . LEU D  4 72  ? 105.457 -96.732  -90.238  1.00 62.58  ? 72   LEU D O   1 
ATOM   4385  C  CB  . LEU D  4 72  ? 102.156 -96.634  -89.566  1.00 61.42  ? 72   LEU D CB  1 
ATOM   4386  C  CG  . LEU D  4 72  ? 102.640 -96.431  -88.134  1.00 60.53  ? 72   LEU D CG  1 
ATOM   4387  C  CD1 . LEU D  4 72  ? 103.149 -95.002  -87.952  1.00 60.25  ? 72   LEU D CD1 1 
ATOM   4388  C  CD2 . LEU D  4 72  ? 101.486 -96.725  -87.185  1.00 59.98  ? 72   LEU D CD2 1 
ATOM   4389  N  N   . ALA D  4 73  ? 104.201 -98.508  -90.774  1.00 64.06  ? 73   ALA D N   1 
ATOM   4390  C  CA  . ALA D  4 73  ? 105.302 -99.451  -90.674  1.00 64.69  ? 73   ALA D CA  1 
ATOM   4391  C  C   . ALA D  4 73  ? 106.453 -98.998  -91.548  1.00 65.58  ? 73   ALA D C   1 
ATOM   4392  O  O   . ALA D  4 73  ? 107.611 -99.155  -91.184  1.00 66.13  ? 73   ALA D O   1 
ATOM   4393  C  CB  . ALA D  4 73  ? 104.847 -100.835 -91.098  1.00 64.76  ? 73   ALA D CB  1 
ATOM   4394  N  N   . LYS D  4 74  ? 106.135 -98.437  -92.708  1.00 67.52  ? 74   LYS D N   1 
ATOM   4395  C  CA  . LYS D  4 74  ? 107.168 -97.966  -93.623  1.00 68.63  ? 74   LYS D CA  1 
ATOM   4396  C  C   . LYS D  4 74  ? 107.724 -96.621  -93.163  1.00 68.13  ? 74   LYS D C   1 
ATOM   4397  O  O   . LYS D  4 74  ? 108.856 -96.272  -93.471  1.00 66.23  ? 74   LYS D O   1 
ATOM   4398  C  CB  . LYS D  4 74  ? 106.607 -97.848  -95.046  1.00 70.44  ? 74   LYS D CB  1 
ATOM   4399  C  CG  . LYS D  4 74  ? 107.636 -97.424  -96.092  1.00 71.88  ? 74   LYS D CG  1 
ATOM   4400  C  CD  . LYS D  4 74  ? 107.054 -97.446  -97.491  1.00 73.07  ? 74   LYS D CD  1 
ATOM   4401  C  CE  . LYS D  4 74  ? 105.845 -96.527  -97.605  1.00 74.90  ? 74   LYS D CE  1 
ATOM   4402  N  NZ  . LYS D  4 74  ? 105.238 -96.564  -98.973  1.00 76.40  ? 74   LYS D NZ  1 
ATOM   4403  N  N   . GLY D  4 75  ? 106.922 -95.869  -92.422  1.00 69.56  ? 75   GLY D N   1 
ATOM   4404  C  CA  . GLY D  4 75  ? 107.381 -94.584  -91.932  1.00 72.36  ? 75   GLY D CA  1 
ATOM   4405  C  C   . GLY D  4 75  ? 108.332 -94.727  -90.751  1.00 74.20  ? 75   GLY D C   1 
ATOM   4406  O  O   . GLY D  4 75  ? 109.062 -93.795  -90.415  1.00 75.11  ? 75   GLY D O   1 
ATOM   4407  N  N   . LEU D  4 76  ? 108.327 -95.897  -90.118  1.00 75.14  ? 76   LEU D N   1 
ATOM   4408  C  CA  . LEU D  4 76  ? 109.186 -96.159  -88.968  1.00 75.47  ? 76   LEU D CA  1 
ATOM   4409  C  C   . LEU D  4 76  ? 110.367 -97.060  -89.297  1.00 76.87  ? 76   LEU D C   1 
ATOM   4410  O  O   . LEU D  4 76  ? 111.427 -96.955  -88.694  1.00 76.89  ? 76   LEU D O   1 
ATOM   4411  C  CB  . LEU D  4 76  ? 108.364 -96.784  -87.841  1.00 73.91  ? 76   LEU D CB  1 
ATOM   4412  C  CG  . LEU D  4 76  ? 107.762 -95.804  -86.830  1.00 73.99  ? 76   LEU D CG  1 
ATOM   4413  C  CD1 . LEU D  4 76  ? 107.202 -94.584  -87.536  1.00 73.45  ? 76   LEU D CD1 1 
ATOM   4414  C  CD2 . LEU D  4 76  ? 106.689 -96.510  -86.021  1.00 73.62  ? 76   LEU D CD2 1 
ATOM   4415  N  N   . PHE D  4 77  ? 110.187 -97.939  -90.269  1.00 79.24  ? 77   PHE D N   1 
ATOM   4416  C  CA  . PHE D  4 77  ? 111.237 -98.864  -90.652  1.00 81.48  ? 77   PHE D CA  1 
ATOM   4417  C  C   . PHE D  4 77  ? 112.455 -98.200  -91.279  1.00 84.25  ? 77   PHE D C   1 
ATOM   4418  O  O   . PHE D  4 77  ? 112.342 -97.183  -91.961  1.00 83.54  ? 77   PHE D O   1 
ATOM   4419  C  CB  . PHE D  4 77  ? 110.663 -99.913  -91.601  1.00 79.29  ? 77   PHE D CB  1 
ATOM   4420  C  CG  . PHE D  4 77  ? 111.671 -100.896 -92.103  1.00 77.45  ? 77   PHE D CG  1 
ATOM   4421  C  CD1 . PHE D  4 77  ? 112.454 -100.604 -93.210  1.00 76.51  ? 77   PHE D CD1 1 
ATOM   4422  C  CD2 . PHE D  4 77  ? 111.822 -102.128 -91.480  1.00 77.46  ? 77   PHE D CD2 1 
ATOM   4423  C  CE1 . PHE D  4 77  ? 113.368 -101.527 -93.693  1.00 76.96  ? 77   PHE D CE1 1 
ATOM   4424  C  CE2 . PHE D  4 77  ? 112.735 -103.060 -91.954  1.00 76.79  ? 77   PHE D CE2 1 
ATOM   4425  C  CZ  . PHE D  4 77  ? 113.509 -102.759 -93.065  1.00 77.13  ? 77   PHE D CZ  1 
ATOM   4426  N  N   . ASP D  4 78  ? 113.621 -98.791  -91.017  1.00 88.45  ? 78   ASP D N   1 
ATOM   4427  C  CA  . ASP D  4 78  ? 114.906 -98.329  -91.542  1.00 92.09  ? 78   ASP D CA  1 
ATOM   4428  C  C   . ASP D  4 78  ? 115.847 -99.533  -91.651  1.00 94.40  ? 78   ASP D C   1 
ATOM   4429  O  O   . ASP D  4 78  ? 115.461 -100.652 -91.299  1.00 94.42  ? 78   ASP D O   1 
ATOM   4430  C  CB  . ASP D  4 78  ? 115.517 -97.242  -90.638  1.00 92.93  ? 78   ASP D CB  1 
ATOM   4431  C  CG  . ASP D  4 78  ? 115.640 -97.673  -89.181  1.00 94.50  ? 78   ASP D CG  1 
ATOM   4432  O  OD1 . ASP D  4 78  ? 116.378 -98.640  -88.891  1.00 94.85  ? 78   ASP D OD1 1 
ATOM   4433  O  OD2 . ASP D  4 78  ? 114.999 -97.034  -88.319  1.00 94.89  ? 78   ASP D OD2 1 
ATOM   4434  N  N   . ASN D  4 79  ? 117.068 -99.309  -92.138  1.00 96.94  ? 79   ASN D N   1 
ATOM   4435  C  CA  . ASN D  4 79  ? 118.053 -100.386 -92.305  1.00 99.05  ? 79   ASN D CA  1 
ATOM   4436  C  C   . ASN D  4 79  ? 118.690 -100.919 -91.016  1.00 99.93  ? 79   ASN D C   1 
ATOM   4437  O  O   . ASN D  4 79  ? 119.553 -101.800 -91.066  1.00 100.43 ? 79   ASN D O   1 
ATOM   4438  C  CB  . ASN D  4 79  ? 119.179 -99.944  -93.249  1.00 100.23 ? 79   ASN D CB  1 
ATOM   4439  C  CG  . ASN D  4 79  ? 118.747 -99.903  -94.700  1.00 101.72 ? 79   ASN D CG  1 
ATOM   4440  O  OD1 . ASN D  4 79  ? 118.122 -100.845 -95.199  1.00 101.92 ? 79   ASN D OD1 1 
ATOM   4441  N  ND2 . ASN D  4 79  ? 119.090 -98.818  -95.393  1.00 101.80 ? 79   ASN D ND2 1 
ATOM   4442  N  N   . LYS D  4 80  ? 118.267 -100.393 -89.871  1.00 100.04 ? 80   LYS D N   1 
ATOM   4443  C  CA  . LYS D  4 80  ? 118.819 -100.816 -88.589  1.00 99.65  ? 80   LYS D CA  1 
ATOM   4444  C  C   . LYS D  4 80  ? 117.809 -101.609 -87.765  1.00 99.44  ? 80   LYS D C   1 
ATOM   4445  O  O   . LYS D  4 80  ? 118.180 -102.291 -86.809  1.00 99.38  ? 80   LYS D O   1 
ATOM   4446  C  CB  . LYS D  4 80  ? 119.281 -99.584  -87.804  1.00 99.81  ? 80   LYS D CB  1 
ATOM   4447  C  CG  . LYS D  4 80  ? 119.809 -99.861  -86.399  1.00 100.34 ? 80   LYS D CG  1 
ATOM   4448  C  CD  . LYS D  4 80  ? 121.175 -100.528 -86.400  1.00 99.79  ? 80   LYS D CD  1 
ATOM   4449  C  CE  . LYS D  4 80  ? 121.734 -100.601 -84.987  1.00 98.64  ? 80   LYS D CE  1 
ATOM   4450  N  NZ  . LYS D  4 80  ? 120.784 -101.272 -84.054  1.00 98.55  ? 80   LYS D NZ  1 
ATOM   4451  N  N   . ARG D  4 81  ? 116.535 -101.526 -88.143  1.00 99.08  ? 81   ARG D N   1 
ATOM   4452  C  CA  . ARG D  4 81  ? 115.475 -102.225 -87.419  1.00 98.56  ? 81   ARG D CA  1 
ATOM   4453  C  C   . ARG D  4 81  ? 115.496 -101.748 -85.972  1.00 96.97  ? 81   ARG D C   1 
ATOM   4454  O  O   . ARG D  4 81  ? 115.031 -102.437 -85.067  1.00 96.27  ? 81   ARG D O   1 
ATOM   4455  C  CB  . ARG D  4 81  ? 115.691 -103.745 -87.472  1.00 99.58  ? 81   ARG D CB  1 
ATOM   4456  C  CG  . ARG D  4 81  ? 115.366 -104.397 -88.817  1.00 101.08 ? 81   ARG D CG  1 
ATOM   4457  C  CD  . ARG D  4 81  ? 116.206 -103.836 -89.960  1.00 102.51 ? 81   ARG D CD  1 
ATOM   4458  N  NE  . ARG D  4 81  ? 115.910 -104.496 -91.232  1.00 104.29 ? 81   ARG D NE  1 
ATOM   4459  C  CZ  . ARG D  4 81  ? 116.445 -104.158 -92.404  1.00 104.90 ? 81   ARG D CZ  1 
ATOM   4460  N  NH1 . ARG D  4 81  ? 117.312 -103.157 -92.483  1.00 104.64 ? 81   ARG D NH1 1 
ATOM   4461  N  NH2 . ARG D  4 81  ? 116.113 -104.823 -93.505  1.00 105.42 ? 81   ARG D NH2 1 
ATOM   4462  N  N   . ARG D  4 82  ? 116.042 -100.553 -85.776  1.00 95.47  ? 82   ARG D N   1 
ATOM   4463  C  CA  . ARG D  4 82  ? 116.163 -99.944  -84.462  1.00 94.39  ? 82   ARG D CA  1 
ATOM   4464  C  C   . ARG D  4 82  ? 114.841 -99.387  -83.949  1.00 93.62  ? 82   ARG D C   1 
ATOM   4465  O  O   . ARG D  4 82  ? 114.805 -98.709  -82.926  1.00 93.95  ? 82   ARG D O   1 
ATOM   4466  C  CB  . ARG D  4 82  ? 117.207 -98.823  -84.515  1.00 94.70  ? 82   ARG D CB  1 
ATOM   4467  C  CG  . ARG D  4 82  ? 116.954 -97.803  -85.619  1.00 95.08  ? 82   ARG D CG  1 
ATOM   4468  C  CD  . ARG D  4 82  ? 117.962 -96.647  -85.615  1.00 95.87  ? 82   ARG D CD  1 
ATOM   4469  N  NE  . ARG D  4 82  ? 119.316 -97.047  -85.998  1.00 96.41  ? 82   ARG D NE  1 
ATOM   4470  C  CZ  . ARG D  4 82  ? 120.313 -96.195  -86.232  1.00 96.05  ? 82   ARG D CZ  1 
ATOM   4471  N  NH1 . ARG D  4 82  ? 120.108 -94.889  -86.124  1.00 96.33  ? 82   ARG D NH1 1 
ATOM   4472  N  NH2 . ARG D  4 82  ? 121.515 -96.646  -86.571  1.00 95.31  ? 82   ARG D NH2 1 
ATOM   4473  N  N   . ILE D  4 83  ? 113.752 -99.681  -84.650  1.00 92.92  ? 83   ILE D N   1 
ATOM   4474  C  CA  . ILE D  4 83  ? 112.436 -99.182  -84.254  1.00 91.85  ? 83   ILE D CA  1 
ATOM   4475  C  C   . ILE D  4 83  ? 111.307 -100.147 -84.611  1.00 91.47  ? 83   ILE D C   1 
ATOM   4476  O  O   . ILE D  4 83  ? 110.272 -100.174 -83.944  1.00 90.58  ? 83   ILE D O   1 
ATOM   4477  C  CB  . ILE D  4 83  ? 112.161 -97.819  -84.927  1.00 91.12  ? 83   ILE D CB  1 
ATOM   4478  C  CG1 . ILE D  4 83  ? 110.679 -97.445  -84.834  1.00 90.26  ? 83   ILE D CG1 1 
ATOM   4479  C  CG2 . ILE D  4 83  ? 112.603 -97.883  -86.371  1.00 91.86  ? 83   ILE D CG2 1 
ATOM   4480  C  CD1 . ILE D  4 83  ? 110.197 -97.140  -83.444  1.00 90.59  ? 83   ILE D CD1 1 
ATOM   4481  N  N   . LEU D  4 84  ? 111.513 -100.950 -85.651  1.00 91.18  ? 84   LEU D N   1 
ATOM   4482  C  CA  . LEU D  4 84  ? 110.486 -101.882 -86.088  1.00 91.00  ? 84   LEU D CA  1 
ATOM   4483  C  C   . LEU D  4 84  ? 111.035 -103.152 -86.723  1.00 91.50  ? 84   LEU D C   1 
ATOM   4484  O  O   . LEU D  4 84  ? 112.082 -103.136 -87.374  1.00 91.49  ? 84   LEU D O   1 
ATOM   4485  C  CB  . LEU D  4 84  ? 109.569 -101.182 -87.093  1.00 90.54  ? 84   LEU D CB  1 
ATOM   4486  C  CG  . LEU D  4 84  ? 108.096 -100.968 -86.751  1.00 90.19  ? 84   LEU D CG  1 
ATOM   4487  C  CD1 . LEU D  4 84  ? 107.932 -100.407 -85.355  1.00 90.75  ? 84   LEU D CD1 1 
ATOM   4488  C  CD2 . LEU D  4 84  ? 107.493 -100.034 -87.776  1.00 90.34  ? 84   LEU D CD2 1 
ATOM   4489  N  N   . SER D  4 85  ? 110.311 -104.249 -86.516  1.00 91.84  ? 85   SER D N   1 
ATOM   4490  C  CA  . SER D  4 85  ? 110.645 -105.556 -87.077  1.00 92.16  ? 85   SER D CA  1 
ATOM   4491  C  C   . SER D  4 85  ? 109.419 -105.962 -87.874  1.00 92.37  ? 85   SER D C   1 
ATOM   4492  O  O   . SER D  4 85  ? 108.306 -105.899 -87.363  1.00 92.30  ? 85   SER D O   1 
ATOM   4493  C  CB  . SER D  4 85  ? 110.880 -106.591 -85.975  1.00 92.64  ? 85   SER D CB  1 
ATOM   4494  O  OG  . SER D  4 85  ? 112.086 -106.351 -85.275  1.00 94.60  ? 85   SER D OG  1 
ATOM   4495  N  N   . VAL D  4 86  ? 109.607 -106.377 -89.119  1.00 93.12  ? 86   VAL D N   1 
ATOM   4496  C  CA  . VAL D  4 86  ? 108.465 -106.767 -89.937  1.00 94.14  ? 86   VAL D CA  1 
ATOM   4497  C  C   . VAL D  4 86  ? 108.618 -108.172 -90.513  1.00 94.35  ? 86   VAL D C   1 
ATOM   4498  O  O   . VAL D  4 86  ? 109.736 -108.645 -90.721  1.00 94.27  ? 86   VAL D O   1 
ATOM   4499  C  CB  . VAL D  4 86  ? 108.252 -105.758 -91.094  1.00 94.56  ? 86   VAL D CB  1 
ATOM   4500  C  CG1 . VAL D  4 86  ? 107.023 -106.136 -91.905  1.00 94.66  ? 86   VAL D CG1 1 
ATOM   4501  C  CG2 . VAL D  4 86  ? 108.102 -104.354 -90.531  1.00 94.07  ? 86   VAL D CG2 1 
ATOM   4502  N  N   . GLU D  4 87  ? 107.489 -108.837 -90.750  1.00 94.55  ? 87   GLU D N   1 
ATOM   4503  C  CA  . GLU D  4 87  ? 107.492 -110.182 -91.319  1.00 94.79  ? 87   GLU D CA  1 
ATOM   4504  C  C   . GLU D  4 87  ? 106.591 -110.237 -92.543  1.00 94.39  ? 87   GLU D C   1 
ATOM   4505  O  O   . GLU D  4 87  ? 105.493 -109.675 -92.537  1.00 94.45  ? 87   GLU D O   1 
ATOM   4506  C  CB  . GLU D  4 87  ? 106.991 -111.213 -90.307  1.00 95.36  ? 87   GLU D CB  1 
ATOM   4507  C  CG  . GLU D  4 87  ? 106.925 -112.630 -90.882  1.00 96.09  ? 87   GLU D CG  1 
ATOM   4508  C  CD  . GLU D  4 87  ? 105.872 -113.498 -90.211  1.00 96.50  ? 87   GLU D CD  1 
ATOM   4509  O  OE1 . GLU D  4 87  ? 105.768 -114.692 -90.568  1.00 96.08  ? 87   GLU D OE1 1 
ATOM   4510  O  OE2 . GLU D  4 87  ? 105.145 -112.987 -89.332  1.00 96.54  ? 87   GLU D OE2 1 
ATOM   4511  N  N   . LEU D  4 88  ? 107.053 -110.925 -93.585  1.00 93.60  ? 88   LEU D N   1 
ATOM   4512  C  CA  . LEU D  4 88  ? 106.279 -111.065 -94.812  1.00 92.52  ? 88   LEU D CA  1 
ATOM   4513  C  C   . LEU D  4 88  ? 104.980 -111.781 -94.506  1.00 91.95  ? 88   LEU D C   1 
ATOM   4514  O  O   . LEU D  4 88  ? 104.993 -112.914 -94.024  1.00 92.01  ? 88   LEU D O   1 
ATOM   4515  C  CB  . LEU D  4 88  ? 107.039 -111.887 -95.854  1.00 92.91  ? 88   LEU D CB  1 
ATOM   4516  C  CG  . LEU D  4 88  ? 108.309 -111.333 -96.497  1.00 94.15  ? 88   LEU D CG  1 
ATOM   4517  C  CD1 . LEU D  4 88  ? 109.427 -111.189 -95.462  1.00 94.91  ? 88   LEU D CD1 1 
ATOM   4518  C  CD2 . LEU D  4 88  ? 108.728 -112.277 -97.614  1.00 94.03  ? 88   LEU D CD2 1 
ATOM   4519  N  N   . PRO D  4 89  ? 103.838 -111.129 -94.773  1.00 91.11  ? 89   PRO D N   1 
ATOM   4520  C  CA  . PRO D  4 89  ? 102.530 -111.737 -94.520  1.00 90.96  ? 89   PRO D CA  1 
ATOM   4521  C  C   . PRO D  4 89  ? 102.459 -113.154 -95.091  1.00 91.21  ? 89   PRO D C   1 
ATOM   4522  O  O   . PRO D  4 89  ? 103.076 -113.462 -96.114  1.00 90.69  ? 89   PRO D O   1 
ATOM   4523  C  CB  . PRO D  4 89  ? 101.576 -110.771 -95.203  1.00 90.41  ? 89   PRO D CB  1 
ATOM   4524  C  CG  . PRO D  4 89  ? 102.230 -109.459 -94.930  1.00 90.26  ? 89   PRO D CG  1 
ATOM   4525  C  CD  . PRO D  4 89  ? 103.683 -109.743 -95.245  1.00 90.11  ? 89   PRO D CD  1 
ATOM   4526  N  N   . LYS D  4 90  ? 101.698 -114.008 -94.419  1.00 91.02  ? 90   LYS D N   1 
ATOM   4527  C  CA  . LYS D  4 90  ? 101.551 -115.405 -94.806  1.00 91.07  ? 90   LYS D CA  1 
ATOM   4528  C  C   . LYS D  4 90  ? 101.346 -115.717 -96.293  1.00 91.05  ? 90   LYS D C   1 
ATOM   4529  O  O   . LYS D  4 90  ? 101.789 -116.764 -96.768  1.00 91.38  ? 90   LYS D O   1 
ATOM   4530  C  CB  . LYS D  4 90  ? 100.421 -116.045 -93.991  1.00 90.78  ? 90   LYS D CB  1 
ATOM   4531  C  CG  . LYS D  4 90  ? 100.659 -116.066 -92.481  1.00 90.24  ? 90   LYS D CG  1 
ATOM   4532  C  CD  . LYS D  4 90  ? 99.828  -115.015 -91.744  1.00 89.31  ? 90   LYS D CD  1 
ATOM   4533  C  CE  . LYS D  4 90  ? 100.259 -113.596 -92.083  1.00 88.66  ? 90   LYS D CE  1 
ATOM   4534  N  NZ  . LYS D  4 90  ? 99.373  -112.579 -91.454  1.00 87.92  ? 90   LYS D NZ  1 
ATOM   4535  N  N   . ILE D  4 91  ? 100.691 -114.828 -97.035  1.00 90.75  ? 91   ILE D N   1 
ATOM   4536  C  CA  . ILE D  4 91  ? 100.441 -115.092 -98.451  1.00 90.21  ? 91   ILE D CA  1 
ATOM   4537  C  C   . ILE D  4 91  ? 101.601 -114.769 -99.394  1.00 89.80  ? 91   ILE D C   1 
ATOM   4538  O  O   . ILE D  4 91  ? 101.755 -115.390 -100.445 1.00 88.89  ? 91   ILE D O   1 
ATOM   4539  C  CB  . ILE D  4 91  ? 99.185  -114.349 -98.943  1.00 90.32  ? 91   ILE D CB  1 
ATOM   4540  C  CG1 . ILE D  4 91  ? 98.919  -114.719 -100.405 1.00 91.36  ? 91   ILE D CG1 1 
ATOM   4541  C  CG2 . ILE D  4 91  ? 99.364  -112.852 -98.768  1.00 89.31  ? 91   ILE D CG2 1 
ATOM   4542  C  CD1 . ILE D  4 91  ? 97.581  -114.278 -100.930 1.00 92.04  ? 91   ILE D CD1 1 
ATOM   4543  N  N   . TYR D  4 92  ? 102.417 -113.794 -99.026  1.00 89.95  ? 92   TYR D N   1 
ATOM   4544  C  CA  . TYR D  4 92  ? 103.555 -113.432 -99.855  1.00 89.90  ? 92   TYR D CA  1 
ATOM   4545  C  C   . TYR D  4 92  ? 104.715 -114.372 -99.528  1.00 91.02  ? 92   TYR D C   1 
ATOM   4546  O  O   . TYR D  4 92  ? 105.765 -114.341 -100.175 1.00 90.17  ? 92   TYR D O   1 
ATOM   4547  C  CB  . TYR D  4 92  ? 103.938 -111.974 -99.591  1.00 87.85  ? 92   TYR D CB  1 
ATOM   4548  C  CG  . TYR D  4 92  ? 102.839 -110.995 -99.950  1.00 85.46  ? 92   TYR D CG  1 
ATOM   4549  C  CD1 . TYR D  4 92  ? 102.525 -110.727 -101.281 1.00 84.51  ? 92   TYR D CD1 1 
ATOM   4550  C  CD2 . TYR D  4 92  ? 102.093 -110.361 -98.958  1.00 84.43  ? 92   TYR D CD2 1 
ATOM   4551  C  CE1 . TYR D  4 92  ? 101.499 -109.854 -101.617 1.00 83.00  ? 92   TYR D CE1 1 
ATOM   4552  C  CE2 . TYR D  4 92  ? 101.064 -109.486 -99.282  1.00 82.82  ? 92   TYR D CE2 1 
ATOM   4553  C  CZ  . TYR D  4 92  ? 100.773 -109.240 -100.613 1.00 82.75  ? 92   TYR D CZ  1 
ATOM   4554  O  OH  . TYR D  4 92  ? 99.751  -108.387 -100.939 1.00 81.33  ? 92   TYR D OH  1 
ATOM   4555  N  N   . GLN D  4 93  ? 104.507 -115.212 -98.516  1.00 92.97  ? 93   GLN D N   1 
ATOM   4556  C  CA  . GLN D  4 93  ? 105.518 -116.172 -98.094  1.00 95.10  ? 93   GLN D CA  1 
ATOM   4557  C  C   . GLN D  4 93  ? 105.630 -117.276 -99.129  1.00 96.18  ? 93   GLN D C   1 
ATOM   4558  O  O   . GLN D  4 93  ? 104.663 -117.581 -99.828  1.00 96.35  ? 93   GLN D O   1 
ATOM   4559  C  CB  . GLN D  4 93  ? 105.150 -116.815 -96.752  1.00 95.79  ? 93   GLN D CB  1 
ATOM   4560  C  CG  . GLN D  4 93  ? 105.055 -115.876 -95.560  1.00 96.63  ? 93   GLN D CG  1 
ATOM   4561  C  CD  . GLN D  4 93  ? 104.823 -116.629 -94.254  1.00 96.79  ? 93   GLN D CD  1 
ATOM   4562  O  OE1 . GLN D  4 93  ? 104.515 -116.029 -93.223  1.00 97.18  ? 93   GLN D OE1 1 
ATOM   4563  N  NE2 . GLN D  4 93  ? 104.979 -117.948 -94.294  1.00 96.45  ? 93   GLN D NE2 1 
ATOM   4564  N  N   . GLU D  4 94  ? 106.811 -117.880 -99.207  1.00 97.61  ? 94   GLU D N   1 
ATOM   4565  C  CA  . GLU D  4 94  ? 107.068 -118.970 -100.140 1.00 98.26  ? 94   GLU D CA  1 
ATOM   4566  C  C   . GLU D  4 94  ? 106.061 -120.096 -99.938  1.00 97.41  ? 94   GLU D C   1 
ATOM   4567  O  O   . GLU D  4 94  ? 105.996 -121.030 -100.734 1.00 96.89  ? 94   GLU D O   1 
ATOM   4568  C  CB  . GLU D  4 94  ? 108.491 -119.508 -99.951  1.00 100.27 ? 94   GLU D CB  1 
ATOM   4569  C  CG  . GLU D  4 94  ? 108.771 -120.169 -98.592  1.00 104.20 ? 94   GLU D CG  1 
ATOM   4570  C  CD  . GLU D  4 94  ? 108.729 -119.201 -97.405  1.00 106.08 ? 94   GLU D CD  1 
ATOM   4571  O  OE1 . GLU D  4 94  ? 107.620 -118.802 -96.982  1.00 107.17 ? 94   GLU D OE1 1 
ATOM   4572  O  OE2 . GLU D  4 94  ? 109.813 -118.841 -96.892  1.00 106.70 ? 94   GLU D OE2 1 
ATOM   4573  N  N   . GLY D  4 95  ? 105.282 -120.002 -98.864  1.00 97.15  ? 95   GLY D N   1 
ATOM   4574  C  CA  . GLY D  4 95  ? 104.281 -121.013 -98.582  1.00 97.28  ? 95   GLY D CA  1 
ATOM   4575  C  C   . GLY D  4 95  ? 103.275 -121.068 -99.712  1.00 97.63  ? 95   GLY D C   1 
ATOM   4576  O  O   . GLY D  4 95  ? 103.102 -122.106 -100.355 1.00 97.29  ? 95   GLY D O   1 
ATOM   4577  N  N   . TRP D  4 96  ? 102.611 -119.940 -99.955  1.00 98.03  ? 96   TRP D N   1 
ATOM   4578  C  CA  . TRP D  4 96  ? 101.626 -119.843 -101.024 1.00 97.50  ? 96   TRP D CA  1 
ATOM   4579  C  C   . TRP D  4 96  ? 102.329 -119.598 -102.352 1.00 97.45  ? 96   TRP D C   1 
ATOM   4580  O  O   . TRP D  4 96  ? 101.844 -120.006 -103.404 1.00 98.15  ? 96   TRP D O   1 
ATOM   4581  C  CB  . TRP D  4 96  ? 100.651 -118.698 -100.757 1.00 96.82  ? 96   TRP D CB  1 
ATOM   4582  C  CG  . TRP D  4 96  ? 99.790  -118.904 -99.564  1.00 96.81  ? 96   TRP D CG  1 
ATOM   4583  C  CD1 . TRP D  4 96  ? 100.155 -118.789 -98.254  1.00 96.64  ? 96   TRP D CD1 1 
ATOM   4584  C  CD2 . TRP D  4 96  ? 98.411  -119.275 -99.566  1.00 97.00  ? 96   TRP D CD2 1 
ATOM   4585  N  NE1 . TRP D  4 96  ? 99.085  -119.065 -97.437  1.00 96.48  ? 96   TRP D NE1 1 
ATOM   4586  C  CE2 . TRP D  4 96  ? 98.001  -119.367 -98.218  1.00 96.95  ? 96   TRP D CE2 1 
ATOM   4587  C  CE3 . TRP D  4 96  ? 97.479  -119.540 -100.579 1.00 97.26  ? 96   TRP D CE3 1 
ATOM   4588  C  CZ2 . TRP D  4 96  ? 96.696  -119.713 -97.854  1.00 97.78  ? 96   TRP D CZ2 1 
ATOM   4589  C  CZ3 . TRP D  4 96  ? 96.179  -119.884 -100.218 1.00 97.22  ? 96   TRP D CZ3 1 
ATOM   4590  C  CH2 . TRP D  4 96  ? 95.801  -119.968 -98.866  1.00 97.71  ? 96   TRP D CH2 1 
ATOM   4591  N  N   . ARG D  4 97  ? 103.478 -118.934 -102.292 1.00 97.22  ? 97   ARG D N   1 
ATOM   4592  C  CA  . ARG D  4 97  ? 104.259 -118.620 -103.484 1.00 97.45  ? 97   ARG D CA  1 
ATOM   4593  C  C   . ARG D  4 97  ? 104.512 -119.864 -104.338 1.00 97.34  ? 97   ARG D C   1 
ATOM   4594  O  O   . ARG D  4 97  ? 105.039 -119.775 -105.449 1.00 97.07  ? 97   ARG D O   1 
ATOM   4595  C  CB  . ARG D  4 97  ? 105.575 -117.963 -103.061 1.00 97.65  ? 97   ARG D CB  1 
ATOM   4596  C  CG  . ARG D  4 97  ? 106.447 -117.427 -104.184 1.00 98.22  ? 97   ARG D CG  1 
ATOM   4597  C  CD  . ARG D  4 97  ? 107.431 -116.415 -103.613 1.00 99.34  ? 97   ARG D CD  1 
ATOM   4598  N  NE  . ARG D  4 97  ? 107.900 -116.824 -102.289 1.00 100.80 ? 97   ARG D NE  1 
ATOM   4599  C  CZ  . ARG D  4 97  ? 108.610 -116.058 -101.466 1.00 101.26 ? 97   ARG D CZ  1 
ATOM   4600  N  NH1 . ARG D  4 97  ? 108.946 -114.826 -101.822 1.00 101.67 ? 97   ARG D NH1 1 
ATOM   4601  N  NH2 . ARG D  4 97  ? 108.977 -116.523 -100.279 1.00 101.10 ? 97   ARG D NH2 1 
ATOM   4602  N  N   . THR D  4 98  ? 104.131 -121.022 -103.805 1.00 97.40  ? 98   THR D N   1 
ATOM   4603  C  CA  . THR D  4 98  ? 104.278 -122.292 -104.508 1.00 97.54  ? 98   THR D CA  1 
ATOM   4604  C  C   . THR D  4 98  ? 102.902 -122.694 -105.036 1.00 97.34  ? 98   THR D C   1 
ATOM   4605  O  O   . THR D  4 98  ? 102.767 -123.104 -106.187 1.00 97.54  ? 98   THR D O   1 
ATOM   4606  C  CB  . THR D  4 98  ? 104.818 -123.412 -103.570 1.00 97.78  ? 98   THR D CB  1 
ATOM   4607  O  OG1 . THR D  4 98  ? 106.171 -123.116 -103.195 1.00 97.28  ? 98   THR D OG1 1 
ATOM   4608  C  CG2 . THR D  4 98  ? 104.784 -124.766 -104.269 1.00 97.05  ? 98   THR D CG2 1 
ATOM   4609  N  N   . VAL D  4 99  ? 101.882 -122.565 -104.190 1.00 96.98  ? 99   VAL D N   1 
ATOM   4610  C  CA  . VAL D  4 99  ? 100.517 -122.901 -104.580 1.00 96.51  ? 99   VAL D CA  1 
ATOM   4611  C  C   . VAL D  4 99  ? 100.064 -122.041 -105.754 1.00 97.09  ? 99   VAL D C   1 
ATOM   4612  O  O   . VAL D  4 99  ? 99.238  -122.468 -106.559 1.00 97.50  ? 99   VAL D O   1 
ATOM   4613  C  CB  . VAL D  4 99  ? 99.542  -122.701 -103.418 1.00 95.74  ? 99   VAL D CB  1 
ATOM   4614  C  CG1 . VAL D  4 99  ? 98.117  -122.952 -103.882 1.00 95.20  ? 99   VAL D CG1 1 
ATOM   4615  C  CG2 . VAL D  4 99  ? 99.903  -123.640 -102.291 1.00 95.44  ? 99   VAL D CG2 1 
ATOM   4616  N  N   . PHE D  4 100 ? 100.597 -120.826 -105.841 1.00 97.57  ? 100  PHE D N   1 
ATOM   4617  C  CA  . PHE D  4 100 ? 100.259 -119.932 -106.940 1.00 98.25  ? 100  PHE D CA  1 
ATOM   4618  C  C   . PHE D  4 100 ? 100.941 -120.474 -108.184 1.00 99.17  ? 100  PHE D C   1 
ATOM   4619  O  O   . PHE D  4 100 ? 100.361 -120.478 -109.269 1.00 99.68  ? 100  PHE D O   1 
ATOM   4620  C  CB  . PHE D  4 100 ? 100.748 -118.506 -106.664 1.00 97.65  ? 100  PHE D CB  1 
ATOM   4621  C  CG  . PHE D  4 100 ? 99.912  -117.752 -105.662 1.00 97.25  ? 100  PHE D CG  1 
ATOM   4622  C  CD1 . PHE D  4 100 ? 100.186 -116.419 -105.377 1.00 97.13  ? 100  PHE D CD1 1 
ATOM   4623  C  CD2 . PHE D  4 100 ? 98.856  -118.372 -104.996 1.00 97.54  ? 100  PHE D CD2 1 
ATOM   4624  C  CE1 . PHE D  4 100 ? 99.424  -115.715 -104.444 1.00 97.39  ? 100  PHE D CE1 1 
ATOM   4625  C  CE2 . PHE D  4 100 ? 98.088  -117.675 -104.060 1.00 97.53  ? 100  PHE D CE2 1 
ATOM   4626  C  CZ  . PHE D  4 100 ? 98.373  -116.345 -103.784 1.00 97.32  ? 100  PHE D CZ  1 
ATOM   4627  N  N   . SER D  4 101 ? 102.178 -120.935 -108.014 1.00 100.16 ? 101  SER D N   1 
ATOM   4628  C  CA  . SER D  4 101 ? 102.951 -121.503 -109.115 1.00 101.09 ? 101  SER D CA  1 
ATOM   4629  C  C   . SER D  4 101 ? 102.142 -122.630 -109.750 1.00 101.51 ? 101  SER D C   1 
ATOM   4630  O  O   . SER D  4 101 ? 102.139 -122.797 -110.971 1.00 101.79 ? 101  SER D O   1 
ATOM   4631  C  CB  . SER D  4 101 ? 104.283 -122.051 -108.600 1.00 101.27 ? 101  SER D CB  1 
ATOM   4632  O  OG  . SER D  4 101 ? 105.005 -121.056 -107.897 1.00 102.31 ? 101  SER D OG  1 
ATOM   4633  N  N   . ALA D  4 102 ? 101.462 -123.405 -108.906 1.00 101.51 ? 102  ALA D N   1 
ATOM   4634  C  CA  . ALA D  4 102 ? 100.626 -124.506 -109.374 1.00 100.82 ? 102  ALA D CA  1 
ATOM   4635  C  C   . ALA D  4 102 ? 99.597  -123.901 -110.324 1.00 100.34 ? 102  ALA D C   1 
ATOM   4636  O  O   . ALA D  4 102 ? 99.733  -124.000 -111.544 1.00 99.84  ? 102  ALA D O   1 
ATOM   4637  C  CB  . ALA D  4 102 ? 99.930  -125.181 -108.191 1.00 100.33 ? 102  ALA D CB  1 
ATOM   4638  N  N   . ASP D  4 103 ? 98.574  -123.267 -109.756 1.00 99.65  ? 103  ASP D N   1 
ATOM   4639  C  CA  . ASP D  4 103 ? 97.540  -122.622 -110.553 1.00 98.81  ? 103  ASP D CA  1 
ATOM   4640  C  C   . ASP D  4 103 ? 97.032  -121.337 -109.908 1.00 97.42  ? 103  ASP D C   1 
ATOM   4641  O  O   . ASP D  4 103 ? 96.338  -121.365 -108.889 1.00 96.30  ? 103  ASP D O   1 
ATOM   4642  C  CB  . ASP D  4 103 ? 96.359  -123.563 -110.788 1.00 99.64  ? 103  ASP D CB  1 
ATOM   4643  C  CG  . ASP D  4 103 ? 95.254  -122.902 -111.589 1.00 99.81  ? 103  ASP D CG  1 
ATOM   4644  O  OD1 . ASP D  4 103 ? 95.551  -122.406 -112.698 1.00 99.74  ? 103  ASP D OD1 1 
ATOM   4645  O  OD2 . ASP D  4 103 ? 94.098  -122.872 -111.110 1.00 99.80  ? 103  ASP D OD2 1 
ATOM   4646  N  N   . PRO D  4 104 ? 97.373  -120.186 -110.501 1.00 96.24  ? 104  PRO D N   1 
ATOM   4647  C  CA  . PRO D  4 104 ? 96.934  -118.903 -109.959 1.00 95.76  ? 104  PRO D CA  1 
ATOM   4648  C  C   . PRO D  4 104 ? 95.461  -118.633 -110.248 1.00 95.75  ? 104  PRO D C   1 
ATOM   4649  O  O   . PRO D  4 104 ? 94.750  -118.073 -109.415 1.00 96.53  ? 104  PRO D O   1 
ATOM   4650  C  CB  . PRO D  4 104 ? 97.858  -117.913 -110.655 1.00 94.82  ? 104  PRO D CB  1 
ATOM   4651  C  CG  . PRO D  4 104 ? 98.027  -118.531 -111.994 1.00 95.16  ? 104  PRO D CG  1 
ATOM   4652  C  CD  . PRO D  4 104 ? 98.256  -119.987 -111.663 1.00 95.47  ? 104  PRO D CD  1 
ATOM   4653  N  N   . ASN D  4 105 ? 95.002  -119.048 -111.423 1.00 95.19  ? 105  ASN D N   1 
ATOM   4654  C  CA  . ASN D  4 105 ? 93.616  -118.829 -111.821 1.00 94.61  ? 105  ASN D CA  1 
ATOM   4655  C  C   . ASN D  4 105 ? 92.572  -119.538 -110.957 1.00 93.91  ? 105  ASN D C   1 
ATOM   4656  O  O   . ASN D  4 105 ? 91.433  -119.728 -111.384 1.00 94.32  ? 105  ASN D O   1 
ATOM   4657  C  CB  . ASN D  4 105 ? 93.431  -119.224 -113.285 1.00 95.09  ? 105  ASN D CB  1 
ATOM   4658  C  CG  . ASN D  4 105 ? 94.234  -118.351 -114.221 1.00 95.58  ? 105  ASN D CG  1 
ATOM   4659  O  OD1 . ASN D  4 105 ? 95.441  -118.183 -114.043 1.00 95.23  ? 105  ASN D OD1 1 
ATOM   4660  N  ND2 . ASN D  4 105 ? 93.572  -117.789 -115.227 1.00 96.12  ? 105  ASN D ND2 1 
ATOM   4661  N  N   . VAL D  4 106 ? 92.953  -119.928 -109.747 1.00 92.61  ? 106  VAL D N   1 
ATOM   4662  C  CA  . VAL D  4 106 ? 92.014  -120.585 -108.841 1.00 91.24  ? 106  VAL D CA  1 
ATOM   4663  C  C   . VAL D  4 106 ? 92.007  -119.833 -107.509 1.00 89.25  ? 106  VAL D C   1 
ATOM   4664  O  O   . VAL D  4 106 ? 91.019  -119.858 -106.769 1.00 88.70  ? 106  VAL D O   1 
ATOM   4665  C  CB  . VAL D  4 106 ? 92.395  -122.080 -108.601 1.00 91.80  ? 106  VAL D CB  1 
ATOM   4666  C  CG1 . VAL D  4 106 ? 93.712  -122.177 -107.842 1.00 90.81  ? 106  VAL D CG1 1 
ATOM   4667  C  CG2 . VAL D  4 106 ? 91.275  -122.792 -107.846 1.00 91.25  ? 106  VAL D CG2 1 
ATOM   4668  N  N   . VAL D  4 107 ? 93.116  -119.150 -107.231 1.00 87.09  ? 107  VAL D N   1 
ATOM   4669  C  CA  . VAL D  4 107 ? 93.284  -118.380 -105.999 1.00 85.19  ? 107  VAL D CA  1 
ATOM   4670  C  C   . VAL D  4 107 ? 92.212  -117.302 -105.854 1.00 82.76  ? 107  VAL D C   1 
ATOM   4671  O  O   . VAL D  4 107 ? 91.675  -116.806 -106.841 1.00 83.31  ? 107  VAL D O   1 
ATOM   4672  C  CB  . VAL D  4 107 ? 94.683  -117.704 -105.947 1.00 85.37  ? 107  VAL D CB  1 
ATOM   4673  C  CG1 . VAL D  4 107 ? 94.906  -117.064 -104.589 1.00 86.25  ? 107  VAL D CG1 1 
ATOM   4674  C  CG2 . VAL D  4 107 ? 95.765  -118.726 -106.219 1.00 85.14  ? 107  VAL D CG2 1 
ATOM   4675  N  N   . ASP D  4 108 ? 91.908  -116.948 -104.614 1.00 79.75  ? 108  ASP D N   1 
ATOM   4676  C  CA  . ASP D  4 108 ? 90.908  -115.934 -104.328 1.00 77.92  ? 108  ASP D CA  1 
ATOM   4677  C  C   . ASP D  4 108 ? 91.621  -114.651 -103.915 1.00 76.27  ? 108  ASP D C   1 
ATOM   4678  O  O   . ASP D  4 108 ? 91.507  -114.206 -102.775 1.00 76.72  ? 108  ASP D O   1 
ATOM   4679  C  CB  . ASP D  4 108 ? 89.994  -116.431 -103.204 1.00 79.04  ? 108  ASP D CB  1 
ATOM   4680  C  CG  . ASP D  4 108 ? 88.798  -115.529 -102.975 1.00 79.21  ? 108  ASP D CG  1 
ATOM   4681  O  OD1 . ASP D  4 108 ? 87.864  -115.970 -102.270 1.00 79.47  ? 108  ASP D OD1 1 
ATOM   4682  O  OD2 . ASP D  4 108 ? 88.791  -114.390 -103.491 1.00 79.10  ? 108  ASP D OD2 1 
ATOM   4683  N  N   . LEU D  4 109 ? 92.352  -114.063 -104.858 1.00 74.40  ? 109  LEU D N   1 
ATOM   4684  C  CA  . LEU D  4 109 ? 93.119  -112.838 -104.631 1.00 72.40  ? 109  LEU D CA  1 
ATOM   4685  C  C   . LEU D  4 109 ? 92.374  -111.665 -104.000 1.00 72.22  ? 109  LEU D C   1 
ATOM   4686  O  O   . LEU D  4 109 ? 92.966  -110.611 -103.768 1.00 71.76  ? 109  LEU D O   1 
ATOM   4687  C  CB  . LEU D  4 109 ? 93.763  -112.378 -105.941 1.00 70.72  ? 109  LEU D CB  1 
ATOM   4688  C  CG  . LEU D  4 109 ? 95.291  -112.457 -105.987 1.00 70.56  ? 109  LEU D CG  1 
ATOM   4689  C  CD1 . LEU D  4 109 ? 95.751  -113.847 -105.580 1.00 70.40  ? 109  LEU D CD1 1 
ATOM   4690  C  CD2 . LEU D  4 109 ? 95.783  -112.117 -107.387 1.00 70.16  ? 109  LEU D CD2 1 
ATOM   4691  N  N   . HIS D  4 110 ? 91.084  -111.828 -103.730 1.00 72.14  ? 110  HIS D N   1 
ATOM   4692  C  CA  . HIS D  4 110 ? 90.333  -110.756 -103.099 1.00 71.86  ? 110  HIS D CA  1 
ATOM   4693  C  C   . HIS D  4 110 ? 90.228  -111.010 -101.611 1.00 73.59  ? 110  HIS D C   1 
ATOM   4694  O  O   . HIS D  4 110 ? 90.389  -110.087 -100.813 1.00 73.70  ? 110  HIS D O   1 
ATOM   4695  C  CB  . HIS D  4 110 ? 88.935  -110.628 -103.682 1.00 69.72  ? 110  HIS D CB  1 
ATOM   4696  C  CG  . HIS D  4 110 ? 88.078  -109.651 -102.943 1.00 67.15  ? 110  HIS D CG  1 
ATOM   4697  N  ND1 . HIS D  4 110 ? 87.243  -110.024 -101.912 1.00 65.96  ? 110  HIS D ND1 1 
ATOM   4698  C  CD2 . HIS D  4 110 ? 87.975  -108.305 -103.042 1.00 65.11  ? 110  HIS D CD2 1 
ATOM   4699  C  CE1 . HIS D  4 110 ? 86.661  -108.951 -101.409 1.00 64.30  ? 110  HIS D CE1 1 
ATOM   4700  N  NE2 . HIS D  4 110 ? 87.089  -107.895 -102.076 1.00 63.62  ? 110  HIS D NE2 1 
ATOM   4701  N  N   . LYS D  4 111 ? 89.934  -112.256 -101.239 1.00 75.93  ? 111  LYS D N   1 
ATOM   4702  C  CA  . LYS D  4 111 ? 89.844  -112.618 -99.826  1.00 77.60  ? 111  LYS D CA  1 
ATOM   4703  C  C   . LYS D  4 111 ? 91.204  -112.280 -99.244  1.00 77.89  ? 111  LYS D C   1 
ATOM   4704  O  O   . LYS D  4 111 ? 91.305  -111.575 -98.244  1.00 76.89  ? 111  LYS D O   1 
ATOM   4705  C  CB  . LYS D  4 111 ? 89.543  -114.114 -99.648  1.00 78.34  ? 111  LYS D CB  1 
ATOM   4706  C  CG  . LYS D  4 111 ? 88.053  -114.460 -99.714  1.00 80.27  ? 111  LYS D CG  1 
ATOM   4707  C  CD  . LYS D  4 111 ? 87.797  -115.940 -99.441  1.00 81.33  ? 111  LYS D CD  1 
ATOM   4708  C  CE  . LYS D  4 111 ? 86.313  -116.282 -99.542  1.00 80.67  ? 111  LYS D CE  1 
ATOM   4709  N  NZ  . LYS D  4 111 ? 86.072  -117.740 -99.361  1.00 80.34  ? 111  LYS D NZ  1 
HETATM 4710  N  N   . MSE D  4 112 ? 92.250  -112.775 -99.892  1.00 79.46  ? 112  MSE D N   1 
HETATM 4711  C  CA  . MSE D  4 112 ? 93.606  -112.483 -99.466  1.00 81.76  ? 112  MSE D CA  1 
HETATM 4712  C  C   . MSE D  4 112 ? 93.717  -110.977 -99.663  1.00 81.16  ? 112  MSE D C   1 
HETATM 4713  O  O   . MSE D  4 112 ? 92.757  -110.352 -100.110 1.00 82.19  ? 112  MSE D O   1 
HETATM 4714  C  CB  . MSE D  4 112 ? 94.601  -113.216 -100.357 1.00 86.10  ? 112  MSE D CB  1 
HETATM 4715  C  CG  . MSE D  4 112 ? 94.302  -114.704 -100.494 1.00 92.78  ? 112  MSE D CG  1 
HETATM 4716  SE SE  . MSE D  4 112 ? 94.228  -115.650 -98.786  1.00 101.50 ? 112  MSE D SE  1 
HETATM 4717  C  CE  . MSE D  4 112 ? 95.922  -116.572 -98.928  1.00 98.66  ? 112  MSE D CE  1 
ATOM   4718  N  N   . GLY D  4 113 ? 94.862  -110.387 -99.339  1.00 79.24  ? 113  GLY D N   1 
ATOM   4719  C  CA  . GLY D  4 113 ? 94.996  -108.948 -99.496  1.00 76.19  ? 113  GLY D CA  1 
ATOM   4720  C  C   . GLY D  4 113 ? 94.213  -108.451 -100.695 1.00 73.44  ? 113  GLY D C   1 
ATOM   4721  O  O   . GLY D  4 113 ? 94.514  -108.859 -101.816 1.00 74.36  ? 113  GLY D O   1 
ATOM   4722  N  N   . PRO D  4 114 ? 93.190  -107.595 -100.504 1.00 70.98  ? 114  PRO D N   1 
ATOM   4723  C  CA  . PRO D  4 114 ? 92.410  -107.094 -101.645 1.00 68.80  ? 114  PRO D CA  1 
ATOM   4724  C  C   . PRO D  4 114 ? 93.284  -106.396 -102.688 1.00 66.80  ? 114  PRO D C   1 
ATOM   4725  O  O   . PRO D  4 114 ? 92.987  -106.450 -103.879 1.00 66.54  ? 114  PRO D O   1 
ATOM   4726  C  CB  . PRO D  4 114 ? 91.384  -106.166 -100.991 1.00 67.80  ? 114  PRO D CB  1 
ATOM   4727  C  CG  . PRO D  4 114 ? 92.061  -105.726 -99.741  1.00 69.54  ? 114  PRO D CG  1 
ATOM   4728  C  CD  . PRO D  4 114 ? 92.726  -106.989 -99.247  1.00 70.44  ? 114  PRO D CD  1 
ATOM   4729  N  N   . HIS D  4 115 ? 94.359  -105.752 -102.230 1.00 64.76  ? 115  HIS D N   1 
ATOM   4730  C  CA  . HIS D  4 115 ? 95.315  -105.074 -103.113 1.00 62.67  ? 115  HIS D CA  1 
ATOM   4731  C  C   . HIS D  4 115 ? 96.541  -105.980 -103.248 1.00 63.43  ? 115  HIS D C   1 
ATOM   4732  O  O   . HIS D  4 115 ? 97.672  -105.538 -103.041 1.00 63.71  ? 115  HIS D O   1 
ATOM   4733  C  CB  . HIS D  4 115 ? 95.785  -103.734 -102.526 1.00 58.49  ? 115  HIS D CB  1 
ATOM   4734  C  CG  . HIS D  4 115 ? 94.727  -102.678 -102.455 1.00 54.39  ? 115  HIS D CG  1 
ATOM   4735  N  ND1 . HIS D  4 115 ? 93.774  -102.641 -101.459 1.00 53.19  ? 115  HIS D ND1 1 
ATOM   4736  C  CD2 . HIS D  4 115 ? 94.502  -101.594 -103.234 1.00 51.68  ? 115  HIS D CD2 1 
ATOM   4737  C  CE1 . HIS D  4 115 ? 93.010  -101.575 -101.625 1.00 51.88  ? 115  HIS D CE1 1 
ATOM   4738  N  NE2 . HIS D  4 115 ? 93.432  -100.923 -102.694 1.00 50.94  ? 115  HIS D NE2 1 
ATOM   4739  N  N   . PHE D  4 116 ? 96.313  -107.241 -103.601 1.00 63.29  ? 116  PHE D N   1 
ATOM   4740  C  CA  . PHE D  4 116 ? 97.392  -108.211 -103.728 1.00 63.52  ? 116  PHE D CA  1 
ATOM   4741  C  C   . PHE D  4 116 ? 98.674  -107.721 -104.391 1.00 64.49  ? 116  PHE D C   1 
ATOM   4742  O  O   . PHE D  4 116 ? 99.756  -107.813 -103.810 1.00 65.93  ? 116  PHE D O   1 
ATOM   4743  C  CB  . PHE D  4 116 ? 96.917  -109.455 -104.474 1.00 62.53  ? 116  PHE D CB  1 
ATOM   4744  C  CG  . PHE D  4 116 ? 97.954  -110.535 -104.538 1.00 62.52  ? 116  PHE D CG  1 
ATOM   4745  C  CD1 . PHE D  4 116 ? 98.165  -111.376 -103.449 1.00 61.81  ? 116  PHE D CD1 1 
ATOM   4746  C  CD2 . PHE D  4 116 ? 98.768  -110.669 -105.659 1.00 62.25  ? 116  PHE D CD2 1 
ATOM   4747  C  CE1 . PHE D  4 116 ? 99.171  -112.330 -103.475 1.00 62.31  ? 116  PHE D CE1 1 
ATOM   4748  C  CE2 . PHE D  4 116 ? 99.779  -111.622 -105.696 1.00 62.58  ? 116  PHE D CE2 1 
ATOM   4749  C  CZ  . PHE D  4 116 ? 99.982  -112.454 -104.603 1.00 62.54  ? 116  PHE D CZ  1 
ATOM   4750  N  N   . TYR D  4 117 ? 98.562  -107.217 -105.612 1.00 64.92  ? 117  TYR D N   1 
ATOM   4751  C  CA  . TYR D  4 117 ? 99.732  -106.755 -106.343 1.00 65.59  ? 117  TYR D CA  1 
ATOM   4752  C  C   . TYR D  4 117 ? 100.363 -105.480 -105.780 1.00 66.19  ? 117  TYR D C   1 
ATOM   4753  O  O   . TYR D  4 117 ? 101.572 -105.428 -105.556 1.00 66.09  ? 117  TYR D O   1 
ATOM   4754  C  CB  . TYR D  4 117 ? 99.356  -106.563 -107.811 1.00 65.53  ? 117  TYR D CB  1 
ATOM   4755  C  CG  . TYR D  4 117 ? 98.909  -107.841 -108.482 1.00 65.81  ? 117  TYR D CG  1 
ATOM   4756  C  CD1 . TYR D  4 117 ? 99.833  -108.711 -109.061 1.00 66.29  ? 117  TYR D CD1 1 
ATOM   4757  C  CD2 . TYR D  4 117 ? 97.561  -108.191 -108.524 1.00 65.86  ? 117  TYR D CD2 1 
ATOM   4758  C  CE1 . TYR D  4 117 ? 99.420  -109.903 -109.671 1.00 66.77  ? 117  TYR D CE1 1 
ATOM   4759  C  CE2 . TYR D  4 117 ? 97.138  -109.378 -109.126 1.00 66.27  ? 117  TYR D CE2 1 
ATOM   4760  C  CZ  . TYR D  4 117 ? 98.069  -110.231 -109.701 1.00 66.44  ? 117  TYR D CZ  1 
ATOM   4761  O  OH  . TYR D  4 117 ? 97.645  -111.400 -110.307 1.00 66.07  ? 117  TYR D OH  1 
ATOM   4762  N  N   . GLY D  4 118 ? 99.543  -104.460 -105.549 1.00 67.04  ? 118  GLY D N   1 
ATOM   4763  C  CA  . GLY D  4 118 ? 100.048 -103.202 -105.029 1.00 68.08  ? 118  GLY D CA  1 
ATOM   4764  C  C   . GLY D  4 118 ? 100.773 -103.317 -103.703 1.00 69.25  ? 118  GLY D C   1 
ATOM   4765  O  O   . GLY D  4 118 ? 101.867 -102.782 -103.543 1.00 69.79  ? 118  GLY D O   1 
ATOM   4766  N  N   . PHE D  4 119 ? 100.160 -104.001 -102.744 1.00 70.15  ? 119  PHE D N   1 
ATOM   4767  C  CA  . PHE D  4 119 ? 100.758 -104.186 -101.423 1.00 70.65  ? 119  PHE D CA  1 
ATOM   4768  C  C   . PHE D  4 119 ? 102.049 -104.981 -101.596 1.00 70.51  ? 119  PHE D C   1 
ATOM   4769  O  O   . PHE D  4 119 ? 103.094 -104.620 -101.062 1.00 70.58  ? 119  PHE D O   1 
ATOM   4770  C  CB  . PHE D  4 119 ? 99.796  -104.962 -100.518 1.00 70.59  ? 119  PHE D CB  1 
ATOM   4771  C  CG  . PHE D  4 119 ? 100.039 -104.770 -99.040  1.00 70.46  ? 119  PHE D CG  1 
ATOM   4772  C  CD1 . PHE D  4 119 ? 99.615  -103.611 -98.396  1.00 70.24  ? 119  PHE D CD1 1 
ATOM   4773  C  CD2 . PHE D  4 119 ? 100.647 -105.769 -98.284  1.00 70.50  ? 119  PHE D CD2 1 
ATOM   4774  C  CE1 . PHE D  4 119 ? 99.788  -103.450 -97.020  1.00 70.09  ? 119  PHE D CE1 1 
ATOM   4775  C  CE2 . PHE D  4 119 ? 100.825 -105.618 -96.909  1.00 70.22  ? 119  PHE D CE2 1 
ATOM   4776  C  CZ  . PHE D  4 119 ? 100.393 -104.454 -96.276  1.00 70.30  ? 119  PHE D CZ  1 
ATOM   4777  N  N   . GLY D  4 120 ? 101.964 -106.065 -102.357 1.00 71.01  ? 120  GLY D N   1 
ATOM   4778  C  CA  . GLY D  4 120 ? 103.126 -106.896 -102.593 1.00 71.50  ? 120  GLY D CA  1 
ATOM   4779  C  C   . GLY D  4 120 ? 104.318 -106.100 -103.076 1.00 71.87  ? 120  GLY D C   1 
ATOM   4780  O  O   . GLY D  4 120 ? 105.431 -106.331 -102.628 1.00 72.39  ? 120  GLY D O   1 
ATOM   4781  N  N   . SER D  4 121 ? 104.093 -105.159 -103.986 1.00 72.90  ? 121  SER D N   1 
ATOM   4782  C  CA  . SER D  4 121 ? 105.182 -104.345 -104.513 1.00 74.02  ? 121  SER D CA  1 
ATOM   4783  C  C   . SER D  4 121 ? 105.797 -103.409 -103.474 1.00 74.57  ? 121  SER D C   1 
ATOM   4784  O  O   . SER D  4 121 ? 107.017 -103.374 -103.309 1.00 74.96  ? 121  SER D O   1 
ATOM   4785  C  CB  . SER D  4 121 ? 104.703 -103.519 -105.703 1.00 73.82  ? 121  SER D CB  1 
ATOM   4786  O  OG  . SER D  4 121 ? 105.723 -102.623 -106.114 1.00 74.81  ? 121  SER D OG  1 
ATOM   4787  N  N   . GLN D  4 122 ? 104.957 -102.637 -102.793 1.00 74.97  ? 122  GLN D N   1 
ATOM   4788  C  CA  . GLN D  4 122 ? 105.432 -101.711 -101.771 1.00 75.93  ? 122  GLN D CA  1 
ATOM   4789  C  C   . GLN D  4 122 ? 106.098 -102.469 -100.628 1.00 76.51  ? 122  GLN D C   1 
ATOM   4790  O  O   . GLN D  4 122 ? 106.913 -101.918 -99.887  1.00 76.40  ? 122  GLN D O   1 
ATOM   4791  C  CB  . GLN D  4 122 ? 104.267 -100.893 -101.216 1.00 76.86  ? 122  GLN D CB  1 
ATOM   4792  C  CG  . GLN D  4 122 ? 103.817 -99.750  -102.098 1.00 78.26  ? 122  GLN D CG  1 
ATOM   4793  C  CD  . GLN D  4 122 ? 104.922 -98.742  -102.342 1.00 79.19  ? 122  GLN D CD  1 
ATOM   4794  O  OE1 . GLN D  4 122 ? 105.784 -98.940  -103.200 1.00 79.88  ? 122  GLN D OE1 1 
ATOM   4795  N  NE2 . GLN D  4 122 ? 104.912 -97.658  -101.575 1.00 79.68  ? 122  GLN D NE2 1 
ATOM   4796  N  N   . LEU D  4 123 ? 105.743 -103.741 -100.498 1.00 76.64  ? 123  LEU D N   1 
ATOM   4797  C  CA  . LEU D  4 123 ? 106.271 -104.598 -99.448  1.00 76.10  ? 123  LEU D CA  1 
ATOM   4798  C  C   . LEU D  4 123 ? 107.748 -104.903 -99.666  1.00 77.51  ? 123  LEU D C   1 
ATOM   4799  O  O   . LEU D  4 123 ? 108.398 -105.492 -98.810  1.00 78.86  ? 123  LEU D O   1 
ATOM   4800  C  CB  . LEU D  4 123 ? 105.465 -105.893 -99.411  1.00 73.82  ? 123  LEU D CB  1 
ATOM   4801  C  CG  . LEU D  4 123 ? 105.481 -106.744 -98.150  1.00 72.45  ? 123  LEU D CG  1 
ATOM   4802  C  CD1 . LEU D  4 123 ? 105.105 -105.895 -96.953  1.00 72.05  ? 123  LEU D CD1 1 
ATOM   4803  C  CD2 . LEU D  4 123 ? 104.501 -107.888 -98.318  1.00 71.88  ? 123  LEU D CD2 1 
ATOM   4804  N  N   . LEU D  4 124 ? 108.277 -104.497 -100.812 1.00 78.87  ? 124  LEU D N   1 
ATOM   4805  C  CA  . LEU D  4 124 ? 109.681 -104.730 -101.131 1.00 80.99  ? 124  LEU D CA  1 
ATOM   4806  C  C   . LEU D  4 124 ? 110.615 -103.796 -100.365 1.00 82.73  ? 124  LEU D C   1 
ATOM   4807  O  O   . LEU D  4 124 ? 111.726 -104.182 -100.002 1.00 82.75  ? 124  LEU D O   1 
ATOM   4808  C  CB  . LEU D  4 124 ? 109.902 -104.569 -102.635 1.00 80.98  ? 124  LEU D CB  1 
ATOM   4809  C  CG  . LEU D  4 124 ? 109.485 -105.743 -103.530 1.00 81.29  ? 124  LEU D CG  1 
ATOM   4810  C  CD1 . LEU D  4 124 ? 108.204 -106.374 -103.033 1.00 81.55  ? 124  LEU D CD1 1 
ATOM   4811  C  CD2 . LEU D  4 124 ? 109.323 -105.250 -104.955 1.00 81.55  ? 124  LEU D CD2 1 
ATOM   4812  N  N   . HIS D  4 125 ? 110.157 -102.570 -100.123 1.00 84.22  ? 125  HIS D N   1 
ATOM   4813  C  CA  . HIS D  4 125 ? 110.934 -101.571 -99.394  1.00 85.90  ? 125  HIS D CA  1 
ATOM   4814  C  C   . HIS D  4 125 ? 111.572 -102.131 -98.130  1.00 86.29  ? 125  HIS D C   1 
ATOM   4815  O  O   . HIS D  4 125 ? 112.709 -101.796 -97.811  1.00 86.18  ? 125  HIS D O   1 
ATOM   4816  C  CB  . HIS D  4 125 ? 110.046 -100.383 -99.008  1.00 88.53  ? 125  HIS D CB  1 
ATOM   4817  C  CG  . HIS D  4 125 ? 109.812 -99.405  -100.119 1.00 90.98  ? 125  HIS D CG  1 
ATOM   4818  N  ND1 . HIS D  4 125 ? 109.349 -99.782  -101.362 1.00 91.76  ? 125  HIS D ND1 1 
ATOM   4819  C  CD2 . HIS D  4 125 ? 109.963 -98.060  -100.166 1.00 92.10  ? 125  HIS D CD2 1 
ATOM   4820  C  CE1 . HIS D  4 125 ? 109.224 -98.712  -102.127 1.00 92.05  ? 125  HIS D CE1 1 
ATOM   4821  N  NE2 . HIS D  4 125 ? 109.590 -97.654  -101.425 1.00 92.97  ? 125  HIS D NE2 1 
ATOM   4822  N  N   . PHE D  4 126 ? 110.835 -102.973 -97.409  1.00 87.40  ? 126  PHE D N   1 
ATOM   4823  C  CA  . PHE D  4 126 ? 111.329 -103.572 -96.172  1.00 88.94  ? 126  PHE D CA  1 
ATOM   4824  C  C   . PHE D  4 126 ? 112.532 -104.486 -96.385  1.00 90.40  ? 126  PHE D C   1 
ATOM   4825  O  O   . PHE D  4 126 ? 112.759 -105.437 -95.632  1.00 89.86  ? 126  PHE D O   1 
ATOM   4826  C  CB  . PHE D  4 126 ? 110.207 -104.340 -95.474  1.00 88.72  ? 126  PHE D CB  1 
ATOM   4827  C  CG  . PHE D  4 126 ? 109.107 -103.460 -94.958  1.00 89.30  ? 126  PHE D CG  1 
ATOM   4828  C  CD1 . PHE D  4 126 ? 109.401 -102.340 -94.186  1.00 89.30  ? 126  PHE D CD1 1 
ATOM   4829  C  CD2 . PHE D  4 126 ? 107.775 -103.752 -95.232  1.00 90.07  ? 126  PHE D CD2 1 
ATOM   4830  C  CE1 . PHE D  4 126 ? 108.386 -101.521 -93.690  1.00 89.78  ? 126  PHE D CE1 1 
ATOM   4831  C  CE2 . PHE D  4 126 ? 106.746 -102.940 -94.741  1.00 90.39  ? 126  PHE D CE2 1 
ATOM   4832  C  CZ  . PHE D  4 126 ? 107.053 -101.821 -93.968  1.00 90.41  ? 126  PHE D CZ  1 
ATOM   4833  N  N   . ASP D  4 127 ? 113.292 -104.171 -97.429  1.00 92.21  ? 127  ASP D N   1 
ATOM   4834  C  CA  . ASP D  4 127 ? 114.507 -104.881 -97.812  1.00 93.28  ? 127  ASP D CA  1 
ATOM   4835  C  C   . ASP D  4 127 ? 114.543 -106.369 -97.489  1.00 92.98  ? 127  ASP D C   1 
ATOM   4836  O  O   . ASP D  4 127 ? 115.601 -106.898 -97.166  1.00 93.16  ? 127  ASP D O   1 
ATOM   4837  C  CB  . ASP D  4 127 ? 115.716 -104.195 -97.167  1.00 95.00  ? 127  ASP D CB  1 
ATOM   4838  C  CG  . ASP D  4 127 ? 117.005 -104.427 -97.938  1.00 96.41  ? 127  ASP D CG  1 
ATOM   4839  O  OD1 . ASP D  4 127 ? 117.359 -105.601 -98.187  1.00 97.28  ? 127  ASP D OD1 1 
ATOM   4840  O  OD2 . ASP D  4 127 ? 117.669 -103.427 -98.293  1.00 96.95  ? 127  ASP D OD2 1 
ATOM   4841  N  N   . SER D  4 128 ? 113.409 -107.054 -97.575  1.00 93.46  ? 128  SER D N   1 
ATOM   4842  C  CA  . SER D  4 128 ? 113.413 -108.484 -97.281  1.00 93.88  ? 128  SER D CA  1 
ATOM   4843  C  C   . SER D  4 128 ? 114.477 -109.155 -98.134  1.00 94.05  ? 128  SER D C   1 
ATOM   4844  O  O   . SER D  4 128 ? 114.751 -108.727 -99.255  1.00 93.68  ? 128  SER D O   1 
ATOM   4845  C  CB  . SER D  4 128 ? 112.052 -109.125 -97.576  1.00 93.84  ? 128  SER D CB  1 
ATOM   4846  O  OG  . SER D  4 128 ? 112.105 -110.536 -97.402  1.00 91.83  ? 128  SER D OG  1 
ATOM   4847  N  N   . PRO D  4 129 ? 115.106 -110.209 -97.606  1.00 94.78  ? 129  PRO D N   1 
ATOM   4848  C  CA  . PRO D  4 129 ? 116.133 -110.885 -98.397  1.00 95.50  ? 129  PRO D CA  1 
ATOM   4849  C  C   . PRO D  4 129 ? 115.478 -111.533 -99.614  1.00 95.96  ? 129  PRO D C   1 
ATOM   4850  O  O   . PRO D  4 129 ? 115.938 -111.373 -100.750 1.00 96.12  ? 129  PRO D O   1 
ATOM   4851  C  CB  . PRO D  4 129 ? 116.690 -111.914 -97.418  1.00 95.23  ? 129  PRO D CB  1 
ATOM   4852  C  CG  . PRO D  4 129 ? 115.477 -112.275 -96.603  1.00 94.81  ? 129  PRO D CG  1 
ATOM   4853  C  CD  . PRO D  4 129 ? 114.867 -110.917 -96.335  1.00 94.95  ? 129  PRO D CD  1 
ATOM   4854  N  N   . GLU D  4 130 ? 114.380 -112.241 -99.354  1.00 95.78  ? 130  GLU D N   1 
ATOM   4855  C  CA  . GLU D  4 130 ? 113.628 -112.947 -100.382 1.00 95.45  ? 130  GLU D CA  1 
ATOM   4856  C  C   . GLU D  4 130 ? 112.758 -112.070 -101.287 1.00 95.79  ? 130  GLU D C   1 
ATOM   4857  O  O   . GLU D  4 130 ? 111.770 -112.546 -101.848 1.00 95.81  ? 130  GLU D O   1 
ATOM   4858  C  CB  . GLU D  4 130 ? 112.765 -114.022 -99.723  1.00 94.54  ? 130  GLU D CB  1 
ATOM   4859  C  CG  . GLU D  4 130 ? 111.969 -113.537 -98.529  1.00 93.12  ? 130  GLU D CG  1 
ATOM   4860  C  CD  . GLU D  4 130 ? 111.155 -114.650 -97.904  1.00 93.28  ? 130  GLU D CD  1 
ATOM   4861  O  OE1 . GLU D  4 130 ? 110.467 -114.397 -96.893  1.00 92.85  ? 130  GLU D OE1 1 
ATOM   4862  O  OE2 . GLU D  4 130 ? 111.203 -115.784 -98.427  1.00 92.41  ? 130  GLU D OE2 1 
ATOM   4863  N  N   . ASN D  4 131 ? 113.126 -110.798 -101.427 1.00 95.72  ? 131  ASN D N   1 
ATOM   4864  C  CA  . ASN D  4 131 ? 112.389 -109.869 -102.282 1.00 94.93  ? 131  ASN D CA  1 
ATOM   4865  C  C   . ASN D  4 131 ? 112.231 -110.454 -103.680 1.00 95.55  ? 131  ASN D C   1 
ATOM   4866  O  O   . ASN D  4 131 ? 111.121 -110.548 -104.213 1.00 95.48  ? 131  ASN D O   1 
ATOM   4867  C  CB  . ASN D  4 131 ? 113.131 -108.533 -102.392 1.00 93.26  ? 131  ASN D CB  1 
ATOM   4868  C  CG  . ASN D  4 131 ? 112.793 -107.581 -101.273 1.00 91.86  ? 131  ASN D CG  1 
ATOM   4869  O  OD1 . ASN D  4 131 ? 113.272 -106.449 -101.242 1.00 90.31  ? 131  ASN D OD1 1 
ATOM   4870  N  ND2 . ASN D  4 131 ? 111.958 -108.031 -100.346 1.00 91.87  ? 131  ASN D ND2 1 
ATOM   4871  N  N   . ALA D  4 132 ? 113.361 -110.837 -104.267 1.00 95.90  ? 132  ALA D N   1 
ATOM   4872  C  CA  . ALA D  4 132 ? 113.394 -111.404 -105.607 1.00 96.34  ? 132  ALA D CA  1 
ATOM   4873  C  C   . ALA D  4 132 ? 112.285 -112.425 -105.834 1.00 96.43  ? 132  ALA D C   1 
ATOM   4874  O  O   . ALA D  4 132 ? 111.375 -112.196 -106.632 1.00 96.46  ? 132  ALA D O   1 
ATOM   4875  C  CB  . ALA D  4 132 ? 114.753 -112.047 -105.861 1.00 95.65  ? 132  ALA D CB  1 
ATOM   4876  N  N   . ASP D  4 133 ? 112.363 -113.544 -105.121 1.00 96.41  ? 133  ASP D N   1 
ATOM   4877  C  CA  . ASP D  4 133 ? 111.386 -114.620 -105.254 1.00 96.61  ? 133  ASP D CA  1 
ATOM   4878  C  C   . ASP D  4 133 ? 109.932 -114.147 -105.236 1.00 96.47  ? 133  ASP D C   1 
ATOM   4879  O  O   . ASP D  4 133 ? 109.072 -114.736 -105.899 1.00 96.43  ? 133  ASP D O   1 
ATOM   4880  C  CB  . ASP D  4 133 ? 111.599 -115.657 -104.153 1.00 97.24  ? 133  ASP D CB  1 
ATOM   4881  C  CG  . ASP D  4 133 ? 110.904 -116.968 -104.453 1.00 97.77  ? 133  ASP D CG  1 
ATOM   4882  O  OD1 . ASP D  4 133 ? 110.927 -117.861 -103.581 1.00 97.79  ? 133  ASP D OD1 1 
ATOM   4883  O  OD2 . ASP D  4 133 ? 110.341 -117.107 -105.562 1.00 97.57  ? 133  ASP D OD2 1 
ATOM   4884  N  N   . ILE D  4 134 ? 109.653 -113.098 -104.465 1.00 95.75  ? 134  ILE D N   1 
ATOM   4885  C  CA  . ILE D  4 134 ? 108.300 -112.552 -104.389 1.00 93.90  ? 134  ILE D CA  1 
ATOM   4886  C  C   . ILE D  4 134 ? 107.934 -112.019 -105.767 1.00 92.83  ? 134  ILE D C   1 
ATOM   4887  O  O   . ILE D  4 134 ? 107.024 -112.529 -106.421 1.00 92.71  ? 134  ILE D O   1 
ATOM   4888  C  CB  . ILE D  4 134 ? 108.209 -111.394 -103.360 1.00 93.55  ? 134  ILE D CB  1 
ATOM   4889  C  CG1 . ILE D  4 134 ? 108.307 -111.951 -101.940 1.00 92.99  ? 134  ILE D CG1 1 
ATOM   4890  C  CG2 . ILE D  4 134 ? 106.904 -110.634 -103.534 1.00 93.19  ? 134  ILE D CG2 1 
ATOM   4891  C  CD1 . ILE D  4 134 ? 108.293 -110.888 -100.867 1.00 92.08  ? 134  ILE D CD1 1 
ATOM   4892  N  N   . SER D  4 135 ? 108.669 -110.999 -106.200 1.00 91.13  ? 135  SER D N   1 
ATOM   4893  C  CA  . SER D  4 135 ? 108.458 -110.367 -107.495 1.00 89.36  ? 135  SER D CA  1 
ATOM   4894  C  C   . SER D  4 135 ? 108.365 -111.384 -108.624 1.00 88.48  ? 135  SER D C   1 
ATOM   4895  O  O   . SER D  4 135 ? 107.500 -111.275 -109.492 1.00 88.45  ? 135  SER D O   1 
ATOM   4896  C  CB  . SER D  4 135 ? 109.596 -109.393 -107.770 1.00 89.10  ? 135  SER D CB  1 
ATOM   4897  O  OG  . SER D  4 135 ? 109.760 -108.515 -106.670 1.00 88.91  ? 135  SER D OG  1 
ATOM   4898  N  N   . GLN D  4 136 ? 109.258 -112.369 -108.613 1.00 87.48  ? 136  GLN D N   1 
ATOM   4899  C  CA  . GLN D  4 136 ? 109.257 -113.411 -109.637 1.00 86.52  ? 136  GLN D CA  1 
ATOM   4900  C  C   . GLN D  4 136 ? 108.034 -114.319 -109.435 1.00 85.54  ? 136  GLN D C   1 
ATOM   4901  O  O   . GLN D  4 136 ? 107.996 -115.460 -109.904 1.00 85.66  ? 136  GLN D O   1 
ATOM   4902  C  CB  . GLN D  4 136 ? 110.549 -114.240 -109.565 1.00 86.71  ? 136  GLN D CB  1 
ATOM   4903  C  CG  . GLN D  4 136 ? 110.723 -115.226 -110.724 1.00 87.41  ? 136  GLN D CG  1 
ATOM   4904  C  CD  . GLN D  4 136 ? 111.791 -116.281 -110.463 1.00 88.60  ? 136  GLN D CD  1 
ATOM   4905  O  OE1 . GLN D  4 136 ? 111.681 -117.079 -109.527 1.00 88.79  ? 136  GLN D OE1 1 
ATOM   4906  N  NE2 . GLN D  4 136 ? 112.830 -116.293 -111.297 1.00 88.65  ? 136  GLN D NE2 1 
ATOM   4907  N  N   . SER D  4 137 ? 107.041 -113.807 -108.716 1.00 83.65  ? 137  SER D N   1 
ATOM   4908  C  CA  . SER D  4 137 ? 105.814 -114.547 -108.469 1.00 82.06  ? 137  SER D CA  1 
ATOM   4909  C  C   . SER D  4 137 ? 104.657 -113.570 -108.653 1.00 81.66  ? 137  SER D C   1 
ATOM   4910  O  O   . SER D  4 137 ? 103.543 -113.970 -108.990 1.00 81.40  ? 137  SER D O   1 
ATOM   4911  C  CB  . SER D  4 137 ? 105.803 -115.130 -107.054 1.00 81.93  ? 137  SER D CB  1 
ATOM   4912  O  OG  . SER D  4 137 ? 104.789 -116.115 -106.918 1.00 80.51  ? 137  SER D OG  1 
ATOM   4913  N  N   . LEU D  4 138 ? 104.933 -112.284 -108.435 1.00 80.99  ? 138  LEU D N   1 
ATOM   4914  C  CA  . LEU D  4 138 ? 103.923 -111.245 -108.608 1.00 79.87  ? 138  LEU D CA  1 
ATOM   4915  C  C   . LEU D  4 138 ? 103.589 -111.146 -110.090 1.00 80.69  ? 138  LEU D C   1 
ATOM   4916  O  O   . LEU D  4 138 ? 102.588 -110.537 -110.468 1.00 81.51  ? 138  LEU D O   1 
ATOM   4917  C  CB  . LEU D  4 138 ? 104.427 -109.885 -108.102 1.00 77.52  ? 138  LEU D CB  1 
ATOM   4918  C  CG  . LEU D  4 138 ? 104.348 -109.582 -106.601 1.00 74.53  ? 138  LEU D CG  1 
ATOM   4919  C  CD1 . LEU D  4 138 ? 104.736 -108.134 -106.361 1.00 73.21  ? 138  LEU D CD1 1 
ATOM   4920  C  CD2 . LEU D  4 138 ? 102.939 -109.830 -106.088 1.00 72.78  ? 138  LEU D CD2 1 
ATOM   4921  N  N   . LEU D  4 139 ? 104.443 -111.742 -110.923 1.00 81.20  ? 139  LEU D N   1 
ATOM   4922  C  CA  . LEU D  4 139 ? 104.254 -111.767 -112.375 1.00 80.84  ? 139  LEU D CA  1 
ATOM   4923  C  C   . LEU D  4 139 ? 103.678 -113.126 -112.745 1.00 80.57  ? 139  LEU D C   1 
ATOM   4924  O  O   . LEU D  4 139 ? 102.667 -113.217 -113.430 1.00 80.28  ? 139  LEU D O   1 
ATOM   4925  C  CB  . LEU D  4 139 ? 105.586 -111.560 -113.102 1.00 80.62  ? 139  LEU D CB  1 
ATOM   4926  C  CG  . LEU D  4 139 ? 106.220 -110.162 -113.091 1.00 81.43  ? 139  LEU D CG  1 
ATOM   4927  C  CD1 . LEU D  4 139 ? 105.565 -109.285 -114.140 1.00 82.24  ? 139  LEU D CD1 1 
ATOM   4928  C  CD2 . LEU D  4 139 ? 106.099 -109.544 -111.700 1.00 81.55  ? 139  LEU D CD2 1 
ATOM   4929  N  N   . GLN D  4 140 ? 104.332 -114.182 -112.278 1.00 81.46  ? 140  GLN D N   1 
ATOM   4930  C  CA  . GLN D  4 140 ? 103.883 -115.545 -112.538 1.00 83.24  ? 140  GLN D CA  1 
ATOM   4931  C  C   . GLN D  4 140 ? 102.401 -115.710 -112.187 1.00 83.35  ? 140  GLN D C   1 
ATOM   4932  O  O   . GLN D  4 140 ? 101.704 -116.544 -112.768 1.00 83.20  ? 140  GLN D O   1 
ATOM   4933  C  CB  . GLN D  4 140 ? 104.748 -116.535 -111.731 1.00 84.43  ? 140  GLN D CB  1 
ATOM   4934  C  CG  . GLN D  4 140 ? 104.189 -117.956 -111.570 1.00 86.16  ? 140  GLN D CG  1 
ATOM   4935  C  CD  . GLN D  4 140 ? 103.175 -118.079 -110.430 1.00 88.13  ? 140  GLN D CD  1 
ATOM   4936  O  OE1 . GLN D  4 140 ? 103.495 -117.839 -109.261 1.00 88.89  ? 140  GLN D OE1 1 
ATOM   4937  N  NE2 . GLN D  4 140 ? 101.947 -118.457 -110.770 1.00 88.97  ? 140  GLN D NE2 1 
ATOM   4938  N  N   . THR D  4 141 ? 101.917 -114.904 -111.248 1.00 83.02  ? 141  THR D N   1 
ATOM   4939  C  CA  . THR D  4 141 ? 100.524 -114.989 -110.830 1.00 83.19  ? 141  THR D CA  1 
ATOM   4940  C  C   . THR D  4 141 ? 99.611  -114.018 -111.578 1.00 82.92  ? 141  THR D C   1 
ATOM   4941  O  O   . THR D  4 141 ? 98.389  -114.166 -111.570 1.00 81.97  ? 141  THR D O   1 
ATOM   4942  C  CB  . THR D  4 141 ? 100.399 -114.760 -109.314 1.00 83.16  ? 141  THR D CB  1 
ATOM   4943  O  OG1 . THR D  4 141 ? 101.017 -113.516 -108.964 1.00 83.80  ? 141  THR D OG1 1 
ATOM   4944  C  CG2 . THR D  4 141 ? 101.082 -115.891 -108.555 1.00 82.82  ? 141  THR D CG2 1 
ATOM   4945  N  N   . PHE D  4 142 ? 100.204 -113.019 -112.218 1.00 83.17  ? 142  PHE D N   1 
ATOM   4946  C  CA  . PHE D  4 142 ? 99.423  -112.065 -112.991 1.00 83.35  ? 142  PHE D CA  1 
ATOM   4947  C  C   . PHE D  4 142 ? 99.449  -112.540 -114.442 1.00 83.68  ? 142  PHE D C   1 
ATOM   4948  O  O   . PHE D  4 142 ? 98.405  -112.834 -115.025 1.00 83.49  ? 142  PHE D O   1 
ATOM   4949  C  CB  . PHE D  4 142 ? 100.009 -110.655 -112.866 1.00 82.25  ? 142  PHE D CB  1 
ATOM   4950  C  CG  . PHE D  4 142 ? 99.366  -109.648 -113.777 1.00 82.23  ? 142  PHE D CG  1 
ATOM   4951  C  CD1 . PHE D  4 142 ? 98.009  -109.724 -114.075 1.00 81.86  ? 142  PHE D CD1 1 
ATOM   4952  C  CD2 . PHE D  4 142 ? 100.119 -108.623 -114.340 1.00 82.35  ? 142  PHE D CD2 1 
ATOM   4953  C  CE1 . PHE D  4 142 ? 97.413  -108.797 -114.922 1.00 82.10  ? 142  PHE D CE1 1 
ATOM   4954  C  CE2 . PHE D  4 142 ? 99.533  -107.687 -115.189 1.00 82.20  ? 142  PHE D CE2 1 
ATOM   4955  C  CZ  . PHE D  4 142 ? 98.178  -107.775 -115.482 1.00 82.30  ? 142  PHE D CZ  1 
ATOM   4956  N  N   . ILE D  4 143 ? 100.648 -112.634 -115.013 1.00 83.79  ? 143  ILE D N   1 
ATOM   4957  C  CA  . ILE D  4 143 ? 100.799 -113.102 -116.387 1.00 83.71  ? 143  ILE D CA  1 
ATOM   4958  C  C   . ILE D  4 143 ? 100.111 -114.455 -116.485 1.00 83.79  ? 143  ILE D C   1 
ATOM   4959  O  O   . ILE D  4 143 ? 99.811  -114.936 -117.572 1.00 84.62  ? 143  ILE D O   1 
ATOM   4960  C  CB  . ILE D  4 143 ? 102.295 -113.268 -116.782 1.00 83.56  ? 143  ILE D CB  1 
ATOM   4961  C  CG1 . ILE D  4 143 ? 102.964 -111.900 -116.946 1.00 83.63  ? 143  ILE D CG1 1 
ATOM   4962  C  CG2 . ILE D  4 143 ? 102.414 -114.036 -118.079 1.00 82.88  ? 143  ILE D CG2 1 
ATOM   4963  C  CD1 . ILE D  4 143 ? 103.141 -111.132 -115.650 1.00 84.43  ? 143  ILE D CD1 1 
ATOM   4964  N  N   . GLY D  4 144 ? 99.853  -115.061 -115.332 1.00 84.00  ? 144  GLY D N   1 
ATOM   4965  C  CA  . GLY D  4 144 ? 99.201  -116.353 -115.312 1.00 83.94  ? 144  GLY D CA  1 
ATOM   4966  C  C   . GLY D  4 144 ? 97.693  -116.245 -115.324 1.00 83.91  ? 144  GLY D C   1 
ATOM   4967  O  O   . GLY D  4 144 ? 97.010  -117.161 -115.771 1.00 83.44  ? 144  GLY D O   1 
ATOM   4968  N  N   . ARG D  4 145 ? 97.166  -115.126 -114.837 1.00 85.01  ? 145  ARG D N   1 
ATOM   4969  C  CA  . ARG D  4 145 ? 95.718  -114.935 -114.802 1.00 86.28  ? 145  ARG D CA  1 
ATOM   4970  C  C   . ARG D  4 145 ? 95.229  -113.958 -115.869 1.00 87.21  ? 145  ARG D C   1 
ATOM   4971  O  O   . ARG D  4 145 ? 94.027  -113.774 -116.051 1.00 86.98  ? 145  ARG D O   1 
ATOM   4972  C  CB  . ARG D  4 145 ? 95.285  -114.456 -113.415 1.00 85.12  ? 145  ARG D CB  1 
ATOM   4973  C  CG  . ARG D  4 145 ? 95.879  -115.281 -112.290 1.00 83.66  ? 145  ARG D CG  1 
ATOM   4974  C  CD  . ARG D  4 145 ? 94.936  -115.409 -111.107 1.00 81.86  ? 145  ARG D CD  1 
ATOM   4975  N  NE  . ARG D  4 145 ? 94.524  -114.121 -110.563 1.00 79.66  ? 145  ARG D NE  1 
ATOM   4976  C  CZ  . ARG D  4 145 ? 93.753  -113.988 -109.490 1.00 79.13  ? 145  ARG D CZ  1 
ATOM   4977  N  NH1 . ARG D  4 145 ? 93.314  -115.062 -108.847 1.00 78.64  ? 145  ARG D NH1 1 
ATOM   4978  N  NH2 . ARG D  4 145 ? 93.413  -112.784 -109.063 1.00 79.15  ? 145  ARG D NH2 1 
ATOM   4979  N  N   . PHE D  4 146 ? 96.173  -113.345 -116.575 1.00 88.49  ? 146  PHE D N   1 
ATOM   4980  C  CA  . PHE D  4 146 ? 95.871  -112.389 -117.634 1.00 90.18  ? 146  PHE D CA  1 
ATOM   4981  C  C   . PHE D  4 146 ? 94.727  -112.850 -118.540 1.00 90.91  ? 146  PHE D C   1 
ATOM   4982  O  O   . PHE D  4 146 ? 93.908  -112.039 -118.973 1.00 90.54  ? 146  PHE D O   1 
ATOM   4983  C  CB  . PHE D  4 146 ? 97.129  -112.152 -118.476 1.00 91.55  ? 146  PHE D CB  1 
ATOM   4984  C  CG  . PHE D  4 146 ? 96.908  -111.275 -119.677 1.00 93.39  ? 146  PHE D CG  1 
ATOM   4985  C  CD1 . PHE D  4 146 ? 96.743  -109.902 -119.534 1.00 94.18  ? 146  PHE D CD1 1 
ATOM   4986  C  CD2 . PHE D  4 146 ? 96.863  -111.826 -120.957 1.00 94.14  ? 146  PHE D CD2 1 
ATOM   4987  C  CE1 . PHE D  4 146 ? 96.537  -109.090 -120.651 1.00 95.08  ? 146  PHE D CE1 1 
ATOM   4988  C  CE2 . PHE D  4 146 ? 96.658  -111.024 -122.080 1.00 94.08  ? 146  PHE D CE2 1 
ATOM   4989  C  CZ  . PHE D  4 146 ? 96.495  -109.655 -121.927 1.00 94.27  ? 146  PHE D CZ  1 
ATOM   4990  N  N   . ARG D  4 147 ? 94.671  -114.150 -118.823 1.00 91.87  ? 147  ARG D N   1 
ATOM   4991  C  CA  . ARG D  4 147 ? 93.632  -114.694 -119.691 1.00 92.49  ? 147  ARG D CA  1 
ATOM   4992  C  C   . ARG D  4 147 ? 92.241  -114.608 -119.087 1.00 91.72  ? 147  ARG D C   1 
ATOM   4993  O  O   . ARG D  4 147 ? 91.448  -113.760 -119.480 1.00 91.94  ? 147  ARG D O   1 
ATOM   4994  C  CB  . ARG D  4 147 ? 93.926  -116.151 -120.045 1.00 94.71  ? 147  ARG D CB  1 
ATOM   4995  C  CG  . ARG D  4 147 ? 92.896  -116.763 -120.995 1.00 97.50  ? 147  ARG D CG  1 
ATOM   4996  C  CD  . ARG D  4 147 ? 93.206  -118.216 -121.290 1.00 99.58  ? 147  ARG D CD  1 
ATOM   4997  N  NE  . ARG D  4 147 ? 94.586  -118.379 -121.736 1.00 102.88 ? 147  ARG D NE  1 
ATOM   4998  C  CZ  . ARG D  4 147 ? 95.151  -119.551 -122.007 1.00 104.44 ? 147  ARG D CZ  1 
ATOM   4999  N  NH1 . ARG D  4 147 ? 94.448  -120.670 -121.880 1.00 105.85 ? 147  ARG D NH1 1 
ATOM   5000  N  NH2 . ARG D  4 147 ? 96.421  -119.606 -122.392 1.00 104.42 ? 147  ARG D NH2 1 
ATOM   5001  N  N   . ARG D  4 148 ? 91.942  -115.493 -118.141 1.00 91.14  ? 148  ARG D N   1 
ATOM   5002  C  CA  . ARG D  4 148 ? 90.630  -115.512 -117.502 1.00 90.87  ? 148  ARG D CA  1 
ATOM   5003  C  C   . ARG D  4 148 ? 90.086  -114.127 -117.142 1.00 90.61  ? 148  ARG D C   1 
ATOM   5004  O  O   . ARG D  4 148 ? 88.882  -113.971 -116.925 1.00 90.84  ? 148  ARG D O   1 
ATOM   5005  C  CB  . ARG D  4 148 ? 90.660  -116.392 -116.245 1.00 91.86  ? 148  ARG D CB  1 
ATOM   5006  C  CG  . ARG D  4 148 ? 90.556  -117.887 -116.511 1.00 92.69  ? 148  ARG D CG  1 
ATOM   5007  C  CD  . ARG D  4 148 ? 90.426  -118.669 -115.207 1.00 93.72  ? 148  ARG D CD  1 
ATOM   5008  N  NE  . ARG D  4 148 ? 89.846  -119.996 -115.419 1.00 95.18  ? 148  ARG D NE  1 
ATOM   5009  C  CZ  . ARG D  4 148 ? 89.500  -120.830 -114.441 1.00 95.10  ? 148  ARG D CZ  1 
ATOM   5010  N  NH1 . ARG D  4 148 ? 88.977  -122.015 -114.728 1.00 95.17  ? 148  ARG D NH1 1 
ATOM   5011  N  NH2 . ARG D  4 148 ? 89.676  -120.483 -113.175 1.00 95.77  ? 148  ARG D NH2 1 
ATOM   5012  N  N   . ILE D  4 149 ? 90.962  -113.126 -117.071 1.00 89.75  ? 149  ILE D N   1 
ATOM   5013  C  CA  . ILE D  4 149 ? 90.531  -111.767 -116.747 1.00 88.74  ? 149  ILE D CA  1 
ATOM   5014  C  C   . ILE D  4 149 ? 90.055  -111.064 -118.019 1.00 88.45  ? 149  ILE D C   1 
ATOM   5015  O  O   . ILE D  4 149 ? 88.972  -110.476 -118.048 1.00 88.84  ? 149  ILE D O   1 
ATOM   5016  C  CB  . ILE D  4 149 ? 91.676  -110.935 -116.108 1.00 88.38  ? 149  ILE D CB  1 
ATOM   5017  C  CG1 . ILE D  4 149 ? 92.133  -111.582 -114.801 1.00 88.10  ? 149  ILE D CG1 1 
ATOM   5018  C  CG2 . ILE D  4 149 ? 91.196  -109.518 -115.814 1.00 88.15  ? 149  ILE D CG2 1 
ATOM   5019  C  CD1 . ILE D  4 149 ? 93.300  -110.869 -114.146 1.00 88.10  ? 149  ILE D CD1 1 
HETATM 5020  N  N   . MSE D  4 150 ? 90.867  -111.134 -119.070 1.00 87.76  ? 150  MSE D N   1 
HETATM 5021  C  CA  . MSE D  4 150 ? 90.528  -110.519 -120.346 1.00 86.23  ? 150  MSE D CA  1 
HETATM 5022  C  C   . MSE D  4 150 ? 89.291  -111.175 -120.939 1.00 84.51  ? 150  MSE D C   1 
HETATM 5023  O  O   . MSE D  4 150 ? 88.350  -110.490 -121.321 1.00 84.46  ? 150  MSE D O   1 
HETATM 5024  C  CB  . MSE D  4 150 ? 91.693  -110.660 -121.319 1.00 87.82  ? 150  MSE D CB  1 
HETATM 5025  C  CG  . MSE D  4 150 ? 91.419  -110.118 -122.703 1.00 90.28  ? 150  MSE D CG  1 
HETATM 5026  SE SE  . MSE D  4 150 ? 92.948  -110.378 -123.859 1.00 94.75  ? 150  MSE D SE  1 
HETATM 5027  C  CE  . MSE D  4 150 ? 92.763  -112.292 -124.083 1.00 92.96  ? 150  MSE D CE  1 
ATOM   5028  N  N   . ASP D  4 151 ? 89.294  -112.503 -121.010 1.00 83.28  ? 151  ASP D N   1 
ATOM   5029  C  CA  . ASP D  4 151 ? 88.160  -113.242 -121.562 1.00 82.94  ? 151  ASP D CA  1 
ATOM   5030  C  C   . ASP D  4 151 ? 86.852  -112.890 -120.858 1.00 82.92  ? 151  ASP D C   1 
ATOM   5031  O  O   . ASP D  4 151 ? 85.775  -112.989 -121.439 1.00 82.11  ? 151  ASP D O   1 
ATOM   5032  C  CB  . ASP D  4 151 ? 88.400  -114.758 -121.469 1.00 81.94  ? 151  ASP D CB  1 
ATOM   5033  C  CG  . ASP D  4 151 ? 89.538  -115.234 -122.367 1.00 81.46  ? 151  ASP D CG  1 
ATOM   5034  O  OD1 . ASP D  4 151 ? 90.024  -114.437 -123.199 1.00 81.06  ? 151  ASP D OD1 1 
ATOM   5035  O  OD2 . ASP D  4 151 ? 89.943  -116.412 -122.247 1.00 80.87  ? 151  ASP D OD2 1 
ATOM   5036  N  N   . SER D  4 152 ? 86.947  -112.474 -119.603 1.00 84.18  ? 152  SER D N   1 
ATOM   5037  C  CA  . SER D  4 152 ? 85.762  -112.115 -118.843 1.00 85.63  ? 152  SER D CA  1 
ATOM   5038  C  C   . SER D  4 152 ? 85.300  -110.709 -119.197 1.00 86.60  ? 152  SER D C   1 
ATOM   5039  O  O   . SER D  4 152 ? 84.103  -110.449 -119.299 1.00 86.34  ? 152  SER D O   1 
ATOM   5040  C  CB  . SER D  4 152 ? 86.052  -112.201 -117.346 1.00 85.70  ? 152  SER D CB  1 
ATOM   5041  O  OG  . SER D  4 152 ? 84.873  -111.985 -116.594 1.00 86.85  ? 152  SER D OG  1 
ATOM   5042  N  N   . SER D  4 153 ? 86.256  -109.807 -119.389 1.00 88.57  ? 153  SER D N   1 
ATOM   5043  C  CA  . SER D  4 153 ? 85.951  -108.422 -119.730 1.00 91.24  ? 153  SER D CA  1 
ATOM   5044  C  C   . SER D  4 153 ? 85.434  -108.275 -121.162 1.00 94.17  ? 153  SER D C   1 
ATOM   5045  O  O   . SER D  4 153 ? 84.427  -107.604 -121.398 1.00 94.10  ? 153  SER D O   1 
ATOM   5046  C  CB  . SER D  4 153 ? 87.195  -107.546 -119.540 1.00 89.96  ? 153  SER D CB  1 
ATOM   5047  O  OG  . SER D  4 153 ? 88.284  -108.016 -120.314 1.00 88.34  ? 153  SER D OG  1 
ATOM   5048  N  N   . GLN D  4 154 ? 86.126  -108.911 -122.108 1.00 97.09  ? 154  GLN D N   1 
ATOM   5049  C  CA  . GLN D  4 154 ? 85.765  -108.864 -123.526 1.00 99.01  ? 154  GLN D CA  1 
ATOM   5050  C  C   . GLN D  4 154 ? 84.505  -109.652 -123.863 1.00 100.49 ? 154  GLN D C   1 
ATOM   5051  O  O   . GLN D  4 154 ? 84.337  -110.093 -124.997 1.00 101.31 ? 154  GLN D O   1 
ATOM   5052  C  CB  . GLN D  4 154 ? 86.919  -109.398 -124.381 1.00 99.16  ? 154  GLN D CB  1 
ATOM   5053  C  CG  . GLN D  4 154 ? 88.177  -108.552 -124.342 1.00 100.39 ? 154  GLN D CG  1 
ATOM   5054  C  CD  . GLN D  4 154 ? 88.016  -107.237 -125.076 1.00 101.11 ? 154  GLN D CD  1 
ATOM   5055  O  OE1 . GLN D  4 154 ? 87.178  -106.408 -124.717 1.00 101.44 ? 154  GLN D OE1 1 
ATOM   5056  N  NE2 . GLN D  4 154 ? 88.820  -107.040 -126.116 1.00 101.18 ? 154  GLN D NE2 1 
ATOM   5057  N  N   . ASN D  4 155 ? 83.622  -109.835 -122.889 1.00 102.31 ? 155  ASN D N   1 
ATOM   5058  C  CA  . ASN D  4 155 ? 82.391  -110.574 -123.127 1.00 104.40 ? 155  ASN D CA  1 
ATOM   5059  C  C   . ASN D  4 155 ? 81.260  -110.088 -122.231 1.00 105.72 ? 155  ASN D C   1 
ATOM   5060  O  O   . ASN D  4 155 ? 81.496  -109.533 -121.155 1.00 105.40 ? 155  ASN D O   1 
ATOM   5061  C  CB  . ASN D  4 155 ? 82.628  -112.075 -122.915 1.00 106.08 ? 155  ASN D CB  1 
ATOM   5062  C  CG  . ASN D  4 155 ? 81.796  -112.654 -121.773 1.00 107.64 ? 155  ASN D CG  1 
ATOM   5063  O  OD1 . ASN D  4 155 ? 81.976  -112.294 -120.605 1.00 107.98 ? 155  ASN D OD1 1 
ATOM   5064  N  ND2 . ASN D  4 155 ? 80.879  -113.560 -122.112 1.00 107.62 ? 155  ASN D ND2 1 
ATOM   5065  N  N   . ALA D  4 156 ? 80.029  -110.301 -122.686 1.00 107.35 ? 156  ALA D N   1 
ATOM   5066  C  CA  . ALA D  4 156 ? 78.850  -109.887 -121.936 1.00 108.97 ? 156  ALA D CA  1 
ATOM   5067  C  C   . ALA D  4 156 ? 78.812  -110.567 -120.572 1.00 109.90 ? 156  ALA D C   1 
ATOM   5068  O  O   . ALA D  4 156 ? 79.350  -111.661 -120.392 1.00 109.91 ? 156  ALA D O   1 
ATOM   5069  C  CB  . ALA D  4 156 ? 77.582  -110.216 -122.726 1.00 108.61 ? 156  ALA D CB  1 
ATOM   5070  N  N   . TYR D  4 157 ? 78.172  -109.909 -119.611 1.00 111.26 ? 157  TYR D N   1 
ATOM   5071  C  CA  . TYR D  4 157 ? 78.065  -110.445 -118.262 1.00 112.22 ? 157  TYR D CA  1 
ATOM   5072  C  C   . TYR D  4 157 ? 77.272  -111.744 -118.167 1.00 112.95 ? 157  TYR D C   1 
ATOM   5073  O  O   . TYR D  4 157 ? 76.386  -112.026 -118.975 1.00 113.36 ? 157  TYR D O   1 
ATOM   5074  C  CB  . TYR D  4 157 ? 77.441  -109.405 -117.315 1.00 111.98 ? 157  TYR D CB  1 
ATOM   5075  C  CG  . TYR D  4 157 ? 76.738  -110.014 -116.113 1.00 111.79 ? 157  TYR D CG  1 
ATOM   5076  C  CD1 . TYR D  4 157 ? 75.385  -110.361 -116.172 1.00 111.60 ? 157  TYR D CD1 1 
ATOM   5077  C  CD2 . TYR D  4 157 ? 77.436  -110.297 -114.940 1.00 111.51 ? 157  TYR D CD2 1 
ATOM   5078  C  CE1 . TYR D  4 157 ? 74.747  -110.976 -115.094 1.00 111.19 ? 157  TYR D CE1 1 
ATOM   5079  C  CE2 . TYR D  4 157 ? 76.807  -110.914 -113.857 1.00 111.22 ? 157  TYR D CE2 1 
ATOM   5080  C  CZ  . TYR D  4 157 ? 75.465  -111.251 -113.941 1.00 110.96 ? 157  TYR D CZ  1 
ATOM   5081  O  OH  . TYR D  4 157 ? 74.847  -111.866 -112.874 1.00 109.93 ? 157  TYR D OH  1 
ATOM   5082  N  N   . ASN D  4 158 ? 77.619  -112.523 -117.150 1.00 113.24 ? 158  ASN D N   1 
ATOM   5083  C  CA  . ASN D  4 158 ? 76.981  -113.790 -116.835 1.00 113.31 ? 158  ASN D CA  1 
ATOM   5084  C  C   . ASN D  4 158 ? 77.465  -114.082 -115.425 1.00 113.42 ? 158  ASN D C   1 
ATOM   5085  O  O   . ASN D  4 158 ? 78.418  -113.454 -114.961 1.00 113.52 ? 158  ASN D O   1 
ATOM   5086  C  CB  . ASN D  4 158 ? 77.411  -114.888 -117.818 1.00 113.25 ? 158  ASN D CB  1 
ATOM   5087  C  CG  . ASN D  4 158 ? 78.868  -114.782 -118.223 1.00 113.37 ? 158  ASN D CG  1 
ATOM   5088  O  OD1 . ASN D  4 158 ? 79.767  -114.967 -117.407 1.00 113.89 ? 158  ASN D OD1 1 
ATOM   5089  N  ND2 . ASN D  4 158 ? 79.107  -114.479 -119.494 1.00 113.03 ? 158  ASN D ND2 1 
ATOM   5090  N  N   . GLU D  4 159 ? 76.813  -115.004 -114.728 1.00 113.56 ? 159  GLU D N   1 
ATOM   5091  C  CA  . GLU D  4 159 ? 77.225  -115.311 -113.364 1.00 113.20 ? 159  GLU D CA  1 
ATOM   5092  C  C   . GLU D  4 159 ? 78.550  -116.066 -113.278 1.00 112.88 ? 159  GLU D C   1 
ATOM   5093  O  O   . GLU D  4 159 ? 78.894  -116.622 -112.233 1.00 112.83 ? 159  GLU D O   1 
ATOM   5094  C  CB  . GLU D  4 159 ? 76.120  -116.075 -112.641 1.00 112.92 ? 159  GLU D CB  1 
ATOM   5095  C  CG  . GLU D  4 159 ? 74.872  -115.241 -112.440 1.00 112.60 ? 159  GLU D CG  1 
ATOM   5096  C  CD  . GLU D  4 159 ? 73.920  -115.858 -111.445 1.00 112.86 ? 159  GLU D CD  1 
ATOM   5097  O  OE1 . GLU D  4 159 ? 74.330  -116.063 -110.283 1.00 112.49 ? 159  GLU D OE1 1 
ATOM   5098  O  OE2 . GLU D  4 159 ? 72.763  -116.137 -111.822 1.00 113.33 ? 159  GLU D OE2 1 
ATOM   5099  N  N   . ASP D  4 160 ? 79.287  -116.082 -114.387 1.00 112.25 ? 160  ASP D N   1 
ATOM   5100  C  CA  . ASP D  4 160 ? 80.597  -116.726 -114.446 1.00 110.59 ? 160  ASP D CA  1 
ATOM   5101  C  C   . ASP D  4 160 ? 81.614  -115.618 -114.208 1.00 108.70 ? 160  ASP D C   1 
ATOM   5102  O  O   . ASP D  4 160 ? 82.729  -115.862 -113.746 1.00 108.74 ? 160  ASP D O   1 
ATOM   5103  C  CB  . ASP D  4 160 ? 80.836  -117.365 -115.819 1.00 111.62 ? 160  ASP D CB  1 
ATOM   5104  C  CG  . ASP D  4 160 ? 79.959  -118.580 -116.060 1.00 112.34 ? 160  ASP D CG  1 
ATOM   5105  O  OD1 . ASP D  4 160 ? 78.722  -118.418 -116.179 1.00 112.66 ? 160  ASP D OD1 1 
ATOM   5106  O  OD2 . ASP D  4 160 ? 80.513  -119.699 -116.126 1.00 112.46 ? 160  ASP D OD2 1 
ATOM   5107  N  N   . THR D  4 161 ? 81.210  -114.395 -114.539 1.00 106.32 ? 161  THR D N   1 
ATOM   5108  C  CA  . THR D  4 161 ? 82.048  -113.220 -114.345 1.00 103.29 ? 161  THR D CA  1 
ATOM   5109  C  C   . THR D  4 161 ? 81.699  -112.669 -112.963 1.00 101.02 ? 161  THR D C   1 
ATOM   5110  O  O   . THR D  4 161 ? 82.560  -112.150 -112.253 1.00 100.78 ? 161  THR D O   1 
ATOM   5111  C  CB  . THR D  4 161 ? 81.772  -112.131 -115.423 1.00 103.17 ? 161  THR D CB  1 
ATOM   5112  O  OG1 . THR D  4 161 ? 80.432  -111.638 -115.286 1.00 102.38 ? 161  THR D OG1 1 
ATOM   5113  C  CG2 . THR D  4 161 ? 81.960  -112.705 -116.825 1.00 102.25 ? 161  THR D CG2 1 
ATOM   5114  N  N   . SER D  4 162 ? 80.430  -112.806 -112.583 1.00 97.82  ? 162  SER D N   1 
ATOM   5115  C  CA  . SER D  4 162 ? 79.962  -112.332 -111.287 1.00 95.07  ? 162  SER D CA  1 
ATOM   5116  C  C   . SER D  4 162 ? 80.547  -113.196 -110.176 1.00 93.35  ? 162  SER D C   1 
ATOM   5117  O  O   . SER D  4 162 ? 80.481  -112.841 -108.999 1.00 92.71  ? 162  SER D O   1 
ATOM   5118  C  CB  . SER D  4 162 ? 78.433  -112.375 -111.227 1.00 94.96  ? 162  SER D CB  1 
ATOM   5119  O  OG  . SER D  4 162 ? 77.951  -111.800 -110.023 1.00 93.86  ? 162  SER D OG  1 
ATOM   5120  N  N   . ALA D  4 163 ? 81.116  -114.334 -110.561 1.00 91.72  ? 163  ALA D N   1 
ATOM   5121  C  CA  . ALA D  4 163 ? 81.729  -115.256 -109.610 1.00 89.74  ? 163  ALA D CA  1 
ATOM   5122  C  C   . ALA D  4 163 ? 83.248  -115.184 -109.758 1.00 88.09  ? 163  ALA D C   1 
ATOM   5123  O  O   . ALA D  4 163 ? 83.994  -115.441 -108.812 1.00 88.18  ? 163  ALA D O   1 
ATOM   5124  C  CB  . ALA D  4 163 ? 81.237  -116.678 -109.861 1.00 89.57  ? 163  ALA D CB  1 
ATOM   5125  N  N   . LEU D  4 164 ? 83.695  -114.834 -110.958 1.00 85.75  ? 164  LEU D N   1 
ATOM   5126  C  CA  . LEU D  4 164 ? 85.114  -114.703 -111.237 1.00 83.85  ? 164  LEU D CA  1 
ATOM   5127  C  C   . LEU D  4 164 ? 85.578  -113.403 -110.597 1.00 82.69  ? 164  LEU D C   1 
ATOM   5128  O  O   . LEU D  4 164 ? 86.568  -113.369 -109.870 1.00 83.02  ? 164  LEU D O   1 
ATOM   5129  C  CB  . LEU D  4 164 ? 85.344  -114.660 -112.749 1.00 84.17  ? 164  LEU D CB  1 
ATOM   5130  C  CG  . LEU D  4 164 ? 86.768  -114.485 -113.285 1.00 84.60  ? 164  LEU D CG  1 
ATOM   5131  C  CD1 . LEU D  4 164 ? 87.250  -113.065 -113.030 1.00 85.45  ? 164  LEU D CD1 1 
ATOM   5132  C  CD2 . LEU D  4 164 ? 87.691  -115.505 -112.635 1.00 84.88  ? 164  LEU D CD2 1 
ATOM   5133  N  N   . VAL D  4 165 ? 84.843  -112.333 -110.875 1.00 80.91  ? 165  VAL D N   1 
ATOM   5134  C  CA  . VAL D  4 165 ? 85.151  -111.011 -110.341 1.00 78.02  ? 165  VAL D CA  1 
ATOM   5135  C  C   . VAL D  4 165 ? 85.293  -111.022 -108.823 1.00 75.99  ? 165  VAL D C   1 
ATOM   5136  O  O   . VAL D  4 165 ? 86.143  -110.328 -108.269 1.00 75.97  ? 165  VAL D O   1 
ATOM   5137  C  CB  . VAL D  4 165 ? 84.059  -109.984 -110.747 1.00 77.35  ? 165  VAL D CB  1 
ATOM   5138  C  CG1 . VAL D  4 165 ? 84.180  -108.725 -109.908 1.00 77.16  ? 165  VAL D CG1 1 
ATOM   5139  C  CG2 . VAL D  4 165 ? 84.201  -109.637 -112.220 1.00 75.95  ? 165  VAL D CG2 1 
ATOM   5140  N  N   . ALA D  4 166 ? 84.466  -111.814 -108.152 1.00 73.69  ? 166  ALA D N   1 
ATOM   5141  C  CA  . ALA D  4 166 ? 84.517  -111.891 -106.699 1.00 71.64  ? 166  ALA D CA  1 
ATOM   5142  C  C   . ALA D  4 166 ? 85.834  -112.501 -106.217 1.00 70.20  ? 166  ALA D C   1 
ATOM   5143  O  O   . ALA D  4 166 ? 85.991  -112.801 -105.032 1.00 69.46  ? 166  ALA D O   1 
ATOM   5144  C  CB  . ALA D  4 166 ? 83.339  -112.705 -106.185 1.00 71.09  ? 166  ALA D CB  1 
ATOM   5145  N  N   . ARG D  4 167 ? 86.778  -112.674 -107.137 1.00 68.67  ? 167  ARG D N   1 
ATOM   5146  C  CA  . ARG D  4 167 ? 88.073  -113.253 -106.802 1.00 67.33  ? 167  ARG D CA  1 
ATOM   5147  C  C   . ARG D  4 167 ? 89.268  -112.483 -107.329 1.00 66.17  ? 167  ARG D C   1 
ATOM   5148  O  O   . ARG D  4 167 ? 90.401  -112.828 -107.017 1.00 67.21  ? 167  ARG D O   1 
ATOM   5149  C  CB  . ARG D  4 167 ? 88.157  -114.696 -107.298 1.00 68.24  ? 167  ARG D CB  1 
ATOM   5150  C  CG  . ARG D  4 167 ? 87.532  -115.689 -106.349 1.00 70.61  ? 167  ARG D CG  1 
ATOM   5151  C  CD  . ARG D  4 167 ? 87.644  -117.124 -106.836 1.00 72.63  ? 167  ARG D CD  1 
ATOM   5152  N  NE  . ARG D  4 167 ? 87.535  -118.050 -105.711 1.00 75.91  ? 167  ARG D NE  1 
ATOM   5153  C  CZ  . ARG D  4 167 ? 86.540  -118.041 -104.827 1.00 77.06  ? 167  ARG D CZ  1 
ATOM   5154  N  NH1 . ARG D  4 167 ? 85.552  -117.156 -104.937 1.00 76.76  ? 167  ARG D NH1 1 
ATOM   5155  N  NH2 . ARG D  4 167 ? 86.548  -118.897 -103.811 1.00 77.41  ? 167  ARG D NH2 1 
ATOM   5156  N  N   . LEU D  4 168 ? 89.033  -111.460 -108.143 1.00 64.16  ? 168  LEU D N   1 
ATOM   5157  C  CA  . LEU D  4 168 ? 90.140  -110.667 -108.669 1.00 61.83  ? 168  LEU D CA  1 
ATOM   5158  C  C   . LEU D  4 168 ? 90.512  -109.669 -107.584 1.00 60.90  ? 168  LEU D C   1 
ATOM   5159  O  O   . LEU D  4 168 ? 89.684  -109.341 -106.733 1.00 60.99  ? 168  LEU D O   1 
ATOM   5160  C  CB  . LEU D  4 168 ? 89.726  -109.906 -109.935 1.00 61.07  ? 168  LEU D CB  1 
ATOM   5161  C  CG  . LEU D  4 168 ? 89.458  -110.650 -111.242 1.00 59.78  ? 168  LEU D CG  1 
ATOM   5162  C  CD1 . LEU D  4 168 ? 89.020  -109.652 -112.292 1.00 59.43  ? 168  LEU D CD1 1 
ATOM   5163  C  CD2 . LEU D  4 168 ? 90.706  -111.361 -111.701 1.00 59.02  ? 168  LEU D CD2 1 
ATOM   5164  N  N   . ASP D  4 169 ? 91.748  -109.188 -107.598 1.00 59.11  ? 169  ASP D N   1 
ATOM   5165  C  CA  . ASP D  4 169 ? 92.147  -108.223 -106.594 1.00 57.95  ? 169  ASP D CA  1 
ATOM   5166  C  C   . ASP D  4 169 ? 91.802  -106.848 -107.139 1.00 58.05  ? 169  ASP D C   1 
ATOM   5167  O  O   . ASP D  4 169 ? 91.247  -106.732 -108.225 1.00 58.57  ? 169  ASP D O   1 
ATOM   5168  C  CB  . ASP D  4 169 ? 93.643  -108.340 -106.289 1.00 57.41  ? 169  ASP D CB  1 
ATOM   5169  C  CG  . ASP D  4 169 ? 94.480  -107.383 -107.096 1.00 57.53  ? 169  ASP D CG  1 
ATOM   5170  O  OD1 . ASP D  4 169 ? 94.362  -107.406 -108.338 1.00 59.06  ? 169  ASP D OD1 1 
ATOM   5171  O  OD2 . ASP D  4 169 ? 95.257  -106.610 -106.488 1.00 55.85  ? 169  ASP D OD2 1 
ATOM   5172  N  N   . GLU D  4 170 ? 92.139  -105.809 -106.390 1.00 58.23  ? 170  GLU D N   1 
ATOM   5173  C  CA  . GLU D  4 170 ? 91.839  -104.441 -106.777 1.00 57.65  ? 170  GLU D CA  1 
ATOM   5174  C  C   . GLU D  4 170 ? 92.432  -103.924 -108.078 1.00 60.80  ? 170  GLU D C   1 
ATOM   5175  O  O   . GLU D  4 170 ? 91.867  -103.016 -108.679 1.00 62.22  ? 170  GLU D O   1 
ATOM   5176  C  CB  . GLU D  4 170 ? 92.237  -103.498 -105.654 1.00 54.46  ? 170  GLU D CB  1 
ATOM   5177  C  CG  . GLU D  4 170 ? 91.457  -103.713 -104.378 1.00 51.99  ? 170  GLU D CG  1 
ATOM   5178  C  CD  . GLU D  4 170 ? 89.973  -103.528 -104.570 1.00 50.19  ? 170  GLU D CD  1 
ATOM   5179  O  OE1 . GLU D  4 170 ? 89.307  -104.454 -105.080 1.00 50.16  ? 170  GLU D OE1 1 
ATOM   5180  O  OE2 . GLU D  4 170 ? 89.478  -102.445 -104.217 1.00 48.23  ? 170  GLU D OE2 1 
HETATM 5181  N  N   . MSE D  4 171 ? 93.563  -104.465 -108.518 1.00 63.69  ? 171  MSE D N   1 
HETATM 5182  C  CA  . MSE D  4 171 ? 94.156  -103.982 -109.762 1.00 67.28  ? 171  MSE D CA  1 
HETATM 5183  C  C   . MSE D  4 171 ? 93.605  -104.778 -110.934 1.00 65.77  ? 171  MSE D C   1 
HETATM 5184  O  O   . MSE D  4 171 ? 93.685  -104.350 -112.082 1.00 65.97  ? 171  MSE D O   1 
HETATM 5185  C  CB  . MSE D  4 171 ? 95.687  -104.089 -109.728 1.00 74.45  ? 171  MSE D CB  1 
HETATM 5186  C  CG  . MSE D  4 171 ? 96.250  -105.446 -110.142 1.00 83.81  ? 171  MSE D CG  1 
HETATM 5187  SE SE  . MSE D  4 171 ? 97.481  -105.332 -111.647 1.00 95.71  ? 171  MSE D SE  1 
HETATM 5188  C  CE  . MSE D  4 171 ? 96.222  -105.686 -113.073 1.00 92.26  ? 171  MSE D CE  1 
ATOM   5189  N  N   . GLU D  4 172 ? 93.050  -105.943 -110.631 1.00 63.43  ? 172  GLU D N   1 
ATOM   5190  C  CA  . GLU D  4 172 ? 92.462  -106.796 -111.648 1.00 61.57  ? 172  GLU D CA  1 
ATOM   5191  C  C   . GLU D  4 172 ? 91.036  -106.329 -111.893 1.00 60.08  ? 172  GLU D C   1 
ATOM   5192  O  O   . GLU D  4 172 ? 90.604  -106.200 -113.036 1.00 59.79  ? 172  GLU D O   1 
ATOM   5193  C  CB  . GLU D  4 172 ? 92.485  -108.251 -111.179 1.00 62.67  ? 172  GLU D CB  1 
ATOM   5194  C  CG  . GLU D  4 172 ? 93.853  -108.908 -111.318 1.00 63.43  ? 172  GLU D CG  1 
ATOM   5195  C  CD  . GLU D  4 172 ? 93.964  -110.181 -110.516 1.00 64.39  ? 172  GLU D CD  1 
ATOM   5196  O  OE1 . GLU D  4 172 ? 94.922  -110.953 -110.749 1.00 65.37  ? 172  GLU D OE1 1 
ATOM   5197  O  OE2 . GLU D  4 172 ? 93.096  -110.398 -109.645 1.00 64.42  ? 172  GLU D OE2 1 
ATOM   5198  N  N   . ARG D  4 173 ? 90.309  -106.073 -110.809 1.00 57.96  ? 173  ARG D N   1 
ATOM   5199  C  CA  . ARG D  4 173 ? 88.945  -105.584 -110.909 1.00 55.97  ? 173  ARG D CA  1 
ATOM   5200  C  C   . ARG D  4 173 ? 89.001  -104.330 -111.791 1.00 56.35  ? 173  ARG D C   1 
ATOM   5201  O  O   . ARG D  4 173 ? 88.029  -103.970 -112.457 1.00 55.74  ? 173  ARG D O   1 
ATOM   5202  C  CB  . ARG D  4 173 ? 88.399  -105.268 -109.505 1.00 54.30  ? 173  ARG D CB  1 
ATOM   5203  C  CG  . ARG D  4 173 ? 87.798  -106.486 -108.761 1.00 52.80  ? 173  ARG D CG  1 
ATOM   5204  C  CD  . ARG D  4 173 ? 87.994  -106.408 -107.238 1.00 51.02  ? 173  ARG D CD  1 
ATOM   5205  N  NE  . ARG D  4 173 ? 86.762  -106.275 -106.448 1.00 48.82  ? 173  ARG D NE  1 
ATOM   5206  C  CZ  . ARG D  4 173 ? 86.048  -107.290 -105.957 1.00 47.21  ? 173  ARG D CZ  1 
ATOM   5207  N  NH1 . ARG D  4 173 ? 86.415  -108.545 -106.168 1.00 45.86  ? 173  ARG D NH1 1 
ATOM   5208  N  NH2 . ARG D  4 173 ? 84.980  -107.050 -105.211 1.00 45.67  ? 173  ARG D NH2 1 
ATOM   5209  N  N   . GLY D  4 174 ? 90.167  -103.690 -111.804 1.00 56.43  ? 174  GLY D N   1 
ATOM   5210  C  CA  . GLY D  4 174 ? 90.375  -102.501 -112.609 1.00 56.60  ? 174  GLY D CA  1 
ATOM   5211  C  C   . GLY D  4 174 ? 90.544  -102.868 -114.069 1.00 57.80  ? 174  GLY D C   1 
ATOM   5212  O  O   . GLY D  4 174 ? 89.927  -102.256 -114.938 1.00 58.51  ? 174  GLY D O   1 
ATOM   5213  N  N   . LEU D  4 175 ? 91.392  -103.855 -114.348 1.00 58.64  ? 175  LEU D N   1 
ATOM   5214  C  CA  . LEU D  4 175 ? 91.598  -104.311 -115.718 1.00 59.05  ? 175  LEU D CA  1 
ATOM   5215  C  C   . LEU D  4 175 ? 90.227  -104.710 -116.220 1.00 60.37  ? 175  LEU D C   1 
ATOM   5216  O  O   . LEU D  4 175 ? 89.825  -104.353 -117.323 1.00 60.84  ? 175  LEU D O   1 
ATOM   5217  C  CB  . LEU D  4 175 ? 92.493  -105.547 -115.760 1.00 58.29  ? 175  LEU D CB  1 
ATOM   5218  C  CG  . LEU D  4 175 ? 93.906  -105.417 -116.317 1.00 59.04  ? 175  LEU D CG  1 
ATOM   5219  C  CD1 . LEU D  4 175 ? 94.477  -106.814 -116.502 1.00 58.14  ? 175  LEU D CD1 1 
ATOM   5220  C  CD2 . LEU D  4 175 ? 93.890  -104.672 -117.645 1.00 59.01  ? 175  LEU D CD2 1 
ATOM   5221  N  N   . PHE D  4 176 ? 89.519  -105.461 -115.381 1.00 61.18  ? 176  PHE D N   1 
ATOM   5222  C  CA  . PHE D  4 176 ? 88.183  -105.940 -115.687 1.00 61.88  ? 176  PHE D CA  1 
ATOM   5223  C  C   . PHE D  4 176 ? 87.307  -104.817 -116.212 1.00 63.86  ? 176  PHE D C   1 
ATOM   5224  O  O   . PHE D  4 176 ? 86.727  -104.935 -117.286 1.00 65.02  ? 176  PHE D O   1 
ATOM   5225  C  CB  . PHE D  4 176 ? 87.540  -106.525 -114.441 1.00 61.32  ? 176  PHE D CB  1 
ATOM   5226  C  CG  . PHE D  4 176 ? 86.183  -107.095 -114.682 1.00 60.60  ? 176  PHE D CG  1 
ATOM   5227  C  CD1 . PHE D  4 176 ? 86.037  -108.329 -115.294 1.00 60.31  ? 176  PHE D CD1 1 
ATOM   5228  C  CD2 . PHE D  4 176 ? 85.047  -106.385 -114.321 1.00 60.84  ? 176  PHE D CD2 1 
ATOM   5229  C  CE1 . PHE D  4 176 ? 84.778  -108.848 -115.544 1.00 60.69  ? 176  PHE D CE1 1 
ATOM   5230  C  CE2 . PHE D  4 176 ? 83.780  -106.896 -114.567 1.00 61.07  ? 176  PHE D CE2 1 
ATOM   5231  C  CZ  . PHE D  4 176 ? 83.645  -108.130 -115.179 1.00 61.22  ? 176  PHE D CZ  1 
ATOM   5232  N  N   . GLN D  4 177 ? 87.205  -103.731 -115.453 1.00 65.59  ? 177  GLN D N   1 
ATOM   5233  C  CA  . GLN D  4 177 ? 86.389  -102.593 -115.872 1.00 67.09  ? 177  GLN D CA  1 
ATOM   5234  C  C   . GLN D  4 177 ? 86.815  -102.071 -117.245 1.00 67.26  ? 177  GLN D C   1 
ATOM   5235  O  O   . GLN D  4 177 ? 86.005  -101.991 -118.158 1.00 67.60  ? 177  GLN D O   1 
ATOM   5236  C  CB  . GLN D  4 177 ? 86.473  -101.458 -114.844 1.00 68.08  ? 177  GLN D CB  1 
ATOM   5237  C  CG  . GLN D  4 177 ? 85.886  -101.797 -113.478 1.00 71.33  ? 177  GLN D CG  1 
ATOM   5238  C  CD  . GLN D  4 177 ? 85.865  -100.603 -112.523 1.00 72.78  ? 177  GLN D CD  1 
ATOM   5239  O  OE1 . GLN D  4 177 ? 85.178  -99.609  -112.770 1.00 73.11  ? 177  GLN D OE1 1 
ATOM   5240  N  NE2 . GLN D  4 177 ? 86.617  -100.702 -111.425 1.00 72.62  ? 177  GLN D NE2 1 
ATOM   5241  N  N   . THR D  4 178 ? 88.088  -101.724 -117.386 1.00 67.38  ? 178  THR D N   1 
ATOM   5242  C  CA  . THR D  4 178 ? 88.609  -101.206 -118.646 1.00 67.63  ? 178  THR D CA  1 
ATOM   5243  C  C   . THR D  4 178 ? 88.217  -102.056 -119.849 1.00 67.86  ? 178  THR D C   1 
ATOM   5244  O  O   . THR D  4 178 ? 87.745  -101.536 -120.857 1.00 67.69  ? 178  THR D O   1 
ATOM   5245  C  CB  . THR D  4 178 ? 90.141  -101.089 -118.591 1.00 67.68  ? 178  THR D CB  1 
ATOM   5246  O  OG1 . THR D  4 178 ? 90.500  -100.163 -117.562 1.00 68.90  ? 178  THR D OG1 1 
ATOM   5247  C  CG2 . THR D  4 178 ? 90.699  -100.599 -119.918 1.00 67.15  ? 178  THR D CG2 1 
ATOM   5248  N  N   . GLY D  4 179 ? 88.422  -103.361 -119.752 1.00 68.71  ? 179  GLY D N   1 
ATOM   5249  C  CA  . GLY D  4 179 ? 88.063  -104.227 -120.856 1.00 70.69  ? 179  GLY D CA  1 
ATOM   5250  C  C   . GLY D  4 179 ? 86.556  -104.267 -121.020 1.00 72.09  ? 179  GLY D C   1 
ATOM   5251  O  O   . GLY D  4 179 ? 86.036  -104.514 -122.108 1.00 73.16  ? 179  GLY D O   1 
ATOM   5252  N  N   . GLN D  4 180 ? 85.859  -104.017 -119.920 1.00 72.40  ? 180  GLN D N   1 
ATOM   5253  C  CA  . GLN D  4 180 ? 84.404  -104.011 -119.880 1.00 72.25  ? 180  GLN D CA  1 
ATOM   5254  C  C   . GLN D  4 180 ? 83.883  -102.689 -120.438 1.00 72.40  ? 180  GLN D C   1 
ATOM   5255  O  O   . GLN D  4 180 ? 82.700  -102.546 -120.723 1.00 73.22  ? 180  GLN D O   1 
ATOM   5256  C  CB  . GLN D  4 180 ? 83.955  -104.177 -118.429 1.00 73.20  ? 180  GLN D CB  1 
ATOM   5257  C  CG  . GLN D  4 180 ? 82.465  -104.179 -118.209 1.00 75.65  ? 180  GLN D CG  1 
ATOM   5258  C  CD  . GLN D  4 180 ? 81.824  -105.462 -118.658 1.00 76.63  ? 180  GLN D CD  1 
ATOM   5259  O  OE1 . GLN D  4 180 ? 80.615  -105.637 -118.535 1.00 78.40  ? 180  GLN D OE1 1 
ATOM   5260  N  NE2 . GLN D  4 180 ? 82.632  -106.375 -119.183 1.00 77.90  ? 180  GLN D NE2 1 
ATOM   5261  N  N   . LYS D  4 181 ? 84.785  -101.728 -120.592 1.00 72.62  ? 181  LYS D N   1 
ATOM   5262  C  CA  . LYS D  4 181 ? 84.459  -100.392 -121.088 1.00 72.52  ? 181  LYS D CA  1 
ATOM   5263  C  C   . LYS D  4 181 ? 84.476  -100.346 -122.610 1.00 72.04  ? 181  LYS D C   1 
ATOM   5264  O  O   . LYS D  4 181 ? 83.550  -99.829  -123.234 1.00 71.82  ? 181  LYS D O   1 
ATOM   5265  C  CB  . LYS D  4 181 ? 85.471  -99.393  -120.512 1.00 73.83  ? 181  LYS D CB  1 
ATOM   5266  C  CG  . LYS D  4 181 ? 85.419  -97.982  -121.053 1.00 74.88  ? 181  LYS D CG  1 
ATOM   5267  C  CD  . LYS D  4 181 ? 86.631  -97.202  -120.547 1.00 77.27  ? 181  LYS D CD  1 
ATOM   5268  C  CE  . LYS D  4 181 ? 86.623  -95.747  -121.011 1.00 79.50  ? 181  LYS D CE  1 
ATOM   5269  N  NZ  . LYS D  4 181 ? 87.774  -94.958  -120.464 1.00 79.45  ? 181  LYS D NZ  1 
ATOM   5270  N  N   . GLY D  4 182 ? 85.536  -100.883 -123.203 1.00 71.57  ? 182  GLY D N   1 
ATOM   5271  C  CA  . GLY D  4 182 ? 85.642  -100.899 -124.649 1.00 71.93  ? 182  GLY D CA  1 
ATOM   5272  C  C   . GLY D  4 182 ? 84.611  -101.833 -125.247 1.00 72.37  ? 182  GLY D C   1 
ATOM   5273  O  O   . GLY D  4 182 ? 84.087  -101.591 -126.326 1.00 72.24  ? 182  GLY D O   1 
ATOM   5274  N  N   . LEU D  4 183 ? 84.317  -102.912 -124.536 1.00 73.08  ? 183  LEU D N   1 
ATOM   5275  C  CA  . LEU D  4 183 ? 83.335  -103.874 -125.000 1.00 73.68  ? 183  LEU D CA  1 
ATOM   5276  C  C   . LEU D  4 183 ? 81.961  -103.226 -124.904 1.00 74.35  ? 183  LEU D C   1 
ATOM   5277  O  O   . LEU D  4 183 ? 81.006  -103.703 -125.502 1.00 75.57  ? 183  LEU D O   1 
ATOM   5278  C  CB  . LEU D  4 183 ? 83.386  -105.136 -124.133 1.00 73.60  ? 183  LEU D CB  1 
ATOM   5279  C  CG  . LEU D  4 183 ? 82.920  -106.478 -124.715 1.00 73.09  ? 183  LEU D CG  1 
ATOM   5280  C  CD1 . LEU D  4 183 ? 81.428  -106.458 -124.982 1.00 71.87  ? 183  LEU D CD1 1 
ATOM   5281  C  CD2 . LEU D  4 183 ? 83.705  -106.772 -125.987 1.00 72.19  ? 183  LEU D CD2 1 
ATOM   5282  N  N   . ASN D  4 184 ? 81.861  -102.141 -124.143 1.00 75.40  ? 184  ASN D N   1 
ATOM   5283  C  CA  . ASN D  4 184 ? 80.590  -101.437 -123.999 1.00 76.90  ? 184  ASN D CA  1 
ATOM   5284  C  C   . ASN D  4 184 ? 80.598  -100.108 -124.730 1.00 77.13  ? 184  ASN D C   1 
ATOM   5285  O  O   . ASN D  4 184 ? 79.612  -99.380  -124.708 1.00 77.27  ? 184  ASN D O   1 
ATOM   5286  C  CB  . ASN D  4 184 ? 80.238  -101.202 -122.527 1.00 78.27  ? 184  ASN D CB  1 
ATOM   5287  C  CG  . ASN D  4 184 ? 79.548  -102.399 -121.893 1.00 80.67  ? 184  ASN D CG  1 
ATOM   5288  O  OD1 . ASN D  4 184 ? 78.831  -103.142 -122.571 1.00 80.52  ? 184  ASN D OD1 1 
ATOM   5289  N  ND2 . ASN D  4 184 ? 79.743  -102.582 -120.585 1.00 81.45  ? 184  ASN D ND2 1 
ATOM   5290  N  N   . ASP D  4 185 ? 81.719  -99.784  -125.361 1.00 77.25  ? 185  ASP D N   1 
ATOM   5291  C  CA  . ASP D  4 185 ? 81.824  -98.550  -126.125 1.00 77.50  ? 185  ASP D CA  1 
ATOM   5292  C  C   . ASP D  4 185 ? 81.522  -98.924  -127.566 1.00 76.92  ? 185  ASP D C   1 
ATOM   5293  O  O   . ASP D  4 185 ? 80.865  -98.185  -128.299 1.00 76.72  ? 185  ASP D O   1 
ATOM   5294  C  CB  . ASP D  4 185 ? 83.237  -97.970  -126.029 1.00 79.28  ? 185  ASP D CB  1 
ATOM   5295  C  CG  . ASP D  4 185 ? 83.466  -96.819  -127.003 1.00 81.27  ? 185  ASP D CG  1 
ATOM   5296  O  OD1 . ASP D  4 185 ? 82.674  -95.849  -126.985 1.00 82.95  ? 185  ASP D OD1 1 
ATOM   5297  O  OD2 . ASP D  4 185 ? 84.441  -96.883  -127.785 1.00 80.47  ? 185  ASP D OD2 1 
ATOM   5298  N  N   . PHE D  4 186 ? 82.007  -100.096 -127.950 1.00 76.36  ? 186  PHE D N   1 
ATOM   5299  C  CA  . PHE D  4 186 ? 81.823  -100.624 -129.289 1.00 75.71  ? 186  PHE D CA  1 
ATOM   5300  C  C   . PHE D  4 186 ? 80.413  -101.162 -129.467 1.00 75.77  ? 186  PHE D C   1 
ATOM   5301  O  O   . PHE D  4 186 ? 79.869  -101.141 -130.567 1.00 75.70  ? 186  PHE D O   1 
ATOM   5302  C  CB  . PHE D  4 186 ? 82.855  -101.720 -129.543 1.00 74.91  ? 186  PHE D CB  1 
ATOM   5303  C  CG  . PHE D  4 186 ? 82.612  -102.510 -130.788 1.00 75.09  ? 186  PHE D CG  1 
ATOM   5304  C  CD1 . PHE D  4 186 ? 81.946  -103.730 -130.732 1.00 74.81  ? 186  PHE D CD1 1 
ATOM   5305  C  CD2 . PHE D  4 186 ? 83.067  -102.048 -132.018 1.00 75.37  ? 186  PHE D CD2 1 
ATOM   5306  C  CE1 . PHE D  4 186 ? 81.740  -104.483 -131.887 1.00 74.46  ? 186  PHE D CE1 1 
ATOM   5307  C  CE2 . PHE D  4 186 ? 82.867  -102.789 -133.179 1.00 74.66  ? 186  PHE D CE2 1 
ATOM   5308  C  CZ  . PHE D  4 186 ? 82.203  -104.011 -133.112 1.00 75.06  ? 186  PHE D CZ  1 
ATOM   5309  N  N   . GLN D  4 187 ? 79.817  -101.641 -128.385 1.00 75.99  ? 187  GLN D N   1 
ATOM   5310  C  CA  . GLN D  4 187 ? 78.466  -102.165 -128.469 1.00 77.59  ? 187  GLN D CA  1 
ATOM   5311  C  C   . GLN D  4 187 ? 77.470  -101.025 -128.453 1.00 78.77  ? 187  GLN D C   1 
ATOM   5312  O  O   . GLN D  4 187 ? 76.316  -101.186 -128.840 1.00 78.25  ? 187  GLN D O   1 
ATOM   5313  C  CB  . GLN D  4 187 ? 78.189  -103.119 -127.312 1.00 77.45  ? 187  GLN D CB  1 
ATOM   5314  C  CG  . GLN D  4 187 ? 78.892  -104.454 -127.453 1.00 77.62  ? 187  GLN D CG  1 
ATOM   5315  C  CD  . GLN D  4 187 ? 78.461  -105.444 -126.396 1.00 77.85  ? 187  GLN D CD  1 
ATOM   5316  O  OE1 . GLN D  4 187 ? 78.865  -106.606 -126.419 1.00 78.43  ? 187  GLN D OE1 1 
ATOM   5317  N  NE2 . GLN D  4 187 ? 77.633  -104.989 -125.458 1.00 77.40  ? 187  GLN D NE2 1 
ATOM   5318  N  N   . CYS D  4 188 ? 77.930  -99.867  -127.994 1.00 80.82  ? 188  CYS D N   1 
ATOM   5319  C  CA  . CYS D  4 188 ? 77.097  -98.675  -127.931 1.00 82.46  ? 188  CYS D CA  1 
ATOM   5320  C  C   . CYS D  4 188 ? 77.312  -97.920  -129.236 1.00 82.98  ? 188  CYS D C   1 
ATOM   5321  O  O   . CYS D  4 188 ? 76.869  -96.782  -129.403 1.00 83.67  ? 188  CYS D O   1 
ATOM   5322  C  CB  . CYS D  4 188 ? 77.510  -97.806  -126.739 1.00 82.98  ? 188  CYS D CB  1 
ATOM   5323  S  SG  . CYS D  4 188 ? 76.587  -96.257  -126.545 1.00 85.80  ? 188  CYS D SG  1 
ATOM   5324  N  N   . TRP D  4 189 ? 78.005  -98.578  -130.158 1.00 83.32  ? 189  TRP D N   1 
ATOM   5325  C  CA  . TRP D  4 189 ? 78.301  -98.014  -131.464 1.00 83.79  ? 189  TRP D CA  1 
ATOM   5326  C  C   . TRP D  4 189 ? 77.718  -98.929  -132.528 1.00 85.25  ? 189  TRP D C   1 
ATOM   5327  O  O   . TRP D  4 189 ? 77.135  -98.468  -133.508 1.00 85.02  ? 189  TRP D O   1 
ATOM   5328  C  CB  . TRP D  4 189 ? 79.809  -97.906  -131.655 1.00 82.20  ? 189  TRP D CB  1 
ATOM   5329  C  CG  . TRP D  4 189 ? 80.194  -97.426  -133.007 1.00 82.09  ? 189  TRP D CG  1 
ATOM   5330  C  CD1 . TRP D  4 189 ? 80.223  -96.135  -133.444 1.00 82.15  ? 189  TRP D CD1 1 
ATOM   5331  C  CD2 . TRP D  4 189 ? 80.594  -98.235  -134.117 1.00 82.02  ? 189  TRP D CD2 1 
ATOM   5332  N  NE1 . TRP D  4 189 ? 80.620  -96.087  -134.758 1.00 81.80  ? 189  TRP D NE1 1 
ATOM   5333  C  CE2 . TRP D  4 189 ? 80.854  -97.364  -135.196 1.00 81.96  ? 189  TRP D CE2 1 
ATOM   5334  C  CE3 . TRP D  4 189 ? 80.759  -99.614  -134.303 1.00 81.42  ? 189  TRP D CE3 1 
ATOM   5335  C  CZ2 . TRP D  4 189 ? 81.270  -97.824  -136.445 1.00 82.13  ? 189  TRP D CZ2 1 
ATOM   5336  C  CZ3 . TRP D  4 189 ? 81.172  -100.072 -135.543 1.00 81.82  ? 189  TRP D CZ3 1 
ATOM   5337  C  CH2 . TRP D  4 189 ? 81.423  -99.178  -136.600 1.00 82.61  ? 189  TRP D CH2 1 
ATOM   5338  N  N   . GLU D  4 190 ? 77.883  -100.232 -132.322 1.00 87.64  ? 190  GLU D N   1 
ATOM   5339  C  CA  . GLU D  4 190 ? 77.378  -101.240 -133.248 1.00 89.96  ? 190  GLU D CA  1 
ATOM   5340  C  C   . GLU D  4 190 ? 75.860  -101.136 -133.342 1.00 90.82  ? 190  GLU D C   1 
ATOM   5341  O  O   . GLU D  4 190 ? 75.241  -101.685 -134.253 1.00 90.56  ? 190  GLU D O   1 
ATOM   5342  C  CB  . GLU D  4 190 ? 77.799  -102.644 -132.777 1.00 91.14  ? 190  GLU D CB  1 
ATOM   5343  C  CG  . GLU D  4 190 ? 77.279  -103.796 -133.645 1.00 94.05  ? 190  GLU D CG  1 
ATOM   5344  C  CD  . GLU D  4 190 ? 78.164  -105.041 -133.591 1.00 95.39  ? 190  GLU D CD  1 
ATOM   5345  O  OE1 . GLU D  4 190 ? 79.317  -104.976 -134.070 1.00 96.21  ? 190  GLU D OE1 1 
ATOM   5346  O  OE2 . GLU D  4 190 ? 77.711  -106.087 -133.075 1.00 96.22  ? 190  GLU D OE2 1 
ATOM   5347  N  N   . LYS D  4 191 ? 75.271  -100.416 -132.394 1.00 92.31  ? 191  LYS D N   1 
ATOM   5348  C  CA  . LYS D  4 191 ? 73.830  -100.216 -132.354 1.00 93.99  ? 191  LYS D CA  1 
ATOM   5349  C  C   . LYS D  4 191 ? 73.473  -98.968  -133.154 1.00 95.25  ? 191  LYS D C   1 
ATOM   5350  O  O   . LYS D  4 191 ? 74.301  -98.443  -133.902 1.00 95.40  ? 191  LYS D O   1 
ATOM   5351  C  CB  . LYS D  4 191 ? 73.366  -100.060 -130.902 1.00 94.83  ? 191  LYS D CB  1 
ATOM   5352  C  CG  . LYS D  4 191 ? 74.017  -98.889  -130.164 1.00 96.12  ? 191  LYS D CG  1 
ATOM   5353  C  CD  . LYS D  4 191 ? 73.767  -98.927  -128.649 1.00 96.39  ? 191  LYS D CD  1 
ATOM   5354  C  CE  . LYS D  4 191 ? 72.310  -98.662  -128.275 1.00 95.62  ? 191  LYS D CE  1 
ATOM   5355  N  NZ  . LYS D  4 191 ? 72.132  -98.567  -126.794 1.00 93.92  ? 191  LYS D NZ  1 
ATOM   5356  N  N   . GLY D  4 192 ? 72.241  -98.494  -132.991 1.00 96.36  ? 192  GLY D N   1 
ATOM   5357  C  CA  . GLY D  4 192 ? 71.802  -97.312  -133.710 1.00 97.36  ? 192  GLY D CA  1 
ATOM   5358  C  C   . GLY D  4 192 ? 72.195  -96.017  -133.024 1.00 97.94  ? 192  GLY D C   1 
ATOM   5359  O  O   . GLY D  4 192 ? 72.992  -95.253  -133.613 1.00 98.07  ? 192  GLY D O   1 
ATOM   5360  N  N   . VAL E  1 10  ? 30.101  -96.149  -113.348 1.00 77.84  ? 20   VAL E N   1 
ATOM   5361  C  CA  . VAL E  1 10  ? 31.397  -95.513  -113.722 1.00 78.80  ? 20   VAL E CA  1 
ATOM   5362  C  C   . VAL E  1 10  ? 31.169  -94.068  -114.162 1.00 78.24  ? 20   VAL E C   1 
ATOM   5363  O  O   . VAL E  1 10  ? 30.039  -93.661  -114.436 1.00 78.22  ? 20   VAL E O   1 
ATOM   5364  C  CB  . VAL E  1 10  ? 32.108  -96.312  -114.857 1.00 79.48  ? 20   VAL E CB  1 
ATOM   5365  C  CG1 . VAL E  1 10  ? 33.325  -95.545  -115.377 1.00 79.91  ? 20   VAL E CG1 1 
ATOM   5366  C  CG2 . VAL E  1 10  ? 32.551  -97.676  -114.330 1.00 79.23  ? 20   VAL E CG2 1 
ATOM   5367  N  N   . LEU E  1 11  ? 32.251  -93.300  -114.225 1.00 77.40  ? 21   LEU E N   1 
ATOM   5368  C  CA  . LEU E  1 11  ? 32.186  -91.895  -114.601 1.00 76.45  ? 21   LEU E CA  1 
ATOM   5369  C  C   . LEU E  1 11  ? 32.791  -91.575  -115.977 1.00 74.64  ? 21   LEU E C   1 
ATOM   5370  O  O   . LEU E  1 11  ? 33.191  -92.478  -116.719 1.00 75.02  ? 21   LEU E O   1 
ATOM   5371  C  CB  . LEU E  1 11  ? 32.868  -91.053  -113.513 1.00 76.72  ? 21   LEU E CB  1 
ATOM   5372  C  CG  . LEU E  1 11  ? 34.169  -91.617  -112.927 1.00 76.42  ? 21   LEU E CG  1 
ATOM   5373  C  CD1 . LEU E  1 11  ? 34.916  -90.522  -112.199 1.00 75.55  ? 21   LEU E CD1 1 
ATOM   5374  C  CD2 . LEU E  1 11  ? 33.861  -92.780  -111.991 1.00 75.84  ? 21   LEU E CD2 1 
ATOM   5375  N  N   . THR E  1 12  ? 32.836  -90.281  -116.302 1.00 71.25  ? 22   THR E N   1 
ATOM   5376  C  CA  . THR E  1 12  ? 33.376  -89.778  -117.566 1.00 68.03  ? 22   THR E CA  1 
ATOM   5377  C  C   . THR E  1 12  ? 34.885  -89.548  -117.472 1.00 65.54  ? 22   THR E C   1 
ATOM   5378  O  O   . THR E  1 12  ? 35.421  -89.420  -116.378 1.00 65.92  ? 22   THR E O   1 
ATOM   5379  C  CB  . THR E  1 12  ? 32.691  -88.451  -117.950 1.00 68.03  ? 22   THR E CB  1 
ATOM   5380  O  OG1 . THR E  1 12  ? 33.615  -87.616  -118.662 1.00 68.48  ? 22   THR E OG1 1 
ATOM   5381  C  CG2 . THR E  1 12  ? 32.212  -87.728  -116.707 1.00 68.35  ? 22   THR E CG2 1 
ATOM   5382  N  N   . PRO E  1 13  ? 35.589  -89.492  -118.620 1.00 63.19  ? 23   PRO E N   1 
ATOM   5383  C  CA  . PRO E  1 13  ? 37.042  -89.278  -118.663 1.00 61.86  ? 23   PRO E CA  1 
ATOM   5384  C  C   . PRO E  1 13  ? 37.586  -88.023  -117.960 1.00 60.52  ? 23   PRO E C   1 
ATOM   5385  O  O   . PRO E  1 13  ? 38.629  -88.073  -117.313 1.00 59.39  ? 23   PRO E O   1 
ATOM   5386  C  CB  . PRO E  1 13  ? 37.339  -89.280  -120.162 1.00 61.05  ? 23   PRO E CB  1 
ATOM   5387  C  CG  . PRO E  1 13  ? 36.359  -90.255  -120.678 1.00 60.72  ? 23   PRO E CG  1 
ATOM   5388  C  CD  . PRO E  1 13  ? 35.090  -89.846  -119.959 1.00 61.75  ? 23   PRO E CD  1 
ATOM   5389  N  N   . ALA E  1 14  ? 36.891  -86.900  -118.094 1.00 59.81  ? 24   ALA E N   1 
ATOM   5390  C  CA  . ALA E  1 14  ? 37.334  -85.664  -117.458 1.00 58.92  ? 24   ALA E CA  1 
ATOM   5391  C  C   . ALA E  1 14  ? 37.359  -85.829  -115.943 1.00 58.44  ? 24   ALA E C   1 
ATOM   5392  O  O   . ALA E  1 14  ? 38.258  -85.344  -115.256 1.00 58.90  ? 24   ALA E O   1 
ATOM   5393  C  CB  . ALA E  1 14  ? 36.407  -84.522  -117.832 1.00 58.71  ? 24   ALA E CB  1 
ATOM   5394  N  N   . GLU E  1 15  ? 36.356  -86.513  -115.422 1.00 56.79  ? 25   GLU E N   1 
ATOM   5395  C  CA  . GLU E  1 15  ? 36.271  -86.732  -113.999 1.00 55.71  ? 25   GLU E CA  1 
ATOM   5396  C  C   . GLU E  1 15  ? 37.253  -87.819  -113.568 1.00 55.55  ? 25   GLU E C   1 
ATOM   5397  O  O   . GLU E  1 15  ? 37.689  -87.845  -112.420 1.00 56.43  ? 25   GLU E O   1 
ATOM   5398  C  CB  . GLU E  1 15  ? 34.844  -87.116  -113.631 1.00 55.60  ? 25   GLU E CB  1 
ATOM   5399  C  CG  . GLU E  1 15  ? 34.607  -87.294  -112.156 1.00 57.86  ? 25   GLU E CG  1 
ATOM   5400  C  CD  . GLU E  1 15  ? 33.157  -87.574  -111.852 1.00 60.07  ? 25   GLU E CD  1 
ATOM   5401  O  OE1 . GLU E  1 15  ? 32.496  -88.218  -112.699 1.00 61.18  ? 25   GLU E OE1 1 
ATOM   5402  O  OE2 . GLU E  1 15  ? 32.683  -87.162  -110.768 1.00 60.41  ? 25   GLU E OE2 1 
ATOM   5403  N  N   . LEU E  1 16  ? 37.614  -88.708  -114.489 1.00 54.50  ? 26   LEU E N   1 
ATOM   5404  C  CA  . LEU E  1 16  ? 38.544  -89.786  -114.173 1.00 52.71  ? 26   LEU E CA  1 
ATOM   5405  C  C   . LEU E  1 16  ? 39.928  -89.229  -113.909 1.00 51.86  ? 26   LEU E C   1 
ATOM   5406  O  O   . LEU E  1 16  ? 40.584  -89.606  -112.951 1.00 52.58  ? 26   LEU E O   1 
ATOM   5407  C  CB  . LEU E  1 16  ? 38.636  -90.790  -115.320 1.00 52.47  ? 26   LEU E CB  1 
ATOM   5408  C  CG  . LEU E  1 16  ? 39.500  -92.008  -114.983 1.00 52.73  ? 26   LEU E CG  1 
ATOM   5409  C  CD1 . LEU E  1 16  ? 38.727  -92.913  -114.034 1.00 53.92  ? 26   LEU E CD1 1 
ATOM   5410  C  CD2 . LEU E  1 16  ? 39.867  -92.769  -116.234 1.00 53.27  ? 26   LEU E CD2 1 
ATOM   5411  N  N   . ILE E  1 17  ? 40.379  -88.338  -114.776 1.00 51.46  ? 27   ILE E N   1 
ATOM   5412  C  CA  . ILE E  1 17  ? 41.688  -87.732  -114.613 1.00 50.91  ? 27   ILE E CA  1 
ATOM   5413  C  C   . ILE E  1 17  ? 41.711  -86.893  -113.343 1.00 50.95  ? 27   ILE E C   1 
ATOM   5414  O  O   . ILE E  1 17  ? 42.732  -86.813  -112.663 1.00 51.44  ? 27   ILE E O   1 
ATOM   5415  C  CB  . ILE E  1 17  ? 42.041  -86.854  -115.835 1.00 50.88  ? 27   ILE E CB  1 
ATOM   5416  C  CG1 . ILE E  1 17  ? 42.083  -87.736  -117.085 1.00 51.36  ? 27   ILE E CG1 1 
ATOM   5417  C  CG2 . ILE E  1 17  ? 43.360  -86.122  -115.612 1.00 50.21  ? 27   ILE E CG2 1 
ATOM   5418  C  CD1 . ILE E  1 17  ? 42.760  -89.095  -116.869 1.00 52.41  ? 27   ILE E CD1 1 
ATOM   5419  N  N   . GLU E  1 18  ? 40.584  -86.275  -113.015 1.00 50.82  ? 28   GLU E N   1 
ATOM   5420  C  CA  . GLU E  1 18  ? 40.517  -85.463  -111.811 1.00 52.13  ? 28   GLU E CA  1 
ATOM   5421  C  C   . GLU E  1 18  ? 40.649  -86.399  -110.612 1.00 52.11  ? 28   GLU E C   1 
ATOM   5422  O  O   . GLU E  1 18  ? 41.436  -86.153  -109.698 1.00 52.72  ? 28   GLU E O   1 
ATOM   5423  C  CB  . GLU E  1 18  ? 39.189  -84.701  -111.743 1.00 53.31  ? 28   GLU E CB  1 
ATOM   5424  C  CG  . GLU E  1 18  ? 39.233  -83.419  -110.911 1.00 56.94  ? 28   GLU E CG  1 
ATOM   5425  C  CD  . GLU E  1 18  ? 40.411  -82.498  -111.288 1.00 61.36  ? 28   GLU E CD  1 
ATOM   5426  O  OE1 . GLU E  1 18  ? 40.844  -82.495  -112.470 1.00 61.31  ? 28   GLU E OE1 1 
ATOM   5427  O  OE2 . GLU E  1 18  ? 40.902  -81.762  -110.396 1.00 63.52  ? 28   GLU E OE2 1 
ATOM   5428  N  N   . ARG E  1 19  ? 39.878  -87.480  -110.632 1.00 50.94  ? 29   ARG E N   1 
ATOM   5429  C  CA  . ARG E  1 19  ? 39.899  -88.461  -109.561 1.00 48.99  ? 29   ARG E CA  1 
ATOM   5430  C  C   . ARG E  1 19  ? 41.317  -89.036  -109.434 1.00 47.04  ? 29   ARG E C   1 
ATOM   5431  O  O   . ARG E  1 19  ? 41.797  -89.280  -108.330 1.00 46.65  ? 29   ARG E O   1 
ATOM   5432  C  CB  . ARG E  1 19  ? 38.888  -89.577  -109.865 1.00 52.12  ? 29   ARG E CB  1 
ATOM   5433  C  CG  . ARG E  1 19  ? 37.934  -89.938  -108.722 1.00 56.68  ? 29   ARG E CG  1 
ATOM   5434  C  CD  . ARG E  1 19  ? 36.724  -89.018  -108.654 1.00 60.87  ? 29   ARG E CD  1 
ATOM   5435  N  NE  . ARG E  1 19  ? 37.092  -87.604  -108.748 1.00 67.06  ? 29   ARG E NE  1 
ATOM   5436  C  CZ  . ARG E  1 19  ? 36.240  -86.589  -108.584 1.00 69.69  ? 29   ARG E CZ  1 
ATOM   5437  N  NH1 . ARG E  1 19  ? 34.962  -86.830  -108.308 1.00 69.68  ? 29   ARG E NH1 1 
ATOM   5438  N  NH2 . ARG E  1 19  ? 36.661  -85.332  -108.717 1.00 70.09  ? 29   ARG E NH2 1 
ATOM   5439  N  N   . LEU E  1 20  ? 41.988  -89.241  -110.564 1.00 44.84  ? 30   LEU E N   1 
ATOM   5440  C  CA  . LEU E  1 20  ? 43.348  -89.780  -110.566 1.00 43.57  ? 30   LEU E CA  1 
ATOM   5441  C  C   . LEU E  1 20  ? 44.289  -88.868  -109.780 1.00 45.78  ? 30   LEU E C   1 
ATOM   5442  O  O   . LEU E  1 20  ? 44.917  -89.274  -108.802 1.00 45.06  ? 30   LEU E O   1 
ATOM   5443  C  CB  . LEU E  1 20  ? 43.859  -89.914  -111.998 1.00 38.91  ? 30   LEU E CB  1 
ATOM   5444  C  CG  . LEU E  1 20  ? 45.332  -90.288  -112.142 1.00 36.84  ? 30   LEU E CG  1 
ATOM   5445  C  CD1 . LEU E  1 20  ? 45.576  -91.657  -111.542 1.00 35.86  ? 30   LEU E CD1 1 
ATOM   5446  C  CD2 . LEU E  1 20  ? 45.720  -90.269  -113.600 1.00 35.04  ? 30   LEU E CD2 1 
ATOM   5447  N  N   . GLU E  1 21  ? 44.387  -87.626  -110.232 1.00 47.97  ? 31   GLU E N   1 
ATOM   5448  C  CA  . GLU E  1 21  ? 45.226  -86.648  -109.575 1.00 48.73  ? 31   GLU E CA  1 
ATOM   5449  C  C   . GLU E  1 21  ? 44.813  -86.524  -108.121 1.00 48.14  ? 31   GLU E C   1 
ATOM   5450  O  O   . GLU E  1 21  ? 45.647  -86.309  -107.257 1.00 49.85  ? 31   GLU E O   1 
ATOM   5451  C  CB  . GLU E  1 21  ? 45.101  -85.306  -110.291 1.00 50.08  ? 31   GLU E CB  1 
ATOM   5452  C  CG  . GLU E  1 21  ? 45.714  -85.325  -111.681 1.00 52.88  ? 31   GLU E CG  1 
ATOM   5453  C  CD  . GLU E  1 21  ? 45.399  -84.074  -112.475 1.00 56.33  ? 31   GLU E CD  1 
ATOM   5454  O  OE1 . GLU E  1 21  ? 45.978  -83.904  -113.580 1.00 57.30  ? 31   GLU E OE1 1 
ATOM   5455  O  OE2 . GLU E  1 21  ? 44.567  -83.266  -111.991 1.00 56.96  ? 31   GLU E OE2 1 
ATOM   5456  N  N   . GLN E  1 22  ? 43.523  -86.674  -107.851 1.00 48.74  ? 32   GLN E N   1 
ATOM   5457  C  CA  . GLN E  1 22  ? 43.013  -86.587  -106.482 1.00 49.43  ? 32   GLN E CA  1 
ATOM   5458  C  C   . GLN E  1 22  ? 43.689  -87.667  -105.642 1.00 48.41  ? 32   GLN E C   1 
ATOM   5459  O  O   . GLN E  1 22  ? 44.008  -87.451  -104.478 1.00 47.75  ? 32   GLN E O   1 
ATOM   5460  C  CB  . GLN E  1 22  ? 41.503  -86.825  -106.454 1.00 51.56  ? 32   GLN E CB  1 
ATOM   5461  C  CG  . GLN E  1 22  ? 40.710  -85.823  -105.641 1.00 55.67  ? 32   GLN E CG  1 
ATOM   5462  C  CD  . GLN E  1 22  ? 40.093  -84.734  -106.509 1.00 59.68  ? 32   GLN E CD  1 
ATOM   5463  O  OE1 . GLN E  1 22  ? 40.799  -84.042  -107.258 1.00 62.64  ? 32   GLN E OE1 1 
ATOM   5464  N  NE2 . GLN E  1 22  ? 38.768  -84.574  -106.414 1.00 58.32  ? 32   GLN E NE2 1 
ATOM   5465  N  N   . ALA E  1 23  ? 43.887  -88.835  -106.251 1.00 47.06  ? 33   ALA E N   1 
ATOM   5466  C  CA  . ALA E  1 23  ? 44.521  -89.972  -105.592 1.00 44.70  ? 33   ALA E CA  1 
ATOM   5467  C  C   . ALA E  1 23  ? 46.001  -89.695  -105.476 1.00 43.41  ? 33   ALA E C   1 
ATOM   5468  O  O   . ALA E  1 23  ? 46.605  -89.906  -104.428 1.00 44.10  ? 33   ALA E O   1 
ATOM   5469  C  CB  . ALA E  1 23  ? 44.297  -91.251  -106.406 1.00 43.13  ? 33   ALA E CB  1 
ATOM   5470  N  N   . TRP E  1 24  ? 46.577  -89.234  -106.577 1.00 42.05  ? 34   TRP E N   1 
ATOM   5471  C  CA  . TRP E  1 24  ? 47.988  -88.912  -106.637 1.00 41.85  ? 34   TRP E CA  1 
ATOM   5472  C  C   . TRP E  1 24  ? 48.360  -88.036  -105.457 1.00 43.36  ? 34   TRP E C   1 
ATOM   5473  O  O   . TRP E  1 24  ? 49.324  -88.298  -104.745 1.00 42.30  ? 34   TRP E O   1 
ATOM   5474  C  CB  . TRP E  1 24  ? 48.286  -88.164  -107.928 1.00 39.93  ? 34   TRP E CB  1 
ATOM   5475  C  CG  . TRP E  1 24  ? 49.708  -87.737  -108.089 1.00 37.68  ? 34   TRP E CG  1 
ATOM   5476  C  CD1 . TRP E  1 24  ? 50.814  -88.514  -107.946 1.00 37.89  ? 34   TRP E CD1 1 
ATOM   5477  C  CD2 . TRP E  1 24  ? 50.174  -86.451  -108.515 1.00 37.96  ? 34   TRP E CD2 1 
ATOM   5478  N  NE1 . TRP E  1 24  ? 51.942  -87.800  -108.262 1.00 37.97  ? 34   TRP E NE1 1 
ATOM   5479  C  CE2 . TRP E  1 24  ? 51.579  -86.528  -108.614 1.00 37.85  ? 34   TRP E CE2 1 
ATOM   5480  C  CE3 . TRP E  1 24  ? 49.539  -85.242  -108.828 1.00 38.67  ? 34   TRP E CE3 1 
ATOM   5481  C  CZ2 . TRP E  1 24  ? 52.364  -85.445  -109.013 1.00 38.17  ? 34   TRP E CZ2 1 
ATOM   5482  C  CZ3 . TRP E  1 24  ? 50.320  -84.165  -109.225 1.00 38.74  ? 34   TRP E CZ3 1 
ATOM   5483  C  CH2 . TRP E  1 24  ? 51.719  -84.276  -109.313 1.00 39.20  ? 34   TRP E CH2 1 
HETATM 5484  N  N   . MSE E  1 25  ? 47.575  -86.991  -105.260 1.00 45.26  ? 35   MSE E N   1 
HETATM 5485  C  CA  . MSE E  1 25  ? 47.826  -86.060  -104.187 1.00 48.57  ? 35   MSE E CA  1 
HETATM 5486  C  C   . MSE E  1 25  ? 47.697  -86.680  -102.798 1.00 47.06  ? 35   MSE E C   1 
HETATM 5487  O  O   . MSE E  1 25  ? 48.588  -86.529  -101.963 1.00 46.56  ? 35   MSE E O   1 
HETATM 5488  C  CB  . MSE E  1 25  ? 46.890  -84.859  -104.326 1.00 54.52  ? 35   MSE E CB  1 
HETATM 5489  C  CG  . MSE E  1 25  ? 47.086  -84.091  -105.630 1.00 62.69  ? 35   MSE E CG  1 
HETATM 5490  SE SE  . MSE E  1 25  ? 46.153  -82.388  -105.718 1.00 76.08  ? 35   MSE E SE  1 
HETATM 5491  C  CE  . MSE E  1 25  ? 46.463  -81.780  -103.884 1.00 72.24  ? 35   MSE E CE  1 
ATOM   5492  N  N   . ASN E  1 26  ? 46.593  -87.375  -102.553 1.00 44.67  ? 36   ASN E N   1 
ATOM   5493  C  CA  . ASN E  1 26  ? 46.359  -87.986  -101.255 1.00 43.04  ? 36   ASN E CA  1 
ATOM   5494  C  C   . ASN E  1 26  ? 47.453  -88.967  -100.862 1.00 42.42  ? 36   ASN E C   1 
ATOM   5495  O  O   . ASN E  1 26  ? 47.980  -88.915  -99.752  1.00 42.44  ? 36   ASN E O   1 
ATOM   5496  C  CB  . ASN E  1 26  ? 45.009  -88.704  -101.248 1.00 43.26  ? 36   ASN E CB  1 
ATOM   5497  C  CG  . ASN E  1 26  ? 43.841  -87.748  -101.321 1.00 43.91  ? 36   ASN E CG  1 
ATOM   5498  O  OD1 . ASN E  1 26  ? 42.688  -88.165  -101.470 1.00 44.91  ? 36   ASN E OD1 1 
ATOM   5499  N  ND2 . ASN E  1 26  ? 44.126  -86.458  -101.210 1.00 44.21  ? 36   ASN E ND2 1 
ATOM   5500  N  N   . GLU E  1 27  ? 47.790  -89.860  -101.780 1.00 41.21  ? 37   GLU E N   1 
ATOM   5501  C  CA  . GLU E  1 27  ? 48.801  -90.870  -101.527 1.00 40.95  ? 37   GLU E CA  1 
ATOM   5502  C  C   . GLU E  1 27  ? 50.128  -90.186  -101.222 1.00 39.05  ? 37   GLU E C   1 
ATOM   5503  O  O   . GLU E  1 27  ? 51.005  -90.741  -100.572 1.00 40.36  ? 37   GLU E O   1 
ATOM   5504  C  CB  . GLU E  1 27  ? 48.936  -91.768  -102.764 1.00 43.76  ? 37   GLU E CB  1 
ATOM   5505  C  CG  . GLU E  1 27  ? 49.453  -93.182  -102.494 1.00 47.31  ? 37   GLU E CG  1 
ATOM   5506  C  CD  . GLU E  1 27  ? 48.447  -94.043  -101.750 1.00 50.18  ? 37   GLU E CD  1 
ATOM   5507  O  OE1 . GLU E  1 27  ? 47.367  -94.352  -102.315 1.00 52.18  ? 37   GLU E OE1 1 
ATOM   5508  O  OE2 . GLU E  1 27  ? 48.742  -94.409  -100.593 1.00 50.83  ? 37   GLU E OE2 1 
ATOM   5509  N  N   . LYS E  1 28  ? 50.247  -88.957  -101.687 1.00 37.72  ? 38   LYS E N   1 
ATOM   5510  C  CA  . LYS E  1 28  ? 51.456  -88.170  -101.532 1.00 36.54  ? 38   LYS E CA  1 
ATOM   5511  C  C   . LYS E  1 28  ? 51.532  -87.454  -100.180 1.00 37.18  ? 38   LYS E C   1 
ATOM   5512  O  O   . LYS E  1 28  ? 52.608  -87.048  -99.752  1.00 38.39  ? 38   LYS E O   1 
ATOM   5513  C  CB  . LYS E  1 28  ? 51.507  -87.174  -102.692 1.00 35.47  ? 38   LYS E CB  1 
ATOM   5514  C  CG  . LYS E  1 28  ? 52.735  -86.336  -102.809 1.00 33.87  ? 38   LYS E CG  1 
ATOM   5515  C  CD  . LYS E  1 28  ? 53.251  -86.358  -104.234 1.00 31.42  ? 38   LYS E CD  1 
ATOM   5516  C  CE  . LYS E  1 28  ? 53.734  -87.756  -104.595 1.00 29.38  ? 38   LYS E CE  1 
ATOM   5517  N  NZ  . LYS E  1 28  ? 54.661  -87.719  -105.758 1.00 26.44  ? 38   LYS E NZ  1 
ATOM   5518  N  N   . PHE E  1 29  ? 50.395  -87.326  -99.501  1.00 36.65  ? 39   PHE E N   1 
ATOM   5519  C  CA  . PHE E  1 29  ? 50.341  -86.652  -98.213  1.00 35.42  ? 39   PHE E CA  1 
ATOM   5520  C  C   . PHE E  1 29  ? 50.015  -87.550  -97.035  1.00 34.50  ? 39   PHE E C   1 
ATOM   5521  O  O   . PHE E  1 29  ? 50.222  -87.172  -95.891  1.00 34.35  ? 39   PHE E O   1 
ATOM   5522  C  CB  . PHE E  1 29  ? 49.323  -85.513  -98.261  1.00 39.48  ? 39   PHE E CB  1 
ATOM   5523  C  CG  . PHE E  1 29  ? 49.765  -84.359  -99.101  1.00 44.34  ? 39   PHE E CG  1 
ATOM   5524  C  CD1 . PHE E  1 29  ? 49.672  -84.413  -100.482 1.00 46.31  ? 39   PHE E CD1 1 
ATOM   5525  C  CD2 . PHE E  1 29  ? 50.356  -83.248  -98.516  1.00 46.13  ? 39   PHE E CD2 1 
ATOM   5526  C  CE1 . PHE E  1 29  ? 50.167  -83.383  -101.263 1.00 46.59  ? 39   PHE E CE1 1 
ATOM   5527  C  CE2 . PHE E  1 29  ? 50.853  -82.214  -99.295  1.00 45.82  ? 39   PHE E CE2 1 
ATOM   5528  C  CZ  . PHE E  1 29  ? 50.760  -82.283  -100.665 1.00 45.67  ? 39   PHE E CZ  1 
ATOM   5529  N  N   . ALA E  1 30  ? 49.496  -88.738  -97.298  1.00 34.58  ? 40   ALA E N   1 
ATOM   5530  C  CA  . ALA E  1 30  ? 49.149  -89.633  -96.207  1.00 34.15  ? 40   ALA E CA  1 
ATOM   5531  C  C   . ALA E  1 30  ? 50.371  -90.409  -95.748  1.00 33.79  ? 40   ALA E C   1 
ATOM   5532  O  O   . ALA E  1 30  ? 51.206  -90.810  -96.552  1.00 35.29  ? 40   ALA E O   1 
ATOM   5533  C  CB  . ALA E  1 30  ? 48.049  -90.587  -96.640  1.00 35.37  ? 40   ALA E CB  1 
ATOM   5534  N  N   . PRO E  1 31  ? 50.491  -90.627  -94.440  1.00 32.98  ? 41   PRO E N   1 
ATOM   5535  C  CA  . PRO E  1 31  ? 51.623  -91.359  -93.878  1.00 33.90  ? 41   PRO E CA  1 
ATOM   5536  C  C   . PRO E  1 31  ? 51.540  -92.869  -94.084  1.00 35.18  ? 41   PRO E C   1 
ATOM   5537  O  O   . PRO E  1 31  ? 52.457  -93.613  -93.745  1.00 36.94  ? 41   PRO E O   1 
ATOM   5538  C  CB  . PRO E  1 31  ? 51.579  -90.968  -92.409  1.00 32.96  ? 41   PRO E CB  1 
ATOM   5539  C  CG  . PRO E  1 31  ? 50.120  -90.828  -92.164  1.00 34.08  ? 41   PRO E CG  1 
ATOM   5540  C  CD  . PRO E  1 31  ? 49.639  -90.073  -93.375  1.00 33.67  ? 41   PRO E CD  1 
ATOM   5541  N  N   . GLU E  1 32  ? 50.441  -93.331  -94.648  1.00 36.04  ? 42   GLU E N   1 
ATOM   5542  C  CA  . GLU E  1 32  ? 50.297  -94.751  -94.863  1.00 36.17  ? 42   GLU E CA  1 
ATOM   5543  C  C   . GLU E  1 32  ? 49.861  -95.027  -96.284  1.00 36.31  ? 42   GLU E C   1 
ATOM   5544  O  O   . GLU E  1 32  ? 49.590  -94.112  -97.067  1.00 34.30  ? 42   GLU E O   1 
ATOM   5545  C  CB  . GLU E  1 32  ? 49.248  -95.310  -93.914  1.00 36.62  ? 42   GLU E CB  1 
ATOM   5546  C  CG  . GLU E  1 32  ? 47.857  -94.816  -94.246  1.00 39.27  ? 42   GLU E CG  1 
ATOM   5547  C  CD  . GLU E  1 32  ? 46.822  -95.293  -93.258  1.00 41.28  ? 42   GLU E CD  1 
ATOM   5548  O  OE1 . GLU E  1 32  ? 46.984  -96.422  -92.745  1.00 43.64  ? 42   GLU E OE1 1 
ATOM   5549  O  OE2 . GLU E  1 32  ? 45.843  -94.552  -93.006  1.00 41.30  ? 42   GLU E OE2 1 
ATOM   5550  N  N   . LEU E  1 33  ? 49.801  -96.315  -96.598  1.00 36.90  ? 43   LEU E N   1 
ATOM   5551  C  CA  . LEU E  1 33  ? 49.350  -96.768  -97.902  1.00 34.71  ? 43   LEU E CA  1 
ATOM   5552  C  C   . LEU E  1 33  ? 47.831  -96.623  -97.842  1.00 34.18  ? 43   LEU E C   1 
ATOM   5553  O  O   . LEU E  1 33  ? 47.197  -97.091  -96.886  1.00 31.88  ? 43   LEU E O   1 
ATOM   5554  C  CB  . LEU E  1 33  ? 49.721  -98.237  -98.102  1.00 32.49  ? 43   LEU E CB  1 
ATOM   5555  C  CG  . LEU E  1 33  ? 49.380  -98.849  -99.451  1.00 29.93  ? 43   LEU E CG  1 
ATOM   5556  C  CD1 . LEU E  1 33  ? 50.162  -98.126  -100.539 1.00 31.62  ? 43   LEU E CD1 1 
ATOM   5557  C  CD2 . LEU E  1 33  ? 49.715  -100.322 -99.442  1.00 27.84  ? 43   LEU E CD2 1 
ATOM   5558  N  N   . LEU E  1 34  ? 47.259  -95.963  -98.849  1.00 34.45  ? 44   LEU E N   1 
ATOM   5559  C  CA  . LEU E  1 34  ? 45.818  -95.752  -98.917  1.00 34.48  ? 44   LEU E CA  1 
ATOM   5560  C  C   . LEU E  1 34  ? 45.112  -96.889  -99.651  1.00 38.02  ? 44   LEU E C   1 
ATOM   5561  O  O   . LEU E  1 34  ? 45.749  -97.842  -100.119 1.00 36.04  ? 44   LEU E O   1 
ATOM   5562  C  CB  . LEU E  1 34  ? 45.515  -94.416  -99.602  1.00 29.23  ? 44   LEU E CB  1 
ATOM   5563  C  CG  . LEU E  1 34  ? 45.810  -93.156  -98.779  1.00 25.00  ? 44   LEU E CG  1 
ATOM   5564  C  CD1 . LEU E  1 34  ? 45.612  -91.908  -99.614  1.00 22.81  ? 44   LEU E CD1 1 
ATOM   5565  C  CD2 . LEU E  1 34  ? 44.909  -93.123  -97.569  1.00 22.39  ? 44   LEU E CD2 1 
ATOM   5566  N  N   . GLU E  1 35  ? 43.788  -96.790  -99.733  1.00 42.43  ? 45   GLU E N   1 
ATOM   5567  C  CA  . GLU E  1 35  ? 42.987  -97.801  -100.417 1.00 46.52  ? 45   GLU E CA  1 
ATOM   5568  C  C   . GLU E  1 35  ? 43.372  -97.923  -101.881 1.00 46.76  ? 45   GLU E C   1 
ATOM   5569  O  O   . GLU E  1 35  ? 43.710  -96.940  -102.534 1.00 46.46  ? 45   GLU E O   1 
ATOM   5570  C  CB  . GLU E  1 35  ? 41.502  -97.469  -100.307 1.00 50.35  ? 45   GLU E CB  1 
ATOM   5571  C  CG  . GLU E  1 35  ? 40.897  -97.828  -98.966  1.00 57.46  ? 45   GLU E CG  1 
ATOM   5572  C  CD  . GLU E  1 35  ? 39.515  -97.235  -98.787  1.00 62.50  ? 45   GLU E CD  1 
ATOM   5573  O  OE1 . GLU E  1 35  ? 38.701  -97.348  -99.733  1.00 66.09  ? 45   GLU E OE1 1 
ATOM   5574  O  OE2 . GLU E  1 35  ? 39.241  -96.661  -97.704  1.00 64.29  ? 45   GLU E OE2 1 
ATOM   5575  N  N   . SER E  1 36  ? 43.320  -99.146  -102.388 1.00 47.80  ? 46   SER E N   1 
ATOM   5576  C  CA  . SER E  1 36  ? 43.670  -99.401  -103.765 1.00 49.46  ? 46   SER E CA  1 
ATOM   5577  C  C   . SER E  1 36  ? 42.573  -98.867  -104.670 1.00 50.85  ? 46   SER E C   1 
ATOM   5578  O  O   . SER E  1 36  ? 41.395  -98.885  -104.309 1.00 50.30  ? 46   SER E O   1 
ATOM   5579  C  CB  . SER E  1 36  ? 43.854  -100.899 -103.986 1.00 50.08  ? 46   SER E CB  1 
ATOM   5580  O  OG  . SER E  1 36  ? 44.449  -101.147 -105.246 1.00 54.20  ? 46   SER E OG  1 
ATOM   5581  N  N   . LYS E  1 37  ? 42.973  -98.381  -105.843 1.00 52.23  ? 47   LYS E N   1 
ATOM   5582  C  CA  . LYS E  1 37  ? 42.042  -97.838  -106.824 1.00 52.35  ? 47   LYS E CA  1 
ATOM   5583  C  C   . LYS E  1 37  ? 42.190  -98.575  -108.155 1.00 53.27  ? 47   LYS E C   1 
ATOM   5584  O  O   . LYS E  1 37  ? 42.646  -98.011  -109.151 1.00 52.33  ? 47   LYS E O   1 
ATOM   5585  C  CB  . LYS E  1 37  ? 42.307  -96.348  -107.017 1.00 52.01  ? 47   LYS E CB  1 
ATOM   5586  C  CG  . LYS E  1 37  ? 42.016  -95.513  -105.789 1.00 51.94  ? 47   LYS E CG  1 
ATOM   5587  C  CD  . LYS E  1 37  ? 40.547  -95.573  -105.421 1.00 53.52  ? 47   LYS E CD  1 
ATOM   5588  C  CE  . LYS E  1 37  ? 40.265  -94.773  -104.168 1.00 54.10  ? 47   LYS E CE  1 
ATOM   5589  N  NZ  . LYS E  1 37  ? 40.795  -93.392  -104.302 1.00 55.50  ? 47   LYS E NZ  1 
ATOM   5590  N  N   . PRO E  1 38  ? 41.789  -99.854  -108.190 1.00 54.77  ? 48   PRO E N   1 
ATOM   5591  C  CA  . PRO E  1 38  ? 41.893  -100.647 -109.415 1.00 55.69  ? 48   PRO E CA  1 
ATOM   5592  C  C   . PRO E  1 38  ? 41.117  -99.998  -110.554 1.00 56.33  ? 48   PRO E C   1 
ATOM   5593  O  O   . PRO E  1 38  ? 41.667  -99.762  -111.634 1.00 56.85  ? 48   PRO E O   1 
ATOM   5594  C  CB  . PRO E  1 38  ? 41.317  -101.992 -108.997 1.00 55.76  ? 48   PRO E CB  1 
ATOM   5595  C  CG  . PRO E  1 38  ? 40.252  -101.588 -108.022 1.00 54.92  ? 48   PRO E CG  1 
ATOM   5596  C  CD  . PRO E  1 38  ? 40.964  -100.552 -107.187 1.00 54.65  ? 48   PRO E CD  1 
ATOM   5597  N  N   . GLU E  1 39  ? 39.843  -99.703  -110.309 1.00 57.02  ? 49   GLU E N   1 
ATOM   5598  C  CA  . GLU E  1 39  ? 39.020  -99.070  -111.328 1.00 59.21  ? 49   GLU E CA  1 
ATOM   5599  C  C   . GLU E  1 39  ? 39.805  -97.920  -111.981 1.00 58.18  ? 49   GLU E C   1 
ATOM   5600  O  O   . GLU E  1 39  ? 40.275  -98.049  -113.117 1.00 56.94  ? 49   GLU E O   1 
ATOM   5601  C  CB  . GLU E  1 39  ? 37.699  -98.564  -110.715 1.00 61.86  ? 49   GLU E CB  1 
ATOM   5602  C  CG  . GLU E  1 39  ? 36.540  -99.598  -110.723 1.00 66.91  ? 49   GLU E CG  1 
ATOM   5603  C  CD  . GLU E  1 39  ? 35.444  -99.311  -111.788 1.00 70.69  ? 49   GLU E CD  1 
ATOM   5604  O  OE1 . GLU E  1 39  ? 35.768  -99.199  -112.997 1.00 71.49  ? 49   GLU E OE1 1 
ATOM   5605  O  OE2 . GLU E  1 39  ? 34.248  -99.207  -111.414 1.00 70.74  ? 49   GLU E OE2 1 
ATOM   5606  N  N   . ILE E  1 40  ? 39.970  -96.819  -111.253 1.00 55.92  ? 50   ILE E N   1 
ATOM   5607  C  CA  . ILE E  1 40  ? 40.702  -95.662  -111.758 1.00 54.38  ? 50   ILE E CA  1 
ATOM   5608  C  C   . ILE E  1 40  ? 41.961  -95.992  -112.571 1.00 54.55  ? 50   ILE E C   1 
ATOM   5609  O  O   . ILE E  1 40  ? 42.118  -95.524  -113.706 1.00 53.97  ? 50   ILE E O   1 
ATOM   5610  C  CB  . ILE E  1 40  ? 41.092  -94.720  -110.596 1.00 52.89  ? 50   ILE E CB  1 
ATOM   5611  C  CG1 . ILE E  1 40  ? 39.888  -93.862  -110.218 1.00 52.61  ? 50   ILE E CG1 1 
ATOM   5612  C  CG2 . ILE E  1 40  ? 42.287  -93.849  -110.978 1.00 51.29  ? 50   ILE E CG2 1 
ATOM   5613  C  CD1 . ILE E  1 40  ? 40.231  -92.722  -109.302 1.00 54.01  ? 50   ILE E CD1 1 
ATOM   5614  N  N   . VAL E  1 41  ? 42.855  -96.796  -111.998 1.00 54.35  ? 51   VAL E N   1 
ATOM   5615  C  CA  . VAL E  1 41  ? 44.106  -97.147  -112.686 1.00 54.41  ? 51   VAL E CA  1 
ATOM   5616  C  C   . VAL E  1 41  ? 43.916  -97.807  -114.049 1.00 55.07  ? 51   VAL E C   1 
ATOM   5617  O  O   . VAL E  1 41  ? 44.424  -97.294  -115.051 1.00 55.42  ? 51   VAL E O   1 
ATOM   5618  C  CB  . VAL E  1 41  ? 45.026  -98.052  -111.798 1.00 53.67  ? 51   VAL E CB  1 
ATOM   5619  C  CG1 . VAL E  1 41  ? 46.339  -98.394  -112.536 1.00 49.88  ? 51   VAL E CG1 1 
ATOM   5620  C  CG2 . VAL E  1 41  ? 45.354  -97.318  -110.525 1.00 52.67  ? 51   VAL E CG2 1 
ATOM   5621  N  N   . GLU E  1 42  ? 43.198  -98.928  -114.107 1.00 56.63  ? 52   GLU E N   1 
ATOM   5622  C  CA  . GLU E  1 42  ? 43.022  -99.565  -115.405 1.00 57.91  ? 52   GLU E CA  1 
ATOM   5623  C  C   . GLU E  1 42  ? 42.180  -98.742  -116.372 1.00 55.79  ? 52   GLU E C   1 
ATOM   5624  O  O   . GLU E  1 42  ? 42.318  -98.890  -117.577 1.00 55.25  ? 52   GLU E O   1 
ATOM   5625  C  CB  . GLU E  1 42  ? 42.485  -100.996 -115.266 1.00 60.05  ? 52   GLU E CB  1 
ATOM   5626  C  CG  . GLU E  1 42  ? 41.546  -101.270 -114.107 1.00 64.66  ? 52   GLU E CG  1 
ATOM   5627  C  CD  . GLU E  1 42  ? 41.468  -102.770 -113.790 1.00 67.77  ? 52   GLU E CD  1 
ATOM   5628  O  OE1 . GLU E  1 42  ? 40.560  -103.193 -113.036 1.00 68.21  ? 52   GLU E OE1 1 
ATOM   5629  O  OE2 . GLU E  1 42  ? 42.332  -103.528 -114.293 1.00 69.27  ? 52   GLU E OE2 1 
ATOM   5630  N  N   . CYS E  1 43  ? 41.327  -97.865  -115.855 1.00 56.04  ? 53   CYS E N   1 
ATOM   5631  C  CA  . CYS E  1 43  ? 40.530  -97.009  -116.724 1.00 55.88  ? 53   CYS E CA  1 
ATOM   5632  C  C   . CYS E  1 43  ? 41.476  -95.994  -117.341 1.00 55.46  ? 53   CYS E C   1 
ATOM   5633  O  O   . CYS E  1 43  ? 41.472  -95.794  -118.550 1.00 55.97  ? 53   CYS E O   1 
ATOM   5634  C  CB  . CYS E  1 43  ? 39.445  -96.262  -115.946 1.00 57.02  ? 53   CYS E CB  1 
ATOM   5635  S  SG  . CYS E  1 43  ? 38.015  -97.252  -115.452 1.00 60.43  ? 53   CYS E SG  1 
ATOM   5636  N  N   . VAL E  1 44  ? 42.288  -95.349  -116.509 1.00 54.87  ? 54   VAL E N   1 
ATOM   5637  C  CA  . VAL E  1 44  ? 43.245  -94.362  -117.004 1.00 54.56  ? 54   VAL E CA  1 
ATOM   5638  C  C   . VAL E  1 44  ? 44.284  -95.068  -117.847 1.00 55.52  ? 54   VAL E C   1 
ATOM   5639  O  O   . VAL E  1 44  ? 44.779  -94.527  -118.834 1.00 54.17  ? 54   VAL E O   1 
ATOM   5640  C  CB  . VAL E  1 44  ? 43.975  -93.649  -115.861 1.00 53.59  ? 54   VAL E CB  1 
ATOM   5641  C  CG1 . VAL E  1 44  ? 45.068  -92.757  -116.430 1.00 53.08  ? 54   VAL E CG1 1 
ATOM   5642  C  CG2 . VAL E  1 44  ? 42.989  -92.833  -115.047 1.00 52.27  ? 54   VAL E CG2 1 
HETATM 5643  N  N   . MSE E  1 45  ? 44.617  -96.283  -117.429 1.00 58.23  ? 55   MSE E N   1 
HETATM 5644  C  CA  . MSE E  1 45  ? 45.588  -97.111  -118.122 1.00 61.53  ? 55   MSE E CA  1 
HETATM 5645  C  C   . MSE E  1 45  ? 45.065  -97.429  -119.515 1.00 62.51  ? 55   MSE E C   1 
HETATM 5646  O  O   . MSE E  1 45  ? 45.813  -97.443  -120.494 1.00 61.78  ? 55   MSE E O   1 
HETATM 5647  C  CB  . MSE E  1 45  ? 45.812  -98.407  -117.340 1.00 64.60  ? 55   MSE E CB  1 
HETATM 5648  C  CG  . MSE E  1 45  ? 47.108  -98.443  -116.562 1.00 69.47  ? 55   MSE E CG  1 
HETATM 5649  SE SE  . MSE E  1 45  ? 48.649  -98.519  -117.742 1.00 80.97  ? 55   MSE E SE  1 
HETATM 5650  C  CE  . MSE E  1 45  ? 48.881  -96.636  -118.144 1.00 75.48  ? 55   MSE E CE  1 
ATOM   5651  N  N   . GLU E  1 46  ? 43.764  -97.679  -119.582 1.00 64.02  ? 56   GLU E N   1 
ATOM   5652  C  CA  . GLU E  1 46  ? 43.079  -98.001  -120.820 1.00 64.10  ? 56   GLU E CA  1 
ATOM   5653  C  C   . GLU E  1 46  ? 42.873  -96.772  -121.692 1.00 63.55  ? 56   GLU E C   1 
ATOM   5654  O  O   . GLU E  1 46  ? 43.177  -96.802  -122.878 1.00 63.91  ? 56   GLU E O   1 
ATOM   5655  C  CB  . GLU E  1 46  ? 41.736  -98.628  -120.500 1.00 66.40  ? 56   GLU E CB  1 
ATOM   5656  C  CG  . GLU E  1 46  ? 40.909  -98.975  -121.696 1.00 69.92  ? 56   GLU E CG  1 
ATOM   5657  C  CD  . GLU E  1 46  ? 39.485  -99.263  -121.303 1.00 72.12  ? 56   GLU E CD  1 
ATOM   5658  O  OE1 . GLU E  1 46  ? 38.775  -98.302  -120.918 1.00 72.11  ? 56   GLU E OE1 1 
ATOM   5659  O  OE2 . GLU E  1 46  ? 39.087  -100.449 -121.365 1.00 73.46  ? 56   GLU E OE2 1 
ATOM   5660  N  N   . GLN E  1 47  ? 42.349  -95.694  -121.114 1.00 63.49  ? 57   GLN E N   1 
ATOM   5661  C  CA  . GLN E  1 47  ? 42.133  -94.469  -121.881 1.00 64.64  ? 57   GLN E CA  1 
ATOM   5662  C  C   . GLN E  1 47  ? 43.412  -94.127  -122.628 1.00 66.04  ? 57   GLN E C   1 
ATOM   5663  O  O   . GLN E  1 47  ? 43.372  -93.595  -123.732 1.00 67.11  ? 57   GLN E O   1 
ATOM   5664  C  CB  . GLN E  1 47  ? 41.768  -93.290  -120.974 1.00 63.93  ? 57   GLN E CB  1 
ATOM   5665  C  CG  . GLN E  1 47  ? 40.528  -93.486  -120.115 1.00 65.26  ? 57   GLN E CG  1 
ATOM   5666  C  CD  . GLN E  1 47  ? 39.263  -93.708  -120.925 1.00 64.77  ? 57   GLN E CD  1 
ATOM   5667  O  OE1 . GLN E  1 47  ? 38.856  -92.853  -121.719 1.00 63.89  ? 57   GLN E OE1 1 
ATOM   5668  N  NE2 . GLN E  1 47  ? 38.630  -94.861  -120.723 1.00 64.14  ? 57   GLN E NE2 1 
ATOM   5669  N  N   . LEU E  1 48  ? 44.554  -94.430  -122.023 1.00 67.83  ? 58   LEU E N   1 
ATOM   5670  C  CA  . LEU E  1 48  ? 45.825  -94.142  -122.667 1.00 69.73  ? 58   LEU E CA  1 
ATOM   5671  C  C   . LEU E  1 48  ? 46.043  -95.034  -123.882 1.00 71.58  ? 58   LEU E C   1 
ATOM   5672  O  O   . LEU E  1 48  ? 46.297  -94.534  -124.973 1.00 72.16  ? 58   LEU E O   1 
ATOM   5673  C  CB  . LEU E  1 48  ? 46.984  -94.303  -121.677 1.00 68.59  ? 58   LEU E CB  1 
ATOM   5674  C  CG  . LEU E  1 48  ? 47.122  -93.205  -120.615 1.00 68.46  ? 58   LEU E CG  1 
ATOM   5675  C  CD1 . LEU E  1 48  ? 48.273  -93.534  -119.682 1.00 67.78  ? 58   LEU E CD1 1 
ATOM   5676  C  CD2 . LEU E  1 48  ? 47.355  -91.861  -121.290 1.00 67.71  ? 58   LEU E CD2 1 
ATOM   5677  N  N   . GLU E  1 49  ? 45.927  -96.349  -123.700 1.00 74.31  ? 59   GLU E N   1 
ATOM   5678  C  CA  . GLU E  1 49  ? 46.132  -97.288  -124.802 1.00 76.46  ? 59   GLU E CA  1 
ATOM   5679  C  C   . GLU E  1 49  ? 45.244  -96.982  -126.000 1.00 76.61  ? 59   GLU E C   1 
ATOM   5680  O  O   . GLU E  1 49  ? 45.688  -97.096  -127.141 1.00 74.72  ? 59   GLU E O   1 
ATOM   5681  C  CB  . GLU E  1 49  ? 45.951  -98.747  -124.327 1.00 78.43  ? 59   GLU E CB  1 
ATOM   5682  C  CG  . GLU E  1 49  ? 44.757  -99.015  -123.407 1.00 81.31  ? 59   GLU E CG  1 
ATOM   5683  C  CD  . GLU E  1 49  ? 44.993  -100.176 -122.423 1.00 82.95  ? 59   GLU E CD  1 
ATOM   5684  O  OE1 . GLU E  1 49  ? 45.948  -100.095 -121.614 1.00 82.64  ? 59   GLU E OE1 1 
ATOM   5685  O  OE2 . GLU E  1 49  ? 44.219  -101.162 -122.452 1.00 83.02  ? 59   GLU E OE2 1 
ATOM   5686  N  N   . HIS E  1 50  ? 44.000  -96.583  -125.744 1.00 78.54  ? 60   HIS E N   1 
ATOM   5687  C  CA  . HIS E  1 50  ? 43.084  -96.227  -126.825 1.00 81.31  ? 60   HIS E CA  1 
ATOM   5688  C  C   . HIS E  1 50  ? 43.649  -94.991  -127.514 1.00 83.36  ? 60   HIS E C   1 
ATOM   5689  O  O   . HIS E  1 50  ? 44.109  -95.060  -128.652 1.00 84.02  ? 60   HIS E O   1 
ATOM   5690  C  CB  . HIS E  1 50  ? 41.682  -95.906  -126.289 1.00 81.55  ? 60   HIS E CB  1 
ATOM   5691  C  CG  . HIS E  1 50  ? 40.912  -97.108  -125.837 1.00 82.98  ? 60   HIS E CG  1 
ATOM   5692  N  ND1 . HIS E  1 50  ? 40.859  -98.277  -126.566 1.00 83.63  ? 60   HIS E ND1 1 
ATOM   5693  C  CD2 . HIS E  1 50  ? 40.142  -97.314  -124.742 1.00 83.29  ? 60   HIS E CD2 1 
ATOM   5694  C  CE1 . HIS E  1 50  ? 40.092  -99.152  -125.938 1.00 83.71  ? 60   HIS E CE1 1 
ATOM   5695  N  NE2 . HIS E  1 50  ? 39.644  -98.592  -124.829 1.00 83.56  ? 60   HIS E NE2 1 
HETATM 5696  N  N   . MSE E  1 51  ? 43.617  -93.865  -126.806 1.00 85.84  ? 61   MSE E N   1 
HETATM 5697  C  CA  . MSE E  1 51  ? 44.130  -92.592  -127.309 1.00 88.16  ? 61   MSE E CA  1 
HETATM 5698  C  C   . MSE E  1 51  ? 45.521  -92.753  -127.909 1.00 89.32  ? 61   MSE E C   1 
HETATM 5699  O  O   . MSE E  1 51  ? 45.946  -91.963  -128.750 1.00 88.75  ? 61   MSE E O   1 
HETATM 5700  C  CB  . MSE E  1 51  ? 44.180  -91.570  -126.172 1.00 89.35  ? 61   MSE E CB  1 
HETATM 5701  C  CG  . MSE E  1 51  ? 44.848  -90.254  -126.534 1.00 91.10  ? 61   MSE E CG  1 
HETATM 5702  SE SE  . MSE E  1 51  ? 44.032  -89.372  -128.047 1.00 93.90  ? 61   MSE E SE  1 
HETATM 5703  C  CE  . MSE E  1 51  ? 42.446  -88.664  -127.181 1.00 91.64  ? 61   MSE E CE  1 
ATOM   5704  N  N   . GLU E  1 52  ? 46.227  -93.781  -127.461 1.00 91.38  ? 62   GLU E N   1 
ATOM   5705  C  CA  . GLU E  1 52  ? 47.565  -94.061  -127.948 1.00 94.16  ? 62   GLU E CA  1 
ATOM   5706  C  C   . GLU E  1 52  ? 47.503  -94.269  -129.462 1.00 95.85  ? 62   GLU E C   1 
ATOM   5707  O  O   . GLU E  1 52  ? 48.160  -93.562  -130.229 1.00 96.36  ? 62   GLU E O   1 
ATOM   5708  C  CB  . GLU E  1 52  ? 48.100  -95.321  -127.264 1.00 95.30  ? 62   GLU E CB  1 
ATOM   5709  C  CG  . GLU E  1 52  ? 49.610  -95.472  -127.291 1.00 97.64  ? 62   GLU E CG  1 
ATOM   5710  C  CD  . GLU E  1 52  ? 50.183  -95.380  -128.690 1.00 98.96  ? 62   GLU E CD  1 
ATOM   5711  O  OE1 . GLU E  1 52  ? 49.675  -96.082  -129.592 1.00 99.83  ? 62   GLU E OE1 1 
ATOM   5712  O  OE2 . GLU E  1 52  ? 51.146  -94.608  -128.884 1.00 99.76  ? 62   GLU E OE2 1 
ATOM   5713  N  N   . GLU E  1 53  ? 46.700  -95.239  -129.892 1.00 97.14  ? 63   GLU E N   1 
ATOM   5714  C  CA  . GLU E  1 53  ? 46.565  -95.533  -131.313 1.00 98.06  ? 63   GLU E CA  1 
ATOM   5715  C  C   . GLU E  1 53  ? 45.364  -94.818  -131.932 1.00 98.69  ? 63   GLU E C   1 
ATOM   5716  O  O   . GLU E  1 53  ? 45.125  -94.932  -133.134 1.00 98.06  ? 63   GLU E O   1 
ATOM   5717  C  CB  . GLU E  1 53  ? 46.437  -97.040  -131.528 1.00 98.16  ? 63   GLU E CB  1 
ATOM   5718  C  CG  . GLU E  1 53  ? 45.059  -97.590  -131.221 1.00 97.77  ? 63   GLU E CG  1 
ATOM   5719  C  CD  . GLU E  1 53  ? 45.024  -99.100  -131.229 1.00 97.64  ? 63   GLU E CD  1 
ATOM   5720  O  OE1 . GLU E  1 53  ? 45.478  -99.708  -132.225 1.00 97.75  ? 63   GLU E OE1 1 
ATOM   5721  O  OE2 . GLU E  1 53  ? 44.537  -99.678  -130.234 1.00 97.64  ? 63   GLU E OE2 1 
ATOM   5722  N  N   . ASN E  1 54  ? 44.606  -94.093  -131.110 1.00 99.88  ? 64   ASN E N   1 
ATOM   5723  C  CA  . ASN E  1 54  ? 43.449  -93.334  -131.593 1.00 101.12 ? 64   ASN E CA  1 
ATOM   5724  C  C   . ASN E  1 54  ? 44.037  -92.258  -132.503 1.00 102.26 ? 64   ASN E C   1 
ATOM   5725  O  O   . ASN E  1 54  ? 43.318  -91.467  -133.117 1.00 102.40 ? 64   ASN E O   1 
ATOM   5726  C  CB  . ASN E  1 54  ? 42.698  -92.686  -130.418 1.00 101.02 ? 64   ASN E CB  1 
ATOM   5727  C  CG  . ASN E  1 54  ? 41.370  -92.051  -130.834 1.00 100.85 ? 64   ASN E CG  1 
ATOM   5728  O  OD1 . ASN E  1 54  ? 40.511  -92.712  -131.416 1.00 101.17 ? 64   ASN E OD1 1 
ATOM   5729  N  ND2 . ASN E  1 54  ? 41.197  -90.767  -130.521 1.00 99.80  ? 64   ASN E ND2 1 
ATOM   5730  N  N   . LEU E  1 55  ? 45.365  -92.243  -132.567 1.00 103.16 ? 65   LEU E N   1 
ATOM   5731  C  CA  . LEU E  1 55  ? 46.109  -91.311  -133.395 1.00 104.17 ? 65   LEU E CA  1 
ATOM   5732  C  C   . LEU E  1 55  ? 47.198  -92.085  -134.122 1.00 105.07 ? 65   LEU E C   1 
ATOM   5733  O  O   . LEU E  1 55  ? 47.258  -92.081  -135.353 1.00 105.48 ? 65   LEU E O   1 
ATOM   5734  C  CB  . LEU E  1 55  ? 46.744  -90.222  -132.534 1.00 104.68 ? 65   LEU E CB  1 
ATOM   5735  C  CG  . LEU E  1 55  ? 45.773  -89.267  -131.839 1.00 105.29 ? 65   LEU E CG  1 
ATOM   5736  C  CD1 . LEU E  1 55  ? 46.566  -88.230  -131.047 1.00 105.11 ? 65   LEU E CD1 1 
ATOM   5737  C  CD2 . LEU E  1 55  ? 44.879  -88.592  -132.877 1.00 104.79 ? 65   LEU E CD2 1 
ATOM   5738  N  N   . ARG E  1 56  ? 48.054  -92.752  -133.352 1.00 105.72 ? 66   ARG E N   1 
ATOM   5739  C  CA  . ARG E  1 56  ? 49.141  -93.538  -133.927 1.00 106.02 ? 66   ARG E CA  1 
ATOM   5740  C  C   . ARG E  1 56  ? 48.597  -94.739  -134.689 1.00 105.38 ? 66   ARG E C   1 
ATOM   5741  O  O   . ARG E  1 56  ? 47.916  -94.582  -135.701 1.00 104.85 ? 66   ARG E O   1 
ATOM   5742  C  CB  . ARG E  1 56  ? 50.095  -94.014  -132.830 1.00 106.61 ? 66   ARG E CB  1 
ATOM   5743  C  CG  . ARG E  1 56  ? 51.478  -93.375  -132.887 1.00 107.94 ? 66   ARG E CG  1 
ATOM   5744  C  CD  . ARG E  1 56  ? 52.412  -93.997  -131.853 1.00 109.25 ? 66   ARG E CD  1 
ATOM   5745  N  NE  . ARG E  1 56  ? 53.786  -93.514  -131.973 1.00 110.02 ? 66   ARG E NE  1 
ATOM   5746  C  CZ  . ARG E  1 56  ? 54.804  -93.953  -131.237 1.00 110.43 ? 66   ARG E CZ  1 
ATOM   5747  N  NH1 . ARG E  1 56  ? 54.612  -94.891  -130.316 1.00 110.16 ? 66   ARG E NH1 1 
ATOM   5748  N  NH2 . ARG E  1 56  ? 56.020  -93.456  -131.426 1.00 110.57 ? 66   ARG E NH2 1 
ATOM   5749  N  N   . GLU E  1 61  ? 53.365  -85.975  -138.737 1.00 95.24  ? 71   GLU E N   1 
ATOM   5750  C  CA  . GLU E  1 61  ? 53.302  -84.589  -138.285 1.00 94.95  ? 71   GLU E CA  1 
ATOM   5751  C  C   . GLU E  1 61  ? 51.845  -84.140  -138.227 1.00 93.21  ? 71   GLU E C   1 
ATOM   5752  O  O   . GLU E  1 61  ? 51.006  -84.664  -138.960 1.00 93.09  ? 71   GLU E O   1 
ATOM   5753  C  CB  . GLU E  1 61  ? 54.094  -83.684  -139.240 1.00 96.78  ? 71   GLU E CB  1 
ATOM   5754  C  CG  . GLU E  1 61  ? 55.568  -84.071  -139.395 1.00 99.24  ? 71   GLU E CG  1 
ATOM   5755  C  CD  . GLU E  1 61  ? 56.335  -83.147  -140.335 1.00 100.77 ? 71   GLU E CD  1 
ATOM   5756  O  OE1 . GLU E  1 61  ? 55.978  -83.066  -141.532 1.00 101.01 ? 71   GLU E OE1 1 
ATOM   5757  O  OE2 . GLU E  1 61  ? 57.301  -82.502  -139.875 1.00 101.61 ? 71   GLU E OE2 1 
ATOM   5758  N  N   . ASP E  1 62  ? 51.559  -83.180  -137.347 1.00 90.90  ? 72   ASP E N   1 
ATOM   5759  C  CA  . ASP E  1 62  ? 50.212  -82.629  -137.163 1.00 88.59  ? 72   ASP E CA  1 
ATOM   5760  C  C   . ASP E  1 62  ? 50.087  -82.043  -135.753 1.00 87.04  ? 72   ASP E C   1 
ATOM   5761  O  O   . ASP E  1 62  ? 50.443  -82.689  -134.763 1.00 86.68  ? 72   ASP E O   1 
ATOM   5762  C  CB  . ASP E  1 62  ? 49.146  -83.714  -137.377 1.00 88.83  ? 72   ASP E CB  1 
ATOM   5763  C  CG  . ASP E  1 62  ? 47.735  -83.153  -137.431 1.00 88.62  ? 72   ASP E CG  1 
ATOM   5764  O  OD1 . ASP E  1 62  ? 46.822  -83.885  -137.875 1.00 87.42  ? 72   ASP E OD1 1 
ATOM   5765  O  OD2 . ASP E  1 62  ? 47.537  -81.987  -137.026 1.00 88.77  ? 72   ASP E OD2 1 
ATOM   5766  N  N   . LEU E  1 63  ? 49.575  -80.818  -135.674 1.00 84.26  ? 73   LEU E N   1 
ATOM   5767  C  CA  . LEU E  1 63  ? 49.414  -80.112  -134.405 1.00 81.34  ? 73   LEU E CA  1 
ATOM   5768  C  C   . LEU E  1 63  ? 48.444  -80.805  -133.453 1.00 80.31  ? 73   LEU E C   1 
ATOM   5769  O  O   . LEU E  1 63  ? 48.801  -81.120  -132.322 1.00 80.71  ? 73   LEU E O   1 
ATOM   5770  C  CB  . LEU E  1 63  ? 48.937  -78.682  -134.663 1.00 80.15  ? 73   LEU E CB  1 
ATOM   5771  C  CG  . LEU E  1 63  ? 49.240  -77.655  -133.575 1.00 79.07  ? 73   LEU E CG  1 
ATOM   5772  C  CD1 . LEU E  1 63  ? 50.742  -77.504  -133.464 1.00 79.48  ? 73   LEU E CD1 1 
ATOM   5773  C  CD2 . LEU E  1 63  ? 48.603  -76.317  -133.912 1.00 78.33  ? 73   LEU E CD2 1 
ATOM   5774  N  N   . LYS E  1 64  ? 47.214  -81.032  -133.904 1.00 78.60  ? 74   LYS E N   1 
ATOM   5775  C  CA  . LYS E  1 64  ? 46.222  -81.687  -133.062 1.00 76.55  ? 74   LYS E CA  1 
ATOM   5776  C  C   . LYS E  1 64  ? 46.791  -82.974  -132.484 1.00 74.68  ? 74   LYS E C   1 
ATOM   5777  O  O   . LYS E  1 64  ? 46.434  -83.375  -131.380 1.00 74.19  ? 74   LYS E O   1 
ATOM   5778  C  CB  . LYS E  1 64  ? 44.948  -82.000  -133.858 1.00 77.26  ? 74   LYS E CB  1 
ATOM   5779  C  CG  . LYS E  1 64  ? 43.928  -82.832  -133.079 1.00 76.49  ? 74   LYS E CG  1 
ATOM   5780  C  CD  . LYS E  1 64  ? 42.639  -83.044  -133.849 1.00 76.47  ? 74   LYS E CD  1 
ATOM   5781  C  CE  . LYS E  1 64  ? 41.916  -81.731  -134.081 1.00 77.41  ? 74   LYS E CE  1 
ATOM   5782  N  NZ  . LYS E  1 64  ? 40.574  -81.959  -134.674 1.00 77.83  ? 74   LYS E NZ  1 
ATOM   5783  N  N   . VAL E  1 65  ? 47.675  -83.619  -133.239 1.00 72.76  ? 75   VAL E N   1 
ATOM   5784  C  CA  . VAL E  1 65  ? 48.301  -84.859  -132.790 1.00 71.86  ? 75   VAL E CA  1 
ATOM   5785  C  C   . VAL E  1 65  ? 49.384  -84.562  -131.749 1.00 71.54  ? 75   VAL E C   1 
ATOM   5786  O  O   . VAL E  1 65  ? 49.657  -85.381  -130.864 1.00 71.94  ? 75   VAL E O   1 
ATOM   5787  C  CB  . VAL E  1 65  ? 48.928  -85.628  -133.980 1.00 71.31  ? 75   VAL E CB  1 
ATOM   5788  C  CG1 . VAL E  1 65  ? 49.660  -86.872  -133.486 1.00 69.91  ? 75   VAL E CG1 1 
ATOM   5789  C  CG2 . VAL E  1 65  ? 47.839  -86.020  -134.961 1.00 71.00  ? 75   VAL E CG2 1 
ATOM   5790  N  N   . SER E  1 66  ? 49.992  -83.383  -131.854 1.00 69.49  ? 76   SER E N   1 
ATOM   5791  C  CA  . SER E  1 66  ? 51.029  -82.985  -130.917 1.00 67.29  ? 76   SER E CA  1 
ATOM   5792  C  C   . SER E  1 66  ? 50.408  -82.536  -129.594 1.00 66.02  ? 76   SER E C   1 
ATOM   5793  O  O   . SER E  1 66  ? 50.964  -82.792  -128.528 1.00 66.71  ? 76   SER E O   1 
ATOM   5794  C  CB  . SER E  1 66  ? 51.875  -81.859  -131.512 1.00 67.64  ? 76   SER E CB  1 
ATOM   5795  O  OG  . SER E  1 66  ? 52.983  -81.570  -130.683 1.00 68.64  ? 76   SER E OG  1 
ATOM   5796  N  N   . ILE E  1 67  ? 49.262  -81.860  -129.654 1.00 63.92  ? 77   ILE E N   1 
ATOM   5797  C  CA  . ILE E  1 67  ? 48.607  -81.424  -128.428 1.00 62.35  ? 77   ILE E CA  1 
ATOM   5798  C  C   . ILE E  1 67  ? 48.196  -82.681  -127.662 1.00 62.99  ? 77   ILE E C   1 
ATOM   5799  O  O   . ILE E  1 67  ? 48.453  -82.800  -126.470 1.00 64.17  ? 77   ILE E O   1 
ATOM   5800  C  CB  . ILE E  1 67  ? 47.341  -80.544  -128.702 1.00 60.53  ? 77   ILE E CB  1 
ATOM   5801  C  CG1 . ILE E  1 67  ? 47.732  -79.081  -128.937 1.00 58.73  ? 77   ILE E CG1 1 
ATOM   5802  C  CG2 . ILE E  1 67  ? 46.395  -80.592  -127.512 1.00 60.06  ? 77   ILE E CG2 1 
ATOM   5803  C  CD1 . ILE E  1 67  ? 48.396  -78.819  -130.257 1.00 57.96  ? 77   ILE E CD1 1 
ATOM   5804  N  N   . HIS E  1 68  ? 47.573  -83.622  -128.360 1.00 62.79  ? 78   HIS E N   1 
ATOM   5805  C  CA  . HIS E  1 68  ? 47.121  -84.863  -127.752 1.00 62.26  ? 78   HIS E CA  1 
ATOM   5806  C  C   . HIS E  1 68  ? 48.240  -85.657  -127.090 1.00 62.69  ? 78   HIS E C   1 
ATOM   5807  O  O   . HIS E  1 68  ? 48.023  -86.284  -126.051 1.00 61.77  ? 78   HIS E O   1 
ATOM   5808  C  CB  . HIS E  1 68  ? 46.420  -85.731  -128.800 1.00 62.23  ? 78   HIS E CB  1 
ATOM   5809  C  CG  . HIS E  1 68  ? 44.954  -85.458  -128.924 1.00 63.27  ? 78   HIS E CG  1 
ATOM   5810  N  ND1 . HIS E  1 68  ? 44.042  -85.852  -127.968 1.00 64.16  ? 78   HIS E ND1 1 
ATOM   5811  C  CD2 . HIS E  1 68  ? 44.245  -84.801  -129.872 1.00 63.23  ? 78   HIS E CD2 1 
ATOM   5812  C  CE1 . HIS E  1 68  ? 42.835  -85.448  -128.321 1.00 63.71  ? 78   HIS E CE1 1 
ATOM   5813  N  NE2 . HIS E  1 68  ? 42.930  -84.807  -129.472 1.00 63.44  ? 78   HIS E NE2 1 
ATOM   5814  N  N   . GLN E  1 69  ? 49.430  -85.641  -127.687 1.00 63.33  ? 79   GLN E N   1 
ATOM   5815  C  CA  . GLN E  1 69  ? 50.559  -86.378  -127.122 1.00 64.77  ? 79   GLN E CA  1 
ATOM   5816  C  C   . GLN E  1 69  ? 50.985  -85.790  -125.790 1.00 65.65  ? 79   GLN E C   1 
ATOM   5817  O  O   . GLN E  1 69  ? 51.334  -86.513  -124.857 1.00 67.02  ? 79   GLN E O   1 
ATOM   5818  C  CB  . GLN E  1 69  ? 51.748  -86.374  -128.077 1.00 64.04  ? 79   GLN E CB  1 
ATOM   5819  C  CG  . GLN E  1 69  ? 51.642  -87.401  -129.172 1.00 66.29  ? 79   GLN E CG  1 
ATOM   5820  C  CD  . GLN E  1 69  ? 52.971  -88.068  -129.449 1.00 67.93  ? 79   GLN E CD  1 
ATOM   5821  O  OE1 . GLN E  1 69  ? 53.691  -88.444  -128.515 1.00 68.06  ? 79   GLN E OE1 1 
ATOM   5822  N  NE2 . GLN E  1 69  ? 53.304  -88.234  -130.731 1.00 66.07  ? 79   GLN E NE2 1 
HETATM 5823  N  N   . MSE E  1 70  ? 50.951  -84.469  -125.709 1.00 66.23  ? 80   MSE E N   1 
HETATM 5824  C  CA  . MSE E  1 70  ? 51.322  -83.773  -124.494 1.00 66.69  ? 80   MSE E CA  1 
HETATM 5825  C  C   . MSE E  1 70  ? 50.328  -84.052  -123.373 1.00 65.00  ? 80   MSE E C   1 
HETATM 5826  O  O   . MSE E  1 70  ? 50.710  -84.538  -122.313 1.00 65.41  ? 80   MSE E O   1 
HETATM 5827  C  CB  . MSE E  1 70  ? 51.398  -82.278  -124.773 1.00 71.11  ? 80   MSE E CB  1 
HETATM 5828  C  CG  . MSE E  1 70  ? 52.482  -81.906  -125.774 1.00 75.47  ? 80   MSE E CG  1 
HETATM 5829  SE SE  . MSE E  1 70  ? 52.636  -79.994  -125.970 1.00 82.47  ? 80   MSE E SE  1 
HETATM 5830  C  CE  . MSE E  1 70  ? 52.769  -79.496  -124.099 1.00 79.94  ? 80   MSE E CE  1 
ATOM   5831  N  N   . GLU E  1 71  ? 49.053  -83.749  -123.611 1.00 63.31  ? 81   GLU E N   1 
ATOM   5832  C  CA  . GLU E  1 71  ? 48.014  -83.980  -122.612 1.00 61.42  ? 81   GLU E CA  1 
ATOM   5833  C  C   . GLU E  1 71  ? 47.955  -85.459  -122.299 1.00 62.14  ? 81   GLU E C   1 
ATOM   5834  O  O   . GLU E  1 71  ? 47.170  -85.895  -121.460 1.00 62.27  ? 81   GLU E O   1 
ATOM   5835  C  CB  . GLU E  1 71  ? 46.643  -83.528  -123.120 1.00 58.91  ? 81   GLU E CB  1 
ATOM   5836  C  CG  . GLU E  1 71  ? 45.536  -83.669  -122.083 1.00 56.65  ? 81   GLU E CG  1 
ATOM   5837  C  CD  . GLU E  1 71  ? 44.432  -84.640  -122.490 1.00 56.90  ? 81   GLU E CD  1 
ATOM   5838  O  OE1 . GLU E  1 71  ? 44.628  -85.435  -123.440 1.00 58.12  ? 81   GLU E OE1 1 
ATOM   5839  O  OE2 . GLU E  1 71  ? 43.361  -84.613  -121.845 1.00 54.98  ? 81   GLU E OE2 1 
HETATM 5840  N  N   . MSE E  1 72  ? 48.786  -86.233  -122.984 1.00 63.42  ? 82   MSE E N   1 
HETATM 5841  C  CA  . MSE E  1 72  ? 48.814  -87.665  -122.764 1.00 64.80  ? 82   MSE E CA  1 
HETATM 5842  C  C   . MSE E  1 72  ? 49.953  -88.004  -121.818 1.00 62.86  ? 82   MSE E C   1 
HETATM 5843  O  O   . MSE E  1 72  ? 49.763  -88.721  -120.839 1.00 62.13  ? 82   MSE E O   1 
HETATM 5844  C  CB  . MSE E  1 72  ? 48.996  -88.396  -124.089 1.00 69.83  ? 82   MSE E CB  1 
HETATM 5845  C  CG  . MSE E  1 72  ? 48.435  -89.805  -124.084 1.00 77.13  ? 82   MSE E CG  1 
HETATM 5846  SE SE  . MSE E  1 72  ? 48.793  -90.753  -125.734 1.00 88.73  ? 82   MSE E SE  1 
HETATM 5847  C  CE  . MSE E  1 72  ? 50.129  -92.041  -125.119 1.00 82.44  ? 82   MSE E CE  1 
ATOM   5848  N  N   . GLU E  1 73  ? 51.135  -87.473  -122.106 1.00 61.36  ? 83   GLU E N   1 
ATOM   5849  C  CA  . GLU E  1 73  ? 52.305  -87.721  -121.269 1.00 60.31  ? 83   GLU E CA  1 
ATOM   5850  C  C   . GLU E  1 73  ? 52.087  -87.194  -119.853 1.00 57.13  ? 83   GLU E C   1 
ATOM   5851  O  O   . GLU E  1 73  ? 52.560  -87.777  -118.879 1.00 56.31  ? 83   GLU E O   1 
ATOM   5852  C  CB  . GLU E  1 73  ? 53.533  -87.084  -121.910 1.00 61.67  ? 83   GLU E CB  1 
ATOM   5853  C  CG  . GLU E  1 73  ? 53.748  -87.599  -123.326 1.00 65.43  ? 83   GLU E CG  1 
ATOM   5854  C  CD  . GLU E  1 73  ? 54.899  -86.923  -124.031 1.00 67.60  ? 83   GLU E CD  1 
ATOM   5855  O  OE1 . GLU E  1 73  ? 54.957  -85.672  -123.997 1.00 69.69  ? 83   GLU E OE1 1 
ATOM   5856  O  OE2 . GLU E  1 73  ? 55.737  -87.638  -124.624 1.00 68.35  ? 83   GLU E OE2 1 
ATOM   5857  N  N   . ARG E  1 74  ? 51.354  -86.098  -119.742 1.00 53.19  ? 84   ARG E N   1 
ATOM   5858  C  CA  . ARG E  1 74  ? 51.066  -85.544  -118.440 1.00 50.84  ? 84   ARG E CA  1 
ATOM   5859  C  C   . ARG E  1 74  ? 50.244  -86.575  -117.667 1.00 51.15  ? 84   ARG E C   1 
ATOM   5860  O  O   . ARG E  1 74  ? 50.429  -86.754  -116.465 1.00 52.50  ? 84   ARG E O   1 
ATOM   5861  C  CB  . ARG E  1 74  ? 50.291  -84.237  -118.586 1.00 48.33  ? 84   ARG E CB  1 
ATOM   5862  C  CG  . ARG E  1 74  ? 50.971  -83.250  -119.504 1.00 46.66  ? 84   ARG E CG  1 
ATOM   5863  C  CD  . ARG E  1 74  ? 50.274  -81.905  -119.511 1.00 45.70  ? 84   ARG E CD  1 
ATOM   5864  N  NE  . ARG E  1 74  ? 50.771  -81.001  -118.476 1.00 43.79  ? 84   ARG E NE  1 
ATOM   5865  C  CZ  . ARG E  1 74  ? 50.077  -80.646  -117.402 1.00 43.12  ? 84   ARG E CZ  1 
ATOM   5866  N  NH1 . ARG E  1 74  ? 48.857  -81.122  -117.218 1.00 46.26  ? 84   ARG E NH1 1 
ATOM   5867  N  NH2 . ARG E  1 74  ? 50.590  -79.800  -116.525 1.00 41.52  ? 84   ARG E NH2 1 
ATOM   5868  N  N   . ILE E  1 75  ? 49.336  -87.257  -118.362 1.00 50.20  ? 85   ILE E N   1 
ATOM   5869  C  CA  . ILE E  1 75  ? 48.494  -88.277  -117.734 1.00 47.24  ? 85   ILE E CA  1 
ATOM   5870  C  C   . ILE E  1 75  ? 49.398  -89.424  -117.302 1.00 45.71  ? 85   ILE E C   1 
ATOM   5871  O  O   . ILE E  1 75  ? 49.242  -89.994  -116.229 1.00 44.48  ? 85   ILE E O   1 
ATOM   5872  C  CB  . ILE E  1 75  ? 47.452  -88.860  -118.728 1.00 47.67  ? 85   ILE E CB  1 
ATOM   5873  C  CG1 . ILE E  1 75  ? 46.552  -87.750  -119.300 1.00 47.58  ? 85   ILE E CG1 1 
ATOM   5874  C  CG2 . ILE E  1 75  ? 46.634  -89.946  -118.035 1.00 47.60  ? 85   ILE E CG2 1 
ATOM   5875  C  CD1 . ILE E  1 75  ? 45.447  -87.269  -118.382 1.00 46.76  ? 85   ILE E CD1 1 
ATOM   5876  N  N   . ARG E  1 76  ? 50.355  -89.756  -118.153 1.00 45.31  ? 86   ARG E N   1 
ATOM   5877  C  CA  . ARG E  1 76  ? 51.260  -90.850  -117.865 1.00 45.85  ? 86   ARG E CA  1 
ATOM   5878  C  C   . ARG E  1 76  ? 52.156  -90.514  -116.682 1.00 44.74  ? 86   ARG E C   1 
ATOM   5879  O  O   . ARG E  1 76  ? 52.373  -91.350  -115.803 1.00 45.76  ? 86   ARG E O   1 
ATOM   5880  C  CB  . ARG E  1 76  ? 52.095  -91.159  -119.094 1.00 46.23  ? 86   ARG E CB  1 
ATOM   5881  C  CG  . ARG E  1 76  ? 52.316  -92.630  -119.329 1.00 50.10  ? 86   ARG E CG  1 
ATOM   5882  C  CD  . ARG E  1 76  ? 52.948  -92.794  -120.686 1.00 56.73  ? 86   ARG E CD  1 
ATOM   5883  N  NE  . ARG E  1 76  ? 54.016  -91.808  -120.862 1.00 62.42  ? 86   ARG E NE  1 
ATOM   5884  C  CZ  . ARG E  1 76  ? 54.509  -91.426  -122.038 1.00 64.62  ? 86   ARG E CZ  1 
ATOM   5885  N  NH1 . ARG E  1 76  ? 54.036  -91.943  -123.169 1.00 65.26  ? 86   ARG E NH1 1 
ATOM   5886  N  NH2 . ARG E  1 76  ? 55.473  -90.515  -122.079 1.00 66.09  ? 86   ARG E NH2 1 
ATOM   5887  N  N   . TYR E  1 77  ? 52.680  -89.292  -116.661 1.00 42.02  ? 87   TYR E N   1 
ATOM   5888  C  CA  . TYR E  1 77  ? 53.522  -88.879  -115.557 1.00 37.84  ? 87   TYR E CA  1 
ATOM   5889  C  C   . TYR E  1 77  ? 52.797  -89.192  -114.271 1.00 34.85  ? 87   TYR E C   1 
ATOM   5890  O  O   . TYR E  1 77  ? 53.249  -90.008  -113.487 1.00 36.86  ? 87   TYR E O   1 
ATOM   5891  C  CB  . TYR E  1 77  ? 53.806  -87.383  -115.598 1.00 37.99  ? 87   TYR E CB  1 
ATOM   5892  C  CG  . TYR E  1 77  ? 54.472  -86.910  -114.330 1.00 40.53  ? 87   TYR E CG  1 
ATOM   5893  C  CD1 . TYR E  1 77  ? 55.685  -87.469  -113.908 1.00 40.14  ? 87   TYR E CD1 1 
ATOM   5894  C  CD2 . TYR E  1 77  ? 53.868  -85.949  -113.514 1.00 41.75  ? 87   TYR E CD2 1 
ATOM   5895  C  CE1 . TYR E  1 77  ? 56.274  -87.093  -112.712 1.00 40.75  ? 87   TYR E CE1 1 
ATOM   5896  C  CE2 . TYR E  1 77  ? 54.452  -85.560  -112.305 1.00 42.35  ? 87   TYR E CE2 1 
ATOM   5897  C  CZ  . TYR E  1 77  ? 55.656  -86.141  -111.911 1.00 42.76  ? 87   TYR E CZ  1 
ATOM   5898  O  OH  . TYR E  1 77  ? 56.230  -85.789  -110.708 1.00 42.94  ? 87   TYR E OH  1 
ATOM   5899  N  N   . VAL E  1 78  ? 51.659  -88.547  -114.070 1.00 32.19  ? 88   VAL E N   1 
ATOM   5900  C  CA  . VAL E  1 78  ? 50.860  -88.741  -112.865 1.00 32.34  ? 88   VAL E CA  1 
ATOM   5901  C  C   . VAL E  1 78  ? 50.537  -90.199  -112.532 1.00 34.15  ? 88   VAL E C   1 
ATOM   5902  O  O   . VAL E  1 78  ? 50.585  -90.604  -111.370 1.00 34.92  ? 88   VAL E O   1 
ATOM   5903  C  CB  . VAL E  1 78  ? 49.523  -87.973  -112.945 1.00 30.47  ? 88   VAL E CB  1 
ATOM   5904  C  CG1 . VAL E  1 78  ? 48.766  -88.117  -111.654 1.00 29.99  ? 88   VAL E CG1 1 
ATOM   5905  C  CG2 . VAL E  1 78  ? 49.770  -86.516  -113.223 1.00 30.89  ? 88   VAL E CG2 1 
ATOM   5906  N  N   . LEU E  1 79  ? 50.185  -90.998  -113.528 1.00 34.62  ? 89   LEU E N   1 
ATOM   5907  C  CA  . LEU E  1 79  ? 49.876  -92.382  -113.225 1.00 34.96  ? 89   LEU E CA  1 
ATOM   5908  C  C   . LEU E  1 79  ? 51.130  -93.094  -112.663 1.00 35.03  ? 89   LEU E C   1 
ATOM   5909  O  O   . LEU E  1 79  ? 51.058  -93.746  -111.620 1.00 33.67  ? 89   LEU E O   1 
ATOM   5910  C  CB  . LEU E  1 79  ? 49.335  -93.076  -114.477 1.00 35.06  ? 89   LEU E CB  1 
ATOM   5911  C  CG  . LEU E  1 79  ? 48.820  -94.510  -114.325 1.00 35.55  ? 89   LEU E CG  1 
ATOM   5912  C  CD1 . LEU E  1 79  ? 47.879  -94.629  -113.132 1.00 33.91  ? 89   LEU E CD1 1 
ATOM   5913  C  CD2 . LEU E  1 79  ? 48.120  -94.901  -115.609 1.00 34.88  ? 89   LEU E CD2 1 
ATOM   5914  N  N   . SER E  1 80  ? 52.270  -92.946  -113.341 1.00 34.01  ? 90   SER E N   1 
ATOM   5915  C  CA  . SER E  1 80  ? 53.529  -93.551  -112.899 1.00 35.79  ? 90   SER E CA  1 
ATOM   5916  C  C   . SER E  1 80  ? 53.923  -93.058  -111.503 1.00 36.88  ? 90   SER E C   1 
ATOM   5917  O  O   . SER E  1 80  ? 54.269  -93.847  -110.615 1.00 37.77  ? 90   SER E O   1 
ATOM   5918  C  CB  . SER E  1 80  ? 54.651  -93.208  -113.869 1.00 35.27  ? 90   SER E CB  1 
ATOM   5919  O  OG  . SER E  1 80  ? 54.360  -93.709  -115.157 1.00 39.93  ? 90   SER E OG  1 
ATOM   5920  N  N   . SER E  1 81  ? 53.894  -91.743  -111.331 1.00 34.98  ? 91   SER E N   1 
ATOM   5921  C  CA  . SER E  1 81  ? 54.209  -91.123  -110.057 1.00 34.00  ? 91   SER E CA  1 
ATOM   5922  C  C   . SER E  1 81  ? 53.393  -91.808  -108.959 1.00 34.45  ? 91   SER E C   1 
ATOM   5923  O  O   . SER E  1 81  ? 53.941  -92.493  -108.097 1.00 34.96  ? 91   SER E O   1 
ATOM   5924  C  CB  . SER E  1 81  ? 53.857  -89.635  -110.118 1.00 34.22  ? 91   SER E CB  1 
ATOM   5925  O  OG  . SER E  1 81  ? 54.119  -88.985  -108.894 1.00 34.41  ? 91   SER E OG  1 
ATOM   5926  N  N   . TYR E  1 82  ? 52.080  -91.609  -109.003 1.00 34.21  ? 92   TYR E N   1 
ATOM   5927  C  CA  . TYR E  1 82  ? 51.151  -92.202  -108.051 1.00 33.15  ? 92   TYR E CA  1 
ATOM   5928  C  C   . TYR E  1 82  ? 51.490  -93.672  -107.769 1.00 34.80  ? 92   TYR E C   1 
ATOM   5929  O  O   . TYR E  1 82  ? 51.430  -94.108  -106.623 1.00 35.50  ? 92   TYR E O   1 
ATOM   5930  C  CB  . TYR E  1 82  ? 49.729  -92.084  -108.608 1.00 32.13  ? 92   TYR E CB  1 
ATOM   5931  C  CG  . TYR E  1 82  ? 48.660  -92.878  -107.887 1.00 29.40  ? 92   TYR E CG  1 
ATOM   5932  C  CD1 . TYR E  1 82  ? 48.136  -92.443  -106.679 1.00 29.34  ? 92   TYR E CD1 1 
ATOM   5933  C  CD2 . TYR E  1 82  ? 48.165  -94.062  -108.427 1.00 29.03  ? 92   TYR E CD2 1 
ATOM   5934  C  CE1 . TYR E  1 82  ? 47.145  -93.158  -106.019 1.00 28.63  ? 92   TYR E CE1 1 
ATOM   5935  C  CE2 . TYR E  1 82  ? 47.173  -94.787  -107.774 1.00 29.95  ? 92   TYR E CE2 1 
ATOM   5936  C  CZ  . TYR E  1 82  ? 46.669  -94.326  -106.568 1.00 29.60  ? 92   TYR E CZ  1 
ATOM   5937  O  OH  . TYR E  1 82  ? 45.699  -95.044  -105.905 1.00 31.06  ? 92   TYR E OH  1 
ATOM   5938  N  N   . LEU E  1 83  ? 51.851  -94.440  -108.796 1.00 34.59  ? 93   LEU E N   1 
ATOM   5939  C  CA  . LEU E  1 83  ? 52.175  -95.846  -108.568 1.00 35.31  ? 93   LEU E CA  1 
ATOM   5940  C  C   . LEU E  1 83  ? 53.471  -96.017  -107.792 1.00 35.78  ? 93   LEU E C   1 
ATOM   5941  O  O   . LEU E  1 83  ? 53.560  -96.898  -106.925 1.00 37.13  ? 93   LEU E O   1 
ATOM   5942  C  CB  . LEU E  1 83  ? 52.254  -96.636  -109.886 1.00 34.87  ? 93   LEU E CB  1 
ATOM   5943  C  CG  . LEU E  1 83  ? 50.944  -96.869  -110.660 1.00 34.99  ? 93   LEU E CG  1 
ATOM   5944  C  CD1 . LEU E  1 83  ? 51.226  -97.827  -111.787 1.00 33.32  ? 93   LEU E CD1 1 
ATOM   5945  C  CD2 . LEU E  1 83  ? 49.838  -97.426  -109.764 1.00 31.68  ? 93   LEU E CD2 1 
ATOM   5946  N  N   . ARG E  1 84  ? 54.473  -95.194  -108.113 1.00 34.95  ? 94   ARG E N   1 
ATOM   5947  C  CA  . ARG E  1 84  ? 55.766  -95.233  -107.418 1.00 33.01  ? 94   ARG E CA  1 
ATOM   5948  C  C   . ARG E  1 84  ? 55.547  -94.970  -105.932 1.00 32.48  ? 94   ARG E C   1 
ATOM   5949  O  O   . ARG E  1 84  ? 56.012  -95.724  -105.076 1.00 32.58  ? 94   ARG E O   1 
ATOM   5950  C  CB  . ARG E  1 84  ? 56.708  -94.147  -107.923 1.00 33.40  ? 94   ARG E CB  1 
ATOM   5951  C  CG  . ARG E  1 84  ? 57.265  -94.335  -109.295 1.00 32.64  ? 94   ARG E CG  1 
ATOM   5952  C  CD  . ARG E  1 84  ? 58.408  -93.367  -109.471 1.00 32.97  ? 94   ARG E CD  1 
ATOM   5953  N  NE  . ARG E  1 84  ? 58.483  -92.881  -110.840 1.00 37.08  ? 94   ARG E NE  1 
ATOM   5954  C  CZ  . ARG E  1 84  ? 57.874  -91.784  -111.286 1.00 35.76  ? 94   ARG E CZ  1 
ATOM   5955  N  NH1 . ARG E  1 84  ? 57.143  -91.041  -110.469 1.00 35.08  ? 94   ARG E NH1 1 
ATOM   5956  N  NH2 . ARG E  1 84  ? 57.988  -91.439  -112.560 1.00 34.19  ? 94   ARG E NH2 1 
ATOM   5957  N  N   . CYS E  1 85  ? 54.847  -93.879  -105.639 1.00 29.62  ? 95   CYS E N   1 
ATOM   5958  C  CA  . CYS E  1 85  ? 54.560  -93.505  -104.272 1.00 28.00  ? 95   CYS E CA  1 
ATOM   5959  C  C   . CYS E  1 85  ? 54.070  -94.714  -103.490 1.00 29.29  ? 95   CYS E C   1 
ATOM   5960  O  O   . CYS E  1 85  ? 54.501  -94.947  -102.360 1.00 30.76  ? 95   CYS E O   1 
ATOM   5961  C  CB  . CYS E  1 85  ? 53.516  -92.404  -104.258 1.00 25.84  ? 95   CYS E CB  1 
ATOM   5962  S  SG  . CYS E  1 85  ? 53.103  -91.766  -102.640 1.00 28.70  ? 95   CYS E SG  1 
ATOM   5963  N  N   . ARG E  1 86  ? 53.181  -95.497  -104.089 1.00 30.70  ? 96   ARG E N   1 
ATOM   5964  C  CA  . ARG E  1 86  ? 52.660  -96.682  -103.415 1.00 30.61  ? 96   ARG E CA  1 
ATOM   5965  C  C   . ARG E  1 86  ? 53.702  -97.808  -103.367 1.00 30.42  ? 96   ARG E C   1 
ATOM   5966  O  O   . ARG E  1 86  ? 53.720  -98.583  -102.410 1.00 29.33  ? 96   ARG E O   1 
ATOM   5967  C  CB  . ARG E  1 86  ? 51.398  -97.209  -104.107 1.00 31.79  ? 96   ARG E CB  1 
ATOM   5968  C  CG  . ARG E  1 86  ? 50.451  -96.158  -104.651 1.00 32.17  ? 96   ARG E CG  1 
ATOM   5969  C  CD  . ARG E  1 86  ? 49.165  -96.796  -105.137 1.00 28.53  ? 96   ARG E CD  1 
ATOM   5970  N  NE  . ARG E  1 86  ? 48.248  -97.009  -104.028 1.00 28.67  ? 96   ARG E NE  1 
ATOM   5971  C  CZ  . ARG E  1 86  ? 47.851  -98.201  -103.596 1.00 31.37  ? 96   ARG E CZ  1 
ATOM   5972  N  NH1 . ARG E  1 86  ? 48.288  -99.309  -104.184 1.00 31.25  ? 96   ARG E NH1 1 
ATOM   5973  N  NH2 . ARG E  1 86  ? 47.016  -98.281  -102.566 1.00 31.68  ? 96   ARG E NH2 1 
ATOM   5974  N  N   . LEU E  1 87  ? 54.546  -97.932  -104.391 1.00 29.77  ? 97   LEU E N   1 
ATOM   5975  C  CA  . LEU E  1 87  ? 55.555  -98.988  -104.350 1.00 33.70  ? 97   LEU E CA  1 
ATOM   5976  C  C   . LEU E  1 87  ? 56.469  -98.709  -103.165 1.00 36.10  ? 97   LEU E C   1 
ATOM   5977  O  O   . LEU E  1 87  ? 56.854  -99.615  -102.419 1.00 36.06  ? 97   LEU E O   1 
ATOM   5978  C  CB  . LEU E  1 87  ? 56.386  -99.029  -105.631 1.00 33.86  ? 97   LEU E CB  1 
ATOM   5979  C  CG  . LEU E  1 87  ? 55.920  -99.942  -106.773 1.00 36.65  ? 97   LEU E CG  1 
ATOM   5980  C  CD1 . LEU E  1 87  ? 57.076  -100.103 -107.763 1.00 34.81  ? 97   LEU E CD1 1 
ATOM   5981  C  CD2 . LEU E  1 87  ? 55.488  -101.319 -106.237 1.00 34.38  ? 97   LEU E CD2 1 
HETATM 5982  N  N   . MSE E  1 88  ? 56.790  -97.429  -103.006 1.00 37.82  ? 98   MSE E N   1 
HETATM 5983  C  CA  . MSE E  1 88  ? 57.634  -96.935  -101.938 1.00 37.36  ? 98   MSE E CA  1 
HETATM 5984  C  C   . MSE E  1 88  ? 57.033  -97.330  -100.589 1.00 33.36  ? 98   MSE E C   1 
HETATM 5985  O  O   . MSE E  1 88  ? 57.710  -97.923  -99.746  1.00 33.55  ? 98   MSE E O   1 
HETATM 5986  C  CB  . MSE E  1 88  ? 57.747  -95.405  -102.066 1.00 46.22  ? 98   MSE E CB  1 
HETATM 5987  C  CG  . MSE E  1 88  ? 58.712  -94.692  -101.089 1.00 58.31  ? 98   MSE E CG  1 
HETATM 5988  SE SE  . MSE E  1 88  ? 57.959  -94.062  -99.387  1.00 74.80  ? 98   MSE E SE  1 
HETATM 5989  C  CE  . MSE E  1 88  ? 57.456  -92.263  -99.950  1.00 70.55  ? 98   MSE E CE  1 
ATOM   5990  N  N   . LYS E  1 89  ? 55.760  -97.019  -100.384 1.00 27.46  ? 99   LYS E N   1 
ATOM   5991  C  CA  . LYS E  1 89  ? 55.120  -97.345  -99.121  1.00 24.83  ? 99   LYS E CA  1 
ATOM   5992  C  C   . LYS E  1 89  ? 55.051  -98.851  -98.868  1.00 25.85  ? 99   LYS E C   1 
ATOM   5993  O  O   . LYS E  1 89  ? 55.230  -99.311  -97.747  1.00 25.67  ? 99   LYS E O   1 
ATOM   5994  C  CB  . LYS E  1 89  ? 53.714  -96.750  -99.065  1.00 22.16  ? 99   LYS E CB  1 
ATOM   5995  C  CG  . LYS E  1 89  ? 53.649  -95.284  -99.397  1.00 18.46  ? 99   LYS E CG  1 
ATOM   5996  C  CD  . LYS E  1 89  ? 52.433  -94.653  -98.746  1.00 16.06  ? 99   LYS E CD  1 
ATOM   5997  C  CE  . LYS E  1 89  ? 52.121  -93.287  -99.351  1.00 11.02  ? 99   LYS E CE  1 
ATOM   5998  N  NZ  . LYS E  1 89  ? 50.848  -92.802  -98.744  1.00 13.56  ? 99   LYS E NZ  1 
ATOM   5999  N  N   . ILE E  1 90  ? 54.773  -99.614  -99.914  1.00 27.96  ? 100  ILE E N   1 
ATOM   6000  C  CA  . ILE E  1 90  ? 54.691  -101.053 -99.805  1.00 28.48  ? 100  ILE E CA  1 
ATOM   6001  C  C   . ILE E  1 90  ? 56.040  -101.583 -99.349  1.00 29.69  ? 100  ILE E C   1 
ATOM   6002  O  O   . ILE E  1 90  ? 56.132  -102.260 -98.331  1.00 29.94  ? 100  ILE E O   1 
ATOM   6003  C  CB  . ILE E  1 90  ? 54.269  -101.642 -101.164 1.00 29.30  ? 100  ILE E CB  1 
ATOM   6004  C  CG1 . ILE E  1 90  ? 52.762  -101.425 -101.328 1.00 29.80  ? 100  ILE E CG1 1 
ATOM   6005  C  CG2 . ILE E  1 90  ? 54.637  -103.114 -101.278 1.00 28.54  ? 100  ILE E CG2 1 
ATOM   6006  C  CD1 . ILE E  1 90  ? 52.273  -101.549 -102.743 1.00 27.91  ? 100  ILE E CD1 1 
ATOM   6007  N  N   . GLU E  1 91  ? 57.091  -101.252 -100.087 1.00 30.96  ? 101  GLU E N   1 
ATOM   6008  C  CA  . GLU E  1 91  ? 58.426  -101.708 -99.736  1.00 32.35  ? 101  GLU E CA  1 
ATOM   6009  C  C   . GLU E  1 91  ? 58.816  -101.252 -98.327  1.00 33.87  ? 101  GLU E C   1 
ATOM   6010  O  O   . GLU E  1 91  ? 59.503  -101.961 -97.584  1.00 35.32  ? 101  GLU E O   1 
ATOM   6011  C  CB  . GLU E  1 91  ? 59.450  -101.162 -100.731 1.00 32.09  ? 101  GLU E CB  1 
ATOM   6012  C  CG  . GLU E  1 91  ? 59.329  -101.691 -102.151 1.00 36.50  ? 101  GLU E CG  1 
ATOM   6013  C  CD  . GLU E  1 91  ? 60.424  -101.139 -103.080 1.00 40.52  ? 101  GLU E CD  1 
ATOM   6014  O  OE1 . GLU E  1 91  ? 61.613  -101.453 -102.873 1.00 42.41  ? 101  GLU E OE1 1 
ATOM   6015  O  OE2 . GLU E  1 91  ? 60.103  -100.384 -104.021 1.00 42.80  ? 101  GLU E OE2 1 
ATOM   6016  N  N   . LYS E  1 92  ? 58.372  -100.064 -97.956  1.00 33.34  ? 102  LYS E N   1 
ATOM   6017  C  CA  . LYS E  1 92  ? 58.727  -99.515  -96.664  1.00 34.18  ? 102  LYS E CA  1 
ATOM   6018  C  C   . LYS E  1 92  ? 58.073  -100.206 -95.482  1.00 33.59  ? 102  LYS E C   1 
ATOM   6019  O  O   . LYS E  1 92  ? 58.706  -100.419 -94.462  1.00 34.58  ? 102  LYS E O   1 
ATOM   6020  C  CB  . LYS E  1 92  ? 58.407  -98.017  -96.636  1.00 35.76  ? 102  LYS E CB  1 
ATOM   6021  C  CG  . LYS E  1 92  ? 58.879  -97.337  -95.380  1.00 39.18  ? 102  LYS E CG  1 
ATOM   6022  C  CD  . LYS E  1 92  ? 58.603  -95.850  -95.372  1.00 41.30  ? 102  LYS E CD  1 
ATOM   6023  C  CE  . LYS E  1 92  ? 59.004  -95.246  -94.024  1.00 43.24  ? 102  LYS E CE  1 
ATOM   6024  N  NZ  . LYS E  1 92  ? 58.575  -93.824  -93.873  1.00 44.76  ? 102  LYS E NZ  1 
ATOM   6025  N  N   . PHE E  1 93  ? 56.805  -100.554 -95.623  1.00 34.27  ? 103  PHE E N   1 
ATOM   6026  C  CA  . PHE E  1 93  ? 56.062  -101.200 -94.555  1.00 35.19  ? 103  PHE E CA  1 
ATOM   6027  C  C   . PHE E  1 93  ? 55.608  -102.604 -94.935  1.00 35.65  ? 103  PHE E C   1 
ATOM   6028  O  O   . PHE E  1 93  ? 54.678  -103.124 -94.316  1.00 35.85  ? 103  PHE E O   1 
ATOM   6029  C  CB  . PHE E  1 93  ? 54.807  -100.391 -94.246  1.00 37.09  ? 103  PHE E CB  1 
ATOM   6030  C  CG  . PHE E  1 93  ? 55.055  -98.939  -94.021  1.00 41.00  ? 103  PHE E CG  1 
ATOM   6031  C  CD1 . PHE E  1 93  ? 55.596  -98.487  -92.820  1.00 43.16  ? 103  PHE E CD1 1 
ATOM   6032  C  CD2 . PHE E  1 93  ? 54.726  -98.010  -95.001  1.00 42.90  ? 103  PHE E CD2 1 
ATOM   6033  C  CE1 . PHE E  1 93  ? 55.804  -97.127  -92.598  1.00 43.40  ? 103  PHE E CE1 1 
ATOM   6034  C  CE2 . PHE E  1 93  ? 54.928  -96.642  -94.790  1.00 43.24  ? 103  PHE E CE2 1 
ATOM   6035  C  CZ  . PHE E  1 93  ? 55.468  -96.202  -93.585  1.00 43.72  ? 103  PHE E CZ  1 
ATOM   6036  N  N   . PHE E  1 94  ? 56.254  -103.225 -95.920  1.00 35.53  ? 104  PHE E N   1 
ATOM   6037  C  CA  . PHE E  1 94  ? 55.813  -104.536 -96.389  1.00 35.15  ? 104  PHE E CA  1 
ATOM   6038  C  C   . PHE E  1 94  ? 55.248  -105.497 -95.345  1.00 35.32  ? 104  PHE E C   1 
ATOM   6039  O  O   . PHE E  1 94  ? 54.188  -106.075 -95.554  1.00 36.05  ? 104  PHE E O   1 
ATOM   6040  C  CB  . PHE E  1 94  ? 56.898  -105.211 -97.260  1.00 35.06  ? 104  PHE E CB  1 
ATOM   6041  C  CG  . PHE E  1 94  ? 58.122  -105.655 -96.516  1.00 37.03  ? 104  PHE E CG  1 
ATOM   6042  C  CD1 . PHE E  1 94  ? 58.142  -106.877 -95.830  1.00 36.80  ? 104  PHE E CD1 1 
ATOM   6043  C  CD2 . PHE E  1 94  ? 59.269  -104.864 -96.507  1.00 35.62  ? 104  PHE E CD2 1 
ATOM   6044  C  CE1 . PHE E  1 94  ? 59.290  -107.302 -95.144  1.00 35.10  ? 104  PHE E CE1 1 
ATOM   6045  C  CE2 . PHE E  1 94  ? 60.419  -105.285 -95.822  1.00 35.68  ? 104  PHE E CE2 1 
ATOM   6046  C  CZ  . PHE E  1 94  ? 60.424  -106.506 -95.141  1.00 34.28  ? 104  PHE E CZ  1 
ATOM   6047  N  N   . PRO E  1 95  ? 55.897  -105.635 -94.186  1.00 35.65  ? 105  PRO E N   1 
ATOM   6048  C  CA  . PRO E  1 95  ? 55.364  -106.558 -93.181  1.00 35.58  ? 105  PRO E CA  1 
ATOM   6049  C  C   . PRO E  1 95  ? 53.947  -106.260 -92.714  1.00 35.42  ? 105  PRO E C   1 
ATOM   6050  O  O   . PRO E  1 95  ? 53.144  -107.161 -92.521  1.00 35.98  ? 105  PRO E O   1 
ATOM   6051  C  CB  . PRO E  1 95  ? 56.354  -106.420 -92.026  1.00 35.09  ? 105  PRO E CB  1 
ATOM   6052  C  CG  . PRO E  1 95  ? 57.605  -105.996 -92.689  1.00 36.12  ? 105  PRO E CG  1 
ATOM   6053  C  CD  . PRO E  1 95  ? 57.104  -104.974 -93.670  1.00 37.11  ? 105  PRO E CD  1 
ATOM   6054  N  N   . HIS E  1 96  ? 53.654  -104.983 -92.518  1.00 38.31  ? 106  HIS E N   1 
ATOM   6055  C  CA  . HIS E  1 96  ? 52.356  -104.547 -92.006  1.00 38.51  ? 106  HIS E CA  1 
ATOM   6056  C  C   . HIS E  1 96  ? 51.300  -104.442 -93.087  1.00 37.72  ? 106  HIS E C   1 
ATOM   6057  O  O   . HIS E  1 96  ? 50.100  -104.558 -92.833  1.00 36.41  ? 106  HIS E O   1 
ATOM   6058  C  CB  . HIS E  1 96  ? 52.548  -103.218 -91.273  1.00 39.28  ? 106  HIS E CB  1 
ATOM   6059  C  CG  . HIS E  1 96  ? 53.657  -103.267 -90.269  1.00 40.75  ? 106  HIS E CG  1 
ATOM   6060  N  ND1 . HIS E  1 96  ? 54.975  -103.050 -90.611  1.00 41.63  ? 106  HIS E ND1 1 
ATOM   6061  C  CD2 . HIS E  1 96  ? 53.665  -103.652 -88.970  1.00 40.50  ? 106  HIS E CD2 1 
ATOM   6062  C  CE1 . HIS E  1 96  ? 55.746  -103.308 -89.569  1.00 41.52  ? 106  HIS E CE1 1 
ATOM   6063  N  NE2 . HIS E  1 96  ? 54.976  -103.676 -88.562  1.00 40.17  ? 106  HIS E NE2 1 
ATOM   6064  N  N   . VAL E  1 97  ? 51.767  -104.239 -94.305  1.00 36.73  ? 107  VAL E N   1 
ATOM   6065  C  CA  . VAL E  1 97  ? 50.881  -104.153 -95.433  1.00 35.23  ? 107  VAL E CA  1 
ATOM   6066  C  C   . VAL E  1 97  ? 50.260  -105.546 -95.648  1.00 34.53  ? 107  VAL E C   1 
ATOM   6067  O  O   . VAL E  1 97  ? 49.053  -105.676 -95.845  1.00 33.59  ? 107  VAL E O   1 
ATOM   6068  C  CB  . VAL E  1 97  ? 51.675  -103.650 -96.649  1.00 34.62  ? 107  VAL E CB  1 
ATOM   6069  C  CG1 . VAL E  1 97  ? 51.399  -104.491 -97.857  1.00 36.68  ? 107  VAL E CG1 1 
ATOM   6070  C  CG2 . VAL E  1 97  ? 51.333  -102.200 -96.900  1.00 32.53  ? 107  VAL E CG2 1 
ATOM   6071  N  N   . LEU E  1 98  ? 51.081  -106.588 -95.574  1.00 33.38  ? 108  LEU E N   1 
ATOM   6072  C  CA  . LEU E  1 98  ? 50.586  -107.951 -95.749  1.00 32.68  ? 108  LEU E CA  1 
ATOM   6073  C  C   . LEU E  1 98  ? 49.647  -108.362 -94.604  1.00 33.01  ? 108  LEU E C   1 
ATOM   6074  O  O   . LEU E  1 98  ? 48.570  -108.901 -94.837  1.00 33.24  ? 108  LEU E O   1 
ATOM   6075  C  CB  . LEU E  1 98  ? 51.765  -108.921 -95.855  1.00 28.54  ? 108  LEU E CB  1 
ATOM   6076  C  CG  . LEU E  1 98  ? 52.641  -108.619 -97.065  1.00 25.91  ? 108  LEU E CG  1 
ATOM   6077  C  CD1 . LEU E  1 98  ? 53.912  -109.407 -97.007  1.00 22.49  ? 108  LEU E CD1 1 
ATOM   6078  C  CD2 . LEU E  1 98  ? 51.873  -108.921 -98.328  1.00 26.90  ? 108  LEU E CD2 1 
ATOM   6079  N  N   . GLU E  1 99  ? 50.064  -108.112 -93.371  1.00 33.94  ? 109  GLU E N   1 
ATOM   6080  C  CA  . GLU E  1 99  ? 49.248  -108.427 -92.203  1.00 36.90  ? 109  GLU E CA  1 
ATOM   6081  C  C   . GLU E  1 99  ? 47.846  -107.876 -92.377  1.00 37.41  ? 109  GLU E C   1 
ATOM   6082  O  O   . GLU E  1 99  ? 46.861  -108.588 -92.208  1.00 37.61  ? 109  GLU E O   1 
ATOM   6083  C  CB  . GLU E  1 99  ? 49.852  -107.787 -90.956  1.00 40.15  ? 109  GLU E CB  1 
ATOM   6084  C  CG  . GLU E  1 99  ? 50.735  -108.686 -90.141  1.00 44.89  ? 109  GLU E CG  1 
ATOM   6085  C  CD  . GLU E  1 99  ? 49.939  -109.657 -89.315  1.00 46.64  ? 109  GLU E CD  1 
ATOM   6086  O  OE1 . GLU E  1 99  ? 48.973  -109.194 -88.672  1.00 47.63  ? 109  GLU E OE1 1 
ATOM   6087  O  OE2 . GLU E  1 99  ? 50.285  -110.863 -89.304  1.00 46.60  ? 109  GLU E OE2 1 
ATOM   6088  N  N   . LYS E  1 100 ? 47.783  -106.586 -92.698  1.00 37.97  ? 110  LYS E N   1 
ATOM   6089  C  CA  . LYS E  1 100 ? 46.534  -105.872 -92.895  1.00 38.60  ? 110  LYS E CA  1 
ATOM   6090  C  C   . LYS E  1 100 ? 45.676  -106.490 -93.990  1.00 38.66  ? 110  LYS E C   1 
ATOM   6091  O  O   . LYS E  1 100 ? 44.462  -106.522 -93.874  1.00 38.48  ? 110  LYS E O   1 
ATOM   6092  C  CB  . LYS E  1 100 ? 46.832  -104.417 -93.244  1.00 40.32  ? 110  LYS E CB  1 
ATOM   6093  C  CG  . LYS E  1 100 ? 45.637  -103.455 -93.229  1.00 42.06  ? 110  LYS E CG  1 
ATOM   6094  C  CD  . LYS E  1 100 ? 46.074  -102.127 -93.844  1.00 45.41  ? 110  LYS E CD  1 
ATOM   6095  C  CE  . LYS E  1 100 ? 45.146  -100.957 -93.541  1.00 47.10  ? 110  LYS E CE  1 
ATOM   6096  N  NZ  . LYS E  1 100 ? 45.722  -99.695  -94.127  1.00 47.95  ? 110  LYS E NZ  1 
ATOM   6097  N  N   . GLU E  1 101 ? 46.294  -106.976 -95.057  1.00 39.04  ? 111  GLU E N   1 
ATOM   6098  C  CA  . GLU E  1 101 ? 45.509  -107.575 -96.126  1.00 40.95  ? 111  GLU E CA  1 
ATOM   6099  C  C   . GLU E  1 101 ? 44.780  -108.796 -95.594  1.00 41.69  ? 111  GLU E C   1 
ATOM   6100  O  O   . GLU E  1 101 ? 43.558  -108.796 -95.456  1.00 42.02  ? 111  GLU E O   1 
ATOM   6101  C  CB  . GLU E  1 101 ? 46.392  -108.003 -97.295  1.00 40.97  ? 111  GLU E CB  1 
ATOM   6102  C  CG  . GLU E  1 101 ? 45.892  -107.500 -98.637  1.00 46.05  ? 111  GLU E CG  1 
ATOM   6103  C  CD  . GLU E  1 101 ? 44.373  -107.571 -98.785  1.00 47.82  ? 111  GLU E CD  1 
ATOM   6104  O  OE1 . GLU E  1 101 ? 43.822  -108.685 -98.940  1.00 48.53  ? 111  GLU E OE1 1 
ATOM   6105  O  OE2 . GLU E  1 101 ? 43.732  -106.499 -98.741  1.00 49.40  ? 111  GLU E OE2 1 
ATOM   6106  N  N   . LYS E  1 102 ? 45.553  -109.828 -95.287  1.00 42.21  ? 112  LYS E N   1 
ATOM   6107  C  CA  . LYS E  1 102 ? 45.019  -111.080 -94.784  1.00 43.48  ? 112  LYS E CA  1 
ATOM   6108  C  C   . LYS E  1 102 ? 44.173  -110.932 -93.535  1.00 44.69  ? 112  LYS E C   1 
ATOM   6109  O  O   . LYS E  1 102 ? 43.425  -111.842 -93.168  1.00 45.72  ? 112  LYS E O   1 
ATOM   6110  C  CB  . LYS E  1 102 ? 46.155  -112.053 -94.479  1.00 43.10  ? 112  LYS E CB  1 
ATOM   6111  C  CG  . LYS E  1 102 ? 47.023  -111.640 -93.318  1.00 39.36  ? 112  LYS E CG  1 
ATOM   6112  C  CD  . LYS E  1 102 ? 48.025  -112.728 -92.974  1.00 38.56  ? 112  LYS E CD  1 
ATOM   6113  C  CE  . LYS E  1 102 ? 48.891  -113.112 -94.156  1.00 33.62  ? 112  LYS E CE  1 
ATOM   6114  N  NZ  . LYS E  1 102 ? 49.929  -114.075 -93.705  1.00 35.80  ? 112  LYS E NZ  1 
ATOM   6115  N  N   . THR E  1 103 ? 44.276  -109.794 -92.874  1.00 45.07  ? 113  THR E N   1 
ATOM   6116  C  CA  . THR E  1 103 ? 43.510  -109.632 -91.665  1.00 47.53  ? 113  THR E CA  1 
ATOM   6117  C  C   . THR E  1 103 ? 42.230  -108.847 -91.878  1.00 49.52  ? 113  THR E C   1 
ATOM   6118  O  O   . THR E  1 103 ? 41.470  -108.636 -90.943  1.00 49.19  ? 113  THR E O   1 
ATOM   6119  C  CB  . THR E  1 103 ? 44.369  -108.974 -90.586  1.00 47.35  ? 113  THR E CB  1 
ATOM   6120  O  OG1 . THR E  1 103 ? 44.018  -109.514 -89.307  1.00 47.94  ? 113  THR E OG1 1 
ATOM   6121  C  CG2 . THR E  1 103 ? 44.174  -107.477 -90.587  1.00 47.67  ? 113  THR E CG2 1 
ATOM   6122  N  N   . ARG E  1 104 ? 41.985  -108.439 -93.120  1.00 53.64  ? 114  ARG E N   1 
ATOM   6123  C  CA  . ARG E  1 104 ? 40.800  -107.664 -93.472  1.00 56.67  ? 114  ARG E CA  1 
ATOM   6124  C  C   . ARG E  1 104 ? 39.585  -108.486 -93.865  1.00 57.66  ? 114  ARG E C   1 
ATOM   6125  O  O   . ARG E  1 104 ? 39.699  -109.530 -94.515  1.00 57.57  ? 114  ARG E O   1 
ATOM   6126  C  CB  . ARG E  1 104 ? 41.123  -106.712 -94.617  1.00 60.75  ? 114  ARG E CB  1 
ATOM   6127  C  CG  . ARG E  1 104 ? 41.467  -105.288 -94.184  1.00 69.30  ? 114  ARG E CG  1 
ATOM   6128  C  CD  . ARG E  1 104 ? 42.354  -104.627 -95.232  1.00 73.50  ? 114  ARG E CD  1 
ATOM   6129  N  NE  . ARG E  1 104 ? 42.329  -103.168 -95.190  1.00 76.41  ? 114  ARG E NE  1 
ATOM   6130  C  CZ  . ARG E  1 104 ? 43.004  -102.401 -96.044  1.00 78.95  ? 114  ARG E CZ  1 
ATOM   6131  N  NH1 . ARG E  1 104 ? 43.756  -102.962 -96.989  1.00 79.02  ? 114  ARG E NH1 1 
ATOM   6132  N  NH2 . ARG E  1 104 ? 42.908  -101.077 -95.973  1.00 78.93  ? 114  ARG E NH2 1 
ATOM   6133  N  N   . PRO E  1 105 ? 38.392  -108.015 -93.469  1.00 58.66  ? 115  PRO E N   1 
ATOM   6134  C  CA  . PRO E  1 105 ? 37.103  -108.661 -93.758  1.00 60.26  ? 115  PRO E CA  1 
ATOM   6135  C  C   . PRO E  1 105 ? 36.724  -108.344 -95.213  1.00 62.14  ? 115  PRO E C   1 
ATOM   6136  O  O   . PRO E  1 105 ? 36.691  -107.171 -95.572  1.00 63.23  ? 115  PRO E O   1 
ATOM   6137  C  CB  . PRO E  1 105 ? 36.168  -108.003 -92.748  1.00 58.54  ? 115  PRO E CB  1 
ATOM   6138  C  CG  . PRO E  1 105 ? 36.737  -106.612 -92.629  1.00 57.28  ? 115  PRO E CG  1 
ATOM   6139  C  CD  . PRO E  1 105 ? 38.218  -106.867 -92.558  1.00 57.39  ? 115  PRO E CD  1 
ATOM   6140  N  N   . GLU E  1 106 ? 36.427  -109.363 -96.032  1.00 63.88  ? 116  GLU E N   1 
ATOM   6141  C  CA  . GLU E  1 106 ? 36.117  -109.158 -97.462  1.00 64.54  ? 116  GLU E CA  1 
ATOM   6142  C  C   . GLU E  1 106 ? 35.331  -107.895 -97.848  1.00 64.97  ? 116  GLU E C   1 
ATOM   6143  O  O   . GLU E  1 106 ? 35.474  -107.400 -98.972  1.00 64.18  ? 116  GLU E O   1 
ATOM   6144  C  CB  . GLU E  1 106 ? 35.450  -110.395 -98.070  1.00 64.20  ? 116  GLU E CB  1 
ATOM   6145  C  CG  . GLU E  1 106 ? 35.322  -110.328 -99.611  1.00 64.09  ? 116  GLU E CG  1 
ATOM   6146  C  CD  . GLU E  1 106 ? 36.629  -109.959 -100.342 1.00 62.72  ? 116  GLU E CD  1 
ATOM   6147  O  OE1 . GLU E  1 106 ? 37.639  -110.682 -100.197 1.00 60.63  ? 116  GLU E OE1 1 
ATOM   6148  O  OE2 . GLU E  1 106 ? 36.639  -108.945 -101.075 1.00 61.03  ? 116  GLU E OE2 1 
ATOM   6149  N  N   . GLY E  1 107 ? 34.490  -107.389 -96.945  1.00 65.40  ? 117  GLY E N   1 
ATOM   6150  C  CA  . GLY E  1 107 ? 33.804  -106.132 -97.214  1.00 65.82  ? 117  GLY E CA  1 
ATOM   6151  C  C   . GLY E  1 107 ? 34.906  -105.154 -96.819  1.00 66.17  ? 117  GLY E C   1 
ATOM   6152  O  O   . GLY E  1 107 ? 34.785  -104.354 -95.888  1.00 66.58  ? 117  GLY E O   1 
ATOM   6153  N  N   . GLU E  1 108 ? 36.005  -105.250 -97.557  1.00 65.53  ? 118  GLU E N   1 
ATOM   6154  C  CA  . GLU E  1 108 ? 37.214  -104.490 -97.292  1.00 64.22  ? 118  GLU E CA  1 
ATOM   6155  C  C   . GLU E  1 108 ? 37.751  -103.665 -98.440  1.00 62.27  ? 118  GLU E C   1 
ATOM   6156  O  O   . GLU E  1 108 ? 37.975  -104.192 -99.534  1.00 63.03  ? 118  GLU E O   1 
ATOM   6157  C  CB  . GLU E  1 108 ? 38.339  -105.467 -96.927  1.00 66.34  ? 118  GLU E CB  1 
ATOM   6158  C  CG  . GLU E  1 108 ? 38.600  -106.483 -98.083  1.00 66.69  ? 118  GLU E CG  1 
ATOM   6159  C  CD  . GLU E  1 108 ? 39.985  -107.114 -98.067  1.00 67.80  ? 118  GLU E CD  1 
ATOM   6160  O  OE1 . GLU E  1 108 ? 40.970  -106.384 -97.827  1.00 67.89  ? 118  GLU E OE1 1 
ATOM   6161  O  OE2 . GLU E  1 108 ? 40.090  -108.337 -98.314  1.00 67.65  ? 118  GLU E OE2 1 
ATOM   6162  N  N   . PRO E  1 109 ? 37.926  -102.355 -98.237  1.00 59.51  ? 119  PRO E N   1 
ATOM   6163  C  CA  . PRO E  1 109 ? 38.493  -101.734 -99.432  1.00 56.00  ? 119  PRO E CA  1 
ATOM   6164  C  C   . PRO E  1 109 ? 39.980  -102.066 -99.219  1.00 52.99  ? 119  PRO E C   1 
ATOM   6165  O  O   . PRO E  1 109 ? 40.626  -101.520 -98.326  1.00 52.73  ? 119  PRO E O   1 
ATOM   6166  C  CB  . PRO E  1 109 ? 38.177  -100.253 -99.239  1.00 54.86  ? 119  PRO E CB  1 
ATOM   6167  C  CG  . PRO E  1 109 ? 36.909  -100.286 -98.465  1.00 56.03  ? 119  PRO E CG  1 
ATOM   6168  C  CD  . PRO E  1 109 ? 37.192  -101.364 -97.433  1.00 58.58  ? 119  PRO E CD  1 
ATOM   6169  N  N   . SER E  1 110 ? 40.491  -103.021 -99.985  1.00 49.47  ? 120  SER E N   1 
ATOM   6170  C  CA  . SER E  1 110 ? 41.886  -103.429 -99.880  1.00 46.59  ? 120  SER E CA  1 
ATOM   6171  C  C   . SER E  1 110 ? 42.810  -102.254 -100.194 1.00 45.64  ? 120  SER E C   1 
ATOM   6172  O  O   . SER E  1 110 ? 42.438  -101.344 -100.945 1.00 46.30  ? 120  SER E O   1 
ATOM   6173  C  CB  . SER E  1 110 ? 42.163  -104.572 -100.861 1.00 45.04  ? 120  SER E CB  1 
ATOM   6174  O  OG  . SER E  1 110 ? 43.549  -104.853 -100.970 1.00 43.54  ? 120  SER E OG  1 
ATOM   6175  N  N   . SER E  1 111 ? 44.009  -102.262 -99.617  1.00 42.86  ? 121  SER E N   1 
ATOM   6176  C  CA  . SER E  1 111 ? 44.965  -101.194 -99.886  1.00 39.80  ? 121  SER E CA  1 
ATOM   6177  C  C   . SER E  1 111 ? 45.980  -101.739 -100.859 1.00 38.43  ? 121  SER E C   1 
ATOM   6178  O  O   . SER E  1 111 ? 46.891  -101.039 -101.293 1.00 39.42  ? 121  SER E O   1 
ATOM   6179  C  CB  . SER E  1 111 ? 45.651  -100.734 -98.605  1.00 38.27  ? 121  SER E CB  1 
ATOM   6180  O  OG  . SER E  1 111 ? 44.713  -100.187 -97.695  1.00 37.41  ? 121  SER E OG  1 
ATOM   6181  N  N   . LEU E  1 112 ? 45.801  -103.002 -101.215 1.00 37.29  ? 122  LEU E N   1 
ATOM   6182  C  CA  . LEU E  1 112 ? 46.698  -103.654 -102.152 1.00 37.84  ? 122  LEU E CA  1 
ATOM   6183  C  C   . LEU E  1 112 ? 45.978  -104.154 -103.401 1.00 38.63  ? 122  LEU E C   1 
ATOM   6184  O  O   . LEU E  1 112 ? 44.967  -104.846 -103.306 1.00 40.78  ? 122  LEU E O   1 
ATOM   6185  C  CB  . LEU E  1 112 ? 47.386  -104.836 -101.477 1.00 35.96  ? 122  LEU E CB  1 
ATOM   6186  C  CG  . LEU E  1 112 ? 48.396  -104.547 -100.377 1.00 35.16  ? 122  LEU E CG  1 
ATOM   6187  C  CD1 . LEU E  1 112 ? 48.858  -105.861 -99.790  1.00 35.48  ? 122  LEU E CD1 1 
ATOM   6188  C  CD2 . LEU E  1 112 ? 49.569  -103.778 -100.945 1.00 33.69  ? 122  LEU E CD2 1 
ATOM   6189  N  N   . SER E  1 113 ? 46.480  -103.790 -104.574 1.00 38.88  ? 123  SER E N   1 
ATOM   6190  C  CA  . SER E  1 113 ? 45.882  -104.290 -105.796 1.00 38.83  ? 123  SER E CA  1 
ATOM   6191  C  C   . SER E  1 113 ? 46.483  -105.692 -105.819 1.00 39.49  ? 123  SER E C   1 
ATOM   6192  O  O   . SER E  1 113 ? 47.552  -105.910 -105.248 1.00 41.29  ? 123  SER E O   1 
ATOM   6193  C  CB  . SER E  1 113 ? 46.366  -103.497 -107.008 1.00 39.02  ? 123  SER E CB  1 
ATOM   6194  O  OG  . SER E  1 113 ? 47.612  -103.985 -107.481 1.00 40.20  ? 123  SER E OG  1 
ATOM   6195  N  N   . PRO E  1 114 ? 45.812  -106.665 -106.453 1.00 38.67  ? 124  PRO E N   1 
ATOM   6196  C  CA  . PRO E  1 114 ? 46.400  -108.009 -106.468 1.00 37.23  ? 124  PRO E CA  1 
ATOM   6197  C  C   . PRO E  1 114 ? 47.802  -108.118 -107.070 1.00 37.04  ? 124  PRO E C   1 
ATOM   6198  O  O   . PRO E  1 114 ? 48.547  -109.026 -106.729 1.00 36.02  ? 124  PRO E O   1 
ATOM   6199  C  CB  . PRO E  1 114 ? 45.362  -108.834 -107.226 1.00 35.81  ? 124  PRO E CB  1 
ATOM   6200  C  CG  . PRO E  1 114 ? 44.666  -107.823 -108.071 1.00 36.34  ? 124  PRO E CG  1 
ATOM   6201  C  CD  . PRO E  1 114 ? 44.522  -106.646 -107.161 1.00 37.31  ? 124  PRO E CD  1 
ATOM   6202  N  N   . GLU E  1 115 ? 48.170  -107.200 -107.956 1.00 38.44  ? 125  GLU E N   1 
ATOM   6203  C  CA  . GLU E  1 115 ? 49.499  -107.256 -108.557 1.00 41.17  ? 125  GLU E CA  1 
ATOM   6204  C  C   . GLU E  1 115 ? 50.544  -106.740 -107.568 1.00 41.62  ? 125  GLU E C   1 
ATOM   6205  O  O   . GLU E  1 115 ? 51.728  -107.100 -107.635 1.00 40.07  ? 125  GLU E O   1 
ATOM   6206  C  CB  . GLU E  1 115 ? 49.551  -106.441 -109.859 1.00 44.63  ? 125  GLU E CB  1 
ATOM   6207  C  CG  . GLU E  1 115 ? 48.291  -105.641 -110.201 1.00 49.88  ? 125  GLU E CG  1 
ATOM   6208  C  CD  . GLU E  1 115 ? 47.122  -106.506 -110.663 1.00 52.16  ? 125  GLU E CD  1 
ATOM   6209  O  OE1 . GLU E  1 115 ? 47.289  -107.286 -111.630 1.00 53.41  ? 125  GLU E OE1 1 
ATOM   6210  O  OE2 . GLU E  1 115 ? 46.031  -106.391 -110.061 1.00 52.58  ? 125  GLU E OE2 1 
ATOM   6211  N  N   . GLU E  1 116 ? 50.091  -105.888 -106.649 1.00 41.66  ? 126  GLU E N   1 
ATOM   6212  C  CA  . GLU E  1 116 ? 50.957  -105.325 -105.620 1.00 39.79  ? 126  GLU E CA  1 
ATOM   6213  C  C   . GLU E  1 116 ? 51.172  -106.425 -104.597 1.00 38.99  ? 126  GLU E C   1 
ATOM   6214  O  O   . GLU E  1 116 ? 52.308  -106.748 -104.255 1.00 40.70  ? 126  GLU E O   1 
ATOM   6215  C  CB  . GLU E  1 116 ? 50.309  -104.080 -104.993 1.00 37.35  ? 126  GLU E CB  1 
ATOM   6216  C  CG  . GLU E  1 116 ? 50.578  -102.811 -105.802 1.00 37.67  ? 126  GLU E CG  1 
ATOM   6217  C  CD  . GLU E  1 116 ? 49.723  -101.626 -105.380 1.00 38.93  ? 126  GLU E CD  1 
ATOM   6218  O  OE1 . GLU E  1 116 ? 50.018  -100.475 -105.814 1.00 37.62  ? 126  GLU E OE1 1 
ATOM   6219  O  OE2 . GLU E  1 116 ? 48.753  -101.853 -104.621 1.00 38.46  ? 126  GLU E OE2 1 
ATOM   6220  N  N   . LEU E  1 117 ? 50.078  -107.018 -104.130 1.00 37.41  ? 127  LEU E N   1 
ATOM   6221  C  CA  . LEU E  1 117 ? 50.164  -108.114 -103.176 1.00 35.45  ? 127  LEU E CA  1 
ATOM   6222  C  C   . LEU E  1 117 ? 51.234  -109.116 -103.621 1.00 34.96  ? 127  LEU E C   1 
ATOM   6223  O  O   . LEU E  1 117 ? 51.998  -109.611 -102.801 1.00 34.98  ? 127  LEU E O   1 
ATOM   6224  C  CB  . LEU E  1 117 ? 48.813  -108.815 -103.053 1.00 34.25  ? 127  LEU E CB  1 
ATOM   6225  C  CG  . LEU E  1 117 ? 48.734  -109.974 -102.059 1.00 32.91  ? 127  LEU E CG  1 
ATOM   6226  C  CD1 . LEU E  1 117 ? 49.289  -109.551 -100.717 1.00 32.54  ? 127  LEU E CD1 1 
ATOM   6227  C  CD2 . LEU E  1 117 ? 47.293  -110.397 -101.904 1.00 31.82  ? 127  LEU E CD2 1 
ATOM   6228  N  N   . ALA E  1 118 ? 51.300  -109.409 -104.918 1.00 34.29  ? 128  ALA E N   1 
ATOM   6229  C  CA  . ALA E  1 118 ? 52.315  -110.339 -105.416 1.00 34.29  ? 128  ALA E CA  1 
ATOM   6230  C  C   . ALA E  1 118 ? 53.694  -109.727 -105.160 1.00 34.76  ? 128  ALA E C   1 
ATOM   6231  O  O   . ALA E  1 118 ? 54.603  -110.389 -104.657 1.00 34.39  ? 128  ALA E O   1 
ATOM   6232  C  CB  . ALA E  1 118 ? 52.124  -110.594 -106.908 1.00 31.49  ? 128  ALA E CB  1 
ATOM   6233  N  N   . PHE E  1 119 ? 53.828  -108.452 -105.512 1.00 34.87  ? 129  PHE E N   1 
ATOM   6234  C  CA  . PHE E  1 119 ? 55.065  -107.711 -105.321 1.00 34.78  ? 129  PHE E CA  1 
ATOM   6235  C  C   . PHE E  1 119 ? 55.442  -107.737 -103.843 1.00 35.58  ? 129  PHE E C   1 
ATOM   6236  O  O   . PHE E  1 119 ? 56.576  -108.056 -103.485 1.00 35.19  ? 129  PHE E O   1 
ATOM   6237  C  CB  . PHE E  1 119 ? 54.861  -106.271 -105.773 1.00 33.88  ? 129  PHE E CB  1 
ATOM   6238  C  CG  . PHE E  1 119 ? 56.060  -105.398 -105.591 1.00 32.91  ? 129  PHE E CG  1 
ATOM   6239  C  CD1 . PHE E  1 119 ? 57.058  -105.365 -106.550 1.00 34.19  ? 129  PHE E CD1 1 
ATOM   6240  C  CD2 . PHE E  1 119 ? 56.183  -104.595 -104.458 1.00 33.79  ? 129  PHE E CD2 1 
ATOM   6241  C  CE1 . PHE E  1 119 ? 58.168  -104.543 -106.390 1.00 34.00  ? 129  PHE E CE1 1 
ATOM   6242  C  CE2 . PHE E  1 119 ? 57.278  -103.774 -104.286 1.00 31.85  ? 129  PHE E CE2 1 
ATOM   6243  C  CZ  . PHE E  1 119 ? 58.275  -103.748 -105.256 1.00 34.35  ? 129  PHE E CZ  1 
ATOM   6244  N  N   . ALA E  1 120 ? 54.474  -107.407 -102.995 1.00 35.25  ? 130  ALA E N   1 
ATOM   6245  C  CA  . ALA E  1 120 ? 54.682  -107.381 -101.555 1.00 38.12  ? 130  ALA E CA  1 
ATOM   6246  C  C   . ALA E  1 120 ? 55.130  -108.736 -101.025 1.00 39.57  ? 130  ALA E C   1 
ATOM   6247  O  O   . ALA E  1 120 ? 56.091  -108.843 -100.253 1.00 39.82  ? 130  ALA E O   1 
ATOM   6248  C  CB  . ALA E  1 120 ? 53.394  -106.949 -100.848 1.00 36.78  ? 130  ALA E CB  1 
ATOM   6249  N  N   . ARG E  1 121 ? 54.423  -109.776 -101.441 1.00 41.26  ? 131  ARG E N   1 
ATOM   6250  C  CA  . ARG E  1 121 ? 54.741  -111.111 -100.989 1.00 40.57  ? 131  ARG E CA  1 
ATOM   6251  C  C   . ARG E  1 121 ? 56.099  -111.545 -101.488 1.00 40.57  ? 131  ARG E C   1 
ATOM   6252  O  O   . ARG E  1 121 ? 56.821  -112.242 -100.775 1.00 41.16  ? 131  ARG E O   1 
ATOM   6253  C  CB  . ARG E  1 121 ? 53.647  -112.086 -101.429 1.00 41.10  ? 131  ARG E CB  1 
ATOM   6254  C  CG  . ARG E  1 121 ? 52.295  -111.744 -100.801 1.00 43.48  ? 131  ARG E CG  1 
ATOM   6255  C  CD  . ARG E  1 121 ? 51.351  -112.940 -100.683 1.00 44.94  ? 131  ARG E CD  1 
ATOM   6256  N  NE  . ARG E  1 121 ? 50.330  -112.968 -101.728 1.00 46.76  ? 131  ARG E NE  1 
ATOM   6257  C  CZ  . ARG E  1 121 ? 49.055  -113.299 -101.523 1.00 47.36  ? 131  ARG E CZ  1 
ATOM   6258  N  NH1 . ARG E  1 121 ? 48.633  -113.628 -100.309 1.00 45.94  ? 131  ARG E NH1 1 
ATOM   6259  N  NH2 . ARG E  1 121 ? 48.196  -113.306 -102.534 1.00 49.55  ? 131  ARG E NH2 1 
ATOM   6260  N  N   . GLU E  1 122 ? 56.463  -111.124 -102.698 1.00 40.06  ? 132  GLU E N   1 
ATOM   6261  C  CA  . GLU E  1 122 ? 57.763  -111.507 -103.249 1.00 41.11  ? 132  GLU E CA  1 
ATOM   6262  C  C   . GLU E  1 122 ? 58.858  -110.805 -102.471 1.00 39.73  ? 132  GLU E C   1 
ATOM   6263  O  O   . GLU E  1 122 ? 59.855  -111.418 -102.113 1.00 39.02  ? 132  GLU E O   1 
ATOM   6264  C  CB  . GLU E  1 122 ? 57.885  -111.131 -104.732 1.00 44.18  ? 132  GLU E CB  1 
ATOM   6265  C  CG  . GLU E  1 122 ? 56.859  -111.767 -105.661 1.00 50.19  ? 132  GLU E CG  1 
ATOM   6266  C  CD  . GLU E  1 122 ? 57.146  -111.486 -107.136 1.00 54.86  ? 132  GLU E CD  1 
ATOM   6267  O  OE1 . GLU E  1 122 ? 58.108  -112.081 -107.680 1.00 56.55  ? 132  GLU E OE1 1 
ATOM   6268  O  OE2 . GLU E  1 122 ? 56.417  -110.665 -107.750 1.00 57.54  ? 132  GLU E OE2 1 
ATOM   6269  N  N   . PHE E  1 123 ? 58.647  -109.514 -102.217 1.00 39.09  ? 133  PHE E N   1 
ATOM   6270  C  CA  . PHE E  1 123 ? 59.582  -108.664 -101.490 1.00 36.65  ? 133  PHE E CA  1 
ATOM   6271  C  C   . PHE E  1 123 ? 59.943  -109.273 -100.150 1.00 38.32  ? 133  PHE E C   1 
ATOM   6272  O  O   . PHE E  1 123 ? 61.113  -109.326 -99.768  1.00 38.12  ? 133  PHE E O   1 
ATOM   6273  C  CB  . PHE E  1 123 ? 58.962  -107.294 -101.252 1.00 34.95  ? 133  PHE E CB  1 
ATOM   6274  C  CG  . PHE E  1 123 ? 59.966  -106.230 -100.925 1.00 36.53  ? 133  PHE E CG  1 
ATOM   6275  C  CD1 . PHE E  1 123 ? 60.729  -105.645 -101.934 1.00 35.47  ? 133  PHE E CD1 1 
ATOM   6276  C  CD2 . PHE E  1 123 ? 60.192  -105.850 -99.604  1.00 36.36  ? 133  PHE E CD2 1 
ATOM   6277  C  CE1 . PHE E  1 123 ? 61.699  -104.711 -101.637 1.00 35.67  ? 133  PHE E CE1 1 
ATOM   6278  C  CE2 . PHE E  1 123 ? 61.160  -104.914 -99.298  1.00 36.38  ? 133  PHE E CE2 1 
ATOM   6279  C  CZ  . PHE E  1 123 ? 61.918  -104.343 -100.316 1.00 36.95  ? 133  PHE E CZ  1 
HETATM 6280  N  N   . MSE E  1 124 ? 58.921  -109.722 -99.433  1.00 39.51  ? 134  MSE E N   1 
HETATM 6281  C  CA  . MSE E  1 124 ? 59.092  -110.343 -98.127  1.00 40.73  ? 134  MSE E CA  1 
HETATM 6282  C  C   . MSE E  1 124 ? 59.906  -111.621 -98.203  1.00 38.72  ? 134  MSE E C   1 
HETATM 6283  O  O   . MSE E  1 124 ? 60.794  -111.853 -97.400  1.00 38.50  ? 134  MSE E O   1 
HETATM 6284  C  CB  . MSE E  1 124 ? 57.731  -110.665 -97.547  1.00 46.25  ? 134  MSE E CB  1 
HETATM 6285  C  CG  . MSE E  1 124 ? 57.759  -111.654 -96.421  1.00 53.72  ? 134  MSE E CG  1 
HETATM 6286  SE SE  . MSE E  1 124 ? 57.539  -110.808 -94.719  1.00 69.15  ? 134  MSE E SE  1 
HETATM 6287  C  CE  . MSE E  1 124 ? 59.110  -111.524 -93.868  1.00 61.35  ? 134  MSE E CE  1 
ATOM   6288  N  N   . ALA E  1 125 ? 59.584  -112.463 -99.171  1.00 38.13  ? 135  ALA E N   1 
ATOM   6289  C  CA  . ALA E  1 125 ? 60.289  -113.724 -99.335  1.00 36.54  ? 135  ALA E CA  1 
ATOM   6290  C  C   . ALA E  1 125 ? 61.735  -113.487 -99.747  1.00 35.35  ? 135  ALA E C   1 
ATOM   6291  O  O   . ALA E  1 125 ? 62.631  -114.239 -99.357  1.00 35.12  ? 135  ALA E O   1 
ATOM   6292  C  CB  . ALA E  1 125 ? 59.578  -114.588 -100.377 1.00 35.05  ? 135  ALA E CB  1 
ATOM   6293  N  N   . ASN E  1 126 ? 61.958  -112.445 -100.539 1.00 33.62  ? 136  ASN E N   1 
ATOM   6294  C  CA  . ASN E  1 126 ? 63.299  -112.124 -101.001 1.00 34.31  ? 136  ASN E CA  1 
ATOM   6295  C  C   . ASN E  1 126 ? 64.162  -111.657 -99.838  1.00 36.79  ? 136  ASN E C   1 
ATOM   6296  O  O   . ASN E  1 126 ? 65.233  -112.217 -99.581  1.00 36.06  ? 136  ASN E O   1 
ATOM   6297  C  CB  . ASN E  1 126 ? 63.245  -111.027 -102.067 1.00 32.41  ? 136  ASN E CB  1 
ATOM   6298  C  CG  . ASN E  1 126 ? 64.584  -110.801 -102.746 1.00 31.30  ? 136  ASN E CG  1 
ATOM   6299  O  OD1 . ASN E  1 126 ? 65.345  -111.738 -102.964 1.00 28.16  ? 136  ASN E OD1 1 
ATOM   6300  N  ND2 . ASN E  1 126 ? 64.865  -109.552 -103.108 1.00 31.75  ? 136  ASN E ND2 1 
ATOM   6301  N  N   . THR E  1 127 ? 63.696  -110.635 -99.126  1.00 37.30  ? 137  THR E N   1 
ATOM   6302  C  CA  . THR E  1 127 ? 64.481  -110.123 -98.019  1.00 38.82  ? 137  THR E CA  1 
ATOM   6303  C  C   . THR E  1 127 ? 64.622  -111.150 -96.912  1.00 37.27  ? 137  THR E C   1 
ATOM   6304  O  O   . THR E  1 127 ? 65.721  -111.344 -96.386  1.00 36.88  ? 137  THR E O   1 
ATOM   6305  C  CB  . THR E  1 127 ? 63.907  -108.786 -97.449  1.00 39.08  ? 137  THR E CB  1 
ATOM   6306  O  OG1 . THR E  1 127 ? 62.530  -108.942 -97.105  1.00 43.58  ? 137  THR E OG1 1 
ATOM   6307  C  CG2 . THR E  1 127 ? 64.024  -107.692 -98.475  1.00 39.38  ? 137  THR E CG2 1 
ATOM   6308  N  N   . GLU E  1 128 ? 63.517  -111.809 -96.574  1.00 35.47  ? 138  GLU E N   1 
ATOM   6309  C  CA  . GLU E  1 128 ? 63.511  -112.832 -95.527  1.00 35.70  ? 138  GLU E CA  1 
ATOM   6310  C  C   . GLU E  1 128 ? 64.576  -113.890 -95.846  1.00 33.44  ? 138  GLU E C   1 
ATOM   6311  O  O   . GLU E  1 128 ? 65.435  -114.219 -95.039  1.00 31.95  ? 138  GLU E O   1 
ATOM   6312  C  CB  . GLU E  1 128 ? 62.138  -113.491 -95.476  1.00 36.06  ? 138  GLU E CB  1 
ATOM   6313  C  CG  . GLU E  1 128 ? 61.660  -113.842 -94.104  1.00 42.25  ? 138  GLU E CG  1 
ATOM   6314  C  CD  . GLU E  1 128 ? 60.212  -114.313 -94.103  1.00 48.58  ? 138  GLU E CD  1 
ATOM   6315  O  OE1 . GLU E  1 128 ? 59.604  -114.373 -93.006  1.00 51.47  ? 138  GLU E OE1 1 
ATOM   6316  O  OE2 . GLU E  1 128 ? 59.677  -114.625 -95.194  1.00 50.97  ? 138  GLU E OE2 1 
ATOM   6317  N  N   . SER E  1 129 ? 64.506  -114.404 -97.056  1.00 32.89  ? 139  SER E N   1 
ATOM   6318  C  CA  . SER E  1 129 ? 65.422  -115.415 -97.526  1.00 32.34  ? 139  SER E CA  1 
ATOM   6319  C  C   . SER E  1 129 ? 66.876  -114.943 -97.388  1.00 32.33  ? 139  SER E C   1 
ATOM   6320  O  O   . SER E  1 129 ? 67.732  -115.689 -96.929  1.00 33.59  ? 139  SER E O   1 
ATOM   6321  C  CB  . SER E  1 129 ? 65.063  -115.743 -98.984  1.00 29.84  ? 139  SER E CB  1 
ATOM   6322  O  OG  . SER E  1 129 ? 65.922  -116.707 -99.537  1.00 30.59  ? 139  SER E OG  1 
ATOM   6323  N  N   . TYR E  1 130 ? 67.144  -113.699 -97.774  1.00 32.75  ? 140  TYR E N   1 
ATOM   6324  C  CA  . TYR E  1 130 ? 68.491  -113.117 -97.712  1.00 32.88  ? 140  TYR E CA  1 
ATOM   6325  C  C   . TYR E  1 130 ? 69.064  -113.091 -96.302  1.00 35.01  ? 140  TYR E C   1 
ATOM   6326  O  O   . TYR E  1 130 ? 70.161  -113.584 -96.040  1.00 35.19  ? 140  TYR E O   1 
ATOM   6327  C  CB  . TYR E  1 130 ? 68.443  -111.687 -98.227  1.00 32.67  ? 140  TYR E CB  1 
ATOM   6328  C  CG  . TYR E  1 130 ? 69.717  -110.919 -98.028  1.00 30.14  ? 140  TYR E CG  1 
ATOM   6329  C  CD1 . TYR E  1 130 ? 70.794  -111.101 -98.883  1.00 29.27  ? 140  TYR E CD1 1 
ATOM   6330  C  CD2 . TYR E  1 130 ? 69.849  -110.020 -96.969  1.00 29.07  ? 140  TYR E CD2 1 
ATOM   6331  C  CE1 . TYR E  1 130 ? 71.971  -110.413 -98.696  1.00 31.57  ? 140  TYR E CE1 1 
ATOM   6332  C  CE2 . TYR E  1 130 ? 71.017  -109.328 -96.763  1.00 29.53  ? 140  TYR E CE2 1 
ATOM   6333  C  CZ  . TYR E  1 130 ? 72.082  -109.528 -97.631  1.00 32.78  ? 140  TYR E CZ  1 
ATOM   6334  O  OH  . TYR E  1 130 ? 73.269  -108.859 -97.434  1.00 33.97  ? 140  TYR E OH  1 
ATOM   6335  N  N   . LEU E  1 131 ? 68.305  -112.476 -95.406  1.00 36.17  ? 141  LEU E N   1 
ATOM   6336  C  CA  . LEU E  1 131 ? 68.674  -112.345 -94.011  1.00 37.67  ? 141  LEU E CA  1 
ATOM   6337  C  C   . LEU E  1 131 ? 69.052  -113.693 -93.405  1.00 40.59  ? 141  LEU E C   1 
ATOM   6338  O  O   . LEU E  1 131 ? 69.972  -113.779 -92.585  1.00 42.67  ? 141  LEU E O   1 
ATOM   6339  C  CB  . LEU E  1 131 ? 67.505  -111.724 -93.234  1.00 34.99  ? 141  LEU E CB  1 
ATOM   6340  C  CG  . LEU E  1 131 ? 67.585  -110.272 -92.751  1.00 31.63  ? 141  LEU E CG  1 
ATOM   6341  C  CD1 . LEU E  1 131 ? 68.391  -109.397 -93.694  1.00 30.28  ? 141  LEU E CD1 1 
ATOM   6342  C  CD2 . LEU E  1 131 ? 66.173  -109.762 -92.606  1.00 30.98  ? 141  LEU E CD2 1 
ATOM   6343  N  N   . LYS E  1 132 ? 68.343  -114.742 -93.807  1.00 41.13  ? 142  LYS E N   1 
ATOM   6344  C  CA  . LYS E  1 132 ? 68.611  -116.077 -93.292  1.00 42.35  ? 142  LYS E CA  1 
ATOM   6345  C  C   . LYS E  1 132 ? 69.952  -116.621 -93.771  1.00 43.08  ? 142  LYS E C   1 
ATOM   6346  O  O   . LYS E  1 132 ? 70.796  -117.021 -92.977  1.00 43.43  ? 142  LYS E O   1 
ATOM   6347  C  CB  . LYS E  1 132 ? 67.501  -117.033 -93.724  1.00 43.46  ? 142  LYS E CB  1 
ATOM   6348  C  CG  . LYS E  1 132 ? 67.763  -118.501 -93.408  1.00 46.90  ? 142  LYS E CG  1 
ATOM   6349  C  CD  . LYS E  1 132 ? 66.620  -119.375 -93.910  1.00 48.77  ? 142  LYS E CD  1 
ATOM   6350  C  CE  . LYS E  1 132 ? 66.581  -120.734 -93.205  1.00 51.71  ? 142  LYS E CE  1 
ATOM   6351  N  NZ  . LYS E  1 132 ? 65.331  -121.520 -93.503  1.00 53.12  ? 142  LYS E NZ  1 
ATOM   6352  N  N   . ASN E  1 133 ? 70.146  -116.617 -95.080  1.00 43.42  ? 143  ASN E N   1 
ATOM   6353  C  CA  . ASN E  1 133 ? 71.354  -117.155 -95.669  1.00 43.82  ? 143  ASN E CA  1 
ATOM   6354  C  C   . ASN E  1 133 ? 72.625  -116.393 -95.384  1.00 43.66  ? 143  ASN E C   1 
ATOM   6355  O  O   . ASN E  1 133 ? 73.706  -116.989 -95.310  1.00 43.73  ? 143  ASN E O   1 
ATOM   6356  C  CB  . ASN E  1 133 ? 71.150  -117.310 -97.177  1.00 44.98  ? 143  ASN E CB  1 
ATOM   6357  C  CG  . ASN E  1 133 ? 70.167  -118.423 -97.506  1.00 47.23  ? 143  ASN E CG  1 
ATOM   6358  O  OD1 . ASN E  1 133 ? 70.458  -119.593 -97.274  1.00 48.28  ? 143  ASN E OD1 1 
ATOM   6359  N  ND2 . ASN E  1 133 ? 68.994  -118.065 -98.024  1.00 45.75  ? 143  ASN E ND2 1 
ATOM   6360  N  N   . VAL E  1 134 ? 72.507  -115.083 -95.205  1.00 43.12  ? 144  VAL E N   1 
ATOM   6361  C  CA  . VAL E  1 134 ? 73.687  -114.261 -94.951  1.00 40.97  ? 144  VAL E CA  1 
ATOM   6362  C  C   . VAL E  1 134 ? 74.116  -114.202 -93.492  1.00 39.11  ? 144  VAL E C   1 
ATOM   6363  O  O   . VAL E  1 134 ? 75.280  -113.939 -93.207  1.00 38.17  ? 144  VAL E O   1 
ATOM   6364  C  CB  . VAL E  1 134 ? 73.483  -112.812 -95.435  1.00 40.37  ? 144  VAL E CB  1 
ATOM   6365  C  CG1 . VAL E  1 134 ? 74.796  -112.063 -95.383  1.00 38.97  ? 144  VAL E CG1 1 
ATOM   6366  C  CG2 . VAL E  1 134 ? 72.935  -112.811 -96.833  1.00 38.84  ? 144  VAL E CG2 1 
ATOM   6367  N  N   . ALA E  1 135 ? 73.203  -114.460 -92.564  1.00 36.98  ? 145  ALA E N   1 
ATOM   6368  C  CA  . ALA E  1 135 ? 73.605  -114.366 -91.178  1.00 37.64  ? 145  ALA E CA  1 
ATOM   6369  C  C   . ALA E  1 135 ? 72.783  -115.081 -90.116  1.00 37.43  ? 145  ALA E C   1 
ATOM   6370  O  O   . ALA E  1 135 ? 73.339  -115.748 -89.256  1.00 40.20  ? 145  ALA E O   1 
ATOM   6371  C  CB  . ALA E  1 135 ? 73.746  -112.883 -90.805  1.00 37.75  ? 145  ALA E CB  1 
ATOM   6372  N  N   . LEU E  1 136 ? 71.470  -114.939 -90.145  1.00 36.47  ? 146  LEU E N   1 
ATOM   6373  C  CA  . LEU E  1 136 ? 70.657  -115.569 -89.119  1.00 35.44  ? 146  LEU E CA  1 
ATOM   6374  C  C   . LEU E  1 136 ? 70.836  -117.071 -88.972  1.00 34.37  ? 146  LEU E C   1 
ATOM   6375  O  O   . LEU E  1 136 ? 70.708  -117.602 -87.870  1.00 33.63  ? 146  LEU E O   1 
ATOM   6376  C  CB  . LEU E  1 136 ? 69.182  -115.238 -89.339  1.00 35.79  ? 146  LEU E CB  1 
ATOM   6377  C  CG  . LEU E  1 136 ? 68.802  -113.804 -88.962  1.00 37.16  ? 146  LEU E CG  1 
ATOM   6378  C  CD1 . LEU E  1 136 ? 69.706  -112.800 -89.671  1.00 35.83  ? 146  LEU E CD1 1 
ATOM   6379  C  CD2 . LEU E  1 136 ? 67.354  -113.569 -89.333  1.00 37.28  ? 146  LEU E CD2 1 
ATOM   6380  N  N   . LYS E  1 137 ? 71.136  -117.769 -90.058  1.00 33.77  ? 147  LYS E N   1 
ATOM   6381  C  CA  . LYS E  1 137 ? 71.303  -119.208 -89.935  1.00 35.30  ? 147  LYS E CA  1 
ATOM   6382  C  C   . LYS E  1 137 ? 72.641  -119.536 -89.283  1.00 37.43  ? 147  LYS E C   1 
ATOM   6383  O  O   . LYS E  1 137 ? 72.818  -120.615 -88.714  1.00 39.52  ? 147  LYS E O   1 
ATOM   6384  C  CB  . LYS E  1 137 ? 71.165  -119.907 -91.296  1.00 32.02  ? 147  LYS E CB  1 
ATOM   6385  C  CG  . LYS E  1 137 ? 72.226  -119.585 -92.316  1.00 30.74  ? 147  LYS E CG  1 
ATOM   6386  C  CD  . LYS E  1 137 ? 71.942  -120.342 -93.599  1.00 31.03  ? 147  LYS E CD  1 
ATOM   6387  C  CE  . LYS E  1 137 ? 72.951  -120.044 -94.694  1.00 30.44  ? 147  LYS E CE  1 
ATOM   6388  N  NZ  . LYS E  1 137 ? 72.783  -120.992 -95.825  1.00 26.25  ? 147  LYS E NZ  1 
ATOM   6389  N  N   . HIS E  1 138 ? 73.570  -118.590 -89.341  1.00 38.13  ? 148  HIS E N   1 
ATOM   6390  C  CA  . HIS E  1 138 ? 74.883  -118.768 -88.742  1.00 38.51  ? 148  HIS E CA  1 
ATOM   6391  C  C   . HIS E  1 138 ? 74.920  -118.279 -87.302  1.00 38.76  ? 148  HIS E C   1 
ATOM   6392  O  O   . HIS E  1 138 ? 75.979  -118.243 -86.688  1.00 37.79  ? 148  HIS E O   1 
ATOM   6393  C  CB  . HIS E  1 138 ? 75.925  -118.024 -89.556  1.00 40.77  ? 148  HIS E CB  1 
ATOM   6394  C  CG  . HIS E  1 138 ? 76.004  -118.479 -90.975  1.00 43.95  ? 148  HIS E CG  1 
ATOM   6395  N  ND1 . HIS E  1 138 ? 76.678  -117.773 -91.948  1.00 45.92  ? 148  HIS E ND1 1 
ATOM   6396  C  CD2 . HIS E  1 138 ? 75.478  -119.561 -91.592  1.00 46.05  ? 148  HIS E CD2 1 
ATOM   6397  C  CE1 . HIS E  1 138 ? 76.561  -118.399 -93.104  1.00 47.11  ? 148  HIS E CE1 1 
ATOM   6398  N  NE2 . HIS E  1 138 ? 75.836  -119.487 -92.916  1.00 47.86  ? 148  HIS E NE2 1 
HETATM 6399  N  N   . MSE E  1 139 ? 73.762  -117.900 -86.772  1.00 40.08  ? 149  MSE E N   1 
HETATM 6400  C  CA  . MSE E  1 139 ? 73.666  -117.426 -85.398  1.00 42.71  ? 149  MSE E CA  1 
HETATM 6401  C  C   . MSE E  1 139 ? 73.272  -118.566 -84.456  1.00 44.04  ? 149  MSE E C   1 
HETATM 6402  O  O   . MSE E  1 139 ? 72.644  -119.538 -84.873  1.00 44.04  ? 149  MSE E O   1 
HETATM 6403  C  CB  . MSE E  1 139 ? 72.644  -116.294 -85.292  1.00 44.44  ? 149  MSE E CB  1 
HETATM 6404  C  CG  . MSE E  1 139 ? 73.101  -114.957 -85.865  1.00 48.09  ? 149  MSE E CG  1 
HETATM 6405  SE SE  . MSE E  1 139 ? 71.729  -113.590 -85.671  1.00 52.05  ? 149  MSE E SE  1 
HETATM 6406  C  CE  . MSE E  1 139 ? 71.230  -114.019 -83.876  1.00 51.92  ? 149  MSE E CE  1 
ATOM   6407  N  N   . PRO E  1 140 ? 73.642  -118.459 -83.168  1.00 45.87  ? 150  PRO E N   1 
ATOM   6408  C  CA  . PRO E  1 140 ? 73.327  -119.482 -82.167  1.00 46.14  ? 150  PRO E CA  1 
ATOM   6409  C  C   . PRO E  1 140 ? 71.857  -119.848 -82.183  1.00 47.31  ? 150  PRO E C   1 
ATOM   6410  O  O   . PRO E  1 140 ? 71.016  -119.017 -82.498  1.00 47.40  ? 150  PRO E O   1 
ATOM   6411  C  CB  . PRO E  1 140 ? 73.721  -118.812 -80.860  1.00 45.15  ? 150  PRO E CB  1 
ATOM   6412  C  CG  . PRO E  1 140 ? 74.865  -117.955 -81.277  1.00 45.68  ? 150  PRO E CG  1 
ATOM   6413  C  CD  . PRO E  1 140 ? 74.365  -117.334 -82.545  1.00 45.98  ? 150  PRO E CD  1 
ATOM   6414  N  N   . PRO E  1 141 ? 71.528  -121.103 -81.844  1.00 49.54  ? 151  PRO E N   1 
ATOM   6415  C  CA  . PRO E  1 141 ? 70.133  -121.553 -81.822  1.00 50.16  ? 151  PRO E CA  1 
ATOM   6416  C  C   . PRO E  1 141 ? 69.285  -120.658 -80.927  1.00 50.87  ? 151  PRO E C   1 
ATOM   6417  O  O   . PRO E  1 141 ? 69.735  -120.233 -79.855  1.00 50.73  ? 151  PRO E O   1 
ATOM   6418  C  CB  . PRO E  1 141 ? 70.240  -122.966 -81.270  1.00 49.17  ? 151  PRO E CB  1 
ATOM   6419  C  CG  . PRO E  1 141 ? 71.552  -123.423 -81.828  1.00 50.11  ? 151  PRO E CG  1 
ATOM   6420  C  CD  . PRO E  1 141 ? 72.443  -122.228 -81.583  1.00 50.00  ? 151  PRO E CD  1 
ATOM   6421  N  N   . ASN E  1 142 ? 68.066  -120.370 -81.375  1.00 50.54  ? 152  ASN E N   1 
ATOM   6422  C  CA  . ASN E  1 142 ? 67.141  -119.535 -80.612  1.00 50.69  ? 152  ASN E CA  1 
ATOM   6423  C  C   . ASN E  1 142 ? 67.531  -118.060 -80.676  1.00 50.06  ? 152  ASN E C   1 
ATOM   6424  O  O   . ASN E  1 142 ? 67.311  -117.296 -79.736  1.00 49.08  ? 152  ASN E O   1 
ATOM   6425  C  CB  . ASN E  1 142 ? 67.073  -120.014 -79.155  1.00 51.48  ? 152  ASN E CB  1 
ATOM   6426  C  CG  . ASN E  1 142 ? 66.733  -121.503 -79.041  1.00 53.74  ? 152  ASN E CG  1 
ATOM   6427  O  OD1 . ASN E  1 142 ? 67.581  -122.375 -79.281  1.00 53.63  ? 152  ASN E OD1 1 
ATOM   6428  N  ND2 . ASN E  1 142 ? 65.482  -121.798 -78.689  1.00 55.24  ? 152  ASN E ND2 1 
ATOM   6429  N  N   . LEU E  1 143 ? 68.118  -117.689 -81.809  1.00 49.80  ? 153  LEU E N   1 
ATOM   6430  C  CA  . LEU E  1 143 ? 68.550  -116.329 -82.111  1.00 48.32  ? 153  LEU E CA  1 
ATOM   6431  C  C   . LEU E  1 143 ? 68.509  -116.208 -83.627  1.00 48.06  ? 153  LEU E C   1 
ATOM   6432  O  O   . LEU E  1 143 ? 68.668  -115.124 -84.173  1.00 50.30  ? 153  LEU E O   1 
ATOM   6433  C  CB  . LEU E  1 143 ? 69.995  -116.079 -81.662  1.00 49.27  ? 153  LEU E CB  1 
ATOM   6434  C  CG  . LEU E  1 143 ? 70.422  -115.615 -80.266  1.00 50.02  ? 153  LEU E CG  1 
ATOM   6435  C  CD1 . LEU E  1 143 ? 69.443  -114.572 -79.779  1.00 49.94  ? 153  LEU E CD1 1 
ATOM   6436  C  CD2 . LEU E  1 143 ? 70.493  -116.791 -79.304  1.00 51.68  ? 153  LEU E CD2 1 
ATOM   6437  N  N   . GLN E  1 144 ? 68.291  -117.339 -84.296  1.00 47.36  ? 154  GLN E N   1 
ATOM   6438  C  CA  . GLN E  1 144 ? 68.266  -117.416 -85.757  1.00 46.10  ? 154  GLN E CA  1 
ATOM   6439  C  C   . GLN E  1 144 ? 67.049  -116.877 -86.493  1.00 45.45  ? 154  GLN E C   1 
ATOM   6440  O  O   . GLN E  1 144 ? 67.093  -116.732 -87.718  1.00 44.98  ? 154  GLN E O   1 
ATOM   6441  C  CB  . GLN E  1 144 ? 68.438  -118.853 -86.207  1.00 45.94  ? 154  GLN E CB  1 
ATOM   6442  C  CG  . GLN E  1 144 ? 69.698  -119.500 -85.789  1.00 48.54  ? 154  GLN E CG  1 
ATOM   6443  C  CD  . GLN E  1 144 ? 69.861  -120.832 -86.460  1.00 51.39  ? 154  GLN E CD  1 
ATOM   6444  O  OE1 . GLN E  1 144 ? 70.754  -121.601 -86.127  1.00 54.81  ? 154  GLN E OE1 1 
ATOM   6445  N  NE2 . GLN E  1 144 ? 68.995  -121.115 -87.426  1.00 53.25  ? 154  GLN E NE2 1 
ATOM   6446  N  N   . LYS E  1 145 ? 65.965  -116.606 -85.778  1.00 43.90  ? 155  LYS E N   1 
ATOM   6447  C  CA  . LYS E  1 145 ? 64.767  -116.106 -86.432  1.00 43.43  ? 155  LYS E CA  1 
ATOM   6448  C  C   . LYS E  1 145 ? 64.513  -114.648 -86.079  1.00 43.38  ? 155  LYS E C   1 
ATOM   6449  O  O   . LYS E  1 145 ? 64.800  -114.207 -84.967  1.00 44.23  ? 155  LYS E O   1 
ATOM   6450  C  CB  . LYS E  1 145 ? 63.544  -116.948 -86.033  1.00 43.85  ? 155  LYS E CB  1 
ATOM   6451  C  CG  . LYS E  1 145 ? 63.717  -118.451 -86.189  1.00 46.31  ? 155  LYS E CG  1 
ATOM   6452  C  CD  . LYS E  1 145 ? 64.203  -118.857 -87.589  1.00 49.18  ? 155  LYS E CD  1 
ATOM   6453  C  CE  . LYS E  1 145 ? 63.075  -118.874 -88.630  1.00 51.81  ? 155  LYS E CE  1 
ATOM   6454  N  NZ  . LYS E  1 145 ? 62.037  -119.935 -88.391  1.00 52.84  ? 155  LYS E NZ  1 
ATOM   6455  N  N   . VAL E  1 146 ? 63.990  -113.896 -87.041  1.00 42.57  ? 156  VAL E N   1 
ATOM   6456  C  CA  . VAL E  1 146 ? 63.652  -112.492 -86.825  1.00 40.90  ? 156  VAL E CA  1 
ATOM   6457  C  C   . VAL E  1 146 ? 62.265  -112.256 -87.405  1.00 39.23  ? 156  VAL E C   1 
ATOM   6458  O  O   . VAL E  1 146 ? 62.042  -112.425 -88.602  1.00 39.41  ? 156  VAL E O   1 
ATOM   6459  C  CB  . VAL E  1 146 ? 64.653  -111.522 -87.519  1.00 41.48  ? 156  VAL E CB  1 
ATOM   6460  C  CG1 . VAL E  1 146 ? 64.110  -110.098 -87.486  1.00 40.63  ? 156  VAL E CG1 1 
ATOM   6461  C  CG2 . VAL E  1 146 ? 65.996  -111.566 -86.821  1.00 41.90  ? 156  VAL E CG2 1 
ATOM   6462  N  N   . ASP E  1 147 ? 61.324  -111.895 -86.552  1.00 37.65  ? 157  ASP E N   1 
ATOM   6463  C  CA  . ASP E  1 147 ? 59.981  -111.631 -87.021  1.00 37.81  ? 157  ASP E CA  1 
ATOM   6464  C  C   . ASP E  1 147 ? 59.918  -110.203 -87.591  1.00 37.64  ? 157  ASP E C   1 
ATOM   6465  O  O   . ASP E  1 147 ? 59.692  -109.227 -86.864  1.00 36.08  ? 157  ASP E O   1 
ATOM   6466  C  CB  . ASP E  1 147 ? 58.987  -111.831 -85.871  1.00 39.63  ? 157  ASP E CB  1 
ATOM   6467  C  CG  . ASP E  1 147 ? 57.602  -111.309 -86.198  1.00 42.81  ? 157  ASP E CG  1 
ATOM   6468  O  OD1 . ASP E  1 147 ? 57.321  -111.089 -87.400  1.00 45.28  ? 157  ASP E OD1 1 
ATOM   6469  O  OD2 . ASP E  1 147 ? 56.794  -111.122 -85.258  1.00 42.15  ? 157  ASP E OD2 1 
ATOM   6470  N  N   . LEU E  1 148 ? 60.133  -110.093 -88.900  1.00 36.47  ? 158  LEU E N   1 
ATOM   6471  C  CA  . LEU E  1 148 ? 60.116  -108.805 -89.575  1.00 35.48  ? 158  LEU E CA  1 
ATOM   6472  C  C   . LEU E  1 148 ? 58.901  -107.961 -89.204  1.00 35.55  ? 158  LEU E C   1 
ATOM   6473  O  O   . LEU E  1 148 ? 58.961  -106.730 -89.209  1.00 35.33  ? 158  LEU E O   1 
ATOM   6474  C  CB  . LEU E  1 148 ? 60.159  -108.999 -91.092  1.00 33.42  ? 158  LEU E CB  1 
ATOM   6475  C  CG  . LEU E  1 148 ? 61.447  -109.612 -91.640  1.00 34.41  ? 158  LEU E CG  1 
ATOM   6476  C  CD1 . LEU E  1 148 ? 61.411  -109.545 -93.151  1.00 33.90  ? 158  LEU E CD1 1 
ATOM   6477  C  CD2 . LEU E  1 148 ? 62.678  -108.858 -91.108  1.00 33.42  ? 158  LEU E CD2 1 
ATOM   6478  N  N   . PHE E  1 149 ? 57.797  -108.615 -88.876  1.00 34.68  ? 159  PHE E N   1 
ATOM   6479  C  CA  . PHE E  1 149 ? 56.608  -107.874 -88.520  1.00 36.56  ? 159  PHE E CA  1 
ATOM   6480  C  C   . PHE E  1 149 ? 56.857  -106.980 -87.307  1.00 38.28  ? 159  PHE E C   1 
ATOM   6481  O  O   . PHE E  1 149 ? 56.178  -105.971 -87.123  1.00 39.51  ? 159  PHE E O   1 
ATOM   6482  C  CB  . PHE E  1 149 ? 55.452  -108.819 -88.227  1.00 37.40  ? 159  PHE E CB  1 
ATOM   6483  C  CG  . PHE E  1 149 ? 54.189  -108.108 -87.872  1.00 39.61  ? 159  PHE E CG  1 
ATOM   6484  C  CD1 . PHE E  1 149 ? 53.491  -107.392 -88.834  1.00 40.30  ? 159  PHE E CD1 1 
ATOM   6485  C  CD2 . PHE E  1 149 ? 53.740  -108.076 -86.558  1.00 40.58  ? 159  PHE E CD2 1 
ATOM   6486  C  CE1 . PHE E  1 149 ? 52.365  -106.646 -88.490  1.00 41.90  ? 159  PHE E CE1 1 
ATOM   6487  C  CE2 . PHE E  1 149 ? 52.619  -107.335 -86.207  1.00 41.46  ? 159  PHE E CE2 1 
ATOM   6488  C  CZ  . PHE E  1 149 ? 51.931  -106.616 -87.176  1.00 41.52  ? 159  PHE E CZ  1 
ATOM   6489  N  N   . ARG E  1 150 ? 57.827  -107.351 -86.477  1.00 39.27  ? 160  ARG E N   1 
ATOM   6490  C  CA  . ARG E  1 150 ? 58.158  -106.562 -85.295  1.00 37.68  ? 160  ARG E CA  1 
ATOM   6491  C  C   . ARG E  1 150 ? 59.412  -105.724 -85.530  1.00 35.67  ? 160  ARG E C   1 
ATOM   6492  O  O   . ARG E  1 150 ? 59.629  -104.715 -84.866  1.00 34.57  ? 160  ARG E O   1 
ATOM   6493  C  CB  . ARG E  1 150 ? 58.374  -107.477 -84.093  1.00 40.65  ? 160  ARG E CB  1 
ATOM   6494  C  CG  . ARG E  1 150 ? 57.146  -108.255 -83.661  1.00 46.43  ? 160  ARG E CG  1 
ATOM   6495  C  CD  . ARG E  1 150 ? 57.485  -109.210 -82.512  1.00 53.97  ? 160  ARG E CD  1 
ATOM   6496  N  NE  . ARG E  1 150 ? 58.217  -108.543 -81.436  1.00 59.94  ? 160  ARG E NE  1 
ATOM   6497  C  CZ  . ARG E  1 150 ? 57.755  -107.502 -80.743  1.00 64.36  ? 160  ARG E CZ  1 
ATOM   6498  N  NH1 . ARG E  1 150 ? 56.550  -107.001 -81.002  1.00 64.95  ? 160  ARG E NH1 1 
ATOM   6499  N  NH2 . ARG E  1 150 ? 58.509  -106.943 -79.801  1.00 66.76  ? 160  ARG E NH2 1 
ATOM   6500  N  N   . ALA E  1 151 ? 60.231  -106.133 -86.489  1.00 33.87  ? 161  ALA E N   1 
ATOM   6501  C  CA  . ALA E  1 151 ? 61.462  -105.409 -86.781  1.00 34.85  ? 161  ALA E CA  1 
ATOM   6502  C  C   . ALA E  1 151 ? 61.274  -104.163 -87.654  1.00 35.17  ? 161  ALA E C   1 
ATOM   6503  O  O   . ALA E  1 151 ? 61.933  -103.143 -87.425  1.00 37.20  ? 161  ALA E O   1 
ATOM   6504  C  CB  . ALA E  1 151 ? 62.479  -106.349 -87.423  1.00 33.57  ? 161  ALA E CB  1 
ATOM   6505  N  N   . VAL E  1 152 ? 60.400  -104.252 -88.658  1.00 33.35  ? 162  VAL E N   1 
ATOM   6506  C  CA  . VAL E  1 152 ? 60.123  -103.128 -89.555  1.00 29.67  ? 162  VAL E CA  1 
ATOM   6507  C  C   . VAL E  1 152 ? 59.131  -102.207 -88.870  1.00 27.74  ? 162  VAL E C   1 
ATOM   6508  O  O   . VAL E  1 152 ? 58.151  -102.658 -88.297  1.00 27.72  ? 162  VAL E O   1 
ATOM   6509  C  CB  . VAL E  1 152 ? 59.519  -103.619 -90.883  1.00 29.53  ? 162  VAL E CB  1 
ATOM   6510  C  CG1 . VAL E  1 152 ? 59.110  -102.448 -91.743  1.00 28.96  ? 162  VAL E CG1 1 
ATOM   6511  C  CG2 . VAL E  1 152 ? 60.529  -104.475 -91.611  1.00 29.28  ? 162  VAL E CG2 1 
ATOM   6512  N  N   . PRO E  1 153 ? 59.367  -100.894 -88.917  1.00 27.03  ? 163  PRO E N   1 
ATOM   6513  C  CA  . PRO E  1 153 ? 58.416  -99.997  -88.251  1.00 28.40  ? 163  PRO E CA  1 
ATOM   6514  C  C   . PRO E  1 153 ? 57.079  -99.775  -88.977  1.00 28.53  ? 163  PRO E C   1 
ATOM   6515  O  O   . PRO E  1 153 ? 57.020  -99.789  -90.208  1.00 29.25  ? 163  PRO E O   1 
ATOM   6516  C  CB  . PRO E  1 153 ? 59.229  -98.711  -88.089  1.00 26.42  ? 163  PRO E CB  1 
ATOM   6517  C  CG  . PRO E  1 153 ? 60.059  -98.712  -89.316  1.00 25.89  ? 163  PRO E CG  1 
ATOM   6518  C  CD  . PRO E  1 153 ? 60.518  -100.148 -89.446  1.00 25.42  ? 163  PRO E CD  1 
ATOM   6519  N  N   . LYS E  1 154 ? 56.013  -99.585  -88.205  1.00 29.33  ? 164  LYS E N   1 
ATOM   6520  C  CA  . LYS E  1 154 ? 54.685  -99.324  -88.761  1.00 32.97  ? 164  LYS E CA  1 
ATOM   6521  C  C   . LYS E  1 154 ? 54.591  -97.857  -89.164  1.00 35.33  ? 164  LYS E C   1 
ATOM   6522  O  O   . LYS E  1 154 ? 55.362  -97.014  -88.691  1.00 36.03  ? 164  LYS E O   1 
ATOM   6523  C  CB  . LYS E  1 154 ? 53.586  -99.568  -87.731  1.00 32.41  ? 164  LYS E CB  1 
ATOM   6524  C  CG  . LYS E  1 154 ? 53.386  -100.997 -87.301  1.00 36.50  ? 164  LYS E CG  1 
ATOM   6525  C  CD  . LYS E  1 154 ? 52.389  -101.063 -86.138  1.00 38.99  ? 164  LYS E CD  1 
ATOM   6526  C  CE  . LYS E  1 154 ? 52.077  -102.505 -85.744  1.00 41.41  ? 164  LYS E CE  1 
ATOM   6527  N  NZ  . LYS E  1 154 ? 51.042  -102.586 -84.669  1.00 42.61  ? 164  LYS E NZ  1 
ATOM   6528  N  N   . PRO E  1 155 ? 53.646  -97.531  -90.054  1.00 36.32  ? 165  PRO E N   1 
ATOM   6529  C  CA  . PRO E  1 155 ? 53.478  -96.145  -90.487  1.00 35.99  ? 165  PRO E CA  1 
ATOM   6530  C  C   . PRO E  1 155 ? 52.975  -95.305  -89.314  1.00 35.75  ? 165  PRO E C   1 
ATOM   6531  O  O   . PRO E  1 155 ? 52.257  -95.810  -88.448  1.00 33.93  ? 165  PRO E O   1 
ATOM   6532  C  CB  . PRO E  1 155 ? 52.472  -96.262  -91.634  1.00 36.28  ? 165  PRO E CB  1 
ATOM   6533  C  CG  . PRO E  1 155 ? 51.708  -97.487  -91.287  1.00 36.60  ? 165  PRO E CG  1 
ATOM   6534  C  CD  . PRO E  1 155 ? 52.794  -98.426  -90.849  1.00 36.33  ? 165  PRO E CD  1 
ATOM   6535  N  N   . ASP E  1 156 ? 53.359  -94.028  -89.292  1.00 36.64  ? 166  ASP E N   1 
ATOM   6536  C  CA  . ASP E  1 156 ? 52.982  -93.142  -88.202  1.00 36.45  ? 166  ASP E CA  1 
ATOM   6537  C  C   . ASP E  1 156 ? 51.661  -92.413  -88.436  1.00 35.49  ? 166  ASP E C   1 
ATOM   6538  O  O   . ASP E  1 156 ? 51.617  -91.334  -89.017  1.00 35.67  ? 166  ASP E O   1 
ATOM   6539  C  CB  . ASP E  1 156 ? 54.123  -92.150  -87.942  1.00 38.71  ? 166  ASP E CB  1 
ATOM   6540  C  CG  . ASP E  1 156 ? 53.954  -91.373  -86.625  1.00 41.93  ? 166  ASP E CG  1 
ATOM   6541  O  OD1 . ASP E  1 156 ? 53.168  -91.810  -85.746  1.00 41.31  ? 166  ASP E OD1 1 
ATOM   6542  O  OD2 . ASP E  1 156 ? 54.625  -90.323  -86.468  1.00 43.68  ? 166  ASP E OD2 1 
ATOM   6543  N  N   . LEU E  1 157 ? 50.581  -93.011  -87.960  1.00 34.11  ? 167  LEU E N   1 
ATOM   6544  C  CA  . LEU E  1 157 ? 49.262  -92.424  -88.123  1.00 34.62  ? 167  LEU E CA  1 
ATOM   6545  C  C   . LEU E  1 157 ? 49.069  -91.100  -87.390  1.00 34.94  ? 167  LEU E C   1 
ATOM   6546  O  O   . LEU E  1 157 ? 48.138  -90.343  -87.689  1.00 34.62  ? 167  LEU E O   1 
ATOM   6547  C  CB  . LEU E  1 157 ? 48.199  -93.420  -87.675  1.00 32.55  ? 167  LEU E CB  1 
ATOM   6548  C  CG  . LEU E  1 157 ? 48.163  -94.679  -88.531  1.00 30.22  ? 167  LEU E CG  1 
ATOM   6549  C  CD1 . LEU E  1 157 ? 46.904  -95.420  -88.201  1.00 29.33  ? 167  LEU E CD1 1 
ATOM   6550  C  CD2 . LEU E  1 157 ? 48.195  -94.323  -90.004  1.00 26.78  ? 167  LEU E CD2 1 
ATOM   6551  N  N   . ASP E  1 158 ? 49.948  -90.825  -86.433  1.00 35.49  ? 168  ASP E N   1 
ATOM   6552  C  CA  . ASP E  1 158 ? 49.870  -89.596  -85.662  1.00 34.98  ? 168  ASP E CA  1 
ATOM   6553  C  C   . ASP E  1 158 ? 50.633  -88.464  -86.341  1.00 34.06  ? 168  ASP E C   1 
ATOM   6554  O  O   . ASP E  1 158 ? 50.808  -87.400  -85.759  1.00 34.84  ? 168  ASP E O   1 
ATOM   6555  C  CB  . ASP E  1 158 ? 50.414  -89.814  -84.247  1.00 36.53  ? 168  ASP E CB  1 
ATOM   6556  C  CG  . ASP E  1 158 ? 49.386  -90.446  -83.305  1.00 39.64  ? 168  ASP E CG  1 
ATOM   6557  O  OD1 . ASP E  1 158 ? 48.299  -89.859  -83.099  1.00 41.49  ? 168  ASP E OD1 1 
ATOM   6558  O  OD2 . ASP E  1 158 ? 49.670  -91.530  -82.753  1.00 40.60  ? 168  ASP E OD2 1 
ATOM   6559  N  N   . SER E  1 159 ? 51.071  -88.686  -87.575  1.00 31.22  ? 169  SER E N   1 
ATOM   6560  C  CA  . SER E  1 159 ? 51.805  -87.662  -88.296  1.00 30.81  ? 169  SER E CA  1 
ATOM   6561  C  C   . SER E  1 159 ? 50.985  -86.411  -88.603  1.00 31.66  ? 169  SER E C   1 
ATOM   6562  O  O   . SER E  1 159 ? 49.757  -86.453  -88.621  1.00 33.53  ? 169  SER E O   1 
ATOM   6563  C  CB  . SER E  1 159 ? 52.344  -88.238  -89.591  1.00 29.73  ? 169  SER E CB  1 
ATOM   6564  O  OG  . SER E  1 159 ? 53.132  -89.373  -89.322  1.00 29.78  ? 169  SER E OG  1 
ATOM   6565  N  N   . TYR E  1 160 ? 51.675  -85.292  -88.825  1.00 31.73  ? 170  TYR E N   1 
ATOM   6566  C  CA  . TYR E  1 160 ? 51.013  -84.035  -89.158  1.00 31.83  ? 170  TYR E CA  1 
ATOM   6567  C  C   . TYR E  1 160 ? 50.984  -83.895  -90.664  1.00 31.85  ? 170  TYR E C   1 
ATOM   6568  O  O   . TYR E  1 160 ? 51.998  -84.060  -91.337  1.00 31.25  ? 170  TYR E O   1 
ATOM   6569  C  CB  . TYR E  1 160 ? 51.728  -82.827  -88.529  1.00 31.87  ? 170  TYR E CB  1 
ATOM   6570  C  CG  . TYR E  1 160 ? 51.270  -82.551  -87.122  1.00 32.84  ? 170  TYR E CG  1 
ATOM   6571  C  CD1 . TYR E  1 160 ? 51.753  -83.305  -86.054  1.00 34.04  ? 170  TYR E CD1 1 
ATOM   6572  C  CD2 . TYR E  1 160 ? 50.265  -81.617  -86.867  1.00 32.91  ? 170  TYR E CD2 1 
ATOM   6573  C  CE1 . TYR E  1 160 ? 51.240  -83.147  -84.768  1.00 33.64  ? 170  TYR E CE1 1 
ATOM   6574  C  CE2 . TYR E  1 160 ? 49.741  -81.451  -85.580  1.00 33.90  ? 170  TYR E CE2 1 
ATOM   6575  C  CZ  . TYR E  1 160 ? 50.233  -82.229  -84.538  1.00 35.08  ? 170  TYR E CZ  1 
ATOM   6576  O  OH  . TYR E  1 160 ? 49.681  -82.148  -83.278  1.00 38.43  ? 170  TYR E OH  1 
ATOM   6577  N  N   . VAL E  1 161 ? 49.814  -83.585  -91.194  1.00 33.01  ? 171  VAL E N   1 
ATOM   6578  C  CA  . VAL E  1 161 ? 49.676  -83.469  -92.631  1.00 35.58  ? 171  VAL E CA  1 
ATOM   6579  C  C   . VAL E  1 161 ? 49.014  -82.176  -93.069  1.00 38.40  ? 171  VAL E C   1 
ATOM   6580  O  O   . VAL E  1 161 ? 48.461  -81.426  -92.248  1.00 38.25  ? 171  VAL E O   1 
ATOM   6581  C  CB  . VAL E  1 161 ? 48.833  -84.651  -93.187  1.00 35.08  ? 171  VAL E CB  1 
ATOM   6582  C  CG1 . VAL E  1 161 ? 49.600  -85.965  -93.066  1.00 31.10  ? 171  VAL E CG1 1 
ATOM   6583  C  CG2 . VAL E  1 161 ? 47.510  -84.742  -92.416  1.00 32.96  ? 171  VAL E CG2 1 
ATOM   6584  N  N   . PHE E  1 162 ? 49.094  -81.916  -94.371  1.00 42.18  ? 172  PHE E N   1 
ATOM   6585  C  CA  . PHE E  1 162 ? 48.441  -80.755  -94.960  1.00 48.03  ? 172  PHE E CA  1 
ATOM   6586  C  C   . PHE E  1 162 ? 47.292  -81.333  -95.773  1.00 49.23  ? 172  PHE E C   1 
ATOM   6587  O  O   . PHE E  1 162 ? 47.484  -81.983  -96.802  1.00 50.97  ? 172  PHE E O   1 
ATOM   6588  C  CB  . PHE E  1 162 ? 49.414  -79.941  -95.821  1.00 50.44  ? 172  PHE E CB  1 
ATOM   6589  C  CG  . PHE E  1 162 ? 50.368  -79.091  -95.002  1.00 54.68  ? 172  PHE E CG  1 
ATOM   6590  C  CD1 . PHE E  1 162 ? 49.875  -78.157  -94.082  1.00 55.64  ? 172  PHE E CD1 1 
ATOM   6591  C  CD2 . PHE E  1 162 ? 51.749  -79.252  -95.108  1.00 54.52  ? 172  PHE E CD2 1 
ATOM   6592  C  CE1 . PHE E  1 162 ? 50.746  -77.405  -93.277  1.00 55.96  ? 172  PHE E CE1 1 
ATOM   6593  C  CE2 . PHE E  1 162 ? 52.626  -78.504  -94.308  1.00 55.65  ? 172  PHE E CE2 1 
ATOM   6594  C  CZ  . PHE E  1 162 ? 52.122  -77.581  -93.392  1.00 55.26  ? 172  PHE E CZ  1 
ATOM   6595  N  N   . LEU E  1 163 ? 46.091  -81.110  -95.262  1.00 49.85  ? 173  LEU E N   1 
ATOM   6596  C  CA  . LEU E  1 163 ? 44.876  -81.629  -95.858  1.00 51.34  ? 173  LEU E CA  1 
ATOM   6597  C  C   . LEU E  1 163 ? 44.085  -80.651  -96.714  1.00 53.03  ? 173  LEU E C   1 
ATOM   6598  O  O   . LEU E  1 163 ? 43.803  -79.532  -96.291  1.00 50.75  ? 173  LEU E O   1 
ATOM   6599  C  CB  . LEU E  1 163 ? 43.970  -82.144  -94.736  1.00 49.10  ? 173  LEU E CB  1 
ATOM   6600  C  CG  . LEU E  1 163 ? 42.578  -82.647  -95.109  1.00 47.89  ? 173  LEU E CG  1 
ATOM   6601  C  CD1 . LEU E  1 163 ? 42.709  -83.871  -95.999  1.00 48.16  ? 173  LEU E CD1 1 
ATOM   6602  C  CD2 . LEU E  1 163 ? 41.798  -82.975  -93.850  1.00 46.59  ? 173  LEU E CD2 1 
ATOM   6603  N  N   . ARG E  1 164 ? 43.733  -81.071  -97.925  1.00 56.78  ? 174  ARG E N   1 
ATOM   6604  C  CA  . ARG E  1 164 ? 42.895  -80.228  -98.773  1.00 60.24  ? 174  ARG E CA  1 
ATOM   6605  C  C   . ARG E  1 164 ? 41.568  -80.959  -98.807  1.00 60.26  ? 174  ARG E C   1 
ATOM   6606  O  O   . ARG E  1 164 ? 41.437  -81.964  -99.489  1.00 60.36  ? 174  ARG E O   1 
ATOM   6607  C  CB  . ARG E  1 164 ? 43.443  -80.083  -100.194 1.00 62.21  ? 174  ARG E CB  1 
ATOM   6608  C  CG  . ARG E  1 164 ? 42.718  -78.971  -100.930 1.00 66.60  ? 174  ARG E CG  1 
ATOM   6609  C  CD  . ARG E  1 164 ? 43.448  -78.463  -102.161 1.00 71.42  ? 174  ARG E CD  1 
ATOM   6610  N  NE  . ARG E  1 164 ? 43.075  -77.075  -102.457 1.00 76.59  ? 174  ARG E NE  1 
ATOM   6611  C  CZ  . ARG E  1 164 ? 41.824  -76.636  -102.628 1.00 78.75  ? 174  ARG E CZ  1 
ATOM   6612  N  NH1 . ARG E  1 164 ? 40.795  -77.474  -102.539 1.00 79.84  ? 174  ARG E NH1 1 
ATOM   6613  N  NH2 . ARG E  1 164 ? 41.595  -75.349  -102.880 1.00 78.47  ? 174  ARG E NH2 1 
ATOM   6614  N  N   . VAL E  1 165 ? 40.595  -80.462  -98.049  1.00 61.71  ? 175  VAL E N   1 
ATOM   6615  C  CA  . VAL E  1 165 ? 39.288  -81.102  -97.965  1.00 63.40  ? 175  VAL E CA  1 
ATOM   6616  C  C   . VAL E  1 165 ? 38.518  -81.133  -99.276  1.00 65.05  ? 175  VAL E C   1 
ATOM   6617  O  O   . VAL E  1 165 ? 38.070  -80.102  -99.775  1.00 63.72  ? 175  VAL E O   1 
ATOM   6618  C  CB  . VAL E  1 165 ? 38.413  -80.428  -96.907  1.00 63.36  ? 175  VAL E CB  1 
ATOM   6619  C  CG1 . VAL E  1 165 ? 37.141  -81.229  -96.709  1.00 62.48  ? 175  VAL E CG1 1 
ATOM   6620  C  CG2 . VAL E  1 165 ? 39.179  -80.308  -95.603  1.00 64.16  ? 175  VAL E CG2 1 
ATOM   6621  N  N   . ARG E  1 166 ? 38.369  -82.337  -99.818  1.00 67.81  ? 176  ARG E N   1 
ATOM   6622  C  CA  . ARG E  1 166 ? 37.659  -82.555  -101.070 1.00 70.55  ? 176  ARG E CA  1 
ATOM   6623  C  C   . ARG E  1 166 ? 36.240  -83.006  -100.770 1.00 71.77  ? 176  ARG E C   1 
ATOM   6624  O  O   . ARG E  1 166 ? 35.461  -83.269  -101.684 1.00 72.29  ? 176  ARG E O   1 
ATOM   6625  C  CB  . ARG E  1 166 ? 38.360  -83.636  -101.902 1.00 72.02  ? 176  ARG E CB  1 
ATOM   6626  C  CG  . ARG E  1 166 ? 39.744  -83.268  -102.427 1.00 73.09  ? 176  ARG E CG  1 
ATOM   6627  C  CD  . ARG E  1 166 ? 39.680  -82.091  -103.389 1.00 75.29  ? 176  ARG E CD  1 
ATOM   6628  N  NE  . ARG E  1 166 ? 40.989  -81.789  -103.961 1.00 77.23  ? 176  ARG E NE  1 
ATOM   6629  C  CZ  . ARG E  1 166 ? 41.260  -80.704  -104.677 1.00 77.49  ? 176  ARG E CZ  1 
ATOM   6630  N  NH1 . ARG E  1 166 ? 40.305  -79.811  -104.910 1.00 77.00  ? 176  ARG E NH1 1 
ATOM   6631  N  NH2 . ARG E  1 166 ? 42.486  -80.512  -105.155 1.00 78.15  ? 176  ARG E NH2 1 
ATOM   6632  N  N   . GLU E  1 167 ? 35.914  -83.099  -99.484  1.00 73.31  ? 177  GLU E N   1 
ATOM   6633  C  CA  . GLU E  1 167 ? 34.589  -83.536  -99.058  1.00 73.73  ? 177  GLU E CA  1 
ATOM   6634  C  C   . GLU E  1 167 ? 34.245  -83.181  -97.615  1.00 72.58  ? 177  GLU E C   1 
ATOM   6635  O  O   . GLU E  1 167 ? 34.646  -83.867  -96.674  1.00 71.68  ? 177  GLU E O   1 
ATOM   6636  C  CB  . GLU E  1 167 ? 34.448  -85.047  -99.260  1.00 76.12  ? 177  GLU E CB  1 
ATOM   6637  C  CG  . GLU E  1 167 ? 35.756  -85.815  -99.120  1.00 80.97  ? 177  GLU E CG  1 
ATOM   6638  C  CD  . GLU E  1 167 ? 35.566  -87.326  -99.185  1.00 83.88  ? 177  GLU E CD  1 
ATOM   6639  O  OE1 . GLU E  1 167 ? 34.696  -87.790  -99.961  1.00 85.85  ? 177  GLU E OE1 1 
ATOM   6640  O  OE2 . GLU E  1 167 ? 36.298  -88.049  -98.468  1.00 84.13  ? 177  GLU E OE2 1 
ATOM   6641  N  N   . ARG E  1 168 ? 33.493  -82.096  -97.470  1.00 71.78  ? 178  ARG E N   1 
ATOM   6642  C  CA  . ARG E  1 168 ? 33.021  -81.582  -96.186  1.00 70.95  ? 178  ARG E CA  1 
ATOM   6643  C  C   . ARG E  1 168 ? 33.042  -82.570  -95.021  1.00 69.96  ? 178  ARG E C   1 
ATOM   6644  O  O   . ARG E  1 168 ? 32.161  -83.414  -94.923  1.00 69.73  ? 178  ARG E O   1 
ATOM   6645  C  CB  . ARG E  1 168 ? 31.587  -81.074  -96.360  1.00 71.32  ? 178  ARG E CB  1 
ATOM   6646  C  CG  . ARG E  1 168 ? 31.406  -79.566  -96.409  1.00 72.10  ? 178  ARG E CG  1 
ATOM   6647  C  CD  . ARG E  1 168 ? 30.978  -79.071  -95.043  1.00 72.94  ? 178  ARG E CD  1 
ATOM   6648  N  NE  . ARG E  1 168 ? 30.083  -80.032  -94.400  1.00 74.28  ? 178  ARG E NE  1 
ATOM   6649  C  CZ  . ARG E  1 168 ? 29.511  -79.854  -93.212  1.00 75.21  ? 178  ARG E CZ  1 
ATOM   6650  N  NH1 . ARG E  1 168 ? 28.715  -80.791  -92.710  1.00 74.32  ? 178  ARG E NH1 1 
ATOM   6651  N  NH2 . ARG E  1 168 ? 29.727  -78.736  -92.529  1.00 74.97  ? 178  ARG E NH2 1 
ATOM   6652  N  N   . GLN E  1 169 ? 34.039  -82.476  -94.144  1.00 69.71  ? 179  GLN E N   1 
ATOM   6653  C  CA  . GLN E  1 169 ? 34.075  -83.355  -92.976  1.00 69.36  ? 179  GLN E CA  1 
ATOM   6654  C  C   . GLN E  1 169 ? 33.565  -82.531  -91.784  1.00 68.86  ? 179  GLN E C   1 
ATOM   6655  O  O   . GLN E  1 169 ? 34.147  -81.509  -91.404  1.00 68.92  ? 179  GLN E O   1 
ATOM   6656  C  CB  . GLN E  1 169 ? 35.476  -83.900  -92.717  1.00 69.73  ? 179  GLN E CB  1 
ATOM   6657  C  CG  . GLN E  1 169 ? 35.488  -84.926  -91.588  1.00 71.89  ? 179  GLN E CG  1 
ATOM   6658  C  CD  . GLN E  1 169 ? 36.594  -85.964  -91.723  1.00 73.60  ? 179  GLN E CD  1 
ATOM   6659  O  OE1 . GLN E  1 169 ? 36.779  -86.802  -90.836  1.00 72.53  ? 179  GLN E OE1 1 
ATOM   6660  N  NE2 . GLN E  1 169 ? 37.329  -85.918  -92.837  1.00 72.91  ? 179  GLN E NE2 1 
ATOM   6661  N  N   . GLU E  1 170 ? 32.465  -83.006  -91.210  1.00 66.96  ? 180  GLU E N   1 
ATOM   6662  C  CA  . GLU E  1 170 ? 31.746  -82.345  -90.133  1.00 64.89  ? 180  GLU E CA  1 
ATOM   6663  C  C   . GLU E  1 170 ? 32.079  -82.694  -88.688  1.00 63.17  ? 180  GLU E C   1 
ATOM   6664  O  O   . GLU E  1 170 ? 32.248  -83.857  -88.335  1.00 63.53  ? 180  GLU E O   1 
ATOM   6665  C  CB  . GLU E  1 170 ? 30.259  -82.579  -90.387  1.00 66.58  ? 180  GLU E CB  1 
ATOM   6666  C  CG  . GLU E  1 170 ? 29.304  -82.064  -89.348  1.00 70.36  ? 180  GLU E CG  1 
ATOM   6667  C  CD  . GLU E  1 170 ? 27.872  -82.476  -89.661  1.00 73.32  ? 180  GLU E CD  1 
ATOM   6668  O  OE1 . GLU E  1 170 ? 27.394  -82.174  -90.779  1.00 74.25  ? 180  GLU E OE1 1 
ATOM   6669  O  OE2 . GLU E  1 170 ? 27.226  -83.106  -88.793  1.00 74.91  ? 180  GLU E OE2 1 
ATOM   6670  N  N   . ASN E  1 171 ? 32.155  -81.656  -87.860  1.00 60.88  ? 181  ASN E N   1 
ATOM   6671  C  CA  . ASN E  1 171 ? 32.421  -81.771  -86.431  1.00 57.83  ? 181  ASN E CA  1 
ATOM   6672  C  C   . ASN E  1 171 ? 33.731  -82.368  -85.954  1.00 56.77  ? 181  ASN E C   1 
ATOM   6673  O  O   . ASN E  1 171 ? 33.748  -83.446  -85.354  1.00 57.27  ? 181  ASN E O   1 
ATOM   6674  C  CB  . ASN E  1 171 ? 31.274  -82.515  -85.767  1.00 57.47  ? 181  ASN E CB  1 
ATOM   6675  C  CG  . ASN E  1 171 ? 30.035  -81.670  -85.662  1.00 59.00  ? 181  ASN E CG  1 
ATOM   6676  O  OD1 . ASN E  1 171 ? 28.990  -82.137  -85.218  1.00 61.08  ? 181  ASN E OD1 1 
ATOM   6677  N  ND2 . ASN E  1 171 ? 30.142  -80.408  -86.071  1.00 59.68  ? 181  ASN E ND2 1 
ATOM   6678  N  N   . ILE E  1 172 ? 34.825  -81.653  -86.191  1.00 54.83  ? 182  ILE E N   1 
ATOM   6679  C  CA  . ILE E  1 172 ? 36.142  -82.103  -85.757  1.00 51.82  ? 182  ILE E CA  1 
ATOM   6680  C  C   . ILE E  1 172 ? 36.511  -81.393  -84.458  1.00 49.98  ? 182  ILE E C   1 
ATOM   6681  O  O   . ILE E  1 172 ? 36.570  -80.166  -84.407  1.00 50.05  ? 182  ILE E O   1 
ATOM   6682  C  CB  . ILE E  1 172 ? 37.221  -81.778  -86.802  1.00 51.65  ? 182  ILE E CB  1 
ATOM   6683  C  CG1 . ILE E  1 172 ? 36.943  -82.536  -88.096  1.00 50.92  ? 182  ILE E CG1 1 
ATOM   6684  C  CG2 . ILE E  1 172 ? 38.591  -82.134  -86.255  1.00 52.11  ? 182  ILE E CG2 1 
ATOM   6685  C  CD1 . ILE E  1 172 ? 37.062  -84.030  -87.959  1.00 51.62  ? 182  ILE E CD1 1 
ATOM   6686  N  N   . LEU E  1 173 ? 36.746  -82.169  -83.408  1.00 47.44  ? 183  LEU E N   1 
ATOM   6687  C  CA  . LEU E  1 173 ? 37.121  -81.608  -82.122  1.00 44.12  ? 183  LEU E CA  1 
ATOM   6688  C  C   . LEU E  1 173 ? 38.623  -81.439  -82.076  1.00 43.22  ? 183  LEU E C   1 
ATOM   6689  O  O   . LEU E  1 173 ? 39.362  -82.372  -82.363  1.00 43.69  ? 183  LEU E O   1 
ATOM   6690  C  CB  . LEU E  1 173 ? 36.708  -82.535  -80.983  1.00 40.91  ? 183  LEU E CB  1 
ATOM   6691  C  CG  . LEU E  1 173 ? 37.137  -82.020  -79.606  1.00 40.06  ? 183  LEU E CG  1 
ATOM   6692  C  CD1 . LEU E  1 173 ? 36.315  -80.793  -79.252  1.00 40.39  ? 183  LEU E CD1 1 
ATOM   6693  C  CD2 . LEU E  1 173 ? 36.951  -83.089  -78.549  1.00 38.43  ? 183  LEU E CD2 1 
ATOM   6694  N  N   . VAL E  1 174 ? 39.084  -80.246  -81.737  1.00 42.91  ? 184  VAL E N   1 
ATOM   6695  C  CA  . VAL E  1 174 ? 40.518  -80.037  -81.632  1.00 43.34  ? 184  VAL E CA  1 
ATOM   6696  C  C   . VAL E  1 174 ? 40.839  -79.761  -80.182  1.00 42.99  ? 184  VAL E C   1 
ATOM   6697  O  O   . VAL E  1 174 ? 40.235  -78.887  -79.558  1.00 41.82  ? 184  VAL E O   1 
ATOM   6698  C  CB  . VAL E  1 174 ? 41.006  -78.876  -82.488  1.00 42.97  ? 184  VAL E CB  1 
ATOM   6699  C  CG1 . VAL E  1 174 ? 42.440  -78.547  -82.115  1.00 40.88  ? 184  VAL E CG1 1 
ATOM   6700  C  CG2 . VAL E  1 174 ? 40.923  -79.259  -83.958  1.00 41.08  ? 184  VAL E CG2 1 
ATOM   6701  N  N   . GLU E  1 175 ? 41.790  -80.521  -79.650  1.00 43.28  ? 185  GLU E N   1 
ATOM   6702  C  CA  . GLU E  1 175 ? 42.170  -80.391  -78.252  1.00 43.81  ? 185  GLU E CA  1 
ATOM   6703  C  C   . GLU E  1 175 ? 43.635  -80.041  -78.054  1.00 43.01  ? 185  GLU E C   1 
ATOM   6704  O  O   . GLU E  1 175 ? 44.478  -80.929  -77.951  1.00 43.81  ? 185  GLU E O   1 
ATOM   6705  C  CB  . GLU E  1 175 ? 41.856  -81.692  -77.518  1.00 42.67  ? 185  GLU E CB  1 
ATOM   6706  C  CG  . GLU E  1 175 ? 40.427  -82.131  -77.685  1.00 44.23  ? 185  GLU E CG  1 
ATOM   6707  C  CD  . GLU E  1 175 ? 40.203  -83.571  -77.275  1.00 46.69  ? 185  GLU E CD  1 
ATOM   6708  O  OE1 . GLU E  1 175 ? 40.910  -84.454  -77.806  1.00 47.07  ? 185  GLU E OE1 1 
ATOM   6709  O  OE2 . GLU E  1 175 ? 39.313  -83.820  -76.432  1.00 47.63  ? 185  GLU E OE2 1 
ATOM   6710  N  N   . PRO E  1 176 ? 43.956  -78.739  -77.999  1.00 40.96  ? 186  PRO E N   1 
ATOM   6711  C  CA  . PRO E  1 176 ? 45.327  -78.267  -77.805  1.00 40.71  ? 186  PRO E CA  1 
ATOM   6712  C  C   . PRO E  1 176 ? 45.846  -78.737  -76.445  1.00 41.63  ? 186  PRO E C   1 
ATOM   6713  O  O   . PRO E  1 176 ? 45.181  -78.539  -75.426  1.00 40.19  ? 186  PRO E O   1 
ATOM   6714  C  CB  . PRO E  1 176 ? 45.169  -76.757  -77.862  1.00 39.68  ? 186  PRO E CB  1 
ATOM   6715  C  CG  . PRO E  1 176 ? 44.000  -76.589  -78.766  1.00 38.44  ? 186  PRO E CG  1 
ATOM   6716  C  CD  . PRO E  1 176 ? 43.055  -77.607  -78.244  1.00 38.85  ? 186  PRO E CD  1 
ATOM   6717  N  N   . ASP E  1 177 ? 47.020  -79.363  -76.427  1.00 43.37  ? 187  ASP E N   1 
ATOM   6718  C  CA  . ASP E  1 177 ? 47.589  -79.852  -75.174  1.00 45.93  ? 187  ASP E CA  1 
ATOM   6719  C  C   . ASP E  1 177 ? 48.147  -78.707  -74.348  1.00 46.57  ? 187  ASP E C   1 
ATOM   6720  O  O   . ASP E  1 177 ? 49.357  -78.573  -74.154  1.00 45.93  ? 187  ASP E O   1 
ATOM   6721  C  CB  . ASP E  1 177 ? 48.686  -80.876  -75.437  1.00 47.64  ? 187  ASP E CB  1 
ATOM   6722  C  CG  . ASP E  1 177 ? 49.375  -81.312  -74.162  1.00 50.88  ? 187  ASP E CG  1 
ATOM   6723  O  OD1 . ASP E  1 177 ? 48.667  -81.661  -73.192  1.00 50.22  ? 187  ASP E OD1 1 
ATOM   6724  O  OD2 . ASP E  1 177 ? 50.625  -81.298  -74.128  1.00 55.30  ? 187  ASP E OD2 1 
ATOM   6725  N  N   . THR E  1 178 ? 47.235  -77.887  -73.851  1.00 48.08  ? 188  THR E N   1 
ATOM   6726  C  CA  . THR E  1 178 ? 47.589  -76.723  -73.076  1.00 49.44  ? 188  THR E CA  1 
ATOM   6727  C  C   . THR E  1 178 ? 47.273  -76.940  -71.610  1.00 49.27  ? 188  THR E C   1 
ATOM   6728  O  O   . THR E  1 178 ? 46.868  -78.027  -71.214  1.00 49.90  ? 188  THR E O   1 
ATOM   6729  C  CB  . THR E  1 178 ? 46.820  -75.516  -73.593  1.00 50.54  ? 188  THR E CB  1 
ATOM   6730  O  OG1 . THR E  1 178 ? 46.709  -75.609  -75.016  1.00 53.47  ? 188  THR E OG1 1 
ATOM   6731  C  CG2 . THR E  1 178 ? 47.561  -74.243  -73.278  1.00 55.06  ? 188  THR E CG2 1 
ATOM   6732  N  N   . ASP E  1 179 ? 47.468  -75.901  -70.809  1.00 49.65  ? 189  ASP E N   1 
ATOM   6733  C  CA  . ASP E  1 179 ? 47.211  -75.974  -69.383  1.00 50.72  ? 189  ASP E CA  1 
ATOM   6734  C  C   . ASP E  1 179 ? 45.781  -75.613  -69.078  1.00 50.20  ? 189  ASP E C   1 
ATOM   6735  O  O   . ASP E  1 179 ? 45.122  -76.230  -68.246  1.00 48.92  ? 189  ASP E O   1 
ATOM   6736  C  CB  . ASP E  1 179 ? 48.153  -75.034  -68.644  1.00 53.12  ? 189  ASP E CB  1 
ATOM   6737  C  CG  . ASP E  1 179 ? 49.543  -75.596  -68.539  1.00 55.53  ? 189  ASP E CG  1 
ATOM   6738  O  OD1 . ASP E  1 179 ? 49.693  -76.635  -67.858  1.00 57.00  ? 189  ASP E OD1 1 
ATOM   6739  O  OD2 . ASP E  1 179 ? 50.475  -75.019  -69.141  1.00 57.92  ? 189  ASP E OD2 1 
ATOM   6740  N  N   . GLU E  1 180 ? 45.308  -74.586  -69.753  1.00 51.21  ? 190  GLU E N   1 
ATOM   6741  C  CA  . GLU E  1 180 ? 43.950  -74.158  -69.567  1.00 52.43  ? 190  GLU E CA  1 
ATOM   6742  C  C   . GLU E  1 180 ? 43.128  -74.796  -70.689  1.00 52.52  ? 190  GLU E C   1 
ATOM   6743  O  O   . GLU E  1 180 ? 43.649  -75.073  -71.774  1.00 49.85  ? 190  GLU E O   1 
ATOM   6744  C  CB  . GLU E  1 180 ? 43.882  -72.623  -69.607  1.00 54.37  ? 190  GLU E CB  1 
ATOM   6745  C  CG  . GLU E  1 180 ? 44.718  -71.954  -70.727  1.00 59.04  ? 190  GLU E CG  1 
ATOM   6746  C  CD  . GLU E  1 180 ? 46.228  -71.870  -70.432  1.00 60.85  ? 190  GLU E CD  1 
ATOM   6747  O  OE1 . GLU E  1 180 ? 46.614  -71.219  -69.427  1.00 62.19  ? 190  GLU E OE1 1 
ATOM   6748  O  OE2 . GLU E  1 180 ? 47.026  -72.442  -71.212  1.00 57.13  ? 190  GLU E OE2 1 
ATOM   6749  N  N   . GLN E  1 181 ? 41.857  -75.062  -70.394  1.00 53.89  ? 191  GLN E N   1 
ATOM   6750  C  CA  . GLN E  1 181 ? 40.912  -75.651  -71.345  1.00 54.09  ? 191  GLN E CA  1 
ATOM   6751  C  C   . GLN E  1 181 ? 40.780  -74.760  -72.588  1.00 54.65  ? 191  GLN E C   1 
ATOM   6752  O  O   . GLN E  1 181 ? 40.083  -73.746  -72.562  1.00 55.30  ? 191  GLN E O   1 
ATOM   6753  C  CB  . GLN E  1 181 ? 39.556  -75.804  -70.653  1.00 53.47  ? 191  GLN E CB  1 
ATOM   6754  C  CG  . GLN E  1 181 ? 38.417  -76.272  -71.525  1.00 54.66  ? 191  GLN E CG  1 
ATOM   6755  C  CD  . GLN E  1 181 ? 38.678  -77.618  -72.153  1.00 55.06  ? 191  GLN E CD  1 
ATOM   6756  O  OE1 . GLN E  1 181 ? 39.355  -78.463  -71.571  1.00 56.98  ? 191  GLN E OE1 1 
ATOM   6757  N  NE2 . GLN E  1 181 ? 38.126  -77.835  -73.342  1.00 54.99  ? 191  GLN E NE2 1 
ATOM   6758  N  N   . ARG E  1 182 ? 41.451  -75.143  -73.671  1.00 54.86  ? 192  ARG E N   1 
ATOM   6759  C  CA  . ARG E  1 182 ? 41.417  -74.370  -74.914  1.00 54.01  ? 192  ARG E CA  1 
ATOM   6760  C  C   . ARG E  1 182 ? 40.874  -75.156  -76.109  1.00 52.39  ? 192  ARG E C   1 
ATOM   6761  O  O   . ARG E  1 182 ? 41.214  -74.861  -77.254  1.00 51.55  ? 192  ARG E O   1 
ATOM   6762  C  CB  . ARG E  1 182 ? 42.822  -73.880  -75.269  1.00 56.63  ? 192  ARG E CB  1 
ATOM   6763  C  CG  . ARG E  1 182 ? 43.281  -72.585  -74.620  1.00 59.58  ? 192  ARG E CG  1 
ATOM   6764  C  CD  . ARG E  1 182 ? 44.582  -72.165  -75.294  1.00 63.56  ? 192  ARG E CD  1 
ATOM   6765  N  NE  . ARG E  1 182 ? 44.419  -72.154  -76.750  1.00 68.99  ? 192  ARG E NE  1 
ATOM   6766  C  CZ  . ARG E  1 182 ? 45.388  -72.385  -77.636  1.00 71.48  ? 192  ARG E CZ  1 
ATOM   6767  N  NH1 . ARG E  1 182 ? 46.628  -72.652  -77.234  1.00 72.25  ? 192  ARG E NH1 1 
ATOM   6768  N  NH2 . ARG E  1 182 ? 45.111  -72.360  -78.937  1.00 71.54  ? 192  ARG E NH2 1 
ATOM   6769  N  N   . ASP E  1 183 ? 40.033  -76.149  -75.848  1.00 50.86  ? 193  ASP E N   1 
ATOM   6770  C  CA  . ASP E  1 183 ? 39.476  -76.970  -76.915  1.00 48.48  ? 193  ASP E CA  1 
ATOM   6771  C  C   . ASP E  1 183 ? 38.459  -76.251  -77.777  1.00 45.91  ? 193  ASP E C   1 
ATOM   6772  O  O   . ASP E  1 183 ? 37.812  -75.298  -77.350  1.00 43.58  ? 193  ASP E O   1 
ATOM   6773  C  CB  . ASP E  1 183 ? 38.824  -78.219  -76.330  1.00 51.52  ? 193  ASP E CB  1 
ATOM   6774  C  CG  . ASP E  1 183 ? 39.826  -79.161  -75.718  1.00 55.00  ? 193  ASP E CG  1 
ATOM   6775  O  OD1 . ASP E  1 183 ? 40.985  -78.742  -75.490  1.00 57.54  ? 193  ASP E OD1 1 
ATOM   6776  O  OD2 . ASP E  1 183 ? 39.449  -80.320  -75.458  1.00 56.73  ? 193  ASP E OD2 1 
ATOM   6777  N  N   . TYR E  1 184 ? 38.312  -76.738  -78.999  1.00 44.18  ? 194  TYR E N   1 
ATOM   6778  C  CA  . TYR E  1 184 ? 37.361  -76.164  -79.932  1.00 41.51  ? 194  TYR E CA  1 
ATOM   6779  C  C   . TYR E  1 184 ? 36.960  -77.156  -81.018  1.00 41.43  ? 194  TYR E C   1 
ATOM   6780  O  O   . TYR E  1 184 ? 37.759  -78.002  -81.439  1.00 40.85  ? 194  TYR E O   1 
ATOM   6781  C  CB  . TYR E  1 184 ? 37.951  -74.899  -80.559  1.00 36.45  ? 194  TYR E CB  1 
ATOM   6782  C  CG  . TYR E  1 184 ? 39.136  -75.102  -81.481  1.00 33.14  ? 194  TYR E CG  1 
ATOM   6783  C  CD1 . TYR E  1 184 ? 38.958  -75.445  -82.822  1.00 33.52  ? 194  TYR E CD1 1 
ATOM   6784  C  CD2 . TYR E  1 184 ? 40.433  -74.883  -81.034  1.00 31.92  ? 194  TYR E CD2 1 
ATOM   6785  C  CE1 . TYR E  1 184 ? 40.044  -75.551  -83.689  1.00 30.02  ? 194  TYR E CE1 1 
ATOM   6786  C  CE2 . TYR E  1 184 ? 41.519  -74.986  -81.894  1.00 28.12  ? 194  TYR E CE2 1 
ATOM   6787  C  CZ  . TYR E  1 184 ? 41.318  -75.312  -83.216  1.00 29.69  ? 194  TYR E CZ  1 
ATOM   6788  O  OH  . TYR E  1 184 ? 42.394  -75.348  -84.076  1.00 31.84  ? 194  TYR E OH  1 
ATOM   6789  N  N   . VAL E  1 185 ? 35.709  -77.060  -81.451  1.00 41.36  ? 195  VAL E N   1 
ATOM   6790  C  CA  . VAL E  1 185 ? 35.207  -77.925  -82.505  1.00 41.83  ? 195  VAL E CA  1 
ATOM   6791  C  C   . VAL E  1 185 ? 34.952  -77.096  -83.755  1.00 42.34  ? 195  VAL E C   1 
ATOM   6792  O  O   . VAL E  1 185 ? 34.361  -76.021  -83.684  1.00 40.77  ? 195  VAL E O   1 
ATOM   6793  C  CB  . VAL E  1 185 ? 33.904  -78.628  -82.091  1.00 41.62  ? 195  VAL E CB  1 
ATOM   6794  C  CG1 . VAL E  1 185 ? 32.915  -77.622  -81.547  1.00 39.14  ? 195  VAL E CG1 1 
ATOM   6795  C  CG2 . VAL E  1 185 ? 33.320  -79.359  -83.288  1.00 40.39  ? 195  VAL E CG2 1 
ATOM   6796  N  N   . ILE E  1 186 ? 35.416  -77.596  -84.896  1.00 44.49  ? 196  ILE E N   1 
ATOM   6797  C  CA  . ILE E  1 186 ? 35.242  -76.895  -86.163  1.00 47.05  ? 196  ILE E CA  1 
ATOM   6798  C  C   . ILE E  1 186 ? 34.829  -77.840  -87.273  1.00 48.82  ? 196  ILE E C   1 
ATOM   6799  O  O   . ILE E  1 186 ? 35.066  -79.041  -87.191  1.00 49.41  ? 196  ILE E O   1 
ATOM   6800  C  CB  . ILE E  1 186 ? 36.551  -76.164  -86.610  1.00 46.19  ? 196  ILE E CB  1 
ATOM   6801  C  CG1 . ILE E  1 186 ? 37.721  -77.148  -86.695  1.00 46.24  ? 196  ILE E CG1 1 
ATOM   6802  C  CG2 . ILE E  1 186 ? 36.874  -75.033  -85.653  1.00 47.28  ? 196  ILE E CG2 1 
ATOM   6803  C  CD1 . ILE E  1 186 ? 37.891  -77.794  -88.050  1.00 46.17  ? 196  ILE E CD1 1 
ATOM   6804  N  N   . ASP E  1 187 ? 34.195  -77.289  -88.304  1.00 51.28  ? 197  ASP E N   1 
ATOM   6805  C  CA  . ASP E  1 187 ? 33.781  -78.077  -89.460  1.00 53.02  ? 197  ASP E CA  1 
ATOM   6806  C  C   . ASP E  1 187 ? 34.826  -77.870  -90.542  1.00 54.01  ? 197  ASP E C   1 
ATOM   6807  O  O   . ASP E  1 187 ? 35.263  -76.746  -90.788  1.00 52.72  ? 197  ASP E O   1 
ATOM   6808  C  CB  . ASP E  1 187 ? 32.410  -77.633  -89.996  1.00 52.60  ? 197  ASP E CB  1 
ATOM   6809  C  CG  . ASP E  1 187 ? 31.251  -78.164  -89.170  1.00 53.69  ? 197  ASP E CG  1 
ATOM   6810  O  OD1 . ASP E  1 187 ? 31.254  -79.367  -88.830  1.00 51.83  ? 197  ASP E OD1 1 
ATOM   6811  O  OD2 . ASP E  1 187 ? 30.324  -77.376  -88.874  1.00 54.50  ? 197  ASP E OD2 1 
ATOM   6812  N  N   . LEU E  1 188 ? 35.234  -78.963  -91.173  1.00 56.37  ? 198  LEU E N   1 
ATOM   6813  C  CA  . LEU E  1 188 ? 36.216  -78.894  -92.242  1.00 58.45  ? 198  LEU E CA  1 
ATOM   6814  C  C   . LEU E  1 188 ? 35.457  -78.753  -93.553  1.00 60.10  ? 198  LEU E C   1 
ATOM   6815  O  O   . LEU E  1 188 ? 34.928  -79.732  -94.081  1.00 60.83  ? 198  LEU E O   1 
ATOM   6816  C  CB  . LEU E  1 188 ? 37.081  -80.159  -92.260  1.00 58.53  ? 198  LEU E CB  1 
ATOM   6817  C  CG  . LEU E  1 188 ? 37.976  -80.394  -91.037  1.00 58.66  ? 198  LEU E CG  1 
ATOM   6818  C  CD1 . LEU E  1 188 ? 38.752  -81.688  -91.182  1.00 59.09  ? 198  LEU E CD1 1 
ATOM   6819  C  CD2 . LEU E  1 188 ? 38.932  -79.240  -90.894  1.00 59.58  ? 198  LEU E CD2 1 
ATOM   6820  N  N   . GLU E  1 189 ? 35.394  -77.525  -94.060  1.00 61.37  ? 199  GLU E N   1 
ATOM   6821  C  CA  . GLU E  1 189 ? 34.695  -77.231  -95.311  1.00 62.00  ? 199  GLU E CA  1 
ATOM   6822  C  C   . GLU E  1 189 ? 35.375  -77.865  -96.511  1.00 62.26  ? 199  GLU E C   1 
ATOM   6823  O  O   . GLU E  1 189 ? 36.584  -78.093  -96.512  1.00 62.09  ? 199  GLU E O   1 
ATOM   6824  C  CB  . GLU E  1 189 ? 34.616  -75.720  -95.532  1.00 61.68  ? 199  GLU E CB  1 
ATOM   6825  C  CG  . GLU E  1 189 ? 33.968  -74.986  -94.392  1.00 63.89  ? 199  GLU E CG  1 
ATOM   6826  C  CD  . GLU E  1 189 ? 32.524  -75.382  -94.216  1.00 65.78  ? 199  GLU E CD  1 
ATOM   6827  O  OE1 . GLU E  1 189 ? 32.228  -76.595  -94.272  1.00 67.21  ? 199  GLU E OE1 1 
ATOM   6828  O  OE2 . GLU E  1 189 ? 31.681  -74.485  -94.015  1.00 67.83  ? 199  GLU E OE2 1 
ATOM   6829  N  N   . LYS E  1 190 ? 34.583  -78.149  -97.535  1.00 63.45  ? 200  LYS E N   1 
ATOM   6830  C  CA  . LYS E  1 190 ? 35.106  -78.734  -98.759  1.00 63.05  ? 200  LYS E CA  1 
ATOM   6831  C  C   . LYS E  1 190 ? 35.793  -77.593  -99.501  1.00 60.82  ? 200  LYS E C   1 
ATOM   6832  O  O   . LYS E  1 190 ? 35.205  -76.526  -99.693  1.00 59.32  ? 200  LYS E O   1 
ATOM   6833  C  CB  . LYS E  1 190 ? 33.960  -79.313  -99.600  1.00 65.64  ? 200  LYS E CB  1 
ATOM   6834  C  CG  . LYS E  1 190 ? 34.397  -79.920  -100.934 1.00 67.73  ? 200  LYS E CG  1 
ATOM   6835  C  CD  . LYS E  1 190 ? 33.202  -80.396  -101.757 1.00 68.89  ? 200  LYS E CD  1 
ATOM   6836  C  CE  . LYS E  1 190 ? 32.249  -79.252  -102.087 1.00 69.17  ? 200  LYS E CE  1 
ATOM   6837  N  NZ  . LYS E  1 190 ? 32.907  -78.181  -102.895 1.00 69.77  ? 200  LYS E NZ  1 
ATOM   6838  N  N   . GLY E  1 191 ? 37.043  -77.815  -99.894  1.00 58.81  ? 201  GLY E N   1 
ATOM   6839  C  CA  . GLY E  1 191 ? 37.787  -76.790  -100.598 1.00 56.60  ? 201  GLY E CA  1 
ATOM   6840  C  C   . GLY E  1 191 ? 38.808  -76.110  -99.706  1.00 55.13  ? 201  GLY E C   1 
ATOM   6841  O  O   . GLY E  1 191 ? 39.775  -75.529  -100.197 1.00 54.94  ? 201  GLY E O   1 
ATOM   6842  N  N   . SER E  1 192 ? 38.598  -76.184  -98.393  1.00 53.62  ? 202  SER E N   1 
ATOM   6843  C  CA  . SER E  1 192 ? 39.515  -75.571  -97.432  1.00 52.18  ? 202  SER E CA  1 
ATOM   6844  C  C   . SER E  1 192 ? 40.699  -76.487  -97.110  1.00 50.85  ? 202  SER E C   1 
ATOM   6845  O  O   . SER E  1 192 ? 40.616  -77.708  -97.264  1.00 50.07  ? 202  SER E O   1 
ATOM   6846  C  CB  . SER E  1 192 ? 38.779  -75.239  -96.134  1.00 51.99  ? 202  SER E CB  1 
ATOM   6847  O  OG  . SER E  1 192 ? 38.457  -76.422  -95.428  1.00 51.19  ? 202  SER E OG  1 
ATOM   6848  N  N   . GLN E  1 193 ? 41.801  -75.887  -96.665  1.00 49.01  ? 203  GLN E N   1 
ATOM   6849  C  CA  . GLN E  1 193 ? 42.988  -76.651  -96.312  1.00 47.52  ? 203  GLN E CA  1 
ATOM   6850  C  C   . GLN E  1 193 ? 43.369  -76.469  -94.843  1.00 45.85  ? 203  GLN E C   1 
ATOM   6851  O  O   . GLN E  1 193 ? 43.082  -75.441  -94.239  1.00 45.43  ? 203  GLN E O   1 
ATOM   6852  C  CB  . GLN E  1 193 ? 44.150  -76.284  -97.239  1.00 46.18  ? 203  GLN E CB  1 
ATOM   6853  C  CG  . GLN E  1 193 ? 44.361  -74.809  -97.460  1.00 46.25  ? 203  GLN E CG  1 
ATOM   6854  C  CD  . GLN E  1 193 ? 44.924  -74.508  -98.852  1.00 47.18  ? 203  GLN E CD  1 
ATOM   6855  O  OE1 . GLN E  1 193 ? 45.372  -73.395  -99.127  1.00 47.68  ? 203  GLN E OE1 1 
ATOM   6856  N  NE2 . GLN E  1 193 ? 44.886  -75.498  -99.734  1.00 46.17  ? 203  GLN E NE2 1 
ATOM   6857  N  N   . HIS E  1 194 ? 44.005  -77.485  -94.268  1.00 44.79  ? 204  HIS E N   1 
ATOM   6858  C  CA  . HIS E  1 194 ? 44.389  -77.441  -92.866  1.00 43.57  ? 204  HIS E CA  1 
ATOM   6859  C  C   . HIS E  1 194 ? 45.703  -78.133  -92.563  1.00 41.28  ? 204  HIS E C   1 
ATOM   6860  O  O   . HIS E  1 194 ? 46.256  -78.854  -93.392  1.00 40.41  ? 204  HIS E O   1 
ATOM   6861  C  CB  . HIS E  1 194 ? 43.310  -78.105  -92.013  1.00 45.28  ? 204  HIS E CB  1 
ATOM   6862  C  CG  . HIS E  1 194 ? 41.949  -77.511  -92.182  1.00 48.25  ? 204  HIS E CG  1 
ATOM   6863  N  ND1 . HIS E  1 194 ? 41.546  -76.374  -91.519  1.00 50.02  ? 204  HIS E ND1 1 
ATOM   6864  C  CD2 . HIS E  1 194 ? 40.901  -77.889  -92.949  1.00 50.26  ? 204  HIS E CD2 1 
ATOM   6865  C  CE1 . HIS E  1 194 ? 40.307  -76.077  -91.869  1.00 50.60  ? 204  HIS E CE1 1 
ATOM   6866  N  NE2 . HIS E  1 194 ? 39.893  -76.982  -92.736  1.00 51.32  ? 204  HIS E NE2 1 
ATOM   6867  N  N   . LEU E  1 195 ? 46.190  -77.883  -91.353  1.00 39.75  ? 205  LEU E N   1 
ATOM   6868  C  CA  . LEU E  1 195 ? 47.399  -78.505  -90.828  1.00 38.50  ? 205  LEU E CA  1 
ATOM   6869  C  C   . LEU E  1 195 ? 46.824  -79.313  -89.671  1.00 36.90  ? 205  LEU E C   1 
ATOM   6870  O  O   . LEU E  1 195 ? 46.234  -78.749  -88.739  1.00 33.58  ? 205  LEU E O   1 
ATOM   6871  C  CB  . LEU E  1 195 ? 48.383  -77.457  -90.306  1.00 39.35  ? 205  LEU E CB  1 
ATOM   6872  C  CG  . LEU E  1 195 ? 49.592  -78.042  -89.567  1.00 38.99  ? 205  LEU E CG  1 
ATOM   6873  C  CD1 . LEU E  1 195 ? 50.256  -79.140  -90.385  1.00 36.86  ? 205  LEU E CD1 1 
ATOM   6874  C  CD2 . LEU E  1 195 ? 50.568  -76.935  -89.277  1.00 38.44  ? 205  LEU E CD2 1 
ATOM   6875  N  N   . ILE E  1 196 ? 46.982  -80.630  -89.722  1.00 35.79  ? 206  ILE E N   1 
ATOM   6876  C  CA  . ILE E  1 196 ? 46.382  -81.446  -88.676  1.00 34.36  ? 206  ILE E CA  1 
ATOM   6877  C  C   . ILE E  1 196 ? 46.998  -82.838  -88.555  1.00 34.59  ? 206  ILE E C   1 
ATOM   6878  O  O   . ILE E  1 196 ? 47.760  -83.267  -89.426  1.00 32.82  ? 206  ILE E O   1 
ATOM   6879  C  CB  . ILE E  1 196 ? 44.855  -81.540  -88.957  1.00 31.48  ? 206  ILE E CB  1 
ATOM   6880  C  CG1 . ILE E  1 196 ? 44.104  -82.032  -87.737  1.00 33.62  ? 206  ILE E CG1 1 
ATOM   6881  C  CG2 . ILE E  1 196 ? 44.594  -82.469  -90.118  1.00 29.22  ? 206  ILE E CG2 1 
ATOM   6882  C  CD1 . ILE E  1 196 ? 42.614  -81.816  -87.856  1.00 33.89  ? 206  ILE E CD1 1 
ATOM   6883  N  N   . ARG E  1 197 ? 46.690  -83.528  -87.457  1.00 38.09  ? 207  ARG E N   1 
ATOM   6884  C  CA  . ARG E  1 197 ? 47.186  -84.895  -87.245  1.00 39.53  ? 207  ARG E CA  1 
ATOM   6885  C  C   . ARG E  1 197 ? 46.285  -85.821  -88.029  1.00 39.90  ? 207  ARG E C   1 
ATOM   6886  O  O   . ARG E  1 197 ? 45.072  -85.863  -87.803  1.00 38.25  ? 207  ARG E O   1 
ATOM   6887  C  CB  . ARG E  1 197 ? 47.141  -85.312  -85.768  1.00 39.38  ? 207  ARG E CB  1 
ATOM   6888  C  CG  . ARG E  1 197 ? 48.443  -85.111  -85.011  1.00 39.34  ? 207  ARG E CG  1 
ATOM   6889  C  CD  . ARG E  1 197 ? 48.499  -85.950  -83.739  1.00 38.71  ? 207  ARG E CD  1 
ATOM   6890  N  NE  . ARG E  1 197 ? 47.432  -85.628  -82.796  1.00 37.39  ? 207  ARG E NE  1 
ATOM   6891  C  CZ  . ARG E  1 197 ? 46.584  -86.525  -82.302  1.00 36.50  ? 207  ARG E CZ  1 
ATOM   6892  N  NH1 . ARG E  1 197 ? 46.678  -87.797  -82.662  1.00 35.56  ? 207  ARG E NH1 1 
ATOM   6893  N  NH2 . ARG E  1 197 ? 45.638  -86.154  -81.451  1.00 35.88  ? 207  ARG E NH2 1 
ATOM   6894  N  N   . TYR E  1 198 ? 46.895  -86.548  -88.956  1.00 41.58  ? 208  TYR E N   1 
ATOM   6895  C  CA  . TYR E  1 198 ? 46.205  -87.494  -89.822  1.00 42.99  ? 208  TYR E CA  1 
ATOM   6896  C  C   . TYR E  1 198 ? 45.160  -88.331  -89.087  1.00 44.23  ? 208  TYR E C   1 
ATOM   6897  O  O   . TYR E  1 198 ? 44.024  -88.449  -89.529  1.00 44.21  ? 208  TYR E O   1 
ATOM   6898  C  CB  . TYR E  1 198 ? 47.241  -88.404  -90.470  1.00 43.31  ? 208  TYR E CB  1 
ATOM   6899  C  CG  . TYR E  1 198 ? 46.670  -89.396  -91.434  1.00 43.23  ? 208  TYR E CG  1 
ATOM   6900  C  CD1 . TYR E  1 198 ? 46.495  -90.727  -91.067  1.00 44.01  ? 208  TYR E CD1 1 
ATOM   6901  C  CD2 . TYR E  1 198 ? 46.324  -89.013  -92.725  1.00 43.68  ? 208  TYR E CD2 1 
ATOM   6902  C  CE1 . TYR E  1 198 ? 45.992  -91.661  -91.970  1.00 45.44  ? 208  TYR E CE1 1 
ATOM   6903  C  CE2 . TYR E  1 198 ? 45.818  -89.933  -93.635  1.00 45.68  ? 208  TYR E CE2 1 
ATOM   6904  C  CZ  . TYR E  1 198 ? 45.656  -91.255  -93.255  1.00 45.62  ? 208  TYR E CZ  1 
ATOM   6905  O  OH  . TYR E  1 198 ? 45.173  -92.167  -94.160  1.00 46.00  ? 208  TYR E OH  1 
ATOM   6906  N  N   . LYS E  1 199 ? 45.557  -88.905  -87.959  1.00 45.68  ? 209  LYS E N   1 
ATOM   6907  C  CA  . LYS E  1 199 ? 44.673  -89.732  -87.160  1.00 46.83  ? 209  LYS E CA  1 
ATOM   6908  C  C   . LYS E  1 199 ? 43.364  -89.016  -86.857  1.00 48.27  ? 209  LYS E C   1 
ATOM   6909  O  O   . LYS E  1 199 ? 42.303  -89.628  -86.844  1.00 49.59  ? 209  LYS E O   1 
ATOM   6910  C  CB  . LYS E  1 199 ? 45.365  -90.100  -85.852  1.00 47.19  ? 209  LYS E CB  1 
ATOM   6911  C  CG  . LYS E  1 199 ? 44.618  -91.096  -84.999  1.00 49.54  ? 209  LYS E CG  1 
ATOM   6912  C  CD  . LYS E  1 199 ? 45.293  -91.257  -83.640  1.00 53.47  ? 209  LYS E CD  1 
ATOM   6913  C  CE  . LYS E  1 199 ? 44.763  -92.471  -82.879  1.00 55.76  ? 209  LYS E CE  1 
ATOM   6914  N  NZ  . LYS E  1 199 ? 45.095  -93.755  -83.589  1.00 56.91  ? 209  LYS E NZ  1 
ATOM   6915  N  N   . THR E  1 200 ? 43.435  -87.717  -86.605  1.00 49.64  ? 210  THR E N   1 
ATOM   6916  C  CA  . THR E  1 200 ? 42.237  -86.948  -86.281  1.00 51.28  ? 210  THR E CA  1 
ATOM   6917  C  C   . THR E  1 200 ? 41.180  -86.959  -87.394  1.00 52.88  ? 210  THR E C   1 
ATOM   6918  O  O   . THR E  1 200 ? 39.977  -86.961  -87.118  1.00 52.22  ? 210  THR E O   1 
ATOM   6919  C  CB  . THR E  1 200 ? 42.606  -85.486  -85.947  1.00 50.89  ? 210  THR E CB  1 
ATOM   6920  O  OG1 . THR E  1 200 ? 43.492  -85.473  -84.826  1.00 51.96  ? 210  THR E OG1 1 
ATOM   6921  C  CG2 . THR E  1 200 ? 41.369  -84.677  -85.598  1.00 49.63  ? 210  THR E CG2 1 
ATOM   6922  N  N   . ILE E  1 201 ? 41.627  -86.974  -88.645  1.00 54.30  ? 211  ILE E N   1 
ATOM   6923  C  CA  . ILE E  1 201 ? 40.707  -86.962  -89.776  1.00 56.85  ? 211  ILE E CA  1 
ATOM   6924  C  C   . ILE E  1 201 ? 40.487  -88.330  -90.424  1.00 60.94  ? 211  ILE E C   1 
ATOM   6925  O  O   . ILE E  1 201 ? 39.346  -88.756  -90.593  1.00 62.38  ? 211  ILE E O   1 
ATOM   6926  C  CB  . ILE E  1 201 ? 41.182  -85.984  -90.870  1.00 53.47  ? 211  ILE E CB  1 
ATOM   6927  C  CG1 . ILE E  1 201 ? 42.521  -86.448  -91.436  1.00 50.39  ? 211  ILE E CG1 1 
ATOM   6928  C  CG2 . ILE E  1 201 ? 41.314  -84.592  -90.292  1.00 52.67  ? 211  ILE E CG2 1 
ATOM   6929  C  CD1 . ILE E  1 201 ? 42.978  -85.677  -92.628  1.00 49.15  ? 211  ILE E CD1 1 
ATOM   6930  N  N   . ALA E  1 202 ? 41.573  -89.014  -90.778  1.00 63.64  ? 212  ALA E N   1 
ATOM   6931  C  CA  . ALA E  1 202 ? 41.495  -90.312  -91.429  1.00 66.96  ? 212  ALA E CA  1 
ATOM   6932  C  C   . ALA E  1 202 ? 40.504  -91.293  -90.804  1.00 71.55  ? 212  ALA E C   1 
ATOM   6933  O  O   . ALA E  1 202 ? 39.538  -91.705  -91.456  1.00 73.01  ? 212  ALA E O   1 
ATOM   6934  C  CB  . ALA E  1 202 ? 42.868  -90.932  -91.496  1.00 65.73  ? 212  ALA E CB  1 
ATOM   6935  N  N   . PRO E  1 203 ? 40.728  -91.698  -89.541  1.00 75.48  ? 213  PRO E N   1 
ATOM   6936  C  CA  . PRO E  1 203 ? 39.794  -92.641  -88.912  1.00 77.85  ? 213  PRO E CA  1 
ATOM   6937  C  C   . PRO E  1 203 ? 38.338  -92.187  -88.970  1.00 78.81  ? 213  PRO E C   1 
ATOM   6938  O  O   . PRO E  1 203 ? 37.537  -92.914  -89.600  1.00 79.48  ? 213  PRO E O   1 
ATOM   6939  C  CB  . PRO E  1 203 ? 40.320  -92.740  -87.480  1.00 78.29  ? 213  PRO E CB  1 
ATOM   6940  C  CG  . PRO E  1 203 ? 41.798  -92.639  -87.679  1.00 78.17  ? 213  PRO E CG  1 
ATOM   6941  C  CD  . PRO E  1 203 ? 41.905  -91.486  -88.678  1.00 77.27  ? 213  PRO E CD  1 
ATOM   6942  O  OXT . PRO E  1 203 ? 38.026  -91.118  -88.393  1.00 79.14  ? 213  PRO E OXT 1 
HETATM 6943  N  N   . MSE F  2 1   ? 83.532  -107.533 -77.611  1.00 78.29  ? 0    MSE F N   1 
HETATM 6944  C  CA  . MSE F  2 1   ? 82.936  -108.847 -77.222  1.00 77.05  ? 0    MSE F CA  1 
HETATM 6945  C  C   . MSE F  2 1   ? 81.755  -108.606 -76.292  1.00 74.29  ? 0    MSE F C   1 
HETATM 6946  O  O   . MSE F  2 1   ? 80.602  -108.821 -76.662  1.00 74.85  ? 0    MSE F O   1 
HETATM 6947  C  CB  . MSE F  2 1   ? 83.993  -109.721 -76.525  1.00 79.90  ? 0    MSE F CB  1 
HETATM 6948  C  CG  . MSE F  2 1   ? 83.477  -111.033 -75.881  1.00 85.60  ? 0    MSE F CG  1 
HETATM 6949  SE SE  . MSE F  2 1   ? 83.253  -112.646 -77.001  1.00 91.79  ? 0    MSE F SE  1 
HETATM 6950  C  CE  . MSE F  2 1   ? 85.046  -112.762 -77.745  1.00 88.08  ? 0    MSE F CE  1 
HETATM 6951  N  N   . MSE F  2 2   ? 82.053  -108.134 -75.091  1.00 70.42  ? 1    MSE F N   1 
HETATM 6952  C  CA  . MSE F  2 2   ? 81.030  -107.873 -74.096  1.00 66.76  ? 1    MSE F CA  1 
HETATM 6953  C  C   . MSE F  2 2   ? 80.174  -106.659 -74.385  1.00 62.55  ? 1    MSE F C   1 
HETATM 6954  O  O   . MSE F  2 2   ? 79.011  -106.622 -74.014  1.00 62.93  ? 1    MSE F O   1 
HETATM 6955  C  CB  . MSE F  2 2   ? 81.678  -107.729 -72.721  1.00 70.73  ? 1    MSE F CB  1 
HETATM 6956  C  CG  . MSE F  2 2   ? 82.245  -109.033 -72.209  1.00 73.97  ? 1    MSE F CG  1 
HETATM 6957  SE SE  . MSE F  2 2   ? 80.839  -110.358 -72.168  1.00 80.03  ? 1    MSE F SE  1 
HETATM 6958  C  CE  . MSE F  2 2   ? 81.817  -111.819 -71.335  1.00 78.47  ? 1    MSE F CE  1 
ATOM   6959  N  N   . PHE F  2 3   ? 80.747  -105.655 -75.031  1.00 58.04  ? 2    PHE F N   1 
ATOM   6960  C  CA  . PHE F  2 3   ? 79.999  -104.444 -75.353  1.00 53.76  ? 2    PHE F CA  1 
ATOM   6961  C  C   . PHE F  2 3   ? 79.716  -104.439 -76.843  1.00 51.51  ? 2    PHE F C   1 
ATOM   6962  O  O   . PHE F  2 3   ? 79.406  -103.399 -77.415  1.00 51.52  ? 2    PHE F O   1 
ATOM   6963  C  CB  . PHE F  2 3   ? 80.813  -103.194 -74.982  1.00 53.89  ? 2    PHE F CB  1 
ATOM   6964  C  CG  . PHE F  2 3   ? 80.766  -102.832 -73.513  1.00 52.39  ? 2    PHE F CG  1 
ATOM   6965  C  CD1 . PHE F  2 3   ? 80.376  -103.759 -72.554  1.00 51.28  ? 2    PHE F CD1 1 
ATOM   6966  C  CD2 . PHE F  2 3   ? 81.095  -101.546 -73.097  1.00 51.55  ? 2    PHE F CD2 1 
ATOM   6967  C  CE1 . PHE F  2 3   ? 80.309  -103.405 -71.212  1.00 50.43  ? 2    PHE F CE1 1 
ATOM   6968  C  CE2 . PHE F  2 3   ? 81.031  -101.187 -71.754  1.00 49.53  ? 2    PHE F CE2 1 
ATOM   6969  C  CZ  . PHE F  2 3   ? 80.636  -102.115 -70.813  1.00 49.17  ? 2    PHE F CZ  1 
ATOM   6970  N  N   . CYS F  2 4   ? 79.830  -105.615 -77.461  1.00 48.22  ? 3    CYS F N   1 
ATOM   6971  C  CA  . CYS F  2 4   ? 79.608  -105.773 -78.893  1.00 43.90  ? 3    CYS F CA  1 
ATOM   6972  C  C   . CYS F  2 4   ? 80.226  -104.571 -79.579  1.00 44.22  ? 3    CYS F C   1 
ATOM   6973  O  O   . CYS F  2 4   ? 79.584  -103.896 -80.369  1.00 44.20  ? 3    CYS F O   1 
ATOM   6974  C  CB  . CYS F  2 4   ? 78.119  -105.814 -79.208  1.00 40.84  ? 3    CYS F CB  1 
ATOM   6975  S  SG  . CYS F  2 4   ? 77.129  -106.582 -77.955  1.00 31.99  ? 3    CYS F SG  1 
ATOM   6976  N  N   . GLU F  2 5   ? 81.483  -104.298 -79.265  1.00 45.35  ? 4    GLU F N   1 
ATOM   6977  C  CA  . GLU F  2 5   ? 82.153  -103.158 -79.851  1.00 44.95  ? 4    GLU F CA  1 
ATOM   6978  C  C   . GLU F  2 5   ? 82.403  -103.352 -81.334  1.00 43.06  ? 4    GLU F C   1 
ATOM   6979  O  O   . GLU F  2 5   ? 82.492  -102.389 -82.075  1.00 43.54  ? 4    GLU F O   1 
ATOM   6980  C  CB  . GLU F  2 5   ? 83.463  -102.892 -79.123  1.00 45.96  ? 4    GLU F CB  1 
ATOM   6981  C  CG  . GLU F  2 5   ? 83.914  -101.446 -79.208  1.00 51.27  ? 4    GLU F CG  1 
ATOM   6982  C  CD  . GLU F  2 5   ? 82.921  -100.473 -78.568  1.00 53.82  ? 4    GLU F CD  1 
ATOM   6983  O  OE1 . GLU F  2 5   ? 82.560  -100.677 -77.386  1.00 54.00  ? 4    GLU F OE1 1 
ATOM   6984  O  OE2 . GLU F  2 5   ? 82.509  -99.501  -79.247  1.00 55.53  ? 4    GLU F OE2 1 
ATOM   6985  N  N   . LYS F  2 6   ? 82.505  -104.597 -81.775  1.00 42.90  ? 5    LYS F N   1 
ATOM   6986  C  CA  . LYS F  2 6   ? 82.752  -104.861 -83.190  1.00 42.15  ? 5    LYS F CA  1 
ATOM   6987  C  C   . LYS F  2 6   ? 81.524  -104.603 -84.051  1.00 40.90  ? 5    LYS F C   1 
ATOM   6988  O  O   . LYS F  2 6   ? 81.630  -104.099 -85.170  1.00 40.71  ? 5    LYS F O   1 
ATOM   6989  C  CB  . LYS F  2 6   ? 83.217  -106.304 -83.391  1.00 43.26  ? 5    LYS F CB  1 
ATOM   6990  C  CG  . LYS F  2 6   ? 83.568  -106.621 -84.833  1.00 44.47  ? 5    LYS F CG  1 
ATOM   6991  C  CD  . LYS F  2 6   ? 84.713  -105.747 -85.298  1.00 46.69  ? 5    LYS F CD  1 
ATOM   6992  C  CE  . LYS F  2 6   ? 85.223  -106.158 -86.654  1.00 48.37  ? 5    LYS F CE  1 
ATOM   6993  N  NZ  . LYS F  2 6   ? 86.529  -105.494 -86.943  1.00 50.50  ? 5    LYS F NZ  1 
ATOM   6994  N  N   . ALA F  2 7   ? 80.361  -104.966 -83.526  1.00 39.61  ? 6    ALA F N   1 
ATOM   6995  C  CA  . ALA F  2 7   ? 79.111  -104.770 -84.235  1.00 40.04  ? 6    ALA F CA  1 
ATOM   6996  C  C   . ALA F  2 7   ? 78.919  -103.276 -84.412  1.00 39.63  ? 6    ALA F C   1 
ATOM   6997  O  O   . ALA F  2 7   ? 78.456  -102.808 -85.438  1.00 39.31  ? 6    ALA F O   1 
ATOM   6998  C  CB  . ALA F  2 7   ? 77.961  -105.355 -83.428  1.00 40.49  ? 6    ALA F CB  1 
HETATM 6999  N  N   . MSE F  2 8   ? 79.294  -102.533 -83.387  1.00 41.68  ? 7    MSE F N   1 
HETATM 7000  C  CA  . MSE F  2 8   ? 79.182  -101.090 -83.400  1.00 41.97  ? 7    MSE F CA  1 
HETATM 7001  C  C   . MSE F  2 8   ? 79.998  -100.411 -84.492  1.00 41.40  ? 7    MSE F C   1 
HETATM 7002  O  O   . MSE F  2 8   ? 79.599  -99.363  -85.000  1.00 40.93  ? 7    MSE F O   1 
HETATM 7003  C  CB  . MSE F  2 8   ? 79.577  -100.543 -82.039  1.00 44.11  ? 7    MSE F CB  1 
HETATM 7004  C  CG  . MSE F  2 8   ? 78.425  -100.521 -81.089  1.00 50.01  ? 7    MSE F CG  1 
HETATM 7005  SE SE  . MSE F  2 8   ? 77.106  -99.302  -81.768  1.00 57.85  ? 7    MSE F SE  1 
HETATM 7006  C  CE  . MSE F  2 8   ? 75.679  -100.547 -82.095  1.00 56.84  ? 7    MSE F CE  1 
ATOM   7007  N  N   . GLU F  2 9   ? 81.135  -100.978 -84.866  1.00 40.11  ? 8    GLU F N   1 
ATOM   7008  C  CA  . GLU F  2 9   ? 81.880  -100.317 -85.907  1.00 43.73  ? 8    GLU F CA  1 
ATOM   7009  C  C   . GLU F  2 9   ? 81.228  -100.628 -87.248  1.00 44.24  ? 8    GLU F C   1 
ATOM   7010  O  O   . GLU F  2 9   ? 81.381  -99.882  -88.223  1.00 45.61  ? 8    GLU F O   1 
ATOM   7011  C  CB  . GLU F  2 9   ? 83.366  -100.700 -85.873  1.00 45.06  ? 8    GLU F CB  1 
ATOM   7012  C  CG  . GLU F  2 9   ? 83.703  -102.144 -86.071  1.00 50.33  ? 8    GLU F CG  1 
ATOM   7013  C  CD  . GLU F  2 9   ? 85.196  -102.395 -85.869  1.00 53.53  ? 8    GLU F CD  1 
ATOM   7014  O  OE1 . GLU F  2 9   ? 85.711  -102.042 -84.784  1.00 55.10  ? 8    GLU F OE1 1 
ATOM   7015  O  OE2 . GLU F  2 9   ? 85.854  -102.938 -86.785  1.00 52.12  ? 8    GLU F OE2 1 
ATOM   7016  N  N   . LEU F  2 10  ? 80.469  -101.715 -87.282  1.00 43.07  ? 9    LEU F N   1 
ATOM   7017  C  CA  . LEU F  2 10  ? 79.758  -102.115 -88.491  1.00 41.00  ? 9    LEU F CA  1 
ATOM   7018  C  C   . LEU F  2 10  ? 78.693  -101.060 -88.739  1.00 39.75  ? 9    LEU F C   1 
ATOM   7019  O  O   . LEU F  2 10  ? 78.600  -100.482 -89.825  1.00 39.72  ? 9    LEU F O   1 
ATOM   7020  C  CB  . LEU F  2 10  ? 79.078  -103.460 -88.267  1.00 41.50  ? 9    LEU F CB  1 
ATOM   7021  C  CG  . LEU F  2 10  ? 79.236  -104.560 -89.304  1.00 41.89  ? 9    LEU F CG  1 
ATOM   7022  C  CD1 . LEU F  2 10  ? 80.699  -104.727 -89.705  1.00 41.22  ? 9    LEU F CD1 1 
ATOM   7023  C  CD2 . LEU F  2 10  ? 78.693  -105.843 -88.684  1.00 42.72  ? 9    LEU F CD2 1 
ATOM   7024  N  N   . ILE F  2 11  ? 77.885  -100.827 -87.710  1.00 37.59  ? 10   ILE F N   1 
ATOM   7025  C  CA  . ILE F  2 11  ? 76.819  -99.849  -87.776  1.00 37.28  ? 10   ILE F CA  1 
ATOM   7026  C  C   . ILE F  2 11  ? 77.370  -98.481  -88.115  1.00 38.06  ? 10   ILE F C   1 
ATOM   7027  O  O   . ILE F  2 11  ? 76.867  -97.799  -88.997  1.00 37.33  ? 10   ILE F O   1 
ATOM   7028  C  CB  . ILE F  2 11  ? 76.073  -99.749  -86.427  1.00 36.44  ? 10   ILE F CB  1 
ATOM   7029  C  CG1 . ILE F  2 11  ? 75.230  -101.014 -86.216  1.00 35.66  ? 10   ILE F CG1 1 
ATOM   7030  C  CG2 . ILE F  2 11  ? 75.221  -98.462  -86.376  1.00 34.22  ? 10   ILE F CG2 1 
ATOM   7031  C  CD1 . ILE F  2 11  ? 74.130  -101.220 -87.257  1.00 33.56  ? 10   ILE F CD1 1 
ATOM   7032  N  N   . ARG F  2 12  ? 78.422  -98.099  -87.409  1.00 39.41  ? 11   ARG F N   1 
ATOM   7033  C  CA  . ARG F  2 12  ? 79.039  -96.796  -87.581  1.00 39.77  ? 11   ARG F CA  1 
ATOM   7034  C  C   . ARG F  2 12  ? 79.544  -96.539  -88.994  1.00 39.97  ? 11   ARG F C   1 
ATOM   7035  O  O   . ARG F  2 12  ? 79.381  -95.451  -89.534  1.00 38.63  ? 11   ARG F O   1 
ATOM   7036  C  CB  . ARG F  2 12  ? 80.175  -96.651  -86.571  1.00 40.00  ? 11   ARG F CB  1 
ATOM   7037  C  CG  . ARG F  2 12  ? 80.298  -95.265  -85.994  1.00 41.15  ? 11   ARG F CG  1 
ATOM   7038  C  CD  . ARG F  2 12  ? 81.356  -95.205  -84.906  1.00 42.53  ? 11   ARG F CD  1 
ATOM   7039  N  NE  . ARG F  2 12  ? 80.900  -95.774  -83.640  1.00 41.39  ? 11   ARG F NE  1 
ATOM   7040  C  CZ  . ARG F  2 12  ? 81.475  -96.812  -83.046  1.00 39.68  ? 11   ARG F CZ  1 
ATOM   7041  N  NH1 . ARG F  2 12  ? 81.000  -97.268  -81.890  1.00 38.11  ? 11   ARG F NH1 1 
ATOM   7042  N  NH2 . ARG F  2 12  ? 82.520  -97.397  -83.618  1.00 36.70  ? 11   ARG F NH2 1 
ATOM   7043  N  N   . GLU F  2 13  ? 80.161  -97.544  -89.591  1.00 41.73  ? 12   GLU F N   1 
ATOM   7044  C  CA  . GLU F  2 13  ? 80.689  -97.418  -90.939  1.00 44.15  ? 12   GLU F CA  1 
ATOM   7045  C  C   . GLU F  2 13  ? 79.562  -97.121  -91.930  1.00 43.96  ? 12   GLU F C   1 
ATOM   7046  O  O   . GLU F  2 13  ? 79.759  -96.422  -92.916  1.00 43.37  ? 12   GLU F O   1 
ATOM   7047  C  CB  . GLU F  2 13  ? 81.419  -98.710  -91.296  1.00 48.47  ? 12   GLU F CB  1 
ATOM   7048  C  CG  . GLU F  2 13  ? 81.780  -98.895  -92.753  1.00 55.41  ? 12   GLU F CG  1 
ATOM   7049  C  CD  . GLU F  2 13  ? 82.458  -100.243 -92.998  1.00 59.25  ? 12   GLU F CD  1 
ATOM   7050  O  OE1 . GLU F  2 13  ? 81.885  -101.283 -92.587  1.00 60.56  ? 12   GLU F OE1 1 
ATOM   7051  O  OE2 . GLU F  2 13  ? 83.560  -100.260 -93.600  1.00 60.61  ? 12   GLU F OE2 1 
ATOM   7052  N  N   . LEU F  2 14  ? 78.375  -97.645  -91.654  1.00 44.13  ? 13   LEU F N   1 
ATOM   7053  C  CA  . LEU F  2 14  ? 77.226  -97.418  -92.517  1.00 44.64  ? 13   LEU F CA  1 
ATOM   7054  C  C   . LEU F  2 14  ? 76.715  -96.000  -92.325  1.00 46.10  ? 13   LEU F C   1 
ATOM   7055  O  O   . LEU F  2 14  ? 76.374  -95.312  -93.276  1.00 48.10  ? 13   LEU F O   1 
ATOM   7056  C  CB  . LEU F  2 14  ? 76.123  -98.407  -92.176  1.00 43.32  ? 13   LEU F CB  1 
ATOM   7057  C  CG  . LEU F  2 14  ? 75.502  -99.149  -93.349  1.00 42.14  ? 13   LEU F CG  1 
ATOM   7058  C  CD1 . LEU F  2 14  ? 76.590  -99.652  -94.288  1.00 42.18  ? 13   LEU F CD1 1 
ATOM   7059  C  CD2 . LEU F  2 14  ? 74.689  -100.304 -92.809  1.00 41.64  ? 13   LEU F CD2 1 
ATOM   7060  N  N   . HIS F  2 15  ? 76.657  -95.571  -91.076  1.00 47.61  ? 14   HIS F N   1 
ATOM   7061  C  CA  . HIS F  2 15  ? 76.206  -94.233  -90.735  1.00 49.19  ? 14   HIS F CA  1 
ATOM   7062  C  C   . HIS F  2 15  ? 77.139  -93.159  -91.318  1.00 51.16  ? 14   HIS F C   1 
ATOM   7063  O  O   . HIS F  2 15  ? 76.684  -92.180  -91.907  1.00 51.14  ? 14   HIS F O   1 
ATOM   7064  C  CB  . HIS F  2 15  ? 76.170  -94.094  -89.222  1.00 49.38  ? 14   HIS F CB  1 
ATOM   7065  C  CG  . HIS F  2 15  ? 75.381  -92.924  -88.745  1.00 50.49  ? 14   HIS F CG  1 
ATOM   7066  N  ND1 . HIS F  2 15  ? 74.004  -92.883  -88.809  1.00 50.55  ? 14   HIS F ND1 1 
ATOM   7067  C  CD2 . HIS F  2 15  ? 75.772  -91.748  -88.200  1.00 50.15  ? 14   HIS F CD2 1 
ATOM   7068  C  CE1 . HIS F  2 15  ? 73.580  -91.731  -88.322  1.00 51.80  ? 14   HIS F CE1 1 
ATOM   7069  N  NE2 . HIS F  2 15  ? 74.633  -91.025  -87.946  1.00 52.61  ? 14   HIS F NE2 1 
ATOM   7070  N  N   . ARG F  2 16  ? 78.446  -93.345  -91.142  1.00 52.46  ? 15   ARG F N   1 
ATOM   7071  C  CA  . ARG F  2 16  ? 79.428  -92.392  -91.644  1.00 52.97  ? 15   ARG F CA  1 
ATOM   7072  C  C   . ARG F  2 16  ? 79.384  -92.298  -93.157  1.00 52.46  ? 15   ARG F C   1 
ATOM   7073  O  O   . ARG F  2 16  ? 79.872  -91.327  -93.734  1.00 51.68  ? 15   ARG F O   1 
ATOM   7074  C  CB  . ARG F  2 16  ? 80.846  -92.772  -91.184  1.00 54.58  ? 15   ARG F CB  1 
ATOM   7075  C  CG  . ARG F  2 16  ? 81.085  -92.580  -89.689  1.00 58.10  ? 15   ARG F CG  1 
ATOM   7076  C  CD  . ARG F  2 16  ? 82.530  -92.908  -89.282  1.00 62.73  ? 15   ARG F CD  1 
ATOM   7077  N  NE  . ARG F  2 16  ? 82.692  -93.037  -87.827  1.00 65.22  ? 15   ARG F NE  1 
ATOM   7078  C  CZ  . ARG F  2 16  ? 82.561  -92.039  -86.951  1.00 67.61  ? 15   ARG F CZ  1 
ATOM   7079  N  NH1 . ARG F  2 16  ? 82.265  -90.809  -87.361  1.00 68.31  ? 15   ARG F NH1 1 
ATOM   7080  N  NH2 . ARG F  2 16  ? 82.718  -92.274  -85.652  1.00 68.62  ? 15   ARG F NH2 1 
ATOM   7081  N  N   . ALA F  2 17  ? 78.804  -93.311  -93.798  1.00 52.57  ? 16   ALA F N   1 
ATOM   7082  C  CA  . ALA F  2 17  ? 78.693  -93.335  -95.255  1.00 52.19  ? 16   ALA F CA  1 
ATOM   7083  C  C   . ALA F  2 17  ? 77.599  -92.358  -95.676  1.00 52.99  ? 16   ALA F C   1 
ATOM   7084  O  O   . ALA F  2 17  ? 76.407  -92.642  -95.540  1.00 52.83  ? 16   ALA F O   1 
ATOM   7085  C  CB  . ALA F  2 17  ? 78.368  -94.733  -95.730  1.00 51.23  ? 16   ALA F CB  1 
ATOM   7086  N  N   . PRO F  2 18  ? 78.001  -91.191  -96.208  1.00 53.93  ? 17   PRO F N   1 
ATOM   7087  C  CA  . PRO F  2 18  ? 77.111  -90.117  -96.664  1.00 53.96  ? 17   PRO F CA  1 
ATOM   7088  C  C   . PRO F  2 18  ? 75.955  -90.531  -97.583  1.00 54.51  ? 17   PRO F C   1 
ATOM   7089  O  O   . PRO F  2 18  ? 76.148  -91.194  -98.607  1.00 53.57  ? 17   PRO F O   1 
ATOM   7090  C  CB  . PRO F  2 18  ? 78.077  -89.131  -97.318  1.00 53.80  ? 17   PRO F CB  1 
ATOM   7091  C  CG  . PRO F  2 18  ? 79.170  -90.015  -97.827  1.00 53.40  ? 17   PRO F CG  1 
ATOM   7092  C  CD  . PRO F  2 18  ? 79.382  -90.940  -96.663  1.00 54.40  ? 17   PRO F CD  1 
ATOM   7093  N  N   . GLU F  2 19  ? 74.758  -90.118  -97.172  1.00 54.97  ? 18   GLU F N   1 
ATOM   7094  C  CA  . GLU F  2 19  ? 73.485  -90.377  -97.849  1.00 55.14  ? 18   GLU F CA  1 
ATOM   7095  C  C   . GLU F  2 19  ? 73.514  -91.167  -99.160  1.00 52.32  ? 18   GLU F C   1 
ATOM   7096  O  O   . GLU F  2 19  ? 73.839  -90.627  -100.219 1.00 52.24  ? 18   GLU F O   1 
ATOM   7097  C  CB  . GLU F  2 19  ? 72.742  -89.043  -98.056  1.00 59.11  ? 18   GLU F CB  1 
ATOM   7098  C  CG  . GLU F  2 19  ? 72.098  -88.456  -96.764  1.00 62.65  ? 18   GLU F CG  1 
ATOM   7099  C  CD  . GLU F  2 19  ? 73.116  -88.023  -95.695  1.00 62.98  ? 18   GLU F CD  1 
ATOM   7100  O  OE1 . GLU F  2 19  ? 72.698  -87.711  -94.555  1.00 61.40  ? 18   GLU F OE1 1 
ATOM   7101  O  OE2 . GLU F  2 19  ? 74.328  -87.987  -95.996  1.00 62.39  ? 18   GLU F OE2 1 
ATOM   7102  N  N   . GLY F  2 20  ? 73.166  -92.452  -99.068  1.00 48.07  ? 19   GLY F N   1 
ATOM   7103  C  CA  . GLY F  2 20  ? 73.138  -93.312  -100.235 1.00 43.63  ? 19   GLY F CA  1 
ATOM   7104  C  C   . GLY F  2 20  ? 74.322  -94.243  -100.386 1.00 41.58  ? 19   GLY F C   1 
ATOM   7105  O  O   . GLY F  2 20  ? 74.160  -95.448  -100.569 1.00 40.59  ? 19   GLY F O   1 
ATOM   7106  N  N   . GLN F  2 21  ? 75.519  -93.672  -100.329 1.00 40.61  ? 20   GLN F N   1 
ATOM   7107  C  CA  . GLN F  2 21  ? 76.762  -94.424  -100.456 1.00 39.49  ? 20   GLN F CA  1 
ATOM   7108  C  C   . GLN F  2 21  ? 76.724  -95.852  -99.922  1.00 37.61  ? 20   GLN F C   1 
ATOM   7109  O  O   . GLN F  2 21  ? 76.161  -96.122  -98.863  1.00 35.34  ? 20   GLN F O   1 
ATOM   7110  C  CB  . GLN F  2 21  ? 77.885  -93.679  -99.752  1.00 41.66  ? 20   GLN F CB  1 
ATOM   7111  C  CG  . GLN F  2 21  ? 78.288  -92.386  -100.403 1.00 44.49  ? 20   GLN F CG  1 
ATOM   7112  C  CD  . GLN F  2 21  ? 79.787  -92.298  -100.573 1.00 45.97  ? 20   GLN F CD  1 
ATOM   7113  O  OE1 . GLN F  2 21  ? 80.550  -92.645  -99.666  1.00 48.31  ? 20   GLN F OE1 1 
ATOM   7114  N  NE2 . GLN F  2 21  ? 80.221  -91.833  -101.733 1.00 46.15  ? 20   GLN F NE2 1 
ATOM   7115  N  N   . LEU F  2 22  ? 77.356  -96.760  -100.654 1.00 36.01  ? 21   LEU F N   1 
ATOM   7116  C  CA  . LEU F  2 22  ? 77.397  -98.158  -100.264 1.00 35.60  ? 21   LEU F CA  1 
ATOM   7117  C  C   . LEU F  2 22  ? 78.828  -98.596  -100.018 1.00 36.11  ? 21   LEU F C   1 
ATOM   7118  O  O   . LEU F  2 22  ? 79.552  -98.891  -100.968 1.00 37.08  ? 21   LEU F O   1 
ATOM   7119  C  CB  . LEU F  2 22  ? 76.806  -99.030  -101.371 1.00 35.75  ? 21   LEU F CB  1 
ATOM   7120  C  CG  . LEU F  2 22  ? 76.797  -100.537 -101.106 1.00 36.79  ? 21   LEU F CG  1 
ATOM   7121  C  CD1 . LEU F  2 22  ? 75.610  -100.872 -100.206 1.00 37.11  ? 21   LEU F CD1 1 
ATOM   7122  C  CD2 . LEU F  2 22  ? 76.708  -101.304 -102.414 1.00 36.18  ? 21   LEU F CD2 1 
ATOM   7123  N  N   . PRO F  2 23  ? 79.266  -98.643  -98.744  1.00 35.79  ? 22   PRO F N   1 
ATOM   7124  C  CA  . PRO F  2 23  ? 80.650  -99.073  -98.519  1.00 34.19  ? 22   PRO F CA  1 
ATOM   7125  C  C   . PRO F  2 23  ? 80.835  -100.534 -98.914  1.00 33.68  ? 22   PRO F C   1 
ATOM   7126  O  O   . PRO F  2 23  ? 79.884  -101.191 -99.297  1.00 33.14  ? 22   PRO F O   1 
ATOM   7127  C  CB  . PRO F  2 23  ? 80.860  -98.805  -97.029  1.00 32.32  ? 22   PRO F CB  1 
ATOM   7128  C  CG  . PRO F  2 23  ? 79.476  -98.868  -96.459  1.00 34.30  ? 22   PRO F CG  1 
ATOM   7129  C  CD  . PRO F  2 23  ? 78.645  -98.181  -97.491  1.00 34.86  ? 22   PRO F CD  1 
ATOM   7130  N  N   . ALA F  2 24  ? 82.057  -101.040 -98.857  1.00 34.86  ? 23   ALA F N   1 
ATOM   7131  C  CA  . ALA F  2 24  ? 82.283  -102.432 -99.219  1.00 35.68  ? 23   ALA F CA  1 
ATOM   7132  C  C   . ALA F  2 24  ? 81.689  -103.320 -98.137  1.00 37.05  ? 23   ALA F C   1 
ATOM   7133  O  O   . ALA F  2 24  ? 81.764  -102.997 -96.948  1.00 40.42  ? 23   ALA F O   1 
ATOM   7134  C  CB  . ALA F  2 24  ? 83.766  -102.706 -99.365  1.00 33.93  ? 23   ALA F CB  1 
ATOM   7135  N  N   . PHE F  2 25  ? 81.085  -104.428 -98.542  1.00 36.79  ? 24   PHE F N   1 
ATOM   7136  C  CA  . PHE F  2 25  ? 80.491  -105.346 -97.576  1.00 37.87  ? 24   PHE F CA  1 
ATOM   7137  C  C   . PHE F  2 25  ? 81.655  -105.920 -96.760  1.00 39.11  ? 24   PHE F C   1 
ATOM   7138  O  O   . PHE F  2 25  ? 82.553  -106.548 -97.333  1.00 40.23  ? 24   PHE F O   1 
ATOM   7139  C  CB  . PHE F  2 25  ? 79.764  -106.481 -98.326  1.00 36.35  ? 24   PHE F CB  1 
ATOM   7140  C  CG  . PHE F  2 25  ? 78.940  -107.382 -97.439  1.00 33.23  ? 24   PHE F CG  1 
ATOM   7141  C  CD1 . PHE F  2 25  ? 77.635  -107.039 -97.093  1.00 33.08  ? 24   PHE F CD1 1 
ATOM   7142  C  CD2 . PHE F  2 25  ? 79.474  -108.563 -96.939  1.00 30.75  ? 24   PHE F CD2 1 
ATOM   7143  C  CE1 . PHE F  2 25  ? 76.868  -107.858 -96.261  1.00 31.91  ? 24   PHE F CE1 1 
ATOM   7144  C  CE2 . PHE F  2 25  ? 78.721  -109.385 -96.109  1.00 30.83  ? 24   PHE F CE2 1 
ATOM   7145  C  CZ  . PHE F  2 25  ? 77.413  -109.030 -95.769  1.00 31.25  ? 24   PHE F CZ  1 
ATOM   7146  N  N   . ASN F  2 26  ? 81.700  -105.705 -95.449  1.00 38.84  ? 25   ASN F N   1 
ATOM   7147  C  CA  . ASN F  2 26  ? 82.825  -106.318 -94.759  1.00 42.33  ? 25   ASN F CA  1 
ATOM   7148  C  C   . ASN F  2 26  ? 82.438  -107.636 -94.131  1.00 42.98  ? 25   ASN F C   1 
ATOM   7149  O  O   . ASN F  2 26  ? 81.728  -107.714 -93.130  1.00 40.75  ? 25   ASN F O   1 
ATOM   7150  C  CB  . ASN F  2 26  ? 83.516  -105.388 -93.743  1.00 43.96  ? 25   ASN F CB  1 
ATOM   7151  C  CG  . ASN F  2 26  ? 82.604  -104.891 -92.690  1.00 44.03  ? 25   ASN F CG  1 
ATOM   7152  O  OD1 . ASN F  2 26  ? 83.035  -104.220 -91.765  1.00 44.97  ? 25   ASN F OD1 1 
ATOM   7153  N  ND2 . ASN F  2 26  ? 81.329  -105.202 -92.816  1.00 47.97  ? 25   ASN F ND2 1 
ATOM   7154  N  N   . GLU F  2 27  ? 82.921  -108.675 -94.797  1.00 44.48  ? 26   GLU F N   1 
ATOM   7155  C  CA  . GLU F  2 27  ? 82.707  -110.057 -94.441  1.00 46.60  ? 26   GLU F CA  1 
ATOM   7156  C  C   . GLU F  2 27  ? 83.402  -110.360 -93.119  1.00 46.61  ? 26   GLU F C   1 
ATOM   7157  O  O   . GLU F  2 27  ? 82.930  -111.185 -92.330  1.00 46.72  ? 26   GLU F O   1 
ATOM   7158  C  CB  . GLU F  2 27  ? 83.256  -110.914 -95.584  1.00 50.73  ? 26   GLU F CB  1 
ATOM   7159  C  CG  . GLU F  2 27  ? 83.708  -110.035 -96.782  1.00 57.64  ? 26   GLU F CG  1 
ATOM   7160  C  CD  . GLU F  2 27  ? 83.890  -110.790 -98.105  1.00 61.55  ? 26   GLU F CD  1 
ATOM   7161  O  OE1 . GLU F  2 27  ? 82.902  -111.389 -98.601  1.00 61.71  ? 26   GLU F OE1 1 
ATOM   7162  O  OE2 . GLU F  2 27  ? 85.021  -110.765 -98.653  1.00 62.64  ? 26   GLU F OE2 1 
ATOM   7163  N  N   . ASP F  2 28  ? 84.512  -109.673 -92.862  1.00 45.31  ? 27   ASP F N   1 
ATOM   7164  C  CA  . ASP F  2 28  ? 85.251  -109.889 -91.631  1.00 44.08  ? 27   ASP F CA  1 
ATOM   7165  C  C   . ASP F  2 28  ? 84.504  -109.325 -90.456  1.00 43.58  ? 27   ASP F C   1 
ATOM   7166  O  O   . ASP F  2 28  ? 84.439  -109.947 -89.402  1.00 45.08  ? 27   ASP F O   1 
ATOM   7167  C  CB  . ASP F  2 28  ? 86.623  -109.251 -91.714  1.00 45.95  ? 27   ASP F CB  1 
ATOM   7168  C  CG  . ASP F  2 28  ? 87.440  -109.804 -92.854  1.00 48.63  ? 27   ASP F CG  1 
ATOM   7169  O  OD1 . ASP F  2 28  ? 87.410  -111.039 -93.057  1.00 50.60  ? 27   ASP F OD1 1 
ATOM   7170  O  OD2 . ASP F  2 28  ? 88.115  -109.009 -93.543  1.00 50.62  ? 27   ASP F OD2 1 
ATOM   7171  N  N   . GLY F  2 29  ? 83.943  -108.137 -90.632  1.00 42.94  ? 28   GLY F N   1 
ATOM   7172  C  CA  . GLY F  2 29  ? 83.189  -107.533 -89.553  1.00 40.99  ? 28   GLY F CA  1 
ATOM   7173  C  C   . GLY F  2 29  ? 82.060  -108.454 -89.139  1.00 39.97  ? 28   GLY F C   1 
ATOM   7174  O  O   . GLY F  2 29  ? 81.875  -108.731 -87.964  1.00 39.60  ? 28   GLY F O   1 
ATOM   7175  N  N   . LEU F  2 30  ? 81.308  -108.937 -90.119  1.00 40.05  ? 29   LEU F N   1 
ATOM   7176  C  CA  . LEU F  2 30  ? 80.189  -109.824 -89.864  1.00 40.03  ? 29   LEU F CA  1 
ATOM   7177  C  C   . LEU F  2 30  ? 80.656  -111.141 -89.292  1.00 40.98  ? 29   LEU F C   1 
ATOM   7178  O  O   . LEU F  2 30  ? 80.056  -111.652 -88.355  1.00 41.45  ? 29   LEU F O   1 
ATOM   7179  C  CB  . LEU F  2 30  ? 79.427  -110.083 -91.152  1.00 40.57  ? 29   LEU F CB  1 
ATOM   7180  C  CG  . LEU F  2 30  ? 78.207  -110.991 -91.073  1.00 39.94  ? 29   LEU F CG  1 
ATOM   7181  C  CD1 . LEU F  2 30  ? 77.094  -110.308 -90.319  1.00 37.99  ? 29   LEU F CD1 1 
ATOM   7182  C  CD2 . LEU F  2 30  ? 77.772  -111.316 -92.487  1.00 40.55  ? 29   LEU F CD2 1 
ATOM   7183  N  N   . ARG F  2 31  ? 81.726  -111.692 -89.859  1.00 43.03  ? 30   ARG F N   1 
ATOM   7184  C  CA  . ARG F  2 31  ? 82.269  -112.964 -89.387  1.00 44.43  ? 30   ARG F CA  1 
ATOM   7185  C  C   . ARG F  2 31  ? 82.611  -112.856 -87.909  1.00 43.36  ? 30   ARG F C   1 
ATOM   7186  O  O   . ARG F  2 31  ? 82.173  -113.671 -87.100  1.00 43.87  ? 30   ARG F O   1 
ATOM   7187  C  CB  . ARG F  2 31  ? 83.522  -113.342 -90.175  1.00 47.57  ? 30   ARG F CB  1 
ATOM   7188  C  CG  . ARG F  2 31  ? 83.677  -114.841 -90.377  1.00 55.88  ? 30   ARG F CG  1 
ATOM   7189  C  CD  . ARG F  2 31  ? 84.900  -115.177 -91.234  1.00 64.12  ? 30   ARG F CD  1 
ATOM   7190  N  NE  . ARG F  2 31  ? 84.826  -116.524 -91.817  1.00 70.80  ? 30   ARG F NE  1 
ATOM   7191  C  CZ  . ARG F  2 31  ? 85.844  -117.148 -92.413  1.00 73.02  ? 30   ARG F CZ  1 
ATOM   7192  N  NH1 . ARG F  2 31  ? 87.030  -116.555 -92.510  1.00 73.54  ? 30   ARG F NH1 1 
ATOM   7193  N  NH2 . ARG F  2 31  ? 85.676  -118.366 -92.920  1.00 73.78  ? 30   ARG F NH2 1 
ATOM   7194  N  N   . GLN F  2 32  ? 83.391  -111.838 -87.559  1.00 42.02  ? 31   GLN F N   1 
ATOM   7195  C  CA  . GLN F  2 32  ? 83.779  -111.619 -86.172  1.00 40.38  ? 31   GLN F CA  1 
ATOM   7196  C  C   . GLN F  2 32  ? 82.588  -111.519 -85.242  1.00 38.81  ? 31   GLN F C   1 
ATOM   7197  O  O   . GLN F  2 32  ? 82.577  -112.127 -84.179  1.00 40.63  ? 31   GLN F O   1 
ATOM   7198  C  CB  . GLN F  2 32  ? 84.593  -110.351 -86.039  1.00 40.29  ? 31   GLN F CB  1 
ATOM   7199  C  CG  . GLN F  2 32  ? 86.056  -110.530 -86.264  1.00 43.93  ? 31   GLN F CG  1 
ATOM   7200  C  CD  . GLN F  2 32  ? 86.808  -109.271 -85.928  1.00 46.62  ? 31   GLN F CD  1 
ATOM   7201  O  OE1 . GLN F  2 32  ? 86.646  -108.720 -84.829  1.00 46.57  ? 31   GLN F OE1 1 
ATOM   7202  N  NE2 . GLN F  2 32  ? 87.633  -108.795 -86.868  1.00 45.65  ? 31   GLN F NE2 1 
ATOM   7203  N  N   . VAL F  2 33  ? 81.588  -110.737 -85.629  1.00 37.14  ? 32   VAL F N   1 
ATOM   7204  C  CA  . VAL F  2 33  ? 80.405  -110.584 -84.799  1.00 33.21  ? 32   VAL F CA  1 
ATOM   7205  C  C   . VAL F  2 33  ? 79.749  -111.940 -84.595  1.00 31.52  ? 32   VAL F C   1 
ATOM   7206  O  O   . VAL F  2 33  ? 79.305  -112.250 -83.502  1.00 31.52  ? 32   VAL F O   1 
ATOM   7207  C  CB  . VAL F  2 33  ? 79.392  -109.614 -85.428  1.00 31.37  ? 32   VAL F CB  1 
ATOM   7208  C  CG1 . VAL F  2 33  ? 78.205  -109.436 -84.489  1.00 32.40  ? 32   VAL F CG1 1 
ATOM   7209  C  CG2 . VAL F  2 33  ? 80.057  -108.272 -85.698  1.00 28.73  ? 32   VAL F CG2 1 
ATOM   7210  N  N   . LEU F  2 34  ? 79.705  -112.749 -85.648  1.00 30.36  ? 33   LEU F N   1 
ATOM   7211  C  CA  . LEU F  2 34  ? 79.114  -114.076 -85.564  1.00 31.37  ? 33   LEU F CA  1 
ATOM   7212  C  C   . LEU F  2 34  ? 79.994  -114.997 -84.712  1.00 33.07  ? 33   LEU F C   1 
ATOM   7213  O  O   . LEU F  2 34  ? 79.497  -115.880 -83.999  1.00 32.53  ? 33   LEU F O   1 
ATOM   7214  C  CB  . LEU F  2 34  ? 78.902  -114.647 -86.974  1.00 29.98  ? 33   LEU F CB  1 
ATOM   7215  C  CG  . LEU F  2 34  ? 77.705  -114.016 -87.706  1.00 31.55  ? 33   LEU F CG  1 
ATOM   7216  C  CD1 . LEU F  2 34  ? 77.605  -114.503 -89.150  1.00 28.48  ? 33   LEU F CD1 1 
ATOM   7217  C  CD2 . LEU F  2 34  ? 76.427  -114.343 -86.930  1.00 30.76  ? 33   LEU F CD2 1 
ATOM   7218  N  N   . GLU F  2 35  ? 81.303  -114.784 -84.787  1.00 34.74  ? 34   GLU F N   1 
ATOM   7219  C  CA  . GLU F  2 35  ? 82.237  -115.555 -83.988  1.00 36.11  ? 34   GLU F CA  1 
ATOM   7220  C  C   . GLU F  2 35  ? 81.978  -115.246 -82.512  1.00 36.36  ? 34   GLU F C   1 
ATOM   7221  O  O   . GLU F  2 35  ? 81.902  -116.151 -81.688  1.00 38.00  ? 34   GLU F O   1 
ATOM   7222  C  CB  . GLU F  2 35  ? 83.672  -115.187 -84.354  1.00 40.30  ? 34   GLU F CB  1 
ATOM   7223  C  CG  . GLU F  2 35  ? 84.279  -116.030 -85.460  1.00 45.33  ? 34   GLU F CG  1 
ATOM   7224  C  CD  . GLU F  2 35  ? 84.163  -117.522 -85.170  1.00 50.26  ? 34   GLU F CD  1 
ATOM   7225  O  OE1 . GLU F  2 35  ? 84.262  -117.920 -83.984  1.00 52.91  ? 34   GLU F OE1 1 
ATOM   7226  O  OE2 . GLU F  2 35  ? 83.984  -118.305 -86.128  1.00 52.85  ? 34   GLU F OE2 1 
ATOM   7227  N  N   . GLU F  2 36  ? 81.832  -113.966 -82.184  1.00 36.41  ? 35   GLU F N   1 
ATOM   7228  C  CA  . GLU F  2 36  ? 81.560  -113.543 -80.812  1.00 36.91  ? 35   GLU F CA  1 
ATOM   7229  C  C   . GLU F  2 36  ? 80.251  -114.086 -80.250  1.00 36.10  ? 35   GLU F C   1 
ATOM   7230  O  O   . GLU F  2 36  ? 80.156  -114.407 -79.064  1.00 34.38  ? 35   GLU F O   1 
ATOM   7231  C  CB  . GLU F  2 36  ? 81.492  -112.030 -80.721  1.00 39.97  ? 35   GLU F CB  1 
ATOM   7232  C  CG  . GLU F  2 36  ? 82.747  -111.306 -81.092  1.00 44.13  ? 35   GLU F CG  1 
ATOM   7233  C  CD  . GLU F  2 36  ? 82.764  -109.921 -80.485  1.00 48.59  ? 35   GLU F CD  1 
ATOM   7234  O  OE1 . GLU F  2 36  ? 81.683  -109.470 -80.002  1.00 50.14  ? 35   GLU F OE1 1 
ATOM   7235  O  OE2 . GLU F  2 36  ? 83.849  -109.294 -80.493  1.00 48.75  ? 35   GLU F OE2 1 
HETATM 7236  N  N   . MSE F  2 37  ? 79.226  -114.143 -81.092  1.00 36.46  ? 36   MSE F N   1 
HETATM 7237  C  CA  . MSE F  2 37  ? 77.929  -114.647 -80.659  1.00 35.92  ? 36   MSE F CA  1 
HETATM 7238  C  C   . MSE F  2 37  ? 78.064  -116.122 -80.306  1.00 34.44  ? 36   MSE F C   1 
HETATM 7239  O  O   . MSE F  2 37  ? 77.484  -116.598 -79.333  1.00 31.31  ? 36   MSE F O   1 
HETATM 7240  C  CB  . MSE F  2 37  ? 76.894  -114.457 -81.766  1.00 37.38  ? 36   MSE F CB  1 
HETATM 7241  C  CG  . MSE F  2 37  ? 76.642  -112.996 -82.123  1.00 39.57  ? 36   MSE F CG  1 
HETATM 7242  SE SE  . MSE F  2 37  ? 75.054  -112.719 -83.204  1.00 43.63  ? 36   MSE F SE  1 
HETATM 7243  C  CE  . MSE F  2 37  ? 73.750  -113.213 -81.861  1.00 36.57  ? 36   MSE F CE  1 
ATOM   7244  N  N   . LYS F  2 38  ? 78.849  -116.834 -81.107  1.00 34.07  ? 37   LYS F N   1 
ATOM   7245  C  CA  . LYS F  2 38  ? 79.094  -118.250 -80.882  1.00 34.44  ? 37   LYS F CA  1 
ATOM   7246  C  C   . LYS F  2 38  ? 79.779  -118.383 -79.524  1.00 34.16  ? 37   LYS F C   1 
ATOM   7247  O  O   . LYS F  2 38  ? 79.327  -119.121 -78.650  1.00 33.07  ? 37   LYS F O   1 
ATOM   7248  C  CB  . LYS F  2 38  ? 79.992  -118.802 -81.993  1.00 35.45  ? 37   LYS F CB  1 
ATOM   7249  C  CG  . LYS F  2 38  ? 80.144  -120.307 -81.975  1.00 38.63  ? 37   LYS F CG  1 
ATOM   7250  C  CD  . LYS F  2 38  ? 81.146  -120.774 -83.020  1.00 42.78  ? 37   LYS F CD  1 
ATOM   7251  C  CE  . LYS F  2 38  ? 81.581  -122.229 -82.773  1.00 45.63  ? 37   LYS F CE  1 
ATOM   7252  N  NZ  . LYS F  2 38  ? 82.640  -122.694 -83.731  1.00 46.70  ? 37   LYS F NZ  1 
ATOM   7253  N  N   . ALA F  2 39  ? 80.863  -117.637 -79.352  1.00 33.72  ? 38   ALA F N   1 
ATOM   7254  C  CA  . ALA F  2 39  ? 81.613  -117.647 -78.110  1.00 34.50  ? 38   ALA F CA  1 
ATOM   7255  C  C   . ALA F  2 39  ? 80.728  -117.375 -76.897  1.00 35.95  ? 38   ALA F C   1 
ATOM   7256  O  O   . ALA F  2 39  ? 80.710  -118.148 -75.938  1.00 38.10  ? 38   ALA F O   1 
ATOM   7257  C  CB  . ALA F  2 39  ? 82.712  -116.618 -78.183  1.00 34.00  ? 38   ALA F CB  1 
ATOM   7258  N  N   . LEU F  2 40  ? 80.013  -116.257 -76.935  1.00 36.52  ? 39   LEU F N   1 
ATOM   7259  C  CA  . LEU F  2 40  ? 79.127  -115.867 -75.851  1.00 35.62  ? 39   LEU F CA  1 
ATOM   7260  C  C   . LEU F  2 40  ? 78.063  -116.913 -75.585  1.00 35.08  ? 39   LEU F C   1 
ATOM   7261  O  O   . LEU F  2 40  ? 77.711  -117.151 -74.447  1.00 34.88  ? 39   LEU F O   1 
ATOM   7262  C  CB  . LEU F  2 40  ? 78.444  -114.542 -76.188  1.00 37.42  ? 39   LEU F CB  1 
ATOM   7263  C  CG  . LEU F  2 40  ? 79.130  -113.228 -75.825  1.00 37.92  ? 39   LEU F CG  1 
ATOM   7264  C  CD1 . LEU F  2 40  ? 78.573  -112.122 -76.693  1.00 39.78  ? 39   LEU F CD1 1 
ATOM   7265  C  CD2 . LEU F  2 40  ? 78.895  -112.913 -74.361  1.00 37.24  ? 39   LEU F CD2 1 
ATOM   7266  N  N   . TYR F  2 41  ? 77.535  -117.526 -76.638  1.00 36.87  ? 40   TYR F N   1 
ATOM   7267  C  CA  . TYR F  2 41  ? 76.490  -118.536 -76.484  1.00 37.97  ? 40   TYR F CA  1 
ATOM   7268  C  C   . TYR F  2 41  ? 77.003  -119.691 -75.642  1.00 39.25  ? 40   TYR F C   1 
ATOM   7269  O  O   . TYR F  2 41  ? 76.317  -120.176 -74.737  1.00 37.99  ? 40   TYR F O   1 
ATOM   7270  C  CB  . TYR F  2 41  ? 76.056  -119.070 -77.845  1.00 38.76  ? 40   TYR F CB  1 
ATOM   7271  C  CG  . TYR F  2 41  ? 75.064  -120.204 -77.738  1.00 42.33  ? 40   TYR F CG  1 
ATOM   7272  C  CD1 . TYR F  2 41  ? 73.794  -119.991 -77.208  1.00 43.31  ? 40   TYR F CD1 1 
ATOM   7273  C  CD2 . TYR F  2 41  ? 75.399  -121.496 -78.142  1.00 42.74  ? 40   TYR F CD2 1 
ATOM   7274  C  CE1 . TYR F  2 41  ? 72.882  -121.029 -77.082  1.00 44.00  ? 40   TYR F CE1 1 
ATOM   7275  C  CE2 . TYR F  2 41  ? 74.493  -122.542 -78.018  1.00 43.64  ? 40   TYR F CE2 1 
ATOM   7276  C  CZ  . TYR F  2 41  ? 73.237  -122.301 -77.489  1.00 45.08  ? 40   TYR F CZ  1 
ATOM   7277  O  OH  . TYR F  2 41  ? 72.325  -123.326 -77.367  1.00 47.55  ? 40   TYR F OH  1 
ATOM   7278  N  N   . GLU F  2 42  ? 78.218  -120.126 -75.974  1.00 39.68  ? 41   GLU F N   1 
ATOM   7279  C  CA  . GLU F  2 42  ? 78.899  -121.205 -75.290  1.00 39.96  ? 41   GLU F CA  1 
ATOM   7280  C  C   . GLU F  2 42  ? 79.172  -120.864 -73.827  1.00 40.98  ? 41   GLU F C   1 
ATOM   7281  O  O   . GLU F  2 42  ? 78.780  -121.608 -72.928  1.00 40.35  ? 41   GLU F O   1 
ATOM   7282  C  CB  . GLU F  2 42  ? 80.210  -121.486 -75.996  1.00 41.89  ? 41   GLU F CB  1 
ATOM   7283  C  CG  . GLU F  2 42  ? 80.045  -121.955 -77.423  1.00 47.17  ? 41   GLU F CG  1 
ATOM   7284  C  CD  . GLU F  2 42  ? 81.371  -122.001 -78.179  1.00 51.62  ? 41   GLU F CD  1 
ATOM   7285  O  OE1 . GLU F  2 42  ? 81.381  -122.542 -79.312  1.00 53.34  ? 41   GLU F OE1 1 
ATOM   7286  O  OE2 . GLU F  2 42  ? 82.396  -121.493 -77.644  1.00 52.15  ? 41   GLU F OE2 1 
ATOM   7287  N  N   . GLN F  2 43  ? 79.854  -119.745 -73.591  1.00 41.90  ? 42   GLN F N   1 
ATOM   7288  C  CA  . GLN F  2 43  ? 80.165  -119.329 -72.233  1.00 43.24  ? 42   GLN F CA  1 
ATOM   7289  C  C   . GLN F  2 43  ? 78.901  -119.385 -71.393  1.00 44.29  ? 42   GLN F C   1 
ATOM   7290  O  O   . GLN F  2 43  ? 78.926  -119.859 -70.267  1.00 46.43  ? 42   GLN F O   1 
ATOM   7291  C  CB  . GLN F  2 43  ? 80.718  -117.907 -72.214  1.00 44.82  ? 42   GLN F CB  1 
ATOM   7292  C  CG  . GLN F  2 43  ? 82.084  -117.729 -72.847  1.00 48.66  ? 42   GLN F CG  1 
ATOM   7293  C  CD  . GLN F  2 43  ? 82.448  -116.253 -73.016  1.00 51.95  ? 42   GLN F CD  1 
ATOM   7294  O  OE1 . GLN F  2 43  ? 82.170  -115.427 -72.133  1.00 53.47  ? 42   GLN F OE1 1 
ATOM   7295  N  NE2 . GLN F  2 43  ? 83.077  -115.915 -74.145  1.00 51.15  ? 42   GLN F NE2 1 
ATOM   7296  N  N   . ASN F  2 44  ? 77.792  -118.909 -71.947  1.00 44.92  ? 43   ASN F N   1 
ATOM   7297  C  CA  . ASN F  2 44  ? 76.515  -118.901 -71.240  1.00 45.73  ? 43   ASN F CA  1 
ATOM   7298  C  C   . ASN F  2 44  ? 76.006  -120.320 -71.022  1.00 47.36  ? 43   ASN F C   1 
ATOM   7299  O  O   . ASN F  2 44  ? 75.335  -120.612 -70.032  1.00 45.82  ? 43   ASN F O   1 
ATOM   7300  C  CB  . ASN F  2 44  ? 75.488  -118.095 -72.041  1.00 45.92  ? 43   ASN F CB  1 
ATOM   7301  C  CG  . ASN F  2 44  ? 74.998  -116.873 -71.294  1.00 44.27  ? 43   ASN F CG  1 
ATOM   7302  O  OD1 . ASN F  2 44  ? 75.746  -116.246 -70.547  1.00 44.31  ? 43   ASN F OD1 1 
ATOM   7303  N  ND2 . ASN F  2 44  ? 73.740  -116.523 -71.502  1.00 42.60  ? 43   ASN F ND2 1 
ATOM   7304  N  N   . GLN F  2 45  ? 76.333  -121.199 -71.961  1.00 50.01  ? 44   GLN F N   1 
ATOM   7305  C  CA  . GLN F  2 45  ? 75.929  -122.594 -71.888  1.00 51.03  ? 44   GLN F CA  1 
ATOM   7306  C  C   . GLN F  2 45  ? 76.565  -123.205 -70.651  1.00 50.91  ? 44   GLN F C   1 
ATOM   7307  O  O   . GLN F  2 45  ? 75.882  -123.697 -69.754  1.00 50.51  ? 44   GLN F O   1 
ATOM   7308  C  CB  . GLN F  2 45  ? 76.407  -123.329 -73.138  1.00 53.41  ? 44   GLN F CB  1 
ATOM   7309  C  CG  . GLN F  2 45  ? 75.377  -124.253 -73.718  1.00 58.77  ? 44   GLN F CG  1 
ATOM   7310  C  CD  . GLN F  2 45  ? 74.131  -123.510 -74.152  1.00 62.64  ? 44   GLN F CD  1 
ATOM   7311  O  OE1 . GLN F  2 45  ? 73.934  -122.343 -73.799  1.00 65.67  ? 44   GLN F OE1 1 
ATOM   7312  N  NE2 . GLN F  2 45  ? 73.273  -124.184 -74.912  1.00 63.33  ? 44   GLN F NE2 1 
ATOM   7313  N  N   . SER F  2 46  ? 77.890  -123.157 -70.615  1.00 50.28  ? 45   SER F N   1 
ATOM   7314  C  CA  . SER F  2 46  ? 78.658  -123.686 -69.503  1.00 50.72  ? 45   SER F CA  1 
ATOM   7315  C  C   . SER F  2 46  ? 78.124  -123.166 -68.171  1.00 52.15  ? 45   SER F C   1 
ATOM   7316  O  O   . SER F  2 46  ? 77.637  -123.934 -67.342  1.00 53.17  ? 45   SER F O   1 
ATOM   7317  C  CB  . SER F  2 46  ? 80.127  -123.292 -69.668  1.00 49.35  ? 45   SER F CB  1 
ATOM   7318  O  OG  . SER F  2 46  ? 80.875  -123.568 -68.501  1.00 50.26  ? 45   SER F OG  1 
ATOM   7319  N  N   . ASP F  2 47  ? 78.211  -121.852 -67.984  1.00 53.03  ? 46   ASP F N   1 
ATOM   7320  C  CA  . ASP F  2 47  ? 77.766  -121.199 -66.761  1.00 53.04  ? 46   ASP F CA  1 
ATOM   7321  C  C   . ASP F  2 47  ? 76.335  -121.570 -66.347  1.00 53.69  ? 46   ASP F C   1 
ATOM   7322  O  O   . ASP F  2 47  ? 76.028  -121.640 -65.159  1.00 52.99  ? 46   ASP F O   1 
ATOM   7323  C  CB  . ASP F  2 47  ? 77.910  -119.679 -66.921  1.00 52.89  ? 46   ASP F CB  1 
ATOM   7324  C  CG  . ASP F  2 47  ? 79.371  -119.237 -67.125  1.00 54.42  ? 46   ASP F CG  1 
ATOM   7325  O  OD1 . ASP F  2 47  ? 80.185  -120.011 -67.683  1.00 54.47  ? 46   ASP F OD1 1 
ATOM   7326  O  OD2 . ASP F  2 47  ? 79.709  -118.098 -66.741  1.00 54.49  ? 46   ASP F OD2 1 
ATOM   7327  N  N   . VAL F  2 48  ? 75.464  -121.829 -67.316  1.00 55.53  ? 47   VAL F N   1 
ATOM   7328  C  CA  . VAL F  2 48  ? 74.078  -122.181 -66.999  1.00 57.93  ? 47   VAL F CA  1 
ATOM   7329  C  C   . VAL F  2 48  ? 73.917  -123.531 -66.311  1.00 59.45  ? 47   VAL F C   1 
ATOM   7330  O  O   . VAL F  2 48  ? 73.011  -123.722 -65.501  1.00 59.28  ? 47   VAL F O   1 
ATOM   7331  C  CB  . VAL F  2 48  ? 73.189  -122.148 -68.258  1.00 57.21  ? 47   VAL F CB  1 
ATOM   7332  C  CG1 . VAL F  2 48  ? 71.938  -122.994 -68.054  1.00 56.62  ? 47   VAL F CG1 1 
ATOM   7333  C  CG2 . VAL F  2 48  ? 72.791  -120.724 -68.542  1.00 56.75  ? 47   VAL F CG2 1 
ATOM   7334  N  N   . ASN F  2 49  ? 74.782  -124.479 -66.636  1.00 61.75  ? 48   ASN F N   1 
ATOM   7335  C  CA  . ASN F  2 49  ? 74.683  -125.769 -65.993  1.00 63.34  ? 48   ASN F CA  1 
ATOM   7336  C  C   . ASN F  2 49  ? 75.251  -125.674 -64.587  1.00 64.92  ? 48   ASN F C   1 
ATOM   7337  O  O   . ASN F  2 49  ? 74.771  -126.355 -63.689  1.00 66.38  ? 48   ASN F O   1 
ATOM   7338  C  CB  . ASN F  2 49  ? 75.379  -126.832 -66.831  1.00 63.69  ? 48   ASN F CB  1 
ATOM   7339  C  CG  . ASN F  2 49  ? 74.649  -127.086 -68.133  1.00 64.31  ? 48   ASN F CG  1 
ATOM   7340  O  OD1 . ASN F  2 49  ? 74.469  -126.173 -68.934  1.00 66.24  ? 48   ASN F OD1 1 
ATOM   7341  N  ND2 . ASN F  2 49  ? 74.207  -128.317 -68.342  1.00 64.41  ? 48   ASN F ND2 1 
ATOM   7342  N  N   . GLU F  2 50  ? 76.251  -124.819 -64.376  1.00 65.93  ? 49   GLU F N   1 
ATOM   7343  C  CA  . GLU F  2 50  ? 76.793  -124.648 -63.029  1.00 67.09  ? 49   GLU F CA  1 
ATOM   7344  C  C   . GLU F  2 50  ? 75.704  -123.976 -62.198  1.00 68.80  ? 49   GLU F C   1 
ATOM   7345  O  O   . GLU F  2 50  ? 75.835  -123.812 -60.988  1.00 69.13  ? 49   GLU F O   1 
ATOM   7346  C  CB  . GLU F  2 50  ? 78.014  -123.740 -63.032  1.00 66.71  ? 49   GLU F CB  1 
ATOM   7347  C  CG  . GLU F  2 50  ? 79.134  -124.180 -63.924  1.00 67.56  ? 49   GLU F CG  1 
ATOM   7348  C  CD  . GLU F  2 50  ? 80.384  -123.380 -63.663  1.00 68.30  ? 49   GLU F CD  1 
ATOM   7349  O  OE1 . GLU F  2 50  ? 80.921  -123.485 -62.539  1.00 68.02  ? 49   GLU F OE1 1 
ATOM   7350  O  OE2 . GLU F  2 50  ? 80.822  -122.641 -64.571  1.00 69.02  ? 49   GLU F OE2 1 
ATOM   7351  N  N   . ALA F  2 51  ? 74.633  -123.571 -62.873  1.00 70.18  ? 50   ALA F N   1 
ATOM   7352  C  CA  . ALA F  2 51  ? 73.515  -122.912 -62.226  1.00 71.47  ? 50   ALA F CA  1 
ATOM   7353  C  C   . ALA F  2 51  ? 72.455  -123.930 -61.818  1.00 73.13  ? 50   ALA F C   1 
ATOM   7354  O  O   . ALA F  2 51  ? 71.512  -123.604 -61.089  1.00 74.37  ? 50   ALA F O   1 
ATOM   7355  C  CB  . ALA F  2 51  ? 72.921  -121.883 -63.161  1.00 71.09  ? 50   ALA F CB  1 
ATOM   7356  N  N   . LYS F  2 52  ? 72.606  -125.157 -62.306  1.00 73.45  ? 51   LYS F N   1 
ATOM   7357  C  CA  . LYS F  2 52  ? 71.686  -126.243 -61.980  1.00 74.53  ? 51   LYS F CA  1 
ATOM   7358  C  C   . LYS F  2 52  ? 72.515  -127.309 -61.269  1.00 75.90  ? 51   LYS F C   1 
ATOM   7359  O  O   . LYS F  2 52  ? 72.408  -127.484 -60.050  1.00 76.13  ? 51   LYS F O   1 
ATOM   7360  C  CB  . LYS F  2 52  ? 71.083  -126.840 -63.245  1.00 73.95  ? 51   LYS F CB  1 
ATOM   7361  C  CG  . LYS F  2 52  ? 70.426  -125.839 -64.163  1.00 75.38  ? 51   LYS F CG  1 
ATOM   7362  C  CD  . LYS F  2 52  ? 70.118  -126.491 -65.504  1.00 76.46  ? 51   LYS F CD  1 
ATOM   7363  C  CE  . LYS F  2 52  ? 71.397  -126.999 -66.174  1.00 77.55  ? 51   LYS F CE  1 
ATOM   7364  N  NZ  . LYS F  2 52  ? 71.170  -127.788 -67.415  1.00 75.35  ? 51   LYS F NZ  1 
ATOM   7365  N  N   . SER F  2 53  ? 73.339  -128.016 -62.047  1.00 76.76  ? 52   SER F N   1 
ATOM   7366  C  CA  . SER F  2 53  ? 74.221  -129.057 -61.520  1.00 76.15  ? 52   SER F CA  1 
ATOM   7367  C  C   . SER F  2 53  ? 74.923  -128.448 -60.325  1.00 75.42  ? 52   SER F C   1 
ATOM   7368  O  O   . SER F  2 53  ? 74.571  -128.736 -59.184  1.00 75.82  ? 52   SER F O   1 
ATOM   7369  C  CB  . SER F  2 53  ? 75.268  -129.477 -62.566  1.00 77.20  ? 52   SER F CB  1 
ATOM   7370  O  OG  . SER F  2 53  ? 74.667  -130.002 -63.741  1.00 78.38  ? 52   SER F OG  1 
ATOM   7371  N  N   . GLY F  2 54  ? 75.910  -127.598 -60.591  1.00 74.86  ? 53   GLY F N   1 
ATOM   7372  C  CA  . GLY F  2 54  ? 76.620  -126.943 -59.508  1.00 74.85  ? 53   GLY F CA  1 
ATOM   7373  C  C   . GLY F  2 54  ? 75.623  -126.142 -58.686  1.00 74.97  ? 53   GLY F C   1 
ATOM   7374  O  O   . GLY F  2 54  ? 74.455  -126.014 -59.072  1.00 75.45  ? 53   GLY F O   1 
ATOM   7375  N  N   . GLY F  2 55  ? 76.065  -125.597 -57.557  1.00 73.55  ? 54   GLY F N   1 
ATOM   7376  C  CA  . GLY F  2 55  ? 75.158  -124.825 -56.728  1.00 71.36  ? 54   GLY F CA  1 
ATOM   7377  C  C   . GLY F  2 55  ? 75.280  -123.331 -56.941  1.00 70.02  ? 54   GLY F C   1 
ATOM   7378  O  O   . GLY F  2 55  ? 74.689  -122.540 -56.200  1.00 69.77  ? 54   GLY F O   1 
ATOM   7379  N  N   . ARG F  2 56  ? 76.038  -122.937 -57.960  1.00 68.14  ? 55   ARG F N   1 
ATOM   7380  C  CA  . ARG F  2 56  ? 76.237  -121.525 -58.243  1.00 66.91  ? 55   ARG F CA  1 
ATOM   7381  C  C   . ARG F  2 56  ? 75.096  -120.884 -59.010  1.00 66.65  ? 55   ARG F C   1 
ATOM   7382  O  O   . ARG F  2 56  ? 75.040  -120.951 -60.236  1.00 67.19  ? 55   ARG F O   1 
ATOM   7383  C  CB  . ARG F  2 56  ? 77.546  -121.317 -58.994  1.00 65.94  ? 55   ARG F CB  1 
ATOM   7384  C  CG  . ARG F  2 56  ? 78.750  -121.753 -58.193  1.00 65.16  ? 55   ARG F CG  1 
ATOM   7385  C  CD  . ARG F  2 56  ? 80.034  -121.270 -58.818  1.00 64.40  ? 55   ARG F CD  1 
ATOM   7386  N  NE  . ARG F  2 56  ? 80.231  -119.837 -58.642  1.00 63.00  ? 55   ARG F NE  1 
ATOM   7387  C  CZ  . ARG F  2 56  ? 81.295  -119.178 -59.090  1.00 63.90  ? 55   ARG F CZ  1 
ATOM   7388  N  NH1 . ARG F  2 56  ? 82.252  -119.828 -59.741  1.00 62.67  ? 55   ARG F NH1 1 
ATOM   7389  N  NH2 . ARG F  2 56  ? 81.409  -117.874 -58.882  1.00 64.27  ? 55   ARG F NH2 1 
ATOM   7390  N  N   . SER F  2 57  ? 74.186  -120.263 -58.267  1.00 65.86  ? 56   SER F N   1 
ATOM   7391  C  CA  . SER F  2 57  ? 73.042  -119.582 -58.850  1.00 64.29  ? 56   SER F CA  1 
ATOM   7392  C  C   . SER F  2 57  ? 73.393  -118.092 -58.895  1.00 62.83  ? 56   SER F C   1 
ATOM   7393  O  O   . SER F  2 57  ? 72.566  -117.245 -59.229  1.00 63.05  ? 56   SER F O   1 
ATOM   7394  C  CB  . SER F  2 57  ? 71.798  -119.824 -57.990  1.00 64.87  ? 56   SER F CB  1 
ATOM   7395  O  OG  . SER F  2 57  ? 70.606  -119.597 -58.728  1.00 65.04  ? 56   SER F OG  1 
ATOM   7396  N  N   . ASP F  2 58  ? 74.641  -117.792 -58.549  1.00 60.93  ? 57   ASP F N   1 
ATOM   7397  C  CA  . ASP F  2 58  ? 75.155  -116.428 -58.557  1.00 58.95  ? 57   ASP F CA  1 
ATOM   7398  C  C   . ASP F  2 58  ? 75.708  -116.115 -59.941  1.00 57.23  ? 57   ASP F C   1 
ATOM   7399  O  O   . ASP F  2 58  ? 76.389  -115.108 -60.139  1.00 56.98  ? 57   ASP F O   1 
ATOM   7400  C  CB  . ASP F  2 58  ? 76.281  -116.271 -57.530  1.00 59.99  ? 57   ASP F CB  1 
ATOM   7401  C  CG  . ASP F  2 58  ? 77.425  -117.264 -57.750  1.00 61.57  ? 57   ASP F CG  1 
ATOM   7402  O  OD1 . ASP F  2 58  ? 78.593  -116.920 -57.449  1.00 59.69  ? 57   ASP F OD1 1 
ATOM   7403  O  OD2 . ASP F  2 58  ? 77.153  -118.397 -58.211  1.00 63.14  ? 57   ASP F OD2 1 
ATOM   7404  N  N   . LEU F  2 59  ? 75.424  -116.993 -60.894  1.00 54.93  ? 58   LEU F N   1 
ATOM   7405  C  CA  . LEU F  2 59  ? 75.899  -116.814 -62.259  1.00 53.49  ? 58   LEU F CA  1 
ATOM   7406  C  C   . LEU F  2 59  ? 74.836  -116.201 -63.181  1.00 52.20  ? 58   LEU F C   1 
ATOM   7407  O  O   . LEU F  2 59  ? 75.159  -115.719 -64.273  1.00 50.22  ? 58   LEU F O   1 
ATOM   7408  C  CB  . LEU F  2 59  ? 76.385  -118.161 -62.815  1.00 52.04  ? 58   LEU F CB  1 
ATOM   7409  C  CG  . LEU F  2 59  ? 77.902  -118.350 -62.946  1.00 50.78  ? 58   LEU F CG  1 
ATOM   7410  C  CD1 . LEU F  2 59  ? 78.618  -117.724 -61.779  1.00 48.64  ? 58   LEU F CD1 1 
ATOM   7411  C  CD2 . LEU F  2 59  ? 78.222  -119.824 -63.042  1.00 50.32  ? 58   LEU F CD2 1 
ATOM   7412  N  N   . ILE F  2 60  ? 73.581  -116.207 -62.727  1.00 50.35  ? 59   ILE F N   1 
ATOM   7413  C  CA  . ILE F  2 60  ? 72.473  -115.662 -63.507  1.00 50.29  ? 59   ILE F CA  1 
ATOM   7414  C  C   . ILE F  2 60  ? 72.775  -114.253 -64.057  1.00 49.66  ? 59   ILE F C   1 
ATOM   7415  O  O   . ILE F  2 60  ? 72.672  -114.017 -65.265  1.00 51.01  ? 59   ILE F O   1 
ATOM   7416  C  CB  . ILE F  2 60  ? 71.169  -115.618 -62.670  1.00 50.94  ? 59   ILE F CB  1 
ATOM   7417  C  CG1 . ILE F  2 60  ? 70.860  -117.009 -62.096  1.00 50.70  ? 59   ILE F CG1 1 
ATOM   7418  C  CG2 . ILE F  2 60  ? 70.010  -115.130 -63.534  1.00 50.52  ? 59   ILE F CG2 1 
ATOM   7419  C  CD1 . ILE F  2 60  ? 70.354  -118.015 -63.094  1.00 48.13  ? 59   ILE F CD1 1 
ATOM   7420  N  N   . PRO F  2 61  ? 73.144  -113.299 -63.180  1.00 47.27  ? 60   PRO F N   1 
ATOM   7421  C  CA  . PRO F  2 61  ? 73.458  -111.930 -63.608  1.00 45.04  ? 60   PRO F CA  1 
ATOM   7422  C  C   . PRO F  2 61  ? 74.459  -111.896 -64.747  1.00 43.72  ? 60   PRO F C   1 
ATOM   7423  O  O   . PRO F  2 61  ? 74.289  -111.160 -65.718  1.00 43.41  ? 60   PRO F O   1 
ATOM   7424  C  CB  . PRO F  2 61  ? 74.009  -111.301 -62.343  1.00 44.69  ? 60   PRO F CB  1 
ATOM   7425  C  CG  . PRO F  2 61  ? 73.145  -111.922 -61.301  1.00 46.83  ? 60   PRO F CG  1 
ATOM   7426  C  CD  . PRO F  2 61  ? 73.147  -113.388 -61.711  1.00 47.21  ? 60   PRO F CD  1 
ATOM   7427  N  N   . THR F  2 62  ? 75.513  -112.689 -64.615  1.00 42.34  ? 61   THR F N   1 
ATOM   7428  C  CA  . THR F  2 62  ? 76.524  -112.769 -65.653  1.00 41.24  ? 61   THR F CA  1 
ATOM   7429  C  C   . THR F  2 62  ? 75.923  -113.424 -66.886  1.00 39.63  ? 61   THR F C   1 
ATOM   7430  O  O   . THR F  2 62  ? 76.300  -113.106 -68.014  1.00 40.34  ? 61   THR F O   1 
ATOM   7431  C  CB  . THR F  2 62  ? 77.711  -113.592 -65.183  1.00 43.47  ? 61   THR F CB  1 
ATOM   7432  O  OG1 . THR F  2 62  ? 78.401  -112.861 -64.163  1.00 46.33  ? 61   THR F OG1 1 
ATOM   7433  C  CG2 . THR F  2 62  ? 78.656  -113.897 -66.345  1.00 42.21  ? 61   THR F CG2 1 
ATOM   7434  N  N   . ILE F  2 63  ? 74.991  -114.351 -66.680  1.00 37.01  ? 62   ILE F N   1 
ATOM   7435  C  CA  . ILE F  2 63  ? 74.349  -115.001 -67.814  1.00 34.41  ? 62   ILE F CA  1 
ATOM   7436  C  C   . ILE F  2 63  ? 73.503  -113.930 -68.514  1.00 31.64  ? 62   ILE F C   1 
ATOM   7437  O  O   . ILE F  2 63  ? 73.609  -113.730 -69.729  1.00 28.78  ? 62   ILE F O   1 
ATOM   7438  C  CB  . ILE F  2 63  ? 73.471  -116.201 -67.355  1.00 34.25  ? 62   ILE F CB  1 
ATOM   7439  C  CG1 . ILE F  2 63  ? 74.367  -117.311 -66.803  1.00 35.84  ? 62   ILE F CG1 1 
ATOM   7440  C  CG2 . ILE F  2 63  ? 72.683  -116.776 -68.526  1.00 34.09  ? 62   ILE F CG2 1 
ATOM   7441  C  CD1 . ILE F  2 63  ? 73.607  -118.456 -66.152  1.00 35.07  ? 62   ILE F CD1 1 
ATOM   7442  N  N   . LYS F  2 64  ? 72.696  -113.225 -67.729  1.00 28.84  ? 63   LYS F N   1 
ATOM   7443  C  CA  . LYS F  2 64  ? 71.848  -112.170 -68.257  1.00 28.21  ? 63   LYS F CA  1 
ATOM   7444  C  C   . LYS F  2 64  ? 72.653  -111.109 -68.981  1.00 30.11  ? 63   LYS F C   1 
ATOM   7445  O  O   . LYS F  2 64  ? 72.222  -110.590 -70.001  1.00 32.60  ? 63   LYS F O   1 
ATOM   7446  C  CB  . LYS F  2 64  ? 71.036  -111.536 -67.137  1.00 24.64  ? 63   LYS F CB  1 
ATOM   7447  C  CG  . LYS F  2 64  ? 70.023  -112.493 -66.572  1.00 23.98  ? 63   LYS F CG  1 
ATOM   7448  C  CD  . LYS F  2 64  ? 69.021  -111.836 -65.656  1.00 21.29  ? 63   LYS F CD  1 
ATOM   7449  C  CE  . LYS F  2 64  ? 67.831  -112.758 -65.514  1.00 22.03  ? 63   LYS F CE  1 
ATOM   7450  N  NZ  . LYS F  2 64  ? 66.877  -112.329 -64.479  1.00 23.88  ? 63   LYS F NZ  1 
ATOM   7451  N  N   . PHE F  2 65  ? 73.825  -110.784 -68.458  1.00 30.96  ? 64   PHE F N   1 
ATOM   7452  C  CA  . PHE F  2 65  ? 74.678  -109.788 -69.090  1.00 31.33  ? 64   PHE F CA  1 
ATOM   7453  C  C   . PHE F  2 65  ? 75.074  -110.304 -70.462  1.00 31.31  ? 64   PHE F C   1 
ATOM   7454  O  O   . PHE F  2 65  ? 75.036  -109.576 -71.440  1.00 32.09  ? 64   PHE F O   1 
ATOM   7455  C  CB  . PHE F  2 65  ? 75.919  -109.563 -68.231  1.00 32.69  ? 64   PHE F CB  1 
ATOM   7456  C  CG  . PHE F  2 65  ? 76.835  -108.478 -68.726  1.00 32.78  ? 64   PHE F CG  1 
ATOM   7457  C  CD1 . PHE F  2 65  ? 76.980  -107.298 -68.004  1.00 32.68  ? 64   PHE F CD1 1 
ATOM   7458  C  CD2 . PHE F  2 65  ? 77.621  -108.669 -69.857  1.00 33.43  ? 64   PHE F CD2 1 
ATOM   7459  C  CE1 . PHE F  2 65  ? 77.903  -106.327 -68.396  1.00 33.52  ? 64   PHE F CE1 1 
ATOM   7460  C  CE2 . PHE F  2 65  ? 78.550  -107.698 -70.259  1.00 33.41  ? 64   PHE F CE2 1 
ATOM   7461  C  CZ  . PHE F  2 65  ? 78.690  -106.529 -69.524  1.00 32.77  ? 64   PHE F CZ  1 
ATOM   7462  N  N   . ARG F  2 66  ? 75.443  -111.573 -70.544  1.00 32.93  ? 65   ARG F N   1 
ATOM   7463  C  CA  . ARG F  2 66  ? 75.847  -112.121 -71.830  1.00 33.34  ? 65   ARG F CA  1 
ATOM   7464  C  C   . ARG F  2 66  ? 74.680  -112.245 -72.805  1.00 32.77  ? 65   ARG F C   1 
ATOM   7465  O  O   . ARG F  2 66  ? 74.875  -112.122 -74.020  1.00 32.73  ? 65   ARG F O   1 
ATOM   7466  C  CB  . ARG F  2 66  ? 76.530  -113.483 -71.655  1.00 35.32  ? 65   ARG F CB  1 
ATOM   7467  C  CG  . ARG F  2 66  ? 77.839  -113.461 -70.866  1.00 36.33  ? 65   ARG F CG  1 
ATOM   7468  C  CD  . ARG F  2 66  ? 78.786  -114.525 -71.399  1.00 38.17  ? 65   ARG F CD  1 
ATOM   7469  N  NE  . ARG F  2 66  ? 79.718  -115.019 -70.392  1.00 40.62  ? 65   ARG F NE  1 
ATOM   7470  C  CZ  . ARG F  2 66  ? 79.368  -115.793 -69.367  1.00 42.11  ? 65   ARG F CZ  1 
ATOM   7471  N  NH1 . ARG F  2 66  ? 78.103  -116.166 -69.208  1.00 42.18  ? 65   ARG F NH1 1 
ATOM   7472  N  NH2 . ARG F  2 66  ? 80.285  -116.205 -68.505  1.00 42.48  ? 65   ARG F NH2 1 
ATOM   7473  N  N   . HIS F  2 67  ? 73.473  -112.482 -72.286  1.00 31.84  ? 66   HIS F N   1 
ATOM   7474  C  CA  . HIS F  2 67  ? 72.307  -112.603 -73.158  1.00 32.38  ? 66   HIS F CA  1 
ATOM   7475  C  C   . HIS F  2 67  ? 71.990  -111.259 -73.831  1.00 31.97  ? 66   HIS F C   1 
ATOM   7476  O  O   . HIS F  2 67  ? 71.597  -111.226 -75.000  1.00 30.51  ? 66   HIS F O   1 
ATOM   7477  C  CB  . HIS F  2 67  ? 71.085  -113.120 -72.389  1.00 33.24  ? 66   HIS F CB  1 
ATOM   7478  C  CG  . HIS F  2 67  ? 69.951  -113.538 -73.282  1.00 36.01  ? 66   HIS F CG  1 
ATOM   7479  N  ND1 . HIS F  2 67  ? 70.080  -114.527 -74.238  1.00 36.40  ? 66   HIS F ND1 1 
ATOM   7480  C  CD2 . HIS F  2 67  ? 68.677  -113.086 -73.381  1.00 33.72  ? 66   HIS F CD2 1 
ATOM   7481  C  CE1 . HIS F  2 67  ? 68.936  -114.664 -74.884  1.00 35.33  ? 66   HIS F CE1 1 
ATOM   7482  N  NE2 . HIS F  2 67  ? 68.069  -113.802 -74.383  1.00 34.31  ? 66   HIS F NE2 1 
ATOM   7483  N  N   . CYS F  2 68  ? 72.178  -110.160 -73.094  1.00 30.63  ? 67   CYS F N   1 
ATOM   7484  C  CA  . CYS F  2 68  ? 71.967  -108.821 -73.627  1.00 28.61  ? 67   CYS F CA  1 
ATOM   7485  C  C   . CYS F  2 68  ? 72.923  -108.616 -74.765  1.00 27.87  ? 67   CYS F C   1 
ATOM   7486  O  O   . CYS F  2 68  ? 72.560  -108.087 -75.795  1.00 29.30  ? 67   CYS F O   1 
ATOM   7487  C  CB  . CYS F  2 68  ? 72.266  -107.763 -72.586  1.00 28.84  ? 67   CYS F CB  1 
ATOM   7488  S  SG  . CYS F  2 68  ? 71.004  -107.591 -71.346  1.00 39.64  ? 67   CYS F SG  1 
ATOM   7489  N  N   . SER F  2 69  ? 74.164  -109.028 -74.565  1.00 28.58  ? 68   SER F N   1 
ATOM   7490  C  CA  . SER F  2 69  ? 75.180  -108.884 -75.597  1.00 30.09  ? 68   SER F CA  1 
ATOM   7491  C  C   . SER F  2 69  ? 74.783  -109.633 -76.847  1.00 30.46  ? 68   SER F C   1 
ATOM   7492  O  O   . SER F  2 69  ? 74.881  -109.097 -77.954  1.00 29.53  ? 68   SER F O   1 
ATOM   7493  C  CB  . SER F  2 69  ? 76.525  -109.400 -75.096  1.00 30.08  ? 68   SER F CB  1 
ATOM   7494  O  OG  . SER F  2 69  ? 76.947  -108.616 -74.002  1.00 31.77  ? 68   SER F OG  1 
ATOM   7495  N  N   . LEU F  2 70  ? 74.344  -110.881 -76.669  1.00 30.99  ? 69   LEU F N   1 
ATOM   7496  C  CA  . LEU F  2 70  ? 73.916  -111.690 -77.805  1.00 28.41  ? 69   LEU F CA  1 
ATOM   7497  C  C   . LEU F  2 70  ? 72.834  -110.939 -78.553  1.00 25.24  ? 69   LEU F C   1 
ATOM   7498  O  O   . LEU F  2 70  ? 72.947  -110.746 -79.759  1.00 26.59  ? 69   LEU F O   1 
ATOM   7499  C  CB  . LEU F  2 70  ? 73.397  -113.053 -77.343  1.00 29.30  ? 69   LEU F CB  1 
ATOM   7500  C  CG  . LEU F  2 70  ? 74.498  -114.059 -76.989  1.00 30.06  ? 69   LEU F CG  1 
ATOM   7501  C  CD1 . LEU F  2 70  ? 73.906  -115.194 -76.162  1.00 31.91  ? 69   LEU F CD1 1 
ATOM   7502  C  CD2 . LEU F  2 70  ? 75.160  -114.582 -78.246  1.00 25.27  ? 69   LEU F CD2 1 
ATOM   7503  N  N   . LEU F  2 71  ? 71.809  -110.485 -77.835  1.00 21.92  ? 70   LEU F N   1 
ATOM   7504  C  CA  . LEU F  2 71  ? 70.717  -109.749 -78.461  1.00 20.52  ? 70   LEU F CA  1 
ATOM   7505  C  C   . LEU F  2 71  ? 71.191  -108.460 -79.119  1.00 22.87  ? 70   LEU F C   1 
ATOM   7506  O  O   . LEU F  2 71  ? 70.627  -108.058 -80.133  1.00 27.03  ? 70   LEU F O   1 
ATOM   7507  C  CB  . LEU F  2 71  ? 69.603  -109.445 -77.456  1.00 14.15  ? 70   LEU F CB  1 
ATOM   7508  C  CG  . LEU F  2 71  ? 68.896  -110.654 -76.806  1.00 15.68  ? 70   LEU F CG  1 
ATOM   7509  C  CD1 . LEU F  2 71  ? 67.669  -110.192 -76.029  1.00 10.01  ? 70   LEU F CD1 1 
ATOM   7510  C  CD2 . LEU F  2 71  ? 68.497  -111.675 -77.857  1.00 9.40   ? 70   LEU F CD2 1 
ATOM   7511  N  N   . ARG F  2 72  ? 72.229  -107.823 -78.578  1.00 22.35  ? 71   ARG F N   1 
ATOM   7512  C  CA  . ARG F  2 72  ? 72.746  -106.591 -79.163  1.00 23.30  ? 71   ARG F CA  1 
ATOM   7513  C  C   . ARG F  2 72  ? 73.366  -106.903 -80.507  1.00 26.81  ? 71   ARG F C   1 
ATOM   7514  O  O   . ARG F  2 72  ? 73.023  -106.294 -81.528  1.00 28.66  ? 71   ARG F O   1 
ATOM   7515  C  CB  . ARG F  2 72  ? 73.819  -105.966 -78.277  1.00 22.79  ? 71   ARG F CB  1 
ATOM   7516  C  CG  . ARG F  2 72  ? 73.534  -104.536 -77.847  1.00 20.66  ? 71   ARG F CG  1 
ATOM   7517  C  CD  . ARG F  2 72  ? 73.751  -103.501 -78.935  1.00 21.63  ? 71   ARG F CD  1 
ATOM   7518  N  NE  . ARG F  2 72  ? 72.803  -102.394 -78.780  1.00 25.58  ? 71   ARG F NE  1 
ATOM   7519  C  CZ  . ARG F  2 72  ? 73.036  -101.122 -79.112  1.00 26.43  ? 71   ARG F CZ  1 
ATOM   7520  N  NH1 . ARG F  2 72  ? 74.211  -100.763 -79.626  1.00 24.73  ? 71   ARG F NH1 1 
ATOM   7521  N  NH2 . ARG F  2 72  ? 72.084  -100.204 -78.931  1.00 24.19  ? 71   ARG F NH2 1 
ATOM   7522  N  N   . ASN F  2 73  ? 74.291  -107.852 -80.505  1.00 28.60  ? 72   ASN F N   1 
ATOM   7523  C  CA  . ASN F  2 73  ? 74.956  -108.242 -81.734  1.00 31.38  ? 72   ASN F CA  1 
ATOM   7524  C  C   . ASN F  2 73  ? 73.960  -108.605 -82.812  1.00 31.77  ? 72   ASN F C   1 
ATOM   7525  O  O   . ASN F  2 73  ? 74.187  -108.311 -83.994  1.00 31.37  ? 72   ASN F O   1 
ATOM   7526  C  CB  . ASN F  2 73  ? 75.898  -109.415 -81.487  1.00 32.62  ? 72   ASN F CB  1 
ATOM   7527  C  CG  . ASN F  2 73  ? 77.109  -109.007 -80.724  1.00 34.59  ? 72   ASN F CG  1 
ATOM   7528  O  OD1 . ASN F  2 73  ? 78.005  -108.345 -81.257  1.00 38.67  ? 72   ASN F OD1 1 
ATOM   7529  N  ND2 . ASN F  2 73  ? 77.142  -109.367 -79.453  1.00 35.78  ? 72   ASN F ND2 1 
ATOM   7530  N  N   . ARG F  2 74  ? 72.865  -109.252 -82.416  1.00 31.51  ? 73   ARG F N   1 
ATOM   7531  C  CA  . ARG F  2 74  ? 71.863  -109.616 -83.393  1.00 32.68  ? 73   ARG F CA  1 
ATOM   7532  C  C   . ARG F  2 74  ? 71.218  -108.366 -83.953  1.00 33.27  ? 73   ARG F C   1 
ATOM   7533  O  O   . ARG F  2 74  ? 71.135  -108.203 -85.166  1.00 33.58  ? 73   ARG F O   1 
ATOM   7534  C  CB  . ARG F  2 74  ? 70.775  -110.487 -82.798  1.00 34.40  ? 73   ARG F CB  1 
ATOM   7535  C  CG  . ARG F  2 74  ? 69.926  -111.105 -83.897  1.00 36.42  ? 73   ARG F CG  1 
ATOM   7536  C  CD  . ARG F  2 74  ? 68.890  -112.028 -83.346  1.00 39.27  ? 73   ARG F CD  1 
ATOM   7537  N  NE  . ARG F  2 74  ? 67.747  -111.280 -82.873  1.00 44.93  ? 73   ARG F NE  1 
ATOM   7538  C  CZ  . ARG F  2 74  ? 66.627  -111.847 -82.460  1.00 49.88  ? 73   ARG F CZ  1 
ATOM   7539  N  NH1 . ARG F  2 74  ? 65.611  -111.096 -82.047  1.00 51.90  ? 73   ARG F NH1 1 
ATOM   7540  N  NH2 . ARG F  2 74  ? 66.532  -113.171 -82.459  1.00 52.27  ? 73   ARG F NH2 1 
ATOM   7541  N  N   . ARG F  2 75  ? 70.759  -107.479 -83.076  1.00 32.03  ? 74   ARG F N   1 
ATOM   7542  C  CA  . ARG F  2 75  ? 70.125  -106.257 -83.537  1.00 31.71  ? 74   ARG F CA  1 
ATOM   7543  C  C   . ARG F  2 75  ? 71.007  -105.470 -84.503  1.00 32.49  ? 74   ARG F C   1 
ATOM   7544  O  O   . ARG F  2 75  ? 70.542  -105.010 -85.539  1.00 32.92  ? 74   ARG F O   1 
ATOM   7545  C  CB  . ARG F  2 75  ? 69.773  -105.372 -82.363  1.00 30.82  ? 74   ARG F CB  1 
ATOM   7546  C  CG  . ARG F  2 75  ? 69.018  -104.146 -82.776  1.00 29.70  ? 74   ARG F CG  1 
ATOM   7547  C  CD  . ARG F  2 75  ? 68.868  -103.187 -81.618  1.00 29.91  ? 74   ARG F CD  1 
ATOM   7548  N  NE  . ARG F  2 75  ? 68.170  -101.992 -82.053  1.00 30.77  ? 74   ARG F NE  1 
ATOM   7549  C  CZ  . ARG F  2 75  ? 68.074  -100.881 -81.341  1.00 33.22  ? 74   ARG F CZ  1 
ATOM   7550  N  NH1 . ARG F  2 75  ? 68.639  -100.806 -80.146  1.00 32.96  ? 74   ARG F NH1 1 
ATOM   7551  N  NH2 . ARG F  2 75  ? 67.409  -99.844  -81.833  1.00 35.28  ? 74   ARG F NH2 1 
ATOM   7552  N  N   . CYS F  2 76  ? 72.284  -105.323 -84.165  1.00 32.95  ? 75   CYS F N   1 
ATOM   7553  C  CA  . CYS F  2 76  ? 73.215  -104.578 -85.009  1.00 31.33  ? 75   CYS F CA  1 
ATOM   7554  C  C   . CYS F  2 76  ? 73.428  -105.236 -86.350  1.00 30.51  ? 75   CYS F C   1 
ATOM   7555  O  O   . CYS F  2 76  ? 73.376  -104.587 -87.382  1.00 30.65  ? 75   CYS F O   1 
ATOM   7556  C  CB  . CYS F  2 76  ? 74.563  -104.414 -84.300  1.00 31.02  ? 75   CYS F CB  1 
ATOM   7557  S  SG  . CYS F  2 76  ? 74.473  -103.360 -82.838  1.00 29.65  ? 75   CYS F SG  1 
ATOM   7558  N  N   . THR F  2 77  ? 73.672  -106.535 -86.330  1.00 31.03  ? 76   THR F N   1 
ATOM   7559  C  CA  . THR F  2 77  ? 73.899  -107.270 -87.557  1.00 31.05  ? 76   THR F CA  1 
ATOM   7560  C  C   . THR F  2 77  ? 72.675  -107.209 -88.490  1.00 30.76  ? 76   THR F C   1 
ATOM   7561  O  O   . THR F  2 77  ? 72.823  -107.044 -89.710  1.00 32.49  ? 76   THR F O   1 
ATOM   7562  C  CB  . THR F  2 77  ? 74.278  -108.729 -87.241  1.00 31.36  ? 76   THR F CB  1 
ATOM   7563  O  OG1 . THR F  2 77  ? 74.519  -109.430 -88.459  1.00 35.69  ? 76   THR F OG1 1 
ATOM   7564  C  CG2 . THR F  2 77  ? 73.169  -109.429 -86.508  1.00 35.20  ? 76   THR F CG2 1 
ATOM   7565  N  N   . VAL F  2 78  ? 71.471  -107.320 -87.930  1.00 27.01  ? 77   VAL F N   1 
ATOM   7566  C  CA  . VAL F  2 78  ? 70.268  -107.253 -88.743  1.00 24.31  ? 77   VAL F CA  1 
ATOM   7567  C  C   . VAL F  2 78  ? 70.079  -105.852 -89.343  1.00 24.74  ? 77   VAL F C   1 
ATOM   7568  O  O   . VAL F  2 78  ? 69.774  -105.721 -90.528  1.00 25.47  ? 77   VAL F O   1 
ATOM   7569  C  CB  . VAL F  2 78  ? 69.020  -107.647 -87.929  1.00 24.21  ? 77   VAL F CB  1 
ATOM   7570  C  CG1 . VAL F  2 78  ? 67.758  -107.366 -88.725  1.00 23.85  ? 77   VAL F CG1 1 
ATOM   7571  C  CG2 . VAL F  2 78  ? 69.077  -109.125 -87.590  1.00 23.95  ? 77   VAL F CG2 1 
ATOM   7572  N  N   . ALA F  2 79  ? 70.269  -104.804 -88.541  1.00 23.00  ? 78   ALA F N   1 
ATOM   7573  C  CA  . ALA F  2 79  ? 70.126  -103.434 -89.037  1.00 19.87  ? 78   ALA F CA  1 
ATOM   7574  C  C   . ALA F  2 79  ? 71.224  -103.094 -90.046  1.00 19.56  ? 78   ALA F C   1 
ATOM   7575  O  O   . ALA F  2 79  ? 71.009  -102.336 -90.989  1.00 19.37  ? 78   ALA F O   1 
ATOM   7576  C  CB  . ALA F  2 79  ? 70.159  -102.469 -87.901  1.00 18.50  ? 78   ALA F CB  1 
ATOM   7577  N  N   . TYR F  2 80  ? 72.411  -103.646 -89.853  1.00 20.18  ? 79   TYR F N   1 
ATOM   7578  C  CA  . TYR F  2 80  ? 73.490  -103.390 -90.794  1.00 21.87  ? 79   TYR F CA  1 
ATOM   7579  C  C   . TYR F  2 80  ? 73.047  -103.991 -92.117  1.00 24.37  ? 79   TYR F C   1 
ATOM   7580  O  O   . TYR F  2 80  ? 73.163  -103.367 -93.168  1.00 27.14  ? 79   TYR F O   1 
ATOM   7581  C  CB  . TYR F  2 80  ? 74.777  -104.067 -90.335  1.00 20.51  ? 79   TYR F CB  1 
ATOM   7582  C  CG  . TYR F  2 80  ? 75.890  -104.057 -91.360  1.00 18.90  ? 79   TYR F CG  1 
ATOM   7583  C  CD1 . TYR F  2 80  ? 76.553  -102.877 -91.676  1.00 19.41  ? 79   TYR F CD1 1 
ATOM   7584  C  CD2 . TYR F  2 80  ? 76.280  -105.229 -92.016  1.00 16.92  ? 79   TYR F CD2 1 
ATOM   7585  C  CE1 . TYR F  2 80  ? 77.575  -102.853 -92.619  1.00 19.87  ? 79   TYR F CE1 1 
ATOM   7586  C  CE2 . TYR F  2 80  ? 77.310  -105.218 -92.966  1.00 17.51  ? 79   TYR F CE2 1 
ATOM   7587  C  CZ  . TYR F  2 80  ? 77.952  -104.018 -93.266  1.00 19.55  ? 79   TYR F CZ  1 
ATOM   7588  O  OH  . TYR F  2 80  ? 78.946  -103.949 -94.240  1.00 21.32  ? 79   TYR F OH  1 
ATOM   7589  N  N   . LEU F  2 81  ? 72.520  -105.208 -92.056  1.00 25.48  ? 80   LEU F N   1 
ATOM   7590  C  CA  . LEU F  2 81  ? 72.056  -105.896 -93.256  1.00 26.00  ? 80   LEU F CA  1 
ATOM   7591  C  C   . LEU F  2 81  ? 70.822  -105.238 -93.895  1.00 25.74  ? 80   LEU F C   1 
ATOM   7592  O  O   . LEU F  2 81  ? 70.792  -104.988 -95.096  1.00 25.45  ? 80   LEU F O   1 
ATOM   7593  C  CB  . LEU F  2 81  ? 71.774  -107.365 -92.919  1.00 24.61  ? 80   LEU F CB  1 
ATOM   7594  C  CG  . LEU F  2 81  ? 73.047  -108.155 -92.583  1.00 23.67  ? 80   LEU F CG  1 
ATOM   7595  C  CD1 . LEU F  2 81  ? 72.714  -109.532 -92.019  1.00 22.67  ? 80   LEU F CD1 1 
ATOM   7596  C  CD2 . LEU F  2 81  ? 73.898  -108.266 -93.842  1.00 21.28  ? 80   LEU F CD2 1 
ATOM   7597  N  N   . TYR F  2 82  ? 69.808  -104.942 -93.097  1.00 25.18  ? 81   TYR F N   1 
ATOM   7598  C  CA  . TYR F  2 82  ? 68.615  -104.327 -93.640  1.00 26.83  ? 81   TYR F CA  1 
ATOM   7599  C  C   . TYR F  2 82  ? 68.856  -102.934 -94.221  1.00 28.98  ? 81   TYR F C   1 
ATOM   7600  O  O   . TYR F  2 82  ? 68.109  -102.486 -95.088  1.00 32.48  ? 81   TYR F O   1 
ATOM   7601  C  CB  . TYR F  2 82  ? 67.537  -104.241 -92.578  1.00 27.65  ? 81   TYR F CB  1 
ATOM   7602  C  CG  . TYR F  2 82  ? 66.211  -103.803 -93.133  1.00 29.97  ? 81   TYR F CG  1 
ATOM   7603  C  CD1 . TYR F  2 82  ? 65.446  -104.660 -93.917  1.00 30.01  ? 81   TYR F CD1 1 
ATOM   7604  C  CD2 . TYR F  2 82  ? 65.738  -102.521 -92.909  1.00 31.26  ? 81   TYR F CD2 1 
ATOM   7605  C  CE1 . TYR F  2 82  ? 64.241  -104.245 -94.466  1.00 31.15  ? 81   TYR F CE1 1 
ATOM   7606  C  CE2 . TYR F  2 82  ? 64.541  -102.096 -93.452  1.00 32.61  ? 81   TYR F CE2 1 
ATOM   7607  C  CZ  . TYR F  2 82  ? 63.793  -102.961 -94.232  1.00 31.78  ? 81   TYR F CZ  1 
ATOM   7608  O  OH  . TYR F  2 82  ? 62.603  -102.526 -94.770  1.00 30.76  ? 81   TYR F OH  1 
ATOM   7609  N  N   . ASP F  2 83  ? 69.888  -102.241 -93.756  1.00 28.01  ? 82   ASP F N   1 
ATOM   7610  C  CA  . ASP F  2 83  ? 70.167  -100.916 -94.274  1.00 26.21  ? 82   ASP F CA  1 
ATOM   7611  C  C   . ASP F  2 83  ? 70.857  -101.015 -95.634  1.00 26.77  ? 82   ASP F C   1 
ATOM   7612  O  O   . ASP F  2 83  ? 70.575  -100.229 -96.543  1.00 28.27  ? 82   ASP F O   1 
ATOM   7613  C  CB  . ASP F  2 83  ? 71.044  -100.130 -93.300  1.00 26.68  ? 82   ASP F CB  1 
ATOM   7614  C  CG  . ASP F  2 83  ? 71.063  -98.644  -93.613  1.00 27.89  ? 82   ASP F CG  1 
ATOM   7615  O  OD1 . ASP F  2 83  ? 70.106  -97.944  -93.197  1.00 28.86  ? 82   ASP F OD1 1 
ATOM   7616  O  OD2 . ASP F  2 83  ? 72.018  -98.182  -94.288  1.00 26.27  ? 82   ASP F OD2 1 
ATOM   7617  N  N   . ARG F  2 84  ? 71.763  -101.973 -95.781  1.00 25.07  ? 83   ARG F N   1 
ATOM   7618  C  CA  . ARG F  2 84  ? 72.444  -102.137 -97.054  1.00 26.04  ? 83   ARG F CA  1 
ATOM   7619  C  C   . ARG F  2 84  ? 71.432  -102.506 -98.129  1.00 26.35  ? 83   ARG F C   1 
ATOM   7620  O  O   . ARG F  2 84  ? 71.526  -102.059 -99.267  1.00 27.55  ? 83   ARG F O   1 
ATOM   7621  C  CB  . ARG F  2 84  ? 73.495  -103.239 -96.978  1.00 27.59  ? 83   ARG F CB  1 
ATOM   7622  C  CG  . ARG F  2 84  ? 74.547  -103.037 -95.919  1.00 26.89  ? 83   ARG F CG  1 
ATOM   7623  C  CD  . ARG F  2 84  ? 75.679  -103.979 -96.149  1.00 23.01  ? 83   ARG F CD  1 
ATOM   7624  N  NE  . ARG F  2 84  ? 76.799  -103.290 -96.763  1.00 27.99  ? 83   ARG F NE  1 
ATOM   7625  C  CZ  . ARG F  2 84  ? 77.182  -103.429 -98.026  1.00 31.31  ? 83   ARG F CZ  1 
ATOM   7626  N  NH1 . ARG F  2 84  ? 76.534  -104.237 -98.844  1.00 34.09  ? 83   ARG F NH1 1 
ATOM   7627  N  NH2 . ARG F  2 84  ? 78.242  -102.774 -98.465  1.00 34.40  ? 83   ARG F NH2 1 
ATOM   7628  N  N   . LEU F  2 85  ? 70.471  -103.348 -97.770  1.00 26.45  ? 84   LEU F N   1 
ATOM   7629  C  CA  . LEU F  2 85  ? 69.452  -103.731 -98.720  1.00 24.81  ? 84   LEU F CA  1 
ATOM   7630  C  C   . LEU F  2 85  ? 68.774  -102.444 -99.148  1.00 25.35  ? 84   LEU F C   1 
ATOM   7631  O  O   . LEU F  2 85  ? 68.612  -102.195 -100.346 1.00 26.00  ? 84   LEU F O   1 
ATOM   7632  C  CB  . LEU F  2 85  ? 68.438  -104.690 -98.088  1.00 23.08  ? 84   LEU F CB  1 
ATOM   7633  C  CG  . LEU F  2 85  ? 68.918  -106.126 -97.811  1.00 22.75  ? 84   LEU F CG  1 
ATOM   7634  C  CD1 . LEU F  2 85  ? 67.716  -106.948 -97.374  1.00 17.86  ? 84   LEU F CD1 1 
ATOM   7635  C  CD2 . LEU F  2 85  ? 69.585  -106.752 -99.052  1.00 16.32  ? 84   LEU F CD2 1 
ATOM   7636  N  N   . LEU F  2 86  ? 68.407  -101.615 -98.169  1.00 23.08  ? 85   LEU F N   1 
ATOM   7637  C  CA  . LEU F  2 86  ? 67.765  -100.335 -98.455  1.00 21.74  ? 85   LEU F CA  1 
ATOM   7638  C  C   . LEU F  2 86  ? 68.568  -99.458  -99.412  1.00 22.23  ? 85   LEU F C   1 
ATOM   7639  O  O   . LEU F  2 86  ? 67.999  -98.825  -100.304 1.00 20.83  ? 85   LEU F O   1 
ATOM   7640  C  CB  . LEU F  2 86  ? 67.537  -99.544  -97.176  1.00 21.41  ? 85   LEU F CB  1 
ATOM   7641  C  CG  . LEU F  2 86  ? 66.461  -100.044 -96.240  1.00 20.02  ? 85   LEU F CG  1 
ATOM   7642  C  CD1 . LEU F  2 86  ? 66.356  -99.130  -95.033  1.00 15.93  ? 85   LEU F CD1 1 
ATOM   7643  C  CD2 . LEU F  2 86  ? 65.173  -100.091 -97.003  1.00 21.45  ? 85   LEU F CD2 1 
ATOM   7644  N  N   . ARG F  2 87  ? 69.881  -99.390  -99.220  1.00 22.35  ? 86   ARG F N   1 
ATOM   7645  C  CA  . ARG F  2 87  ? 70.690  -98.562  -100.109 1.00 23.73  ? 86   ARG F CA  1 
ATOM   7646  C  C   . ARG F  2 87  ? 70.718  -99.184  -101.496 1.00 23.47  ? 86   ARG F C   1 
ATOM   7647  O  O   . ARG F  2 87  ? 70.618  -98.487  -102.496 1.00 23.03  ? 86   ARG F O   1 
ATOM   7648  C  CB  . ARG F  2 87  ? 72.118  -98.398  -99.565  1.00 23.60  ? 86   ARG F CB  1 
ATOM   7649  C  CG  . ARG F  2 87  ? 72.214  -97.437  -98.394  1.00 25.06  ? 86   ARG F CG  1 
ATOM   7650  C  CD  . ARG F  2 87  ? 73.550  -97.514  -97.665  1.00 26.29  ? 86   ARG F CD  1 
ATOM   7651  N  NE  . ARG F  2 87  ? 73.436  -96.960  -96.315  1.00 28.47  ? 86   ARG F NE  1 
ATOM   7652  C  CZ  . ARG F  2 87  ? 74.069  -95.872  -95.881  1.00 28.88  ? 86   ARG F CZ  1 
ATOM   7653  N  NH1 . ARG F  2 87  ? 74.885  -95.199  -96.681  1.00 25.73  ? 86   ARG F NH1 1 
ATOM   7654  N  NH2 . ARG F  2 87  ? 73.859  -95.440  -94.643  1.00 30.85  ? 86   ARG F NH2 1 
ATOM   7655  N  N   . ILE F  2 88  ? 70.846  -100.503 -101.545 1.00 24.89  ? 87   ILE F N   1 
ATOM   7656  C  CA  . ILE F  2 88  ? 70.879  -101.221 -102.811 1.00 26.25  ? 87   ILE F CA  1 
ATOM   7657  C  C   . ILE F  2 88  ? 69.566  -101.068 -103.583 1.00 27.04  ? 87   ILE F C   1 
ATOM   7658  O  O   . ILE F  2 88  ? 69.572  -100.748 -104.766 1.00 26.38  ? 87   ILE F O   1 
ATOM   7659  C  CB  . ILE F  2 88  ? 71.186  -102.705 -102.576 1.00 24.23  ? 87   ILE F CB  1 
ATOM   7660  C  CG1 . ILE F  2 88  ? 72.625  -102.838 -102.058 1.00 24.25  ? 87   ILE F CG1 1 
ATOM   7661  C  CG2 . ILE F  2 88  ? 70.988  -103.481 -103.850 1.00 20.77  ? 87   ILE F CG2 1 
ATOM   7662  C  CD1 . ILE F  2 88  ? 72.968  -104.175 -101.470 1.00 22.13  ? 87   ILE F CD1 1 
ATOM   7663  N  N   . ARG F  2 89  ? 68.445  -101.289 -102.914 1.00 27.84  ? 88   ARG F N   1 
ATOM   7664  C  CA  . ARG F  2 89  ? 67.148  -101.141 -103.555 1.00 31.06  ? 88   ARG F CA  1 
ATOM   7665  C  C   . ARG F  2 89  ? 67.118  -99.804  -104.282 1.00 33.94  ? 88   ARG F C   1 
ATOM   7666  O  O   . ARG F  2 89  ? 66.701  -99.719  -105.434 1.00 36.33  ? 88   ARG F O   1 
ATOM   7667  C  CB  . ARG F  2 89  ? 66.045  -101.178 -102.497 1.00 31.80  ? 88   ARG F CB  1 
ATOM   7668  C  CG  . ARG F  2 89  ? 64.640  -100.894 -102.999 1.00 35.90  ? 88   ARG F CG  1 
ATOM   7669  C  CD  . ARG F  2 89  ? 64.321  -99.406  -103.110 1.00 39.30  ? 88   ARG F CD  1 
ATOM   7670  N  NE  . ARG F  2 89  ? 62.904  -99.173  -103.408 1.00 43.11  ? 88   ARG F NE  1 
ATOM   7671  C  CZ  . ARG F  2 89  ? 62.387  -97.981  -103.702 1.00 45.16  ? 88   ARG F CZ  1 
ATOM   7672  N  NH1 . ARG F  2 89  ? 63.177  -96.914  -103.740 1.00 47.40  ? 88   ARG F NH1 1 
ATOM   7673  N  NH2 . ARG F  2 89  ? 61.088  -97.845  -103.953 1.00 44.55  ? 88   ARG F NH2 1 
ATOM   7674  N  N   . ALA F  2 90  ? 67.572  -98.759  -103.599 1.00 35.80  ? 89   ALA F N   1 
ATOM   7675  C  CA  . ALA F  2 90  ? 67.593  -97.413  -104.157 1.00 35.76  ? 89   ALA F CA  1 
ATOM   7676  C  C   . ALA F  2 90  ? 68.331  -97.328  -105.485 1.00 35.98  ? 89   ALA F C   1 
ATOM   7677  O  O   . ALA F  2 90  ? 67.921  -96.590  -106.370 1.00 36.61  ? 89   ALA F O   1 
ATOM   7678  C  CB  . ALA F  2 90  ? 68.206  -96.450  -103.153 1.00 35.84  ? 89   ALA F CB  1 
ATOM   7679  N  N   . LEU F  2 91  ? 69.418  -98.076  -105.621 1.00 37.32  ? 90   LEU F N   1 
ATOM   7680  C  CA  . LEU F  2 91  ? 70.196  -98.086  -106.860 1.00 39.51  ? 90   LEU F CA  1 
ATOM   7681  C  C   . LEU F  2 91  ? 69.355  -98.323  -108.119 1.00 40.28  ? 90   LEU F C   1 
ATOM   7682  O  O   . LEU F  2 91  ? 69.554  -97.655  -109.136 1.00 39.09  ? 90   LEU F O   1 
ATOM   7683  C  CB  . LEU F  2 91  ? 71.275  -99.167  -106.787 1.00 41.19  ? 90   LEU F CB  1 
ATOM   7684  C  CG  . LEU F  2 91  ? 72.589  -98.867  -106.071 1.00 42.87  ? 90   LEU F CG  1 
ATOM   7685  C  CD1 . LEU F  2 91  ? 72.355  -97.954  -104.888 1.00 42.65  ? 90   LEU F CD1 1 
ATOM   7686  C  CD2 . LEU F  2 91  ? 73.216  -100.194 -105.645 1.00 43.49  ? 90   LEU F CD2 1 
ATOM   7687  N  N   . ARG F  2 92  ? 68.440  -99.293  -108.044 1.00 42.18  ? 91   ARG F N   1 
ATOM   7688  C  CA  . ARG F  2 92  ? 67.563  -99.652  -109.160 1.00 42.99  ? 91   ARG F CA  1 
ATOM   7689  C  C   . ARG F  2 92  ? 66.913  -98.419  -109.750 1.00 44.26  ? 91   ARG F C   1 
ATOM   7690  O  O   . ARG F  2 92  ? 66.844  -98.251  -110.961 1.00 44.83  ? 91   ARG F O   1 
ATOM   7691  C  CB  . ARG F  2 92  ? 66.466  -100.608 -108.694 1.00 43.66  ? 91   ARG F CB  1 
ATOM   7692  C  CG  . ARG F  2 92  ? 65.512  -101.047 -109.808 1.00 45.24  ? 91   ARG F CG  1 
ATOM   7693  C  CD  . ARG F  2 92  ? 66.284  -101.758 -110.903 1.00 46.70  ? 91   ARG F CD  1 
ATOM   7694  N  NE  . ARG F  2 92  ? 65.440  -102.293 -111.965 1.00 47.71  ? 91   ARG F NE  1 
ATOM   7695  C  CZ  . ARG F  2 92  ? 64.850  -101.567 -112.908 1.00 48.59  ? 91   ARG F CZ  1 
ATOM   7696  N  NH1 . ARG F  2 92  ? 64.106  -102.169 -113.826 1.00 49.14  ? 91   ARG F NH1 1 
ATOM   7697  N  NH2 . ARG F  2 92  ? 65.001  -100.251 -112.943 1.00 48.23  ? 91   ARG F NH2 1 
ATOM   7698  N  N   . TRP F  2 93  ? 66.429  -97.551  -108.882 1.00 45.37  ? 92   TRP F N   1 
ATOM   7699  C  CA  . TRP F  2 93  ? 65.799  -96.341  -109.339 1.00 46.63  ? 92   TRP F CA  1 
ATOM   7700  C  C   . TRP F  2 93  ? 66.811  -95.246  -109.684 1.00 48.92  ? 92   TRP F C   1 
ATOM   7701  O  O   . TRP F  2 93  ? 66.613  -94.511  -110.650 1.00 49.82  ? 92   TRP F O   1 
ATOM   7702  C  CB  . TRP F  2 93  ? 64.806  -95.879  -108.289 1.00 46.15  ? 92   TRP F CB  1 
ATOM   7703  C  CG  . TRP F  2 93  ? 63.793  -96.945  -107.980 1.00 47.24  ? 92   TRP F CG  1 
ATOM   7704  C  CD1 . TRP F  2 93  ? 63.950  -98.014  -107.142 1.00 48.00  ? 92   TRP F CD1 1 
ATOM   7705  C  CD2 . TRP F  2 93  ? 62.475  -97.061  -108.532 1.00 47.00  ? 92   TRP F CD2 1 
ATOM   7706  N  NE1 . TRP F  2 93  ? 62.810  -98.784  -107.135 1.00 47.38  ? 92   TRP F NE1 1 
ATOM   7707  C  CE2 . TRP F  2 93  ? 61.891  -98.221  -107.980 1.00 46.63  ? 92   TRP F CE2 1 
ATOM   7708  C  CE3 . TRP F  2 93  ? 61.733  -96.298  -109.439 1.00 46.49  ? 92   TRP F CE3 1 
ATOM   7709  C  CZ2 . TRP F  2 93  ? 60.601  -98.632  -108.303 1.00 47.58  ? 92   TRP F CZ2 1 
ATOM   7710  C  CZ3 . TRP F  2 93  ? 60.452  -96.707  -109.759 1.00 47.96  ? 92   TRP F CZ3 1 
ATOM   7711  C  CH2 . TRP F  2 93  ? 59.898  -97.864  -109.193 1.00 47.94  ? 92   TRP F CH2 1 
ATOM   7712  N  N   . GLU F  2 94  ? 67.895  -95.118  -108.922 1.00 51.17  ? 93   GLU F N   1 
ATOM   7713  C  CA  . GLU F  2 94  ? 68.866  -94.097  -109.283 1.00 53.72  ? 93   GLU F CA  1 
ATOM   7714  C  C   . GLU F  2 94  ? 69.468  -94.471  -110.626 1.00 53.79  ? 93   GLU F C   1 
ATOM   7715  O  O   . GLU F  2 94  ? 69.191  -93.820  -111.618 1.00 53.77  ? 93   GLU F O   1 
ATOM   7716  C  CB  . GLU F  2 94  ? 69.989  -93.941  -108.254 1.00 56.25  ? 93   GLU F CB  1 
ATOM   7717  C  CG  . GLU F  2 94  ? 71.167  -93.131  -108.829 1.00 60.58  ? 93   GLU F CG  1 
ATOM   7718  C  CD  . GLU F  2 94  ? 72.030  -92.433  -107.779 1.00 64.18  ? 93   GLU F CD  1 
ATOM   7719  O  OE1 . GLU F  2 94  ? 72.505  -93.104  -106.830 1.00 65.34  ? 93   GLU F OE1 1 
ATOM   7720  O  OE2 . GLU F  2 94  ? 72.242  -91.203  -107.916 1.00 65.25  ? 93   GLU F OE2 1 
ATOM   7721  N  N   . TYR F  2 95  ? 70.285  -95.518  -110.667 1.00 54.97  ? 94   TYR F N   1 
ATOM   7722  C  CA  . TYR F  2 95  ? 70.893  -95.940  -111.929 1.00 55.90  ? 94   TYR F CA  1 
ATOM   7723  C  C   . TYR F  2 95  ? 69.874  -96.743  -112.715 1.00 55.91  ? 94   TYR F C   1 
ATOM   7724  O  O   . TYR F  2 95  ? 68.673  -96.534  -112.569 1.00 57.26  ? 94   TYR F O   1 
ATOM   7725  C  CB  . TYR F  2 95  ? 72.147  -96.778  -111.671 1.00 56.69  ? 94   TYR F CB  1 
ATOM   7726  C  CG  . TYR F  2 95  ? 73.136  -96.063  -110.787 1.00 57.82  ? 94   TYR F CG  1 
ATOM   7727  C  CD1 . TYR F  2 95  ? 72.880  -95.899  -109.430 1.00 59.46  ? 94   TYR F CD1 1 
ATOM   7728  C  CD2 . TYR F  2 95  ? 74.291  -95.494  -111.312 1.00 57.82  ? 94   TYR F CD2 1 
ATOM   7729  C  CE1 . TYR F  2 95  ? 73.745  -95.184  -108.615 1.00 61.26  ? 94   TYR F CE1 1 
ATOM   7730  C  CE2 . TYR F  2 95  ? 75.170  -94.769  -110.501 1.00 59.42  ? 94   TYR F CE2 1 
ATOM   7731  C  CZ  . TYR F  2 95  ? 74.887  -94.617  -109.151 1.00 60.51  ? 94   TYR F CZ  1 
ATOM   7732  O  OH  . TYR F  2 95  ? 75.718  -93.888  -108.327 1.00 60.27  ? 94   TYR F OH  1 
ATOM   7733  N  N   . GLY F  2 96  ? 70.335  -97.662  -113.548 1.00 55.20  ? 95   GLY F N   1 
ATOM   7734  C  CA  . GLY F  2 96  ? 69.386  -98.448  -114.308 1.00 55.05  ? 95   GLY F CA  1 
ATOM   7735  C  C   . GLY F  2 96  ? 69.024  -99.786  -113.694 1.00 53.71  ? 95   GLY F C   1 
ATOM   7736  O  O   . GLY F  2 96  ? 68.990  -99.960  -112.481 1.00 53.81  ? 95   GLY F O   1 
ATOM   7737  N  N   . SER F  2 97  ? 68.728  -100.732 -114.571 1.00 54.11  ? 96   SER F N   1 
ATOM   7738  C  CA  . SER F  2 97  ? 68.394  -102.091 -114.190 1.00 53.36  ? 96   SER F CA  1 
ATOM   7739  C  C   . SER F  2 97  ? 69.740  -102.799 -114.261 1.00 52.88  ? 96   SER F C   1 
ATOM   7740  O  O   . SER F  2 97  ? 69.872  -103.987 -113.971 1.00 51.05  ? 96   SER F O   1 
ATOM   7741  C  CB  . SER F  2 97  ? 67.426  -102.679 -115.215 1.00 53.29  ? 96   SER F CB  1 
ATOM   7742  O  OG  . SER F  2 97  ? 67.216  -104.061 -114.997 1.00 57.41  ? 96   SER F OG  1 
ATOM   7743  N  N   . ILE F  2 98  ? 70.741  -102.023 -114.661 1.00 52.74  ? 97   ILE F N   1 
ATOM   7744  C  CA  . ILE F  2 98  ? 72.101  -102.508 -114.810 1.00 52.97  ? 97   ILE F CA  1 
ATOM   7745  C  C   . ILE F  2 98  ? 73.056  -101.594 -114.002 1.00 51.71  ? 97   ILE F C   1 
ATOM   7746  O  O   . ILE F  2 98  ? 73.249  -100.414 -114.323 1.00 51.51  ? 97   ILE F O   1 
ATOM   7747  C  CB  . ILE F  2 98  ? 72.468  -102.548 -116.324 1.00 54.36  ? 97   ILE F CB  1 
ATOM   7748  C  CG1 . ILE F  2 98  ? 73.825  -103.221 -116.528 1.00 55.43  ? 97   ILE F CG1 1 
ATOM   7749  C  CG2 . ILE F  2 98  ? 72.400  -101.147 -116.912 1.00 56.44  ? 97   ILE F CG2 1 
ATOM   7750  C  CD1 . ILE F  2 98  ? 73.794  -104.731 -116.296 1.00 55.86  ? 97   ILE F CD1 1 
ATOM   7751  N  N   . LEU F  2 99  ? 73.633  -102.159 -112.943 1.00 49.15  ? 98   LEU F N   1 
ATOM   7752  C  CA  . LEU F  2 99  ? 74.530  -101.440 -112.042 1.00 46.17  ? 98   LEU F CA  1 
ATOM   7753  C  C   . LEU F  2 99  ? 75.944  -101.199 -112.522 1.00 44.70  ? 98   LEU F C   1 
ATOM   7754  O  O   . LEU F  2 99  ? 76.543  -102.039 -113.179 1.00 45.33  ? 98   LEU F O   1 
ATOM   7755  C  CB  . LEU F  2 99  ? 74.634  -102.179 -110.709 1.00 45.11  ? 98   LEU F CB  1 
ATOM   7756  C  CG  . LEU F  2 99  ? 73.544  -102.043 -109.654 1.00 44.47  ? 98   LEU F CG  1 
ATOM   7757  C  CD1 . LEU F  2 99  ? 72.304  -101.409 -110.238 1.00 45.49  ? 98   LEU F CD1 1 
ATOM   7758  C  CD2 . LEU F  2 99  ? 73.255  -103.422 -109.088 1.00 43.45  ? 98   LEU F CD2 1 
ATOM   7759  N  N   . PRO F  2 100 ? 76.502  -100.037 -112.177 1.00 43.95  ? 99   PRO F N   1 
ATOM   7760  C  CA  . PRO F  2 100 ? 77.872  -99.700  -112.566 1.00 43.41  ? 99   PRO F CA  1 
ATOM   7761  C  C   . PRO F  2 100 ? 78.748  -100.735 -111.860 1.00 44.38  ? 99   PRO F C   1 
ATOM   7762  O  O   . PRO F  2 100 ? 78.438  -101.119 -110.733 1.00 44.87  ? 99   PRO F O   1 
ATOM   7763  C  CB  . PRO F  2 100 ? 78.059  -98.313  -111.967 1.00 42.39  ? 99   PRO F CB  1 
ATOM   7764  C  CG  . PRO F  2 100 ? 76.672  -97.750  -111.954 1.00 41.14  ? 99   PRO F CG  1 
ATOM   7765  C  CD  . PRO F  2 100 ? 75.850  -98.904  -111.494 1.00 42.65  ? 99   PRO F CD  1 
ATOM   7766  N  N   . ASN F  2 101 ? 79.826  -101.199 -112.489 1.00 45.75  ? 100  ASN F N   1 
ATOM   7767  C  CA  . ASN F  2 101 ? 80.664  -102.192 -111.817 1.00 46.91  ? 100  ASN F CA  1 
ATOM   7768  C  C   . ASN F  2 101 ? 81.170  -101.681 -110.464 1.00 47.39  ? 100  ASN F C   1 
ATOM   7769  O  O   . ASN F  2 101 ? 81.428  -102.462 -109.552 1.00 47.32  ? 100  ASN F O   1 
ATOM   7770  C  CB  . ASN F  2 101 ? 81.843  -102.613 -112.703 1.00 47.78  ? 100  ASN F CB  1 
ATOM   7771  C  CG  . ASN F  2 101 ? 81.412  -103.508 -113.854 1.00 49.42  ? 100  ASN F CG  1 
ATOM   7772  O  OD1 . ASN F  2 101 ? 80.559  -104.378 -113.687 1.00 51.01  ? 100  ASN F OD1 1 
ATOM   7773  N  ND2 . ASN F  2 101 ? 82.008  -103.308 -115.022 1.00 48.47  ? 100  ASN F ND2 1 
ATOM   7774  N  N   . ALA F  2 102 ? 81.292  -100.364 -110.330 1.00 48.40  ? 101  ALA F N   1 
ATOM   7775  C  CA  . ALA F  2 102 ? 81.755  -99.768  -109.084 1.00 48.27  ? 101  ALA F CA  1 
ATOM   7776  C  C   . ALA F  2 102 ? 80.919  -100.260 -107.906 1.00 48.60  ? 101  ALA F C   1 
ATOM   7777  O  O   . ALA F  2 102 ? 81.439  -100.917 -107.014 1.00 48.99  ? 101  ALA F O   1 
ATOM   7778  C  CB  . ALA F  2 102 ? 81.695  -98.253  -109.178 1.00 47.74  ? 101  ALA F CB  1 
ATOM   7779  N  N   . LEU F  2 103 ? 79.627  -99.944  -107.910 1.00 49.21  ? 102  LEU F N   1 
ATOM   7780  C  CA  . LEU F  2 103 ? 78.737  -100.367 -106.836 1.00 50.05  ? 102  LEU F CA  1 
ATOM   7781  C  C   . LEU F  2 103 ? 78.545  -101.879 -106.843 1.00 51.60  ? 102  LEU F C   1 
ATOM   7782  O  O   . LEU F  2 103 ? 78.075  -102.468 -105.869 1.00 51.13  ? 102  LEU F O   1 
ATOM   7783  C  CB  . LEU F  2 103 ? 77.366  -99.715  -106.979 1.00 49.50  ? 102  LEU F CB  1 
ATOM   7784  C  CG  . LEU F  2 103 ? 77.286  -98.203  -107.117 1.00 49.72  ? 102  LEU F CG  1 
ATOM   7785  C  CD1 . LEU F  2 103 ? 77.492  -97.838  -108.568 1.00 50.50  ? 102  LEU F CD1 1 
ATOM   7786  C  CD2 . LEU F  2 103 ? 75.919  -97.711  -106.649 1.00 51.26  ? 102  LEU F CD2 1 
ATOM   7787  N  N   . ARG F  2 104 ? 78.894  -102.509 -107.955 1.00 53.43  ? 103  ARG F N   1 
ATOM   7788  C  CA  . ARG F  2 104 ? 78.740  -103.947 -108.068 1.00 54.15  ? 103  ARG F CA  1 
ATOM   7789  C  C   . ARG F  2 104 ? 79.832  -104.621 -107.250 1.00 52.67  ? 103  ARG F C   1 
ATOM   7790  O  O   . ARG F  2 104 ? 79.599  -105.655 -106.631 1.00 53.64  ? 103  ARG F O   1 
ATOM   7791  C  CB  . ARG F  2 104 ? 78.803  -104.356 -109.545 1.00 57.43  ? 103  ARG F CB  1 
ATOM   7792  C  CG  . ARG F  2 104 ? 78.355  -105.781 -109.854 1.00 62.05  ? 103  ARG F CG  1 
ATOM   7793  C  CD  . ARG F  2 104 ? 77.884  -105.913 -111.313 1.00 65.18  ? 103  ARG F CD  1 
ATOM   7794  N  NE  . ARG F  2 104 ? 77.864  -107.307 -111.765 1.00 68.28  ? 103  ARG F NE  1 
ATOM   7795  C  CZ  . ARG F  2 104 ? 78.948  -107.995 -112.125 1.00 69.82  ? 103  ARG F CZ  1 
ATOM   7796  N  NH1 . ARG F  2 104 ? 80.148  -107.423 -112.095 1.00 70.23  ? 103  ARG F NH1 1 
ATOM   7797  N  NH2 . ARG F  2 104 ? 78.840  -109.258 -112.516 1.00 70.25  ? 103  ARG F NH2 1 
ATOM   7798  N  N   . PHE F  2 105 ? 81.014  -104.013 -107.220 1.00 51.77  ? 104  PHE F N   1 
ATOM   7799  C  CA  . PHE F  2 105 ? 82.152  -104.555 -106.469 1.00 50.11  ? 104  PHE F CA  1 
ATOM   7800  C  C   . PHE F  2 105 ? 81.965  -104.547 -104.943 1.00 49.87  ? 104  PHE F C   1 
ATOM   7801  O  O   . PHE F  2 105 ? 82.398  -105.472 -104.254 1.00 50.76  ? 104  PHE F O   1 
ATOM   7802  C  CB  . PHE F  2 105 ? 83.433  -103.775 -106.785 1.00 48.11  ? 104  PHE F CB  1 
ATOM   7803  C  CG  . PHE F  2 105 ? 83.928  -103.927 -108.196 1.00 46.54  ? 104  PHE F CG  1 
ATOM   7804  C  CD1 . PHE F  2 105 ? 83.731  -105.107 -108.904 1.00 46.21  ? 104  PHE F CD1 1 
ATOM   7805  C  CD2 . PHE F  2 105 ? 84.659  -102.901 -108.796 1.00 45.69  ? 104  PHE F CD2 1 
ATOM   7806  C  CE1 . PHE F  2 105 ? 84.259  -105.260 -110.190 1.00 46.16  ? 104  PHE F CE1 1 
ATOM   7807  C  CE2 . PHE F  2 105 ? 85.190  -103.045 -110.074 1.00 44.50  ? 104  PHE F CE2 1 
ATOM   7808  C  CZ  . PHE F  2 105 ? 84.991  -104.224 -110.773 1.00 45.17  ? 104  PHE F CZ  1 
ATOM   7809  N  N   . HIS F  2 106 ? 81.331  -103.503 -104.416 1.00 49.04  ? 105  HIS F N   1 
ATOM   7810  C  CA  . HIS F  2 106 ? 81.129  -103.380 -102.976 1.00 48.74  ? 105  HIS F CA  1 
ATOM   7811  C  C   . HIS F  2 106 ? 79.893  -104.113 -102.468 1.00 47.95  ? 105  HIS F C   1 
ATOM   7812  O  O   . HIS F  2 106 ? 79.461  -103.904 -101.334 1.00 48.88  ? 105  HIS F O   1 
ATOM   7813  C  CB  . HIS F  2 106 ? 81.072  -101.891 -102.571 1.00 49.29  ? 105  HIS F CB  1 
ATOM   7814  C  CG  . HIS F  2 106 ? 82.398  -101.180 -102.649 1.00 49.95  ? 105  HIS F CG  1 
ATOM   7815  N  ND1 . HIS F  2 106 ? 82.524  -99.819  -102.470 1.00 49.18  ? 105  HIS F ND1 1 
ATOM   7816  C  CD2 . HIS F  2 106 ? 83.656  -101.645 -102.863 1.00 50.84  ? 105  HIS F CD2 1 
ATOM   7817  C  CE1 . HIS F  2 106 ? 83.798  -99.477  -102.569 1.00 50.92  ? 105  HIS F CE1 1 
ATOM   7818  N  NE2 . HIS F  2 106 ? 84.508  -100.565 -102.806 1.00 51.09  ? 105  HIS F NE2 1 
HETATM 7819  N  N   . MSE F  2 107 ? 79.336  -104.988 -103.299 1.00 47.88  ? 106  MSE F N   1 
HETATM 7820  C  CA  . MSE F  2 107 ? 78.145  -105.743 -102.920 1.00 47.05  ? 106  MSE F CA  1 
HETATM 7821  C  C   . MSE F  2 107 ? 78.440  -107.202 -102.617 1.00 45.57  ? 106  MSE F C   1 
HETATM 7822  O  O   . MSE F  2 107 ? 79.221  -107.844 -103.311 1.00 45.10  ? 106  MSE F O   1 
HETATM 7823  C  CB  . MSE F  2 107 ? 77.105  -105.661 -104.027 1.00 48.96  ? 106  MSE F CB  1 
HETATM 7824  C  CG  . MSE F  2 107 ? 76.544  -104.269 -104.230 1.00 52.69  ? 106  MSE F CG  1 
HETATM 7825  SE SE  . MSE F  2 107 ? 75.285  -104.191 -105.689 1.00 57.17  ? 106  MSE F SE  1 
HETATM 7826  C  CE  . MSE F  2 107 ? 73.970  -105.412 -104.965 1.00 50.85  ? 106  MSE F CE  1 
ATOM   7827  N  N   . ALA F  2 108 ? 77.816  -107.726 -101.572 1.00 43.78  ? 107  ALA F N   1 
ATOM   7828  C  CA  . ALA F  2 108 ? 78.026  -109.118 -101.212 1.00 43.31  ? 107  ALA F CA  1 
ATOM   7829  C  C   . ALA F  2 108 ? 77.401  -109.962 -102.303 1.00 43.12  ? 107  ALA F C   1 
ATOM   7830  O  O   . ALA F  2 108 ? 76.551  -109.484 -103.049 1.00 43.89  ? 107  ALA F O   1 
ATOM   7831  C  CB  . ALA F  2 108 ? 77.369  -109.419 -99.881  1.00 43.83  ? 107  ALA F CB  1 
ATOM   7832  N  N   . ALA F  2 109 ? 77.810  -111.218 -102.402 1.00 42.45  ? 108  ALA F N   1 
ATOM   7833  C  CA  . ALA F  2 109 ? 77.252  -112.081 -103.430 1.00 40.00  ? 108  ALA F CA  1 
ATOM   7834  C  C   . ALA F  2 109 ? 75.747  -112.170 -103.261 1.00 40.13  ? 108  ALA F C   1 
ATOM   7835  O  O   . ALA F  2 109 ? 75.004  -111.934 -104.211 1.00 39.98  ? 108  ALA F O   1 
ATOM   7836  C  CB  . ALA F  2 109 ? 77.865  -113.467 -103.357 1.00 37.49  ? 108  ALA F CB  1 
ATOM   7837  N  N   . GLU F  2 110 ? 75.296  -112.494 -102.052 1.00 39.35  ? 109  GLU F N   1 
ATOM   7838  C  CA  . GLU F  2 110 ? 73.870  -112.628 -101.799 1.00 39.91  ? 109  GLU F CA  1 
ATOM   7839  C  C   . GLU F  2 110 ? 73.088  -111.342 -101.981 1.00 40.03  ? 109  GLU F C   1 
ATOM   7840  O  O   . GLU F  2 110 ? 71.886  -111.388 -102.219 1.00 39.71  ? 109  GLU F O   1 
ATOM   7841  C  CB  . GLU F  2 110 ? 73.610  -113.194 -100.403 1.00 41.20  ? 109  GLU F CB  1 
ATOM   7842  C  CG  . GLU F  2 110 ? 74.767  -113.052 -99.446  1.00 46.59  ? 109  GLU F CG  1 
ATOM   7843  C  CD  . GLU F  2 110 ? 75.746  -114.210 -99.539  1.00 48.38  ? 109  GLU F CD  1 
ATOM   7844  O  OE1 . GLU F  2 110 ? 75.324  -115.356 -99.251  1.00 48.46  ? 109  GLU F OE1 1 
ATOM   7845  O  OE2 . GLU F  2 110 ? 76.927  -113.973 -99.891  1.00 48.84  ? 109  GLU F OE2 1 
ATOM   7846  N  N   . GLU F  2 111 ? 73.746  -110.194 -101.868 1.00 40.86  ? 110  GLU F N   1 
ATOM   7847  C  CA  . GLU F  2 111 ? 73.034  -108.935 -102.069 1.00 42.19  ? 110  GLU F CA  1 
ATOM   7848  C  C   . GLU F  2 111 ? 72.750  -108.786 -103.555 1.00 43.98  ? 110  GLU F C   1 
ATOM   7849  O  O   . GLU F  2 111 ? 71.646  -108.403 -103.950 1.00 44.50  ? 110  GLU F O   1 
ATOM   7850  C  CB  . GLU F  2 111 ? 73.852  -107.750 -101.570 1.00 41.47  ? 110  GLU F CB  1 
ATOM   7851  C  CG  . GLU F  2 111 ? 73.921  -107.667 -100.062 1.00 40.97  ? 110  GLU F CG  1 
ATOM   7852  C  CD  . GLU F  2 111 ? 74.821  -106.557 -99.588  1.00 39.21  ? 110  GLU F CD  1 
ATOM   7853  O  OE1 . GLU F  2 111 ? 75.921  -106.416 -100.173 1.00 39.20  ? 110  GLU F OE1 1 
ATOM   7854  O  OE2 . GLU F  2 111 ? 74.434  -105.845 -98.633  1.00 35.96  ? 110  GLU F OE2 1 
HETATM 7855  N  N   . MSE F  2 112 ? 73.749  -109.091 -104.377 1.00 44.76  ? 111  MSE F N   1 
HETATM 7856  C  CA  . MSE F  2 112 ? 73.577  -109.032 -105.819 1.00 47.54  ? 111  MSE F CA  1 
HETATM 7857  C  C   . MSE F  2 112 ? 72.382  -109.931 -106.170 1.00 46.15  ? 111  MSE F C   1 
HETATM 7858  O  O   . MSE F  2 112 ? 71.537  -109.579 -106.982 1.00 47.05  ? 111  MSE F O   1 
HETATM 7859  C  CB  . MSE F  2 112 ? 74.845  -109.528 -106.516 1.00 52.36  ? 111  MSE F CB  1 
HETATM 7860  C  CG  . MSE F  2 112 ? 74.834  -109.386 -108.025 1.00 58.77  ? 111  MSE F CG  1 
HETATM 7861  SE SE  . MSE F  2 112 ? 74.540  -107.560 -108.652 1.00 71.80  ? 111  MSE F SE  1 
HETATM 7862  C  CE  . MSE F  2 112 ? 72.698  -107.756 -109.203 1.00 67.23  ? 111  MSE F CE  1 
ATOM   7863  N  N   . GLU F  2 113 ? 72.315  -111.090 -105.529 1.00 45.19  ? 112  GLU F N   1 
ATOM   7864  C  CA  . GLU F  2 113 ? 71.228  -112.041 -105.732 1.00 44.16  ? 112  GLU F CA  1 
ATOM   7865  C  C   . GLU F  2 113 ? 69.893  -111.413 -105.316 1.00 42.89  ? 112  GLU F C   1 
ATOM   7866  O  O   . GLU F  2 113 ? 68.900  -111.527 -106.026 1.00 44.28  ? 112  GLU F O   1 
ATOM   7867  C  CB  . GLU F  2 113 ? 71.486  -113.288 -104.895 1.00 45.55  ? 112  GLU F CB  1 
ATOM   7868  C  CG  . GLU F  2 113 ? 70.771  -114.530 -105.361 1.00 51.01  ? 112  GLU F CG  1 
ATOM   7869  C  CD  . GLU F  2 113 ? 71.091  -115.743 -104.492 1.00 55.48  ? 112  GLU F CD  1 
ATOM   7870  O  OE1 . GLU F  2 113 ? 72.257  -115.873 -104.047 1.00 56.87  ? 112  GLU F OE1 1 
ATOM   7871  O  OE2 . GLU F  2 113 ? 70.180  -116.575 -104.263 1.00 57.94  ? 112  GLU F OE2 1 
ATOM   7872  N  N   . TRP F  2 114 ? 69.873  -110.752 -104.161 1.00 39.94  ? 113  TRP F N   1 
ATOM   7873  C  CA  . TRP F  2 114 ? 68.663  -110.109 -103.657 1.00 36.37  ? 113  TRP F CA  1 
ATOM   7874  C  C   . TRP F  2 114 ? 68.167  -109.053 -104.640 1.00 36.89  ? 113  TRP F C   1 
ATOM   7875  O  O   . TRP F  2 114 ? 66.962  -108.912 -104.867 1.00 36.77  ? 113  TRP F O   1 
ATOM   7876  C  CB  . TRP F  2 114 ? 68.949  -109.433 -102.313 1.00 32.04  ? 113  TRP F CB  1 
ATOM   7877  C  CG  . TRP F  2 114 ? 67.740  -108.817 -101.657 1.00 27.03  ? 113  TRP F CG  1 
ATOM   7878  C  CD1 . TRP F  2 114 ? 66.891  -109.421 -100.780 1.00 25.17  ? 113  TRP F CD1 1 
ATOM   7879  C  CD2 . TRP F  2 114 ? 67.221  -107.494 -101.870 1.00 25.01  ? 113  TRP F CD2 1 
ATOM   7880  N  NE1 . TRP F  2 114 ? 65.872  -108.562 -100.434 1.00 23.74  ? 113  TRP F NE1 1 
ATOM   7881  C  CE2 . TRP F  2 114 ? 66.049  -107.374 -101.092 1.00 24.04  ? 113  TRP F CE2 1 
ATOM   7882  C  CE3 . TRP F  2 114 ? 67.631  -106.403 -102.644 1.00 24.06  ? 113  TRP F CE3 1 
ATOM   7883  C  CZ2 . TRP F  2 114 ? 65.277  -106.205 -101.068 1.00 23.39  ? 113  TRP F CZ2 1 
ATOM   7884  C  CZ3 . TRP F  2 114 ? 66.862  -105.240 -102.621 1.00 24.55  ? 113  TRP F CZ3 1 
ATOM   7885  C  CH2 . TRP F  2 114 ? 65.697  -105.153 -101.838 1.00 23.40  ? 113  TRP F CH2 1 
ATOM   7886  N  N   . PHE F  2 115 ? 69.111  -108.308 -105.208 1.00 36.16  ? 114  PHE F N   1 
ATOM   7887  C  CA  . PHE F  2 115 ? 68.816  -107.235 -106.158 1.00 36.51  ? 114  PHE F CA  1 
ATOM   7888  C  C   . PHE F  2 115 ? 68.157  -107.760 -107.424 1.00 37.40  ? 114  PHE F C   1 
ATOM   7889  O  O   . PHE F  2 115 ? 67.183  -107.182 -107.921 1.00 35.86  ? 114  PHE F O   1 
ATOM   7890  C  CB  . PHE F  2 115 ? 70.106  -106.511 -106.528 1.00 34.71  ? 114  PHE F CB  1 
ATOM   7891  C  CG  . PHE F  2 115 ? 69.926  -105.409 -107.527 1.00 32.33  ? 114  PHE F CG  1 
ATOM   7892  C  CD1 . PHE F  2 115 ? 69.348  -104.200 -107.152 1.00 30.03  ? 114  PHE F CD1 1 
ATOM   7893  C  CD2 . PHE F  2 115 ? 70.390  -105.559 -108.835 1.00 31.51  ? 114  PHE F CD2 1 
ATOM   7894  C  CE1 . PHE F  2 115 ? 69.244  -103.157 -108.058 1.00 28.89  ? 114  PHE F CE1 1 
ATOM   7895  C  CE2 . PHE F  2 115 ? 70.291  -104.521 -109.756 1.00 28.58  ? 114  PHE F CE2 1 
ATOM   7896  C  CZ  . PHE F  2 115 ? 69.720  -103.319 -109.366 1.00 30.29  ? 114  PHE F CZ  1 
ATOM   7897  N  N   . ASN F  2 116 ? 68.707  -108.852 -107.950 1.00 38.33  ? 115  ASN F N   1 
ATOM   7898  C  CA  . ASN F  2 116 ? 68.166  -109.462 -109.148 1.00 38.31  ? 115  ASN F CA  1 
ATOM   7899  C  C   . ASN F  2 116 ? 66.751  -109.932 -108.911 1.00 38.17  ? 115  ASN F C   1 
ATOM   7900  O  O   . ASN F  2 116 ? 65.877  -109.677 -109.733 1.00 40.64  ? 115  ASN F O   1 
ATOM   7901  C  CB  . ASN F  2 116 ? 69.049  -110.608 -109.611 1.00 39.55  ? 115  ASN F CB  1 
ATOM   7902  C  CG  . ASN F  2 116 ? 70.368  -110.118 -110.174 1.00 42.02  ? 115  ASN F CG  1 
ATOM   7903  O  OD1 . ASN F  2 116 ? 70.409  -109.159 -110.955 1.00 43.06  ? 115  ASN F OD1 1 
ATOM   7904  N  ND2 . ASN F  2 116 ? 71.452  -110.775 -109.793 1.00 43.77  ? 115  ASN F ND2 1 
ATOM   7905  N  N   . ASN F  2 117 ? 66.494  -110.606 -107.800 1.00 36.79  ? 116  ASN F N   1 
ATOM   7906  C  CA  . ASN F  2 117 ? 65.120  -111.016 -107.554 1.00 38.10  ? 116  ASN F CA  1 
ATOM   7907  C  C   . ASN F  2 117 ? 64.270  -109.744 -107.452 1.00 38.50  ? 116  ASN F C   1 
ATOM   7908  O  O   . ASN F  2 117 ? 63.110  -109.742 -107.842 1.00 40.13  ? 116  ASN F O   1 
ATOM   7909  C  CB  . ASN F  2 117 ? 64.983  -111.834 -106.262 1.00 39.50  ? 116  ASN F CB  1 
ATOM   7910  C  CG  . ASN F  2 117 ? 65.923  -113.028 -106.213 1.00 40.91  ? 116  ASN F CG  1 
ATOM   7911  O  OD1 . ASN F  2 117 ? 66.198  -113.670 -107.229 1.00 43.66  ? 116  ASN F OD1 1 
ATOM   7912  N  ND2 . ASN F  2 117 ? 66.414  -113.336 -105.022 1.00 40.88  ? 116  ASN F ND2 1 
ATOM   7913  N  N   . TYR F  2 118 ? 64.846  -108.656 -106.944 1.00 38.55  ? 117  TYR F N   1 
ATOM   7914  C  CA  . TYR F  2 118 ? 64.095  -107.404 -106.826 1.00 38.33  ? 117  TYR F CA  1 
ATOM   7915  C  C   . TYR F  2 118 ? 63.773  -106.815 -108.191 1.00 39.79  ? 117  TYR F C   1 
ATOM   7916  O  O   . TYR F  2 118 ? 62.637  -106.424 -108.447 1.00 38.36  ? 117  TYR F O   1 
ATOM   7917  C  CB  . TYR F  2 118 ? 64.865  -106.351 -106.005 1.00 34.90  ? 117  TYR F CB  1 
ATOM   7918  C  CG  . TYR F  2 118 ? 64.136  -105.018 -105.906 1.00 28.06  ? 117  TYR F CG  1 
ATOM   7919  C  CD1 . TYR F  2 118 ? 64.483  -103.945 -106.710 1.00 27.41  ? 117  TYR F CD1 1 
ATOM   7920  C  CD2 . TYR F  2 118 ? 63.071  -104.855 -105.031 1.00 29.49  ? 117  TYR F CD2 1 
ATOM   7921  C  CE1 . TYR F  2 118 ? 63.786  -102.741 -106.644 1.00 27.18  ? 117  TYR F CE1 1 
ATOM   7922  C  CE2 . TYR F  2 118 ? 62.368  -103.664 -104.953 1.00 27.56  ? 117  TYR F CE2 1 
ATOM   7923  C  CZ  . TYR F  2 118 ? 62.731  -102.612 -105.758 1.00 27.76  ? 117  TYR F CZ  1 
ATOM   7924  O  OH  . TYR F  2 118 ? 62.055  -101.423 -105.637 1.00 28.79  ? 117  TYR F OH  1 
ATOM   7925  N  N   . LYS F  2 119 ? 64.775  -106.736 -109.059 1.00 42.02  ? 118  LYS F N   1 
ATOM   7926  C  CA  . LYS F  2 119 ? 64.557  -106.182 -110.385 1.00 46.51  ? 118  LYS F CA  1 
ATOM   7927  C  C   . LYS F  2 119 ? 63.555  -107.054 -111.160 1.00 48.08  ? 118  LYS F C   1 
ATOM   7928  O  O   . LYS F  2 119 ? 62.686  -106.532 -111.870 1.00 48.50  ? 118  LYS F O   1 
ATOM   7929  C  CB  . LYS F  2 119 ? 65.887  -106.058 -111.150 1.00 48.69  ? 118  LYS F CB  1 
ATOM   7930  C  CG  . LYS F  2 119 ? 66.612  -107.371 -111.350 1.00 52.08  ? 118  LYS F CG  1 
ATOM   7931  C  CD  . LYS F  2 119 ? 67.636  -107.299 -112.472 1.00 54.79  ? 118  LYS F CD  1 
ATOM   7932  C  CE  . LYS F  2 119 ? 68.751  -106.314 -112.182 1.00 55.44  ? 118  LYS F CE  1 
ATOM   7933  N  NZ  . LYS F  2 119 ? 69.832  -106.453 -113.205 1.00 57.04  ? 118  LYS F NZ  1 
ATOM   7934  N  N   . ARG F  2 120 ? 63.663  -108.376 -111.016 1.00 48.24  ? 119  ARG F N   1 
ATOM   7935  C  CA  . ARG F  2 120 ? 62.732  -109.269 -111.693 1.00 48.09  ? 119  ARG F CA  1 
ATOM   7936  C  C   . ARG F  2 120 ? 61.324  -108.987 -111.188 1.00 48.11  ? 119  ARG F C   1 
ATOM   7937  O  O   . ARG F  2 120 ? 60.411  -108.768 -111.981 1.00 50.20  ? 119  ARG F O   1 
ATOM   7938  C  CB  . ARG F  2 120 ? 63.084  -110.741 -111.447 1.00 49.20  ? 119  ARG F CB  1 
ATOM   7939  C  CG  . ARG F  2 120 ? 64.303  -111.235 -112.224 1.00 52.03  ? 119  ARG F CG  1 
ATOM   7940  C  CD  . ARG F  2 120 ? 64.336  -112.764 -112.320 1.00 55.49  ? 119  ARG F CD  1 
ATOM   7941  N  NE  . ARG F  2 120 ? 64.856  -113.437 -111.122 1.00 59.38  ? 119  ARG F NE  1 
ATOM   7942  C  CZ  . ARG F  2 120 ? 66.149  -113.515 -110.789 1.00 60.42  ? 119  ARG F CZ  1 
ATOM   7943  N  NH1 . ARG F  2 120 ? 67.081  -112.958 -111.558 1.00 59.91  ? 119  ARG F NH1 1 
ATOM   7944  N  NH2 . ARG F  2 120 ? 66.516  -114.170 -109.689 1.00 59.20  ? 119  ARG F NH2 1 
ATOM   7945  N  N   . SER F  2 121 ? 61.149  -108.978 -109.870 1.00 46.11  ? 120  SER F N   1 
ATOM   7946  C  CA  . SER F  2 121 ? 59.835  -108.717 -109.291 1.00 45.79  ? 120  SER F CA  1 
ATOM   7947  C  C   . SER F  2 121 ? 59.248  -107.383 -109.734 1.00 45.67  ? 120  SER F C   1 
ATOM   7948  O  O   . SER F  2 121 ? 58.034  -107.255 -109.903 1.00 45.61  ? 120  SER F O   1 
ATOM   7949  C  CB  . SER F  2 121 ? 59.902  -108.746 -107.764 1.00 45.16  ? 120  SER F CB  1 
ATOM   7950  O  OG  . SER F  2 121 ? 59.949  -110.075 -107.282 1.00 46.84  ? 120  SER F OG  1 
ATOM   7951  N  N   . LEU F  2 122 ? 60.106  -106.387 -109.910 1.00 44.58  ? 121  LEU F N   1 
ATOM   7952  C  CA  . LEU F  2 122 ? 59.636  -105.083 -110.326 1.00 43.72  ? 121  LEU F CA  1 
ATOM   7953  C  C   . LEU F  2 122 ? 59.118  -105.188 -111.754 1.00 43.36  ? 121  LEU F C   1 
ATOM   7954  O  O   . LEU F  2 122 ? 58.008  -104.736 -112.051 1.00 43.29  ? 121  LEU F O   1 
ATOM   7955  C  CB  . LEU F  2 122 ? 60.769  -104.059 -110.236 1.00 44.95  ? 121  LEU F CB  1 
ATOM   7956  C  CG  . LEU F  2 122 ? 60.433  -102.570 -110.395 1.00 44.92  ? 121  LEU F CG  1 
ATOM   7957  C  CD1 . LEU F  2 122 ? 59.404  -102.135 -109.361 1.00 43.59  ? 121  LEU F CD1 1 
ATOM   7958  C  CD2 . LEU F  2 122 ? 61.709  -101.762 -110.240 1.00 46.48  ? 121  LEU F CD2 1 
ATOM   7959  N  N   . ALA F  2 123 ? 59.912  -105.793 -112.636 1.00 41.98  ? 122  ALA F N   1 
ATOM   7960  C  CA  . ALA F  2 123 ? 59.498  -105.956 -114.028 1.00 41.91  ? 122  ALA F CA  1 
ATOM   7961  C  C   . ALA F  2 123 ? 58.127  -106.639 -114.074 1.00 41.56  ? 122  ALA F C   1 
ATOM   7962  O  O   . ALA F  2 123 ? 57.169  -106.105 -114.634 1.00 40.60  ? 122  ALA F O   1 
ATOM   7963  C  CB  . ALA F  2 123 ? 60.518  -106.774 -114.788 1.00 40.64  ? 122  ALA F CB  1 
ATOM   7964  N  N   . THR F  2 124 ? 58.031  -107.819 -113.478 1.00 40.97  ? 123  THR F N   1 
ATOM   7965  C  CA  . THR F  2 124 ? 56.758  -108.520 -113.439 1.00 41.43  ? 123  THR F CA  1 
ATOM   7966  C  C   . THR F  2 124 ? 55.637  -107.545 -113.068 1.00 42.28  ? 123  THR F C   1 
ATOM   7967  O  O   . THR F  2 124 ? 54.636  -107.451 -113.771 1.00 44.45  ? 123  THR F O   1 
ATOM   7968  C  CB  . THR F  2 124 ? 56.799  -109.675 -112.420 1.00 40.37  ? 123  THR F CB  1 
ATOM   7969  O  OG1 . THR F  2 124 ? 57.502  -110.783 -112.992 1.00 42.08  ? 123  THR F OG1 1 
ATOM   7970  C  CG2 . THR F  2 124 ? 55.407  -110.104 -112.022 1.00 36.96  ? 123  THR F CG2 1 
ATOM   7971  N  N   . TYR F  2 125 ? 55.811  -106.803 -111.981 1.00 42.18  ? 124  TYR F N   1 
ATOM   7972  C  CA  . TYR F  2 125 ? 54.792  -105.856 -111.559 1.00 41.89  ? 124  TYR F CA  1 
ATOM   7973  C  C   . TYR F  2 125 ? 54.415  -104.841 -112.635 1.00 44.55  ? 124  TYR F C   1 
ATOM   7974  O  O   . TYR F  2 125 ? 53.239  -104.570 -112.864 1.00 43.70  ? 124  TYR F O   1 
ATOM   7975  C  CB  . TYR F  2 125 ? 55.245  -105.085 -110.321 1.00 37.57  ? 124  TYR F CB  1 
ATOM   7976  C  CG  . TYR F  2 125 ? 54.220  -104.072 -109.890 1.00 32.82  ? 124  TYR F CG  1 
ATOM   7977  C  CD1 . TYR F  2 125 ? 53.010  -104.480 -109.323 1.00 32.80  ? 124  TYR F CD1 1 
ATOM   7978  C  CD2 . TYR F  2 125 ? 54.419  -102.717 -110.120 1.00 30.16  ? 124  TYR F CD2 1 
ATOM   7979  C  CE1 . TYR F  2 125 ? 52.017  -103.560 -108.996 1.00 31.60  ? 124  TYR F CE1 1 
ATOM   7980  C  CE2 . TYR F  2 125 ? 53.439  -101.789 -109.808 1.00 30.76  ? 124  TYR F CE2 1 
ATOM   7981  C  CZ  . TYR F  2 125 ? 52.237  -102.213 -109.246 1.00 32.43  ? 124  TYR F CZ  1 
ATOM   7982  O  OH  . TYR F  2 125 ? 51.252  -101.292 -108.954 1.00 32.72  ? 124  TYR F OH  1 
HETATM 7983  N  N   . MSE F  2 126 ? 55.412  -104.267 -113.289 1.00 47.80  ? 125  MSE F N   1 
HETATM 7984  C  CA  . MSE F  2 126 ? 55.136  -103.264 -114.297 1.00 52.46  ? 125  MSE F CA  1 
HETATM 7985  C  C   . MSE F  2 126 ? 54.489  -103.852 -115.536 1.00 55.25  ? 125  MSE F C   1 
HETATM 7986  O  O   . MSE F  2 126 ? 53.497  -103.321 -116.037 1.00 56.26  ? 125  MSE F O   1 
HETATM 7987  C  CB  . MSE F  2 126 ? 56.425  -102.534 -114.657 1.00 54.27  ? 125  MSE F CB  1 
HETATM 7988  C  CG  . MSE F  2 126 ? 57.197  -102.085 -113.426 1.00 57.96  ? 125  MSE F CG  1 
HETATM 7989  SE SE  . MSE F  2 126 ? 58.545  -100.750 -113.748 1.00 62.74  ? 125  MSE F SE  1 
HETATM 7990  C  CE  . MSE F  2 126 ? 59.904  -101.889 -114.518 1.00 56.97  ? 125  MSE F CE  1 
ATOM   7991  N  N   . ARG F  2 127 ? 55.046  -104.959 -116.020 1.00 57.60  ? 126  ARG F N   1 
ATOM   7992  C  CA  . ARG F  2 127 ? 54.534  -105.629 -117.208 1.00 58.20  ? 126  ARG F CA  1 
ATOM   7993  C  C   . ARG F  2 127 ? 53.072  -106.001 -117.091 1.00 59.24  ? 126  ARG F C   1 
ATOM   7994  O  O   . ARG F  2 127 ? 52.425  -106.262 -118.096 1.00 60.74  ? 126  ARG F O   1 
ATOM   7995  C  CB  . ARG F  2 127 ? 55.340  -106.891 -117.496 1.00 58.20  ? 126  ARG F CB  1 
ATOM   7996  C  CG  . ARG F  2 127 ? 56.676  -106.631 -118.144 1.00 60.44  ? 126  ARG F CG  1 
ATOM   7997  C  CD  . ARG F  2 127 ? 57.507  -107.895 -118.167 1.00 63.65  ? 126  ARG F CD  1 
ATOM   7998  N  NE  . ARG F  2 127 ? 58.810  -107.682 -118.793 1.00 66.70  ? 126  ARG F NE  1 
ATOM   7999  C  CZ  . ARG F  2 127 ? 59.794  -108.577 -118.793 1.00 67.27  ? 126  ARG F CZ  1 
ATOM   8000  N  NH1 . ARG F  2 127 ? 59.629  -109.752 -118.197 1.00 66.80  ? 126  ARG F NH1 1 
ATOM   8001  N  NH2 . ARG F  2 127 ? 60.943  -108.298 -119.394 1.00 68.82  ? 126  ARG F NH2 1 
ATOM   8002  N  N   . SER F  2 128 ? 52.543  -106.019 -115.875 1.00 59.67  ? 127  SER F N   1 
ATOM   8003  C  CA  . SER F  2 128 ? 51.151  -106.388 -115.687 1.00 62.04  ? 127  SER F CA  1 
ATOM   8004  C  C   . SER F  2 128 ? 50.277  -105.218 -115.270 1.00 63.90  ? 127  SER F C   1 
ATOM   8005  O  O   . SER F  2 128 ? 49.318  -105.396 -114.523 1.00 64.09  ? 127  SER F O   1 
ATOM   8006  C  CB  . SER F  2 128 ? 51.043  -107.484 -114.632 1.00 62.23  ? 127  SER F CB  1 
ATOM   8007  O  OG  . SER F  2 128 ? 51.201  -106.944 -113.332 1.00 62.29  ? 127  SER F OG  1 
ATOM   8008  N  N   . LEU F  2 129 ? 50.590  -104.025 -115.752 1.00 66.11  ? 128  LEU F N   1 
ATOM   8009  C  CA  . LEU F  2 129 ? 49.801  -102.866 -115.369 1.00 70.35  ? 128  LEU F CA  1 
ATOM   8010  C  C   . LEU F  2 129 ? 48.723  -102.446 -116.364 1.00 74.78  ? 128  LEU F C   1 
ATOM   8011  O  O   . LEU F  2 129 ? 48.176  -101.342 -116.261 1.00 75.55  ? 128  LEU F O   1 
ATOM   8012  C  CB  . LEU F  2 129 ? 50.720  -101.679 -115.075 1.00 68.80  ? 128  LEU F CB  1 
ATOM   8013  C  CG  . LEU F  2 129 ? 51.404  -101.662 -113.708 1.00 66.28  ? 128  LEU F CG  1 
ATOM   8014  C  CD1 . LEU F  2 129 ? 52.405  -100.532 -113.663 1.00 65.33  ? 128  LEU F CD1 1 
ATOM   8015  C  CD2 . LEU F  2 129 ? 50.365  -101.497 -112.612 1.00 65.01  ? 128  LEU F CD2 1 
ATOM   8016  N  N   . GLY F  2 130 ? 48.402  -103.313 -117.319 1.00 78.65  ? 129  GLY F N   1 
ATOM   8017  C  CA  . GLY F  2 130 ? 47.372  -102.951 -118.275 1.00 83.04  ? 129  GLY F CA  1 
ATOM   8018  C  C   . GLY F  2 130 ? 47.122  -103.933 -119.402 1.00 86.25  ? 129  GLY F C   1 
ATOM   8019  O  O   . GLY F  2 130 ? 47.422  -103.625 -120.560 1.00 86.43  ? 129  GLY F O   1 
ATOM   8020  N  N   . GLY F  2 131 ? 46.562  -105.096 -119.062 1.00 88.42  ? 130  GLY F N   1 
ATOM   8021  C  CA  . GLY F  2 131 ? 46.259  -106.127 -120.045 1.00 90.91  ? 130  GLY F CA  1 
ATOM   8022  C  C   . GLY F  2 131 ? 47.015  -105.966 -121.350 1.00 92.93  ? 130  GLY F C   1 
ATOM   8023  O  O   . GLY F  2 131 ? 46.438  -106.059 -122.437 1.00 92.98  ? 130  GLY F O   1 
ATOM   8024  N  N   . ASP F  2 132 ? 48.317  -105.726 -121.232 1.00 94.29  ? 131  ASP F N   1 
ATOM   8025  C  CA  . ASP F  2 132 ? 49.176  -105.525 -122.387 1.00 95.55  ? 131  ASP F CA  1 
ATOM   8026  C  C   . ASP F  2 132 ? 50.623  -105.490 -121.906 1.00 94.99  ? 131  ASP F C   1 
ATOM   8027  O  O   . ASP F  2 132 ? 51.147  -106.487 -121.404 1.00 95.03  ? 131  ASP F O   1 
ATOM   8028  C  CB  . ASP F  2 132 ? 48.818  -104.201 -123.068 1.00 97.88  ? 131  ASP F CB  1 
ATOM   8029  C  CG  . ASP F  2 132 ? 49.600  -103.971 -124.347 1.00 101.06 ? 131  ASP F CG  1 
ATOM   8030  O  OD1 . ASP F  2 132 ? 49.433  -102.896 -124.963 1.00 103.18 ? 131  ASP F OD1 1 
ATOM   8031  O  OD2 . ASP F  2 132 ? 50.380  -104.865 -124.740 1.00 102.88 ? 131  ASP F OD2 1 
ATOM   8032  N  N   . GLU F  2 133 ? 51.264  -104.338 -122.067 1.00 94.12  ? 132  GLU F N   1 
ATOM   8033  C  CA  . GLU F  2 133 ? 52.639  -104.160 -121.629 1.00 92.80  ? 132  GLU F CA  1 
ATOM   8034  C  C   . GLU F  2 133 ? 52.650  -103.158 -120.484 1.00 90.48  ? 132  GLU F C   1 
ATOM   8035  O  O   . GLU F  2 133 ? 53.546  -102.320 -120.370 1.00 90.24  ? 132  GLU F O   1 
ATOM   8036  C  CB  . GLU F  2 133 ? 53.512  -103.677 -122.790 1.00 94.72  ? 132  GLU F CB  1 
ATOM   8037  C  CG  . GLU F  2 133 ? 53.884  -104.791 -123.762 1.00 98.09  ? 132  GLU F CG  1 
ATOM   8038  C  CD  . GLU F  2 133 ? 54.811  -105.830 -123.136 1.00 100.32 ? 132  GLU F CD  1 
ATOM   8039  O  OE1 . GLU F  2 133 ? 56.047  -105.632 -123.180 1.00 101.11 ? 132  GLU F OE1 1 
ATOM   8040  O  OE2 . GLU F  2 133 ? 54.305  -106.836 -122.589 1.00 100.60 ? 132  GLU F OE2 1 
ATOM   8041  N  N   . GLY F  2 134 ? 51.624  -103.263 -119.642 1.00 87.54  ? 133  GLY F N   1 
ATOM   8042  C  CA  . GLY F  2 134 ? 51.491  -102.399 -118.486 1.00 83.09  ? 133  GLY F CA  1 
ATOM   8043  C  C   . GLY F  2 134 ? 52.091  -101.017 -118.633 1.00 79.60  ? 133  GLY F C   1 
ATOM   8044  O  O   . GLY F  2 134 ? 51.633  -100.216 -119.447 1.00 80.41  ? 133  GLY F O   1 
ATOM   8045  N  N   . LEU F  2 135 ? 53.129  -100.737 -117.854 1.00 75.11  ? 134  LEU F N   1 
ATOM   8046  C  CA  . LEU F  2 135 ? 53.756  -99.425  -117.892 1.00 70.34  ? 134  LEU F CA  1 
ATOM   8047  C  C   . LEU F  2 135 ? 55.077  -99.427  -117.138 1.00 67.77  ? 134  LEU F C   1 
ATOM   8048  O  O   . LEU F  2 135 ? 55.181  -100.008 -116.061 1.00 68.16  ? 134  LEU F O   1 
ATOM   8049  C  CB  . LEU F  2 135 ? 52.804  -98.406  -117.261 1.00 68.49  ? 134  LEU F CB  1 
ATOM   8050  C  CG  . LEU F  2 135 ? 53.238  -96.954  -117.095 1.00 67.33  ? 134  LEU F CG  1 
ATOM   8051  C  CD1 . LEU F  2 135 ? 53.546  -96.344  -118.446 1.00 67.92  ? 134  LEU F CD1 1 
ATOM   8052  C  CD2 . LEU F  2 135 ? 52.131  -96.184  -116.403 1.00 66.12  ? 134  LEU F CD2 1 
ATOM   8053  N  N   . ASP F  2 136 ? 56.094  -98.796  -117.708 1.00 64.43  ? 135  ASP F N   1 
ATOM   8054  C  CA  . ASP F  2 136 ? 57.374  -98.727  -117.024 1.00 62.59  ? 135  ASP F CA  1 
ATOM   8055  C  C   . ASP F  2 136 ? 57.334  -97.473  -116.165 1.00 61.61  ? 135  ASP F C   1 
ATOM   8056  O  O   . ASP F  2 136 ? 57.394  -96.356  -116.678 1.00 60.96  ? 135  ASP F O   1 
ATOM   8057  C  CB  . ASP F  2 136 ? 58.533  -98.640  -118.013 1.00 62.44  ? 135  ASP F CB  1 
ATOM   8058  C  CG  . ASP F  2 136 ? 59.885  -98.628  -117.318 1.00 63.53  ? 135  ASP F CG  1 
ATOM   8059  O  OD1 . ASP F  2 136 ? 60.922  -98.581  -118.014 1.00 63.50  ? 135  ASP F OD1 1 
ATOM   8060  O  OD2 . ASP F  2 136 ? 59.911  -98.666  -116.069 1.00 63.91  ? 135  ASP F OD2 1 
ATOM   8061  N  N   . ILE F  2 137 ? 57.226  -97.662  -114.855 1.00 60.26  ? 136  ILE F N   1 
ATOM   8062  C  CA  . ILE F  2 137 ? 57.150  -96.538  -113.944 1.00 59.07  ? 136  ILE F CA  1 
ATOM   8063  C  C   . ILE F  2 137 ? 58.497  -96.020  -113.438 1.00 59.65  ? 136  ILE F C   1 
ATOM   8064  O  O   . ILE F  2 137 ? 58.556  -95.287  -112.450 1.00 59.13  ? 136  ILE F O   1 
ATOM   8065  C  CB  . ILE F  2 137 ? 56.254  -96.887  -112.765 1.00 57.27  ? 136  ILE F CB  1 
ATOM   8066  C  CG1 . ILE F  2 137 ? 56.823  -98.095  -112.019 1.00 56.98  ? 136  ILE F CG1 1 
ATOM   8067  C  CG2 . ILE F  2 137 ? 54.867  -97.192  -113.277 1.00 54.92  ? 136  ILE F CG2 1 
ATOM   8068  C  CD1 . ILE F  2 137 ? 56.096  -98.421  -110.729 1.00 55.86  ? 136  ILE F CD1 1 
ATOM   8069  N  N   . THR F  2 138 ? 59.577  -96.386  -114.119 1.00 60.21  ? 137  THR F N   1 
ATOM   8070  C  CA  . THR F  2 138 ? 60.899  -95.912  -113.728 1.00 61.36  ? 137  THR F CA  1 
ATOM   8071  C  C   . THR F  2 138 ? 61.377  -94.853  -114.716 1.00 63.55  ? 137  THR F C   1 
ATOM   8072  O  O   . THR F  2 138 ? 62.495  -94.347  -114.598 1.00 63.33  ? 137  THR F O   1 
ATOM   8073  C  CB  . THR F  2 138 ? 61.947  -97.047  -113.716 1.00 60.26  ? 137  THR F CB  1 
ATOM   8074  O  OG1 . THR F  2 138 ? 62.192  -97.485  -115.054 1.00 59.38  ? 137  THR F OG1 1 
ATOM   8075  C  CG2 . THR F  2 138 ? 61.471  -98.214  -112.882 1.00 58.59  ? 137  THR F CG2 1 
ATOM   8076  N  N   . GLN F  2 139 ? 60.519  -94.503  -115.674 1.00 66.27  ? 138  GLN F N   1 
ATOM   8077  C  CA  . GLN F  2 139 ? 60.885  -93.530  -116.701 1.00 69.11  ? 138  GLN F CA  1 
ATOM   8078  C  C   . GLN F  2 139 ? 60.361  -92.093  -116.586 1.00 69.80  ? 138  GLN F C   1 
ATOM   8079  O  O   . GLN F  2 139 ? 61.146  -91.142  -116.615 1.00 69.67  ? 138  GLN F O   1 
ATOM   8080  C  CB  . GLN F  2 139 ? 60.529  -94.095  -118.081 1.00 70.47  ? 138  GLN F CB  1 
ATOM   8081  C  CG  . GLN F  2 139 ? 61.295  -95.360  -118.425 1.00 73.16  ? 138  GLN F CG  1 
ATOM   8082  C  CD  . GLN F  2 139 ? 62.787  -95.223  -118.150 1.00 75.50  ? 138  GLN F CD  1 
ATOM   8083  O  OE1 . GLN F  2 139 ? 63.482  -94.436  -118.793 1.00 76.34  ? 138  GLN F OE1 1 
ATOM   8084  N  NE2 . GLN F  2 139 ? 63.282  -95.987  -117.181 1.00 77.18  ? 138  GLN F NE2 1 
ATOM   8085  N  N   . ASP F  2 140 ? 59.051  -91.921  -116.475 1.00 70.21  ? 139  ASP F N   1 
ATOM   8086  C  CA  . ASP F  2 140 ? 58.495  -90.578  -116.377 1.00 71.26  ? 139  ASP F CA  1 
ATOM   8087  C  C   . ASP F  2 140 ? 58.800  -90.029  -114.990 1.00 69.98  ? 139  ASP F C   1 
ATOM   8088  O  O   . ASP F  2 140 ? 57.911  -89.534  -114.301 1.00 69.99  ? 139  ASP F O   1 
ATOM   8089  C  CB  . ASP F  2 140 ? 56.981  -90.623  -116.603 1.00 75.86  ? 139  ASP F CB  1 
ATOM   8090  C  CG  . ASP F  2 140 ? 56.490  -89.511  -117.528 1.00 81.07  ? 139  ASP F CG  1 
ATOM   8091  O  OD1 . ASP F  2 140 ? 56.776  -88.322  -117.248 1.00 83.59  ? 139  ASP F OD1 1 
ATOM   8092  O  OD2 . ASP F  2 140 ? 55.813  -89.829  -118.535 1.00 83.53  ? 139  ASP F OD2 1 
HETATM 8093  N  N   . MSE F  2 141 ? 60.068  -90.105  -114.596 1.00 68.70  ? 140  MSE F N   1 
HETATM 8094  C  CA  . MSE F  2 141 ? 60.514  -89.668  -113.274 1.00 68.11  ? 140  MSE F CA  1 
HETATM 8095  C  C   . MSE F  2 141 ? 60.203  -88.235  -112.857 1.00 67.09  ? 140  MSE F C   1 
HETATM 8096  O  O   . MSE F  2 141 ? 59.993  -87.965  -111.677 1.00 66.88  ? 140  MSE F O   1 
HETATM 8097  C  CB  . MSE F  2 141 ? 62.014  -89.941  -113.123 1.00 69.18  ? 140  MSE F CB  1 
HETATM 8098  C  CG  . MSE F  2 141 ? 62.372  -91.428  -113.155 1.00 70.84  ? 140  MSE F CG  1 
HETATM 8099  SE SE  . MSE F  2 141 ? 61.738  -92.454  -111.620 1.00 74.47  ? 140  MSE F SE  1 
HETATM 8100  C  CE  . MSE F  2 141 ? 63.355  -93.456  -111.253 1.00 74.38  ? 140  MSE F CE  1 
ATOM   8101  N  N   . LYS F  2 142 ? 60.173  -87.314  -113.810 1.00 67.51  ? 141  LYS F N   1 
ATOM   8102  C  CA  . LYS F  2 142 ? 59.872  -85.919  -113.498 1.00 66.96  ? 141  LYS F CA  1 
ATOM   8103  C  C   . LYS F  2 142 ? 58.806  -85.361  -114.442 1.00 67.36  ? 141  LYS F C   1 
ATOM   8104  O  O   . LYS F  2 142 ? 58.667  -85.823  -115.576 1.00 66.67  ? 141  LYS F O   1 
ATOM   8105  C  CB  . LYS F  2 142 ? 61.148  -85.078  -113.592 1.00 66.27  ? 141  LYS F CB  1 
ATOM   8106  C  CG  . LYS F  2 142 ? 62.217  -85.449  -112.569 1.00 65.96  ? 141  LYS F CG  1 
ATOM   8107  C  CD  . LYS F  2 142 ? 63.530  -84.721  -112.835 1.00 65.25  ? 141  LYS F CD  1 
ATOM   8108  C  CE  . LYS F  2 142 ? 64.175  -85.205  -114.120 1.00 64.62  ? 141  LYS F CE  1 
ATOM   8109  N  NZ  . LYS F  2 142 ? 65.338  -84.372  -114.517 1.00 64.68  ? 141  LYS F NZ  1 
ATOM   8110  N  N   . PRO F  2 143 ? 58.030  -84.364  -113.981 1.00 68.54  ? 142  PRO F N   1 
ATOM   8111  C  CA  . PRO F  2 143 ? 56.987  -83.770  -114.822 1.00 69.54  ? 142  PRO F CA  1 
ATOM   8112  C  C   . PRO F  2 143 ? 57.521  -83.451  -116.219 1.00 70.89  ? 142  PRO F C   1 
ATOM   8113  O  O   . PRO F  2 143 ? 58.619  -82.904  -116.363 1.00 69.72  ? 142  PRO F O   1 
ATOM   8114  C  CB  . PRO F  2 143 ? 56.597  -82.518  -114.043 1.00 69.03  ? 142  PRO F CB  1 
ATOM   8115  C  CG  . PRO F  2 143 ? 56.750  -82.957  -112.626 1.00 68.22  ? 142  PRO F CG  1 
ATOM   8116  C  CD  . PRO F  2 143 ? 58.065  -83.713  -112.659 1.00 68.83  ? 142  PRO F CD  1 
ATOM   8117  N  N   . PRO F  2 144 ? 56.746  -83.795  -117.266 1.00 72.48  ? 143  PRO F N   1 
ATOM   8118  C  CA  . PRO F  2 144 ? 57.131  -83.554  -118.658 1.00 73.60  ? 143  PRO F CA  1 
ATOM   8119  C  C   . PRO F  2 144 ? 57.165  -82.072  -118.980 1.00 76.06  ? 143  PRO F C   1 
ATOM   8120  O  O   . PRO F  2 144 ? 56.372  -81.290  -118.452 1.00 75.82  ? 143  PRO F O   1 
ATOM   8121  C  CB  . PRO F  2 144 ? 56.052  -84.289  -119.436 1.00 72.46  ? 143  PRO F CB  1 
ATOM   8122  C  CG  . PRO F  2 144 ? 54.852  -84.060  -118.592 1.00 72.36  ? 143  PRO F CG  1 
ATOM   8123  C  CD  . PRO F  2 144 ? 55.377  -84.338  -117.201 1.00 72.24  ? 143  PRO F CD  1 
ATOM   8124  N  N   . LYS F  2 145 ? 58.090  -81.690  -119.852 1.00 79.07  ? 144  LYS F N   1 
ATOM   8125  C  CA  . LYS F  2 145 ? 58.236  -80.294  -120.247 1.00 82.35  ? 144  LYS F CA  1 
ATOM   8126  C  C   . LYS F  2 145 ? 57.548  -79.990  -121.588 1.00 83.76  ? 144  LYS F C   1 
ATOM   8127  O  O   . LYS F  2 145 ? 56.472  -79.384  -121.612 1.00 84.64  ? 144  LYS F O   1 
ATOM   8128  C  CB  . LYS F  2 145 ? 59.730  -79.927  -120.299 1.00 82.44  ? 144  LYS F CB  1 
ATOM   8129  C  CG  . LYS F  2 145 ? 60.644  -81.102  -120.657 1.00 82.68  ? 144  LYS F CG  1 
ATOM   8130  C  CD  . LYS F  2 145 ? 62.116  -80.719  -120.648 1.00 82.14  ? 144  LYS F CD  1 
ATOM   8131  C  CE  . LYS F  2 145 ? 63.005  -81.950  -120.782 1.00 82.03  ? 144  LYS F CE  1 
ATOM   8132  N  NZ  . LYS F  2 145 ? 62.712  -82.747  -122.010 1.00 80.40  ? 144  LYS F NZ  1 
ATOM   8133  N  N   . SER F  2 146 ? 58.171  -80.426  -122.685 1.00 84.61  ? 145  SER F N   1 
ATOM   8134  C  CA  . SER F  2 146 ? 57.678  -80.222  -124.052 1.00 85.12  ? 145  SER F CA  1 
ATOM   8135  C  C   . SER F  2 146 ? 58.875  -79.924  -124.952 1.00 85.58  ? 145  SER F C   1 
ATOM   8136  O  O   . SER F  2 146 ? 59.031  -78.754  -125.370 1.00 85.44  ? 145  SER F O   1 
ATOM   8137  C  CB  . SER F  2 146 ? 56.680  -79.054  -124.138 1.00 85.57  ? 145  SER F CB  1 
ATOM   8138  O  OG  . SER F  2 146 ? 57.290  -77.808  -123.832 1.00 85.38  ? 145  SER F OG  1 
HETATM 8139  N  N   . MSE G  3 1   ? 54.096  -84.713  -98.941  1.00 75.31  ? 0    MSE G N   1 
HETATM 8140  C  CA  . MSE G  3 1   ? 54.498  -83.448  -99.617  1.00 75.08  ? 0    MSE G CA  1 
HETATM 8141  C  C   . MSE G  3 1   ? 54.911  -83.680  -101.064 1.00 72.93  ? 0    MSE G C   1 
HETATM 8142  O  O   . MSE G  3 1   ? 55.265  -84.791  -101.461 1.00 70.97  ? 0    MSE G O   1 
HETATM 8143  C  CB  . MSE G  3 1   ? 55.668  -82.784  -98.880  1.00 79.32  ? 0    MSE G CB  1 
HETATM 8144  C  CG  . MSE G  3 1   ? 55.397  -82.375  -97.434  1.00 84.32  ? 0    MSE G CG  1 
HETATM 8145  SE SE  . MSE G  3 1   ? 53.948  -81.098  -97.172  1.00 92.62  ? 0    MSE G SE  1 
HETATM 8146  C  CE  . MSE G  3 1   ? 53.083  -82.005  -95.690  1.00 88.54  ? 0    MSE G CE  1 
HETATM 8147  N  N   . MSE G  3 2   ? 54.887  -82.602  -101.837 1.00 71.29  ? 1    MSE G N   1 
HETATM 8148  C  CA  . MSE G  3 2   ? 55.247  -82.651  -103.240 1.00 68.97  ? 1    MSE G CA  1 
HETATM 8149  C  C   . MSE G  3 2   ? 56.530  -81.891  -103.514 1.00 66.22  ? 1    MSE G C   1 
HETATM 8150  O  O   . MSE G  3 2   ? 57.017  -81.137  -102.677 1.00 65.57  ? 1    MSE G O   1 
HETATM 8151  C  CB  . MSE G  3 2   ? 54.129  -82.041  -104.075 1.00 72.08  ? 1    MSE G CB  1 
HETATM 8152  C  CG  . MSE G  3 2   ? 52.750  -82.555  -103.719 1.00 76.28  ? 1    MSE G CG  1 
HETATM 8153  SE SE  . MSE G  3 2   ? 51.392  -81.754  -104.821 1.00 80.62  ? 1    MSE G SE  1 
HETATM 8154  C  CE  . MSE G  3 2   ? 51.493  -79.944  -104.140 1.00 79.16  ? 1    MSE G CE  1 
ATOM   8155  N  N   . ASP G  3 3   ? 57.066  -82.103  -104.708 1.00 64.14  ? 2    ASP G N   1 
ATOM   8156  C  CA  . ASP G  3 3   ? 58.279  -81.442  -105.159 1.00 61.48  ? 2    ASP G CA  1 
ATOM   8157  C  C   . ASP G  3 3   ? 57.878  -80.081  -105.722 1.00 58.93  ? 2    ASP G C   1 
ATOM   8158  O  O   . ASP G  3 3   ? 56.710  -79.846  -106.019 1.00 57.58  ? 2    ASP G O   1 
ATOM   8159  C  CB  . ASP G  3 3   ? 58.936  -82.289  -106.250 1.00 64.88  ? 2    ASP G CB  1 
ATOM   8160  C  CG  . ASP G  3 3   ? 60.147  -81.614  -106.879 1.00 69.47  ? 2    ASP G CG  1 
ATOM   8161  O  OD1 . ASP G  3 3   ? 59.987  -80.576  -107.566 1.00 70.59  ? 2    ASP G OD1 1 
ATOM   8162  O  OD2 . ASP G  3 3   ? 61.271  -82.131  -106.686 1.00 73.30  ? 2    ASP G OD2 1 
ATOM   8163  N  N   . ALA G  3 4   ? 58.841  -79.179  -105.862 1.00 56.92  ? 3    ALA G N   1 
ATOM   8164  C  CA  . ALA G  3 4   ? 58.560  -77.861  -106.412 1.00 54.77  ? 3    ALA G CA  1 
ATOM   8165  C  C   . ALA G  3 4   ? 57.948  -78.025  -107.804 1.00 53.08  ? 3    ALA G C   1 
ATOM   8166  O  O   . ALA G  3 4   ? 56.956  -77.375  -108.133 1.00 52.76  ? 3    ALA G O   1 
ATOM   8167  C  CB  . ALA G  3 4   ? 59.841  -77.041  -106.492 1.00 53.94  ? 3    ALA G CB  1 
ATOM   8168  N  N   . ALA G  3 5   ? 58.539  -78.910  -108.603 1.00 50.35  ? 4    ALA G N   1 
ATOM   8169  C  CA  . ALA G  3 5   ? 58.082  -79.181  -109.961 1.00 49.00  ? 4    ALA G CA  1 
ATOM   8170  C  C   . ALA G  3 5   ? 56.698  -79.847  -110.060 1.00 49.11  ? 4    ALA G C   1 
ATOM   8171  O  O   . ALA G  3 5   ? 55.951  -79.617  -111.012 1.00 49.87  ? 4    ALA G O   1 
ATOM   8172  C  CB  . ALA G  3 5   ? 59.114  -80.028  -110.677 1.00 47.51  ? 4    ALA G CB  1 
ATOM   8173  N  N   . GLU G  3 6   ? 56.344  -80.676  -109.094 1.00 48.51  ? 5    GLU G N   1 
ATOM   8174  C  CA  . GLU G  3 6   ? 55.044  -81.309  -109.163 1.00 49.67  ? 5    GLU G CA  1 
ATOM   8175  C  C   . GLU G  3 6   ? 53.960  -80.269  -108.939 1.00 48.44  ? 5    GLU G C   1 
ATOM   8176  O  O   . GLU G  3 6   ? 52.840  -80.425  -109.403 1.00 49.25  ? 5    GLU G O   1 
ATOM   8177  C  CB  . GLU G  3 6   ? 54.927  -82.424  -108.117 1.00 53.09  ? 5    GLU G CB  1 
ATOM   8178  C  CG  . GLU G  3 6   ? 56.001  -83.498  -108.237 1.00 57.38  ? 5    GLU G CG  1 
ATOM   8179  C  CD  . GLU G  3 6   ? 55.716  -84.718  -107.373 1.00 61.29  ? 5    GLU G CD  1 
ATOM   8180  O  OE1 . GLU G  3 6   ? 55.475  -84.547  -106.155 1.00 62.52  ? 5    GLU G OE1 1 
ATOM   8181  O  OE2 . GLU G  3 6   ? 55.738  -85.851  -107.914 1.00 63.43  ? 5    GLU G OE2 1 
ATOM   8182  N  N   . VAL G  3 7   ? 54.298  -79.205  -108.223 1.00 48.29  ? 6    VAL G N   1 
ATOM   8183  C  CA  . VAL G  3 7   ? 53.341  -78.139  -107.933 1.00 47.88  ? 6    VAL G CA  1 
ATOM   8184  C  C   . VAL G  3 7   ? 53.225  -77.218  -109.142 1.00 47.32  ? 6    VAL G C   1 
ATOM   8185  O  O   . VAL G  3 7   ? 52.197  -76.576  -109.354 1.00 46.31  ? 6    VAL G O   1 
ATOM   8186  C  CB  . VAL G  3 7   ? 53.774  -77.312  -106.687 1.00 48.52  ? 6    VAL G CB  1 
ATOM   8187  C  CG1 . VAL G  3 7   ? 52.707  -76.275  -106.342 1.00 47.67  ? 6    VAL G CG1 1 
ATOM   8188  C  CG2 . VAL G  3 7   ? 54.002  -78.242  -105.500 1.00 47.50  ? 6    VAL G CG2 1 
ATOM   8189  N  N   . GLU G  3 8   ? 54.298  -77.156  -109.923 1.00 46.99  ? 7    GLU G N   1 
ATOM   8190  C  CA  . GLU G  3 8   ? 54.328  -76.350  -111.130 1.00 47.19  ? 7    GLU G CA  1 
ATOM   8191  C  C   . GLU G  3 8   ? 53.427  -77.071  -112.126 1.00 45.62  ? 7    GLU G C   1 
ATOM   8192  O  O   . GLU G  3 8   ? 52.571  -76.465  -112.768 1.00 45.04  ? 7    GLU G O   1 
ATOM   8193  C  CB  . GLU G  3 8   ? 55.762  -76.258  -111.660 1.00 49.05  ? 7    GLU G CB  1 
ATOM   8194  C  CG  . GLU G  3 8   ? 55.885  -75.842  -113.124 1.00 53.31  ? 7    GLU G CG  1 
ATOM   8195  C  CD  . GLU G  3 8   ? 56.961  -74.789  -113.351 1.00 56.10  ? 7    GLU G CD  1 
ATOM   8196  O  OE1 . GLU G  3 8   ? 56.700  -73.600  -113.051 1.00 57.66  ? 7    GLU G OE1 1 
ATOM   8197  O  OE2 . GLU G  3 8   ? 58.068  -75.148  -113.820 1.00 56.95  ? 7    GLU G OE2 1 
ATOM   8198  N  N   . PHE G  3 9   ? 53.628  -78.379  -112.231 1.00 43.62  ? 8    PHE G N   1 
ATOM   8199  C  CA  . PHE G  3 9   ? 52.837  -79.225  -113.117 1.00 41.67  ? 8    PHE G CA  1 
ATOM   8200  C  C   . PHE G  3 9   ? 51.347  -78.937  -112.919 1.00 41.58  ? 8    PHE G C   1 
ATOM   8201  O  O   . PHE G  3 9   ? 50.584  -78.904  -113.883 1.00 43.31  ? 8    PHE G O   1 
ATOM   8202  C  CB  . PHE G  3 9   ? 53.136  -80.692  -112.805 1.00 38.89  ? 8    PHE G CB  1 
ATOM   8203  C  CG  . PHE G  3 9   ? 52.283  -81.667  -113.552 1.00 35.04  ? 8    PHE G CG  1 
ATOM   8204  C  CD1 . PHE G  3 9   ? 52.653  -82.110  -114.815 1.00 34.71  ? 8    PHE G CD1 1 
ATOM   8205  C  CD2 . PHE G  3 9   ? 51.113  -82.161  -112.982 1.00 33.88  ? 8    PHE G CD2 1 
ATOM   8206  C  CE1 . PHE G  3 9   ? 51.868  -83.038  -115.504 1.00 33.39  ? 8    PHE G CE1 1 
ATOM   8207  C  CE2 . PHE G  3 9   ? 50.323  -83.079  -113.655 1.00 32.69  ? 8    PHE G CE2 1 
ATOM   8208  C  CZ  . PHE G  3 9   ? 50.700  -83.521  -114.921 1.00 32.85  ? 8    PHE G CZ  1 
ATOM   8209  N  N   . LEU G  3 10  ? 50.935  -78.719  -111.675 1.00 39.10  ? 9    LEU G N   1 
ATOM   8210  C  CA  . LEU G  3 10  ? 49.538  -78.433  -111.379 1.00 40.29  ? 9    LEU G CA  1 
ATOM   8211  C  C   . LEU G  3 10  ? 49.109  -77.019  -111.790 1.00 41.26  ? 9    LEU G C   1 
ATOM   8212  O  O   . LEU G  3 10  ? 47.966  -76.795  -112.208 1.00 40.63  ? 9    LEU G O   1 
ATOM   8213  C  CB  . LEU G  3 10  ? 49.274  -78.610  -109.882 1.00 41.97  ? 9    LEU G CB  1 
ATOM   8214  C  CG  . LEU G  3 10  ? 48.628  -79.889  -109.350 1.00 42.61  ? 9    LEU G CG  1 
ATOM   8215  C  CD1 . LEU G  3 10  ? 49.364  -81.112  -109.832 1.00 44.15  ? 9    LEU G CD1 1 
ATOM   8216  C  CD2 . LEU G  3 10  ? 48.637  -79.830  -107.836 1.00 43.48  ? 9    LEU G CD2 1 
ATOM   8217  N  N   . ALA G  3 11  ? 50.018  -76.060  -111.650 1.00 41.96  ? 10   ALA G N   1 
ATOM   8218  C  CA  . ALA G  3 11  ? 49.709  -74.678  -111.997 1.00 42.49  ? 10   ALA G CA  1 
ATOM   8219  C  C   . ALA G  3 11  ? 49.473  -74.551  -113.501 1.00 42.80  ? 10   ALA G C   1 
ATOM   8220  O  O   . ALA G  3 11  ? 48.781  -73.644  -113.963 1.00 42.39  ? 10   ALA G O   1 
ATOM   8221  C  CB  . ALA G  3 11  ? 50.846  -73.766  -111.549 1.00 42.34  ? 10   ALA G CB  1 
ATOM   8222  N  N   . GLU G  3 12  ? 50.055  -75.478  -114.254 1.00 43.27  ? 11   GLU G N   1 
ATOM   8223  C  CA  . GLU G  3 12  ? 49.920  -75.513  -115.701 1.00 44.05  ? 11   GLU G CA  1 
ATOM   8224  C  C   . GLU G  3 12  ? 48.499  -75.885  -116.131 1.00 45.46  ? 11   GLU G C   1 
ATOM   8225  O  O   . GLU G  3 12  ? 48.123  -75.687  -117.284 1.00 45.33  ? 11   GLU G O   1 
ATOM   8226  C  CB  . GLU G  3 12  ? 50.896  -76.523  -116.281 1.00 42.33  ? 11   GLU G CB  1 
ATOM   8227  C  CG  . GLU G  3 12  ? 52.327  -76.071  -116.278 1.00 43.16  ? 11   GLU G CG  1 
ATOM   8228  C  CD  . GLU G  3 12  ? 53.277  -77.202  -116.620 1.00 44.80  ? 11   GLU G CD  1 
ATOM   8229  O  OE1 . GLU G  3 12  ? 54.445  -76.921  -116.972 1.00 45.91  ? 11   GLU G OE1 1 
ATOM   8230  O  OE2 . GLU G  3 12  ? 52.857  -78.377  -116.528 1.00 45.75  ? 11   GLU G OE2 1 
ATOM   8231  N  N   . LYS G  3 13  ? 47.718  -76.439  -115.209 1.00 45.93  ? 12   LYS G N   1 
ATOM   8232  C  CA  . LYS G  3 13  ? 46.353  -76.819  -115.516 1.00 46.67  ? 12   LYS G CA  1 
ATOM   8233  C  C   . LYS G  3 13  ? 45.475  -75.576  -115.469 1.00 48.06  ? 12   LYS G C   1 
ATOM   8234  O  O   . LYS G  3 13  ? 44.302  -75.606  -115.864 1.00 48.05  ? 12   LYS G O   1 
ATOM   8235  C  CB  . LYS G  3 13  ? 45.850  -77.865  -114.517 1.00 47.64  ? 12   LYS G CB  1 
ATOM   8236  C  CG  . LYS G  3 13  ? 46.590  -79.202  -114.592 1.00 50.24  ? 12   LYS G CG  1 
ATOM   8237  C  CD  . LYS G  3 13  ? 45.679  -80.404  -114.290 1.00 51.17  ? 12   LYS G CD  1 
ATOM   8238  C  CE  . LYS G  3 13  ? 45.155  -80.422  -112.852 1.00 53.90  ? 12   LYS G CE  1 
ATOM   8239  N  NZ  . LYS G  3 13  ? 44.274  -79.275  -112.471 1.00 54.40  ? 12   LYS G NZ  1 
ATOM   8240  N  N   . GLU G  3 14  ? 46.058  -74.481  -114.992 1.00 48.58  ? 13   GLU G N   1 
ATOM   8241  C  CA  . GLU G  3 14  ? 45.350  -73.214  -114.889 1.00 49.19  ? 13   GLU G CA  1 
ATOM   8242  C  C   . GLU G  3 14  ? 45.041  -72.656  -116.265 1.00 50.07  ? 13   GLU G C   1 
ATOM   8243  O  O   . GLU G  3 14  ? 45.863  -72.729  -117.180 1.00 48.38  ? 13   GLU G O   1 
ATOM   8244  C  CB  . GLU G  3 14  ? 46.182  -72.208  -114.098 1.00 49.43  ? 13   GLU G CB  1 
ATOM   8245  C  CG  . GLU G  3 14  ? 46.158  -72.462  -112.615 1.00 50.48  ? 13   GLU G CG  1 
ATOM   8246  C  CD  . GLU G  3 14  ? 44.767  -72.285  -112.037 1.00 52.51  ? 13   GLU G CD  1 
ATOM   8247  O  OE1 . GLU G  3 14  ? 44.291  -71.127  -111.991 1.00 53.27  ? 13   GLU G OE1 1 
ATOM   8248  O  OE2 . GLU G  3 14  ? 44.146  -73.299  -111.639 1.00 52.17  ? 13   GLU G OE2 1 
ATOM   8249  N  N   . LEU G  3 15  ? 43.849  -72.096  -116.414 1.00 51.89  ? 14   LEU G N   1 
ATOM   8250  C  CA  . LEU G  3 15  ? 43.458  -71.541  -117.695 1.00 54.94  ? 14   LEU G CA  1 
ATOM   8251  C  C   . LEU G  3 15  ? 44.028  -70.167  -117.951 1.00 56.93  ? 14   LEU G C   1 
ATOM   8252  O  O   . LEU G  3 15  ? 44.037  -69.306  -117.074 1.00 57.29  ? 14   LEU G O   1 
ATOM   8253  C  CB  . LEU G  3 15  ? 41.934  -71.463  -117.821 1.00 55.79  ? 14   LEU G CB  1 
ATOM   8254  C  CG  . LEU G  3 15  ? 41.179  -72.744  -118.179 1.00 56.24  ? 14   LEU G CG  1 
ATOM   8255  C  CD1 . LEU G  3 15  ? 41.921  -73.493  -119.297 1.00 55.30  ? 14   LEU G CD1 1 
ATOM   8256  C  CD2 . LEU G  3 15  ? 41.057  -73.611  -116.946 1.00 59.37  ? 14   LEU G CD2 1 
ATOM   8257  N  N   . VAL G  3 16  ? 44.505  -69.971  -119.170 1.00 59.00  ? 15   VAL G N   1 
ATOM   8258  C  CA  . VAL G  3 16  ? 45.039  -68.690  -119.586 1.00 60.94  ? 15   VAL G CA  1 
ATOM   8259  C  C   . VAL G  3 16  ? 44.571  -68.479  -121.029 1.00 63.15  ? 15   VAL G C   1 
ATOM   8260  O  O   . VAL G  3 16  ? 44.922  -69.250  -121.922 1.00 64.66  ? 15   VAL G O   1 
ATOM   8261  C  CB  . VAL G  3 16  ? 46.576  -68.674  -119.511 1.00 59.60  ? 15   VAL G CB  1 
ATOM   8262  C  CG1 . VAL G  3 16  ? 47.163  -69.737  -120.424 1.00 58.97  ? 15   VAL G CG1 1 
ATOM   8263  C  CG2 . VAL G  3 16  ? 47.087  -67.303  -119.893 1.00 61.13  ? 15   VAL G CG2 1 
ATOM   8264  N  N   . THR G  3 17  ? 43.757  -67.454  -121.258 1.00 64.47  ? 16   THR G N   1 
ATOM   8265  C  CA  . THR G  3 17  ? 43.256  -67.193  -122.604 1.00 66.48  ? 16   THR G CA  1 
ATOM   8266  C  C   . THR G  3 17  ? 44.369  -66.774  -123.570 1.00 68.00  ? 16   THR G C   1 
ATOM   8267  O  O   . THR G  3 17  ? 45.307  -66.071  -123.197 1.00 66.53  ? 16   THR G O   1 
ATOM   8268  C  CB  . THR G  3 17  ? 42.184  -66.087  -122.609 1.00 65.55  ? 16   THR G CB  1 
ATOM   8269  O  OG1 . THR G  3 17  ? 42.818  -64.810  -122.723 1.00 64.72  ? 16   THR G OG1 1 
ATOM   8270  C  CG2 . THR G  3 17  ? 41.376  -66.122  -121.322 1.00 65.66  ? 16   THR G CG2 1 
ATOM   8271  N  N   . ILE G  3 18  ? 44.260  -67.226  -124.814 1.00 71.20  ? 17   ILE G N   1 
ATOM   8272  C  CA  . ILE G  3 18  ? 45.236  -66.881  -125.842 1.00 74.58  ? 17   ILE G CA  1 
ATOM   8273  C  C   . ILE G  3 18  ? 44.563  -66.485  -127.153 1.00 76.26  ? 17   ILE G C   1 
ATOM   8274  O  O   . ILE G  3 18  ? 43.394  -66.801  -127.401 1.00 76.29  ? 17   ILE G O   1 
ATOM   8275  C  CB  . ILE G  3 18  ? 46.227  -68.042  -126.123 1.00 74.55  ? 17   ILE G CB  1 
ATOM   8276  C  CG1 . ILE G  3 18  ? 45.476  -69.351  -126.384 1.00 75.52  ? 17   ILE G CG1 1 
ATOM   8277  C  CG2 . ILE G  3 18  ? 47.159  -68.203  -124.952 1.00 75.27  ? 17   ILE G CG2 1 
ATOM   8278  C  CD1 . ILE G  3 18  ? 44.734  -69.406  -127.699 1.00 74.33  ? 17   ILE G CD1 1 
ATOM   8279  N  N   . ILE G  3 19  ? 45.316  -65.777  -127.982 1.00 77.46  ? 18   ILE G N   1 
ATOM   8280  C  CA  . ILE G  3 19  ? 44.826  -65.336  -129.274 1.00 78.87  ? 18   ILE G CA  1 
ATOM   8281  C  C   . ILE G  3 19  ? 45.832  -65.866  -130.302 1.00 78.82  ? 18   ILE G C   1 
ATOM   8282  O  O   . ILE G  3 19  ? 46.905  -65.299  -130.501 1.00 78.19  ? 18   ILE G O   1 
ATOM   8283  C  CB  . ILE G  3 19  ? 44.695  -63.789  -129.295 1.00 79.30  ? 18   ILE G CB  1 
ATOM   8284  C  CG1 . ILE G  3 19  ? 44.445  -63.295  -130.717 1.00 81.44  ? 18   ILE G CG1 1 
ATOM   8285  C  CG2 . ILE G  3 19  ? 45.917  -63.155  -128.674 1.00 79.47  ? 18   ILE G CG2 1 
ATOM   8286  C  CD1 . ILE G  3 19  ? 44.254  -61.784  -130.822 1.00 83.27  ? 18   ILE G CD1 1 
ATOM   8287  N  N   . PRO G  3 20  ? 45.494  -66.998  -130.945 1.00 79.21  ? 19   PRO G N   1 
ATOM   8288  C  CA  . PRO G  3 20  ? 46.296  -67.696  -131.956 1.00 79.43  ? 19   PRO G CA  1 
ATOM   8289  C  C   . PRO G  3 20  ? 46.330  -67.061  -133.342 1.00 80.25  ? 19   PRO G C   1 
ATOM   8290  O  O   . PRO G  3 20  ? 45.427  -66.319  -133.726 1.00 80.55  ? 19   PRO G O   1 
ATOM   8291  C  CB  . PRO G  3 20  ? 45.659  -69.073  -131.987 1.00 78.90  ? 19   PRO G CB  1 
ATOM   8292  C  CG  . PRO G  3 20  ? 44.213  -68.741  -131.820 1.00 79.38  ? 19   PRO G CG  1 
ATOM   8293  C  CD  . PRO G  3 20  ? 44.228  -67.716  -130.706 1.00 78.80  ? 19   PRO G CD  1 
ATOM   8294  N  N   . ASN G  3 21  ? 47.382  -67.372  -134.092 1.00 80.75  ? 20   ASN G N   1 
ATOM   8295  C  CA  . ASN G  3 21  ? 47.550  -66.855  -135.444 1.00 81.12  ? 20   ASN G CA  1 
ATOM   8296  C  C   . ASN G  3 21  ? 47.260  -67.984  -136.420 1.00 82.05  ? 20   ASN G C   1 
ATOM   8297  O  O   . ASN G  3 21  ? 47.630  -67.919  -137.594 1.00 82.77  ? 20   ASN G O   1 
ATOM   8298  C  CB  . ASN G  3 21  ? 48.981  -66.365  -135.656 1.00 79.77  ? 20   ASN G CB  1 
ATOM   8299  C  CG  . ASN G  3 21  ? 49.996  -67.487  -135.564 1.00 78.38  ? 20   ASN G CG  1 
ATOM   8300  O  OD1 . ASN G  3 21  ? 49.898  -68.496  -136.269 1.00 77.54  ? 20   ASN G OD1 1 
ATOM   8301  N  ND2 . ASN G  3 21  ? 50.980  -67.314  -134.695 1.00 77.25  ? 20   ASN G ND2 1 
ATOM   8302  N  N   . PHE G  3 22  ? 46.610  -69.028  -135.920 1.00 82.43  ? 21   PHE G N   1 
ATOM   8303  C  CA  . PHE G  3 22  ? 46.275  -70.180  -136.742 1.00 82.09  ? 21   PHE G CA  1 
ATOM   8304  C  C   . PHE G  3 22  ? 44.838  -70.630  -136.471 1.00 80.91  ? 21   PHE G C   1 
ATOM   8305  O  O   . PHE G  3 22  ? 44.167  -70.120  -135.570 1.00 79.79  ? 21   PHE G O   1 
ATOM   8306  C  CB  . PHE G  3 22  ? 47.247  -71.338  -136.456 1.00 83.57  ? 21   PHE G CB  1 
ATOM   8307  C  CG  . PHE G  3 22  ? 47.086  -71.935  -135.085 1.00 85.64  ? 21   PHE G CG  1 
ATOM   8308  C  CD1 . PHE G  3 22  ? 47.496  -71.237  -133.954 1.00 85.84  ? 21   PHE G CD1 1 
ATOM   8309  C  CD2 . PHE G  3 22  ? 46.452  -73.165  -134.919 1.00 86.16  ? 21   PHE G CD2 1 
ATOM   8310  C  CE1 . PHE G  3 22  ? 47.270  -71.750  -132.676 1.00 85.73  ? 21   PHE G CE1 1 
ATOM   8311  C  CE2 . PHE G  3 22  ? 46.221  -73.684  -133.644 1.00 85.97  ? 21   PHE G CE2 1 
ATOM   8312  C  CZ  . PHE G  3 22  ? 46.631  -72.973  -132.522 1.00 86.16  ? 21   PHE G CZ  1 
ATOM   8313  N  N   . SER G  3 23  ? 44.378  -71.591  -137.264 1.00 80.34  ? 22   SER G N   1 
ATOM   8314  C  CA  . SER G  3 23  ? 43.033  -72.134  -137.130 1.00 78.97  ? 22   SER G CA  1 
ATOM   8315  C  C   . SER G  3 23  ? 43.080  -73.652  -136.936 1.00 77.72  ? 22   SER G C   1 
ATOM   8316  O  O   . SER G  3 23  ? 43.871  -74.356  -137.571 1.00 76.33  ? 22   SER G O   1 
ATOM   8317  C  CB  . SER G  3 23  ? 42.200  -71.777  -138.367 1.00 78.71  ? 22   SER G CB  1 
ATOM   8318  O  OG  . SER G  3 23  ? 42.928  -72.032  -139.557 1.00 78.58  ? 22   SER G OG  1 
ATOM   8319  N  N   . LEU G  3 24  ? 42.235  -74.142  -136.036 1.00 76.52  ? 23   LEU G N   1 
ATOM   8320  C  CA  . LEU G  3 24  ? 42.164  -75.562  -135.745 1.00 75.75  ? 23   LEU G CA  1 
ATOM   8321  C  C   . LEU G  3 24  ? 40.801  -75.905  -135.171 1.00 74.48  ? 23   LEU G C   1 
ATOM   8322  O  O   . LEU G  3 24  ? 40.163  -75.087  -134.507 1.00 73.21  ? 23   LEU G O   1 
ATOM   8323  C  CB  . LEU G  3 24  ? 43.257  -75.958  -134.755 1.00 77.74  ? 23   LEU G CB  1 
ATOM   8324  C  CG  . LEU G  3 24  ? 43.349  -77.448  -134.415 1.00 78.93  ? 23   LEU G CG  1 
ATOM   8325  C  CD1 . LEU G  3 24  ? 43.749  -78.251  -135.645 1.00 78.86  ? 23   LEU G CD1 1 
ATOM   8326  C  CD2 . LEU G  3 24  ? 44.371  -77.641  -133.313 1.00 79.93  ? 23   LEU G CD2 1 
ATOM   8327  N  N   . ASP G  3 25  ? 40.363  -77.128  -135.429 1.00 73.94  ? 24   ASP G N   1 
ATOM   8328  C  CA  . ASP G  3 25  ? 39.067  -77.588  -134.963 1.00 74.27  ? 24   ASP G CA  1 
ATOM   8329  C  C   . ASP G  3 25  ? 39.092  -78.093  -133.524 1.00 73.22  ? 24   ASP G C   1 
ATOM   8330  O  O   . ASP G  3 25  ? 40.071  -78.699  -133.073 1.00 72.70  ? 24   ASP G O   1 
ATOM   8331  C  CB  . ASP G  3 25  ? 38.551  -78.691  -135.892 1.00 76.51  ? 24   ASP G CB  1 
ATOM   8332  C  CG  . ASP G  3 25  ? 38.291  -78.192  -137.308 1.00 78.89  ? 24   ASP G CG  1 
ATOM   8333  O  OD1 . ASP G  3 25  ? 37.224  -77.581  -137.543 1.00 80.30  ? 24   ASP G OD1 1 
ATOM   8334  O  OD2 . ASP G  3 25  ? 39.160  -78.399  -138.184 1.00 79.44  ? 24   ASP G OD2 1 
ATOM   8335  N  N   . LYS G  3 26  ? 38.000  -77.829  -132.815 1.00 71.12  ? 25   LYS G N   1 
ATOM   8336  C  CA  . LYS G  3 26  ? 37.839  -78.245  -131.431 1.00 69.53  ? 25   LYS G CA  1 
ATOM   8337  C  C   . LYS G  3 26  ? 38.515  -79.592  -131.149 1.00 68.89  ? 25   LYS G C   1 
ATOM   8338  O  O   . LYS G  3 26  ? 38.269  -80.581  -131.847 1.00 68.54  ? 25   LYS G O   1 
ATOM   8339  C  CB  . LYS G  3 26  ? 36.344  -78.318  -131.104 1.00 69.32  ? 25   LYS G CB  1 
ATOM   8340  C  CG  . LYS G  3 26  ? 36.002  -79.012  -129.799 1.00 70.30  ? 25   LYS G CG  1 
ATOM   8341  C  CD  . LYS G  3 26  ? 34.512  -78.905  -129.473 1.00 71.25  ? 25   LYS G CD  1 
ATOM   8342  C  CE  . LYS G  3 26  ? 34.087  -77.451  -129.252 1.00 72.34  ? 25   LYS G CE  1 
ATOM   8343  N  NZ  . LYS G  3 26  ? 32.707  -77.338  -128.690 1.00 72.12  ? 25   LYS G NZ  1 
ATOM   8344  N  N   . ILE G  3 27  ? 39.376  -79.612  -130.127 1.00 67.32  ? 26   ILE G N   1 
ATOM   8345  C  CA  . ILE G  3 27  ? 40.097  -80.821  -129.716 1.00 63.89  ? 26   ILE G CA  1 
ATOM   8346  C  C   . ILE G  3 27  ? 39.414  -81.519  -128.539 1.00 62.77  ? 26   ILE G C   1 
ATOM   8347  O  O   . ILE G  3 27  ? 38.991  -80.882  -127.570 1.00 62.51  ? 26   ILE G O   1 
ATOM   8348  C  CB  . ILE G  3 27  ? 41.563  -80.504  -129.329 1.00 63.13  ? 26   ILE G CB  1 
ATOM   8349  C  CG1 . ILE G  3 27  ? 41.662  -79.068  -128.826 1.00 63.67  ? 26   ILE G CG1 1 
ATOM   8350  C  CG2 . ILE G  3 27  ? 42.485  -80.714  -130.514 1.00 61.90  ? 26   ILE G CG2 1 
ATOM   8351  C  CD1 . ILE G  3 27  ? 43.078  -78.588  -128.655 1.00 64.56  ? 26   ILE G CD1 1 
ATOM   8352  N  N   . TYR G  3 28  ? 39.304  -82.838  -128.640 1.00 61.86  ? 27   TYR G N   1 
ATOM   8353  C  CA  . TYR G  3 28  ? 38.671  -83.641  -127.605 1.00 61.85  ? 27   TYR G CA  1 
ATOM   8354  C  C   . TYR G  3 28  ? 39.732  -84.396  -126.813 1.00 60.95  ? 27   TYR G C   1 
ATOM   8355  O  O   . TYR G  3 28  ? 40.046  -85.545  -127.115 1.00 59.87  ? 27   TYR G O   1 
ATOM   8356  C  CB  . TYR G  3 28  ? 37.681  -84.626  -128.241 1.00 61.85  ? 27   TYR G CB  1 
ATOM   8357  C  CG  . TYR G  3 28  ? 36.381  -83.996  -128.702 1.00 61.85  ? 27   TYR G CG  1 
ATOM   8358  C  CD1 . TYR G  3 28  ? 35.448  -83.532  -127.775 1.00 61.91  ? 27   TYR G CD1 1 
ATOM   8359  C  CD2 . TYR G  3 28  ? 36.078  -83.875  -130.063 1.00 62.26  ? 27   TYR G CD2 1 
ATOM   8360  C  CE1 . TYR G  3 28  ? 34.243  -82.966  -128.181 1.00 63.15  ? 27   TYR G CE1 1 
ATOM   8361  C  CE2 . TYR G  3 28  ? 34.870  -83.306  -130.485 1.00 62.88  ? 27   TYR G CE2 1 
ATOM   8362  C  CZ  . TYR G  3 28  ? 33.956  -82.855  -129.534 1.00 63.56  ? 27   TYR G CZ  1 
ATOM   8363  O  OH  . TYR G  3 28  ? 32.753  -82.301  -129.918 1.00 62.81  ? 27   TYR G OH  1 
ATOM   8364  N  N   . LEU G  3 29  ? 40.274  -83.735  -125.796 1.00 60.11  ? 28   LEU G N   1 
ATOM   8365  C  CA  . LEU G  3 29  ? 41.314  -84.307  -124.947 1.00 60.74  ? 28   LEU G CA  1 
ATOM   8366  C  C   . LEU G  3 29  ? 40.722  -85.232  -123.869 1.00 62.48  ? 28   LEU G C   1 
ATOM   8367  O  O   . LEU G  3 29  ? 39.612  -84.981  -123.387 1.00 63.00  ? 28   LEU G O   1 
ATOM   8368  C  CB  . LEU G  3 29  ? 42.103  -83.165  -124.302 1.00 57.58  ? 28   LEU G CB  1 
ATOM   8369  C  CG  . LEU G  3 29  ? 42.675  -82.135  -125.279 1.00 55.23  ? 28   LEU G CG  1 
ATOM   8370  C  CD1 . LEU G  3 29  ? 43.479  -81.102  -124.512 1.00 54.70  ? 28   LEU G CD1 1 
ATOM   8371  C  CD2 . LEU G  3 29  ? 43.554  -82.823  -126.310 1.00 54.21  ? 28   LEU G CD2 1 
ATOM   8372  N  N   . ILE G  3 30  ? 41.445  -86.295  -123.488 1.00 63.13  ? 29   ILE G N   1 
ATOM   8373  C  CA  . ILE G  3 30  ? 40.916  -87.215  -122.468 1.00 64.58  ? 29   ILE G CA  1 
ATOM   8374  C  C   . ILE G  3 30  ? 40.507  -86.444  -121.216 1.00 65.39  ? 29   ILE G C   1 
ATOM   8375  O  O   . ILE G  3 30  ? 39.577  -86.838  -120.502 1.00 65.83  ? 29   ILE G O   1 
ATOM   8376  C  CB  . ILE G  3 30  ? 41.948  -88.319  -122.072 1.00 65.47  ? 29   ILE G CB  1 
ATOM   8377  C  CG1 . ILE G  3 30  ? 43.273  -87.677  -121.688 1.00 67.11  ? 29   ILE G CG1 1 
ATOM   8378  C  CG2 . ILE G  3 30  ? 42.235  -89.260  -123.262 1.00 65.88  ? 29   ILE G CG2 1 
ATOM   8379  C  CD1 . ILE G  3 30  ? 44.534  -88.614  -121.977 1.00 68.52  ? 29   ILE G CD1 1 
ATOM   8380  N  N   . GLY G  3 31  ? 41.197  -85.331  -120.970 1.00 67.01  ? 30   GLY G N   1 
ATOM   8381  C  CA  . GLY G  3 31  ? 40.912  -84.516  -119.804 1.00 67.91  ? 30   GLY G CA  1 
ATOM   8382  C  C   . GLY G  3 31  ? 39.743  -83.567  -119.970 1.00 68.12  ? 30   GLY G C   1 
ATOM   8383  O  O   . GLY G  3 31  ? 38.874  -83.481  -119.108 1.00 69.23  ? 30   GLY G O   1 
ATOM   8384  N  N   . GLY G  3 32  ? 39.717  -82.846  -121.080 1.00 70.20  ? 31   GLY G N   1 
ATOM   8385  C  CA  . GLY G  3 32  ? 38.636  -81.911  -121.307 1.00 70.85  ? 31   GLY G CA  1 
ATOM   8386  C  C   . GLY G  3 32  ? 38.425  -81.589  -122.770 1.00 71.70  ? 31   GLY G C   1 
ATOM   8387  O  O   . GLY G  3 32  ? 39.031  -82.186  -123.658 1.00 71.89  ? 31   GLY G O   1 
ATOM   8388  N  N   . ASP G  3 33  ? 37.562  -80.616  -123.013 1.00 73.53  ? 32   ASP G N   1 
ATOM   8389  C  CA  . ASP G  3 33  ? 37.231  -80.195  -124.360 1.00 75.03  ? 32   ASP G CA  1 
ATOM   8390  C  C   . ASP G  3 33  ? 37.725  -78.780  -124.651 1.00 75.06  ? 32   ASP G C   1 
ATOM   8391  O  O   . ASP G  3 33  ? 37.146  -77.801  -124.179 1.00 73.97  ? 32   ASP G O   1 
ATOM   8392  C  CB  . ASP G  3 33  ? 35.713  -80.276  -124.542 1.00 77.44  ? 32   ASP G CB  1 
ATOM   8393  C  CG  . ASP G  3 33  ? 35.242  -79.615  -125.815 1.00 80.26  ? 32   ASP G CG  1 
ATOM   8394  O  OD1 . ASP G  3 33  ? 35.778  -79.972  -126.887 1.00 82.53  ? 32   ASP G OD1 1 
ATOM   8395  O  OD2 . ASP G  3 33  ? 34.338  -78.746  -125.745 1.00 80.41  ? 32   ASP G OD2 1 
ATOM   8396  N  N   . LEU G  3 34  ? 38.802  -78.674  -125.422 1.00 75.30  ? 33   LEU G N   1 
ATOM   8397  C  CA  . LEU G  3 34  ? 39.339  -77.366  -125.774 1.00 76.50  ? 33   LEU G CA  1 
ATOM   8398  C  C   . LEU G  3 34  ? 38.718  -76.865  -127.069 1.00 78.19  ? 33   LEU G C   1 
ATOM   8399  O  O   . LEU G  3 34  ? 39.017  -77.369  -128.152 1.00 77.06  ? 33   LEU G O   1 
ATOM   8400  C  CB  . LEU G  3 34  ? 40.864  -77.420  -125.904 1.00 74.57  ? 33   LEU G CB  1 
ATOM   8401  C  CG  . LEU G  3 34  ? 41.627  -77.330  -124.583 1.00 72.48  ? 33   LEU G CG  1 
ATOM   8402  C  CD1 . LEU G  3 34  ? 43.114  -77.381  -124.852 1.00 72.12  ? 33   LEU G CD1 1 
ATOM   8403  C  CD2 . LEU G  3 34  ? 41.258  -76.040  -123.868 1.00 70.69  ? 33   LEU G CD2 1 
ATOM   8404  N  N   . GLY G  3 35  ? 37.848  -75.867  -126.932 1.00 81.20  ? 34   GLY G N   1 
ATOM   8405  C  CA  . GLY G  3 35  ? 37.147  -75.279  -128.063 1.00 83.99  ? 34   GLY G CA  1 
ATOM   8406  C  C   . GLY G  3 35  ? 37.961  -75.013  -129.318 1.00 85.66  ? 34   GLY G C   1 
ATOM   8407  O  O   . GLY G  3 35  ? 39.171  -75.254  -129.343 1.00 86.65  ? 34   GLY G O   1 
ATOM   8408  N  N   . PRO G  3 36  ? 37.312  -74.493  -130.377 1.00 86.23  ? 35   PRO G N   1 
ATOM   8409  C  CA  . PRO G  3 36  ? 37.868  -74.154  -131.694 1.00 86.74  ? 35   PRO G CA  1 
ATOM   8410  C  C   . PRO G  3 36  ? 38.825  -72.964  -131.691 1.00 87.49  ? 35   PRO G C   1 
ATOM   8411  O  O   . PRO G  3 36  ? 38.585  -71.960  -131.018 1.00 86.78  ? 35   PRO G O   1 
ATOM   8412  C  CB  . PRO G  3 36  ? 36.626  -73.874  -132.514 1.00 86.57  ? 35   PRO G CB  1 
ATOM   8413  C  CG  . PRO G  3 36  ? 35.761  -73.185  -131.508 1.00 87.03  ? 35   PRO G CG  1 
ATOM   8414  C  CD  . PRO G  3 36  ? 35.899  -74.084  -130.300 1.00 86.36  ? 35   PRO G CD  1 
ATOM   8415  N  N   . PHE G  3 37  ? 39.896  -73.079  -132.471 1.00 88.67  ? 36   PHE G N   1 
ATOM   8416  C  CA  . PHE G  3 37  ? 40.911  -72.034  -132.557 1.00 90.22  ? 36   PHE G CA  1 
ATOM   8417  C  C   . PHE G  3 37  ? 40.827  -71.224  -133.839 1.00 90.61  ? 36   PHE G C   1 
ATOM   8418  O  O   . PHE G  3 37  ? 41.162  -71.712  -134.918 1.00 90.78  ? 36   PHE G O   1 
ATOM   8419  C  CB  . PHE G  3 37  ? 42.308  -72.652  -132.453 1.00 91.39  ? 36   PHE G CB  1 
ATOM   8420  C  CG  . PHE G  3 37  ? 42.535  -73.411  -131.185 1.00 91.98  ? 36   PHE G CG  1 
ATOM   8421  C  CD1 . PHE G  3 37  ? 42.766  -72.739  -129.991 1.00 92.18  ? 36   PHE G CD1 1 
ATOM   8422  C  CD2 . PHE G  3 37  ? 42.469  -74.800  -131.172 1.00 92.03  ? 36   PHE G CD2 1 
ATOM   8423  C  CE1 . PHE G  3 37  ? 42.926  -73.437  -128.803 1.00 92.39  ? 36   PHE G CE1 1 
ATOM   8424  C  CE2 . PHE G  3 37  ? 42.626  -75.508  -129.990 1.00 92.04  ? 36   PHE G CE2 1 
ATOM   8425  C  CZ  . PHE G  3 37  ? 42.855  -74.826  -128.802 1.00 92.44  ? 36   PHE G CZ  1 
ATOM   8426  N  N   . ASN G  3 38  ? 40.385  -69.979  -133.709 1.00 90.87  ? 37   ASN G N   1 
ATOM   8427  C  CA  . ASN G  3 38  ? 40.273  -69.082  -134.851 1.00 90.61  ? 37   ASN G CA  1 
ATOM   8428  C  C   . ASN G  3 38  ? 41.115  -67.844  -134.579 1.00 89.56  ? 37   ASN G C   1 
ATOM   8429  O  O   . ASN G  3 38  ? 40.831  -67.080  -133.657 1.00 89.65  ? 37   ASN G O   1 
ATOM   8430  C  CB  . ASN G  3 38  ? 38.810  -68.700  -135.082 1.00 91.21  ? 37   ASN G CB  1 
ATOM   8431  C  CG  . ASN G  3 38  ? 37.979  -69.869  -135.586 1.00 92.30  ? 37   ASN G CG  1 
ATOM   8432  O  OD1 . ASN G  3 38  ? 36.778  -69.735  -135.830 1.00 92.93  ? 37   ASN G OD1 1 
ATOM   8433  N  ND2 . ASN G  3 38  ? 38.618  -71.024  -135.749 1.00 92.72  ? 37   ASN G ND2 1 
ATOM   8434  N  N   . PRO G  3 39  ? 42.162  -67.627  -135.389 1.00 88.58  ? 38   PRO G N   1 
ATOM   8435  C  CA  . PRO G  3 39  ? 43.048  -66.472  -135.219 1.00 88.38  ? 38   PRO G CA  1 
ATOM   8436  C  C   . PRO G  3 39  ? 42.339  -65.174  -134.845 1.00 87.85  ? 38   PRO G C   1 
ATOM   8437  O  O   . PRO G  3 39  ? 41.185  -64.959  -135.211 1.00 87.90  ? 38   PRO G O   1 
ATOM   8438  C  CB  . PRO G  3 39  ? 43.781  -66.393  -136.562 1.00 87.80  ? 38   PRO G CB  1 
ATOM   8439  C  CG  . PRO G  3 39  ? 42.856  -67.081  -137.511 1.00 87.44  ? 38   PRO G CG  1 
ATOM   8440  C  CD  . PRO G  3 39  ? 42.370  -68.245  -136.708 1.00 87.97  ? 38   PRO G CD  1 
ATOM   8441  N  N   . GLY G  3 40  ? 43.038  -64.325  -134.096 1.00 86.99  ? 39   GLY G N   1 
ATOM   8442  C  CA  . GLY G  3 40  ? 42.472  -63.056  -133.676 1.00 86.24  ? 39   GLY G CA  1 
ATOM   8443  C  C   . GLY G  3 40  ? 41.414  -63.172  -132.593 1.00 85.94  ? 39   GLY G C   1 
ATOM   8444  O  O   . GLY G  3 40  ? 40.939  -62.160  -132.081 1.00 85.60  ? 39   GLY G O   1 
ATOM   8445  N  N   . LEU G  3 41  ? 41.046  -64.398  -132.235 1.00 86.58  ? 40   LEU G N   1 
ATOM   8446  C  CA  . LEU G  3 41  ? 40.030  -64.619  -131.208 1.00 87.39  ? 40   LEU G CA  1 
ATOM   8447  C  C   . LEU G  3 41  ? 40.551  -65.257  -129.918 1.00 87.58  ? 40   LEU G C   1 
ATOM   8448  O  O   . LEU G  3 41  ? 41.379  -66.170  -129.947 1.00 87.82  ? 40   LEU G O   1 
ATOM   8449  C  CB  . LEU G  3 41  ? 38.888  -65.476  -131.764 1.00 88.02  ? 40   LEU G CB  1 
ATOM   8450  C  CG  . LEU G  3 41  ? 37.848  -64.789  -132.654 1.00 87.94  ? 40   LEU G CG  1 
ATOM   8451  C  CD1 . LEU G  3 41  ? 37.127  -63.714  -131.854 1.00 87.11  ? 40   LEU G CD1 1 
ATOM   8452  C  CD2 . LEU G  3 41  ? 38.522  -64.194  -133.876 1.00 88.40  ? 40   LEU G CD2 1 
ATOM   8453  N  N   . PRO G  3 42  ? 40.055  -64.776  -128.764 1.00 87.63  ? 41   PRO G N   1 
ATOM   8454  C  CA  . PRO G  3 42  ? 40.405  -65.231  -127.413 1.00 86.88  ? 41   PRO G CA  1 
ATOM   8455  C  C   . PRO G  3 42  ? 40.004  -66.683  -127.153 1.00 85.96  ? 41   PRO G C   1 
ATOM   8456  O  O   . PRO G  3 42  ? 38.856  -67.067  -127.391 1.00 86.17  ? 41   PRO G O   1 
ATOM   8457  C  CB  . PRO G  3 42  ? 39.627  -64.268  -126.514 1.00 87.03  ? 41   PRO G CB  1 
ATOM   8458  C  CG  . PRO G  3 42  ? 39.531  -63.029  -127.340 1.00 87.23  ? 41   PRO G CG  1 
ATOM   8459  C  CD  . PRO G  3 42  ? 39.182  -63.590  -128.692 1.00 87.88  ? 41   PRO G CD  1 
ATOM   8460  N  N   . VAL G  3 43  ? 40.943  -67.482  -126.650 1.00 84.42  ? 42   VAL G N   1 
ATOM   8461  C  CA  . VAL G  3 43  ? 40.669  -68.887  -126.355 1.00 82.36  ? 42   VAL G CA  1 
ATOM   8462  C  C   . VAL G  3 43  ? 41.274  -69.300  -125.020 1.00 80.34  ? 42   VAL G C   1 
ATOM   8463  O  O   . VAL G  3 43  ? 42.495  -69.379  -124.892 1.00 80.22  ? 42   VAL G O   1 
ATOM   8464  C  CB  . VAL G  3 43  ? 41.255  -69.829  -127.443 1.00 82.71  ? 42   VAL G CB  1 
ATOM   8465  C  CG1 . VAL G  3 43  ? 40.682  -71.230  -127.281 1.00 81.46  ? 42   VAL G CG1 1 
ATOM   8466  C  CG2 . VAL G  3 43  ? 40.965  -69.282  -128.835 1.00 83.69  ? 42   VAL G CG2 1 
ATOM   8467  N  N   . GLU G  3 44  ? 40.428  -69.559  -124.026 1.00 77.99  ? 43   GLU G N   1 
ATOM   8468  C  CA  . GLU G  3 44  ? 40.921  -69.996  -122.723 1.00 75.36  ? 43   GLU G CA  1 
ATOM   8469  C  C   . GLU G  3 44  ? 41.479  -71.406  -122.877 1.00 72.65  ? 43   GLU G C   1 
ATOM   8470  O  O   . GLU G  3 44  ? 40.760  -72.335  -123.237 1.00 71.73  ? 43   GLU G O   1 
ATOM   8471  C  CB  . GLU G  3 44  ? 39.799  -69.990  -121.686 1.00 75.80  ? 43   GLU G CB  1 
ATOM   8472  C  CG  . GLU G  3 44  ? 39.322  -68.604  -121.320 1.00 78.46  ? 43   GLU G CG  1 
ATOM   8473  C  CD  . GLU G  3 44  ? 38.372  -68.600  -120.135 1.00 80.99  ? 43   GLU G CD  1 
ATOM   8474  O  OE1 . GLU G  3 44  ? 37.948  -67.499  -119.715 1.00 82.77  ? 43   GLU G OE1 1 
ATOM   8475  O  OE2 . GLU G  3 44  ? 38.046  -69.692  -119.621 1.00 81.42  ? 43   GLU G OE2 1 
ATOM   8476  N  N   . VAL G  3 45  ? 42.766  -71.563  -122.596 1.00 70.35  ? 44   VAL G N   1 
ATOM   8477  C  CA  . VAL G  3 45  ? 43.417  -72.857  -122.739 1.00 67.03  ? 44   VAL G CA  1 
ATOM   8478  C  C   . VAL G  3 45  ? 44.319  -73.150  -121.526 1.00 64.73  ? 44   VAL G C   1 
ATOM   8479  O  O   . VAL G  3 45  ? 44.656  -72.246  -120.760 1.00 63.56  ? 44   VAL G O   1 
ATOM   8480  C  CB  . VAL G  3 45  ? 44.249  -72.860  -124.062 1.00 66.53  ? 44   VAL G CB  1 
ATOM   8481  C  CG1 . VAL G  3 45  ? 45.556  -72.120  -123.865 1.00 65.83  ? 44   VAL G CG1 1 
ATOM   8482  C  CG2 . VAL G  3 45  ? 44.475  -74.266  -124.554 1.00 66.83  ? 44   VAL G CG2 1 
ATOM   8483  N  N   . PRO G  3 46  ? 44.680  -74.428  -121.310 1.00 63.01  ? 45   PRO G N   1 
ATOM   8484  C  CA  . PRO G  3 46  ? 45.547  -74.744  -120.175 1.00 61.38  ? 45   PRO G CA  1 
ATOM   8485  C  C   . PRO G  3 46  ? 46.891  -74.043  -120.357 1.00 59.40  ? 45   PRO G C   1 
ATOM   8486  O  O   . PRO G  3 46  ? 47.429  -73.980  -121.467 1.00 58.47  ? 45   PRO G O   1 
ATOM   8487  C  CB  . PRO G  3 46  ? 45.677  -76.262  -120.255 1.00 62.15  ? 45   PRO G CB  1 
ATOM   8488  C  CG  . PRO G  3 46  ? 44.365  -76.676  -120.783 1.00 62.95  ? 45   PRO G CG  1 
ATOM   8489  C  CD  . PRO G  3 46  ? 44.127  -75.667  -121.886 1.00 63.35  ? 45   PRO G CD  1 
ATOM   8490  N  N   . LEU G  3 47  ? 47.430  -73.531  -119.259 1.00 57.07  ? 46   LEU G N   1 
ATOM   8491  C  CA  . LEU G  3 47  ? 48.696  -72.820  -119.283 1.00 54.52  ? 46   LEU G CA  1 
ATOM   8492  C  C   . LEU G  3 47  ? 49.802  -73.597  -119.979 1.00 52.89  ? 46   LEU G C   1 
ATOM   8493  O  O   . LEU G  3 47  ? 50.598  -73.018  -120.711 1.00 52.51  ? 46   LEU G O   1 
ATOM   8494  C  CB  . LEU G  3 47  ? 49.111  -72.460  -117.849 1.00 54.85  ? 46   LEU G CB  1 
ATOM   8495  C  CG  . LEU G  3 47  ? 50.320  -71.551  -117.617 1.00 54.95  ? 46   LEU G CG  1 
ATOM   8496  C  CD1 . LEU G  3 47  ? 51.595  -72.367  -117.627 1.00 56.51  ? 46   LEU G CD1 1 
ATOM   8497  C  CD2 . LEU G  3 47  ? 50.359  -70.466  -118.676 1.00 55.29  ? 46   LEU G CD2 1 
ATOM   8498  N  N   . TRP G  3 48  ? 49.848  -74.907  -119.769 1.00 52.07  ? 47   TRP G N   1 
ATOM   8499  C  CA  . TRP G  3 48  ? 50.897  -75.707  -120.385 1.00 51.78  ? 47   TRP G CA  1 
ATOM   8500  C  C   . TRP G  3 48  ? 50.825  -75.677  -121.891 1.00 52.62  ? 47   TRP G C   1 
ATOM   8501  O  O   . TRP G  3 48  ? 51.856  -75.670  -122.561 1.00 53.36  ? 47   TRP G O   1 
ATOM   8502  C  CB  . TRP G  3 48  ? 50.861  -77.168  -119.902 1.00 51.04  ? 47   TRP G CB  1 
ATOM   8503  C  CG  . TRP G  3 48  ? 49.570  -77.905  -120.121 1.00 50.30  ? 47   TRP G CG  1 
ATOM   8504  C  CD1 . TRP G  3 48  ? 48.508  -77.976  -119.263 1.00 50.14  ? 47   TRP G CD1 1 
ATOM   8505  C  CD2 . TRP G  3 48  ? 49.207  -78.676  -121.270 1.00 51.05  ? 47   TRP G CD2 1 
ATOM   8506  N  NE1 . TRP G  3 48  ? 47.505  -78.744  -119.805 1.00 49.88  ? 47   TRP G NE1 1 
ATOM   8507  C  CE2 . TRP G  3 48  ? 47.906  -79.186  -121.038 1.00 51.85  ? 47   TRP G CE2 1 
ATOM   8508  C  CE3 . TRP G  3 48  ? 49.851  -78.984  -122.479 1.00 51.77  ? 47   TRP G CE3 1 
ATOM   8509  C  CZ2 . TRP G  3 48  ? 47.235  -79.992  -121.974 1.00 52.16  ? 47   TRP G CZ2 1 
ATOM   8510  C  CZ3 . TRP G  3 48  ? 49.184  -79.788  -123.412 1.00 51.72  ? 47   TRP G CZ3 1 
ATOM   8511  C  CH2 . TRP G  3 48  ? 47.888  -80.281  -123.150 1.00 51.54  ? 47   TRP G CH2 1 
ATOM   8512  N  N   . LEU G  3 49  ? 49.610  -75.660  -122.427 1.00 53.29  ? 48   LEU G N   1 
ATOM   8513  C  CA  . LEU G  3 49  ? 49.445  -75.638  -123.869 1.00 53.81  ? 48   LEU G CA  1 
ATOM   8514  C  C   . LEU G  3 49  ? 49.794  -74.259  -124.414 1.00 53.36  ? 48   LEU G C   1 
ATOM   8515  O  O   . LEU G  3 49  ? 50.416  -74.145  -125.473 1.00 51.13  ? 48   LEU G O   1 
ATOM   8516  C  CB  . LEU G  3 49  ? 48.016  -76.030  -124.245 1.00 55.50  ? 48   LEU G CB  1 
ATOM   8517  C  CG  . LEU G  3 49  ? 47.723  -76.061  -125.751 1.00 56.57  ? 48   LEU G CG  1 
ATOM   8518  C  CD1 . LEU G  3 49  ? 46.736  -77.164  -126.089 1.00 55.93  ? 48   LEU G CD1 1 
ATOM   8519  C  CD2 . LEU G  3 49  ? 47.180  -74.700  -126.172 1.00 57.65  ? 48   LEU G CD2 1 
ATOM   8520  N  N   . ALA G  3 50  ? 49.405  -73.221  -123.676 1.00 53.08  ? 49   ALA G N   1 
ATOM   8521  C  CA  . ALA G  3 50  ? 49.683  -71.841  -124.062 1.00 53.81  ? 49   ALA G CA  1 
ATOM   8522  C  C   . ALA G  3 50  ? 51.186  -71.665  -124.205 1.00 55.35  ? 49   ALA G C   1 
ATOM   8523  O  O   . ALA G  3 50  ? 51.681  -71.183  -125.223 1.00 53.92  ? 49   ALA G O   1 
ATOM   8524  C  CB  . ALA G  3 50  ? 49.150  -70.893  -123.006 1.00 53.16  ? 49   ALA G CB  1 
ATOM   8525  N  N   . ILE G  3 51  ? 51.908  -72.064  -123.166 1.00 58.09  ? 50   ILE G N   1 
ATOM   8526  C  CA  . ILE G  3 51  ? 53.359  -71.973  -123.158 1.00 60.53  ? 50   ILE G CA  1 
ATOM   8527  C  C   . ILE G  3 51  ? 53.924  -72.607  -124.430 1.00 63.40  ? 50   ILE G C   1 
ATOM   8528  O  O   . ILE G  3 51  ? 54.779  -72.026  -125.100 1.00 64.81  ? 50   ILE G O   1 
ATOM   8529  C  CB  . ILE G  3 51  ? 53.955  -72.704  -121.921 1.00 58.79  ? 50   ILE G CB  1 
ATOM   8530  C  CG1 . ILE G  3 51  ? 53.419  -72.081  -120.630 1.00 58.38  ? 50   ILE G CG1 1 
ATOM   8531  C  CG2 . ILE G  3 51  ? 55.464  -72.622  -121.944 1.00 58.40  ? 50   ILE G CG2 1 
ATOM   8532  C  CD1 . ILE G  3 51  ? 53.676  -70.593  -120.504 1.00 57.53  ? 50   ILE G CD1 1 
ATOM   8533  N  N   . ASN G  3 52  ? 53.430  -73.797  -124.762 1.00 65.85  ? 51   ASN G N   1 
ATOM   8534  C  CA  . ASN G  3 52  ? 53.897  -74.528  -125.937 1.00 67.59  ? 51   ASN G CA  1 
ATOM   8535  C  C   . ASN G  3 52  ? 53.600  -73.825  -127.253 1.00 69.38  ? 51   ASN G C   1 
ATOM   8536  O  O   . ASN G  3 52  ? 54.394  -73.902  -128.190 1.00 69.08  ? 51   ASN G O   1 
ATOM   8537  C  CB  . ASN G  3 52  ? 53.274  -75.918  -125.982 1.00 67.02  ? 51   ASN G CB  1 
ATOM   8538  C  CG  . ASN G  3 52  ? 53.926  -76.804  -127.017 1.00 66.97  ? 51   ASN G CG  1 
ATOM   8539  O  OD1 . ASN G  3 52  ? 54.850  -77.561  -126.711 1.00 67.03  ? 51   ASN G OD1 1 
ATOM   8540  N  ND2 . ASN G  3 52  ? 53.464  -76.701  -128.257 1.00 66.72  ? 51   ASN G ND2 1 
ATOM   8541  N  N   . LEU G  3 53  ? 52.448  -73.159  -127.326 1.00 71.67  ? 52   LEU G N   1 
ATOM   8542  C  CA  . LEU G  3 53  ? 52.047  -72.437  -128.535 1.00 72.76  ? 52   LEU G CA  1 
ATOM   8543  C  C   . LEU G  3 53  ? 52.950  -71.229  -128.765 1.00 75.11  ? 52   LEU G C   1 
ATOM   8544  O  O   . LEU G  3 53  ? 53.678  -71.182  -129.756 1.00 75.86  ? 52   LEU G O   1 
ATOM   8545  C  CB  . LEU G  3 53  ? 50.594  -71.961  -128.434 1.00 69.51  ? 52   LEU G CB  1 
ATOM   8546  C  CG  . LEU G  3 53  ? 49.477  -72.997  -128.328 1.00 67.26  ? 52   LEU G CG  1 
ATOM   8547  C  CD1 . LEU G  3 53  ? 48.157  -72.278  -128.147 1.00 66.65  ? 52   LEU G CD1 1 
ATOM   8548  C  CD2 . LEU G  3 53  ? 49.452  -73.870  -129.564 1.00 65.55  ? 52   LEU G CD2 1 
ATOM   8549  N  N   . LYS G  3 54  ? 52.911  -70.259  -127.851 1.00 76.98  ? 53   LYS G N   1 
ATOM   8550  C  CA  . LYS G  3 54  ? 53.735  -69.063  -127.988 1.00 78.51  ? 53   LYS G CA  1 
ATOM   8551  C  C   . LYS G  3 54  ? 55.206  -69.402  -128.161 1.00 79.09  ? 53   LYS G C   1 
ATOM   8552  O  O   . LYS G  3 54  ? 56.011  -68.552  -128.524 1.00 78.83  ? 53   LYS G O   1 
ATOM   8553  C  CB  . LYS G  3 54  ? 53.577  -68.141  -126.780 1.00 78.83  ? 53   LYS G CB  1 
ATOM   8554  C  CG  . LYS G  3 54  ? 54.397  -66.868  -126.917 1.00 80.37  ? 53   LYS G CG  1 
ATOM   8555  C  CD  . LYS G  3 54  ? 53.985  -65.786  -125.941 1.00 81.25  ? 53   LYS G CD  1 
ATOM   8556  C  CE  . LYS G  3 54  ? 54.703  -64.483  -126.274 1.00 81.51  ? 53   LYS G CE  1 
ATOM   8557  N  NZ  . LYS G  3 54  ? 54.466  -64.076  -127.690 1.00 80.52  ? 53   LYS G NZ  1 
ATOM   8558  N  N   . GLN G  3 55  ? 55.553  -70.652  -127.901 1.00 80.91  ? 54   GLN G N   1 
ATOM   8559  C  CA  . GLN G  3 55  ? 56.928  -71.092  -128.035 1.00 83.75  ? 54   GLN G CA  1 
ATOM   8560  C  C   . GLN G  3 55  ? 57.133  -71.576  -129.468 1.00 84.89  ? 54   GLN G C   1 
ATOM   8561  O  O   . GLN G  3 55  ? 58.263  -71.737  -129.934 1.00 84.98  ? 54   GLN G O   1 
ATOM   8562  C  CB  . GLN G  3 55  ? 57.203  -72.207  -127.028 1.00 85.63  ? 54   GLN G CB  1 
ATOM   8563  C  CG  . GLN G  3 55  ? 58.614  -72.224  -126.487 1.00 87.86  ? 54   GLN G CG  1 
ATOM   8564  C  CD  . GLN G  3 55  ? 58.704  -72.955  -125.166 1.00 88.97  ? 54   GLN G CD  1 
ATOM   8565  O  OE1 . GLN G  3 55  ? 58.353  -74.131  -125.069 1.00 90.08  ? 54   GLN G OE1 1 
ATOM   8566  N  NE2 . GLN G  3 55  ? 59.174  -72.259  -124.137 1.00 89.45  ? 54   GLN G NE2 1 
ATOM   8567  N  N   . ARG G  3 56  ? 56.015  -71.813  -130.151 1.00 85.87  ? 55   ARG G N   1 
ATOM   8568  C  CA  . ARG G  3 56  ? 55.994  -72.243  -131.548 1.00 87.22  ? 55   ARG G CA  1 
ATOM   8569  C  C   . ARG G  3 56  ? 55.499  -71.018  -132.294 1.00 88.27  ? 55   ARG G C   1 
ATOM   8570  O  O   . ARG G  3 56  ? 55.286  -71.037  -133.509 1.00 87.90  ? 55   ARG G O   1 
ATOM   8571  C  CB  . ARG G  3 56  ? 54.999  -73.384  -131.751 1.00 87.59  ? 55   ARG G CB  1 
ATOM   8572  C  CG  . ARG G  3 56  ? 55.481  -74.750  -131.316 1.00 88.04  ? 55   ARG G CG  1 
ATOM   8573  C  CD  . ARG G  3 56  ? 54.339  -75.749  -131.382 1.00 88.25  ? 55   ARG G CD  1 
ATOM   8574  N  NE  . ARG G  3 56  ? 54.810  -77.128  -131.427 1.00 89.00  ? 55   ARG G NE  1 
ATOM   8575  C  CZ  . ARG G  3 56  ? 54.013  -78.188  -131.357 1.00 89.56  ? 55   ARG G CZ  1 
ATOM   8576  N  NH1 . ARG G  3 56  ? 52.704  -78.029  -131.233 1.00 89.26  ? 55   ARG G NH1 1 
ATOM   8577  N  NH2 . ARG G  3 56  ? 54.523  -79.410  -131.424 1.00 90.32  ? 55   ARG G NH2 1 
ATOM   8578  N  N   . GLN G  3 57  ? 55.300  -69.959  -131.514 1.00 89.44  ? 56   GLN G N   1 
ATOM   8579  C  CA  . GLN G  3 57  ? 54.826  -68.670  -131.991 1.00 90.26  ? 56   GLN G CA  1 
ATOM   8580  C  C   . GLN G  3 57  ? 53.403  -68.726  -132.553 1.00 90.04  ? 56   GLN G C   1 
ATOM   8581  O  O   . GLN G  3 57  ? 52.860  -67.710  -132.972 1.00 90.30  ? 56   GLN G O   1 
ATOM   8582  C  CB  . GLN G  3 57  ? 55.798  -68.109  -133.035 1.00 91.08  ? 56   GLN G CB  1 
ATOM   8583  C  CG  . GLN G  3 57  ? 55.790  -66.591  -133.107 1.00 93.46  ? 56   GLN G CG  1 
ATOM   8584  C  CD  . GLN G  3 57  ? 56.067  -65.949  -131.757 1.00 94.98  ? 56   GLN G CD  1 
ATOM   8585  O  OE1 . GLN G  3 57  ? 57.159  -66.090  -131.206 1.00 95.93  ? 56   GLN G OE1 1 
ATOM   8586  N  NE2 . GLN G  3 57  ? 55.073  -65.246  -131.214 1.00 95.64  ? 56   GLN G NE2 1 
ATOM   8587  N  N   . LYS G  3 58  ? 52.792  -69.906  -132.540 1.00 89.82  ? 57   LYS G N   1 
ATOM   8588  C  CA  . LYS G  3 58  ? 51.440  -70.055  -133.059 1.00 89.73  ? 57   LYS G CA  1 
ATOM   8589  C  C   . LYS G  3 58  ? 50.348  -69.385  -132.229 1.00 90.11  ? 57   LYS G C   1 
ATOM   8590  O  O   . LYS G  3 58  ? 49.168  -69.565  -132.513 1.00 90.22  ? 57   LYS G O   1 
ATOM   8591  C  CB  . LYS G  3 58  ? 51.093  -71.534  -133.242 1.00 89.45  ? 57   LYS G CB  1 
ATOM   8592  C  CG  . LYS G  3 58  ? 51.837  -72.204  -134.377 1.00 89.78  ? 57   LYS G CG  1 
ATOM   8593  C  CD  . LYS G  3 58  ? 51.160  -73.503  -134.780 1.00 90.16  ? 57   LYS G CD  1 
ATOM   8594  C  CE  . LYS G  3 58  ? 51.828  -74.115  -136.005 1.00 90.98  ? 57   LYS G CE  1 
ATOM   8595  N  NZ  . LYS G  3 58  ? 51.101  -75.313  -136.520 1.00 91.24  ? 57   LYS G NZ  1 
ATOM   8596  N  N   . CYS G  3 59  ? 50.718  -68.619  -131.208 1.00 90.98  ? 58   CYS G N   1 
ATOM   8597  C  CA  . CYS G  3 59  ? 49.701  -67.946  -130.399 1.00 92.03  ? 58   CYS G CA  1 
ATOM   8598  C  C   . CYS G  3 59  ? 50.206  -66.678  -129.724 1.00 93.02  ? 58   CYS G C   1 
ATOM   8599  O  O   . CYS G  3 59  ? 51.330  -66.226  -129.964 1.00 93.51  ? 58   CYS G O   1 
ATOM   8600  C  CB  . CYS G  3 59  ? 49.130  -68.893  -129.333 1.00 92.43  ? 58   CYS G CB  1 
ATOM   8601  S  SG  . CYS G  3 59  ? 50.012  -68.911  -127.754 1.00 90.34  ? 58   CYS G SG  1 
ATOM   8602  N  N   . ARG G  3 60  ? 49.362  -66.119  -128.863 1.00 93.38  ? 59   ARG G N   1 
ATOM   8603  C  CA  . ARG G  3 60  ? 49.680  -64.889  -128.153 1.00 93.61  ? 59   ARG G CA  1 
ATOM   8604  C  C   . ARG G  3 60  ? 49.026  -64.911  -126.769 1.00 93.53  ? 59   ARG G C   1 
ATOM   8605  O  O   . ARG G  3 60  ? 47.801  -64.855  -126.650 1.00 93.25  ? 59   ARG G O   1 
ATOM   8606  C  CB  . ARG G  3 60  ? 49.170  -63.718  -128.990 1.00 94.07  ? 59   ARG G CB  1 
ATOM   8607  C  CG  . ARG G  3 60  ? 49.314  -62.333  -128.407 1.00 95.46  ? 59   ARG G CG  1 
ATOM   8608  C  CD  . ARG G  3 60  ? 48.717  -61.350  -129.398 1.00 96.88  ? 59   ARG G CD  1 
ATOM   8609  N  NE  . ARG G  3 60  ? 48.305  -60.091  -128.793 1.00 98.48  ? 59   ARG G NE  1 
ATOM   8610  C  CZ  . ARG G  3 60  ? 47.425  -59.262  -129.346 1.00 99.29  ? 59   ARG G CZ  1 
ATOM   8611  N  NH1 . ARG G  3 60  ? 47.101  -58.131  -128.733 1.00 100.10 ? 59   ARG G NH1 1 
ATOM   8612  N  NH2 . ARG G  3 60  ? 46.859  -59.572  -130.508 1.00 98.56  ? 59   ARG G NH2 1 
ATOM   8613  N  N   . LEU G  3 61  ? 49.857  -65.003  -125.730 1.00 93.32  ? 60   LEU G N   1 
ATOM   8614  C  CA  . LEU G  3 61  ? 49.386  -65.053  -124.344 1.00 92.93  ? 60   LEU G CA  1 
ATOM   8615  C  C   . LEU G  3 61  ? 48.719  -63.773  -123.865 1.00 92.90  ? 60   LEU G C   1 
ATOM   8616  O  O   . LEU G  3 61  ? 49.335  -62.709  -123.838 1.00 92.76  ? 60   LEU G O   1 
ATOM   8617  C  CB  . LEU G  3 61  ? 50.543  -65.385  -123.399 1.00 92.65  ? 60   LEU G CB  1 
ATOM   8618  C  CG  . LEU G  3 61  ? 50.961  -66.848  -123.224 1.00 92.28  ? 60   LEU G CG  1 
ATOM   8619  C  CD1 . LEU G  3 61  ? 49.840  -67.616  -122.547 1.00 91.80  ? 60   LEU G CD1 1 
ATOM   8620  C  CD2 . LEU G  3 61  ? 51.310  -67.457  -124.565 1.00 92.04  ? 60   LEU G CD2 1 
ATOM   8621  N  N   . LEU G  3 62  ? 47.456  -63.889  -123.477 1.00 92.83  ? 61   LEU G N   1 
ATOM   8622  C  CA  . LEU G  3 62  ? 46.705  -62.747  -122.983 1.00 92.66  ? 61   LEU G CA  1 
ATOM   8623  C  C   . LEU G  3 62  ? 46.890  -62.734  -121.469 1.00 92.54  ? 61   LEU G C   1 
ATOM   8624  O  O   . LEU G  3 62  ? 46.205  -63.452  -120.738 1.00 92.60  ? 61   LEU G O   1 
ATOM   8625  C  CB  . LEU G  3 62  ? 45.223  -62.898  -123.345 1.00 93.30  ? 61   LEU G CB  1 
ATOM   8626  C  CG  . LEU G  3 62  ? 44.304  -61.674  -123.275 1.00 93.05  ? 61   LEU G CG  1 
ATOM   8627  C  CD1 . LEU G  3 62  ? 44.195  -61.169  -121.846 1.00 93.54  ? 61   LEU G CD1 1 
ATOM   8628  C  CD2 . LEU G  3 62  ? 44.847  -60.597  -124.192 1.00 92.61  ? 61   LEU G CD2 1 
ATOM   8629  N  N   . PRO G  3 63  ? 47.835  -61.919  -120.982 1.00 92.16  ? 62   PRO G N   1 
ATOM   8630  C  CA  . PRO G  3 63  ? 48.140  -61.791  -119.555 1.00 91.31  ? 62   PRO G CA  1 
ATOM   8631  C  C   . PRO G  3 63  ? 46.901  -61.718  -118.671 1.00 90.15  ? 62   PRO G C   1 
ATOM   8632  O  O   . PRO G  3 63  ? 45.952  -60.993  -118.975 1.00 89.91  ? 62   PRO G O   1 
ATOM   8633  C  CB  . PRO G  3 63  ? 48.964  -60.512  -119.500 1.00 91.62  ? 62   PRO G CB  1 
ATOM   8634  C  CG  . PRO G  3 63  ? 49.712  -60.561  -120.790 1.00 91.88  ? 62   PRO G CG  1 
ATOM   8635  C  CD  . PRO G  3 63  ? 48.636  -60.965  -121.770 1.00 92.25  ? 62   PRO G CD  1 
ATOM   8636  N  N   . PRO G  3 64  ? 46.900  -62.473  -117.560 1.00 89.29  ? 63   PRO G N   1 
ATOM   8637  C  CA  . PRO G  3 64  ? 45.787  -62.513  -116.606 1.00 88.34  ? 63   PRO G CA  1 
ATOM   8638  C  C   . PRO G  3 64  ? 45.332  -61.149  -116.091 1.00 87.69  ? 63   PRO G C   1 
ATOM   8639  O  O   . PRO G  3 64  ? 46.058  -60.163  -116.159 1.00 87.71  ? 63   PRO G O   1 
ATOM   8640  C  CB  . PRO G  3 64  ? 46.312  -63.424  -115.494 1.00 88.11  ? 63   PRO G CB  1 
ATOM   8641  C  CG  . PRO G  3 64  ? 47.808  -63.350  -115.640 1.00 88.60  ? 63   PRO G CG  1 
ATOM   8642  C  CD  . PRO G  3 64  ? 47.986  -63.365  -117.126 1.00 88.52  ? 63   PRO G CD  1 
ATOM   8643  N  N   . GLU G  3 65  ? 44.111  -61.120  -115.575 1.00 87.44  ? 64   GLU G N   1 
ATOM   8644  C  CA  . GLU G  3 65  ? 43.485  -59.912  -115.057 1.00 87.75  ? 64   GLU G CA  1 
ATOM   8645  C  C   . GLU G  3 65  ? 44.111  -59.347  -113.777 1.00 88.15  ? 64   GLU G C   1 
ATOM   8646  O  O   . GLU G  3 65  ? 43.851  -58.203  -113.407 1.00 87.72  ? 64   GLU G O   1 
ATOM   8647  C  CB  . GLU G  3 65  ? 41.991  -60.185  -114.829 1.00 87.86  ? 64   GLU G CB  1 
ATOM   8648  C  CG  . GLU G  3 65  ? 41.657  -61.293  -113.796 1.00 88.76  ? 64   GLU G CG  1 
ATOM   8649  C  CD  . GLU G  3 65  ? 41.995  -62.731  -114.248 1.00 88.46  ? 64   GLU G CD  1 
ATOM   8650  O  OE1 . GLU G  3 65  ? 41.588  -63.682  -113.544 1.00 86.77  ? 64   GLU G OE1 1 
ATOM   8651  O  OE2 . GLU G  3 65  ? 42.662  -62.925  -115.286 1.00 88.75  ? 64   GLU G OE2 1 
ATOM   8652  N  N   . TRP G  3 66  ? 44.940  -60.143  -113.108 1.00 89.07  ? 65   TRP G N   1 
ATOM   8653  C  CA  . TRP G  3 66  ? 45.580  -59.716  -111.865 1.00 88.97  ? 65   TRP G CA  1 
ATOM   8654  C  C   . TRP G  3 66  ? 47.040  -59.304  -112.012 1.00 89.55  ? 65   TRP G C   1 
ATOM   8655  O  O   . TRP G  3 66  ? 47.584  -58.642  -111.130 1.00 89.48  ? 65   TRP G O   1 
ATOM   8656  C  CB  . TRP G  3 66  ? 45.491  -60.823  -110.806 1.00 87.91  ? 65   TRP G CB  1 
ATOM   8657  C  CG  . TRP G  3 66  ? 46.148  -62.111  -111.214 1.00 86.44  ? 65   TRP G CG  1 
ATOM   8658  C  CD1 . TRP G  3 66  ? 45.546  -63.184  -111.799 1.00 86.11  ? 65   TRP G CD1 1 
ATOM   8659  C  CD2 . TRP G  3 66  ? 47.544  -62.435  -111.122 1.00 86.25  ? 65   TRP G CD2 1 
ATOM   8660  N  NE1 . TRP G  3 66  ? 46.476  -64.155  -112.082 1.00 86.18  ? 65   TRP G NE1 1 
ATOM   8661  C  CE2 . TRP G  3 66  ? 47.711  -63.722  -111.677 1.00 86.22  ? 65   TRP G CE2 1 
ATOM   8662  C  CE3 . TRP G  3 66  ? 48.669  -61.763  -110.626 1.00 86.29  ? 65   TRP G CE3 1 
ATOM   8663  C  CZ2 . TRP G  3 66  ? 48.961  -64.353  -111.752 1.00 85.95  ? 65   TRP G CZ2 1 
ATOM   8664  C  CZ3 . TRP G  3 66  ? 49.913  -62.393  -110.701 1.00 86.20  ? 65   TRP G CZ3 1 
ATOM   8665  C  CH2 . TRP G  3 66  ? 50.045  -63.675  -111.261 1.00 85.28  ? 65   TRP G CH2 1 
HETATM 8666  N  N   . MSE G  3 67  ? 47.683  -59.705  -113.105 1.00 90.36  ? 66   MSE G N   1 
HETATM 8667  C  CA  . MSE G  3 67  ? 49.082  -59.356  -113.312 1.00 91.51  ? 66   MSE G CA  1 
HETATM 8668  C  C   . MSE G  3 67  ? 49.267  -57.890  -113.660 1.00 93.23  ? 66   MSE G C   1 
HETATM 8669  O  O   . MSE G  3 67  ? 49.995  -57.552  -114.594 1.00 93.67  ? 66   MSE G O   1 
HETATM 8670  C  CB  . MSE G  3 67  ? 49.705  -60.219  -114.407 1.00 90.64  ? 66   MSE G CB  1 
HETATM 8671  C  CG  . MSE G  3 67  ? 50.346  -61.484  -113.887 1.00 90.80  ? 66   MSE G CG  1 
HETATM 8672  SE SE  . MSE G  3 67  ? 51.648  -62.206  -115.111 1.00 91.67  ? 66   MSE G SE  1 
HETATM 8673  C  CE  . MSE G  3 67  ? 53.082  -60.959  -114.795 1.00 91.45  ? 66   MSE G CE  1 
ATOM   8674  N  N   . ASP G  3 68  ? 48.610  -57.024  -112.897 1.00 94.99  ? 67   ASP G N   1 
ATOM   8675  C  CA  . ASP G  3 68  ? 48.697  -55.586  -113.108 1.00 96.26  ? 67   ASP G CA  1 
ATOM   8676  C  C   . ASP G  3 68  ? 49.552  -54.918  -112.037 1.00 96.91  ? 67   ASP G C   1 
ATOM   8677  O  O   . ASP G  3 68  ? 49.166  -54.865  -110.870 1.00 96.91  ? 67   ASP G O   1 
ATOM   8678  C  CB  . ASP G  3 68  ? 47.301  -54.970  -113.097 1.00 97.22  ? 67   ASP G CB  1 
ATOM   8679  C  CG  . ASP G  3 68  ? 47.335  -53.463  -113.224 1.00 98.63  ? 67   ASP G CG  1 
ATOM   8680  O  OD1 . ASP G  3 68  ? 47.895  -52.965  -114.224 1.00 98.97  ? 67   ASP G OD1 1 
ATOM   8681  O  OD2 . ASP G  3 68  ? 46.804  -52.777  -112.325 1.00 99.66  ? 67   ASP G OD2 1 
ATOM   8682  N  N   . VAL G  3 69  ? 50.710  -54.405  -112.445 1.00 97.93  ? 68   VAL G N   1 
ATOM   8683  C  CA  . VAL G  3 69  ? 51.633  -53.735  -111.529 1.00 98.49  ? 68   VAL G CA  1 
ATOM   8684  C  C   . VAL G  3 69  ? 50.918  -52.813  -110.541 1.00 98.93  ? 68   VAL G C   1 
ATOM   8685  O  O   . VAL G  3 69  ? 51.249  -52.777  -109.356 1.00 98.98  ? 68   VAL G O   1 
ATOM   8686  C  CB  . VAL G  3 69  ? 52.699  -52.920  -112.314 1.00 97.74  ? 68   VAL G CB  1 
ATOM   8687  C  CG1 . VAL G  3 69  ? 52.029  -52.028  -113.342 1.00 97.72  ? 68   VAL G CG1 1 
ATOM   8688  C  CG2 . VAL G  3 69  ? 53.518  -52.082  -111.357 1.00 97.80  ? 68   VAL G CG2 1 
ATOM   8689  N  N   . GLU G  3 70  ? 49.930  -52.078  -111.033 1.00 99.73  ? 69   GLU G N   1 
ATOM   8690  C  CA  . GLU G  3 70  ? 49.177  -51.154  -110.198 1.00 100.61 ? 69   GLU G CA  1 
ATOM   8691  C  C   . GLU G  3 70  ? 48.300  -51.913  -109.201 1.00 100.65 ? 69   GLU G C   1 
ATOM   8692  O  O   . GLU G  3 70  ? 47.956  -51.396  -108.138 1.00 100.49 ? 69   GLU G O   1 
ATOM   8693  C  CB  . GLU G  3 70  ? 48.318  -50.248  -111.090 1.00 101.49 ? 69   GLU G CB  1 
ATOM   8694  C  CG  . GLU G  3 70  ? 47.651  -49.085  -110.369 1.00 102.38 ? 69   GLU G CG  1 
ATOM   8695  C  CD  . GLU G  3 70  ? 46.992  -48.104  -111.327 1.00 102.49 ? 69   GLU G CD  1 
ATOM   8696  O  OE1 . GLU G  3 70  ? 47.706  -47.539  -112.184 1.00 101.71 ? 69   GLU G OE1 1 
ATOM   8697  O  OE2 . GLU G  3 70  ? 45.762  -47.899  -111.221 1.00 102.67 ? 69   GLU G OE2 1 
ATOM   8698  N  N   . LYS G  3 71  ? 47.950  -53.146  -109.547 1.00 100.72 ? 70   LYS G N   1 
ATOM   8699  C  CA  . LYS G  3 71  ? 47.112  -53.970  -108.687 1.00 100.75 ? 70   LYS G CA  1 
ATOM   8700  C  C   . LYS G  3 71  ? 47.925  -54.767  -107.676 1.00 100.41 ? 70   LYS G C   1 
ATOM   8701  O  O   . LYS G  3 71  ? 47.577  -54.819  -106.498 1.00 99.79  ? 70   LYS G O   1 
ATOM   8702  C  CB  . LYS G  3 71  ? 46.274  -54.925  -109.534 1.00 101.31 ? 70   LYS G CB  1 
ATOM   8703  C  CG  . LYS G  3 71  ? 45.186  -54.244  -110.341 1.00 102.32 ? 70   LYS G CG  1 
ATOM   8704  C  CD  . LYS G  3 71  ? 44.488  -55.213  -111.288 1.00 103.91 ? 70   LYS G CD  1 
ATOM   8705  C  CE  . LYS G  3 71  ? 43.787  -56.349  -110.550 1.00 105.34 ? 70   LYS G CE  1 
ATOM   8706  N  NZ  . LYS G  3 71  ? 44.731  -57.309  -109.899 1.00 106.05 ? 70   LYS G NZ  1 
ATOM   8707  N  N   . LEU G  3 72  ? 49.006  -55.389  -108.135 1.00 100.63 ? 71   LEU G N   1 
ATOM   8708  C  CA  . LEU G  3 72  ? 49.848  -56.183  -107.250 1.00 101.07 ? 71   LEU G CA  1 
ATOM   8709  C  C   . LEU G  3 72  ? 50.537  -55.310  -106.216 1.00 101.23 ? 71   LEU G C   1 
ATOM   8710  O  O   . LEU G  3 72  ? 51.098  -55.805  -105.240 1.00 101.37 ? 71   LEU G O   1 
ATOM   8711  C  CB  . LEU G  3 72  ? 50.891  -56.961  -108.054 1.00 100.69 ? 71   LEU G CB  1 
ATOM   8712  C  CG  . LEU G  3 72  ? 50.327  -58.033  -108.987 1.00 100.89 ? 71   LEU G CG  1 
ATOM   8713  C  CD1 . LEU G  3 72  ? 51.474  -58.853  -109.539 1.00 101.37 ? 71   LEU G CD1 1 
ATOM   8714  C  CD2 . LEU G  3 72  ? 49.346  -58.930  -108.237 1.00 100.77 ? 71   LEU G CD2 1 
ATOM   8715  N  N   . GLU G  3 73  ? 50.491  -54.004  -106.437 1.00 101.60 ? 72   GLU G N   1 
ATOM   8716  C  CA  . GLU G  3 73  ? 51.096  -53.063  -105.513 1.00 101.70 ? 72   GLU G CA  1 
ATOM   8717  C  C   . GLU G  3 73  ? 50.134  -52.885  -104.344 1.00 101.45 ? 72   GLU G C   1 
ATOM   8718  O  O   . GLU G  3 73  ? 50.551  -52.722  -103.201 1.00 101.09 ? 72   GLU G O   1 
ATOM   8719  C  CB  . GLU G  3 73  ? 51.335  -51.730  -106.212 1.00 102.41 ? 72   GLU G CB  1 
ATOM   8720  C  CG  . GLU G  3 73  ? 52.178  -50.760  -105.422 1.00 103.95 ? 72   GLU G CG  1 
ATOM   8721  C  CD  . GLU G  3 73  ? 52.283  -49.416  -106.105 1.00 105.29 ? 72   GLU G CD  1 
ATOM   8722  O  OE1 . GLU G  3 73  ? 52.666  -49.386  -107.296 1.00 106.10 ? 72   GLU G OE1 1 
ATOM   8723  O  OE2 . GLU G  3 73  ? 51.982  -48.391  -105.453 1.00 105.31 ? 72   GLU G OE2 1 
ATOM   8724  N  N   . LYS G  3 74  ? 48.839  -52.919  -104.641 1.00 102.12 ? 73   LYS G N   1 
ATOM   8725  C  CA  . LYS G  3 74  ? 47.818  -52.784  -103.607 1.00 103.12 ? 73   LYS G CA  1 
ATOM   8726  C  C   . LYS G  3 74  ? 47.971  -53.975  -102.671 1.00 103.77 ? 73   LYS G C   1 
ATOM   8727  O  O   . LYS G  3 74  ? 47.988  -53.829  -101.449 1.00 103.08 ? 73   LYS G O   1 
ATOM   8728  C  CB  . LYS G  3 74  ? 46.413  -52.810  -104.222 1.00 103.13 ? 73   LYS G CB  1 
ATOM   8729  C  CG  . LYS G  3 74  ? 46.167  -51.789  -105.323 1.00 103.40 ? 73   LYS G CG  1 
ATOM   8730  C  CD  . LYS G  3 74  ? 44.750  -51.908  -105.871 1.00 103.41 ? 73   LYS G CD  1 
ATOM   8731  C  CE  . LYS G  3 74  ? 44.496  -50.912  -106.994 1.00 103.72 ? 73   LYS G CE  1 
ATOM   8732  N  NZ  . LYS G  3 74  ? 43.107  -51.009  -107.529 1.00 103.48 ? 73   LYS G NZ  1 
HETATM 8733  N  N   . MSE G  3 75  ? 48.084  -55.156  -103.273 1.00 104.91 ? 74   MSE G N   1 
HETATM 8734  C  CA  . MSE G  3 75  ? 48.235  -56.399  -102.536 1.00 105.58 ? 74   MSE G CA  1 
HETATM 8735  C  C   . MSE G  3 75  ? 49.578  -56.430  -101.811 1.00 105.53 ? 74   MSE G C   1 
HETATM 8736  O  O   . MSE G  3 75  ? 49.638  -56.769  -100.631 1.00 105.78 ? 74   MSE G O   1 
HETATM 8737  C  CB  . MSE G  3 75  ? 48.098  -57.589  -103.496 1.00 106.91 ? 74   MSE G CB  1 
HETATM 8738  C  CG  . MSE G  3 75  ? 46.761  -57.598  -104.247 1.00 109.52 ? 74   MSE G CG  1 
HETATM 8739  SE SE  . MSE G  3 75  ? 46.462  -59.037  -105.532 1.00 113.63 ? 74   MSE G SE  1 
HETATM 8740  C  CE  . MSE G  3 75  ? 45.323  -60.165  -104.450 1.00 111.00 ? 74   MSE G CE  1 
ATOM   8741  N  N   . ARG G  3 76  ? 50.651  -56.058  -102.506 1.00 105.36 ? 75   ARG G N   1 
ATOM   8742  C  CA  . ARG G  3 76  ? 51.982  -56.049  -101.899 1.00 105.17 ? 75   ARG G CA  1 
ATOM   8743  C  C   . ARG G  3 76  ? 51.954  -55.359  -100.545 1.00 104.69 ? 75   ARG G C   1 
ATOM   8744  O  O   . ARG G  3 76  ? 52.661  -55.758  -99.621  1.00 104.40 ? 75   ARG G O   1 
ATOM   8745  C  CB  . ARG G  3 76  ? 52.990  -55.326  -102.795 1.00 105.80 ? 75   ARG G CB  1 
ATOM   8746  C  CG  . ARG G  3 76  ? 54.383  -55.225  -102.179 1.00 107.14 ? 75   ARG G CG  1 
ATOM   8747  C  CD  . ARG G  3 76  ? 55.347  -54.411  -103.042 1.00 108.43 ? 75   ARG G CD  1 
ATOM   8748  N  NE  . ARG G  3 76  ? 54.981  -52.999  -103.116 1.00 110.08 ? 75   ARG G NE  1 
ATOM   8749  C  CZ  . ARG G  3 76  ? 54.904  -52.187  -102.065 1.00 110.88 ? 75   ARG G CZ  1 
ATOM   8750  N  NH1 . ARG G  3 76  ? 55.168  -52.644  -100.847 1.00 111.17 ? 75   ARG G NH1 1 
ATOM   8751  N  NH2 . ARG G  3 76  ? 54.561  -50.916  -102.231 1.00 110.71 ? 75   ARG G NH2 1 
ATOM   8752  N  N   . ASP G  3 77  ? 51.139  -54.314  -100.443 1.00 104.53 ? 76   ASP G N   1 
ATOM   8753  C  CA  . ASP G  3 77  ? 51.002  -53.551  -99.208  1.00 104.28 ? 76   ASP G CA  1 
ATOM   8754  C  C   . ASP G  3 77  ? 49.985  -54.230  -98.305  1.00 103.80 ? 76   ASP G C   1 
ATOM   8755  O  O   . ASP G  3 77  ? 50.266  -54.535  -97.145  1.00 103.92 ? 76   ASP G O   1 
ATOM   8756  C  CB  . ASP G  3 77  ? 50.542  -52.123  -99.516  1.00 104.81 ? 76   ASP G CB  1 
ATOM   8757  C  CG  . ASP G  3 77  ? 51.603  -51.308  -100.238 1.00 105.50 ? 76   ASP G CG  1 
ATOM   8758  O  OD1 . ASP G  3 77  ? 52.142  -51.794  -101.256 1.00 105.50 ? 76   ASP G OD1 1 
ATOM   8759  O  OD2 . ASP G  3 77  ? 51.895  -50.178  -99.791  1.00 105.50 ? 76   ASP G OD2 1 
ATOM   8760  N  N   . HIS G  3 78  ? 48.800  -54.462  -98.855  1.00 103.20 ? 77   HIS G N   1 
ATOM   8761  C  CA  . HIS G  3 78  ? 47.715  -55.104  -98.126  1.00 102.40 ? 77   HIS G CA  1 
ATOM   8762  C  C   . HIS G  3 78  ? 48.211  -56.337  -97.377  1.00 101.21 ? 77   HIS G C   1 
ATOM   8763  O  O   . HIS G  3 78  ? 47.761  -56.624  -96.269  1.00 100.90 ? 77   HIS G O   1 
ATOM   8764  C  CB  . HIS G  3 78  ? 46.599  -55.482  -99.105  1.00 103.50 ? 77   HIS G CB  1 
ATOM   8765  C  CG  . HIS G  3 78  ? 45.420  -56.138  -98.460  1.00 104.00 ? 77   HIS G CG  1 
ATOM   8766  N  ND1 . HIS G  3 78  ? 44.812  -55.631  -97.332  1.00 104.34 ? 77   HIS G ND1 1 
ATOM   8767  C  CD2 . HIS G  3 78  ? 44.720  -57.246  -98.801  1.00 104.05 ? 77   HIS G CD2 1 
ATOM   8768  C  CE1 . HIS G  3 78  ? 43.787  -56.399  -97.005  1.00 104.67 ? 77   HIS G CE1 1 
ATOM   8769  N  NE2 . HIS G  3 78  ? 43.710  -57.386  -97.881  1.00 104.74 ? 77   HIS G NE2 1 
ATOM   8770  N  N   . GLU G  3 79  ? 49.144  -57.062  -97.987  1.00 99.87  ? 78   GLU G N   1 
ATOM   8771  C  CA  . GLU G  3 79  ? 49.703  -58.253  -97.365  1.00 98.92  ? 78   GLU G CA  1 
ATOM   8772  C  C   . GLU G  3 79  ? 50.379  -57.852  -96.066  1.00 99.28  ? 78   GLU G C   1 
ATOM   8773  O  O   . GLU G  3 79  ? 50.127  -58.441  -95.015  1.00 99.76  ? 78   GLU G O   1 
ATOM   8774  C  CB  . GLU G  3 79  ? 50.730  -58.905  -98.289  1.00 97.62  ? 78   GLU G CB  1 
ATOM   8775  C  CG  . GLU G  3 79  ? 50.386  -60.320  -98.724  1.00 95.84  ? 78   GLU G CG  1 
ATOM   8776  C  CD  . GLU G  3 79  ? 50.212  -61.265  -97.556  1.00 94.64  ? 78   GLU G CD  1 
ATOM   8777  O  OE1 . GLU G  3 79  ? 51.107  -61.310  -96.687  1.00 94.42  ? 78   GLU G OE1 1 
ATOM   8778  O  OE2 . GLU G  3 79  ? 49.184  -61.968  -97.510  1.00 93.58  ? 78   GLU G OE2 1 
ATOM   8779  N  N   . ARG G  3 80  ? 51.236  -56.839  -96.149  1.00 99.39  ? 79   ARG G N   1 
ATOM   8780  C  CA  . ARG G  3 80  ? 51.970  -56.341  -94.992  1.00 99.65  ? 79   ARG G CA  1 
ATOM   8781  C  C   . ARG G  3 80  ? 51.034  -55.897  -93.869  1.00 99.66  ? 79   ARG G C   1 
ATOM   8782  O  O   . ARG G  3 80  ? 50.864  -56.601  -92.873  1.00 99.66  ? 79   ARG G O   1 
ATOM   8783  C  CB  . ARG G  3 80  ? 52.877  -55.184  -95.419  1.00 99.77  ? 79   ARG G CB  1 
ATOM   8784  C  CG  . ARG G  3 80  ? 53.800  -55.544  -96.575  1.00 100.91 ? 79   ARG G CG  1 
ATOM   8785  C  CD  . ARG G  3 80  ? 54.574  -54.342  -97.103  1.00 103.00 ? 79   ARG G CD  1 
ATOM   8786  N  NE  . ARG G  3 80  ? 55.781  -54.043  -96.334  1.00 104.45 ? 79   ARG G NE  1 
ATOM   8787  C  CZ  . ARG G  3 80  ? 56.585  -53.011  -96.579  1.00 104.79 ? 79   ARG G CZ  1 
ATOM   8788  N  NH1 . ARG G  3 80  ? 56.310  -52.173  -97.571  1.00 104.76 ? 79   ARG G NH1 1 
ATOM   8789  N  NH2 . ARG G  3 80  ? 57.669  -52.821  -95.841  1.00 104.75 ? 79   ARG G NH2 1 
ATOM   8790  N  N   . LYS G  3 81  ? 50.426  -54.729  -94.038  1.00 99.62  ? 80   LYS G N   1 
ATOM   8791  C  CA  . LYS G  3 81  ? 49.504  -54.183  -93.047  1.00 99.68  ? 80   LYS G CA  1 
ATOM   8792  C  C   . LYS G  3 81  ? 48.698  -55.258  -92.311  1.00 99.41  ? 80   LYS G C   1 
ATOM   8793  O  O   . LYS G  3 81  ? 48.615  -55.250  -91.085  1.00 99.28  ? 80   LYS G O   1 
ATOM   8794  C  CB  . LYS G  3 81  ? 48.542  -53.203  -93.729  1.00 99.54  ? 80   LYS G CB  1 
ATOM   8795  C  CG  . LYS G  3 81  ? 47.497  -52.585  -92.811  1.00 99.96  ? 80   LYS G CG  1 
ATOM   8796  C  CD  . LYS G  3 81  ? 46.431  -51.849  -93.614  1.00 100.47 ? 80   LYS G CD  1 
ATOM   8797  C  CE  . LYS G  3 81  ? 45.697  -52.805  -94.556  1.00 100.96 ? 80   LYS G CE  1 
ATOM   8798  N  NZ  . LYS G  3 81  ? 44.670  -52.126  -95.395  1.00 100.26 ? 80   LYS G NZ  1 
ATOM   8799  N  N   . GLU G  3 82  ? 48.125  -56.187  -93.071  1.00 99.45  ? 81   GLU G N   1 
ATOM   8800  C  CA  . GLU G  3 82  ? 47.292  -57.258  -92.524  1.00 99.42  ? 81   GLU G CA  1 
ATOM   8801  C  C   . GLU G  3 82  ? 47.838  -58.144  -91.405  1.00 98.49  ? 81   GLU G C   1 
ATOM   8802  O  O   . GLU G  3 82  ? 47.059  -58.651  -90.597  1.00 99.26  ? 81   GLU G O   1 
ATOM   8803  C  CB  . GLU G  3 82  ? 46.798  -58.155  -93.661  1.00 100.71 ? 81   GLU G CB  1 
ATOM   8804  C  CG  . GLU G  3 82  ? 45.515  -57.669  -94.314  1.00 102.70 ? 81   GLU G CG  1 
ATOM   8805  C  CD  . GLU G  3 82  ? 44.312  -57.780  -93.392  1.00 103.51 ? 81   GLU G CD  1 
ATOM   8806  O  OE1 . GLU G  3 82  ? 43.983  -58.912  -92.974  1.00 103.65 ? 81   GLU G OE1 1 
ATOM   8807  O  OE2 . GLU G  3 82  ? 43.697  -56.735  -93.086  1.00 104.28 ? 81   GLU G OE2 1 
ATOM   8808  N  N   . GLU G  3 83  ? 49.150  -58.349  -91.352  1.00 96.60  ? 82   GLU G N   1 
ATOM   8809  C  CA  . GLU G  3 83  ? 49.748  -59.193  -90.312  1.00 94.41  ? 82   GLU G CA  1 
ATOM   8810  C  C   . GLU G  3 83  ? 49.413  -60.677  -90.501  1.00 91.36  ? 82   GLU G C   1 
ATOM   8811  O  O   . GLU G  3 83  ? 50.244  -61.545  -90.236  1.00 91.21  ? 82   GLU G O   1 
ATOM   8812  C  CB  . GLU G  3 83  ? 49.301  -58.727  -88.917  1.00 96.33  ? 82   GLU G CB  1 
ATOM   8813  C  CG  . GLU G  3 83  ? 49.922  -59.515  -87.764  1.00 99.36  ? 82   GLU G CG  1 
ATOM   8814  C  CD  . GLU G  3 83  ? 49.069  -60.695  -87.314  1.00 101.39 ? 82   GLU G CD  1 
ATOM   8815  O  OE1 . GLU G  3 83  ? 48.522  -61.413  -88.183  1.00 102.13 ? 82   GLU G OE1 1 
ATOM   8816  O  OE2 . GLU G  3 83  ? 48.957  -60.909  -86.084  1.00 101.46 ? 82   GLU G OE2 1 
ATOM   8817  N  N   . THR G  3 84  ? 48.189  -60.963  -90.935  1.00 87.79  ? 83   THR G N   1 
ATOM   8818  C  CA  . THR G  3 84  ? 47.760  -62.335  -91.198  1.00 83.52  ? 83   THR G CA  1 
ATOM   8819  C  C   . THR G  3 84  ? 47.859  -62.543  -92.711  1.00 80.99  ? 83   THR G C   1 
ATOM   8820  O  O   . THR G  3 84  ? 48.143  -61.599  -93.447  1.00 80.57  ? 83   THR G O   1 
ATOM   8821  C  CB  . THR G  3 84  ? 46.305  -62.569  -90.743  1.00 83.24  ? 83   THR G CB  1 
ATOM   8822  O  OG1 . THR G  3 84  ? 45.861  -63.849  -91.207  1.00 81.96  ? 83   THR G OG1 1 
ATOM   8823  C  CG2 . THR G  3 84  ? 45.390  -61.486  -91.293  1.00 82.86  ? 83   THR G CG2 1 
ATOM   8824  N  N   . PHE G  3 85  ? 47.631  -63.762  -93.186  1.00 77.71  ? 84   PHE G N   1 
ATOM   8825  C  CA  . PHE G  3 85  ? 47.725  -64.010  -94.619  1.00 74.70  ? 84   PHE G CA  1 
ATOM   8826  C  C   . PHE G  3 85  ? 46.586  -63.419  -95.435  1.00 73.35  ? 84   PHE G C   1 
ATOM   8827  O  O   . PHE G  3 85  ? 45.427  -63.449  -95.023  1.00 72.72  ? 84   PHE G O   1 
ATOM   8828  C  CB  . PHE G  3 85  ? 47.824  -65.503  -94.897  1.00 73.37  ? 84   PHE G CB  1 
ATOM   8829  C  CG  . PHE G  3 85  ? 49.123  -66.096  -94.482  1.00 72.54  ? 84   PHE G CG  1 
ATOM   8830  C  CD1 . PHE G  3 85  ? 49.221  -66.841  -93.316  1.00 72.70  ? 84   PHE G CD1 1 
ATOM   8831  C  CD2 . PHE G  3 85  ? 50.259  -65.901  -95.253  1.00 72.15  ? 84   PHE G CD2 1 
ATOM   8832  C  CE1 . PHE G  3 85  ? 50.434  -67.386  -92.926  1.00 72.32  ? 84   PHE G CE1 1 
ATOM   8833  C  CE2 . PHE G  3 85  ? 51.477  -66.440  -94.871  1.00 72.27  ? 84   PHE G CE2 1 
ATOM   8834  C  CZ  . PHE G  3 85  ? 51.565  -67.185  -93.705  1.00 72.55  ? 84   PHE G CZ  1 
ATOM   8835  N  N   . THR G  3 86  ? 46.938  -62.891  -96.603  1.00 71.91  ? 85   THR G N   1 
ATOM   8836  C  CA  . THR G  3 86  ? 45.986  -62.275  -97.525  1.00 70.33  ? 85   THR G CA  1 
ATOM   8837  C  C   . THR G  3 86  ? 45.610  -63.250  -98.636  1.00 68.83  ? 85   THR G C   1 
ATOM   8838  O  O   . THR G  3 86  ? 46.415  -64.081  -99.033  1.00 68.54  ? 85   THR G O   1 
ATOM   8839  C  CB  . THR G  3 86  ? 46.602  -61.010  -98.165  1.00 70.41  ? 85   THR G CB  1 
ATOM   8840  O  OG1 . THR G  3 86  ? 46.807  -60.022  -97.152  1.00 69.66  ? 85   THR G OG1 1 
ATOM   8841  C  CG2 . THR G  3 86  ? 45.700  -60.446  -99.258  1.00 71.66  ? 85   THR G CG2 1 
ATOM   8842  N  N   . PRO G  3 87  ? 44.372  -63.169  -99.143  1.00 68.05  ? 86   PRO G N   1 
ATOM   8843  C  CA  . PRO G  3 87  ? 43.958  -64.074  -100.219 1.00 67.85  ? 86   PRO G CA  1 
ATOM   8844  C  C   . PRO G  3 87  ? 44.572  -63.647  -101.548 1.00 67.20  ? 86   PRO G C   1 
ATOM   8845  O  O   . PRO G  3 87  ? 44.286  -62.568  -102.055 1.00 67.44  ? 86   PRO G O   1 
ATOM   8846  C  CB  . PRO G  3 87  ? 42.440  -63.943  -100.208 1.00 67.14  ? 86   PRO G CB  1 
ATOM   8847  C  CG  . PRO G  3 87  ? 42.248  -62.526  -99.807  1.00 68.01  ? 86   PRO G CG  1 
ATOM   8848  C  CD  . PRO G  3 87  ? 43.231  -62.370  -98.670  1.00 68.02  ? 86   PRO G CD  1 
HETATM 8849  N  N   . MSE G  3 88  ? 45.427  -64.500  -102.099 1.00 67.33  ? 87   MSE G N   1 
HETATM 8850  C  CA  . MSE G  3 88  ? 46.098  -64.220  -103.360 1.00 67.29  ? 87   MSE G CA  1 
HETATM 8851  C  C   . MSE G  3 88  ? 45.140  -64.281  -104.548 1.00 66.51  ? 87   MSE G C   1 
HETATM 8852  O  O   . MSE G  3 88  ? 44.020  -64.785  -104.433 1.00 65.61  ? 87   MSE G O   1 
HETATM 8853  C  CB  . MSE G  3 88  ? 47.226  -65.232  -103.580 1.00 68.67  ? 87   MSE G CB  1 
HETATM 8854  C  CG  . MSE G  3 88  ? 48.321  -65.186  -102.541 1.00 71.23  ? 87   MSE G CG  1 
HETATM 8855  SE SE  . MSE G  3 88  ? 49.406  -63.604  -102.688 1.00 76.69  ? 87   MSE G SE  1 
HETATM 8856  C  CE  . MSE G  3 88  ? 48.310  -62.396  -101.648 1.00 72.35  ? 87   MSE G CE  1 
ATOM   8857  N  N   . PRO G  3 89  ? 45.573  -63.757  -105.708 1.00 65.75  ? 88   PRO G N   1 
ATOM   8858  C  CA  . PRO G  3 89  ? 44.762  -63.759  -106.925 1.00 64.20  ? 88   PRO G CA  1 
ATOM   8859  C  C   . PRO G  3 89  ? 44.685  -65.170  -107.502 1.00 63.02  ? 88   PRO G C   1 
ATOM   8860  O  O   . PRO G  3 89  ? 43.604  -65.715  -107.688 1.00 64.30  ? 88   PRO G O   1 
ATOM   8861  C  CB  . PRO G  3 89  ? 45.522  -62.807  -107.836 1.00 65.41  ? 88   PRO G CB  1 
ATOM   8862  C  CG  . PRO G  3 89  ? 46.948  -63.043  -107.442 1.00 65.02  ? 88   PRO G CG  1 
ATOM   8863  C  CD  . PRO G  3 89  ? 46.838  -63.033  -105.935 1.00 66.11  ? 88   PRO G CD  1 
ATOM   8864  N  N   . SER G  3 90  ? 45.841  -65.762  -107.772 1.00 60.93  ? 89   SER G N   1 
ATOM   8865  C  CA  . SER G  3 90  ? 45.897  -67.111  -108.319 1.00 59.36  ? 89   SER G CA  1 
ATOM   8866  C  C   . SER G  3 90  ? 46.416  -68.141  -107.309 1.00 59.37  ? 89   SER G C   1 
ATOM   8867  O  O   . SER G  3 90  ? 47.407  -67.902  -106.617 1.00 61.06  ? 89   SER G O   1 
ATOM   8868  C  CB  . SER G  3 90  ? 46.795  -67.121  -109.555 1.00 57.47  ? 89   SER G CB  1 
ATOM   8869  O  OG  . SER G  3 90  ? 46.897  -68.425  -110.097 1.00 56.36  ? 89   SER G OG  1 
ATOM   8870  N  N   . PRO G  3 91  ? 45.754  -69.305  -107.209 1.00 58.24  ? 90   PRO G N   1 
ATOM   8871  C  CA  . PRO G  3 91  ? 46.203  -70.335  -106.269 1.00 57.32  ? 90   PRO G CA  1 
ATOM   8872  C  C   . PRO G  3 91  ? 47.604  -70.799  -106.647 1.00 55.97  ? 90   PRO G C   1 
ATOM   8873  O  O   . PRO G  3 91  ? 48.231  -71.572  -105.924 1.00 56.40  ? 90   PRO G O   1 
ATOM   8874  C  CB  . PRO G  3 91  ? 45.172  -71.445  -106.457 1.00 57.61  ? 90   PRO G CB  1 
ATOM   8875  C  CG  . PRO G  3 91  ? 43.948  -70.709  -106.844 1.00 58.61  ? 90   PRO G CG  1 
ATOM   8876  C  CD  . PRO G  3 91  ? 44.488  -69.707  -107.838 1.00 59.23  ? 90   PRO G CD  1 
ATOM   8877  N  N   . TYR G  3 92  ? 48.073  -70.325  -107.798 1.00 54.40  ? 91   TYR G N   1 
ATOM   8878  C  CA  . TYR G  3 92  ? 49.388  -70.667  -108.320 1.00 54.02  ? 91   TYR G CA  1 
ATOM   8879  C  C   . TYR G  3 92  ? 50.049  -69.410  -108.877 1.00 54.44  ? 91   TYR G C   1 
ATOM   8880  O  O   . TYR G  3 92  ? 50.758  -69.453  -109.882 1.00 51.72  ? 91   TYR G O   1 
ATOM   8881  C  CB  . TYR G  3 92  ? 49.235  -71.712  -109.423 1.00 53.79  ? 91   TYR G CB  1 
ATOM   8882  C  CG  . TYR G  3 92  ? 48.533  -72.967  -108.962 1.00 54.07  ? 91   TYR G CG  1 
ATOM   8883  C  CD1 . TYR G  3 92  ? 49.261  -74.080  -108.543 1.00 54.14  ? 91   TYR G CD1 1 
ATOM   8884  C  CD2 . TYR G  3 92  ? 47.140  -73.030  -108.902 1.00 53.13  ? 91   TYR G CD2 1 
ATOM   8885  C  CE1 . TYR G  3 92  ? 48.620  -75.227  -108.074 1.00 53.79  ? 91   TYR G CE1 1 
ATOM   8886  C  CE2 . TYR G  3 92  ? 46.491  -74.169  -108.431 1.00 53.47  ? 91   TYR G CE2 1 
ATOM   8887  C  CZ  . TYR G  3 92  ? 47.238  -75.265  -108.018 1.00 53.97  ? 91   TYR G CZ  1 
ATOM   8888  O  OH  . TYR G  3 92  ? 46.608  -76.393  -107.537 1.00 54.41  ? 91   TYR G OH  1 
ATOM   8889  N  N   . TYR G  3 93  ? 49.823  -68.288  -108.204 1.00 56.64  ? 92   TYR G N   1 
ATOM   8890  C  CA  . TYR G  3 93  ? 50.372  -67.019  -108.651 1.00 60.00  ? 92   TYR G CA  1 
ATOM   8891  C  C   . TYR G  3 93  ? 51.884  -67.041  -108.863 1.00 61.86  ? 92   TYR G C   1 
ATOM   8892  O  O   . TYR G  3 93  ? 52.378  -66.580  -109.888 1.00 63.48  ? 92   TYR G O   1 
ATOM   8893  C  CB  . TYR G  3 93  ? 49.995  -65.899  -107.676 1.00 60.57  ? 92   TYR G CB  1 
ATOM   8894  C  CG  . TYR G  3 93  ? 50.849  -65.807  -106.434 1.00 61.54  ? 92   TYR G CG  1 
ATOM   8895  C  CD1 . TYR G  3 93  ? 50.447  -66.402  -105.240 1.00 62.66  ? 92   TYR G CD1 1 
ATOM   8896  C  CD2 . TYR G  3 93  ? 52.047  -65.089  -106.443 1.00 61.35  ? 92   TYR G CD2 1 
ATOM   8897  C  CE1 . TYR G  3 93  ? 51.214  -66.277  -104.084 1.00 62.38  ? 92   TYR G CE1 1 
ATOM   8898  C  CE2 . TYR G  3 93  ? 52.818  -64.963  -105.300 1.00 61.65  ? 92   TYR G CE2 1 
ATOM   8899  C  CZ  . TYR G  3 93  ? 52.395  -65.556  -104.124 1.00 62.09  ? 92   TYR G CZ  1 
ATOM   8900  O  OH  . TYR G  3 93  ? 53.150  -65.416  -102.989 1.00 61.81  ? 92   TYR G OH  1 
HETATM 8901  N  N   . MSE G  3 94  ? 52.620  -67.577  -107.900 1.00 63.28  ? 93   MSE G N   1 
HETATM 8902  C  CA  . MSE G  3 94  ? 54.066  -67.640  -108.017 1.00 64.42  ? 93   MSE G CA  1 
HETATM 8903  C  C   . MSE G  3 94  ? 54.474  -68.289  -109.332 1.00 63.83  ? 93   MSE G C   1 
HETATM 8904  O  O   . MSE G  3 94  ? 55.285  -67.755  -110.079 1.00 63.69  ? 93   MSE G O   1 
HETATM 8905  C  CB  . MSE G  3 94  ? 54.648  -68.459  -106.872 1.00 68.76  ? 93   MSE G CB  1 
HETATM 8906  C  CG  . MSE G  3 94  ? 56.152  -68.350  -106.745 1.00 73.56  ? 93   MSE G CG  1 
HETATM 8907  SE SE  . MSE G  3 94  ? 56.614  -66.562  -106.189 1.00 81.75  ? 93   MSE G SE  1 
HETATM 8908  C  CE  . MSE G  3 94  ? 58.306  -66.393  -107.112 1.00 80.25  ? 93   MSE G CE  1 
ATOM   8909  N  N   . GLU G  3 95  ? 53.895  -69.451  -109.606 1.00 63.28  ? 94   GLU G N   1 
ATOM   8910  C  CA  . GLU G  3 95  ? 54.200  -70.216  -110.805 1.00 60.80  ? 94   GLU G CA  1 
ATOM   8911  C  C   . GLU G  3 95  ? 53.628  -69.609  -112.086 1.00 59.78  ? 94   GLU G C   1 
ATOM   8912  O  O   . GLU G  3 95  ? 54.216  -69.753  -113.157 1.00 59.59  ? 94   GLU G O   1 
ATOM   8913  C  CB  . GLU G  3 95  ? 53.703  -71.655  -110.627 1.00 60.53  ? 94   GLU G CB  1 
ATOM   8914  C  CG  . GLU G  3 95  ? 54.042  -72.265  -109.260 1.00 59.75  ? 94   GLU G CG  1 
ATOM   8915  C  CD  . GLU G  3 95  ? 53.000  -71.959  -108.189 1.00 58.65  ? 94   GLU G CD  1 
ATOM   8916  O  OE1 . GLU G  3 95  ? 52.650  -70.777  -107.996 1.00 58.45  ? 94   GLU G OE1 1 
ATOM   8917  O  OE2 . GLU G  3 95  ? 52.529  -72.906  -107.528 1.00 58.36  ? 94   GLU G OE2 1 
ATOM   8918  N  N   . LEU G  3 96  ? 52.485  -68.939  -111.994 1.00 58.19  ? 95   LEU G N   1 
ATOM   8919  C  CA  . LEU G  3 96  ? 51.913  -68.333  -113.186 1.00 57.58  ? 95   LEU G CA  1 
ATOM   8920  C  C   . LEU G  3 96  ? 52.811  -67.190  -113.608 1.00 58.07  ? 95   LEU G C   1 
ATOM   8921  O  O   . LEU G  3 96  ? 53.024  -66.956  -114.797 1.00 58.50  ? 95   LEU G O   1 
ATOM   8922  C  CB  . LEU G  3 96  ? 50.493  -67.821  -112.922 1.00 56.65  ? 95   LEU G CB  1 
ATOM   8923  C  CG  . LEU G  3 96  ? 49.391  -68.843  -113.226 1.00 55.44  ? 95   LEU G CG  1 
ATOM   8924  C  CD1 . LEU G  3 96  ? 48.035  -68.321  -112.805 1.00 54.07  ? 95   LEU G CD1 1 
ATOM   8925  C  CD2 . LEU G  3 96  ? 49.404  -69.141  -114.707 1.00 54.62  ? 95   LEU G CD2 1 
ATOM   8926  N  N   . THR G  3 97  ? 53.352  -66.491  -112.617 1.00 58.11  ? 96   THR G N   1 
ATOM   8927  C  CA  . THR G  3 97  ? 54.241  -65.360  -112.853 1.00 57.58  ? 96   THR G CA  1 
ATOM   8928  C  C   . THR G  3 97  ? 55.618  -65.829  -113.323 1.00 57.06  ? 96   THR G C   1 
ATOM   8929  O  O   . THR G  3 97  ? 56.206  -65.274  -114.244 1.00 56.32  ? 96   THR G O   1 
ATOM   8930  C  CB  . THR G  3 97  ? 54.368  -64.511  -111.566 1.00 57.55  ? 96   THR G CB  1 
ATOM   8931  O  OG1 . THR G  3 97  ? 53.121  -63.843  -111.319 1.00 56.99  ? 96   THR G OG1 1 
ATOM   8932  C  CG2 . THR G  3 97  ? 55.482  -63.484  -111.693 1.00 58.06  ? 96   THR G CG2 1 
ATOM   8933  N  N   . LYS G  3 98  ? 56.128  -66.869  -112.690 1.00 58.43  ? 97   LYS G N   1 
ATOM   8934  C  CA  . LYS G  3 98  ? 57.422  -67.392  -113.067 1.00 59.65  ? 97   LYS G CA  1 
ATOM   8935  C  C   . LYS G  3 98  ? 57.372  -67.853  -114.515 1.00 60.72  ? 97   LYS G C   1 
ATOM   8936  O  O   . LYS G  3 98  ? 58.311  -67.630  -115.268 1.00 61.87  ? 97   LYS G O   1 
ATOM   8937  C  CB  . LYS G  3 98  ? 57.800  -68.548  -112.138 1.00 59.73  ? 97   LYS G CB  1 
ATOM   8938  C  CG  . LYS G  3 98  ? 59.150  -69.188  -112.411 1.00 61.08  ? 97   LYS G CG  1 
ATOM   8939  C  CD  . LYS G  3 98  ? 59.010  -70.411  -113.298 1.00 63.34  ? 97   LYS G CD  1 
ATOM   8940  C  CE  . LYS G  3 98  ? 60.266  -71.261  -113.254 1.00 64.71  ? 97   LYS G CE  1 
ATOM   8941  N  NZ  . LYS G  3 98  ? 60.088  -72.543  -113.993 1.00 67.08  ? 97   LYS G NZ  1 
ATOM   8942  N  N   . LEU G  3 99  ? 56.265  -68.470  -114.911 1.00 61.74  ? 98   LEU G N   1 
ATOM   8943  C  CA  . LEU G  3 99  ? 56.127  -68.969  -116.275 1.00 62.94  ? 98   LEU G CA  1 
ATOM   8944  C  C   . LEU G  3 99  ? 55.665  -67.950  -117.317 1.00 64.01  ? 98   LEU G C   1 
ATOM   8945  O  O   . LEU G  3 99  ? 56.161  -67.949  -118.445 1.00 65.19  ? 98   LEU G O   1 
ATOM   8946  C  CB  . LEU G  3 99  ? 55.201  -70.189  -116.293 1.00 62.20  ? 98   LEU G CB  1 
ATOM   8947  C  CG  . LEU G  3 99  ? 55.822  -71.492  -115.782 1.00 61.61  ? 98   LEU G CG  1 
ATOM   8948  C  CD1 . LEU G  3 99  ? 54.782  -72.592  -115.766 1.00 59.62  ? 98   LEU G CD1 1 
ATOM   8949  C  CD2 . LEU G  3 99  ? 56.992  -71.880  -116.677 1.00 61.05  ? 98   LEU G CD2 1 
ATOM   8950  N  N   . LEU G  3 100 ? 54.722  -67.084  -116.964 1.00 64.23  ? 99   LEU G N   1 
ATOM   8951  C  CA  . LEU G  3 100 ? 54.261  -66.090  -117.928 1.00 64.81  ? 99   LEU G CA  1 
ATOM   8952  C  C   . LEU G  3 100 ? 55.311  -65.012  -118.161 1.00 65.76  ? 99   LEU G C   1 
ATOM   8953  O  O   . LEU G  3 100 ? 55.059  -64.054  -118.876 1.00 67.09  ? 99   LEU G O   1 
ATOM   8954  C  CB  . LEU G  3 100 ? 52.951  -65.439  -117.468 1.00 63.86  ? 99   LEU G CB  1 
ATOM   8955  C  CG  . LEU G  3 100 ? 51.662  -66.243  -117.667 1.00 62.60  ? 99   LEU G CG  1 
ATOM   8956  C  CD1 . LEU G  3 100 ? 50.480  -65.473  -117.113 1.00 62.23  ? 99   LEU G CD1 1 
ATOM   8957  C  CD2 . LEU G  3 100 ? 51.461  -66.528  -119.139 1.00 60.83  ? 99   LEU G CD2 1 
ATOM   8958  N  N   . LEU G  3 101 ? 56.480  -65.162  -117.548 1.00 66.50  ? 100  LEU G N   1 
ATOM   8959  C  CA  . LEU G  3 101 ? 57.567  -64.201  -117.715 1.00 67.17  ? 100  LEU G CA  1 
ATOM   8960  C  C   . LEU G  3 101 ? 58.796  -64.947  -118.184 1.00 68.75  ? 100  LEU G C   1 
ATOM   8961  O  O   . LEU G  3 101 ? 59.710  -64.373  -118.766 1.00 68.59  ? 100  LEU G O   1 
ATOM   8962  C  CB  . LEU G  3 101 ? 57.874  -63.483  -116.401 1.00 66.41  ? 100  LEU G CB  1 
ATOM   8963  C  CG  . LEU G  3 101 ? 56.971  -62.297  -116.064 1.00 65.37  ? 100  LEU G CG  1 
ATOM   8964  C  CD1 . LEU G  3 101 ? 55.526  -62.751  -116.004 1.00 65.44  ? 100  LEU G CD1 1 
ATOM   8965  C  CD2 . LEU G  3 101 ? 57.398  -61.690  -114.744 1.00 64.06  ? 100  LEU G CD2 1 
ATOM   8966  N  N   . ASN G  3 102 ? 58.804  -66.242  -117.912 1.00 71.28  ? 101  ASN G N   1 
ATOM   8967  C  CA  . ASN G  3 102 ? 59.897  -67.112  -118.306 1.00 73.93  ? 101  ASN G CA  1 
ATOM   8968  C  C   . ASN G  3 102 ? 59.683  -67.361  -119.795 1.00 74.54  ? 101  ASN G C   1 
ATOM   8969  O  O   . ASN G  3 102 ? 60.610  -67.735  -120.516 1.00 74.12  ? 101  ASN G O   1 
ATOM   8970  C  CB  . ASN G  3 102 ? 59.804  -68.429  -117.519 1.00 76.50  ? 101  ASN G CB  1 
ATOM   8971  C  CG  . ASN G  3 102 ? 61.129  -69.180  -117.440 1.00 78.19  ? 101  ASN G CG  1 
ATOM   8972  O  OD1 . ASN G  3 102 ? 61.243  -70.174  -116.711 1.00 77.58  ? 101  ASN G OD1 1 
ATOM   8973  N  ND2 . ASN G  3 102 ? 62.132  -68.717  -118.189 1.00 78.39  ? 101  ASN G ND2 1 
ATOM   8974  N  N   . HIS G  3 103 ? 58.452  -67.127  -120.248 1.00 75.55  ? 102  HIS G N   1 
ATOM   8975  C  CA  . HIS G  3 103 ? 58.092  -67.341  -121.646 1.00 76.79  ? 102  HIS G CA  1 
ATOM   8976  C  C   . HIS G  3 103 ? 57.280  -66.213  -122.292 1.00 78.43  ? 102  HIS G C   1 
ATOM   8977  O  O   . HIS G  3 103 ? 57.584  -65.791  -123.405 1.00 78.98  ? 102  HIS G O   1 
ATOM   8978  C  CB  . HIS G  3 103 ? 57.328  -68.660  -121.776 1.00 75.25  ? 102  HIS G CB  1 
ATOM   8979  C  CG  . HIS G  3 103 ? 58.114  -69.858  -121.347 1.00 73.87  ? 102  HIS G CG  1 
ATOM   8980  N  ND1 . HIS G  3 103 ? 59.218  -70.311  -122.037 1.00 74.32  ? 102  HIS G ND1 1 
ATOM   8981  C  CD2 . HIS G  3 103 ? 57.966  -70.688  -120.288 1.00 73.07  ? 102  HIS G CD2 1 
ATOM   8982  C  CE1 . HIS G  3 103 ? 59.716  -71.368  -121.421 1.00 73.25  ? 102  HIS G CE1 1 
ATOM   8983  N  NE2 . HIS G  3 103 ? 58.975  -71.617  -120.357 1.00 72.63  ? 102  HIS G NE2 1 
ATOM   8984  N  N   . ALA G  3 104 ? 56.247  -65.729  -121.611 1.00 80.46  ? 103  ALA G N   1 
ATOM   8985  C  CA  . ALA G  3 104 ? 55.422  -64.653  -122.165 1.00 83.53  ? 103  ALA G CA  1 
ATOM   8986  C  C   . ALA G  3 104 ? 55.933  -63.262  -121.762 1.00 85.81  ? 103  ALA G C   1 
ATOM   8987  O  O   . ALA G  3 104 ? 55.146  -62.332  -121.527 1.00 84.55  ? 103  ALA G O   1 
ATOM   8988  C  CB  . ALA G  3 104 ? 53.974  -64.831  -121.725 1.00 83.53  ? 103  ALA G CB  1 
ATOM   8989  N  N   . SER G  3 105 ? 57.258  -63.135  -121.692 1.00 88.79  ? 104  SER G N   1 
ATOM   8990  C  CA  . SER G  3 105 ? 57.921  -61.884  -121.318 1.00 91.33  ? 104  SER G CA  1 
ATOM   8991  C  C   . SER G  3 105 ? 57.454  -60.734  -122.200 1.00 93.28  ? 104  SER G C   1 
ATOM   8992  O  O   . SER G  3 105 ? 57.506  -59.561  -121.815 1.00 93.41  ? 104  SER G O   1 
ATOM   8993  C  CB  . SER G  3 105 ? 59.443  -62.052  -121.439 1.00 91.23  ? 104  SER G CB  1 
ATOM   8994  O  OG  . SER G  3 105 ? 59.803  -62.655  -122.673 1.00 90.95  ? 104  SER G OG  1 
ATOM   8995  N  N   . ASP G  3 106 ? 56.979  -61.106  -123.383 1.00 95.46  ? 105  ASP G N   1 
ATOM   8996  C  CA  . ASP G  3 106 ? 56.495  -60.180  -124.396 1.00 96.17  ? 105  ASP G CA  1 
ATOM   8997  C  C   . ASP G  3 106 ? 55.125  -59.591  -124.064 1.00 96.46  ? 105  ASP G C   1 
ATOM   8998  O  O   . ASP G  3 106 ? 55.013  -58.463  -123.589 1.00 96.55  ? 105  ASP G O   1 
ATOM   8999  C  CB  . ASP G  3 106 ? 56.421  -60.923  -125.726 1.00 96.47  ? 105  ASP G CB  1 
ATOM   9000  C  CG  . ASP G  3 106 ? 57.596  -61.861  -125.927 1.00 97.40  ? 105  ASP G CG  1 
ATOM   9001  O  OD1 . ASP G  3 106 ? 57.479  -62.787  -126.755 1.00 97.44  ? 105  ASP G OD1 1 
ATOM   9002  O  OD2 . ASP G  3 106 ? 58.638  -61.670  -125.260 1.00 97.90  ? 105  ASP G OD2 1 
ATOM   9003  N  N   . ASN G  3 107 ? 54.086  -60.376  -124.320 1.00 96.79  ? 106  ASN G N   1 
ATOM   9004  C  CA  . ASN G  3 107 ? 52.711  -59.957  -124.088 1.00 97.69  ? 106  ASN G CA  1 
ATOM   9005  C  C   . ASN G  3 107 ? 52.430  -59.264  -122.760 1.00 98.74  ? 106  ASN G C   1 
ATOM   9006  O  O   . ASN G  3 107 ? 51.347  -58.705  -122.580 1.00 98.50  ? 106  ASN G O   1 
ATOM   9007  C  CB  . ASN G  3 107 ? 51.774  -61.161  -124.216 1.00 96.60  ? 106  ASN G CB  1 
ATOM   9008  C  CG  . ASN G  3 107 ? 51.879  -61.840  -125.562 1.00 95.52  ? 106  ASN G CG  1 
ATOM   9009  O  OD1 . ASN G  3 107 ? 51.700  -61.210  -126.603 1.00 95.22  ? 106  ASN G OD1 1 
ATOM   9010  N  ND2 . ASN G  3 107 ? 52.167  -63.136  -125.549 1.00 94.77  ? 106  ASN G ND2 1 
ATOM   9011  N  N   . ILE G  3 108 ? 53.384  -59.279  -121.834 1.00 100.24 ? 107  ILE G N   1 
ATOM   9012  C  CA  . ILE G  3 108 ? 53.136  -58.659  -120.536 1.00 102.08 ? 107  ILE G CA  1 
ATOM   9013  C  C   . ILE G  3 108 ? 53.638  -57.228  -120.323 1.00 102.86 ? 107  ILE G C   1 
ATOM   9014  O  O   . ILE G  3 108 ? 54.807  -56.910  -120.554 1.00 102.19 ? 107  ILE G O   1 
ATOM   9015  C  CB  . ILE G  3 108 ? 53.659  -59.556  -119.389 1.00 102.48 ? 107  ILE G CB  1 
ATOM   9016  C  CG1 . ILE G  3 108 ? 53.034  -60.949  -119.509 1.00 102.33 ? 107  ILE G CG1 1 
ATOM   9017  C  CG2 . ILE G  3 108 ? 53.295  -58.946  -118.036 1.00 102.05 ? 107  ILE G CG2 1 
ATOM   9018  C  CD1 . ILE G  3 108 ? 53.253  -61.836  -118.307 1.00 103.39 ? 107  ILE G CD1 1 
ATOM   9019  N  N   . PRO G  3 109 ? 52.732  -56.343  -119.873 1.00 104.16 ? 108  PRO G N   1 
ATOM   9020  C  CA  . PRO G  3 109 ? 52.993  -54.927  -119.598 1.00 105.65 ? 108  PRO G CA  1 
ATOM   9021  C  C   . PRO G  3 109 ? 53.871  -54.754  -118.362 1.00 106.99 ? 108  PRO G C   1 
ATOM   9022  O  O   . PRO G  3 109 ? 53.568  -55.303  -117.304 1.00 107.45 ? 108  PRO G O   1 
ATOM   9023  C  CB  . PRO G  3 109 ? 51.592  -54.351  -119.374 1.00 105.77 ? 108  PRO G CB  1 
ATOM   9024  C  CG  . PRO G  3 109 ? 50.684  -55.306  -120.103 1.00 104.70 ? 108  PRO G CG  1 
ATOM   9025  C  CD  . PRO G  3 109 ? 51.292  -56.630  -119.751 1.00 104.46 ? 108  PRO G CD  1 
ATOM   9026  N  N   . LYS G  3 110 ? 54.945  -53.981  -118.497 1.00 108.08 ? 109  LYS G N   1 
ATOM   9027  C  CA  . LYS G  3 110 ? 55.865  -53.731  -117.389 1.00 108.62 ? 109  LYS G CA  1 
ATOM   9028  C  C   . LYS G  3 110 ? 56.639  -55.002  -117.062 1.00 109.23 ? 109  LYS G C   1 
ATOM   9029  O  O   . LYS G  3 110 ? 56.567  -55.509  -115.944 1.00 109.19 ? 109  LYS G O   1 
ATOM   9030  C  CB  . LYS G  3 110 ? 55.097  -53.270  -116.145 1.00 108.54 ? 109  LYS G CB  1 
ATOM   9031  C  CG  . LYS G  3 110 ? 54.153  -52.101  -116.376 1.00 109.05 ? 109  LYS G CG  1 
ATOM   9032  C  CD  . LYS G  3 110 ? 54.877  -50.841  -116.849 1.00 109.52 ? 109  LYS G CD  1 
ATOM   9033  C  CE  . LYS G  3 110 ? 55.803  -50.246  -115.786 1.00 109.22 ? 109  LYS G CE  1 
ATOM   9034  N  NZ  . LYS G  3 110 ? 57.047  -51.036  -115.573 1.00 109.28 ? 109  LYS G NZ  1 
ATOM   9035  N  N   . ALA G  3 111 ? 57.376  -55.506  -118.049 1.00 110.14 ? 110  ALA G N   1 
ATOM   9036  C  CA  . ALA G  3 111 ? 58.173  -56.725  -117.910 1.00 110.37 ? 110  ALA G CA  1 
ATOM   9037  C  C   . ALA G  3 111 ? 58.711  -56.971  -116.499 1.00 110.39 ? 110  ALA G C   1 
ATOM   9038  O  O   . ALA G  3 111 ? 58.004  -57.493  -115.637 1.00 110.24 ? 110  ALA G O   1 
ATOM   9039  C  CB  . ALA G  3 111 ? 59.331  -56.707  -118.918 1.00 110.03 ? 110  ALA G CB  1 
ATOM   9040  N  N   . ASP G  3 112 ? 59.962  -56.592  -116.264 1.00 110.36 ? 111  ASP G N   1 
ATOM   9041  C  CA  . ASP G  3 112 ? 60.584  -56.800  -114.963 1.00 110.52 ? 111  ASP G CA  1 
ATOM   9042  C  C   . ASP G  3 112 ? 59.869  -56.121  -113.793 1.00 109.57 ? 111  ASP G C   1 
ATOM   9043  O  O   . ASP G  3 112 ? 60.189  -56.376  -112.634 1.00 108.88 ? 111  ASP G O   1 
ATOM   9044  C  CB  . ASP G  3 112 ? 62.043  -56.345  -115.006 1.00 112.16 ? 111  ASP G CB  1 
ATOM   9045  C  CG  . ASP G  3 112 ? 62.762  -56.579  -113.690 1.00 113.83 ? 111  ASP G CG  1 
ATOM   9046  O  OD1 . ASP G  3 112 ? 62.775  -57.738  -113.216 1.00 114.02 ? 111  ASP G OD1 1 
ATOM   9047  O  OD2 . ASP G  3 112 ? 63.313  -55.604  -113.132 1.00 114.85 ? 111  ASP G OD2 1 
ATOM   9048  N  N   . GLU G  3 113 ? 58.902  -55.261  -114.090 1.00 108.88 ? 112  GLU G N   1 
ATOM   9049  C  CA  . GLU G  3 113 ? 58.165  -54.565  -113.041 1.00 108.10 ? 112  GLU G CA  1 
ATOM   9050  C  C   . GLU G  3 113 ? 57.392  -55.565  -112.185 1.00 107.23 ? 112  GLU G C   1 
ATOM   9051  O  O   . GLU G  3 113 ? 57.474  -55.537  -110.958 1.00 107.49 ? 112  GLU G O   1 
ATOM   9052  C  CB  . GLU G  3 113 ? 57.194  -53.558  -113.661 1.00 109.32 ? 112  GLU G CB  1 
ATOM   9053  C  CG  . GLU G  3 113 ? 56.430  -52.697  -112.661 1.00 110.51 ? 112  GLU G CG  1 
ATOM   9054  C  CD  . GLU G  3 113 ? 57.291  -51.625  -112.014 1.00 110.79 ? 112  GLU G CD  1 
ATOM   9055  O  OE1 . GLU G  3 113 ? 58.267  -51.981  -111.320 1.00 111.39 ? 112  GLU G OE1 1 
ATOM   9056  O  OE2 . GLU G  3 113 ? 56.989  -50.426  -112.201 1.00 109.93 ? 112  GLU G OE2 1 
ATOM   9057  N  N   . ILE G  3 114 ? 56.641  -56.446  -112.842 1.00 105.85 ? 113  ILE G N   1 
ATOM   9058  C  CA  . ILE G  3 114 ? 55.855  -57.464  -112.149 1.00 103.53 ? 113  ILE G CA  1 
ATOM   9059  C  C   . ILE G  3 114 ? 56.796  -58.527  -111.589 1.00 102.55 ? 113  ILE G C   1 
ATOM   9060  O  O   . ILE G  3 114 ? 56.615  -59.013  -110.474 1.00 102.12 ? 113  ILE G O   1 
ATOM   9061  C  CB  . ILE G  3 114 ? 54.855  -58.154  -113.111 1.00 102.53 ? 113  ILE G CB  1 
ATOM   9062  C  CG1 . ILE G  3 114 ? 53.966  -57.111  -113.792 1.00 100.99 ? 113  ILE G CG1 1 
ATOM   9063  C  CG2 . ILE G  3 114 ? 54.002  -59.145  -112.345 1.00 102.58 ? 113  ILE G CG2 1 
ATOM   9064  C  CD1 . ILE G  3 114 ? 53.108  -56.319  -112.850 1.00 99.44  ? 113  ILE G CD1 1 
ATOM   9065  N  N   . ARG G  3 115 ? 57.806  -58.868  -112.380 1.00 101.66 ? 114  ARG G N   1 
ATOM   9066  C  CA  . ARG G  3 115 ? 58.809  -59.871  -112.028 1.00 101.13 ? 114  ARG G CA  1 
ATOM   9067  C  C   . ARG G  3 115 ? 59.555  -59.553  -110.731 1.00 100.20 ? 114  ARG G C   1 
ATOM   9068  O  O   . ARG G  3 115 ? 60.520  -60.232  -110.376 1.00 100.19 ? 114  ARG G O   1 
ATOM   9069  C  CB  . ARG G  3 115 ? 59.798  -60.000  -113.191 1.00 102.41 ? 114  ARG G CB  1 
ATOM   9070  C  CG  . ARG G  3 115 ? 60.921  -61.003  -113.014 1.00 102.68 ? 114  ARG G CG  1 
ATOM   9071  C  CD  . ARG G  3 115 ? 61.685  -61.139  -114.323 1.00 103.99 ? 114  ARG G CD  1 
ATOM   9072  N  NE  . ARG G  3 115 ? 62.886  -61.956  -114.191 1.00 104.86 ? 114  ARG G NE  1 
ATOM   9073  C  CZ  . ARG G  3 115 ? 63.678  -62.285  -115.206 1.00 104.90 ? 114  ARG G CZ  1 
ATOM   9074  N  NH1 . ARG G  3 115 ? 63.396  -61.867  -116.432 1.00 105.19 ? 114  ARG G NH1 1 
ATOM   9075  N  NH2 . ARG G  3 115 ? 64.758  -63.024  -114.993 1.00 105.22 ? 114  ARG G NH2 1 
ATOM   9076  N  N   . THR G  3 116 ? 59.103  -58.523  -110.025 1.00 98.90  ? 115  THR G N   1 
ATOM   9077  C  CA  . THR G  3 116 ? 59.737  -58.122  -108.778 1.00 97.69  ? 115  THR G CA  1 
ATOM   9078  C  C   . THR G  3 116 ? 58.676  -57.689  -107.777 1.00 97.00  ? 115  THR G C   1 
ATOM   9079  O  O   . THR G  3 116 ? 58.867  -57.800  -106.569 1.00 97.05  ? 115  THR G O   1 
ATOM   9080  C  CB  . THR G  3 116 ? 60.726  -56.956  -109.009 1.00 97.64  ? 115  THR G CB  1 
ATOM   9081  O  OG1 . THR G  3 116 ? 61.519  -56.754  -107.833 1.00 97.78  ? 115  THR G OG1 1 
ATOM   9082  C  CG2 . THR G  3 116 ? 59.973  -55.675  -109.326 1.00 97.59  ? 115  THR G CG2 1 
ATOM   9083  N  N   . LEU G  3 117 ? 57.556  -57.194  -108.288 1.00 96.35  ? 116  LEU G N   1 
ATOM   9084  C  CA  . LEU G  3 117 ? 56.465  -56.754  -107.433 1.00 96.44  ? 116  LEU G CA  1 
ATOM   9085  C  C   . LEU G  3 117 ? 55.794  -57.979  -106.816 1.00 96.39  ? 116  LEU G C   1 
ATOM   9086  O  O   . LEU G  3 117 ? 55.114  -57.889  -105.793 1.00 96.24  ? 116  LEU G O   1 
ATOM   9087  C  CB  . LEU G  3 117 ? 55.444  -55.965  -108.250 1.00 97.40  ? 116  LEU G CB  1 
ATOM   9088  C  CG  . LEU G  3 117 ? 54.380  -55.222  -107.441 1.00 98.27  ? 116  LEU G CG  1 
ATOM   9089  C  CD1 . LEU G  3 117 ? 55.039  -54.070  -106.692 1.00 98.24  ? 116  LEU G CD1 1 
ATOM   9090  C  CD2 . LEU G  3 117 ? 53.292  -54.700  -108.366 1.00 98.89  ? 116  LEU G CD2 1 
ATOM   9091  N  N   . VAL G  3 118 ? 55.982  -59.128  -107.454 1.00 95.96  ? 117  VAL G N   1 
ATOM   9092  C  CA  . VAL G  3 118 ? 55.408  -60.370  -106.965 1.00 94.72  ? 117  VAL G CA  1 
ATOM   9093  C  C   . VAL G  3 118 ? 56.373  -60.963  -105.959 1.00 94.02  ? 117  VAL G C   1 
ATOM   9094  O  O   . VAL G  3 118 ? 55.994  -61.282  -104.834 1.00 93.82  ? 117  VAL G O   1 
ATOM   9095  C  CB  . VAL G  3 118 ? 55.206  -61.385  -108.102 1.00 94.54  ? 117  VAL G CB  1 
ATOM   9096  C  CG1 . VAL G  3 118 ? 54.610  -62.666  -107.552 1.00 94.71  ? 117  VAL G CG1 1 
ATOM   9097  C  CG2 . VAL G  3 118 ? 54.304  -60.798  -109.167 1.00 94.91  ? 117  VAL G CG2 1 
ATOM   9098  N  N   . LYS G  3 119 ? 57.627  -61.103  -106.378 1.00 93.51  ? 118  LYS G N   1 
ATOM   9099  C  CA  . LYS G  3 119 ? 58.663  -61.659  -105.519 1.00 93.53  ? 118  LYS G CA  1 
ATOM   9100  C  C   . LYS G  3 119 ? 58.648  -60.962  -104.168 1.00 93.02  ? 118  LYS G C   1 
ATOM   9101  O  O   . LYS G  3 119 ? 58.953  -61.571  -103.147 1.00 93.40  ? 118  LYS G O   1 
ATOM   9102  C  CB  . LYS G  3 119 ? 60.041  -61.503  -106.165 1.00 93.76  ? 118  LYS G CB  1 
ATOM   9103  C  CG  . LYS G  3 119 ? 61.172  -62.110  -105.349 1.00 94.30  ? 118  LYS G CG  1 
ATOM   9104  C  CD  . LYS G  3 119 ? 62.528  -61.855  -105.997 1.00 96.07  ? 118  LYS G CD  1 
ATOM   9105  C  CE  . LYS G  3 119 ? 63.672  -62.362  -105.120 1.00 96.51  ? 118  LYS G CE  1 
ATOM   9106  N  NZ  . LYS G  3 119 ? 65.012  -62.114  -105.729 1.00 96.00  ? 118  LYS G NZ  1 
ATOM   9107  N  N   . ASP G  3 120 ? 58.293  -59.682  -104.161 1.00 92.07  ? 119  ASP G N   1 
ATOM   9108  C  CA  . ASP G  3 120 ? 58.233  -58.940  -102.913 1.00 91.01  ? 119  ASP G CA  1 
ATOM   9109  C  C   . ASP G  3 120 ? 57.160  -59.603  -102.051 1.00 89.98  ? 119  ASP G C   1 
ATOM   9110  O  O   . ASP G  3 120 ? 57.370  -59.843  -100.864 1.00 90.02  ? 119  ASP G O   1 
ATOM   9111  C  CB  . ASP G  3 120 ? 57.884  -57.470  -103.179 1.00 91.99  ? 119  ASP G CB  1 
ATOM   9112  C  CG  . ASP G  3 120 ? 58.060  -56.590  -101.949 1.00 92.64  ? 119  ASP G CG  1 
ATOM   9113  O  OD1 . ASP G  3 120 ? 59.178  -56.563  -101.391 1.00 93.50  ? 119  ASP G OD1 1 
ATOM   9114  O  OD2 . ASP G  3 120 ? 57.088  -55.922  -101.539 1.00 91.78  ? 119  ASP G OD2 1 
HETATM 9115  N  N   . MSE G  3 121 ? 56.016  -59.913  -102.655 1.00 89.05  ? 120  MSE G N   1 
HETATM 9116  C  CA  . MSE G  3 121 ? 54.932  -60.564  -101.926 1.00 87.63  ? 120  MSE G CA  1 
HETATM 9117  C  C   . MSE G  3 121 ? 55.385  -61.915  -101.408 1.00 82.98  ? 120  MSE G C   1 
HETATM 9118  O  O   . MSE G  3 121 ? 55.194  -62.237  -100.239 1.00 82.06  ? 120  MSE G O   1 
HETATM 9119  C  CB  . MSE G  3 121 ? 53.704  -60.762  -102.816 1.00 93.45  ? 120  MSE G CB  1 
HETATM 9120  C  CG  . MSE G  3 121 ? 52.885  -59.510  -103.031 1.00 101.36 ? 120  MSE G CG  1 
HETATM 9121  SE SE  . MSE G  3 121 ? 51.067  -59.905  -103.577 1.00 113.71 ? 120  MSE G SE  1 
HETATM 9122  C  CE  . MSE G  3 121 ? 51.340  -59.944  -105.495 1.00 109.17 ? 120  MSE G CE  1 
ATOM   9123  N  N   . TRP G  3 122 ? 55.982  -62.709  -102.287 1.00 77.64  ? 121  TRP G N   1 
ATOM   9124  C  CA  . TRP G  3 122 ? 56.457  -64.021  -101.895 1.00 72.91  ? 121  TRP G CA  1 
ATOM   9125  C  C   . TRP G  3 122 ? 57.382  -63.927  -100.696 1.00 71.17  ? 121  TRP G C   1 
ATOM   9126  O  O   . TRP G  3 122 ? 57.264  -64.709  -99.752  1.00 71.86  ? 121  TRP G O   1 
ATOM   9127  C  CB  . TRP G  3 122 ? 57.193  -64.694  -103.054 1.00 70.87  ? 121  TRP G CB  1 
ATOM   9128  C  CG  . TRP G  3 122 ? 58.082  -65.819  -102.620 1.00 68.29  ? 121  TRP G CG  1 
ATOM   9129  C  CD1 . TRP G  3 122 ? 59.379  -65.723  -102.212 1.00 68.29  ? 121  TRP G CD1 1 
ATOM   9130  C  CD2 . TRP G  3 122 ? 57.733  -67.206  -102.522 1.00 67.89  ? 121  TRP G CD2 1 
ATOM   9131  N  NE1 . TRP G  3 122 ? 59.864  -66.962  -101.867 1.00 68.30  ? 121  TRP G NE1 1 
ATOM   9132  C  CE2 . TRP G  3 122 ? 58.875  -67.891  -102.048 1.00 68.09  ? 121  TRP G CE2 1 
ATOM   9133  C  CE3 . TRP G  3 122 ? 56.568  -67.937  -102.789 1.00 66.86  ? 121  TRP G CE3 1 
ATOM   9134  C  CZ2 . TRP G  3 122 ? 58.887  -69.274  -101.835 1.00 67.64  ? 121  TRP G CZ2 1 
ATOM   9135  C  CZ3 . TRP G  3 122 ? 56.580  -69.314  -102.577 1.00 66.63  ? 121  TRP G CZ3 1 
ATOM   9136  C  CH2 . TRP G  3 122 ? 57.732  -69.966  -102.105 1.00 66.83  ? 121  TRP G CH2 1 
ATOM   9137  N  N   . ASP G  3 123 ? 58.296  -62.962  -100.732 1.00 68.56  ? 122  ASP G N   1 
ATOM   9138  C  CA  . ASP G  3 123 ? 59.263  -62.782  -99.652  1.00 64.56  ? 122  ASP G CA  1 
ATOM   9139  C  C   . ASP G  3 123 ? 58.649  -62.406  -98.308  1.00 60.41  ? 122  ASP G C   1 
ATOM   9140  O  O   . ASP G  3 123 ? 59.034  -62.954  -97.274  1.00 58.34  ? 122  ASP G O   1 
ATOM   9141  C  CB  . ASP G  3 123 ? 60.319  -61.741  -100.050 1.00 66.49  ? 122  ASP G CB  1 
ATOM   9142  C  CG  . ASP G  3 123 ? 61.186  -62.197  -101.220 1.00 68.00  ? 122  ASP G CG  1 
ATOM   9143  O  OD1 . ASP G  3 123 ? 61.740  -63.320  -101.169 1.00 69.12  ? 122  ASP G OD1 1 
ATOM   9144  O  OD2 . ASP G  3 123 ? 61.323  -61.426  -102.193 1.00 70.13  ? 122  ASP G OD2 1 
ATOM   9145  N  N   . THR G  3 124 ? 57.699  -61.479  -98.307  1.00 56.06  ? 123  THR G N   1 
ATOM   9146  C  CA  . THR G  3 124 ? 57.096  -61.099  -97.041  1.00 54.76  ? 123  THR G CA  1 
ATOM   9147  C  C   . THR G  3 124 ? 56.188  -62.220  -96.532  1.00 53.74  ? 123  THR G C   1 
ATOM   9148  O  O   . THR G  3 124 ? 55.864  -62.273  -95.341  1.00 53.63  ? 123  THR G O   1 
ATOM   9149  C  CB  . THR G  3 124 ? 56.277  -59.772  -97.133  1.00 53.14  ? 123  THR G CB  1 
ATOM   9150  O  OG1 . THR G  3 124 ? 54.913  -60.059  -97.453  1.00 51.08  ? 123  THR G OG1 1 
ATOM   9151  C  CG2 . THR G  3 124 ? 56.858  -58.859  -98.185  1.00 53.05  ? 123  THR G CG2 1 
ATOM   9152  N  N   . ARG G  3 125 ? 55.793  -63.121  -97.429  1.00 51.32  ? 124  ARG G N   1 
ATOM   9153  C  CA  . ARG G  3 125 ? 54.924  -64.231  -97.054  1.00 49.73  ? 124  ARG G CA  1 
ATOM   9154  C  C   . ARG G  3 125 ? 55.685  -65.368  -96.389  1.00 49.56  ? 124  ARG G C   1 
ATOM   9155  O  O   . ARG G  3 125 ? 55.371  -65.766  -95.261  1.00 47.98  ? 124  ARG G O   1 
ATOM   9156  C  CB  . ARG G  3 125 ? 54.191  -64.771  -98.273  1.00 48.42  ? 124  ARG G CB  1 
ATOM   9157  C  CG  . ARG G  3 125 ? 53.167  -63.820  -98.851  1.00 47.78  ? 124  ARG G CG  1 
ATOM   9158  C  CD  . ARG G  3 125 ? 52.138  -64.583  -99.666  1.00 44.23  ? 124  ARG G CD  1 
ATOM   9159  N  NE  . ARG G  3 125 ? 50.812  -64.431  -99.090  1.00 42.68  ? 124  ARG G NE  1 
ATOM   9160  C  CZ  . ARG G  3 125 ? 49.820  -65.298  -99.249  1.00 43.79  ? 124  ARG G CZ  1 
ATOM   9161  N  NH1 . ARG G  3 125 ? 48.652  -65.057  -98.679  1.00 45.29  ? 124  ARG G NH1 1 
ATOM   9162  N  NH2 . ARG G  3 125 ? 49.995  -66.407  -99.959  1.00 42.90  ? 124  ARG G NH2 1 
ATOM   9163  N  N   . ILE G  3 126 ? 56.677  -65.897  -97.099  1.00 49.31  ? 125  ILE G N   1 
ATOM   9164  C  CA  . ILE G  3 126 ? 57.491  -66.984  -96.577  1.00 50.33  ? 125  ILE G CA  1 
ATOM   9165  C  C   . ILE G  3 126 ? 58.016  -66.564  -95.203  1.00 50.50  ? 125  ILE G C   1 
ATOM   9166  O  O   . ILE G  3 126 ? 58.317  -67.405  -94.356  1.00 52.72  ? 125  ILE G O   1 
ATOM   9167  C  CB  . ILE G  3 126 ? 58.679  -67.289  -97.522  1.00 50.56  ? 125  ILE G CB  1 
ATOM   9168  C  CG1 . ILE G  3 126 ? 59.012  -68.783  -97.502  1.00 53.04  ? 125  ILE G CG1 1 
ATOM   9169  C  CG2 . ILE G  3 126 ? 59.908  -66.512  -97.082  1.00 52.27  ? 125  ILE G CG2 1 
ATOM   9170  C  CD1 . ILE G  3 126 ? 59.604  -69.299  -96.173  1.00 52.51  ? 125  ILE G CD1 1 
ATOM   9171  N  N   . ALA G  3 127 ? 58.107  -65.253  -94.990  1.00 50.58  ? 126  ALA G N   1 
ATOM   9172  C  CA  . ALA G  3 127 ? 58.583  -64.678  -93.731  1.00 48.58  ? 126  ALA G CA  1 
ATOM   9173  C  C   . ALA G  3 127 ? 57.516  -64.764  -92.652  1.00 47.25  ? 126  ALA G C   1 
ATOM   9174  O  O   . ALA G  3 127 ? 57.800  -65.147  -91.520  1.00 48.05  ? 126  ALA G O   1 
ATOM   9175  C  CB  . ALA G  3 127 ? 58.977  -63.227  -93.942  1.00 48.18  ? 126  ALA G CB  1 
ATOM   9176  N  N   . LYS G  3 128 ? 56.290  -64.392  -93.008  1.00 46.09  ? 127  LYS G N   1 
ATOM   9177  C  CA  . LYS G  3 128 ? 55.175  -64.435  -92.072  1.00 45.19  ? 127  LYS G CA  1 
ATOM   9178  C  C   . LYS G  3 128 ? 54.929  -65.880  -91.691  1.00 44.73  ? 127  LYS G C   1 
ATOM   9179  O  O   . LYS G  3 128 ? 54.394  -66.175  -90.622  1.00 42.66  ? 127  LYS G O   1 
ATOM   9180  C  CB  . LYS G  3 128 ? 53.917  -63.851  -92.715  1.00 45.11  ? 127  LYS G CB  1 
ATOM   9181  C  CG  . LYS G  3 128 ? 54.084  -62.421  -93.175  1.00 45.44  ? 127  LYS G CG  1 
ATOM   9182  C  CD  . LYS G  3 128 ? 52.825  -61.864  -93.814  1.00 46.95  ? 127  LYS G CD  1 
ATOM   9183  C  CE  . LYS G  3 128 ? 51.720  -61.650  -92.796  1.00 46.81  ? 127  LYS G CE  1 
ATOM   9184  N  NZ  . LYS G  3 128 ? 50.583  -60.895  -93.398  1.00 47.32  ? 127  LYS G NZ  1 
ATOM   9185  N  N   . LEU G  3 129 ? 55.336  -66.776  -92.587  1.00 44.72  ? 128  LEU G N   1 
ATOM   9186  C  CA  . LEU G  3 129 ? 55.175  -68.201  -92.378  1.00 44.09  ? 128  LEU G CA  1 
ATOM   9187  C  C   . LEU G  3 129 ? 56.048  -68.646  -91.208  1.00 43.92  ? 128  LEU G C   1 
ATOM   9188  O  O   . LEU G  3 129 ? 55.557  -69.277  -90.263  1.00 43.65  ? 128  LEU G O   1 
ATOM   9189  C  CB  . LEU G  3 129 ? 55.547  -68.965  -93.653  1.00 44.17  ? 128  LEU G CB  1 
ATOM   9190  C  CG  . LEU G  3 129 ? 55.271  -70.474  -93.604  1.00 44.16  ? 128  LEU G CG  1 
ATOM   9191  C  CD1 . LEU G  3 129 ? 53.783  -70.729  -93.392  1.00 40.55  ? 128  LEU G CD1 1 
ATOM   9192  C  CD2 . LEU G  3 129 ? 55.765  -71.122  -94.883  1.00 43.14  ? 128  LEU G CD2 1 
ATOM   9193  N  N   . ARG G  3 130 ? 57.338  -68.326  -91.263  1.00 42.06  ? 129  ARG G N   1 
ATOM   9194  C  CA  . ARG G  3 130 ? 58.220  -68.691  -90.168  1.00 41.93  ? 129  ARG G CA  1 
ATOM   9195  C  C   . ARG G  3 130 ? 57.652  -68.143  -88.857  1.00 41.81  ? 129  ARG G C   1 
ATOM   9196  O  O   . ARG G  3 130 ? 57.521  -68.882  -87.873  1.00 42.83  ? 129  ARG G O   1 
ATOM   9197  C  CB  . ARG G  3 130 ? 59.618  -68.144  -90.408  1.00 43.42  ? 129  ARG G CB  1 
ATOM   9198  C  CG  . ARG G  3 130 ? 60.309  -68.792  -91.581  1.00 48.54  ? 129  ARG G CG  1 
ATOM   9199  C  CD  . ARG G  3 130 ? 61.559  -68.036  -91.974  1.00 54.57  ? 129  ARG G CD  1 
ATOM   9200  N  NE  . ARG G  3 130 ? 62.027  -68.420  -93.305  1.00 60.10  ? 129  ARG G NE  1 
ATOM   9201  C  CZ  . ARG G  3 130 ? 62.470  -67.554  -94.215  1.00 62.51  ? 129  ARG G CZ  1 
ATOM   9202  N  NH1 . ARG G  3 130 ? 62.502  -66.254  -93.931  1.00 63.56  ? 129  ARG G NH1 1 
ATOM   9203  N  NH2 . ARG G  3 130 ? 62.873  -67.981  -95.407  1.00 63.21  ? 129  ARG G NH2 1 
ATOM   9204  N  N   . VAL G  3 131 ? 57.298  -66.859  -88.845  1.00 38.98  ? 130  VAL G N   1 
ATOM   9205  C  CA  . VAL G  3 131 ? 56.735  -66.240  -87.648  1.00 36.15  ? 130  VAL G CA  1 
ATOM   9206  C  C   . VAL G  3 131 ? 55.460  -66.947  -87.187  1.00 34.59  ? 130  VAL G C   1 
ATOM   9207  O  O   . VAL G  3 131 ? 55.297  -67.226  -86.008  1.00 33.46  ? 130  VAL G O   1 
ATOM   9208  C  CB  . VAL G  3 131 ? 56.456  -64.732  -87.887  1.00 36.71  ? 130  VAL G CB  1 
ATOM   9209  C  CG1 . VAL G  3 131 ? 55.565  -64.171  -86.796  1.00 35.01  ? 130  VAL G CG1 1 
ATOM   9210  C  CG2 . VAL G  3 131 ? 57.770  -63.967  -87.915  1.00 35.16  ? 130  VAL G CG2 1 
ATOM   9211  N  N   . SER G  3 132 ? 54.559  -67.241  -88.116  1.00 35.07  ? 131  SER G N   1 
ATOM   9212  C  CA  . SER G  3 132 ? 53.311  -67.934  -87.780  1.00 36.65  ? 131  SER G CA  1 
ATOM   9213  C  C   . SER G  3 132 ? 53.599  -69.337  -87.265  1.00 36.00  ? 131  SER G C   1 
ATOM   9214  O  O   . SER G  3 132 ? 52.978  -69.798  -86.312  1.00 35.37  ? 131  SER G O   1 
ATOM   9215  C  CB  . SER G  3 132 ? 52.406  -68.065  -89.007  1.00 38.12  ? 131  SER G CB  1 
ATOM   9216  O  OG  . SER G  3 132 ? 52.132  -66.813  -89.594  1.00 45.02  ? 131  SER G OG  1 
ATOM   9217  N  N   . ALA G  3 133 ? 54.525  -70.024  -87.926  1.00 35.75  ? 132  ALA G N   1 
ATOM   9218  C  CA  . ALA G  3 133 ? 54.900  -71.375  -87.528  1.00 36.85  ? 132  ALA G CA  1 
ATOM   9219  C  C   . ALA G  3 133 ? 55.495  -71.395  -86.113  1.00 37.52  ? 132  ALA G C   1 
ATOM   9220  O  O   . ALA G  3 133 ? 55.172  -72.274  -85.317  1.00 37.92  ? 132  ALA G O   1 
ATOM   9221  C  CB  . ALA G  3 133 ? 55.897  -71.961  -88.530  1.00 35.60  ? 132  ALA G CB  1 
ATOM   9222  N  N   . ASP G  3 134 ? 56.359  -70.432  -85.799  1.00 36.85  ? 133  ASP G N   1 
ATOM   9223  C  CA  . ASP G  3 134 ? 56.969  -70.376  -84.472  1.00 37.50  ? 133  ASP G CA  1 
ATOM   9224  C  C   . ASP G  3 134 ? 55.887  -70.136  -83.426  1.00 35.88  ? 133  ASP G C   1 
ATOM   9225  O  O   . ASP G  3 134 ? 55.841  -70.776  -82.368  1.00 34.60  ? 133  ASP G O   1 
ATOM   9226  C  CB  . ASP G  3 134 ? 58.021  -69.260  -84.419  1.00 39.91  ? 133  ASP G CB  1 
ATOM   9227  C  CG  . ASP G  3 134 ? 58.658  -69.120  -83.051  1.00 41.51  ? 133  ASP G CG  1 
ATOM   9228  O  OD1 . ASP G  3 134 ? 59.155  -70.131  -82.508  1.00 43.41  ? 133  ASP G OD1 1 
ATOM   9229  O  OD2 . ASP G  3 134 ? 58.668  -67.993  -82.519  1.00 43.96  ? 133  ASP G OD2 1 
ATOM   9230  N  N   . SER G  3 135 ? 55.007  -69.204  -83.739  1.00 34.77  ? 134  SER G N   1 
ATOM   9231  C  CA  . SER G  3 135 ? 53.912  -68.885  -82.860  1.00 34.22  ? 134  SER G CA  1 
ATOM   9232  C  C   . SER G  3 135 ? 53.125  -70.164  -82.603  1.00 34.03  ? 134  SER G C   1 
ATOM   9233  O  O   . SER G  3 135 ? 52.752  -70.463  -81.471  1.00 34.43  ? 134  SER G O   1 
ATOM   9234  C  CB  . SER G  3 135 ? 53.028  -67.844  -83.529  1.00 32.97  ? 134  SER G CB  1 
ATOM   9235  O  OG  . SER G  3 135 ? 51.958  -67.503  -82.686  1.00 38.19  ? 134  SER G OG  1 
ATOM   9236  N  N   . PHE G  3 136 ? 52.893  -70.916  -83.677  1.00 34.99  ? 135  PHE G N   1 
ATOM   9237  C  CA  . PHE G  3 136 ? 52.156  -72.180  -83.645  1.00 34.88  ? 135  PHE G CA  1 
ATOM   9238  C  C   . PHE G  3 136 ? 52.760  -73.196  -82.675  1.00 34.52  ? 135  PHE G C   1 
ATOM   9239  O  O   . PHE G  3 136 ? 52.048  -73.852  -81.906  1.00 34.63  ? 135  PHE G O   1 
ATOM   9240  C  CB  . PHE G  3 136 ? 52.111  -72.768  -85.058  1.00 35.63  ? 135  PHE G CB  1 
ATOM   9241  C  CG  . PHE G  3 136 ? 51.332  -74.051  -85.167  1.00 37.71  ? 135  PHE G CG  1 
ATOM   9242  C  CD1 . PHE G  3 136 ? 51.953  -75.280  -84.970  1.00 38.63  ? 135  PHE G CD1 1 
ATOM   9243  C  CD2 . PHE G  3 136 ? 49.971  -74.031  -85.453  1.00 38.91  ? 135  PHE G CD2 1 
ATOM   9244  C  CE1 . PHE G  3 136 ? 51.233  -76.470  -85.054  1.00 37.85  ? 135  PHE G CE1 1 
ATOM   9245  C  CE2 . PHE G  3 136 ? 49.240  -75.219  -85.540  1.00 39.74  ? 135  PHE G CE2 1 
ATOM   9246  C  CZ  . PHE G  3 136 ? 49.877  -76.440  -85.338  1.00 38.62  ? 135  PHE G CZ  1 
ATOM   9247  N  N   . VAL G  3 137 ? 54.078  -73.318  -82.716  1.00 33.54  ? 136  VAL G N   1 
ATOM   9248  C  CA  . VAL G  3 137 ? 54.782  -74.244  -81.861  1.00 34.55  ? 136  VAL G CA  1 
ATOM   9249  C  C   . VAL G  3 137 ? 54.767  -73.826  -80.397  1.00 36.18  ? 136  VAL G C   1 
ATOM   9250  O  O   . VAL G  3 137 ? 54.460  -74.634  -79.518  1.00 35.78  ? 136  VAL G O   1 
ATOM   9251  C  CB  . VAL G  3 137 ? 56.208  -74.385  -82.330  1.00 34.49  ? 136  VAL G CB  1 
ATOM   9252  C  CG1 . VAL G  3 137 ? 56.980  -75.257  -81.386  1.00 36.76  ? 136  VAL G CG1 1 
ATOM   9253  C  CG2 . VAL G  3 137 ? 56.215  -74.981  -83.711  1.00 36.11  ? 136  VAL G CG2 1 
ATOM   9254  N  N   . ARG G  3 138 ? 55.091  -72.562  -80.140  1.00 38.80  ? 137  ARG G N   1 
ATOM   9255  C  CA  . ARG G  3 138 ? 55.120  -72.035  -78.777  1.00 39.75  ? 137  ARG G CA  1 
ATOM   9256  C  C   . ARG G  3 138 ? 53.767  -72.051  -78.088  1.00 38.76  ? 137  ARG G C   1 
ATOM   9257  O  O   . ARG G  3 138 ? 53.691  -72.283  -76.892  1.00 38.39  ? 137  ARG G O   1 
ATOM   9258  C  CB  . ARG G  3 138 ? 55.662  -70.606  -78.764  1.00 43.56  ? 137  ARG G CB  1 
ATOM   9259  C  CG  . ARG G  3 138 ? 57.135  -70.466  -79.137  1.00 49.97  ? 137  ARG G CG  1 
ATOM   9260  C  CD  . ARG G  3 138 ? 57.466  -68.996  -79.361  1.00 56.10  ? 137  ARG G CD  1 
ATOM   9261  N  NE  . ARG G  3 138 ? 56.663  -68.445  -80.459  1.00 62.76  ? 137  ARG G NE  1 
ATOM   9262  C  CZ  . ARG G  3 138 ? 56.445  -67.147  -80.672  1.00 64.78  ? 137  ARG G CZ  1 
ATOM   9263  N  NH1 . ARG G  3 138 ? 56.969  -66.238  -79.855  1.00 66.80  ? 137  ARG G NH1 1 
ATOM   9264  N  NH2 . ARG G  3 138 ? 55.705  -66.757  -81.708  1.00 65.27  ? 137  ARG G NH2 1 
ATOM   9265  N  N   . GLN G  3 139 ? 52.695  -71.792  -78.827  1.00 40.09  ? 138  GLN G N   1 
ATOM   9266  C  CA  . GLN G  3 139 ? 51.363  -71.795  -78.219  1.00 41.38  ? 138  GLN G CA  1 
ATOM   9267  C  C   . GLN G  3 139 ? 50.786  -73.207  -78.133  1.00 40.33  ? 138  GLN G C   1 
ATOM   9268  O  O   . GLN G  3 139 ? 49.655  -73.401  -77.689  1.00 37.39  ? 138  GLN G O   1 
ATOM   9269  C  CB  . GLN G  3 139 ? 50.412  -70.903  -79.007  1.00 43.42  ? 138  GLN G CB  1 
ATOM   9270  C  CG  . GLN G  3 139 ? 50.656  -69.421  -78.852  1.00 48.80  ? 138  GLN G CG  1 
ATOM   9271  C  CD  . GLN G  3 139 ? 49.866  -68.606  -79.874  1.00 53.88  ? 138  GLN G CD  1 
ATOM   9272  O  OE1 . GLN G  3 139 ? 50.116  -68.697  -81.084  1.00 54.14  ? 138  GLN G OE1 1 
ATOM   9273  N  NE2 . GLN G  3 139 ? 48.899  -67.811  -79.392  1.00 54.75  ? 138  GLN G NE2 1 
ATOM   9274  N  N   . GLN G  3 140 ? 51.570  -74.181  -78.577  1.00 40.09  ? 139  GLN G N   1 
ATOM   9275  C  CA  . GLN G  3 140 ? 51.162  -75.570  -78.545  1.00 41.05  ? 139  GLN G CA  1 
ATOM   9276  C  C   . GLN G  3 140 ? 49.836  -75.849  -79.268  1.00 42.39  ? 139  GLN G C   1 
ATOM   9277  O  O   . GLN G  3 140 ? 48.958  -76.538  -78.749  1.00 42.16  ? 139  GLN G O   1 
ATOM   9278  C  CB  . GLN G  3 140 ? 51.095  -76.021  -77.093  1.00 40.11  ? 139  GLN G CB  1 
ATOM   9279  C  CG  . GLN G  3 140 ? 52.428  -75.843  -76.362  1.00 40.23  ? 139  GLN G CG  1 
ATOM   9280  C  CD  . GLN G  3 140 ? 52.386  -76.340  -74.923  1.00 40.95  ? 139  GLN G CD  1 
ATOM   9281  O  OE1 . GLN G  3 140 ? 51.691  -75.770  -74.075  1.00 40.20  ? 139  GLN G OE1 1 
ATOM   9282  N  NE2 . GLN G  3 140 ? 53.124  -77.412  -74.643  1.00 40.93  ? 139  GLN G NE2 1 
ATOM   9283  N  N   . GLU G  3 141 ? 49.707  -75.318  -80.481  1.00 42.72  ? 140  GLU G N   1 
ATOM   9284  C  CA  . GLU G  3 141 ? 48.504  -75.504  -81.282  1.00 43.23  ? 140  GLU G CA  1 
ATOM   9285  C  C   . GLU G  3 141 ? 48.420  -76.948  -81.774  1.00 43.71  ? 140  GLU G C   1 
ATOM   9286  O  O   . GLU G  3 141 ? 49.446  -77.598  -81.969  1.00 44.52  ? 140  GLU G O   1 
ATOM   9287  C  CB  . GLU G  3 141 ? 48.535  -74.572  -82.493  1.00 44.54  ? 140  GLU G CB  1 
ATOM   9288  C  CG  . GLU G  3 141 ? 48.662  -73.101  -82.182  1.00 46.76  ? 140  GLU G CG  1 
ATOM   9289  C  CD  . GLU G  3 141 ? 47.463  -72.552  -81.438  1.00 49.49  ? 140  GLU G CD  1 
ATOM   9290  O  OE1 . GLU G  3 141 ? 46.485  -73.307  -81.226  1.00 50.90  ? 140  GLU G OE1 1 
ATOM   9291  O  OE2 . GLU G  3 141 ? 47.500  -71.357  -81.066  1.00 50.19  ? 140  GLU G OE2 1 
ATOM   9292  N  N   . ALA G  3 142 ? 47.202  -77.437  -82.003  1.00 43.29  ? 141  ALA G N   1 
ATOM   9293  C  CA  . ALA G  3 142 ? 46.999  -78.811  -82.474  1.00 42.19  ? 141  ALA G CA  1 
ATOM   9294  C  C   . ALA G  3 142 ? 46.506  -78.855  -83.926  1.00 42.62  ? 141  ALA G C   1 
ATOM   9295  O  O   . ALA G  3 142 ? 46.503  -79.906  -84.577  1.00 41.50  ? 141  ALA G O   1 
ATOM   9296  C  CB  . ALA G  3 142 ? 45.994  -79.523  -81.563  1.00 40.40  ? 141  ALA G CB  1 
ATOM   9297  N  N   . HIS G  3 143 ? 46.106  -77.699  -84.433  1.00 42.34  ? 142  HIS G N   1 
ATOM   9298  C  CA  . HIS G  3 143 ? 45.579  -77.612  -85.779  1.00 42.95  ? 142  HIS G CA  1 
ATOM   9299  C  C   . HIS G  3 143 ? 45.690  -76.166  -86.235  1.00 43.96  ? 142  HIS G C   1 
ATOM   9300  O  O   . HIS G  3 143 ? 45.946  -75.279  -85.430  1.00 44.20  ? 142  HIS G O   1 
ATOM   9301  C  CB  . HIS G  3 143 ? 44.120  -78.076  -85.750  1.00 42.30  ? 142  HIS G CB  1 
ATOM   9302  C  CG  . HIS G  3 143 ? 43.239  -77.385  -86.737  1.00 41.00  ? 142  HIS G CG  1 
ATOM   9303  N  ND1 . HIS G  3 143 ? 43.300  -77.632  -88.090  1.00 42.02  ? 142  HIS G ND1 1 
ATOM   9304  C  CD2 . HIS G  3 143 ? 42.286  -76.441  -86.570  1.00 39.54  ? 142  HIS G CD2 1 
ATOM   9305  C  CE1 . HIS G  3 143 ? 42.423  -76.869  -88.714  1.00 40.22  ? 142  HIS G CE1 1 
ATOM   9306  N  NE2 . HIS G  3 143 ? 41.795  -76.137  -87.814  1.00 40.07  ? 142  HIS G NE2 1 
ATOM   9307  N  N   . ALA G  3 144 ? 45.511  -75.929  -87.526  1.00 45.45  ? 143  ALA G N   1 
ATOM   9308  C  CA  . ALA G  3 144 ? 45.593  -74.578  -88.054  1.00 47.44  ? 143  ALA G CA  1 
ATOM   9309  C  C   . ALA G  3 144 ? 44.996  -74.512  -89.442  1.00 49.39  ? 143  ALA G C   1 
ATOM   9310  O  O   . ALA G  3 144 ? 45.327  -75.326  -90.304  1.00 49.01  ? 143  ALA G O   1 
ATOM   9311  C  CB  . ALA G  3 144 ? 47.033  -74.123  -88.099  1.00 47.08  ? 143  ALA G CB  1 
ATOM   9312  N  N   . LYS G  3 145 ? 44.107  -73.543  -89.649  1.00 51.97  ? 144  LYS G N   1 
ATOM   9313  C  CA  . LYS G  3 145 ? 43.475  -73.351  -90.948  1.00 52.76  ? 144  LYS G CA  1 
ATOM   9314  C  C   . LYS G  3 145 ? 44.483  -72.603  -91.818  1.00 52.87  ? 144  LYS G C   1 
ATOM   9315  O  O   . LYS G  3 145 ? 45.254  -71.784  -91.314  1.00 52.66  ? 144  LYS G O   1 
ATOM   9316  C  CB  . LYS G  3 145 ? 42.188  -72.545  -90.789  1.00 52.89  ? 144  LYS G CB  1 
ATOM   9317  C  CG  . LYS G  3 145 ? 41.450  -72.286  -92.092  1.00 56.23  ? 144  LYS G CG  1 
ATOM   9318  C  CD  . LYS G  3 145 ? 40.092  -71.651  -91.836  1.00 57.17  ? 144  LYS G CD  1 
ATOM   9319  C  CE  . LYS G  3 145 ? 39.141  -72.654  -91.191  1.00 59.58  ? 144  LYS G CE  1 
ATOM   9320  N  NZ  . LYS G  3 145 ? 37.869  -72.036  -90.703  1.00 60.35  ? 144  LYS G NZ  1 
ATOM   9321  N  N   . LEU G  3 146 ? 44.487  -72.877  -93.118  1.00 52.97  ? 145  LEU G N   1 
ATOM   9322  C  CA  . LEU G  3 146 ? 45.449  -72.234  -94.009  1.00 53.28  ? 145  LEU G CA  1 
ATOM   9323  C  C   . LEU G  3 146 ? 44.865  -72.001  -95.382  1.00 53.00  ? 145  LEU G C   1 
ATOM   9324  O  O   . LEU G  3 146 ? 45.523  -72.298  -96.374  1.00 51.65  ? 145  LEU G O   1 
ATOM   9325  C  CB  . LEU G  3 146 ? 46.678  -73.133  -94.186  1.00 54.40  ? 145  LEU G CB  1 
ATOM   9326  C  CG  . LEU G  3 146 ? 47.259  -73.937  -93.022  1.00 53.22  ? 145  LEU G CG  1 
ATOM   9327  C  CD1 . LEU G  3 146 ? 48.323  -74.887  -93.557  1.00 52.00  ? 145  LEU G CD1 1 
ATOM   9328  C  CD2 . LEU G  3 146 ? 47.842  -72.998  -91.981  1.00 54.15  ? 145  LEU G CD2 1 
ATOM   9329  N  N   . ASP G  3 147 ? 43.653  -71.466  -95.458  1.00 54.91  ? 146  ASP G N   1 
ATOM   9330  C  CA  . ASP G  3 147 ? 43.021  -71.264  -96.765  1.00 56.93  ? 146  ASP G CA  1 
ATOM   9331  C  C   . ASP G  3 147 ? 43.681  -70.251  -97.692  1.00 57.28  ? 146  ASP G C   1 
ATOM   9332  O  O   . ASP G  3 147 ? 43.723  -70.469  -98.907  1.00 57.73  ? 146  ASP G O   1 
ATOM   9333  C  CB  . ASP G  3 147 ? 41.542  -70.913  -96.603  1.00 58.03  ? 146  ASP G CB  1 
ATOM   9334  C  CG  . ASP G  3 147 ? 40.749  -72.026  -95.930  1.00 60.51  ? 146  ASP G CG  1 
ATOM   9335  O  OD1 . ASP G  3 147 ? 40.951  -73.211  -96.288  1.00 59.66  ? 146  ASP G OD1 1 
ATOM   9336  O  OD2 . ASP G  3 147 ? 39.916  -71.711  -95.050  1.00 62.20  ? 146  ASP G OD2 1 
ATOM   9337  N  N   . ASN G  3 148 ? 44.201  -69.157  -97.138  1.00 56.27  ? 147  ASN G N   1 
ATOM   9338  C  CA  . ASN G  3 148 ? 44.844  -68.143  -97.968  1.00 55.26  ? 147  ASN G CA  1 
ATOM   9339  C  C   . ASN G  3 148 ? 46.260  -68.490  -98.390  1.00 54.23  ? 147  ASN G C   1 
ATOM   9340  O  O   . ASN G  3 148 ? 46.887  -67.747  -99.147  1.00 55.04  ? 147  ASN G O   1 
ATOM   9341  C  CB  . ASN G  3 148 ? 44.816  -66.785  -97.269  1.00 56.17  ? 147  ASN G CB  1 
ATOM   9342  C  CG  . ASN G  3 148 ? 43.452  -66.129  -97.352  1.00 57.51  ? 147  ASN G CG  1 
ATOM   9343  O  OD1 . ASN G  3 148 ? 43.204  -65.079  -96.751  1.00 57.36  ? 147  ASN G OD1 1 
ATOM   9344  N  ND2 . ASN G  3 148 ? 42.552  -66.750  -98.112  1.00 57.95  ? 147  ASN G ND2 1 
ATOM   9345  N  N   . LEU G  3 149 ? 46.766  -69.618  -97.905  1.00 52.16  ? 148  LEU G N   1 
ATOM   9346  C  CA  . LEU G  3 149 ? 48.103  -70.059  -98.275  1.00 50.81  ? 148  LEU G CA  1 
ATOM   9347  C  C   . LEU G  3 149 ? 47.991  -70.821  -99.593  1.00 50.20  ? 148  LEU G C   1 
ATOM   9348  O  O   . LEU G  3 149 ? 46.894  -71.210  -99.988  1.00 50.29  ? 148  LEU G O   1 
ATOM   9349  C  CB  . LEU G  3 149 ? 48.669  -70.973  -97.194  1.00 51.87  ? 148  LEU G CB  1 
ATOM   9350  C  CG  . LEU G  3 149 ? 49.754  -70.435  -96.258  1.00 52.76  ? 148  LEU G CG  1 
ATOM   9351  C  CD1 . LEU G  3 149 ? 49.314  -69.144  -95.617  1.00 52.46  ? 148  LEU G CD1 1 
ATOM   9352  C  CD2 . LEU G  3 149 ? 50.039  -71.477  -95.191  1.00 52.63  ? 148  LEU G CD2 1 
ATOM   9353  N  N   . THR G  3 150 ? 49.112  -71.029  -100.274 1.00 48.33  ? 149  THR G N   1 
ATOM   9354  C  CA  . THR G  3 150 ? 49.100  -71.754  -101.533 1.00 48.58  ? 149  THR G CA  1 
ATOM   9355  C  C   . THR G  3 150 ? 50.146  -72.856  -101.492 1.00 49.60  ? 149  THR G C   1 
ATOM   9356  O  O   . THR G  3 150 ? 51.109  -72.760  -100.744 1.00 51.37  ? 149  THR G O   1 
ATOM   9357  C  CB  . THR G  3 150 ? 49.404  -70.824  -102.713 1.00 48.81  ? 149  THR G CB  1 
ATOM   9358  O  OG1 . THR G  3 150 ? 50.788  -70.470  -102.704 1.00 48.53  ? 149  THR G OG1 1 
ATOM   9359  C  CG2 . THR G  3 150 ? 48.577  -69.566  -102.613 1.00 48.99  ? 149  THR G CG2 1 
ATOM   9360  N  N   . LEU G  3 151 ? 49.962  -73.898  -102.299 1.00 50.87  ? 150  LEU G N   1 
ATOM   9361  C  CA  . LEU G  3 151 ? 50.894  -75.019  -102.326 1.00 50.92  ? 150  LEU G CA  1 
ATOM   9362  C  C   . LEU G  3 151 ? 52.353  -74.608  -102.244 1.00 52.26  ? 150  LEU G C   1 
ATOM   9363  O  O   . LEU G  3 151 ? 52.955  -74.753  -101.188 1.00 55.26  ? 150  LEU G O   1 
ATOM   9364  C  CB  . LEU G  3 151 ? 50.667  -75.877  -103.565 1.00 50.55  ? 150  LEU G CB  1 
ATOM   9365  C  CG  . LEU G  3 151 ? 49.243  -76.405  -103.700 1.00 49.57  ? 150  LEU G CG  1 
ATOM   9366  C  CD1 . LEU G  3 151 ? 49.205  -77.434  -104.802 1.00 50.00  ? 150  LEU G CD1 1 
ATOM   9367  C  CD2 . LEU G  3 151 ? 48.789  -77.026  -102.391 1.00 50.35  ? 150  LEU G CD2 1 
HETATM 9368  N  N   . MSE G  3 152 ? 52.929  -74.098  -103.330 1.00 52.85  ? 151  MSE G N   1 
HETATM 9369  C  CA  . MSE G  3 152 ? 54.336  -73.693  -103.306 1.00 54.10  ? 151  MSE G CA  1 
HETATM 9370  C  C   . MSE G  3 152 ? 54.776  -73.184  -101.943 1.00 53.32  ? 151  MSE G C   1 
HETATM 9371  O  O   . MSE G  3 152 ? 55.839  -73.550  -101.434 1.00 52.17  ? 151  MSE G O   1 
HETATM 9372  C  CB  . MSE G  3 152 ? 54.609  -72.607  -104.337 1.00 57.14  ? 151  MSE G CB  1 
HETATM 9373  C  CG  . MSE G  3 152 ? 54.980  -73.153  -105.687 1.00 64.26  ? 151  MSE G CG  1 
HETATM 9374  SE SE  . MSE G  3 152 ? 56.576  -74.200  -105.566 1.00 71.49  ? 151  MSE G SE  1 
HETATM 9375  C  CE  . MSE G  3 152 ? 57.804  -72.733  -105.358 1.00 69.93  ? 151  MSE G CE  1 
ATOM   9376  N  N   . GLU G  3 153 ? 53.948  -72.342  -101.348 1.00 51.40  ? 152  GLU G N   1 
ATOM   9377  C  CA  . GLU G  3 153 ? 54.266  -71.787  -100.051 1.00 51.26  ? 152  GLU G CA  1 
ATOM   9378  C  C   . GLU G  3 153 ? 54.302  -72.849  -98.944  1.00 52.16  ? 152  GLU G C   1 
ATOM   9379  O  O   . GLU G  3 153 ? 55.338  -73.061  -98.297  1.00 52.18  ? 152  GLU G O   1 
ATOM   9380  C  CB  . GLU G  3 153 ? 53.261  -70.686  -99.725  1.00 50.19  ? 152  GLU G CB  1 
ATOM   9381  C  CG  . GLU G  3 153 ? 53.055  -69.731  -100.899 1.00 49.71  ? 152  GLU G CG  1 
ATOM   9382  C  CD  . GLU G  3 153 ? 52.233  -68.505  -100.548 1.00 48.94  ? 152  GLU G CD  1 
ATOM   9383  O  OE1 . GLU G  3 153 ? 51.110  -68.645  -100.014 1.00 48.13  ? 152  GLU G OE1 1 
ATOM   9384  O  OE2 . GLU G  3 153 ? 52.717  -67.392  -100.818 1.00 49.52  ? 152  GLU G OE2 1 
ATOM   9385  N  N   . ILE G  3 154 ? 53.187  -73.534  -98.736  1.00 52.00  ? 153  ILE G N   1 
ATOM   9386  C  CA  . ILE G  3 154 ? 53.143  -74.540  -97.688  1.00 53.15  ? 153  ILE G CA  1 
ATOM   9387  C  C   . ILE G  3 154 ? 53.966  -75.771  -98.029  1.00 53.72  ? 153  ILE G C   1 
ATOM   9388  O  O   . ILE G  3 154 ? 54.238  -76.597  -97.171  1.00 54.37  ? 153  ILE G O   1 
ATOM   9389  C  CB  . ILE G  3 154 ? 51.679  -74.989  -97.372  1.00 53.07  ? 153  ILE G CB  1 
ATOM   9390  C  CG1 . ILE G  3 154 ? 51.409  -76.376  -97.947  1.00 51.42  ? 153  ILE G CG1 1 
ATOM   9391  C  CG2 . ILE G  3 154 ? 50.681  -73.998  -97.945  1.00 51.47  ? 153  ILE G CG2 1 
ATOM   9392  C  CD1 . ILE G  3 154 ? 50.018  -76.860  -97.677  1.00 54.88  ? 153  ILE G CD1 1 
ATOM   9393  N  N   . ASN G  3 155 ? 54.389  -75.886  -99.274  1.00 55.01  ? 154  ASN G N   1 
ATOM   9394  C  CA  . ASN G  3 155 ? 55.123  -77.067  -99.671  1.00 57.35  ? 154  ASN G CA  1 
ATOM   9395  C  C   . ASN G  3 155 ? 56.618  -76.860  -99.816  1.00 58.40  ? 154  ASN G C   1 
ATOM   9396  O  O   . ASN G  3 155 ? 57.301  -77.687  -100.408 1.00 59.85  ? 154  ASN G O   1 
ATOM   9397  C  CB  . ASN G  3 155 ? 54.525  -77.607  -100.972 1.00 60.11  ? 154  ASN G CB  1 
ATOM   9398  C  CG  . ASN G  3 155 ? 54.551  -79.125  -101.049 1.00 62.00  ? 154  ASN G CG  1 
ATOM   9399  O  OD1 . ASN G  3 155 ? 55.607  -79.729  -101.233 1.00 64.70  ? 154  ASN G OD1 1 
ATOM   9400  N  ND2 . ASN G  3 155 ? 53.382  -79.747  -100.908 1.00 61.04  ? 154  ASN G ND2 1 
ATOM   9401  N  N   . THR G  3 156 ? 57.133  -75.757  -99.288  1.00 59.64  ? 155  THR G N   1 
ATOM   9402  C  CA  . THR G  3 156 ? 58.574  -75.494  -99.349  1.00 60.32  ? 155  THR G CA  1 
ATOM   9403  C  C   . THR G  3 156 ? 59.122  -75.399  -97.926  1.00 60.01  ? 155  THR G C   1 
ATOM   9404  O  O   . THR G  3 156 ? 60.336  -75.413  -97.714  1.00 62.22  ? 155  THR G O   1 
ATOM   9405  C  CB  . THR G  3 156 ? 58.901  -74.176  -100.084 1.00 61.40  ? 155  THR G CB  1 
ATOM   9406  O  OG1 . THR G  3 156 ? 58.149  -73.105  -99.495  1.00 63.46  ? 155  THR G OG1 1 
ATOM   9407  C  CG2 . THR G  3 156 ? 58.586  -74.290  -101.568 1.00 60.68  ? 155  THR G CG2 1 
ATOM   9408  N  N   . SER G  3 157 ? 58.214  -75.290  -96.957  1.00 58.38  ? 156  SER G N   1 
ATOM   9409  C  CA  . SER G  3 157 ? 58.563  -75.213  -95.539  1.00 55.22  ? 156  SER G CA  1 
ATOM   9410  C  C   . SER G  3 157 ? 57.725  -76.282  -94.848  1.00 52.90  ? 156  SER G C   1 
ATOM   9411  O  O   . SER G  3 157 ? 57.836  -76.521  -93.648  1.00 51.77  ? 156  SER G O   1 
ATOM   9412  C  CB  . SER G  3 157 ? 58.204  -73.835  -94.982  1.00 55.64  ? 156  SER G CB  1 
ATOM   9413  O  OG  . SER G  3 157 ? 58.827  -72.813  -95.739  1.00 56.27  ? 156  SER G OG  1 
ATOM   9414  N  N   . GLY G  3 158 ? 56.886  -76.928  -95.648  1.00 51.76  ? 157  GLY G N   1 
ATOM   9415  C  CA  . GLY G  3 158 ? 55.999  -77.956  -95.149  1.00 49.60  ? 157  GLY G CA  1 
ATOM   9416  C  C   . GLY G  3 158 ? 56.661  -79.173  -94.545  1.00 48.08  ? 157  GLY G C   1 
ATOM   9417  O  O   . GLY G  3 158 ? 56.354  -79.536  -93.410  1.00 49.21  ? 157  GLY G O   1 
ATOM   9418  N  N   . THR G  3 159 ? 57.556  -79.824  -95.279  1.00 45.04  ? 158  THR G N   1 
ATOM   9419  C  CA  . THR G  3 159 ? 58.191  -81.005  -94.711  1.00 44.50  ? 158  THR G CA  1 
ATOM   9420  C  C   . THR G  3 159 ? 58.827  -80.676  -93.375  1.00 43.88  ? 158  THR G C   1 
ATOM   9421  O  O   . THR G  3 159 ? 58.669  -81.409  -92.402  1.00 45.40  ? 158  THR G O   1 
ATOM   9422  C  CB  . THR G  3 159 ? 59.280  -81.575  -95.612  1.00 43.70  ? 158  THR G CB  1 
ATOM   9423  O  OG1 . THR G  3 159 ? 58.693  -82.070  -96.819  1.00 45.55  ? 158  THR G OG1 1 
ATOM   9424  C  CG2 . THR G  3 159 ? 59.987  -82.708  -94.907  1.00 40.94  ? 158  THR G CG2 1 
ATOM   9425  N  N   . PHE G  3 160 ? 59.539  -79.558  -93.339  1.00 42.12  ? 159  PHE G N   1 
ATOM   9426  C  CA  . PHE G  3 160 ? 60.224  -79.124  -92.138  1.00 38.95  ? 159  PHE G CA  1 
ATOM   9427  C  C   . PHE G  3 160 ? 59.280  -78.880  -90.984  1.00 37.88  ? 159  PHE G C   1 
ATOM   9428  O  O   . PHE G  3 160 ? 59.439  -79.453  -89.914  1.00 39.36  ? 159  PHE G O   1 
ATOM   9429  C  CB  . PHE G  3 160 ? 61.032  -77.855  -92.426  1.00 37.08  ? 159  PHE G CB  1 
ATOM   9430  C  CG  . PHE G  3 160 ? 61.736  -77.310  -91.227  1.00 35.75  ? 159  PHE G CG  1 
ATOM   9431  C  CD1 . PHE G  3 160 ? 61.048  -76.554  -90.283  1.00 35.26  ? 159  PHE G CD1 1 
ATOM   9432  C  CD2 . PHE G  3 160 ? 63.078  -77.604  -91.004  1.00 34.95  ? 159  PHE G CD2 1 
ATOM   9433  C  CE1 . PHE G  3 160 ? 61.685  -76.106  -89.132  1.00 35.31  ? 159  PHE G CE1 1 
ATOM   9434  C  CE2 . PHE G  3 160 ? 63.724  -77.159  -89.853  1.00 33.26  ? 159  PHE G CE2 1 
ATOM   9435  C  CZ  . PHE G  3 160 ? 63.028  -76.411  -88.915  1.00 34.03  ? 159  PHE G CZ  1 
ATOM   9436  N  N   . LEU G  3 161 ? 58.293  -78.028  -91.199  1.00 37.06  ? 160  LEU G N   1 
ATOM   9437  C  CA  . LEU G  3 161 ? 57.353  -77.696  -90.141  1.00 36.26  ? 160  LEU G CA  1 
ATOM   9438  C  C   . LEU G  3 161 ? 56.615  -78.947  -89.691  1.00 35.45  ? 160  LEU G C   1 
ATOM   9439  O  O   . LEU G  3 161 ? 56.104  -79.046  -88.573  1.00 35.31  ? 160  LEU G O   1 
ATOM   9440  C  CB  . LEU G  3 161 ? 56.375  -76.636  -90.653  1.00 36.95  ? 160  LEU G CB  1 
ATOM   9441  C  CG  . LEU G  3 161 ? 55.481  -75.933  -89.633  1.00 40.25  ? 160  LEU G CG  1 
ATOM   9442  C  CD1 . LEU G  3 161 ? 54.115  -76.593  -89.571  1.00 41.14  ? 160  LEU G CD1 1 
ATOM   9443  C  CD2 . LEU G  3 161 ? 56.166  -75.950  -88.265  1.00 40.23  ? 160  LEU G CD2 1 
ATOM   9444  N  N   . THR G  3 162 ? 56.594  -79.923  -90.578  1.00 34.71  ? 161  THR G N   1 
ATOM   9445  C  CA  . THR G  3 162 ? 55.906  -81.162  -90.310  1.00 33.18  ? 161  THR G CA  1 
ATOM   9446  C  C   . THR G  3 162 ? 56.755  -82.160  -89.515  1.00 31.62  ? 161  THR G C   1 
ATOM   9447  O  O   . THR G  3 162 ? 56.262  -82.733  -88.540  1.00 31.32  ? 161  THR G O   1 
ATOM   9448  C  CB  . THR G  3 162 ? 55.366  -81.743  -91.656  1.00 33.45  ? 161  THR G CB  1 
ATOM   9449  O  OG1 . THR G  3 162 ? 53.939  -81.634  -91.654  1.00 32.06  ? 161  THR G OG1 1 
ATOM   9450  C  CG2 . THR G  3 162 ? 55.802  -83.199  -91.887  1.00 32.90  ? 161  THR G CG2 1 
ATOM   9451  N  N   . GLN G  3 163 ? 58.016  -82.358  -89.902  1.00 29.03  ? 162  GLN G N   1 
ATOM   9452  C  CA  . GLN G  3 163 ? 58.874  -83.286  -89.173  1.00 29.86  ? 162  GLN G CA  1 
ATOM   9453  C  C   . GLN G  3 163 ? 59.026  -82.748  -87.763  1.00 30.21  ? 162  GLN G C   1 
ATOM   9454  O  O   . GLN G  3 163 ? 59.005  -83.500  -86.773  1.00 30.86  ? 162  GLN G O   1 
ATOM   9455  C  CB  . GLN G  3 163 ? 60.252  -83.392  -89.814  1.00 30.72  ? 162  GLN G CB  1 
ATOM   9456  C  CG  . GLN G  3 163 ? 60.236  -83.680  -91.294  1.00 36.26  ? 162  GLN G CG  1 
ATOM   9457  C  CD  . GLN G  3 163 ? 61.580  -84.185  -91.794  1.00 40.40  ? 162  GLN G CD  1 
ATOM   9458  O  OE1 . GLN G  3 163 ? 62.639  -83.778  -91.290  1.00 42.11  ? 162  GLN G OE1 1 
ATOM   9459  N  NE2 . GLN G  3 163 ? 61.548  -85.071  -92.796  1.00 39.21  ? 162  GLN G NE2 1 
ATOM   9460  N  N   . ALA G  3 164 ? 59.176  -81.429  -87.686  1.00 28.00  ? 163  ALA G N   1 
ATOM   9461  C  CA  . ALA G  3 164 ? 59.314  -80.747  -86.426  1.00 25.88  ? 163  ALA G CA  1 
ATOM   9462  C  C   . ALA G  3 164 ? 58.153  -81.104  -85.520  1.00 26.49  ? 163  ALA G C   1 
ATOM   9463  O  O   . ALA G  3 164 ? 58.365  -81.552  -84.394  1.00 26.73  ? 163  ALA G O   1 
ATOM   9464  C  CB  . ALA G  3 164 ? 59.352  -79.271  -86.653  1.00 26.45  ? 163  ALA G CB  1 
ATOM   9465  N  N   . LEU G  3 165 ? 56.924  -80.908  -86.003  1.00 27.58  ? 164  LEU G N   1 
ATOM   9466  C  CA  . LEU G  3 165 ? 55.727  -81.212  -85.198  1.00 27.15  ? 164  LEU G CA  1 
ATOM   9467  C  C   . LEU G  3 165 ? 55.660  -82.680  -84.783  1.00 26.70  ? 164  LEU G C   1 
ATOM   9468  O  O   . LEU G  3 165 ? 55.109  -83.025  -83.730  1.00 23.28  ? 164  LEU G O   1 
ATOM   9469  C  CB  . LEU G  3 165 ? 54.461  -80.833  -85.970  1.00 28.37  ? 164  LEU G CB  1 
ATOM   9470  C  CG  . LEU G  3 165 ? 53.895  -79.414  -85.816  1.00 28.52  ? 164  LEU G CG  1 
ATOM   9471  C  CD1 . LEU G  3 165 ? 55.017  -78.406  -85.710  1.00 31.30  ? 164  LEU G CD1 1 
ATOM   9472  C  CD2 . LEU G  3 165 ? 53.016  -79.092  -87.014  1.00 25.70  ? 164  LEU G CD2 1 
ATOM   9473  N  N   . ASN G  3 166 ? 56.232  -83.543  -85.615  1.00 26.23  ? 165  ASN G N   1 
ATOM   9474  C  CA  . ASN G  3 166 ? 56.234  -84.959  -85.323  1.00 27.61  ? 165  ASN G CA  1 
ATOM   9475  C  C   . ASN G  3 166 ? 57.151  -85.309  -84.155  1.00 27.81  ? 165  ASN G C   1 
ATOM   9476  O  O   . ASN G  3 166 ? 56.757  -86.062  -83.252  1.00 27.70  ? 165  ASN G O   1 
ATOM   9477  C  CB  . ASN G  3 166 ? 56.604  -85.743  -86.574  1.00 29.40  ? 165  ASN G CB  1 
ATOM   9478  C  CG  . ASN G  3 166 ? 55.464  -85.791  -87.568  1.00 31.53  ? 165  ASN G CG  1 
ATOM   9479  O  OD1 . ASN G  3 166 ? 54.299  -85.625  -87.189  1.00 32.64  ? 165  ASN G OD1 1 
ATOM   9480  N  ND2 . ASN G  3 166 ? 55.783  -86.032  -88.839  1.00 31.11  ? 165  ASN G ND2 1 
ATOM   9481  N  N   . HIS G  3 167 ? 58.365  -84.769  -84.162  1.00 25.54  ? 166  HIS G N   1 
ATOM   9482  C  CA  . HIS G  3 167 ? 59.285  -85.011  -83.062  1.00 24.00  ? 166  HIS G CA  1 
ATOM   9483  C  C   . HIS G  3 167 ? 58.636  -84.508  -81.775  1.00 25.05  ? 166  HIS G C   1 
ATOM   9484  O  O   . HIS G  3 167 ? 58.574  -85.203  -80.770  1.00 25.45  ? 166  HIS G O   1 
ATOM   9485  C  CB  . HIS G  3 167 ? 60.581  -84.263  -83.301  1.00 21.67  ? 166  HIS G CB  1 
ATOM   9486  C  CG  . HIS G  3 167 ? 61.394  -84.816  -84.422  1.00 21.38  ? 166  HIS G CG  1 
ATOM   9487  N  ND1 . HIS G  3 167 ? 61.905  -84.024  -85.427  1.00 19.91  ? 166  HIS G ND1 1 
ATOM   9488  C  CD2 . HIS G  3 167 ? 61.848  -86.070  -84.660  1.00 20.01  ? 166  HIS G CD2 1 
ATOM   9489  C  CE1 . HIS G  3 167 ? 62.644  -84.767  -86.234  1.00 20.35  ? 166  HIS G CE1 1 
ATOM   9490  N  NE2 . HIS G  3 167 ? 62.625  -86.010  -85.791  1.00 18.31  ? 166  HIS G NE2 1 
HETATM 9491  N  N   . MSE G  3 168 ? 58.140  -83.286  -81.805  1.00 25.62  ? 167  MSE G N   1 
HETATM 9492  C  CA  . MSE G  3 168 ? 57.505  -82.755  -80.628  1.00 29.60  ? 167  MSE G CA  1 
HETATM 9493  C  C   . MSE G  3 168 ? 56.385  -83.658  -80.132  1.00 27.25  ? 167  MSE G C   1 
HETATM 9494  O  O   . MSE G  3 168 ? 56.267  -83.907  -78.948  1.00 25.35  ? 167  MSE G O   1 
HETATM 9495  C  CB  . MSE G  3 168 ? 56.971  -81.366  -80.927  1.00 37.73  ? 167  MSE G CB  1 
HETATM 9496  C  CG  . MSE G  3 168 ? 58.058  -80.447  -81.434  1.00 48.58  ? 167  MSE G CG  1 
HETATM 9497  SE SE  . MSE G  3 168 ? 57.446  -78.654  -81.739  1.00 63.29  ? 167  MSE G SE  1 
HETATM 9498  C  CE  . MSE G  3 168 ? 55.694  -78.758  -80.851  1.00 54.95  ? 167  MSE G CE  1 
ATOM   9499  N  N   . TYR G  3 169 ? 55.557  -84.149  -81.042  1.00 28.78  ? 168  TYR G N   1 
ATOM   9500  C  CA  . TYR G  3 169 ? 54.462  -85.008  -80.639  1.00 27.71  ? 168  TYR G CA  1 
ATOM   9501  C  C   . TYR G  3 169 ? 54.980  -86.267  -79.952  1.00 28.15  ? 168  TYR G C   1 
ATOM   9502  O  O   . TYR G  3 169 ? 54.406  -86.712  -78.955  1.00 27.57  ? 168  TYR G O   1 
ATOM   9503  C  CB  . TYR G  3 169 ? 53.592  -85.381  -81.836  1.00 25.14  ? 168  TYR G CB  1 
ATOM   9504  C  CG  . TYR G  3 169 ? 52.364  -86.152  -81.410  1.00 23.53  ? 168  TYR G CG  1 
ATOM   9505  C  CD1 . TYR G  3 169 ? 52.333  -87.556  -81.469  1.00 21.21  ? 168  TYR G CD1 1 
ATOM   9506  C  CD2 . TYR G  3 169 ? 51.248  -85.482  -80.903  1.00 22.23  ? 168  TYR G CD2 1 
ATOM   9507  C  CE1 . TYR G  3 169 ? 51.226  -88.266  -81.038  1.00 21.65  ? 168  TYR G CE1 1 
ATOM   9508  C  CE2 . TYR G  3 169 ? 50.129  -86.183  -80.462  1.00 23.17  ? 168  TYR G CE2 1 
ATOM   9509  C  CZ  . TYR G  3 169 ? 50.122  -87.576  -80.529  1.00 24.20  ? 168  TYR G CZ  1 
ATOM   9510  O  OH  . TYR G  3 169 ? 49.023  -88.266  -80.055  1.00 25.01  ? 168  TYR G OH  1 
ATOM   9511  N  N   . LYS G  3 170 ? 56.059  -86.845  -80.479  1.00 27.97  ? 169  LYS G N   1 
ATOM   9512  C  CA  . LYS G  3 170 ? 56.635  -88.029  -79.856  1.00 28.34  ? 169  LYS G CA  1 
ATOM   9513  C  C   . LYS G  3 170 ? 57.148  -87.643  -78.469  1.00 30.42  ? 169  LYS G C   1 
ATOM   9514  O  O   . LYS G  3 170 ? 56.956  -88.381  -77.504  1.00 31.59  ? 169  LYS G O   1 
ATOM   9515  C  CB  . LYS G  3 170 ? 57.784  -88.583  -80.689  1.00 27.31  ? 169  LYS G CB  1 
ATOM   9516  C  CG  . LYS G  3 170 ? 57.367  -89.207  -82.000  1.00 29.18  ? 169  LYS G CG  1 
ATOM   9517  C  CD  . LYS G  3 170 ? 58.504  -90.022  -82.586  1.00 32.01  ? 169  LYS G CD  1 
ATOM   9518  C  CE  . LYS G  3 170 ? 58.276  -90.301  -84.060  1.00 35.86  ? 169  LYS G CE  1 
ATOM   9519  N  NZ  . LYS G  3 170 ? 58.129  -89.031  -84.850  1.00 39.03  ? 169  LYS G NZ  1 
ATOM   9520  N  N   . LEU G  3 171 ? 57.793  -86.478  -78.384  1.00 31.60  ? 170  LEU G N   1 
ATOM   9521  C  CA  . LEU G  3 171 ? 58.329  -85.948  -77.125  1.00 31.96  ? 170  LEU G CA  1 
ATOM   9522  C  C   . LEU G  3 171 ? 57.230  -85.652  -76.111  1.00 32.89  ? 170  LEU G C   1 
ATOM   9523  O  O   . LEU G  3 171 ? 57.415  -85.798  -74.907  1.00 34.76  ? 170  LEU G O   1 
ATOM   9524  C  CB  . LEU G  3 171 ? 59.124  -84.652  -77.372  1.00 28.29  ? 170  LEU G CB  1 
ATOM   9525  C  CG  . LEU G  3 171 ? 60.529  -84.792  -77.954  1.00 26.37  ? 170  LEU G CG  1 
ATOM   9526  C  CD1 . LEU G  3 171 ? 61.129  -83.448  -78.135  1.00 27.02  ? 170  LEU G CD1 1 
ATOM   9527  C  CD2 . LEU G  3 171 ? 61.381  -85.628  -77.046  1.00 25.28  ? 170  LEU G CD2 1 
ATOM   9528  N  N   . ARG G  3 172 ? 56.086  -85.219  -76.609  1.00 35.17  ? 171  ARG G N   1 
ATOM   9529  C  CA  . ARG G  3 172 ? 54.965  -84.882  -75.762  1.00 36.36  ? 171  ARG G CA  1 
ATOM   9530  C  C   . ARG G  3 172 ? 54.182  -86.119  -75.309  1.00 37.32  ? 171  ARG G C   1 
ATOM   9531  O  O   . ARG G  3 172 ? 53.193  -86.006  -74.605  1.00 36.84  ? 171  ARG G O   1 
ATOM   9532  C  CB  . ARG G  3 172 ? 54.070  -83.892  -76.513  1.00 35.36  ? 171  ARG G CB  1 
ATOM   9533  C  CG  . ARG G  3 172 ? 52.740  -83.651  -75.876  1.00 35.10  ? 171  ARG G CG  1 
ATOM   9534  C  CD  . ARG G  3 172 ? 51.907  -82.752  -76.736  1.00 36.72  ? 171  ARG G CD  1 
ATOM   9535  N  NE  . ARG G  3 172 ? 52.038  -81.358  -76.341  1.00 39.62  ? 171  ARG G NE  1 
ATOM   9536  C  CZ  . ARG G  3 172 ? 52.647  -80.433  -77.066  1.00 42.24  ? 171  ARG G CZ  1 
ATOM   9537  N  NH1 . ARG G  3 172 ? 53.187  -80.761  -78.236  1.00 42.64  ? 171  ARG G NH1 1 
ATOM   9538  N  NH2 . ARG G  3 172 ? 52.709  -79.182  -76.618  1.00 42.98  ? 171  ARG G NH2 1 
ATOM   9539  N  N   . THR G  3 173 ? 54.629  -87.307  -75.694  1.00 40.06  ? 172  THR G N   1 
ATOM   9540  C  CA  . THR G  3 173 ? 53.929  -88.527  -75.283  1.00 43.07  ? 172  THR G CA  1 
ATOM   9541  C  C   . THR G  3 173 ? 54.877  -89.711  -75.032  1.00 45.63  ? 172  THR G C   1 
ATOM   9542  O  O   . THR G  3 173 ? 54.467  -90.869  -75.169  1.00 46.05  ? 172  THR G O   1 
ATOM   9543  C  CB  . THR G  3 173 ? 52.867  -88.970  -76.352  1.00 43.28  ? 172  THR G CB  1 
ATOM   9544  O  OG1 . THR G  3 173 ? 53.516  -89.240  -77.606  1.00 43.19  ? 172  THR G OG1 1 
ATOM   9545  C  CG2 . THR G  3 173 ? 51.817  -87.897  -76.552  1.00 39.52  ? 172  THR G CG2 1 
ATOM   9546  N  N   . ASN G  3 174 ? 56.129  -89.432  -74.652  1.00 47.67  ? 173  ASN G N   1 
ATOM   9547  C  CA  . ASN G  3 174 ? 57.107  -90.501  -74.420  1.00 49.25  ? 173  ASN G CA  1 
ATOM   9548  C  C   . ASN G  3 174 ? 56.938  -91.310  -73.141  1.00 50.32  ? 173  ASN G C   1 
ATOM   9549  O  O   . ASN G  3 174 ? 57.517  -92.393  -73.016  1.00 50.99  ? 173  ASN G O   1 
ATOM   9550  C  CB  . ASN G  3 174 ? 58.552  -89.975  -74.491  1.00 47.78  ? 173  ASN G CB  1 
ATOM   9551  C  CG  . ASN G  3 174 ? 58.735  -88.660  -73.788  1.00 45.73  ? 173  ASN G CG  1 
ATOM   9552  O  OD1 . ASN G  3 174 ? 58.058  -88.368  -72.806  1.00 44.12  ? 173  ASN G OD1 1 
ATOM   9553  N  ND2 . ASN G  3 174 ? 59.670  -87.854  -74.283  1.00 45.99  ? 173  ASN G ND2 1 
ATOM   9554  N  N   . LEU G  3 175 ? 56.170  -90.796  -72.188  1.00 50.76  ? 174  LEU G N   1 
ATOM   9555  C  CA  . LEU G  3 175 ? 55.954  -91.545  -70.961  1.00 53.54  ? 174  LEU G CA  1 
ATOM   9556  C  C   . LEU G  3 175 ? 54.460  -91.755  -70.791  1.00 56.32  ? 174  LEU G C   1 
ATOM   9557  O  O   . LEU G  3 175 ? 53.959  -91.905  -69.681  1.00 55.84  ? 174  LEU G O   1 
ATOM   9558  C  CB  . LEU G  3 175 ? 56.559  -90.818  -69.749  1.00 51.03  ? 174  LEU G CB  1 
ATOM   9559  C  CG  . LEU G  3 175 ? 55.984  -89.487  -69.271  1.00 50.44  ? 174  LEU G CG  1 
ATOM   9560  C  CD1 . LEU G  3 175 ? 56.781  -88.992  -68.092  1.00 46.95  ? 174  LEU G CD1 1 
ATOM   9561  C  CD2 . LEU G  3 175 ? 56.013  -88.478  -70.397  1.00 52.38  ? 174  LEU G CD2 1 
ATOM   9562  N  N   . GLN G  3 176 ? 53.761  -91.780  -71.926  1.00 60.80  ? 175  GLN G N   1 
ATOM   9563  C  CA  . GLN G  3 176 ? 52.310  -91.969  -71.974  1.00 63.95  ? 175  GLN G CA  1 
ATOM   9564  C  C   . GLN G  3 176 ? 51.536  -90.829  -71.303  1.00 65.26  ? 175  GLN G C   1 
ATOM   9565  O  O   . GLN G  3 176 ? 52.080  -89.699  -71.295  1.00 66.37  ? 175  GLN G O   1 
ATOM   9566  C  CB  . GLN G  3 176 ? 51.926  -93.328  -71.367  1.00 64.44  ? 175  GLN G CB  1 
ATOM   9567  C  CG  . GLN G  3 176 ? 51.812  -94.455  -72.406  1.00 66.94  ? 175  GLN G CG  1 
ATOM   9568  C  CD  . GLN G  3 176 ? 53.141  -94.834  -73.058  1.00 67.93  ? 175  GLN G CD  1 
ATOM   9569  O  OE1 . GLN G  3 176 ? 53.937  -93.971  -73.431  1.00 68.73  ? 175  GLN G OE1 1 
ATOM   9570  N  NE2 . GLN G  3 176 ? 53.373  -96.135  -73.211  1.00 67.52  ? 175  GLN G NE2 1 
ATOM   9571  N  N   . GLU H  4 3   ? 67.314  -88.950  -102.425 1.00 76.98  ? 3    GLU H N   1 
ATOM   9572  C  CA  . GLU H  4 3   ? 67.561  -90.329  -102.939 1.00 77.01  ? 3    GLU H CA  1 
ATOM   9573  C  C   . GLU H  4 3   ? 66.341  -91.238  -102.735 1.00 75.10  ? 3    GLU H C   1 
ATOM   9574  O  O   . GLU H  4 3   ? 65.451  -90.930  -101.939 1.00 75.41  ? 3    GLU H O   1 
ATOM   9575  C  CB  . GLU H  4 3   ? 68.801  -90.939  -102.250 1.00 79.42  ? 3    GLU H CB  1 
ATOM   9576  C  CG  . GLU H  4 3   ? 68.762  -90.972  -100.714 1.00 82.98  ? 3    GLU H CG  1 
ATOM   9577  C  CD  . GLU H  4 3   ? 69.105  -89.631  -100.055 1.00 85.62  ? 3    GLU H CD  1 
ATOM   9578  O  OE1 . GLU H  4 3   ? 69.048  -89.548  -98.806  1.00 85.48  ? 3    GLU H OE1 1 
ATOM   9579  O  OE2 . GLU H  4 3   ? 69.434  -88.662  -100.776 1.00 86.49  ? 3    GLU H OE2 1 
ATOM   9580  N  N   . ALA H  4 4   ? 66.295  -92.347  -103.473 1.00 71.94  ? 4    ALA H N   1 
ATOM   9581  C  CA  . ALA H  4 4   ? 65.195  -93.307  -103.364 1.00 67.35  ? 4    ALA H CA  1 
ATOM   9582  C  C   . ALA H  4 4   ? 65.500  -94.196  -102.175 1.00 64.59  ? 4    ALA H C   1 
ATOM   9583  O  O   . ALA H  4 4   ? 64.856  -95.230  -101.968 1.00 64.51  ? 4    ALA H O   1 
ATOM   9584  C  CB  . ALA H  4 4   ? 65.100  -94.152  -104.628 1.00 67.23  ? 4    ALA H CB  1 
ATOM   9585  N  N   . TYR H  4 5   ? 66.509  -93.776  -101.412 1.00 59.75  ? 5    TYR H N   1 
ATOM   9586  C  CA  . TYR H  4 5   ? 66.961  -94.483  -100.227 1.00 54.34  ? 5    TYR H CA  1 
ATOM   9587  C  C   . TYR H  4 5   ? 66.194  -94.043  -98.993  1.00 53.09  ? 5    TYR H C   1 
ATOM   9588  O  O   . TYR H  4 5   ? 66.423  -92.951  -98.463  1.00 52.50  ? 5    TYR H O   1 
ATOM   9589  C  CB  . TYR H  4 5   ? 68.465  -94.241  -100.027 1.00 51.74  ? 5    TYR H CB  1 
ATOM   9590  C  CG  . TYR H  4 5   ? 69.030  -94.635  -98.671  1.00 48.21  ? 5    TYR H CG  1 
ATOM   9591  C  CD1 . TYR H  4 5   ? 68.836  -95.913  -98.145  1.00 47.07  ? 5    TYR H CD1 1 
ATOM   9592  C  CD2 . TYR H  4 5   ? 69.777  -93.727  -97.923  1.00 46.21  ? 5    TYR H CD2 1 
ATOM   9593  C  CE1 . TYR H  4 5   ? 69.375  -96.275  -96.909  1.00 45.81  ? 5    TYR H CE1 1 
ATOM   9594  C  CE2 . TYR H  4 5   ? 70.318  -94.078  -96.691  1.00 44.68  ? 5    TYR H CE2 1 
ATOM   9595  C  CZ  . TYR H  4 5   ? 70.117  -95.351  -96.189  1.00 44.81  ? 5    TYR H CZ  1 
ATOM   9596  O  OH  . TYR H  4 5   ? 70.675  -95.698  -94.976  1.00 42.65  ? 5    TYR H OH  1 
ATOM   9597  N  N   . PHE H  4 6   ? 65.259  -94.879  -98.548  1.00 52.03  ? 6    PHE H N   1 
ATOM   9598  C  CA  . PHE H  4 6   ? 64.516  -94.555  -97.341  1.00 52.05  ? 6    PHE H CA  1 
ATOM   9599  C  C   . PHE H  4 6   ? 65.054  -95.363  -96.158  1.00 49.20  ? 6    PHE H C   1 
ATOM   9600  O  O   . PHE H  4 6   ? 64.638  -96.504  -95.918  1.00 47.14  ? 6    PHE H O   1 
ATOM   9601  C  CB  . PHE H  4 6   ? 63.007  -94.782  -97.518  1.00 55.26  ? 6    PHE H CB  1 
ATOM   9602  C  CG  . PHE H  4 6   ? 62.650  -95.935  -98.409  1.00 59.66  ? 6    PHE H CG  1 
ATOM   9603  C  CD1 . PHE H  4 6   ? 62.297  -95.714  -99.738  1.00 59.96  ? 6    PHE H CD1 1 
ATOM   9604  C  CD2 . PHE H  4 6   ? 62.615  -97.241  -97.910  1.00 62.04  ? 6    PHE H CD2 1 
ATOM   9605  C  CE1 . PHE H  4 6   ? 61.908  -96.773  -100.558 1.00 60.51  ? 6    PHE H CE1 1 
ATOM   9606  C  CE2 . PHE H  4 6   ? 62.226  -98.311  -98.725  1.00 61.38  ? 6    PHE H CE2 1 
ATOM   9607  C  CZ  . PHE H  4 6   ? 61.871  -98.072  -100.052 1.00 61.44  ? 6    PHE H CZ  1 
ATOM   9608  N  N   . ARG H  4 7   ? 66.000  -94.745  -95.445  1.00 45.04  ? 7    ARG H N   1 
ATOM   9609  C  CA  . ARG H  4 7   ? 66.648  -95.328  -94.276  1.00 41.54  ? 7    ARG H CA  1 
ATOM   9610  C  C   . ARG H  4 7   ? 65.631  -95.442  -93.156  1.00 36.39  ? 7    ARG H C   1 
ATOM   9611  O  O   . ARG H  4 7   ? 64.705  -94.648  -93.098  1.00 37.06  ? 7    ARG H O   1 
ATOM   9612  C  CB  . ARG H  4 7   ? 67.793  -94.429  -93.819  1.00 45.72  ? 7    ARG H CB  1 
ATOM   9613  C  CG  . ARG H  4 7   ? 67.330  -93.127  -93.176  1.00 52.13  ? 7    ARG H CG  1 
ATOM   9614  C  CD  . ARG H  4 7   ? 68.504  -92.217  -92.809  1.00 58.54  ? 7    ARG H CD  1 
ATOM   9615  N  NE  . ARG H  4 7   ? 69.220  -91.715  -93.985  1.00 63.95  ? 7    ARG H NE  1 
ATOM   9616  C  CZ  . ARG H  4 7   ? 68.709  -90.879  -94.893  1.00 67.49  ? 7    ARG H CZ  1 
ATOM   9617  N  NH1 . ARG H  4 7   ? 69.452  -90.487  -95.928  1.00 68.88  ? 7    ARG H NH1 1 
ATOM   9618  N  NH2 . ARG H  4 7   ? 67.462  -90.428  -94.771  1.00 67.89  ? 7    ARG H NH2 1 
ATOM   9619  N  N   . VAL H  4 8   ? 65.790  -96.413  -92.263  1.00 31.44  ? 8    VAL H N   1 
ATOM   9620  C  CA  . VAL H  4 8   ? 64.835  -96.550  -91.174  1.00 28.17  ? 8    VAL H CA  1 
ATOM   9621  C  C   . VAL H  4 8   ? 64.895  -95.323  -90.277  1.00 28.29  ? 8    VAL H C   1 
ATOM   9622  O  O   . VAL H  4 8   ? 65.955  -94.928  -89.816  1.00 29.64  ? 8    VAL H O   1 
ATOM   9623  C  CB  . VAL H  4 8   ? 65.090  -97.825  -90.337  1.00 25.50  ? 8    VAL H CB  1 
ATOM   9624  C  CG1 . VAL H  4 8   ? 64.112  -97.907  -89.192  1.00 21.39  ? 8    VAL H CG1 1 
ATOM   9625  C  CG2 . VAL H  4 8   ? 64.954  -99.042  -91.210  1.00 22.60  ? 8    VAL H CG2 1 
ATOM   9626  N  N   . GLU H  4 9   ? 63.745  -94.708  -90.055  1.00 29.57  ? 9    GLU H N   1 
ATOM   9627  C  CA  . GLU H  4 9   ? 63.648  -93.522  -89.221  1.00 31.21  ? 9    GLU H CA  1 
ATOM   9628  C  C   . GLU H  4 9   ? 63.790  -93.913  -87.758  1.00 30.44  ? 9    GLU H C   1 
ATOM   9629  O  O   . GLU H  4 9   ? 63.541  -95.057  -87.373  1.00 30.80  ? 9    GLU H O   1 
ATOM   9630  C  CB  . GLU H  4 9   ? 62.296  -92.845  -89.442  1.00 35.83  ? 9    GLU H CB  1 
ATOM   9631  C  CG  . GLU H  4 9   ? 61.111  -93.835  -89.452  1.00 43.56  ? 9    GLU H CG  1 
ATOM   9632  C  CD  . GLU H  4 9   ? 60.670  -94.232  -90.869  1.00 49.37  ? 9    GLU H CD  1 
ATOM   9633  O  OE1 . GLU H  4 9   ? 59.968  -93.410  -91.513  1.00 53.95  ? 9    GLU H OE1 1 
ATOM   9634  O  OE2 . GLU H  4 9   ? 61.024  -95.345  -91.342  1.00 48.79  ? 9    GLU H OE2 1 
ATOM   9635  N  N   . SER H  4 10  ? 64.190  -92.953  -86.940  1.00 28.67  ? 10   SER H N   1 
ATOM   9636  C  CA  . SER H  4 10  ? 64.376  -93.183  -85.518  1.00 25.71  ? 10   SER H CA  1 
ATOM   9637  C  C   . SER H  4 10  ? 63.046  -93.127  -84.785  1.00 25.92  ? 10   SER H C   1 
ATOM   9638  O  O   . SER H  4 10  ? 62.083  -92.536  -85.281  1.00 27.23  ? 10   SER H O   1 
ATOM   9639  C  CB  . SER H  4 10  ? 65.347  -92.139  -84.954  1.00 22.32  ? 10   SER H CB  1 
ATOM   9640  O  OG  . SER H  4 10  ? 65.030  -91.799  -83.618  1.00 22.00  ? 10   SER H OG  1 
ATOM   9641  N  N   . GLY H  4 11  ? 63.000  -93.756  -83.612  1.00 25.26  ? 11   GLY H N   1 
ATOM   9642  C  CA  . GLY H  4 11  ? 61.796  -93.758  -82.807  1.00 26.14  ? 11   GLY H CA  1 
ATOM   9643  C  C   . GLY H  4 11  ? 62.062  -93.434  -81.346  1.00 28.61  ? 11   GLY H C   1 
ATOM   9644  O  O   . GLY H  4 11  ? 61.131  -93.297  -80.555  1.00 28.79  ? 11   GLY H O   1 
ATOM   9645  N  N   . ALA H  4 12  ? 63.335  -93.279  -80.989  1.00 29.81  ? 12   ALA H N   1 
ATOM   9646  C  CA  . ALA H  4 12  ? 63.737  -93.002  -79.616  1.00 27.23  ? 12   ALA H CA  1 
ATOM   9647  C  C   . ALA H  4 12  ? 63.047  -91.826  -78.919  1.00 27.90  ? 12   ALA H C   1 
ATOM   9648  O  O   . ALA H  4 12  ? 62.775  -91.897  -77.721  1.00 28.72  ? 12   ALA H O   1 
ATOM   9649  C  CB  . ALA H  4 12  ? 65.226  -92.827  -79.566  1.00 27.29  ? 12   ALA H CB  1 
ATOM   9650  N  N   . LEU H  4 13  ? 62.743  -90.752  -79.640  1.00 28.52  ? 13   LEU H N   1 
ATOM   9651  C  CA  . LEU H  4 13  ? 62.102  -89.605  -78.986  1.00 28.03  ? 13   LEU H CA  1 
ATOM   9652  C  C   . LEU H  4 13  ? 60.718  -89.946  -78.445  1.00 27.73  ? 13   LEU H C   1 
ATOM   9653  O  O   . LEU H  4 13  ? 60.098  -89.161  -77.724  1.00 27.06  ? 13   LEU H O   1 
ATOM   9654  C  CB  . LEU H  4 13  ? 62.032  -88.386  -79.936  1.00 27.11  ? 13   LEU H CB  1 
ATOM   9655  C  CG  . LEU H  4 13  ? 63.299  -87.504  -80.061  1.00 24.33  ? 13   LEU H CG  1 
ATOM   9656  C  CD1 . LEU H  4 13  ? 64.424  -88.204  -80.809  1.00 15.94  ? 13   LEU H CD1 1 
ATOM   9657  C  CD2 . LEU H  4 13  ? 62.936  -86.240  -80.781  1.00 25.41  ? 13   LEU H CD2 1 
ATOM   9658  N  N   . GLY H  4 14  ? 60.242  -91.133  -78.787  1.00 28.93  ? 14   GLY H N   1 
ATOM   9659  C  CA  . GLY H  4 14  ? 58.941  -91.561  -78.308  1.00 31.71  ? 14   GLY H CA  1 
ATOM   9660  C  C   . GLY H  4 14  ? 59.085  -92.695  -77.312  1.00 33.76  ? 14   GLY H C   1 
ATOM   9661  O  O   . GLY H  4 14  ? 60.191  -92.948  -76.823  1.00 33.76  ? 14   GLY H O   1 
ATOM   9662  N  N   . PRO H  4 15  ? 57.988  -93.400  -76.991  1.00 34.36  ? 15   PRO H N   1 
ATOM   9663  C  CA  . PRO H  4 15  ? 57.992  -94.520  -76.043  1.00 35.30  ? 15   PRO H CA  1 
ATOM   9664  C  C   . PRO H  4 15  ? 59.130  -95.518  -76.242  1.00 36.08  ? 15   PRO H C   1 
ATOM   9665  O  O   . PRO H  4 15  ? 59.809  -95.873  -75.288  1.00 37.02  ? 15   PRO H O   1 
ATOM   9666  C  CB  . PRO H  4 15  ? 56.626  -95.157  -76.260  1.00 34.01  ? 15   PRO H CB  1 
ATOM   9667  C  CG  . PRO H  4 15  ? 55.780  -93.967  -76.546  1.00 35.08  ? 15   PRO H CG  1 
ATOM   9668  C  CD  . PRO H  4 15  ? 56.632  -93.174  -77.516  1.00 34.28  ? 15   PRO H CD  1 
ATOM   9669  N  N   . GLU H  4 16  ? 59.352  -95.965  -77.472  1.00 36.02  ? 16   GLU H N   1 
ATOM   9670  C  CA  . GLU H  4 16  ? 60.410  -96.929  -77.707  1.00 36.50  ? 16   GLU H CA  1 
ATOM   9671  C  C   . GLU H  4 16  ? 61.274  -96.660  -78.931  1.00 35.83  ? 16   GLU H C   1 
ATOM   9672  O  O   . GLU H  4 16  ? 60.916  -95.870  -79.797  1.00 35.32  ? 16   GLU H O   1 
ATOM   9673  C  CB  . GLU H  4 16  ? 59.808  -98.328  -77.807  1.00 40.54  ? 16   GLU H CB  1 
ATOM   9674  C  CG  . GLU H  4 16  ? 59.511  -99.005  -76.458  1.00 47.17  ? 16   GLU H CG  1 
ATOM   9675  C  CD  . GLU H  4 16  ? 60.764  -99.208  -75.581  1.00 51.94  ? 16   GLU H CD  1 
ATOM   9676  O  OE1 . GLU H  4 16  ? 61.917  -99.163  -76.105  1.00 52.30  ? 16   GLU H OE1 1 
ATOM   9677  O  OE2 . GLU H  4 16  ? 60.583  -99.425  -74.358  1.00 52.54  ? 16   GLU H OE2 1 
ATOM   9678  N  N   . GLU H  4 17  ? 62.428  -97.319  -78.984  1.00 34.71  ? 17   GLU H N   1 
ATOM   9679  C  CA  . GLU H  4 17  ? 63.346  -97.182  -80.113  1.00 32.58  ? 17   GLU H CA  1 
ATOM   9680  C  C   . GLU H  4 17  ? 62.771  -97.977  -81.279  1.00 30.35  ? 17   GLU H C   1 
ATOM   9681  O  O   . GLU H  4 17  ? 61.772  -98.671  -81.127  1.00 31.78  ? 17   GLU H O   1 
ATOM   9682  C  CB  . GLU H  4 17  ? 64.717  -97.778  -79.775  1.00 31.65  ? 17   GLU H CB  1 
ATOM   9683  C  CG  . GLU H  4 17  ? 65.462  -97.123  -78.642  1.00 33.51  ? 17   GLU H CG  1 
ATOM   9684  C  CD  . GLU H  4 17  ? 66.716  -97.898  -78.241  1.00 33.10  ? 17   GLU H CD  1 
ATOM   9685  O  OE1 . GLU H  4 17  ? 67.462  -98.360  -79.138  1.00 30.70  ? 17   GLU H OE1 1 
ATOM   9686  O  OE2 . GLU H  4 17  ? 66.955  -98.037  -77.019  1.00 33.60  ? 17   GLU H OE2 1 
ATOM   9687  N  N   . ASN H  4 18  ? 63.411  -97.874  -82.437  1.00 27.12  ? 18   ASN H N   1 
ATOM   9688  C  CA  . ASN H  4 18  ? 63.001  -98.627  -83.608  1.00 24.78  ? 18   ASN H CA  1 
ATOM   9689  C  C   . ASN H  4 18  ? 64.095  -99.650  -83.827  1.00 24.38  ? 18   ASN H C   1 
ATOM   9690  O  O   . ASN H  4 18  ? 65.213  -99.321  -84.238  1.00 23.99  ? 18   ASN H O   1 
ATOM   9691  C  CB  . ASN H  4 18  ? 62.886  -97.737  -84.844  1.00 26.17  ? 18   ASN H CB  1 
ATOM   9692  C  CG  . ASN H  4 18  ? 61.506  -97.129  -85.013  1.00 25.04  ? 18   ASN H CG  1 
ATOM   9693  O  OD1 . ASN H  4 18  ? 61.329  -96.200  -85.808  1.00 25.94  ? 18   ASN H OD1 1 
ATOM   9694  N  ND2 . ASN H  4 18  ? 60.524  -97.644  -84.277  1.00 20.18  ? 18   ASN H ND2 1 
ATOM   9695  N  N   . PHE H  4 19  ? 63.754  -100.900 -83.563  1.00 22.41  ? 19   PHE H N   1 
ATOM   9696  C  CA  . PHE H  4 19  ? 64.695  -101.988 -83.687  1.00 19.80  ? 19   PHE H CA  1 
ATOM   9697  C  C   . PHE H  4 19  ? 65.741  -101.848 -84.759  1.00 20.41  ? 19   PHE H C   1 
ATOM   9698  O  O   . PHE H  4 19  ? 66.873  -102.252 -84.554  1.00 21.92  ? 19   PHE H O   1 
ATOM   9699  C  CB  . PHE H  4 19  ? 63.965  -103.303 -83.911  1.00 17.04  ? 19   PHE H CB  1 
ATOM   9700  C  CG  . PHE H  4 19  ? 64.871  -104.487 -83.901  1.00 16.26  ? 19   PHE H CG  1 
ATOM   9701  C  CD1 . PHE H  4 19  ? 65.359  -104.995 -82.693  1.00 15.94  ? 19   PHE H CD1 1 
ATOM   9702  C  CD2 . PHE H  4 19  ? 65.292  -105.064 -85.095  1.00 16.66  ? 19   PHE H CD2 1 
ATOM   9703  C  CE1 . PHE H  4 19  ? 66.254  -106.052 -82.671  1.00 15.64  ? 19   PHE H CE1 1 
ATOM   9704  C  CE2 . PHE H  4 19  ? 66.199  -106.135 -85.089  1.00 18.40  ? 19   PHE H CE2 1 
ATOM   9705  C  CZ  . PHE H  4 19  ? 66.680  -106.627 -83.872  1.00 18.34  ? 19   PHE H CZ  1 
ATOM   9706  N  N   . LEU H  4 20  ? 65.381  -101.272 -85.898  1.00 21.81  ? 20   LEU H N   1 
ATOM   9707  C  CA  . LEU H  4 20  ? 66.320  -101.178 -87.012  1.00 23.66  ? 20   LEU H CA  1 
ATOM   9708  C  C   . LEU H  4 20  ? 66.880  -99.812  -87.330  1.00 23.99  ? 20   LEU H C   1 
ATOM   9709  O  O   . LEU H  4 20  ? 67.527  -99.644  -88.359  1.00 23.09  ? 20   LEU H O   1 
ATOM   9710  C  CB  . LEU H  4 20  ? 65.675  -101.747 -88.289  1.00 25.88  ? 20   LEU H CB  1 
ATOM   9711  C  CG  . LEU H  4 20  ? 65.190  -103.201 -88.255  1.00 25.65  ? 20   LEU H CG  1 
ATOM   9712  C  CD1 . LEU H  4 20  ? 64.451  -103.524 -89.550  1.00 25.06  ? 20   LEU H CD1 1 
ATOM   9713  C  CD2 . LEU H  4 20  ? 66.385  -104.135 -88.051  1.00 23.52  ? 20   LEU H CD2 1 
ATOM   9714  N  N   . SER H  4 21  ? 66.634  -98.840  -86.463  1.00 25.36  ? 21   SER H N   1 
ATOM   9715  C  CA  . SER H  4 21  ? 67.141  -97.502  -86.692  1.00 28.34  ? 21   SER H CA  1 
ATOM   9716  C  C   . SER H  4 21  ? 68.624  -97.423  -86.339  1.00 31.41  ? 21   SER H C   1 
ATOM   9717  O  O   . SER H  4 21  ? 69.011  -97.679  -85.197  1.00 32.06  ? 21   SER H O   1 
ATOM   9718  C  CB  . SER H  4 21  ? 66.372  -96.478  -85.850  1.00 28.69  ? 21   SER H CB  1 
ATOM   9719  O  OG  . SER H  4 21  ? 66.928  -95.177  -86.021  1.00 30.97  ? 21   SER H OG  1 
ATOM   9720  N  N   . LEU H  4 22  ? 69.456  -97.082  -87.319  1.00 32.83  ? 22   LEU H N   1 
ATOM   9721  C  CA  . LEU H  4 22  ? 70.875  -96.942  -87.064  1.00 33.37  ? 22   LEU H CA  1 
ATOM   9722  C  C   . LEU H  4 22  ? 71.062  -95.818  -86.044  1.00 34.06  ? 22   LEU H C   1 
ATOM   9723  O  O   . LEU H  4 22  ? 71.958  -95.872  -85.203  1.00 34.56  ? 22   LEU H O   1 
ATOM   9724  C  CB  . LEU H  4 22  ? 71.624  -96.584  -88.346  1.00 34.36  ? 22   LEU H CB  1 
ATOM   9725  C  CG  . LEU H  4 22  ? 71.636  -97.535  -89.544  1.00 35.23  ? 22   LEU H CG  1 
ATOM   9726  C  CD1 . LEU H  4 22  ? 72.701  -97.038  -90.510  1.00 34.11  ? 22   LEU H CD1 1 
ATOM   9727  C  CD2 . LEU H  4 22  ? 71.939  -98.969  -89.121  1.00 33.85  ? 22   LEU H CD2 1 
ATOM   9728  N  N   . ASP H  4 23  ? 70.212  -94.798  -86.134  1.00 35.04  ? 23   ASP H N   1 
ATOM   9729  C  CA  . ASP H  4 23  ? 70.269  -93.649  -85.232  1.00 35.50  ? 23   ASP H CA  1 
ATOM   9730  C  C   . ASP H  4 23  ? 69.976  -94.097  -83.824  1.00 34.43  ? 23   ASP H C   1 
ATOM   9731  O  O   . ASP H  4 23  ? 70.585  -93.625  -82.865  1.00 33.78  ? 23   ASP H O   1 
ATOM   9732  C  CB  . ASP H  4 23  ? 69.228  -92.596  -85.628  1.00 38.64  ? 23   ASP H CB  1 
ATOM   9733  C  CG  . ASP H  4 23  ? 69.710  -91.666  -86.726  1.00 41.30  ? 23   ASP H CG  1 
ATOM   9734  O  OD1 . ASP H  4 23  ? 68.845  -91.056  -87.401  1.00 43.84  ? 23   ASP H OD1 1 
ATOM   9735  O  OD2 . ASP H  4 23  ? 70.942  -91.525  -86.904  1.00 41.69  ? 23   ASP H OD2 1 
ATOM   9736  N  N   . ASP H  4 24  ? 69.028  -95.017  -83.707  1.00 33.82  ? 24   ASP H N   1 
ATOM   9737  C  CA  . ASP H  4 24  ? 68.624  -95.519  -82.408  1.00 34.05  ? 24   ASP H CA  1 
ATOM   9738  C  C   . ASP H  4 24  ? 69.565  -96.491  -81.721  1.00 32.74  ? 24   ASP H C   1 
ATOM   9739  O  O   . ASP H  4 24  ? 69.519  -96.623  -80.500  1.00 32.77  ? 24   ASP H O   1 
ATOM   9740  C  CB  . ASP H  4 24  ? 67.238  -96.143  -82.508  1.00 36.11  ? 24   ASP H CB  1 
ATOM   9741  C  CG  . ASP H  4 24  ? 66.150  -95.105  -82.559  1.00 39.54  ? 24   ASP H CG  1 
ATOM   9742  O  OD1 . ASP H  4 24  ? 64.976  -95.475  -82.793  1.00 42.06  ? 24   ASP H OD1 1 
ATOM   9743  O  OD2 . ASP H  4 24  ? 66.476  -93.914  -82.354  1.00 39.62  ? 24   ASP H OD2 1 
ATOM   9744  N  N   . ILE H  4 25  ? 70.418  -97.173  -82.477  1.00 31.79  ? 25   ILE H N   1 
ATOM   9745  C  CA  . ILE H  4 25  ? 71.307  -98.120  -81.839  1.00 33.18  ? 25   ILE H CA  1 
ATOM   9746  C  C   . ILE H  4 25  ? 72.661  -97.486  -81.620  1.00 33.13  ? 25   ILE H C   1 
ATOM   9747  O  O   . ILE H  4 25  ? 73.553  -98.061  -81.013  1.00 35.42  ? 25   ILE H O   1 
ATOM   9748  C  CB  . ILE H  4 25  ? 71.390  -99.457  -82.642  1.00 33.99  ? 25   ILE H CB  1 
ATOM   9749  C  CG1 . ILE H  4 25  ? 72.475  -99.431  -83.690  1.00 35.26  ? 25   ILE H CG1 1 
ATOM   9750  C  CG2 . ILE H  4 25  ? 70.078  -99.707  -83.385  1.00 35.54  ? 25   ILE H CG2 1 
ATOM   9751  C  CD1 . ILE H  4 25  ? 72.327  -100.635 -84.622  1.00 38.52  ? 25   ILE H CD1 1 
ATOM   9752  N  N   . LEU H  4 26  ? 72.783  -96.261  -82.097  1.00 33.11  ? 26   LEU H N   1 
ATOM   9753  C  CA  . LEU H  4 26  ? 73.995  -95.492  -81.952  1.00 31.49  ? 26   LEU H CA  1 
ATOM   9754  C  C   . LEU H  4 26  ? 73.773  -94.708  -80.668  1.00 32.79  ? 26   LEU H C   1 
ATOM   9755  O  O   . LEU H  4 26  ? 74.683  -94.520  -79.873  1.00 35.23  ? 26   LEU H O   1 
ATOM   9756  C  CB  . LEU H  4 26  ? 74.145  -94.558  -83.146  1.00 28.58  ? 26   LEU H CB  1 
ATOM   9757  C  CG  . LEU H  4 26  ? 75.539  -94.442  -83.747  1.00 27.98  ? 26   LEU H CG  1 
ATOM   9758  C  CD1 . LEU H  4 26  ? 76.297  -95.742  -83.503  1.00 28.72  ? 26   LEU H CD1 1 
ATOM   9759  C  CD2 . LEU H  4 26  ? 75.437  -94.118  -85.234  1.00 25.31  ? 26   LEU H CD2 1 
HETATM 9760  N  N   . MSE H  4 27  ? 72.545  -94.260  -80.465  1.00 32.98  ? 27   MSE H N   1 
HETATM 9761  C  CA  . MSE H  4 27  ? 72.202  -93.526  -79.259  1.00 33.30  ? 27   MSE H CA  1 
HETATM 9762  C  C   . MSE H  4 27  ? 72.240  -94.470  -78.073  1.00 32.18  ? 27   MSE H C   1 
HETATM 9763  O  O   . MSE H  4 27  ? 72.653  -94.093  -76.980  1.00 34.19  ? 27   MSE H O   1 
HETATM 9764  C  CB  . MSE H  4 27  ? 70.809  -92.921  -79.392  1.00 34.72  ? 27   MSE H CB  1 
HETATM 9765  C  CG  . MSE H  4 27  ? 70.221  -92.360  -78.111  1.00 38.60  ? 27   MSE H CG  1 
HETATM 9766  SE SE  . MSE H  4 27  ? 69.460  -93.692  -76.922  1.00 49.96  ? 27   MSE H SE  1 
HETATM 9767  C  CE  . MSE H  4 27  ? 68.238  -94.617  -78.122  1.00 45.92  ? 27   MSE H CE  1 
ATOM   9768  N  N   . SER H  4 28  ? 71.815  -95.704  -78.295  1.00 30.90  ? 28   SER H N   1 
ATOM   9769  C  CA  . SER H  4 28  ? 71.785  -96.709  -77.245  1.00 28.56  ? 28   SER H CA  1 
ATOM   9770  C  C   . SER H  4 28  ? 73.155  -97.179  -76.773  1.00 28.69  ? 28   SER H C   1 
ATOM   9771  O  O   . SER H  4 28  ? 73.256  -97.956  -75.826  1.00 27.17  ? 28   SER H O   1 
ATOM   9772  C  CB  . SER H  4 28  ? 70.988  -97.908  -77.713  1.00 27.24  ? 28   SER H CB  1 
ATOM   9773  O  OG  . SER H  4 28  ? 69.804  -97.989  -76.960  1.00 31.86  ? 28   SER H OG  1 
ATOM   9774  N  N   . HIS H  4 29  ? 74.208  -96.726  -77.436  1.00 28.31  ? 29   HIS H N   1 
ATOM   9775  C  CA  . HIS H  4 29  ? 75.539  -97.121  -77.024  1.00 30.27  ? 29   HIS H CA  1 
ATOM   9776  C  C   . HIS H  4 29  ? 76.129  -96.186  -75.976  1.00 31.91  ? 29   HIS H C   1 
ATOM   9777  O  O   . HIS H  4 29  ? 76.976  -96.586  -75.180  1.00 31.93  ? 29   HIS H O   1 
ATOM   9778  C  CB  . HIS H  4 29  ? 76.489  -97.158  -78.202  1.00 30.76  ? 29   HIS H CB  1 
ATOM   9779  C  CG  . HIS H  4 29  ? 77.593  -98.140  -78.023  1.00 30.59  ? 29   HIS H CG  1 
ATOM   9780  N  ND1 . HIS H  4 29  ? 78.853  -97.950  -78.541  1.00 30.90  ? 29   HIS H ND1 1 
ATOM   9781  C  CD2 . HIS H  4 29  ? 77.614  -99.344  -77.402  1.00 30.60  ? 29   HIS H CD2 1 
ATOM   9782  C  CE1 . HIS H  4 29  ? 79.605  -98.995  -78.246  1.00 33.55  ? 29   HIS H CE1 1 
ATOM   9783  N  NE2 . HIS H  4 29  ? 78.876  -99.856  -77.556  1.00 32.62  ? 29   HIS H NE2 1 
ATOM   9784  N  N   . GLU H  4 30  ? 75.701  -94.932  -76.001  1.00 33.32  ? 30   GLU H N   1 
ATOM   9785  C  CA  . GLU H  4 30  ? 76.179  -93.954  -75.048  1.00 35.08  ? 30   GLU H CA  1 
ATOM   9786  C  C   . GLU H  4 30  ? 76.031  -94.528  -73.640  1.00 36.12  ? 30   GLU H C   1 
ATOM   9787  O  O   . GLU H  4 30  ? 75.065  -95.250  -73.350  1.00 32.40  ? 30   GLU H O   1 
ATOM   9788  C  CB  . GLU H  4 30  ? 75.393  -92.659  -75.217  1.00 36.02  ? 30   GLU H CB  1 
ATOM   9789  C  CG  . GLU H  4 30  ? 75.574  -92.070  -76.599  1.00 40.79  ? 30   GLU H CG  1 
ATOM   9790  C  CD  . GLU H  4 30  ? 77.021  -91.673  -76.880  1.00 46.18  ? 30   GLU H CD  1 
ATOM   9791  O  OE1 . GLU H  4 30  ? 77.433  -90.564  -76.461  1.00 50.54  ? 30   GLU H OE1 1 
ATOM   9792  O  OE2 . GLU H  4 30  ? 77.758  -92.471  -77.506  1.00 48.15  ? 30   GLU H OE2 1 
ATOM   9793  N  N   . LYS H  4 31  ? 77.007  -94.213  -72.780  1.00 37.98  ? 31   LYS H N   1 
ATOM   9794  C  CA  . LYS H  4 31  ? 77.043  -94.714  -71.407  1.00 37.75  ? 31   LYS H CA  1 
ATOM   9795  C  C   . LYS H  4 31  ? 76.164  -94.004  -70.392  1.00 37.48  ? 31   LYS H C   1 
ATOM   9796  O  O   . LYS H  4 31  ? 75.879  -92.818  -70.478  1.00 35.93  ? 31   LYS H O   1 
ATOM   9797  C  CB  . LYS H  4 31  ? 78.475  -94.728  -70.876  1.00 37.22  ? 31   LYS H CB  1 
ATOM   9798  C  CG  . LYS H  4 31  ? 79.477  -95.357  -71.804  1.00 41.57  ? 31   LYS H CG  1 
ATOM   9799  C  CD  . LYS H  4 31  ? 79.141  -96.788  -72.141  1.00 45.29  ? 31   LYS H CD  1 
ATOM   9800  C  CE  . LYS H  4 31  ? 79.989  -97.273  -73.334  1.00 49.67  ? 31   LYS H CE  1 
ATOM   9801  N  NZ  . LYS H  4 31  ? 79.725  -96.515  -74.622  1.00 46.52  ? 31   LYS H NZ  1 
ATOM   9802  N  N   . LEU H  4 32  ? 75.768  -94.778  -69.401  1.00 39.43  ? 32   LEU H N   1 
ATOM   9803  C  CA  . LEU H  4 32  ? 74.927  -94.328  -68.319  1.00 40.80  ? 32   LEU H CA  1 
ATOM   9804  C  C   . LEU H  4 32  ? 75.709  -94.649  -67.035  1.00 42.08  ? 32   LEU H C   1 
ATOM   9805  O  O   . LEU H  4 32  ? 76.536  -95.563  -67.017  1.00 41.73  ? 32   LEU H O   1 
ATOM   9806  C  CB  . LEU H  4 32  ? 73.636  -95.136  -68.372  1.00 39.86  ? 32   LEU H CB  1 
ATOM   9807  C  CG  . LEU H  4 32  ? 72.462  -94.746  -67.502  1.00 40.54  ? 32   LEU H CG  1 
ATOM   9808  C  CD1 . LEU H  4 32  ? 71.866  -93.462  -68.045  1.00 42.73  ? 32   LEU H CD1 1 
ATOM   9809  C  CD2 . LEU H  4 32  ? 71.426  -95.858  -67.522  1.00 42.21  ? 32   LEU H CD2 1 
ATOM   9810  N  N   . PRO H  4 33  ? 75.497  -93.877  -65.963  1.00 43.44  ? 33   PRO H N   1 
ATOM   9811  C  CA  . PRO H  4 33  ? 76.210  -94.153  -64.708  1.00 43.19  ? 33   PRO H CA  1 
ATOM   9812  C  C   . PRO H  4 33  ? 75.449  -95.229  -63.952  1.00 43.55  ? 33   PRO H C   1 
ATOM   9813  O  O   . PRO H  4 33  ? 74.241  -95.110  -63.738  1.00 45.42  ? 33   PRO H O   1 
ATOM   9814  C  CB  . PRO H  4 33  ? 76.160  -92.816  -63.975  1.00 43.11  ? 33   PRO H CB  1 
ATOM   9815  C  CG  . PRO H  4 33  ? 76.014  -91.819  -65.082  1.00 44.48  ? 33   PRO H CG  1 
ATOM   9816  C  CD  . PRO H  4 33  ? 75.019  -92.486  -65.985  1.00 44.02  ? 33   PRO H CD  1 
ATOM   9817  N  N   . VAL H  4 34  ? 76.137  -96.275  -63.530  1.00 43.84  ? 34   VAL H N   1 
ATOM   9818  C  CA  . VAL H  4 34  ? 75.444  -97.337  -62.819  1.00 45.52  ? 34   VAL H CA  1 
ATOM   9819  C  C   . VAL H  4 34  ? 76.253  -97.957  -61.683  1.00 45.98  ? 34   VAL H C   1 
ATOM   9820  O  O   . VAL H  4 34  ? 77.486  -97.922  -61.692  1.00 45.45  ? 34   VAL H O   1 
ATOM   9821  C  CB  . VAL H  4 34  ? 75.041  -98.448  -63.808  1.00 46.67  ? 34   VAL H CB  1 
ATOM   9822  C  CG1 . VAL H  4 34  ? 76.283  -99.085  -64.406  1.00 45.20  ? 34   VAL H CG1 1 
ATOM   9823  C  CG2 . VAL H  4 34  ? 74.200  -99.483  -63.107  1.00 49.62  ? 34   VAL H CG2 1 
ATOM   9824  N  N   . ARG H  4 35  ? 75.550  -98.515  -60.701  1.00 46.98  ? 35   ARG H N   1 
ATOM   9825  C  CA  . ARG H  4 35  ? 76.194  -99.184  -59.568  1.00 48.54  ? 35   ARG H CA  1 
ATOM   9826  C  C   . ARG H  4 35  ? 75.600  -100.585 -59.406  1.00 47.84  ? 35   ARG H C   1 
ATOM   9827  O  O   . ARG H  4 35  ? 74.400  -100.737 -59.169  1.00 45.47  ? 35   ARG H O   1 
ATOM   9828  C  CB  . ARG H  4 35  ? 75.985  -98.403  -58.275  1.00 50.70  ? 35   ARG H CB  1 
ATOM   9829  C  CG  . ARG H  4 35  ? 76.698  -99.012  -57.087  1.00 54.58  ? 35   ARG H CG  1 
ATOM   9830  C  CD  . ARG H  4 35  ? 76.190  -98.429  -55.776  1.00 59.30  ? 35   ARG H CD  1 
ATOM   9831  N  NE  . ARG H  4 35  ? 74.773  -98.724  -55.561  1.00 63.47  ? 35   ARG H NE  1 
ATOM   9832  C  CZ  . ARG H  4 35  ? 74.088  -98.379  -54.470  1.00 65.92  ? 35   ARG H CZ  1 
ATOM   9833  N  NH1 . ARG H  4 35  ? 74.687  -97.722  -53.482  1.00 67.59  ? 35   ARG H NH1 1 
ATOM   9834  N  NH2 . ARG H  4 35  ? 72.801  -98.694  -54.365  1.00 66.13  ? 35   ARG H NH2 1 
ATOM   9835  N  N   . THR H  4 36  ? 76.446  -101.604 -59.535  1.00 47.78  ? 36   THR H N   1 
ATOM   9836  C  CA  . THR H  4 36  ? 75.984  -102.980 -59.416  1.00 48.34  ? 36   THR H CA  1 
ATOM   9837  C  C   . THR H  4 36  ? 75.445  -103.285 -58.028  1.00 48.56  ? 36   THR H C   1 
ATOM   9838  O  O   . THR H  4 36  ? 76.080  -102.984 -57.021  1.00 47.56  ? 36   THR H O   1 
ATOM   9839  C  CB  . THR H  4 36  ? 77.105  -103.995 -59.746  1.00 48.92  ? 36   THR H CB  1 
ATOM   9840  O  OG1 . THR H  4 36  ? 78.155  -103.906 -58.776  1.00 49.08  ? 36   THR H OG1 1 
ATOM   9841  C  CG2 . THR H  4 36  ? 77.674  -103.714 -61.117  1.00 48.60  ? 36   THR H CG2 1 
ATOM   9842  N  N   . GLU H  4 37  ? 74.261  -103.881 -57.993  1.00 49.07  ? 37   GLU H N   1 
ATOM   9843  C  CA  . GLU H  4 37  ? 73.621  -104.248 -56.743  1.00 50.30  ? 37   GLU H CA  1 
ATOM   9844  C  C   . GLU H  4 37  ? 73.805  -105.736 -56.447  1.00 50.87  ? 37   GLU H C   1 
ATOM   9845  O  O   . GLU H  4 37  ? 73.089  -106.300 -55.627  1.00 52.59  ? 37   GLU H O   1 
ATOM   9846  C  CB  . GLU H  4 37  ? 72.133  -103.918 -56.813  1.00 50.78  ? 37   GLU H CB  1 
ATOM   9847  C  CG  . GLU H  4 37  ? 71.862  -102.444 -56.944  1.00 53.58  ? 37   GLU H CG  1 
ATOM   9848  C  CD  . GLU H  4 37  ? 72.394  -101.661 -55.758  1.00 55.89  ? 37   GLU H CD  1 
ATOM   9849  O  OE1 . GLU H  4 37  ? 71.661  -101.522 -54.753  1.00 55.96  ? 37   GLU H OE1 1 
ATOM   9850  O  OE2 . GLU H  4 37  ? 73.555  -101.198 -55.826  1.00 57.57  ? 37   GLU H OE2 1 
ATOM   9851  N  N   . THR H  4 38  ? 74.770  -106.365 -57.108  1.00 50.24  ? 38   THR H N   1 
ATOM   9852  C  CA  . THR H  4 38  ? 75.017  -107.783 -56.918  1.00 50.20  ? 38   THR H CA  1 
ATOM   9853  C  C   . THR H  4 38  ? 76.322  -108.145 -57.608  1.00 52.10  ? 38   THR H C   1 
ATOM   9854  O  O   . THR H  4 38  ? 76.732  -107.481 -58.565  1.00 52.82  ? 38   THR H O   1 
ATOM   9855  C  CB  . THR H  4 38  ? 73.881  -108.619 -57.526  1.00 50.21  ? 38   THR H CB  1 
ATOM   9856  O  OG1 . THR H  4 38  ? 73.947  -109.956 -57.026  1.00 51.26  ? 38   THR H OG1 1 
ATOM   9857  C  CG2 . THR H  4 38  ? 74.002  -108.662 -59.040  1.00 51.00  ? 38   THR H CG2 1 
ATOM   9858  N  N   . ALA H  4 39  ? 76.970  -109.199 -57.121  1.00 53.93  ? 39   ALA H N   1 
ATOM   9859  C  CA  . ALA H  4 39  ? 78.238  -109.655 -57.684  1.00 55.16  ? 39   ALA H CA  1 
ATOM   9860  C  C   . ALA H  4 39  ? 78.054  -110.321 -59.034  1.00 56.37  ? 39   ALA H C   1 
ATOM   9861  O  O   . ALA H  4 39  ? 77.138  -111.127 -59.234  1.00 55.57  ? 39   ALA H O   1 
ATOM   9862  C  CB  . ALA H  4 39  ? 78.915  -110.617 -56.736  1.00 55.91  ? 39   ALA H CB  1 
HETATM 9863  N  N   . MSE H  4 40  ? 78.947  -109.975 -59.954  1.00 57.67  ? 40   MSE H N   1 
HETATM 9864  C  CA  . MSE H  4 40  ? 78.916  -110.514 -61.299  1.00 58.93  ? 40   MSE H CA  1 
HETATM 9865  C  C   . MSE H  4 40  ? 80.224  -111.240 -61.562  1.00 56.57  ? 40   MSE H C   1 
HETATM 9866  O  O   . MSE H  4 40  ? 81.207  -110.653 -62.015  1.00 54.69  ? 40   MSE H O   1 
HETATM 9867  C  CB  . MSE H  4 40  ? 78.716  -109.387 -62.313  1.00 64.96  ? 40   MSE H CB  1 
HETATM 9868  C  CG  . MSE H  4 40  ? 77.545  -108.472 -61.978  1.00 71.52  ? 40   MSE H CG  1 
HETATM 9869  SE SE  . MSE H  4 40  ? 76.973  -107.392 -63.475  1.00 80.79  ? 40   MSE H SE  1 
HETATM 9870  C  CE  . MSE H  4 40  ? 75.568  -108.553 -64.126  1.00 76.99  ? 40   MSE H CE  1 
ATOM   9871  N  N   . PRO H  4 41  ? 80.251  -112.541 -61.264  1.00 55.40  ? 41   PRO H N   1 
ATOM   9872  C  CA  . PRO H  4 41  ? 81.444  -113.359 -61.464  1.00 54.88  ? 41   PRO H CA  1 
ATOM   9873  C  C   . PRO H  4 41  ? 81.877  -113.521 -62.908  1.00 54.67  ? 41   PRO H C   1 
ATOM   9874  O  O   . PRO H  4 41  ? 81.056  -113.726 -63.787  1.00 54.42  ? 41   PRO H O   1 
ATOM   9875  C  CB  . PRO H  4 41  ? 81.061  -114.683 -60.815  1.00 53.94  ? 41   PRO H CB  1 
ATOM   9876  C  CG  . PRO H  4 41  ? 79.574  -114.718 -60.970  1.00 53.69  ? 41   PRO H CG  1 
ATOM   9877  C  CD  . PRO H  4 41  ? 79.175  -113.324 -60.634  1.00 53.97  ? 41   PRO H CD  1 
ATOM   9878  N  N   . ARG H  4 42  ? 83.180  -113.405 -63.134  1.00 56.36  ? 42   ARG H N   1 
ATOM   9879  C  CA  . ARG H  4 42  ? 83.787  -113.575 -64.451  1.00 58.57  ? 42   ARG H CA  1 
ATOM   9880  C  C   . ARG H  4 42  ? 83.812  -112.362 -65.373  1.00 59.33  ? 42   ARG H C   1 
ATOM   9881  O  O   . ARG H  4 42  ? 84.408  -112.415 -66.447  1.00 59.40  ? 42   ARG H O   1 
ATOM   9882  C  CB  . ARG H  4 42  ? 83.147  -114.781 -65.149  1.00 58.26  ? 42   ARG H CB  1 
ATOM   9883  C  CG  . ARG H  4 42  ? 83.266  -116.029 -64.280  1.00 59.63  ? 42   ARG H CG  1 
ATOM   9884  C  CD  . ARG H  4 42  ? 82.389  -117.193 -64.702  1.00 60.49  ? 42   ARG H CD  1 
ATOM   9885  N  NE  . ARG H  4 42  ? 82.333  -118.186 -63.632  1.00 61.94  ? 42   ARG H NE  1 
ATOM   9886  C  CZ  . ARG H  4 42  ? 82.047  -119.472 -63.803  1.00 63.02  ? 42   ARG H CZ  1 
ATOM   9887  N  NH1 . ARG H  4 42  ? 81.788  -119.946 -65.012  1.00 64.37  ? 42   ARG H NH1 1 
ATOM   9888  N  NH2 . ARG H  4 42  ? 82.027  -120.290 -62.760  1.00 63.60  ? 42   ARG H NH2 1 
ATOM   9889  N  N   . LEU H  4 43  ? 83.191  -111.264 -64.955  1.00 61.19  ? 43   LEU H N   1 
ATOM   9890  C  CA  . LEU H  4 43  ? 83.185  -110.057 -65.775  1.00 62.66  ? 43   LEU H CA  1 
ATOM   9891  C  C   . LEU H  4 43  ? 84.354  -109.141 -65.455  1.00 64.85  ? 43   LEU H C   1 
ATOM   9892  O  O   . LEU H  4 43  ? 84.880  -108.471 -66.343  1.00 65.47  ? 43   LEU H O   1 
ATOM   9893  C  CB  . LEU H  4 43  ? 81.879  -109.275 -65.611  1.00 61.41  ? 43   LEU H CB  1 
ATOM   9894  C  CG  . LEU H  4 43  ? 80.677  -109.700 -66.456  1.00 60.65  ? 43   LEU H CG  1 
ATOM   9895  C  CD1 . LEU H  4 43  ? 81.172  -110.224 -67.805  1.00 59.05  ? 43   LEU H CD1 1 
ATOM   9896  C  CD2 . LEU H  4 43  ? 79.873  -110.764 -65.729  1.00 60.98  ? 43   LEU H CD2 1 
ATOM   9897  N  N   . GLY H  4 44  ? 84.756  -109.107 -64.187  1.00 67.47  ? 44   GLY H N   1 
ATOM   9898  C  CA  . GLY H  4 44  ? 85.868  -108.261 -63.792  1.00 69.33  ? 44   GLY H CA  1 
ATOM   9899  C  C   . GLY H  4 44  ? 86.973  -108.362 -64.822  1.00 71.23  ? 44   GLY H C   1 
ATOM   9900  O  O   . GLY H  4 44  ? 87.659  -107.379 -65.118  1.00 70.12  ? 44   GLY H O   1 
ATOM   9901  N  N   . ALA H  4 45  ? 87.118  -109.565 -65.378  1.00 73.26  ? 45   ALA H N   1 
ATOM   9902  C  CA  . ALA H  4 45  ? 88.126  -109.861 -66.387  1.00 75.67  ? 45   ALA H CA  1 
ATOM   9903  C  C   . ALA H  4 45  ? 88.364  -108.655 -67.285  1.00 77.62  ? 45   ALA H C   1 
ATOM   9904  O  O   . ALA H  4 45  ? 89.484  -108.159 -67.375  1.00 77.72  ? 45   ALA H O   1 
ATOM   9905  C  CB  . ALA H  4 45  ? 87.693  -111.068 -67.214  1.00 75.77  ? 45   ALA H CB  1 
ATOM   9906  N  N   . PHE H  4 46  ? 87.312  -108.185 -67.950  1.00 80.49  ? 46   PHE H N   1 
ATOM   9907  C  CA  . PHE H  4 46  ? 87.438  -107.021 -68.816  1.00 82.87  ? 46   PHE H CA  1 
ATOM   9908  C  C   . PHE H  4 46  ? 86.524  -105.903 -68.345  1.00 83.23  ? 46   PHE H C   1 
ATOM   9909  O  O   . PHE H  4 46  ? 85.392  -105.755 -68.796  1.00 83.02  ? 46   PHE H O   1 
ATOM   9910  C  CB  . PHE H  4 46  ? 87.134  -107.377 -70.272  1.00 84.84  ? 46   PHE H CB  1 
ATOM   9911  C  CG  . PHE H  4 46  ? 88.289  -107.116 -71.208  1.00 86.99  ? 46   PHE H CG  1 
ATOM   9912  C  CD1 . PHE H  4 46  ? 89.421  -107.927 -71.183  1.00 87.15  ? 46   PHE H CD1 1 
ATOM   9913  C  CD2 . PHE H  4 46  ? 88.253  -106.044 -72.100  1.00 87.77  ? 46   PHE H CD2 1 
ATOM   9914  C  CE1 . PHE H  4 46  ? 90.502  -107.675 -72.031  1.00 88.09  ? 46   PHE H CE1 1 
ATOM   9915  C  CE2 . PHE H  4 46  ? 89.328  -105.784 -72.953  1.00 88.36  ? 46   PHE H CE2 1 
ATOM   9916  C  CZ  . PHE H  4 46  ? 90.455  -106.602 -72.917  1.00 88.47  ? 46   PHE H CZ  1 
ATOM   9917  N  N   . PHE H  4 47  ? 87.057  -105.131 -67.412  1.00 84.25  ? 47   PHE H N   1 
ATOM   9918  C  CA  . PHE H  4 47  ? 86.396  -103.994 -66.793  1.00 85.40  ? 47   PHE H CA  1 
ATOM   9919  C  C   . PHE H  4 47  ? 87.529  -103.334 -66.019  1.00 87.16  ? 47   PHE H C   1 
ATOM   9920  O  O   . PHE H  4 47  ? 87.316  -102.421 -65.215  1.00 87.61  ? 47   PHE H O   1 
ATOM   9921  C  CB  . PHE H  4 47  ? 85.310  -104.465 -65.825  1.00 84.25  ? 47   PHE H CB  1 
ATOM   9922  C  CG  . PHE H  4 47  ? 83.913  -104.361 -66.372  1.00 83.65  ? 47   PHE H CG  1 
ATOM   9923  C  CD1 . PHE H  4 47  ? 83.355  -103.120 -66.660  1.00 82.85  ? 47   PHE H CD1 1 
ATOM   9924  C  CD2 . PHE H  4 47  ? 83.146  -105.503 -66.585  1.00 83.28  ? 47   PHE H CD2 1 
ATOM   9925  C  CE1 . PHE H  4 47  ? 82.056  -103.020 -67.150  1.00 82.12  ? 47   PHE H CE1 1 
ATOM   9926  C  CE2 . PHE H  4 47  ? 81.843  -105.409 -67.076  1.00 81.50  ? 47   PHE H CE2 1 
ATOM   9927  C  CZ  . PHE H  4 47  ? 81.300  -104.168 -67.357  1.00 81.55  ? 47   PHE H CZ  1 
ATOM   9928  N  N   . LEU H  4 48  ? 88.738  -103.837 -66.276  1.00 88.42  ? 48   LEU H N   1 
ATOM   9929  C  CA  . LEU H  4 48  ? 89.967  -103.363 -65.645  1.00 88.24  ? 48   LEU H CA  1 
ATOM   9930  C  C   . LEU H  4 48  ? 91.030  -103.111 -66.715  1.00 88.07  ? 48   LEU H C   1 
ATOM   9931  O  O   . LEU H  4 48  ? 92.005  -102.392 -66.486  1.00 87.70  ? 48   LEU H O   1 
ATOM   9932  C  CB  . LEU H  4 48  ? 90.484  -104.408 -64.651  1.00 87.67  ? 48   LEU H CB  1 
ATOM   9933  C  CG  . LEU H  4 48  ? 89.556  -104.808 -63.501  1.00 87.63  ? 48   LEU H CG  1 
ATOM   9934  C  CD1 . LEU H  4 48  ? 90.172  -105.969 -62.731  1.00 86.83  ? 48   LEU H CD1 1 
ATOM   9935  C  CD2 . LEU H  4 48  ? 89.320  -103.611 -62.590  1.00 86.81  ? 48   LEU H CD2 1 
ATOM   9936  N  N   . ASP H  4 57  ? 87.117  -117.318 -60.771  1.00 74.29  ? 57   ASP H N   1 
ATOM   9937  C  CA  . ASP H  4 57  ? 86.224  -116.459 -61.542  1.00 74.54  ? 57   ASP H CA  1 
ATOM   9938  C  C   . ASP H  4 57  ? 86.161  -115.015 -61.015  1.00 75.16  ? 57   ASP H C   1 
ATOM   9939  O  O   . ASP H  4 57  ? 85.115  -114.568 -60.526  1.00 74.99  ? 57   ASP H O   1 
ATOM   9940  C  CB  . ASP H  4 57  ? 84.814  -117.081 -61.585  1.00 72.25  ? 57   ASP H CB  1 
ATOM   9941  C  CG  . ASP H  4 57  ? 84.457  -117.842 -60.316  1.00 68.16  ? 57   ASP H CG  1 
ATOM   9942  O  OD1 . ASP H  4 57  ? 84.314  -117.222 -59.247  1.00 66.11  ? 57   ASP H OD1 1 
ATOM   9943  O  OD2 . ASP H  4 57  ? 84.316  -119.073 -60.394  1.00 66.49  ? 57   ASP H OD2 1 
ATOM   9944  N  N   . ASN H  4 58  ? 87.275  -114.287 -61.139  1.00 75.09  ? 58   ASN H N   1 
ATOM   9945  C  CA  . ASN H  4 58  ? 87.354  -112.907 -60.658  1.00 74.41  ? 58   ASN H CA  1 
ATOM   9946  C  C   . ASN H  4 58  ? 86.159  -112.075 -61.097  1.00 73.10  ? 58   ASN H C   1 
ATOM   9947  O  O   . ASN H  4 58  ? 86.098  -111.587 -62.224  1.00 73.41  ? 58   ASN H O   1 
ATOM   9948  C  CB  . ASN H  4 58  ? 88.637  -112.234 -61.131  1.00 75.49  ? 58   ASN H CB  1 
ATOM   9949  C  CG  . ASN H  4 58  ? 89.182  -111.257 -60.103  1.00 78.60  ? 58   ASN H CG  1 
ATOM   9950  O  OD1 . ASN H  4 58  ? 90.013  -110.402 -60.414  1.00 80.76  ? 58   ASN H OD1 1 
ATOM   9951  N  ND2 . ASN H  4 58  ? 88.719  -111.390 -58.858  1.00 78.79  ? 58   ASN H ND2 1 
ATOM   9952  N  N   . ALA H  4 59  ? 85.224  -111.906 -60.171  1.00 71.10  ? 59   ALA H N   1 
ATOM   9953  C  CA  . ALA H  4 59  ? 83.984  -111.178 -60.399  1.00 69.50  ? 59   ALA H CA  1 
ATOM   9954  C  C   . ALA H  4 59  ? 84.078  -109.656 -60.391  1.00 67.96  ? 59   ALA H C   1 
ATOM   9955  O  O   . ALA H  4 59  ? 85.163  -109.076 -60.418  1.00 67.85  ? 59   ALA H O   1 
ATOM   9956  C  CB  . ALA H  4 59  ? 82.958  -111.620 -59.356  1.00 69.96  ? 59   ALA H CB  1 
ATOM   9957  N  N   . VAL H  4 60  ? 82.901  -109.032 -60.386  1.00 65.14  ? 60   VAL H N   1 
ATOM   9958  C  CA  . VAL H  4 60  ? 82.757  -107.587 -60.314  1.00 61.70  ? 60   VAL H CA  1 
ATOM   9959  C  C   . VAL H  4 60  ? 82.018  -107.409 -59.003  1.00 61.28  ? 60   VAL H C   1 
ATOM   9960  O  O   . VAL H  4 60  ? 80.842  -107.753 -58.887  1.00 62.27  ? 60   VAL H O   1 
ATOM   9961  C  CB  . VAL H  4 60  ? 81.883  -107.007 -61.435  1.00 60.01  ? 60   VAL H CB  1 
ATOM   9962  C  CG1 . VAL H  4 60  ? 81.744  -105.512 -61.237  1.00 57.26  ? 60   VAL H CG1 1 
ATOM   9963  C  CG2 . VAL H  4 60  ? 82.498  -107.294 -62.788  1.00 59.40  ? 60   VAL H CG2 1 
ATOM   9964  N  N   . PRO H  4 61  ? 82.706  -106.870 -57.994  1.00 59.98  ? 61   PRO H N   1 
ATOM   9965  C  CA  . PRO H  4 61  ? 82.199  -106.614 -56.645  1.00 58.42  ? 61   PRO H CA  1 
ATOM   9966  C  C   . PRO H  4 61  ? 80.848  -105.919 -56.567  1.00 57.29  ? 61   PRO H C   1 
ATOM   9967  O  O   . PRO H  4 61  ? 80.613  -104.903 -57.218  1.00 57.50  ? 61   PRO H O   1 
ATOM   9968  C  CB  . PRO H  4 61  ? 83.313  -105.789 -56.018  1.00 59.67  ? 61   PRO H CB  1 
ATOM   9969  C  CG  . PRO H  4 61  ? 83.881  -105.060 -57.194  1.00 60.53  ? 61   PRO H CG  1 
ATOM   9970  C  CD  . PRO H  4 61  ? 83.973  -106.155 -58.211  1.00 60.24  ? 61   PRO H CD  1 
ATOM   9971  N  N   . GLN H  4 62  ? 79.977  -106.483 -55.739  1.00 56.11  ? 62   GLN H N   1 
ATOM   9972  C  CA  . GLN H  4 62  ? 78.628  -105.986 -55.526  1.00 54.78  ? 62   GLN H CA  1 
ATOM   9973  C  C   . GLN H  4 62  ? 78.563  -104.552 -55.021  1.00 53.82  ? 62   GLN H C   1 
ATOM   9974  O  O   . GLN H  4 62  ? 78.163  -104.310 -53.887  1.00 54.84  ? 62   GLN H O   1 
ATOM   9975  C  CB  . GLN H  4 62  ? 77.905  -106.894 -54.535  1.00 56.01  ? 62   GLN H CB  1 
ATOM   9976  C  CG  . GLN H  4 62  ? 76.425  -106.600 -54.379  1.00 59.42  ? 62   GLN H CG  1 
ATOM   9977  C  CD  . GLN H  4 62  ? 76.034  -106.198 -52.970  1.00 59.39  ? 62   GLN H CD  1 
ATOM   9978  O  OE1 . GLN H  4 62  ? 76.247  -105.058 -52.550  1.00 60.01  ? 62   GLN H OE1 1 
ATOM   9979  N  NE2 . GLN H  4 62  ? 75.457  -107.138 -52.230  1.00 59.86  ? 62   GLN H NE2 1 
ATOM   9980  N  N   . GLY H  4 63  ? 78.937  -103.600 -55.866  1.00 52.62  ? 63   GLY H N   1 
ATOM   9981  C  CA  . GLY H  4 63  ? 78.888  -102.208 -55.472  1.00 50.01  ? 63   GLY H CA  1 
ATOM   9982  C  C   . GLY H  4 63  ? 79.767  -101.386 -56.380  1.00 49.73  ? 63   GLY H C   1 
ATOM   9983  O  O   . GLY H  4 63  ? 80.085  -100.237 -56.087  1.00 51.20  ? 63   GLY H O   1 
ATOM   9984  N  N   . SER H  4 64  ? 80.167  -101.981 -57.492  1.00 48.72  ? 64   SER H N   1 
ATOM   9985  C  CA  . SER H  4 64  ? 81.020  -101.291 -58.437  1.00 48.87  ? 64   SER H CA  1 
ATOM   9986  C  C   . SER H  4 64  ? 80.257  -100.193 -59.164  1.00 49.38  ? 64   SER H C   1 
ATOM   9987  O  O   . SER H  4 64  ? 79.074  -100.343 -59.478  1.00 48.90  ? 64   SER H O   1 
ATOM   9988  C  CB  . SER H  4 64  ? 81.577  -102.279 -59.454  1.00 48.83  ? 64   SER H CB  1 
ATOM   9989  O  OG  . SER H  4 64  ? 82.124  -103.409 -58.806  1.00 50.12  ? 64   SER H OG  1 
ATOM   9990  N  N   . LYS H  4 65  ? 80.943  -99.083  -59.415  1.00 49.60  ? 65   LYS H N   1 
ATOM   9991  C  CA  . LYS H  4 65  ? 80.346  -97.966  -60.129  1.00 49.77  ? 65   LYS H CA  1 
ATOM   9992  C  C   . LYS H  4 65  ? 80.811  -98.054  -61.574  1.00 48.71  ? 65   LYS H C   1 
ATOM   9993  O  O   . LYS H  4 65  ? 81.961  -97.750  -61.891  1.00 47.66  ? 65   LYS H O   1 
ATOM   9994  C  CB  . LYS H  4 65  ? 80.765  -96.621  -59.512  1.00 50.39  ? 65   LYS H CB  1 
ATOM   9995  C  CG  . LYS H  4 65  ? 80.095  -96.314  -58.167  1.00 52.05  ? 65   LYS H CG  1 
ATOM   9996  C  CD  . LYS H  4 65  ? 80.251  -94.841  -57.779  1.00 53.30  ? 65   LYS H CD  1 
ATOM   9997  C  CE  . LYS H  4 65  ? 79.611  -93.925  -58.828  1.00 56.10  ? 65   LYS H CE  1 
ATOM   9998  N  NZ  . LYS H  4 65  ? 79.659  -92.463  -58.515  1.00 55.36  ? 65   LYS H NZ  1 
ATOM   9999  N  N   . LEU H  4 66  ? 79.905  -98.489  -62.446  1.00 47.54  ? 66   LEU H N   1 
ATOM   10000 C  CA  . LEU H  4 66  ? 80.219  -98.634  -63.857  1.00 45.55  ? 66   LEU H CA  1 
ATOM   10001 C  C   . LEU H  4 66  ? 79.528  -97.620  -64.755  1.00 45.03  ? 66   LEU H C   1 
ATOM   10002 O  O   . LEU H  4 66  ? 78.596  -96.921  -64.353  1.00 43.10  ? 66   LEU H O   1 
ATOM   10003 C  CB  . LEU H  4 66  ? 79.842  -100.034 -64.360  1.00 44.64  ? 66   LEU H CB  1 
ATOM   10004 C  CG  . LEU H  4 66  ? 80.460  -101.310 -63.792  1.00 42.63  ? 66   LEU H CG  1 
ATOM   10005 C  CD1 . LEU H  4 66  ? 81.892  -101.024 -63.361  1.00 42.28  ? 66   LEU H CD1 1 
ATOM   10006 C  CD2 . LEU H  4 66  ? 79.622  -101.817 -62.642  1.00 40.20  ? 66   LEU H CD2 1 
ATOM   10007 N  N   . GLU H  4 67  ? 80.021  -97.577  -65.987  1.00 44.89  ? 67   GLU H N   1 
ATOM   10008 C  CA  . GLU H  4 67  ? 79.513  -96.730  -67.059  1.00 44.06  ? 67   GLU H CA  1 
ATOM   10009 C  C   . GLU H  4 67  ? 79.049  -97.738  -68.113  1.00 42.74  ? 67   GLU H C   1 
ATOM   10010 O  O   . GLU H  4 67  ? 79.866  -98.236  -68.888  1.00 42.68  ? 67   GLU H O   1 
ATOM   10011 C  CB  . GLU H  4 67  ? 80.644  -95.874  -67.646  1.00 44.50  ? 67   GLU H CB  1 
ATOM   10012 C  CG  . GLU H  4 67  ? 81.034  -94.661  -66.838  1.00 47.14  ? 67   GLU H CG  1 
ATOM   10013 C  CD  . GLU H  4 67  ? 79.914  -93.652  -66.763  1.00 51.30  ? 67   GLU H CD  1 
ATOM   10014 O  OE1 . GLU H  4 67  ? 78.963  -93.877  -65.988  1.00 54.09  ? 67   GLU H OE1 1 
ATOM   10015 O  OE2 . GLU H  4 67  ? 79.968  -92.637  -67.492  1.00 53.54  ? 67   GLU H OE2 1 
ATOM   10016 N  N   . LEU H  4 68  ? 77.756  -98.054  -68.142  1.00 41.03  ? 68   LEU H N   1 
ATOM   10017 C  CA  . LEU H  4 68  ? 77.248  -99.031  -69.114  1.00 39.88  ? 68   LEU H CA  1 
ATOM   10018 C  C   . LEU H  4 68  ? 76.524  -98.402  -70.288  1.00 37.69  ? 68   LEU H C   1 
ATOM   10019 O  O   . LEU H  4 68  ? 75.980  -97.309  -70.179  1.00 39.19  ? 68   LEU H O   1 
ATOM   10020 C  CB  . LEU H  4 68  ? 76.263  -100.007 -68.455  1.00 39.27  ? 68   LEU H CB  1 
ATOM   10021 C  CG  . LEU H  4 68  ? 76.604  -100.710 -67.140  1.00 38.98  ? 68   LEU H CG  1 
ATOM   10022 C  CD1 . LEU H  4 68  ? 75.427  -101.597 -66.769  1.00 36.02  ? 68   LEU H CD1 1 
ATOM   10023 C  CD2 . LEU H  4 68  ? 77.897  -101.519 -67.256  1.00 37.20  ? 68   LEU H CD2 1 
ATOM   10024 N  N   . PRO H  4 69  ? 76.525  -99.084  -71.438  1.00 35.59  ? 69   PRO H N   1 
ATOM   10025 C  CA  . PRO H  4 69  ? 75.836  -98.580  -72.631  1.00 33.26  ? 69   PRO H CA  1 
ATOM   10026 C  C   . PRO H  4 69  ? 74.337  -98.604  -72.307  1.00 31.54  ? 69   PRO H C   1 
ATOM   10027 O  O   . PRO H  4 69  ? 73.846  -99.588  -71.764  1.00 31.29  ? 69   PRO H O   1 
ATOM   10028 C  CB  . PRO H  4 69  ? 76.213  -99.607  -73.696  1.00 32.53  ? 69   PRO H CB  1 
ATOM   10029 C  CG  . PRO H  4 69  ? 77.598  -99.997  -73.298  1.00 32.85  ? 69   PRO H CG  1 
ATOM   10030 C  CD  . PRO H  4 69  ? 77.460  -100.168 -71.791  1.00 35.19  ? 69   PRO H CD  1 
ATOM   10031 N  N   . LEU H  4 70  ? 73.602  -97.540  -72.624  1.00 31.08  ? 70   LEU H N   1 
ATOM   10032 C  CA  . LEU H  4 70  ? 72.175  -97.528  -72.298  1.00 28.94  ? 70   LEU H CA  1 
ATOM   10033 C  C   . LEU H  4 70  ? 71.467  -98.842  -72.626  1.00 29.29  ? 70   LEU H C   1 
ATOM   10034 O  O   . LEU H  4 70  ? 70.599  -99.279  -71.875  1.00 30.24  ? 70   LEU H O   1 
ATOM   10035 C  CB  . LEU H  4 70  ? 71.442  -96.384  -73.002  1.00 26.20  ? 70   LEU H CB  1 
ATOM   10036 C  CG  . LEU H  4 70  ? 69.953  -96.365  -72.615  1.00 25.93  ? 70   LEU H CG  1 
ATOM   10037 C  CD1 . LEU H  4 70  ? 69.808  -95.980  -71.162  1.00 26.33  ? 70   LEU H CD1 1 
ATOM   10038 C  CD2 . LEU H  4 70  ? 69.193  -95.406  -73.458  1.00 25.71  ? 70   LEU H CD2 1 
ATOM   10039 N  N   . TRP H  4 71  ? 71.821  -99.473  -73.741  1.00 28.61  ? 71   TRP H N   1 
ATOM   10040 C  CA  . TRP H  4 71  ? 71.172  -100.727 -74.084  1.00 29.11  ? 71   TRP H CA  1 
ATOM   10041 C  C   . TRP H  4 71  ? 71.399  -101.790 -73.019  1.00 30.61  ? 71   TRP H C   1 
ATOM   10042 O  O   . TRP H  4 71  ? 70.441  -102.391 -72.541  1.00 32.00  ? 71   TRP H O   1 
ATOM   10043 C  CB  . TRP H  4 71  ? 71.628  -101.251 -75.456  1.00 28.36  ? 71   TRP H CB  1 
ATOM   10044 C  CG  . TRP H  4 71  ? 73.084  -101.572 -75.614  1.00 27.70  ? 71   TRP H CG  1 
ATOM   10045 C  CD1 . TRP H  4 71  ? 74.031  -100.779 -76.182  1.00 27.19  ? 71   TRP H CD1 1 
ATOM   10046 C  CD2 . TRP H  4 71  ? 73.748  -102.802 -75.260  1.00 28.18  ? 71   TRP H CD2 1 
ATOM   10047 N  NE1 . TRP H  4 71  ? 75.244  -101.433 -76.216  1.00 28.99  ? 71   TRP H NE1 1 
ATOM   10048 C  CE2 . TRP H  4 71  ? 75.100  -102.674 -75.656  1.00 26.99  ? 71   TRP H CE2 1 
ATOM   10049 C  CE3 . TRP H  4 71  ? 73.332  -103.997 -74.649  1.00 26.00  ? 71   TRP H CE3 1 
ATOM   10050 C  CZ2 . TRP H  4 71  ? 76.039  -103.693 -75.463  1.00 24.91  ? 71   TRP H CZ2 1 
ATOM   10051 C  CZ3 . TRP H  4 71  ? 74.266  -105.007 -74.455  1.00 24.03  ? 71   TRP H CZ3 1 
ATOM   10052 C  CH2 . TRP H  4 71  ? 75.603  -104.848 -74.862  1.00 25.10  ? 71   TRP H CH2 1 
ATOM   10053 N  N   . LEU H  4 72  ? 72.659  -101.996 -72.631  1.00 32.01  ? 72   LEU H N   1 
ATOM   10054 C  CA  . LEU H  4 72  ? 73.036  -102.994 -71.626  1.00 30.94  ? 72   LEU H CA  1 
ATOM   10055 C  C   . LEU H  4 72  ? 72.397  -102.736 -70.273  1.00 30.74  ? 72   LEU H C   1 
ATOM   10056 O  O   . LEU H  4 72  ? 71.975  -103.674 -69.607  1.00 32.19  ? 72   LEU H O   1 
ATOM   10057 C  CB  . LEU H  4 72  ? 74.564  -103.038 -71.497  1.00 31.12  ? 72   LEU H CB  1 
ATOM   10058 C  CG  . LEU H  4 72  ? 75.295  -104.099 -70.660  1.00 30.52  ? 72   LEU H CG  1 
ATOM   10059 C  CD1 . LEU H  4 72  ? 75.213  -103.702 -69.225  1.00 32.17  ? 72   LEU H CD1 1 
ATOM   10060 C  CD2 . LEU H  4 72  ? 74.713  -105.498 -70.874  1.00 30.73  ? 72   LEU H CD2 1 
ATOM   10061 N  N   . ALA H  4 73  ? 72.320  -101.467 -69.873  1.00 30.81  ? 73   ALA H N   1 
ATOM   10062 C  CA  . ALA H  4 73  ? 71.722  -101.080 -68.592  1.00 29.29  ? 73   ALA H CA  1 
ATOM   10063 C  C   . ALA H  4 73  ? 70.212  -101.247 -68.611  1.00 30.07  ? 73   ALA H C   1 
ATOM   10064 O  O   . ALA H  4 73  ? 69.584  -101.466 -67.583  1.00 29.44  ? 73   ALA H O   1 
ATOM   10065 C  CB  . ALA H  4 73  ? 72.070  -99.642  -68.270  1.00 27.33  ? 73   ALA H CB  1 
ATOM   10066 N  N   . LYS H  4 74  ? 69.618  -101.125 -69.788  1.00 33.06  ? 74   LYS H N   1 
ATOM   10067 C  CA  . LYS H  4 74  ? 68.179  -101.277 -69.891  1.00 35.92  ? 74   LYS H CA  1 
ATOM   10068 C  C   . LYS H  4 74  ? 67.873  -102.780 -69.769  1.00 35.43  ? 74   LYS H C   1 
ATOM   10069 O  O   . LYS H  4 74  ? 66.845  -103.183 -69.203  1.00 33.84  ? 74   LYS H O   1 
ATOM   10070 C  CB  . LYS H  4 74  ? 67.692  -100.695 -71.228  1.00 37.25  ? 74   LYS H CB  1 
ATOM   10071 C  CG  . LYS H  4 74  ? 66.174  -100.609 -71.390  1.00 42.70  ? 74   LYS H CG  1 
ATOM   10072 C  CD  . LYS H  4 74  ? 65.800  -99.801  -72.654  1.00 48.34  ? 74   LYS H CD  1 
ATOM   10073 C  CE  . LYS H  4 74  ? 64.287  -99.863  -72.991  1.00 51.46  ? 74   LYS H CE  1 
ATOM   10074 N  NZ  . LYS H  4 74  ? 63.831  -101.144 -73.651  1.00 50.82  ? 74   LYS H NZ  1 
ATOM   10075 N  N   . GLY H  4 75  ? 68.802  -103.595 -70.267  1.00 33.69  ? 75   GLY H N   1 
ATOM   10076 C  CA  . GLY H  4 75  ? 68.642  -105.034 -70.221  1.00 32.38  ? 75   GLY H CA  1 
ATOM   10077 C  C   . GLY H  4 75  ? 68.656  -105.608 -68.819  1.00 33.27  ? 75   GLY H C   1 
ATOM   10078 O  O   . GLY H  4 75  ? 67.792  -106.416 -68.467  1.00 34.04  ? 75   GLY H O   1 
ATOM   10079 N  N   . LEU H  4 76  ? 69.624  -105.175 -68.014  1.00 32.35  ? 76   LEU H N   1 
ATOM   10080 C  CA  . LEU H  4 76  ? 69.792  -105.652 -66.645  1.00 32.18  ? 76   LEU H CA  1 
ATOM   10081 C  C   . LEU H  4 76  ? 68.892  -105.002 -65.584  1.00 34.06  ? 76   LEU H C   1 
ATOM   10082 O  O   . LEU H  4 76  ? 68.543  -105.624 -64.576  1.00 35.87  ? 76   LEU H O   1 
ATOM   10083 C  CB  . LEU H  4 76  ? 71.255  -105.480 -66.250  1.00 31.96  ? 76   LEU H CB  1 
ATOM   10084 C  CG  . LEU H  4 76  ? 72.299  -106.561 -66.592  1.00 31.85  ? 76   LEU H CG  1 
ATOM   10085 C  CD1 . LEU H  4 76  ? 71.763  -107.612 -67.560  1.00 28.57  ? 76   LEU H CD1 1 
ATOM   10086 C  CD2 . LEU H  4 76  ? 73.539  -105.860 -67.135  1.00 28.96  ? 76   LEU H CD2 1 
ATOM   10087 N  N   . PHE H  4 77  ? 68.512  -103.751 -65.805  1.00 35.55  ? 77   PHE H N   1 
ATOM   10088 C  CA  . PHE H  4 77  ? 67.668  -103.030 -64.859  1.00 35.05  ? 77   PHE H CA  1 
ATOM   10089 C  C   . PHE H  4 77  ? 66.285  -103.660 -64.648  1.00 35.23  ? 77   PHE H C   1 
ATOM   10090 O  O   . PHE H  4 77  ? 65.771  -104.365 -65.513  1.00 34.40  ? 77   PHE H O   1 
ATOM   10091 C  CB  . PHE H  4 77  ? 67.520  -101.565 -65.320  1.00 33.52  ? 77   PHE H CB  1 
ATOM   10092 C  CG  . PHE H  4 77  ? 66.636  -100.732 -64.429  1.00 33.27  ? 77   PHE H CG  1 
ATOM   10093 C  CD1 . PHE H  4 77  ? 65.302  -100.510 -64.760  1.00 31.77  ? 77   PHE H CD1 1 
ATOM   10094 C  CD2 . PHE H  4 77  ? 67.124  -100.220 -63.225  1.00 32.28  ? 77   PHE H CD2 1 
ATOM   10095 C  CE1 . PHE H  4 77  ? 64.455  -99.790  -63.902  1.00 32.50  ? 77   PHE H CE1 1 
ATOM   10096 C  CE2 . PHE H  4 77  ? 66.291  -99.503  -62.363  1.00 32.38  ? 77   PHE H CE2 1 
ATOM   10097 C  CZ  . PHE H  4 77  ? 64.951  -99.288  -62.702  1.00 31.11  ? 77   PHE H CZ  1 
ATOM   10098 N  N   . ASP H  4 78  ? 65.713  -103.421 -63.472  1.00 36.15  ? 78   ASP H N   1 
ATOM   10099 C  CA  . ASP H  4 78  ? 64.376  -103.885 -63.123  1.00 39.92  ? 78   ASP H CA  1 
ATOM   10100 C  C   . ASP H  4 78  ? 64.003  -102.981 -61.959  1.00 41.99  ? 78   ASP H C   1 
ATOM   10101 O  O   . ASP H  4 78  ? 64.884  -102.513 -61.246  1.00 42.21  ? 78   ASP H O   1 
ATOM   10102 C  CB  . ASP H  4 78  ? 64.364  -105.379 -62.750  1.00 42.19  ? 78   ASP H CB  1 
ATOM   10103 C  CG  . ASP H  4 78  ? 64.883  -105.662 -61.344  1.00 46.27  ? 78   ASP H CG  1 
ATOM   10104 O  OD1 . ASP H  4 78  ? 64.107  -105.491 -60.371  1.00 45.47  ? 78   ASP H OD1 1 
ATOM   10105 O  OD2 . ASP H  4 78  ? 66.065  -106.065 -61.221  1.00 46.36  ? 78   ASP H OD2 1 
ATOM   10106 N  N   . ASN H  4 79  ? 62.714  -102.709 -61.776  1.00 44.46  ? 79   ASN H N   1 
ATOM   10107 C  CA  . ASN H  4 79  ? 62.277  -101.787 -60.724  1.00 46.66  ? 79   ASN H CA  1 
ATOM   10108 C  C   . ASN H  4 79  ? 62.669  -102.077 -59.283  1.00 47.14  ? 79   ASN H C   1 
ATOM   10109 O  O   . ASN H  4 79  ? 62.346  -101.300 -58.392  1.00 49.31  ? 79   ASN H O   1 
ATOM   10110 C  CB  . ASN H  4 79  ? 60.758  -101.595 -60.779  1.00 48.95  ? 79   ASN H CB  1 
ATOM   10111 C  CG  . ASN H  4 79  ? 60.305  -100.832 -62.017  1.00 52.82  ? 79   ASN H CG  1 
ATOM   10112 O  OD1 . ASN H  4 79  ? 61.085  -100.094 -62.637  1.00 54.65  ? 79   ASN H OD1 1 
ATOM   10113 N  ND2 . ASN H  4 79  ? 59.033  -100.991 -62.372  1.00 53.18  ? 79   ASN H ND2 1 
ATOM   10114 N  N   . LYS H  4 80  ? 63.358  -103.181 -59.037  1.00 46.64  ? 80   LYS H N   1 
ATOM   10115 C  CA  . LYS H  4 80  ? 63.747  -103.520 -57.677  1.00 45.68  ? 80   LYS H CA  1 
ATOM   10116 C  C   . LYS H  4 80  ? 65.246  -103.385 -57.519  1.00 45.07  ? 80   LYS H C   1 
ATOM   10117 O  O   . LYS H  4 80  ? 65.804  -103.654 -56.456  1.00 44.17  ? 80   LYS H O   1 
ATOM   10118 C  CB  . LYS H  4 80  ? 63.332  -104.947 -57.363  1.00 47.46  ? 80   LYS H CB  1 
ATOM   10119 C  CG  . LYS H  4 80  ? 61.846  -105.167 -57.271  1.00 47.06  ? 80   LYS H CG  1 
ATOM   10120 C  CD  . LYS H  4 80  ? 61.324  -104.768 -55.912  1.00 47.74  ? 80   LYS H CD  1 
ATOM   10121 C  CE  . LYS H  4 80  ? 60.040  -105.519 -55.613  1.00 49.17  ? 80   LYS H CE  1 
ATOM   10122 N  NZ  . LYS H  4 80  ? 59.108  -105.448 -56.776  1.00 51.37  ? 80   LYS H NZ  1 
ATOM   10123 N  N   . ARG H  4 81  ? 65.892  -102.980 -58.601  1.00 44.92  ? 81   ARG H N   1 
ATOM   10124 C  CA  . ARG H  4 81  ? 67.330  -102.795 -58.608  1.00 45.35  ? 81   ARG H CA  1 
ATOM   10125 C  C   . ARG H  4 81  ? 68.090  -104.010 -58.060  1.00 43.61  ? 81   ARG H C   1 
ATOM   10126 O  O   . ARG H  4 81  ? 68.942  -103.878 -57.186  1.00 42.90  ? 81   ARG H O   1 
ATOM   10127 C  CB  . ARG H  4 81  ? 67.682  -101.528 -57.817  1.00 48.19  ? 81   ARG H CB  1 
ATOM   10128 C  CG  . ARG H  4 81  ? 67.135  -100.238 -58.433  1.00 51.21  ? 81   ARG H CG  1 
ATOM   10129 C  CD  . ARG H  4 81  ? 65.659  -99.985  -58.104  1.00 54.14  ? 81   ARG H CD  1 
ATOM   10130 N  NE  . ARG H  4 81  ? 65.039  -99.095  -59.091  1.00 58.12  ? 81   ARG H NE  1 
ATOM   10131 C  CZ  . ARG H  4 81  ? 63.881  -98.459  -58.927  1.00 58.59  ? 81   ARG H CZ  1 
ATOM   10132 N  NH1 . ARG H  4 81  ? 63.192  -98.595  -57.803  1.00 60.03  ? 81   ARG H NH1 1 
ATOM   10133 N  NH2 . ARG H  4 81  ? 63.403  -97.690  -59.896  1.00 58.70  ? 81   ARG H NH2 1 
ATOM   10134 N  N   . ARG H  4 82  ? 67.774  -105.189 -58.591  1.00 41.70  ? 82   ARG H N   1 
ATOM   10135 C  CA  . ARG H  4 82  ? 68.415  -106.427 -58.177  1.00 38.56  ? 82   ARG H CA  1 
ATOM   10136 C  C   . ARG H  4 82  ? 69.816  -106.532 -58.730  1.00 38.93  ? 82   ARG H C   1 
ATOM   10137 O  O   . ARG H  4 82  ? 70.732  -106.897 -58.007  1.00 41.29  ? 82   ARG H O   1 
ATOM   10138 C  CB  . ARG H  4 82  ? 67.619  -107.635 -58.653  1.00 38.17  ? 82   ARG H CB  1 
ATOM   10139 C  CG  . ARG H  4 82  ? 66.275  -107.798 -57.989  1.00 37.95  ? 82   ARG H CG  1 
ATOM   10140 C  CD  . ARG H  4 82  ? 65.462  -108.859 -58.689  1.00 35.17  ? 82   ARG H CD  1 
ATOM   10141 N  NE  . ARG H  4 82  ? 64.051  -108.514 -58.622  1.00 38.99  ? 82   ARG H NE  1 
ATOM   10142 C  CZ  . ARG H  4 82  ? 63.146  -108.866 -59.528  1.00 41.02  ? 82   ARG H CZ  1 
ATOM   10143 N  NH1 . ARG H  4 82  ? 63.502  -109.588 -60.588  1.00 41.30  ? 82   ARG H NH1 1 
ATOM   10144 N  NH2 . ARG H  4 82  ? 61.881  -108.486 -59.373  1.00 40.66  ? 82   ARG H NH2 1 
ATOM   10145 N  N   . ILE H  4 83  ? 69.991  -106.230 -60.012  1.00 38.34  ? 83   ILE H N   1 
ATOM   10146 C  CA  . ILE H  4 83  ? 71.316  -106.315 -60.613  1.00 37.79  ? 83   ILE H CA  1 
ATOM   10147 C  C   . ILE H  4 83  ? 72.052  -104.989 -60.576  1.00 37.54  ? 83   ILE H C   1 
ATOM   10148 O  O   . ILE H  4 83  ? 73.253  -104.959 -60.312  1.00 37.25  ? 83   ILE H O   1 
ATOM   10149 C  CB  . ILE H  4 83  ? 71.273  -106.762 -62.091  1.00 39.21  ? 83   ILE H CB  1 
ATOM   10150 C  CG1 . ILE H  4 83  ? 70.374  -107.990 -62.257  1.00 38.93  ? 83   ILE H CG1 1 
ATOM   10151 C  CG2 . ILE H  4 83  ? 72.692  -107.058 -62.573  1.00 37.49  ? 83   ILE H CG2 1 
ATOM   10152 C  CD1 . ILE H  4 83  ? 70.813  -109.171 -61.473  1.00 40.21  ? 83   ILE H CD1 1 
ATOM   10153 N  N   . LEU H  4 84  ? 71.344  -103.893 -60.851  1.00 37.60  ? 84   LEU H N   1 
ATOM   10154 C  CA  . LEU H  4 84  ? 71.983  -102.578 -60.853  1.00 36.39  ? 84   LEU H CA  1 
ATOM   10155 C  C   . LEU H  4 84  ? 71.067  -101.426 -60.484  1.00 35.44  ? 84   LEU H C   1 
ATOM   10156 O  O   . LEU H  4 84  ? 69.862  -101.588 -60.376  1.00 32.83  ? 84   LEU H O   1 
ATOM   10157 C  CB  . LEU H  4 84  ? 72.653  -102.303 -62.214  1.00 34.71  ? 84   LEU H CB  1 
ATOM   10158 C  CG  . LEU H  4 84  ? 71.871  -102.048 -63.511  1.00 35.53  ? 84   LEU H CG  1 
ATOM   10159 C  CD1 . LEU H  4 84  ? 72.833  -102.080 -64.697  1.00 32.83  ? 84   LEU H CD1 1 
ATOM   10160 C  CD2 . LEU H  4 84  ? 70.808  -103.102 -63.717  1.00 37.53  ? 84   LEU H CD2 1 
ATOM   10161 N  N   . SER H  4 85  ? 71.684  -100.272 -60.250  1.00 37.45  ? 85   SER H N   1 
ATOM   10162 C  CA  . SER H  4 85  ? 70.996  -99.037  -59.892  1.00 38.11  ? 85   SER H CA  1 
ATOM   10163 C  C   . SER H  4 85  ? 71.508  -98.051  -60.904  1.00 38.17  ? 85   SER H C   1 
ATOM   10164 O  O   . SER H  4 85  ? 72.688  -98.073  -61.260  1.00 38.02  ? 85   SER H O   1 
ATOM   10165 C  CB  . SER H  4 85  ? 71.404  -98.550  -58.505  1.00 40.61  ? 85   SER H CB  1 
ATOM   10166 O  OG  . SER H  4 85  ? 71.222  -99.550  -57.522  1.00 45.67  ? 85   SER H OG  1 
ATOM   10167 N  N   . VAL H  4 86  ? 70.635  -97.169  -61.357  1.00 38.40  ? 86   VAL H N   1 
ATOM   10168 C  CA  . VAL H  4 86  ? 71.037  -96.207  -62.362  1.00 38.77  ? 86   VAL H CA  1 
ATOM   10169 C  C   . VAL H  4 86  ? 70.929  -94.781  -61.863  1.00 38.70  ? 86   VAL H C   1 
ATOM   10170 O  O   . VAL H  4 86  ? 70.152  -94.488  -60.959  1.00 36.53  ? 86   VAL H O   1 
ATOM   10171 C  CB  . VAL H  4 86  ? 70.185  -96.409  -63.644  1.00 39.37  ? 86   VAL H CB  1 
ATOM   10172 C  CG1 . VAL H  4 86  ? 70.233  -95.173  -64.535  1.00 41.05  ? 86   VAL H CG1 1 
ATOM   10173 C  CG2 . VAL H  4 86  ? 70.698  -97.620  -64.401  1.00 39.45  ? 86   VAL H CG2 1 
ATOM   10174 N  N   . GLU H  4 87  ? 71.743  -93.904  -62.442  1.00 40.04  ? 87   GLU H N   1 
ATOM   10175 C  CA  . GLU H  4 87  ? 71.724  -92.497  -62.082  1.00 41.21  ? 87   GLU H CA  1 
ATOM   10176 C  C   . GLU H  4 87  ? 71.609  -91.664  -63.351  1.00 38.63  ? 87   GLU H C   1 
ATOM   10177 O  O   . GLU H  4 87  ? 72.262  -91.967  -64.345  1.00 39.21  ? 87   GLU H O   1 
ATOM   10178 C  CB  . GLU H  4 87  ? 72.997  -92.109  -61.330  1.00 45.07  ? 87   GLU H CB  1 
ATOM   10179 C  CG  . GLU H  4 87  ? 72.959  -90.661  -60.875  1.00 52.93  ? 87   GLU H CG  1 
ATOM   10180 C  CD  . GLU H  4 87  ? 74.119  -90.277  -59.986  1.00 57.74  ? 87   GLU H CD  1 
ATOM   10181 O  OE1 . GLU H  4 87  ? 74.148  -89.101  -59.543  1.00 60.26  ? 87   GLU H OE1 1 
ATOM   10182 O  OE2 . GLU H  4 87  ? 74.995  -91.142  -59.732  1.00 59.46  ? 87   GLU H OE2 1 
ATOM   10183 N  N   . LEU H  4 88  ? 70.790  -90.616  -63.313  1.00 34.39  ? 88   LEU H N   1 
ATOM   10184 C  CA  . LEU H  4 88  ? 70.603  -89.763  -64.478  1.00 31.39  ? 88   LEU H CA  1 
ATOM   10185 C  C   . LEU H  4 88  ? 71.861  -88.992  -64.768  1.00 29.45  ? 88   LEU H C   1 
ATOM   10186 O  O   . LEU H  4 88  ? 72.507  -88.481  -63.855  1.00 31.81  ? 88   LEU H O   1 
ATOM   10187 C  CB  . LEU H  4 88  ? 69.507  -88.716  -64.251  1.00 33.94  ? 88   LEU H CB  1 
ATOM   10188 C  CG  . LEU H  4 88  ? 68.230  -89.010  -63.472  1.00 38.77  ? 88   LEU H CG  1 
ATOM   10189 C  CD1 . LEU H  4 88  ? 68.568  -89.485  -62.032  1.00 40.90  ? 88   LEU H CD1 1 
ATOM   10190 C  CD2 . LEU H  4 88  ? 67.393  -87.742  -63.437  1.00 36.33  ? 88   LEU H CD2 1 
ATOM   10191 N  N   . PRO H  4 89  ? 72.239  -88.893  -66.042  1.00 26.57  ? 89   PRO H N   1 
ATOM   10192 C  CA  . PRO H  4 89  ? 73.444  -88.131  -66.354  1.00 26.09  ? 89   PRO H CA  1 
ATOM   10193 C  C   . PRO H  4 89  ? 73.177  -86.694  -65.903  1.00 27.40  ? 89   PRO H C   1 
ATOM   10194 O  O   . PRO H  4 89  ? 72.026  -86.273  -65.823  1.00 25.34  ? 89   PRO H O   1 
ATOM   10195 C  CB  . PRO H  4 89  ? 73.537  -88.258  -67.862  1.00 24.69  ? 89   PRO H CB  1 
ATOM   10196 C  CG  . PRO H  4 89  ? 73.026  -89.622  -68.092  1.00 25.81  ? 89   PRO H CG  1 
ATOM   10197 C  CD  . PRO H  4 89  ? 71.792  -89.661  -67.210  1.00 26.07  ? 89   PRO H CD  1 
ATOM   10198 N  N   . LYS H  4 90  ? 74.234  -85.951  -65.595  1.00 30.10  ? 90   LYS H N   1 
ATOM   10199 C  CA  . LYS H  4 90  ? 74.104  -84.576  -65.121  1.00 30.69  ? 90   LYS H CA  1 
ATOM   10200 C  C   . LYS H  4 90  ? 73.167  -83.696  -65.955  1.00 31.04  ? 90   LYS H C   1 
ATOM   10201 O  O   . LYS H  4 90  ? 72.230  -83.083  -65.420  1.00 31.32  ? 90   LYS H O   1 
ATOM   10202 C  CB  . LYS H  4 90  ? 75.486  -83.934  -65.048  1.00 32.54  ? 90   LYS H