data_2EHR
# 
_entry.id   2EHR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2EHR         pdb_00002ehr 10.2210/pdb2ehr/pdb 
RCSB  RCSB026680   ?            ?                   
WWPDB D_1000026680 ?            ?                   
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hso003006830.7 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2EHR 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-07 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Inoue, K.'                                              1 
'Hayashi, F.'                                            2 
'Yokoyama, S.'                                           3 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the sixth PDZ domain of human InaD-like protein' 
_citation.journal_abbrev            'to be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Inoue, K.'    1 ? 
primary 'Hayashi, F.'  2 ? 
primary 'Yokoyama, S.' 3 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'InaD-like protein' 
_entity.formula_weight             12328.965 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'PDZ domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Inadl protein, hINADL, Pals1-associated tight junction protein, Protein associated to tight junctions' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGPNFSHWGPPRIVEIFREPNVSLGISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTNALKTGDKILEVSG
VDLQNASHSEAVEAIKNAGNPVVFIVQSLSSTPRVIP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGPNFSHWGPPRIVEIFREPNVSLGISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTNALKTGDKILEVSG
VDLQNASHSEAVEAIKNAGNPVVFIVQSLSSTPRVIP
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hso003006830.7 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   PRO n 
1 9   ASN n 
1 10  PHE n 
1 11  SER n 
1 12  HIS n 
1 13  TRP n 
1 14  GLY n 
1 15  PRO n 
1 16  PRO n 
1 17  ARG n 
1 18  ILE n 
1 19  VAL n 
1 20  GLU n 
1 21  ILE n 
1 22  PHE n 
1 23  ARG n 
1 24  GLU n 
1 25  PRO n 
1 26  ASN n 
1 27  VAL n 
1 28  SER n 
1 29  LEU n 
1 30  GLY n 
1 31  ILE n 
1 32  SER n 
1 33  ILE n 
1 34  VAL n 
1 35  GLY n 
1 36  GLY n 
1 37  GLN n 
1 38  THR n 
1 39  VAL n 
1 40  ILE n 
1 41  LYS n 
1 42  ARG n 
1 43  LEU n 
1 44  LYS n 
1 45  ASN n 
1 46  GLY n 
1 47  GLU n 
1 48  GLU n 
1 49  LEU n 
1 50  LYS n 
1 51  GLY n 
1 52  ILE n 
1 53  PHE n 
1 54  ILE n 
1 55  LYS n 
1 56  GLN n 
1 57  VAL n 
1 58  LEU n 
1 59  GLU n 
1 60  ASP n 
1 61  SER n 
1 62  PRO n 
1 63  ALA n 
1 64  GLY n 
1 65  LYS n 
1 66  THR n 
1 67  ASN n 
1 68  ALA n 
1 69  LEU n 
1 70  LYS n 
1 71  THR n 
1 72  GLY n 
1 73  ASP n 
1 74  LYS n 
1 75  ILE n 
1 76  LEU n 
1 77  GLU n 
1 78  VAL n 
1 79  SER n 
1 80  GLY n 
1 81  VAL n 
1 82  ASP n 
1 83  LEU n 
1 84  GLN n 
1 85  ASN n 
1 86  ALA n 
1 87  SER n 
1 88  HIS n 
1 89  SER n 
1 90  GLU n 
1 91  ALA n 
1 92  VAL n 
1 93  GLU n 
1 94  ALA n 
1 95  ILE n 
1 96  LYS n 
1 97  ASN n 
1 98  ALA n 
1 99  GLY n 
1 100 ASN n 
1 101 PRO n 
1 102 VAL n 
1 103 VAL n 
1 104 PHE n 
1 105 ILE n 
1 106 VAL n 
1 107 GLN n 
1 108 SER n 
1 109 LEU n 
1 110 SER n 
1 111 SER n 
1 112 THR n 
1 113 PRO n 
1 114 ARG n 
1 115 VAL n 
1 116 ILE n 
1 117 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'INADL, PATJ' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P060313-18 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    INADL_HUMAN 
_struct_ref.pdbx_db_accession          Q8NI35 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PNFSHWGPPRIVEIFREPNVSLGISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTNALKTGDKILEVSGVDLQNAS
HSEAVEAIKNAGNPVVFIVQSLSSTPRVIP
;
_struct_ref.pdbx_align_begin           1058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2EHR 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 117 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8NI35 
_struct_ref_seq.db_align_beg                  1058 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1167 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       117 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2EHR GLY A 1 ? UNP Q8NI35 ? ? 'expression tag' 1 1 
1 2EHR SER A 2 ? UNP Q8NI35 ? ? 'expression tag' 2 2 
1 2EHR SER A 3 ? UNP Q8NI35 ? ? 'expression tag' 3 3 
1 2EHR GLY A 4 ? UNP Q8NI35 ? ? 'expression tag' 4 4 
1 2EHR SER A 5 ? UNP Q8NI35 ? ? 'expression tag' 5 5 
1 2EHR SER A 6 ? UNP Q8NI35 ? ? 'expression tag' 6 6 
1 2EHR GLY A 7 ? UNP Q8NI35 ? ? 'expression tag' 7 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.19mM U-15N, 13C-labeled protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2EHR 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2EHR 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations, structures with the lowest energy, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2EHR 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1C     Varian          1 
processing           NMRPipe 20060324 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      KUJIRA  0.9807   'Kobayashi, N.' 4 
'structure solution' CYANA   2.1      'Guntert, P.'   5 
refinement           CYANA   2.1      'Guntert, P.'   6 
# 
_exptl.entry_id          2EHR 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2EHR 
_struct.title                     'Solution structure of the sixth PDZ domain of human InaD-like protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2EHR 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
_struct_keywords.text            
;PDZ domain, InaD-like protein, Inadl protein, hINADL, Pals1-associated tight junction protein, Protein associated to tight junctions, INADL, PATJ, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       SER 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        87 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ASN 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        97 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        SER 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         87 
_struct_conf.end_auth_comp_id        ASN 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         97 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 1  0.06  
2  ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 2  -0.02 
3  ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 3  -0.04 
4  ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 4  -0.07 
5  ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 5  -0.01 
6  ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 6  -0.09 
7  ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 7  -0.09 
8  ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 8  -0.06 
9  ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 9  -0.07 
10 ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 10 -0.11 
11 ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 11 -0.09 
12 ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 12 -0.15 
13 ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 13 0.00  
14 ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 14 -0.09 
15 ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 15 -0.04 
16 ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 16 -0.07 
17 ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 17 -0.06 
18 ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 18 -0.07 
19 ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 19 -0.03 
20 ASN 100 A . ? ASN 100 A PRO 101 A ? PRO 101 A 20 -0.02 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 17  ? ILE A 21  ? ARG A 17  ILE A 21  
A 2 VAL A 102 ? VAL A 106 ? VAL A 102 VAL A 106 
A 3 LYS A 74  ? VAL A 78  ? LYS A 74  VAL A 78  
A 4 ILE A 52  ? VAL A 57  ? ILE A 52  VAL A 57  
A 5 ILE A 31  ? ILE A 33  ? ILE A 31  ILE A 33  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 21  ? N ILE A 21  O VAL A 102 ? O VAL A 102 
A 2 3 O ILE A 105 ? O ILE A 105 N GLU A 77  ? N GLU A 77  
A 3 4 O ILE A 75  ? O ILE A 75  N ILE A 52  ? N ILE A 52  
A 4 5 O LYS A 55  ? O LYS A 55  N SER A 32  ? N SER A 32  
# 
_database_PDB_matrix.entry_id          2EHR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2EHR 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 0.270   -33.483 -11.416 1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 0.739   -32.372 -10.608 1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 2.185   -32.018 -10.893 1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 2.999   -31.917 -9.975  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -0.399  -34.101 -11.054 1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 0.121   -31.510 -10.808 1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 0.644   -32.636 -9.565  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 2.506   -31.829 -12.169 1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 3.865   -31.489 -12.573 1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 4.418   -30.353 -11.718 1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 5.632   -30.183 -11.600 1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 3.897   -31.093 -14.050 1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 4.062   -32.230 -14.880 1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 1.812   -31.923 -12.855 1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 4.482   -32.364 -12.430 1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 2.970   -30.604 -14.309 1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 4.721   -30.415 -14.220 1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 3.572   -32.104 -15.696 1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 3.518   -29.577 -11.123 1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 3.914   -28.453 -10.281 1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 3.361   -28.612 -8.868  1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 4.045   -28.328 -7.886  1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 3.425   -27.137 -10.888 1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 3.732   -26.041 -10.043 1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 2.565   -29.762 -11.255 1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 4.993   -28.439 -10.234 1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 3.903   -26.984 -11.843 1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 2.354   -27.183 -11.024 1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 3.478   -25.222 -10.476 1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 2.115   -29.068 -8.774  1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 1.490   -29.256 -7.478  1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 0.763   -28.015 -7.000  1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 1.122   -26.897 -7.367  1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 1.617   -29.278 -9.592  1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 0.785   -30.071 -7.546  1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 2.253   -29.513 -6.758  1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? -0.264  -28.213 -6.179  1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? -1.048  -27.101 -5.654  1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? -1.424  -27.343 -4.195  1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? -1.819  -28.446 -3.819  1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? -2.312  -26.899 -6.492  1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? -3.009  -25.733 -6.091  1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? -0.502  -29.129 -5.923  1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? -0.440  -26.210 -5.714  1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? -2.039  -26.802 -7.532  1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? -2.962  -27.753 -6.368  1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? -2.402  -24.989 -6.068  1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -1.298  -26.302 -3.378  1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -1.621  -26.401 -1.959  1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? -2.393  -25.172 -1.491  1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? -1.842  -24.075 -1.405  1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -0.343  -26.560 -1.133  1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 0.555   -25.490 -1.372  1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -0.977  -25.449 -3.737  1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? -2.240  -27.275 -1.820  1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -0.594  -26.576 -0.084  1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 0.143   -27.488 -1.401  1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 0.082   -24.760 -1.780  1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? -3.673  -25.364 -1.189  1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? -4.502  -24.263 -0.733  1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? -5.978  -24.512 -0.969  1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? -6.575  -23.986 -1.909  1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? -4.059  -26.261 -1.276  1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? -4.336  -24.116 0.324   1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? -4.211  -23.367 -1.260  1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . PRO A 1 8   ? -6.590  -25.332 -0.103  1.00 0.00 ? 8   PRO A N    1  
ATOM 67    C CA   . PRO A 1 8   ? -8.013  -25.669 -0.202  1.00 0.00 ? 8   PRO A CA   1  
ATOM 68    C C    . PRO A 1 8   ? -8.914  -24.485 0.132   1.00 0.00 ? 8   PRO A C    1  
ATOM 69    O O    . PRO A 1 8   ? -9.563  -24.462 1.177   1.00 0.00 ? 8   PRO A O    1  
ATOM 70    C CB   . PRO A 1 8   ? -8.187  -26.782 0.834   1.00 0.00 ? 8   PRO A CB   1  
ATOM 71    C CG   . PRO A 1 8   ? -7.096  -26.554 1.823   1.00 0.00 ? 8   PRO A CG   1  
ATOM 72    C CD   . PRO A 1 8   ? -5.940  -25.994 1.041   1.00 0.00 ? 8   PRO A CD   1  
ATOM 73    H HA   . PRO A 1 8   ? -8.265  -26.046 -1.183  1.00 0.00 ? 8   PRO A HA   1  
ATOM 74    H HB2  . PRO A 1 8   ? -9.162  -26.700 1.294   1.00 0.00 ? 8   PRO A HB2  1  
ATOM 75    H HB3  . PRO A 1 8   ? -8.090  -27.744 0.354   1.00 0.00 ? 8   PRO A HB3  1  
ATOM 76    H HG2  . PRO A 1 8   ? -7.421  -25.847 2.571   1.00 0.00 ? 8   PRO A HG2  1  
ATOM 77    H HG3  . PRO A 1 8   ? -6.818  -27.490 2.284   1.00 0.00 ? 8   PRO A HG3  1  
ATOM 78    H HD2  . PRO A 1 8   ? -5.391  -25.281 1.638   1.00 0.00 ? 8   PRO A HD2  1  
ATOM 79    H HD3  . PRO A 1 8   ? -5.290  -26.789 0.707   1.00 0.00 ? 8   PRO A HD3  1  
ATOM 80    N N    . ASN A 1 9   ? -8.948  -23.503 -0.763  1.00 0.00 ? 9   ASN A N    1  
ATOM 81    C CA   . ASN A 1 9   ? -9.770  -22.314 -0.562  1.00 0.00 ? 9   ASN A CA   1  
ATOM 82    C C    . ASN A 1 9   ? -9.282  -21.512 0.641   1.00 0.00 ? 9   ASN A C    1  
ATOM 83    O O    . ASN A 1 9   ? -10.078 -21.066 1.467   1.00 0.00 ? 9   ASN A O    1  
ATOM 84    C CB   . ASN A 1 9   ? -11.235 -22.710 -0.365  1.00 0.00 ? 9   ASN A CB   1  
ATOM 85    C CG   . ASN A 1 9   ? -12.188 -21.575 -0.688  1.00 0.00 ? 9   ASN A CG   1  
ATOM 86    O OD1  . ASN A 1 9   ? -12.150 -20.519 -0.056  1.00 0.00 ? 9   ASN A OD1  1  
ATOM 87    N ND2  . ASN A 1 9   ? -13.050 -21.788 -1.675  1.00 0.00 ? 9   ASN A ND2  1  
ATOM 88    H H    . ASN A 1 9   ? -8.408  -23.578 -1.577  1.00 0.00 ? 9   ASN A H    1  
ATOM 89    H HA   . ASN A 1 9   ? -9.688  -21.701 -1.446  1.00 0.00 ? 9   ASN A HA   1  
ATOM 90    H HB2  . ASN A 1 9   ? -11.467 -23.543 -1.012  1.00 0.00 ? 9   ASN A HB2  1  
ATOM 91    H HB3  . ASN A 1 9   ? -11.388 -23.003 0.662   1.00 0.00 ? 9   ASN A HB3  1  
ATOM 92    H HD21 . ASN A 1 9   ? -13.023 -22.654 -2.134  1.00 0.00 ? 9   ASN A HD21 1  
ATOM 93    H HD22 . ASN A 1 9   ? -13.677 -21.071 -1.905  1.00 0.00 ? 9   ASN A HD22 1  
ATOM 94    N N    . PHE A 1 10  ? -7.969  -21.333 0.732   1.00 0.00 ? 10  PHE A N    1  
ATOM 95    C CA   . PHE A 1 10  ? -7.374  -20.585 1.833   1.00 0.00 ? 10  PHE A CA   1  
ATOM 96    C C    . PHE A 1 10  ? -6.655  -19.340 1.320   1.00 0.00 ? 10  PHE A C    1  
ATOM 97    O O    . PHE A 1 10  ? -5.678  -19.436 0.578   1.00 0.00 ? 10  PHE A O    1  
ATOM 98    C CB   . PHE A 1 10  ? -6.395  -21.469 2.608   1.00 0.00 ? 10  PHE A CB   1  
ATOM 99    C CG   . PHE A 1 10  ? -6.246  -21.077 4.051   1.00 0.00 ? 10  PHE A CG   1  
ATOM 100   C CD1  . PHE A 1 10  ? -7.353  -21.007 4.881   1.00 0.00 ? 10  PHE A CD1  1  
ATOM 101   C CD2  . PHE A 1 10  ? -4.999  -20.778 4.576   1.00 0.00 ? 10  PHE A CD2  1  
ATOM 102   C CE1  . PHE A 1 10  ? -7.219  -20.646 6.209   1.00 0.00 ? 10  PHE A CE1  1  
ATOM 103   C CE2  . PHE A 1 10  ? -4.859  -20.418 5.902   1.00 0.00 ? 10  PHE A CE2  1  
ATOM 104   C CZ   . PHE A 1 10  ? -5.971  -20.351 6.720   1.00 0.00 ? 10  PHE A CZ   1  
ATOM 105   H H    . PHE A 1 10  ? -7.385  -21.713 0.042   1.00 0.00 ? 10  PHE A H    1  
ATOM 106   H HA   . PHE A 1 10  ? -8.171  -20.279 2.494   1.00 0.00 ? 10  PHE A HA   1  
ATOM 107   H HB2  . PHE A 1 10  ? -6.742  -22.491 2.577   1.00 0.00 ? 10  PHE A HB2  1  
ATOM 108   H HB3  . PHE A 1 10  ? -5.422  -21.409 2.144   1.00 0.00 ? 10  PHE A HB3  1  
ATOM 109   H HD1  . PHE A 1 10  ? -8.331  -21.238 4.482   1.00 0.00 ? 10  PHE A HD1  1  
ATOM 110   H HD2  . PHE A 1 10  ? -4.129  -20.829 3.937   1.00 0.00 ? 10  PHE A HD2  1  
ATOM 111   H HE1  . PHE A 1 10  ? -8.090  -20.595 6.845   1.00 0.00 ? 10  PHE A HE1  1  
ATOM 112   H HE2  . PHE A 1 10  ? -3.882  -20.187 6.300   1.00 0.00 ? 10  PHE A HE2  1  
ATOM 113   H HZ   . PHE A 1 10  ? -5.864  -20.070 7.757   1.00 0.00 ? 10  PHE A HZ   1  
ATOM 114   N N    . SER A 1 11  ? -7.148  -18.172 1.720   1.00 0.00 ? 11  SER A N    1  
ATOM 115   C CA   . SER A 1 11  ? -6.557  -16.908 1.298   1.00 0.00 ? 11  SER A CA   1  
ATOM 116   C C    . SER A 1 11  ? -6.387  -16.867 -0.218  1.00 0.00 ? 11  SER A C    1  
ATOM 117   O O    . SER A 1 11  ? -5.339  -16.467 -0.726  1.00 0.00 ? 11  SER A O    1  
ATOM 118   C CB   . SER A 1 11  ? -5.204  -16.701 1.980   1.00 0.00 ? 11  SER A CB   1  
ATOM 119   O OG   . SER A 1 11  ? -4.788  -15.349 1.889   1.00 0.00 ? 11  SER A OG   1  
ATOM 120   H H    . SER A 1 11  ? -7.930  -18.161 2.311   1.00 0.00 ? 11  SER A H    1  
ATOM 121   H HA   . SER A 1 11  ? -7.226  -16.114 1.595   1.00 0.00 ? 11  SER A HA   1  
ATOM 122   H HB2  . SER A 1 11  ? -5.284  -16.970 3.022   1.00 0.00 ? 11  SER A HB2  1  
ATOM 123   H HB3  . SER A 1 11  ? -4.463  -17.326 1.502   1.00 0.00 ? 11  SER A HB3  1  
ATOM 124   H HG   . SER A 1 11  ? -3.944  -15.242 2.334   1.00 0.00 ? 11  SER A HG   1  
ATOM 125   N N    . HIS A 1 12  ? -7.425  -17.285 -0.935  1.00 0.00 ? 12  HIS A N    1  
ATOM 126   C CA   . HIS A 1 12  ? -7.392  -17.296 -2.393  1.00 0.00 ? 12  HIS A CA   1  
ATOM 127   C C    . HIS A 1 12  ? -7.331  -15.876 -2.946  1.00 0.00 ? 12  HIS A C    1  
ATOM 128   O O    . HIS A 1 12  ? -8.317  -15.140 -2.905  1.00 0.00 ? 12  HIS A O    1  
ATOM 129   C CB   . HIS A 1 12  ? -8.621  -18.019 -2.947  1.00 0.00 ? 12  HIS A CB   1  
ATOM 130   C CG   . HIS A 1 12  ? -8.405  -18.614 -4.304  1.00 0.00 ? 12  HIS A CG   1  
ATOM 131   N ND1  . HIS A 1 12  ? -8.322  -19.972 -4.526  1.00 0.00 ? 12  HIS A ND1  1  
ATOM 132   C CD2  . HIS A 1 12  ? -8.256  -18.027 -5.515  1.00 0.00 ? 12  HIS A CD2  1  
ATOM 133   C CE1  . HIS A 1 12  ? -8.130  -20.195 -5.814  1.00 0.00 ? 12  HIS A CE1  1  
ATOM 134   N NE2  . HIS A 1 12  ? -8.086  -19.031 -6.436  1.00 0.00 ? 12  HIS A NE2  1  
ATOM 135   H H    . HIS A 1 12  ? -8.232  -17.593 -0.473  1.00 0.00 ? 12  HIS A H    1  
ATOM 136   H HA   . HIS A 1 12  ? -6.504  -17.827 -2.701  1.00 0.00 ? 12  HIS A HA   1  
ATOM 137   H HB2  . HIS A 1 12  ? -8.893  -18.819 -2.274  1.00 0.00 ? 12  HIS A HB2  1  
ATOM 138   H HB3  . HIS A 1 12  ? -9.441  -17.319 -3.017  1.00 0.00 ? 12  HIS A HB3  1  
ATOM 139   H HD1  . HIS A 1 12  ? -8.392  -20.669 -3.841  1.00 0.00 ? 12  HIS A HD1  1  
ATOM 140   H HD2  . HIS A 1 12  ? -8.268  -16.965 -5.719  1.00 0.00 ? 12  HIS A HD2  1  
ATOM 141   H HE1  . HIS A 1 12  ? -8.026  -21.164 -6.279  1.00 0.00 ? 12  HIS A HE1  1  
ATOM 142   N N    . TRP A 1 13  ? -6.167  -15.497 -3.462  1.00 0.00 ? 13  TRP A N    1  
ATOM 143   C CA   . TRP A 1 13  ? -5.977  -14.164 -4.022  1.00 0.00 ? 13  TRP A CA   1  
ATOM 144   C C    . TRP A 1 13  ? -6.359  -14.134 -5.498  1.00 0.00 ? 13  TRP A C    1  
ATOM 145   O O    . TRP A 1 13  ? -5.655  -14.687 -6.342  1.00 0.00 ? 13  TRP A O    1  
ATOM 146   C CB   . TRP A 1 13  ? -4.525  -13.717 -3.849  1.00 0.00 ? 13  TRP A CB   1  
ATOM 147   C CG   . TRP A 1 13  ? -4.082  -13.676 -2.417  1.00 0.00 ? 13  TRP A CG   1  
ATOM 148   C CD1  . TRP A 1 13  ? -3.703  -14.737 -1.646  1.00 0.00 ? 13  TRP A CD1  1  
ATOM 149   C CD2  . TRP A 1 13  ? -3.977  -12.515 -1.586  1.00 0.00 ? 13  TRP A CD2  1  
ATOM 150   N NE1  . TRP A 1 13  ? -3.367  -14.306 -0.386  1.00 0.00 ? 13  TRP A NE1  1  
ATOM 151   C CE2  . TRP A 1 13  ? -3.526  -12.947 -0.323  1.00 0.00 ? 13  TRP A CE2  1  
ATOM 152   C CE3  . TRP A 1 13  ? -4.217  -11.153 -1.786  1.00 0.00 ? 13  TRP A CE3  1  
ATOM 153   C CZ2  . TRP A 1 13  ? -3.312  -12.064 0.732   1.00 0.00 ? 13  TRP A CZ2  1  
ATOM 154   C CZ3  . TRP A 1 13  ? -4.005  -10.279 -0.737  1.00 0.00 ? 13  TRP A CZ3  1  
ATOM 155   C CH2  . TRP A 1 13  ? -3.555  -10.736 0.509   1.00 0.00 ? 13  TRP A CH2  1  
ATOM 156   H H    . TRP A 1 13  ? -5.417  -16.128 -3.466  1.00 0.00 ? 13  TRP A H    1  
ATOM 157   H HA   . TRP A 1 13  ? -6.620  -13.484 -3.483  1.00 0.00 ? 13  TRP A HA   1  
ATOM 158   H HB2  . TRP A 1 13  ? -3.879  -14.401 -4.378  1.00 0.00 ? 13  TRP A HB2  1  
ATOM 159   H HB3  . TRP A 1 13  ? -4.409  -12.726 -4.263  1.00 0.00 ? 13  TRP A HB3  1  
ATOM 160   H HD1  . TRP A 1 13  ? -3.677  -15.760 -1.990  1.00 0.00 ? 13  TRP A HD1  1  
ATOM 161   H HE1  . TRP A 1 13  ? -3.062  -14.879 0.349   1.00 0.00 ? 13  TRP A HE1  1  
ATOM 162   H HE3  . TRP A 1 13  ? -4.563  -10.781 -2.739  1.00 0.00 ? 13  TRP A HE3  1  
ATOM 163   H HZ2  . TRP A 1 13  ? -2.965  -12.402 1.698   1.00 0.00 ? 13  TRP A HZ2  1  
ATOM 164   H HZ3  . TRP A 1 13  ? -4.185  -9.222  -0.873  1.00 0.00 ? 13  TRP A HZ3  1  
ATOM 165   H HH2  . TRP A 1 13  ? -3.404  -10.018 1.299   1.00 0.00 ? 13  TRP A HH2  1  
ATOM 166   N N    . GLY A 1 14  ? -7.478  -13.484 -5.803  1.00 0.00 ? 14  GLY A N    1  
ATOM 167   C CA   . GLY A 1 14  ? -7.933  -13.395 -7.178  1.00 0.00 ? 14  GLY A CA   1  
ATOM 168   C C    . GLY A 1 14  ? -6.998  -12.576 -8.046  1.00 0.00 ? 14  GLY A C    1  
ATOM 169   O O    . GLY A 1 14  ? -5.844  -12.331 -7.693  1.00 0.00 ? 14  GLY A O    1  
ATOM 170   H H    . GLY A 1 14  ? -7.999  -13.062 -5.088  1.00 0.00 ? 14  GLY A H    1  
ATOM 171   H HA2  . GLY A 1 14  ? -8.006  -14.392 -7.587  1.00 0.00 ? 14  GLY A HA2  1  
ATOM 172   H HA3  . GLY A 1 14  ? -8.911  -12.938 -7.193  1.00 0.00 ? 14  GLY A HA3  1  
ATOM 173   N N    . PRO A 1 15  ? -7.497  -12.139 -9.212  1.00 0.00 ? 15  PRO A N    1  
ATOM 174   C CA   . PRO A 1 15  ? -6.715  -11.338 -10.157 1.00 0.00 ? 15  PRO A CA   1  
ATOM 175   C C    . PRO A 1 15  ? -6.440  -9.931  -9.636  1.00 0.00 ? 15  PRO A C    1  
ATOM 176   O O    . PRO A 1 15  ? -7.126  -9.428  -8.746  1.00 0.00 ? 15  PRO A O    1  
ATOM 177   C CB   . PRO A 1 15  ? -7.607  -11.282 -11.399 1.00 0.00 ? 15  PRO A CB   1  
ATOM 178   C CG   . PRO A 1 15  ? -8.990  -11.476 -10.881 1.00 0.00 ? 15  PRO A CG   1  
ATOM 179   C CD   . PRO A 1 15  ? -8.864  -12.394 -9.697  1.00 0.00 ? 15  PRO A CD   1  
ATOM 180   H HA   . PRO A 1 15  ? -5.779  -11.818 -10.406 1.00 0.00 ? 15  PRO A HA   1  
ATOM 181   H HB2  . PRO A 1 15  ? -7.497  -10.322 -11.883 1.00 0.00 ? 15  PRO A HB2  1  
ATOM 182   H HB3  . PRO A 1 15  ? -7.329  -12.070 -12.083 1.00 0.00 ? 15  PRO A HB3  1  
ATOM 183   H HG2  . PRO A 1 15  ? -9.405  -10.527 -10.577 1.00 0.00 ? 15  PRO A HG2  1  
ATOM 184   H HG3  . PRO A 1 15  ? -9.608  -11.929 -11.642 1.00 0.00 ? 15  PRO A HG3  1  
ATOM 185   H HD2  . PRO A 1 15  ? -9.594  -12.140 -8.943  1.00 0.00 ? 15  PRO A HD2  1  
ATOM 186   H HD3  . PRO A 1 15  ? -8.978  -13.423 -10.004 1.00 0.00 ? 15  PRO A HD3  1  
ATOM 187   N N    . PRO A 1 16  ? -5.412  -9.280  -10.202 1.00 0.00 ? 16  PRO A N    1  
ATOM 188   C CA   . PRO A 1 16  ? -5.024  -7.922  -9.810  1.00 0.00 ? 16  PRO A CA   1  
ATOM 189   C C    . PRO A 1 16  ? -6.050  -6.879  -10.240 1.00 0.00 ? 16  PRO A C    1  
ATOM 190   O O    . PRO A 1 16  ? -6.924  -7.156  -11.061 1.00 0.00 ? 16  PRO A O    1  
ATOM 191   C CB   . PRO A 1 16  ? -3.700  -7.705  -10.546 1.00 0.00 ? 16  PRO A CB   1  
ATOM 192   C CG   . PRO A 1 16  ? -3.765  -8.620  -11.720 1.00 0.00 ? 16  PRO A CG   1  
ATOM 193   C CD   . PRO A 1 16  ? -4.552  -9.819  -11.268 1.00 0.00 ? 16  PRO A CD   1  
ATOM 194   H HA   . PRO A 1 16  ? -4.862  -7.848  -8.744  1.00 0.00 ? 16  PRO A HA   1  
ATOM 195   H HB2  . PRO A 1 16  ? -3.621  -6.671  -10.853 1.00 0.00 ? 16  PRO A HB2  1  
ATOM 196   H HB3  . PRO A 1 16  ? -2.876  -7.957  -9.895  1.00 0.00 ? 16  PRO A HB3  1  
ATOM 197   H HG2  . PRO A 1 16  ? -4.268  -8.129  -12.540 1.00 0.00 ? 16  PRO A HG2  1  
ATOM 198   H HG3  . PRO A 1 16  ? -2.768  -8.914  -12.012 1.00 0.00 ? 16  PRO A HG3  1  
ATOM 199   H HD2  . PRO A 1 16  ? -5.144  -10.211 -12.081 1.00 0.00 ? 16  PRO A HD2  1  
ATOM 200   H HD3  . PRO A 1 16  ? -3.890  -10.579 -10.880 1.00 0.00 ? 16  PRO A HD3  1  
ATOM 201   N N    . ARG A 1 17  ? -5.937  -5.679  -9.680  1.00 0.00 ? 17  ARG A N    1  
ATOM 202   C CA   . ARG A 1 17  ? -6.856  -4.594  -10.005 1.00 0.00 ? 17  ARG A CA   1  
ATOM 203   C C    . ARG A 1 17  ? -6.116  -3.263  -10.094 1.00 0.00 ? 17  ARG A C    1  
ATOM 204   O O    . ARG A 1 17  ? -5.338  -2.914  -9.205  1.00 0.00 ? 17  ARG A O    1  
ATOM 205   C CB   . ARG A 1 17  ? -7.965  -4.505  -8.955  1.00 0.00 ? 17  ARG A CB   1  
ATOM 206   C CG   . ARG A 1 17  ? -7.492  -4.806  -7.543  1.00 0.00 ? 17  ARG A CG   1  
ATOM 207   C CD   . ARG A 1 17  ? -8.517  -4.370  -6.507  1.00 0.00 ? 17  ARG A CD   1  
ATOM 208   N NE   . ARG A 1 17  ? -9.881  -4.688  -6.920  1.00 0.00 ? 17  ARG A NE   1  
ATOM 209   C CZ   . ARG A 1 17  ? -10.353 -5.927  -7.008  1.00 0.00 ? 17  ARG A CZ   1  
ATOM 210   N NH1  . ARG A 1 17  ? -9.574  -6.959  -6.713  1.00 0.00 ? 17  ARG A NH1  1  
ATOM 211   N NH2  . ARG A 1 17  ? -11.606 -6.136  -7.391  1.00 0.00 ? 17  ARG A NH2  1  
ATOM 212   H H    . ARG A 1 17  ? -5.220  -5.519  -9.032  1.00 0.00 ? 17  ARG A H    1  
ATOM 213   H HA   . ARG A 1 17  ? -7.298  -4.811  -10.966 1.00 0.00 ? 17  ARG A HA   1  
ATOM 214   H HB2  . ARG A 1 17  ? -8.377  -3.506  -8.968  1.00 0.00 ? 17  ARG A HB2  1  
ATOM 215   H HB3  . ARG A 1 17  ? -8.742  -5.209  -9.209  1.00 0.00 ? 17  ARG A HB3  1  
ATOM 216   H HG2  . ARG A 1 17  ? -7.329  -5.869  -7.446  1.00 0.00 ? 17  ARG A HG2  1  
ATOM 217   H HG3  . ARG A 1 17  ? -6.566  -4.280  -7.363  1.00 0.00 ? 17  ARG A HG3  1  
ATOM 218   H HD2  . ARG A 1 17  ? -8.306  -4.875  -5.576  1.00 0.00 ? 17  ARG A HD2  1  
ATOM 219   H HD3  . ARG A 1 17  ? -8.433  -3.303  -6.365  1.00 0.00 ? 17  ARG A HD3  1  
ATOM 220   H HE   . ARG A 1 17  ? -10.474 -3.941  -7.143  1.00 0.00 ? 17  ARG A HE   1  
ATOM 221   H HH11 . ARG A 1 17  ? -8.629  -6.804  -6.423  1.00 0.00 ? 17  ARG A HH11 1  
ATOM 222   H HH12 . ARG A 1 17  ? -9.931  -7.890  -6.779  1.00 0.00 ? 17  ARG A HH12 1  
ATOM 223   H HH21 . ARG A 1 17  ? -12.196 -5.361  -7.614  1.00 0.00 ? 17  ARG A HH21 1  
ATOM 224   H HH22 . ARG A 1 17  ? -11.959 -7.068  -7.457  1.00 0.00 ? 17  ARG A HH22 1  
ATOM 225   N N    . ILE A 1 18  ? -6.363  -2.525  -11.171 1.00 0.00 ? 18  ILE A N    1  
ATOM 226   C CA   . ILE A 1 18  ? -5.721  -1.233  -11.375 1.00 0.00 ? 18  ILE A CA   1  
ATOM 227   C C    . ILE A 1 18  ? -6.653  -0.089  -10.991 1.00 0.00 ? 18  ILE A C    1  
ATOM 228   O O    . ILE A 1 18  ? -7.811  -0.050  -11.408 1.00 0.00 ? 18  ILE A O    1  
ATOM 229   C CB   . ILE A 1 18  ? -5.277  -1.049  -12.838 1.00 0.00 ? 18  ILE A CB   1  
ATOM 230   C CG1  . ILE A 1 18  ? -4.015  -1.868  -13.118 1.00 0.00 ? 18  ILE A CG1  1  
ATOM 231   C CG2  . ILE A 1 18  ? -5.037  0.423   -13.139 1.00 0.00 ? 18  ILE A CG2  1  
ATOM 232   C CD1  . ILE A 1 18  ? -3.569  -1.817  -14.563 1.00 0.00 ? 18  ILE A CD1  1  
ATOM 233   H H    . ILE A 1 18  ? -6.993  -2.857  -11.844 1.00 0.00 ? 18  ILE A H    1  
ATOM 234   H HA   . ILE A 1 18  ? -4.843  -1.194  -10.746 1.00 0.00 ? 18  ILE A HA   1  
ATOM 235   H HB   . ILE A 1 18  ? -6.073  -1.398  -13.479 1.00 0.00 ? 18  ILE A HB   1  
ATOM 236   H HG12 . ILE A 1 18  ? -3.208  -1.493  -12.509 1.00 0.00 ? 18  ILE A HG12 1  
ATOM 237   H HG13 . ILE A 1 18  ? -4.202  -2.901  -12.864 1.00 0.00 ? 18  ILE A HG13 1  
ATOM 238   H HG21 . ILE A 1 18  ? -5.933  0.855   -13.560 1.00 0.00 ? 18  ILE A HG21 1  
ATOM 239   H HG22 . ILE A 1 18  ? -4.785  0.940   -12.225 1.00 0.00 ? 18  ILE A HG22 1  
ATOM 240   H HG23 . ILE A 1 18  ? -4.225  0.519   -13.843 1.00 0.00 ? 18  ILE A HG23 1  
ATOM 241   H HD11 . ILE A 1 18  ? -3.454  -2.823  -14.939 1.00 0.00 ? 18  ILE A HD11 1  
ATOM 242   H HD12 . ILE A 1 18  ? -4.311  -1.297  -15.151 1.00 0.00 ? 18  ILE A HD12 1  
ATOM 243   H HD13 . ILE A 1 18  ? -2.626  -1.297  -14.631 1.00 0.00 ? 18  ILE A HD13 1  
ATOM 244   N N    . VAL A 1 19  ? -6.140  0.844   -10.194 1.00 0.00 ? 19  VAL A N    1  
ATOM 245   C CA   . VAL A 1 19  ? -6.925  1.991   -9.756  1.00 0.00 ? 19  VAL A CA   1  
ATOM 246   C C    . VAL A 1 19  ? -6.087  3.265   -9.760  1.00 0.00 ? 19  VAL A C    1  
ATOM 247   O O    . VAL A 1 19  ? -5.018  3.317   -9.153  1.00 0.00 ? 19  VAL A O    1  
ATOM 248   C CB   . VAL A 1 19  ? -7.499  1.772   -8.343  1.00 0.00 ? 19  VAL A CB   1  
ATOM 249   C CG1  . VAL A 1 19  ? -8.451  2.899   -7.973  1.00 0.00 ? 19  VAL A CG1  1  
ATOM 250   C CG2  . VAL A 1 19  ? -8.196  0.423   -8.255  1.00 0.00 ? 19  VAL A CG2  1  
ATOM 251   H H    . VAL A 1 19  ? -5.210  0.758   -9.895  1.00 0.00 ? 19  VAL A H    1  
ATOM 252   H HA   . VAL A 1 19  ? -7.750  2.113   -10.442 1.00 0.00 ? 19  VAL A HA   1  
ATOM 253   H HB   . VAL A 1 19  ? -6.679  1.777   -7.639  1.00 0.00 ? 19  VAL A HB   1  
ATOM 254   H HG11 . VAL A 1 19  ? -9.286  2.904   -8.658  1.00 0.00 ? 19  VAL A HG11 1  
ATOM 255   H HG12 . VAL A 1 19  ? -8.811  2.750   -6.965  1.00 0.00 ? 19  VAL A HG12 1  
ATOM 256   H HG13 . VAL A 1 19  ? -7.931  3.844   -8.034  1.00 0.00 ? 19  VAL A HG13 1  
ATOM 257   H HG21 . VAL A 1 19  ? -9.212  0.519   -8.607  1.00 0.00 ? 19  VAL A HG21 1  
ATOM 258   H HG22 . VAL A 1 19  ? -7.669  -0.294  -8.866  1.00 0.00 ? 19  VAL A HG22 1  
ATOM 259   H HG23 . VAL A 1 19  ? -8.201  0.086   -7.229  1.00 0.00 ? 19  VAL A HG23 1  
ATOM 260   N N    . GLU A 1 20  ? -6.580  4.289   -10.449 1.00 0.00 ? 20  GLU A N    1  
ATOM 261   C CA   . GLU A 1 20  ? -5.875  5.563   -10.532 1.00 0.00 ? 20  GLU A CA   1  
ATOM 262   C C    . GLU A 1 20  ? -6.253  6.471   -9.365  1.00 0.00 ? 20  GLU A C    1  
ATOM 263   O O    . GLU A 1 20  ? -7.420  6.826   -9.194  1.00 0.00 ? 20  GLU A O    1  
ATOM 264   C CB   . GLU A 1 20  ? -6.190  6.260   -11.858 1.00 0.00 ? 20  GLU A CB   1  
ATOM 265   C CG   . GLU A 1 20  ? -5.225  5.904   -12.976 1.00 0.00 ? 20  GLU A CG   1  
ATOM 266   C CD   . GLU A 1 20  ? -5.879  5.940   -14.344 1.00 0.00 ? 20  GLU A CD   1  
ATOM 267   O OE1  . GLU A 1 20  ? -6.718  6.836   -14.577 1.00 0.00 ? 20  GLU A OE1  1  
ATOM 268   O OE2  . GLU A 1 20  ? -5.553  5.073   -15.181 1.00 0.00 ? 20  GLU A OE2  1  
ATOM 269   H H    . GLU A 1 20  ? -7.438  4.186   -10.912 1.00 0.00 ? 20  GLU A H    1  
ATOM 270   H HA   . GLU A 1 20  ? -4.816  5.360   -10.486 1.00 0.00 ? 20  GLU A HA   1  
ATOM 271   H HB2  . GLU A 1 20  ? -7.187  5.983   -12.168 1.00 0.00 ? 20  GLU A HB2  1  
ATOM 272   H HB3  . GLU A 1 20  ? -6.154  7.328   -11.706 1.00 0.00 ? 20  GLU A HB3  1  
ATOM 273   H HG2  . GLU A 1 20  ? -4.408  6.609   -12.967 1.00 0.00 ? 20  GLU A HG2  1  
ATOM 274   H HG3  . GLU A 1 20  ? -4.843  4.909   -12.802 1.00 0.00 ? 20  GLU A HG3  1  
ATOM 275   N N    . ILE A 1 21  ? -5.259  6.843   -8.566  1.00 0.00 ? 21  ILE A N    1  
ATOM 276   C CA   . ILE A 1 21  ? -5.486  7.709   -7.417  1.00 0.00 ? 21  ILE A CA   1  
ATOM 277   C C    . ILE A 1 21  ? -4.726  9.023   -7.560  1.00 0.00 ? 21  ILE A C    1  
ATOM 278   O O    . ILE A 1 21  ? -3.501  9.035   -7.679  1.00 0.00 ? 21  ILE A O    1  
ATOM 279   C CB   . ILE A 1 21  ? -5.062  7.025   -6.104  1.00 0.00 ? 21  ILE A CB   1  
ATOM 280   C CG1  . ILE A 1 21  ? -5.329  5.520   -6.178  1.00 0.00 ? 21  ILE A CG1  1  
ATOM 281   C CG2  . ILE A 1 21  ? -5.799  7.641   -4.924  1.00 0.00 ? 21  ILE A CG2  1  
ATOM 282   C CD1  . ILE A 1 21  ? -4.791  4.751   -4.992  1.00 0.00 ? 21  ILE A CD1  1  
ATOM 283   H H    . ILE A 1 21  ? -4.350  6.527   -8.755  1.00 0.00 ? 21  ILE A H    1  
ATOM 284   H HA   . ILE A 1 21  ? -6.544  7.921   -7.364  1.00 0.00 ? 21  ILE A HA   1  
ATOM 285   H HB   . ILE A 1 21  ? -4.005  7.189   -5.962  1.00 0.00 ? 21  ILE A HB   1  
ATOM 286   H HG12 . ILE A 1 21  ? -6.393  5.351   -6.227  1.00 0.00 ? 21  ILE A HG12 1  
ATOM 287   H HG13 . ILE A 1 21  ? -4.865  5.124   -7.070  1.00 0.00 ? 21  ILE A HG13 1  
ATOM 288   H HG21 . ILE A 1 21  ? -6.861  7.482   -5.040  1.00 0.00 ? 21  ILE A HG21 1  
ATOM 289   H HG22 . ILE A 1 21  ? -5.465  7.176   -4.008  1.00 0.00 ? 21  ILE A HG22 1  
ATOM 290   H HG23 . ILE A 1 21  ? -5.596  8.700   -4.885  1.00 0.00 ? 21  ILE A HG23 1  
ATOM 291   H HD11 . ILE A 1 21  ? -5.458  4.874   -4.151  1.00 0.00 ? 21  ILE A HD11 1  
ATOM 292   H HD12 . ILE A 1 21  ? -4.719  3.704   -5.243  1.00 0.00 ? 21  ILE A HD12 1  
ATOM 293   H HD13 . ILE A 1 21  ? -3.813  5.128   -4.732  1.00 0.00 ? 21  ILE A HD13 1  
ATOM 294   N N    . PHE A 1 22  ? -5.462  10.130  -7.546  1.00 0.00 ? 22  PHE A N    1  
ATOM 295   C CA   . PHE A 1 22  ? -4.857  11.451  -7.674  1.00 0.00 ? 22  PHE A CA   1  
ATOM 296   C C    . PHE A 1 22  ? -4.408  11.977  -6.313  1.00 0.00 ? 22  PHE A C    1  
ATOM 297   O O    . PHE A 1 22  ? -5.221  12.159  -5.407  1.00 0.00 ? 22  PHE A O    1  
ATOM 298   C CB   . PHE A 1 22  ? -5.847  12.429  -8.310  1.00 0.00 ? 22  PHE A CB   1  
ATOM 299   C CG   . PHE A 1 22  ? -5.604  12.661  -9.774  1.00 0.00 ? 22  PHE A CG   1  
ATOM 300   C CD1  . PHE A 1 22  ? -5.991  11.718  -10.712 1.00 0.00 ? 22  PHE A CD1  1  
ATOM 301   C CD2  . PHE A 1 22  ? -4.988  13.823  -10.211 1.00 0.00 ? 22  PHE A CD2  1  
ATOM 302   C CE1  . PHE A 1 22  ? -5.768  11.929  -12.059 1.00 0.00 ? 22  PHE A CE1  1  
ATOM 303   C CE2  . PHE A 1 22  ? -4.763  14.039  -11.558 1.00 0.00 ? 22  PHE A CE2  1  
ATOM 304   C CZ   . PHE A 1 22  ? -5.154  13.091  -12.483 1.00 0.00 ? 22  PHE A CZ   1  
ATOM 305   H H    . PHE A 1 22  ? -6.434  10.057  -7.448  1.00 0.00 ? 22  PHE A H    1  
ATOM 306   H HA   . PHE A 1 22  ? -3.994  11.359  -8.314  1.00 0.00 ? 22  PHE A HA   1  
ATOM 307   H HB2  . PHE A 1 22  ? -6.849  12.040  -8.198  1.00 0.00 ? 22  PHE A HB2  1  
ATOM 308   H HB3  . PHE A 1 22  ? -5.777  13.381  -7.805  1.00 0.00 ? 22  PHE A HB3  1  
ATOM 309   H HD1  . PHE A 1 22  ? -6.473  10.809  -10.382 1.00 0.00 ? 22  PHE A HD1  1  
ATOM 310   H HD2  . PHE A 1 22  ? -4.682  14.565  -9.488  1.00 0.00 ? 22  PHE A HD2  1  
ATOM 311   H HE1  . PHE A 1 22  ? -6.075  11.186  -12.781 1.00 0.00 ? 22  PHE A HE1  1  
ATOM 312   H HE2  . PHE A 1 22  ? -4.282  14.949  -11.885 1.00 0.00 ? 22  PHE A HE2  1  
ATOM 313   H HZ   . PHE A 1 22  ? -4.978  13.258  -13.535 1.00 0.00 ? 22  PHE A HZ   1  
ATOM 314   N N    . ARG A 1 23  ? -3.108  12.219  -6.179  1.00 0.00 ? 23  ARG A N    1  
ATOM 315   C CA   . ARG A 1 23  ? -2.550  12.723  -4.930  1.00 0.00 ? 23  ARG A CA   1  
ATOM 316   C C    . ARG A 1 23  ? -3.144  14.083  -4.578  1.00 0.00 ? 23  ARG A C    1  
ATOM 317   O O    . ARG A 1 23  ? -3.509  14.858  -5.462  1.00 0.00 ? 23  ARG A O    1  
ATOM 318   C CB   . ARG A 1 23  ? -1.028  12.830  -5.034  1.00 0.00 ? 23  ARG A CB   1  
ATOM 319   C CG   . ARG A 1 23  ? -0.541  13.285  -6.400  1.00 0.00 ? 23  ARG A CG   1  
ATOM 320   C CD   . ARG A 1 23  ? 0.925   13.686  -6.364  1.00 0.00 ? 23  ARG A CD   1  
ATOM 321   N NE   . ARG A 1 23  ? 1.342   14.348  -7.598  1.00 0.00 ? 23  ARG A NE   1  
ATOM 322   C CZ   . ARG A 1 23  ? 1.175   15.645  -7.828  1.00 0.00 ? 23  ARG A CZ   1  
ATOM 323   N NH1  . ARG A 1 23  ? 0.603   16.416  -6.914  1.00 0.00 ? 23  ARG A NH1  1  
ATOM 324   N NH2  . ARG A 1 23  ? 1.581   16.174  -8.976  1.00 0.00 ? 23  ARG A NH2  1  
ATOM 325   H H    . ARG A 1 23  ? -2.510  12.054  -6.938  1.00 0.00 ? 23  ARG A H    1  
ATOM 326   H HA   . ARG A 1 23  ? -2.800  12.021  -4.148  1.00 0.00 ? 23  ARG A HA   1  
ATOM 327   H HB2  . ARG A 1 23  ? -0.677  13.539  -4.298  1.00 0.00 ? 23  ARG A HB2  1  
ATOM 328   H HB3  . ARG A 1 23  ? -0.596  11.863  -4.825  1.00 0.00 ? 23  ARG A HB3  1  
ATOM 329   H HG2  . ARG A 1 23  ? -0.664  12.475  -7.104  1.00 0.00 ? 23  ARG A HG2  1  
ATOM 330   H HG3  . ARG A 1 23  ? -1.130  14.133  -6.718  1.00 0.00 ? 23  ARG A HG3  1  
ATOM 331   H HD2  . ARG A 1 23  ? 1.080   14.360  -5.535  1.00 0.00 ? 23  ARG A HD2  1  
ATOM 332   H HD3  . ARG A 1 23  ? 1.524   12.798  -6.223  1.00 0.00 ? 23  ARG A HD3  1  
ATOM 333   H HE   . ARG A 1 23  ? 1.767   13.797  -8.287  1.00 0.00 ? 23  ARG A HE   1  
ATOM 334   H HH11 . ARG A 1 23  ? 0.297   16.020  -6.048  1.00 0.00 ? 23  ARG A HH11 1  
ATOM 335   H HH12 . ARG A 1 23  ? 0.479   17.393  -7.090  1.00 0.00 ? 23  ARG A HH12 1  
ATOM 336   H HH21 . ARG A 1 23  ? 2.013   15.596  -9.667  1.00 0.00 ? 23  ARG A HH21 1  
ATOM 337   H HH22 . ARG A 1 23  ? 1.455   17.150  -9.148  1.00 0.00 ? 23  ARG A HH22 1  
ATOM 338   N N    . GLU A 1 24  ? -3.238  14.366  -3.283  1.00 0.00 ? 24  GLU A N    1  
ATOM 339   C CA   . GLU A 1 24  ? -3.789  15.632  -2.815  1.00 0.00 ? 24  GLU A CA   1  
ATOM 340   C C    . GLU A 1 24  ? -2.708  16.488  -2.162  1.00 0.00 ? 24  GLU A C    1  
ATOM 341   O O    . GLU A 1 24  ? -1.692  15.988  -1.678  1.00 0.00 ? 24  GLU A O    1  
ATOM 342   C CB   . GLU A 1 24  ? -4.927  15.383  -1.823  1.00 0.00 ? 24  GLU A CB   1  
ATOM 343   C CG   . GLU A 1 24  ? -6.215  14.916  -2.478  1.00 0.00 ? 24  GLU A CG   1  
ATOM 344   C CD   . GLU A 1 24  ? -7.094  16.068  -2.926  1.00 0.00 ? 24  GLU A CD   1  
ATOM 345   O OE1  . GLU A 1 24  ? -7.574  16.822  -2.054  1.00 0.00 ? 24  GLU A OE1  1  
ATOM 346   O OE2  . GLU A 1 24  ? -7.300  16.216  -4.148  1.00 0.00 ? 24  GLU A OE2  1  
ATOM 347   H H    . GLU A 1 24  ? -2.930  13.707  -2.626  1.00 0.00 ? 24  GLU A H    1  
ATOM 348   H HA   . GLU A 1 24  ? -4.180  16.160  -3.672  1.00 0.00 ? 24  GLU A HA   1  
ATOM 349   H HB2  . GLU A 1 24  ? -4.613  14.630  -1.115  1.00 0.00 ? 24  GLU A HB2  1  
ATOM 350   H HB3  . GLU A 1 24  ? -5.131  16.301  -1.291  1.00 0.00 ? 24  GLU A HB3  1  
ATOM 351   H HG2  . GLU A 1 24  ? -5.968  14.316  -3.341  1.00 0.00 ? 24  GLU A HG2  1  
ATOM 352   H HG3  . GLU A 1 24  ? -6.767  14.315  -1.770  1.00 0.00 ? 24  GLU A HG3  1  
ATOM 353   N N    . PRO A 1 25  ? -2.929  17.811  -2.148  1.00 0.00 ? 25  PRO A N    1  
ATOM 354   C CA   . PRO A 1 25  ? -1.985  18.765  -1.558  1.00 0.00 ? 25  PRO A CA   1  
ATOM 355   C C    . PRO A 1 25  ? -1.929  18.659  -0.038  1.00 0.00 ? 25  PRO A C    1  
ATOM 356   O O    . PRO A 1 25  ? -1.144  17.888  0.511   1.00 0.00 ? 25  PRO A O    1  
ATOM 357   C CB   . PRO A 1 25  ? -2.547  20.125  -1.978  1.00 0.00 ? 25  PRO A CB   1  
ATOM 358   C CG   . PRO A 1 25  ? -4.002  19.885  -2.192  1.00 0.00 ? 25  PRO A CG   1  
ATOM 359   C CD   . PRO A 1 25  ? -4.118  18.477  -2.706  1.00 0.00 ? 25  PRO A CD   1  
ATOM 360   H HA   . PRO A 1 25  ? -0.992  18.643  -1.963  1.00 0.00 ? 25  PRO A HA   1  
ATOM 361   H HB2  . PRO A 1 25  ? -2.376  20.847  -1.192  1.00 0.00 ? 25  PRO A HB2  1  
ATOM 362   H HB3  . PRO A 1 25  ? -2.064  20.453  -2.886  1.00 0.00 ? 25  PRO A HB3  1  
ATOM 363   H HG2  . PRO A 1 25  ? -4.532  19.988  -1.258  1.00 0.00 ? 25  PRO A HG2  1  
ATOM 364   H HG3  . PRO A 1 25  ? -4.385  20.583  -2.922  1.00 0.00 ? 25  PRO A HG3  1  
ATOM 365   H HD2  . PRO A 1 25  ? -5.024  18.016  -2.343  1.00 0.00 ? 25  PRO A HD2  1  
ATOM 366   H HD3  . PRO A 1 25  ? -4.093  18.466  -3.786  1.00 0.00 ? 25  PRO A HD3  1  
ATOM 367   N N    . ASN A 1 26  ? -2.767  19.440  0.637   1.00 0.00 ? 26  ASN A N    1  
ATOM 368   C CA   . ASN A 1 26  ? -2.811  19.433  2.095   1.00 0.00 ? 26  ASN A CA   1  
ATOM 369   C C    . ASN A 1 26  ? -2.846  18.006  2.632   1.00 0.00 ? 26  ASN A C    1  
ATOM 370   O O    . ASN A 1 26  ? -2.180  17.685  3.616   1.00 0.00 ? 26  ASN A O    1  
ATOM 371   C CB   . ASN A 1 26  ? -4.035  20.207  2.592   1.00 0.00 ? 26  ASN A CB   1  
ATOM 372   C CG   . ASN A 1 26  ? -4.080  21.624  2.055   1.00 0.00 ? 26  ASN A CG   1  
ATOM 373   O OD1  . ASN A 1 26  ? -3.198  22.436  2.338   1.00 0.00 ? 26  ASN A OD1  1  
ATOM 374   N ND2  . ASN A 1 26  ? -5.111  21.928  1.274   1.00 0.00 ? 26  ASN A ND2  1  
ATOM 375   H H    . ASN A 1 26  ? -3.369  20.034  0.143   1.00 0.00 ? 26  ASN A H    1  
ATOM 376   H HA   . ASN A 1 26  ? -1.918  19.920  2.456   1.00 0.00 ? 26  ASN A HA   1  
ATOM 377   H HB2  . ASN A 1 26  ? -4.931  19.693  2.274   1.00 0.00 ? 26  ASN A HB2  1  
ATOM 378   H HB3  . ASN A 1 26  ? -4.012  20.250  3.670   1.00 0.00 ? 26  ASN A HB3  1  
ATOM 379   H HD21 . ASN A 1 26  ? -5.775  21.231  1.092   1.00 0.00 ? 26  ASN A HD21 1  
ATOM 380   H HD22 . ASN A 1 26  ? -5.164  22.838  0.913   1.00 0.00 ? 26  ASN A HD22 1  
ATOM 381   N N    . VAL A 1 27  ? -3.627  17.152  1.978   1.00 0.00 ? 27  VAL A N    1  
ATOM 382   C CA   . VAL A 1 27  ? -3.748  15.758  2.387   1.00 0.00 ? 27  VAL A CA   1  
ATOM 383   C C    . VAL A 1 27  ? -3.052  14.832  1.397   1.00 0.00 ? 27  VAL A C    1  
ATOM 384   O O    . VAL A 1 27  ? -2.919  15.155  0.216   1.00 0.00 ? 27  VAL A O    1  
ATOM 385   C CB   . VAL A 1 27  ? -5.224  15.337  2.518   1.00 0.00 ? 27  VAL A CB   1  
ATOM 386   C CG1  . VAL A 1 27  ? -5.936  15.468  1.180   1.00 0.00 ? 27  VAL A CG1  1  
ATOM 387   C CG2  . VAL A 1 27  ? -5.327  13.915  3.049   1.00 0.00 ? 27  VAL A CG2  1  
ATOM 388   H H    . VAL A 1 27  ? -4.134  17.467  1.200   1.00 0.00 ? 27  VAL A H    1  
ATOM 389   H HA   . VAL A 1 27  ? -3.278  15.652  3.355   1.00 0.00 ? 27  VAL A HA   1  
ATOM 390   H HB   . VAL A 1 27  ? -5.705  15.998  3.223   1.00 0.00 ? 27  VAL A HB   1  
ATOM 391   H HG11 . VAL A 1 27  ? -5.736  14.593  0.579   1.00 0.00 ? 27  VAL A HG11 1  
ATOM 392   H HG12 . VAL A 1 27  ? -7.000  15.557  1.346   1.00 0.00 ? 27  VAL A HG12 1  
ATOM 393   H HG13 . VAL A 1 27  ? -5.577  16.347  0.666   1.00 0.00 ? 27  VAL A HG13 1  
ATOM 394   H HG21 . VAL A 1 27  ? -4.659  13.795  3.889   1.00 0.00 ? 27  VAL A HG21 1  
ATOM 395   H HG22 . VAL A 1 27  ? -6.341  13.722  3.365   1.00 0.00 ? 27  VAL A HG22 1  
ATOM 396   H HG23 . VAL A 1 27  ? -5.054  13.218  2.270   1.00 0.00 ? 27  VAL A HG23 1  
ATOM 397   N N    . SER A 1 28  ? -2.610  13.677  1.884   1.00 0.00 ? 28  SER A N    1  
ATOM 398   C CA   . SER A 1 28  ? -1.924  12.704  1.042   1.00 0.00 ? 28  SER A CA   1  
ATOM 399   C C    . SER A 1 28  ? -2.924  11.773  0.364   1.00 0.00 ? 28  SER A C    1  
ATOM 400   O O    . SER A 1 28  ? -4.131  12.015  0.387   1.00 0.00 ? 28  SER A O    1  
ATOM 401   C CB   . SER A 1 28  ? -0.932  11.888  1.874   1.00 0.00 ? 28  SER A CB   1  
ATOM 402   O OG   . SER A 1 28  ? 0.176   11.480  1.090   1.00 0.00 ? 28  SER A OG   1  
ATOM 403   H H    . SER A 1 28  ? -2.746  13.476  2.834   1.00 0.00 ? 28  SER A H    1  
ATOM 404   H HA   . SER A 1 28  ? -1.382  13.247  0.282   1.00 0.00 ? 28  SER A HA   1  
ATOM 405   H HB2  . SER A 1 28  ? -0.574  12.489  2.695   1.00 0.00 ? 28  SER A HB2  1  
ATOM 406   H HB3  . SER A 1 28  ? -1.428  11.009  2.260   1.00 0.00 ? 28  SER A HB3  1  
ATOM 407   H HG   . SER A 1 28  ? 0.099   10.544  0.889   1.00 0.00 ? 28  SER A HG   1  
ATOM 408   N N    . LEU A 1 29  ? -2.412  10.706  -0.241  1.00 0.00 ? 29  LEU A N    1  
ATOM 409   C CA   . LEU A 1 29  ? -3.259  9.736   -0.927  1.00 0.00 ? 29  LEU A CA   1  
ATOM 410   C C    . LEU A 1 29  ? -4.251  9.099   0.040   1.00 0.00 ? 29  LEU A C    1  
ATOM 411   O O    . LEU A 1 29  ? -5.310  8.620   -0.365  1.00 0.00 ? 29  LEU A O    1  
ATOM 412   C CB   . LEU A 1 29  ? -2.400  8.653   -1.582  1.00 0.00 ? 29  LEU A CB   1  
ATOM 413   C CG   . LEU A 1 29  ? -2.143  8.815   -3.080  1.00 0.00 ? 29  LEU A CG   1  
ATOM 414   C CD1  . LEU A 1 29  ? -1.551  7.540   -3.662  1.00 0.00 ? 29  LEU A CD1  1  
ATOM 415   C CD2  . LEU A 1 29  ? -3.428  9.188   -3.805  1.00 0.00 ? 29  LEU A CD2  1  
ATOM 416   H H    . LEU A 1 29  ? -1.443  10.566  -0.225  1.00 0.00 ? 29  LEU A H    1  
ATOM 417   H HA   . LEU A 1 29  ? -3.809  10.261  -1.694  1.00 0.00 ? 29  LEU A HA   1  
ATOM 418   H HB2  . LEU A 1 29  ? -1.444  8.642   -1.082  1.00 0.00 ? 29  LEU A HB2  1  
ATOM 419   H HB3  . LEU A 1 29  ? -2.895  7.704   -1.431  1.00 0.00 ? 29  LEU A HB3  1  
ATOM 420   H HG   . LEU A 1 29  ? -1.429  9.613   -3.232  1.00 0.00 ? 29  LEU A HG   1  
ATOM 421   H HD11 . LEU A 1 29  ? -2.176  7.189   -4.469  1.00 0.00 ? 29  LEU A HD11 1  
ATOM 422   H HD12 . LEU A 1 29  ? -1.499  6.785   -2.892  1.00 0.00 ? 29  LEU A HD12 1  
ATOM 423   H HD13 . LEU A 1 29  ? -0.558  7.742   -4.036  1.00 0.00 ? 29  LEU A HD13 1  
ATOM 424   H HD21 . LEU A 1 29  ? -4.254  8.638   -3.380  1.00 0.00 ? 29  LEU A HD21 1  
ATOM 425   H HD22 . LEU A 1 29  ? -3.333  8.945   -4.853  1.00 0.00 ? 29  LEU A HD22 1  
ATOM 426   H HD23 . LEU A 1 29  ? -3.607  10.248  -3.697  1.00 0.00 ? 29  LEU A HD23 1  
ATOM 427   N N    . GLY A 1 30  ? -3.902  9.098   1.323   1.00 0.00 ? 30  GLY A N    1  
ATOM 428   C CA   . GLY A 1 30  ? -4.774  8.519   2.329   1.00 0.00 ? 30  GLY A CA   1  
ATOM 429   C C    . GLY A 1 30  ? -4.590  7.020   2.461   1.00 0.00 ? 30  GLY A C    1  
ATOM 430   O O    . GLY A 1 30  ? -5.392  6.345   3.108   1.00 0.00 ? 30  GLY A O    1  
ATOM 431   H H    . GLY A 1 30  ? -3.046  9.494   1.589   1.00 0.00 ? 30  GLY A H    1  
ATOM 432   H HA2  . GLY A 1 30  ? -4.564  8.982   3.281   1.00 0.00 ? 30  GLY A HA2  1  
ATOM 433   H HA3  . GLY A 1 30  ? -5.800  8.722   2.060   1.00 0.00 ? 30  GLY A HA3  1  
ATOM 434   N N    . ILE A 1 31  ? -3.535  6.498   1.846   1.00 0.00 ? 31  ILE A N    1  
ATOM 435   C CA   . ILE A 1 31  ? -3.250  5.069   1.898   1.00 0.00 ? 31  ILE A CA   1  
ATOM 436   C C    . ILE A 1 31  ? -1.988  4.789   2.707   1.00 0.00 ? 31  ILE A C    1  
ATOM 437   O O    . ILE A 1 31  ? -1.064  5.602   2.736   1.00 0.00 ? 31  ILE A O    1  
ATOM 438   C CB   . ILE A 1 31  ? -3.083  4.477   0.486   1.00 0.00 ? 31  ILE A CB   1  
ATOM 439   C CG1  . ILE A 1 31  ? -4.155  5.033   -0.454  1.00 0.00 ? 31  ILE A CG1  1  
ATOM 440   C CG2  . ILE A 1 31  ? -3.152  2.958   0.538   1.00 0.00 ? 31  ILE A CG2  1  
ATOM 441   C CD1  . ILE A 1 31  ? -3.948  4.647   -1.902  1.00 0.00 ? 31  ILE A CD1  1  
ATOM 442   H H    . ILE A 1 31  ? -2.933  7.087   1.346   1.00 0.00 ? 31  ILE A H    1  
ATOM 443   H HA   . ILE A 1 31  ? -4.087  4.580   2.376   1.00 0.00 ? 31  ILE A HA   1  
ATOM 444   H HB   . ILE A 1 31  ? -2.109  4.756   0.115   1.00 0.00 ? 31  ILE A HB   1  
ATOM 445   H HG12 . ILE A 1 31  ? -5.121  4.663   -0.147  1.00 0.00 ? 31  ILE A HG12 1  
ATOM 446   H HG13 . ILE A 1 31  ? -4.152  6.111   -0.393  1.00 0.00 ? 31  ILE A HG13 1  
ATOM 447   H HG21 . ILE A 1 31  ? -3.949  2.656   1.201   1.00 0.00 ? 31  ILE A HG21 1  
ATOM 448   H HG22 . ILE A 1 31  ? -3.345  2.573   -0.452  1.00 0.00 ? 31  ILE A HG22 1  
ATOM 449   H HG23 . ILE A 1 31  ? -2.214  2.566   0.901   1.00 0.00 ? 31  ILE A HG23 1  
ATOM 450   H HD11 . ILE A 1 31  ? -4.607  3.829   -2.154  1.00 0.00 ? 31  ILE A HD11 1  
ATOM 451   H HD12 . ILE A 1 31  ? -4.168  5.494   -2.535  1.00 0.00 ? 31  ILE A HD12 1  
ATOM 452   H HD13 . ILE A 1 31  ? -2.923  4.342   -2.050  1.00 0.00 ? 31  ILE A HD13 1  
ATOM 453   N N    . SER A 1 32  ? -1.956  3.633   3.362   1.00 0.00 ? 32  SER A N    1  
ATOM 454   C CA   . SER A 1 32  ? -0.808  3.246   4.173   1.00 0.00 ? 32  SER A CA   1  
ATOM 455   C C    . SER A 1 32  ? -0.378  1.816   3.860   1.00 0.00 ? 32  SER A C    1  
ATOM 456   O O    . SER A 1 32  ? -1.075  1.088   3.152   1.00 0.00 ? 32  SER A O    1  
ATOM 457   C CB   . SER A 1 32  ? -1.140  3.376   5.661   1.00 0.00 ? 32  SER A CB   1  
ATOM 458   O OG   . SER A 1 32  ? -1.392  4.726   6.011   1.00 0.00 ? 32  SER A OG   1  
ATOM 459   H H    . SER A 1 32  ? -2.724  3.027   3.299   1.00 0.00 ? 32  SER A H    1  
ATOM 460   H HA   . SER A 1 32  ? 0.007   3.914   3.935   1.00 0.00 ? 32  SER A HA   1  
ATOM 461   H HB2  . SER A 1 32  ? -2.019  2.789   5.883   1.00 0.00 ? 32  SER A HB2  1  
ATOM 462   H HB3  . SER A 1 32  ? -0.308  3.014   6.246   1.00 0.00 ? 32  SER A HB3  1  
ATOM 463   H HG   . SER A 1 32  ? -2.100  4.762   6.658   1.00 0.00 ? 32  SER A HG   1  
ATOM 464   N N    . ILE A 1 33  ? 0.773   1.420   4.392   1.00 0.00 ? 33  ILE A N    1  
ATOM 465   C CA   . ILE A 1 33  ? 1.295   0.077   4.171   1.00 0.00 ? 33  ILE A CA   1  
ATOM 466   C C    . ILE A 1 33  ? 1.945   -0.475  5.435   1.00 0.00 ? 33  ILE A C    1  
ATOM 467   O O    . ILE A 1 33  ? 2.504   0.273   6.237   1.00 0.00 ? 33  ILE A O    1  
ATOM 468   C CB   . ILE A 1 33  ? 2.325   0.055   3.026   1.00 0.00 ? 33  ILE A CB   1  
ATOM 469   C CG1  . ILE A 1 33  ? 3.343   1.183   3.206   1.00 0.00 ? 33  ILE A CG1  1  
ATOM 470   C CG2  . ILE A 1 33  ? 1.624   0.175   1.681   1.00 0.00 ? 33  ILE A CG2  1  
ATOM 471   C CD1  . ILE A 1 33  ? 4.504   1.109   2.239   1.00 0.00 ? 33  ILE A CD1  1  
ATOM 472   H H    . ILE A 1 33  ? 1.283   2.046   4.948   1.00 0.00 ? 33  ILE A H    1  
ATOM 473   H HA   . ILE A 1 33  ? 0.467   -0.561  3.896   1.00 0.00 ? 33  ILE A HA   1  
ATOM 474   H HB   . ILE A 1 33  ? 2.840   -0.893  3.053   1.00 0.00 ? 33  ILE A HB   1  
ATOM 475   H HG12 . ILE A 1 33  ? 2.850   2.131   3.058   1.00 0.00 ? 33  ILE A HG12 1  
ATOM 476   H HG13 . ILE A 1 33  ? 3.742   1.142   4.209   1.00 0.00 ? 33  ILE A HG13 1  
ATOM 477   H HG21 . ILE A 1 33  ? 1.029   -0.708  1.505   1.00 0.00 ? 33  ILE A HG21 1  
ATOM 478   H HG22 . ILE A 1 33  ? 0.984   1.045   1.686   1.00 0.00 ? 33  ILE A HG22 1  
ATOM 479   H HG23 . ILE A 1 33  ? 2.362   0.275   0.899   1.00 0.00 ? 33  ILE A HG23 1  
ATOM 480   H HD11 . ILE A 1 33  ? 4.495   0.151   1.738   1.00 0.00 ? 33  ILE A HD11 1  
ATOM 481   H HD12 . ILE A 1 33  ? 4.414   1.897   1.506   1.00 0.00 ? 33  ILE A HD12 1  
ATOM 482   H HD13 . ILE A 1 33  ? 5.431   1.222   2.780   1.00 0.00 ? 33  ILE A HD13 1  
ATOM 483   N N    . VAL A 1 34  ? 1.869   -1.791  5.606   1.00 0.00 ? 34  VAL A N    1  
ATOM 484   C CA   . VAL A 1 34  ? 2.452   -2.446  6.771   1.00 0.00 ? 34  VAL A CA   1  
ATOM 485   C C    . VAL A 1 34  ? 3.793   -3.084  6.429   1.00 0.00 ? 34  VAL A C    1  
ATOM 486   O O    . VAL A 1 34  ? 4.201   -3.114  5.269   1.00 0.00 ? 34  VAL A O    1  
ATOM 487   C CB   . VAL A 1 34  ? 1.511   -3.526  7.337   1.00 0.00 ? 34  VAL A CB   1  
ATOM 488   C CG1  . VAL A 1 34  ? 0.060   -3.173  7.053   1.00 0.00 ? 34  VAL A CG1  1  
ATOM 489   C CG2  . VAL A 1 34  ? 1.860   -4.890  6.761   1.00 0.00 ? 34  VAL A CG2  1  
ATOM 490   H H    . VAL A 1 34  ? 1.410   -2.335  4.932   1.00 0.00 ? 34  VAL A H    1  
ATOM 491   H HA   . VAL A 1 34  ? 2.605   -1.696  7.534   1.00 0.00 ? 34  VAL A HA   1  
ATOM 492   H HB   . VAL A 1 34  ? 1.646   -3.566  8.408   1.00 0.00 ? 34  VAL A HB   1  
ATOM 493   H HG11 . VAL A 1 34  ? -0.044  -2.887  6.016   1.00 0.00 ? 34  VAL A HG11 1  
ATOM 494   H HG12 . VAL A 1 34  ? -0.566  -4.030  7.255   1.00 0.00 ? 34  VAL A HG12 1  
ATOM 495   H HG13 . VAL A 1 34  ? -0.241  -2.350  7.685   1.00 0.00 ? 34  VAL A HG13 1  
ATOM 496   H HG21 . VAL A 1 34  ? 1.171   -5.629  7.142   1.00 0.00 ? 34  VAL A HG21 1  
ATOM 497   H HG22 . VAL A 1 34  ? 1.790   -4.854  5.684   1.00 0.00 ? 34  VAL A HG22 1  
ATOM 498   H HG23 . VAL A 1 34  ? 2.867   -5.156  7.048   1.00 0.00 ? 34  VAL A HG23 1  
ATOM 499   N N    . GLY A 1 35  ? 4.477   -3.594  7.449   1.00 0.00 ? 35  GLY A N    1  
ATOM 500   C CA   . GLY A 1 35  ? 5.766   -4.225  7.236   1.00 0.00 ? 35  GLY A CA   1  
ATOM 501   C C    . GLY A 1 35  ? 6.595   -3.512  6.186   1.00 0.00 ? 35  GLY A C    1  
ATOM 502   O O    . GLY A 1 35  ? 6.897   -2.327  6.323   1.00 0.00 ? 35  GLY A O    1  
ATOM 503   H H    . GLY A 1 35  ? 4.103   -3.541  8.353   1.00 0.00 ? 35  GLY A H    1  
ATOM 504   H HA2  . GLY A 1 35  ? 6.312   -4.230  8.168   1.00 0.00 ? 35  GLY A HA2  1  
ATOM 505   H HA3  . GLY A 1 35  ? 5.607   -5.246  6.919   1.00 0.00 ? 35  GLY A HA3  1  
ATOM 506   N N    . GLY A 1 36  ? 6.965   -4.235  5.134   1.00 0.00 ? 36  GLY A N    1  
ATOM 507   C CA   . GLY A 1 36  ? 7.762   -3.648  4.073   1.00 0.00 ? 36  GLY A CA   1  
ATOM 508   C C    . GLY A 1 36  ? 9.213   -4.082  4.129   1.00 0.00 ? 36  GLY A C    1  
ATOM 509   O O    . GLY A 1 36  ? 10.057  -3.376  4.681   1.00 0.00 ? 36  GLY A O    1  
ATOM 510   H H    . GLY A 1 36  ? 6.695   -5.176  5.078   1.00 0.00 ? 36  GLY A H    1  
ATOM 511   H HA2  . GLY A 1 36  ? 7.346   -3.941  3.120   1.00 0.00 ? 36  GLY A HA2  1  
ATOM 512   H HA3  . GLY A 1 36  ? 7.717   -2.572  4.158   1.00 0.00 ? 36  GLY A HA3  1  
ATOM 513   N N    . GLN A 1 37  ? 9.504   -5.246  3.558   1.00 0.00 ? 37  GLN A N    1  
ATOM 514   C CA   . GLN A 1 37  ? 10.863  -5.774  3.549   1.00 0.00 ? 37  GLN A CA   1  
ATOM 515   C C    . GLN A 1 37  ? 11.335  -6.037  2.122   1.00 0.00 ? 37  GLN A C    1  
ATOM 516   O O    . GLN A 1 37  ? 10.526  -6.254  1.219   1.00 0.00 ? 37  GLN A O    1  
ATOM 517   C CB   . GLN A 1 37  ? 10.938  -7.062  4.370   1.00 0.00 ? 37  GLN A CB   1  
ATOM 518   C CG   . GLN A 1 37  ? 10.202  -6.982  5.697   1.00 0.00 ? 37  GLN A CG   1  
ATOM 519   C CD   . GLN A 1 37  ? 10.782  -7.912  6.744   1.00 0.00 ? 37  GLN A CD   1  
ATOM 520   O OE1  . GLN A 1 37  ? 11.965  -7.830  7.077   1.00 0.00 ? 37  GLN A OE1  1  
ATOM 521   N NE2  . GLN A 1 37  ? 9.951   -8.805  7.269   1.00 0.00 ? 37  GLN A NE2  1  
ATOM 522   H H    . GLN A 1 37  ? 8.788   -5.763  3.134   1.00 0.00 ? 37  GLN A H    1  
ATOM 523   H HA   . GLN A 1 37  ? 11.509  -5.034  3.997   1.00 0.00 ? 37  GLN A HA   1  
ATOM 524   H HB2  . GLN A 1 37  ? 10.510  -7.868  3.793   1.00 0.00 ? 37  GLN A HB2  1  
ATOM 525   H HB3  . GLN A 1 37  ? 11.975  -7.286  4.572   1.00 0.00 ? 37  GLN A HB3  1  
ATOM 526   H HG2  . GLN A 1 37  ? 10.260  -5.969  6.066   1.00 0.00 ? 37  GLN A HG2  1  
ATOM 527   H HG3  . GLN A 1 37  ? 9.167   -7.246  5.535   1.00 0.00 ? 37  GLN A HG3  1  
ATOM 528   H HE21 . GLN A 1 37  ? 9.022   -8.813  6.955   1.00 0.00 ? 37  GLN A HE21 1  
ATOM 529   H HE22 . GLN A 1 37  ? 10.300  -9.419  7.947   1.00 0.00 ? 37  GLN A HE22 1  
ATOM 530   N N    . THR A 1 38  ? 12.650  -6.018  1.926   1.00 0.00 ? 38  THR A N    1  
ATOM 531   C CA   . THR A 1 38  ? 13.229  -6.253  0.609   1.00 0.00 ? 38  THR A CA   1  
ATOM 532   C C    . THR A 1 38  ? 14.281  -7.355  0.661   1.00 0.00 ? 38  THR A C    1  
ATOM 533   O O    . THR A 1 38  ? 14.740  -7.838  -0.375  1.00 0.00 ? 38  THR A O    1  
ATOM 534   C CB   . THR A 1 38  ? 13.871  -4.973  0.042   1.00 0.00 ? 38  THR A CB   1  
ATOM 535   O OG1  . THR A 1 38  ? 14.482  -5.251  -1.223  1.00 0.00 ? 38  THR A OG1  1  
ATOM 536   C CG2  . THR A 1 38  ? 14.911  -4.417  1.002   1.00 0.00 ? 38  THR A CG2  1  
ATOM 537   H H    . THR A 1 38  ? 13.243  -5.840  2.685   1.00 0.00 ? 38  THR A H    1  
ATOM 538   H HA   . THR A 1 38  ? 12.434  -6.557  -0.056  1.00 0.00 ? 38  THR A HA   1  
ATOM 539   H HB   . THR A 1 38  ? 13.097  -4.231  -0.097  1.00 0.00 ? 38  THR A HB   1  
ATOM 540   H HG1  . THR A 1 38  ? 14.068  -4.715  -1.904  1.00 0.00 ? 38  THR A HG1  1  
ATOM 541   H HG21 . THR A 1 38  ? 15.704  -5.138  1.130   1.00 0.00 ? 38  THR A HG21 1  
ATOM 542   H HG22 . THR A 1 38  ? 14.449  -4.218  1.958   1.00 0.00 ? 38  THR A HG22 1  
ATOM 543   H HG23 . THR A 1 38  ? 15.318  -3.500  0.601   1.00 0.00 ? 38  THR A HG23 1  
ATOM 544   N N    . VAL A 1 39  ? 14.658  -7.751  1.872   1.00 0.00 ? 39  VAL A N    1  
ATOM 545   C CA   . VAL A 1 39  ? 15.655  -8.798  2.058   1.00 0.00 ? 39  VAL A CA   1  
ATOM 546   C C    . VAL A 1 39  ? 15.307  -9.683  3.250   1.00 0.00 ? 39  VAL A C    1  
ATOM 547   O O    . VAL A 1 39  ? 15.061  -9.189  4.351   1.00 0.00 ? 39  VAL A O    1  
ATOM 548   C CB   . VAL A 1 39  ? 17.061  -8.205  2.266   1.00 0.00 ? 39  VAL A CB   1  
ATOM 549   C CG1  . VAL A 1 39  ? 17.959  -9.198  2.989   1.00 0.00 ? 39  VAL A CG1  1  
ATOM 550   C CG2  . VAL A 1 39  ? 17.669  -7.796  0.933   1.00 0.00 ? 39  VAL A CG2  1  
ATOM 551   H H    . VAL A 1 39  ? 14.256  -7.328  2.660   1.00 0.00 ? 39  VAL A H    1  
ATOM 552   H HA   . VAL A 1 39  ? 15.672  -9.405  1.165   1.00 0.00 ? 39  VAL A HA   1  
ATOM 553   H HB   . VAL A 1 39  ? 16.970  -7.322  2.882   1.00 0.00 ? 39  VAL A HB   1  
ATOM 554   H HG11 . VAL A 1 39  ? 17.794  -9.123  4.054   1.00 0.00 ? 39  VAL A HG11 1  
ATOM 555   H HG12 . VAL A 1 39  ? 17.727  -10.200 2.657   1.00 0.00 ? 39  VAL A HG12 1  
ATOM 556   H HG13 . VAL A 1 39  ? 18.992  -8.975  2.768   1.00 0.00 ? 39  VAL A HG13 1  
ATOM 557   H HG21 . VAL A 1 39  ? 18.666  -7.414  1.094   1.00 0.00 ? 39  VAL A HG21 1  
ATOM 558   H HG22 . VAL A 1 39  ? 17.712  -8.654  0.280   1.00 0.00 ? 39  VAL A HG22 1  
ATOM 559   H HG23 . VAL A 1 39  ? 17.059  -7.028  0.479   1.00 0.00 ? 39  VAL A HG23 1  
ATOM 560   N N    . ILE A 1 40  ? 15.289  -10.992 3.024   1.00 0.00 ? 40  ILE A N    1  
ATOM 561   C CA   . ILE A 1 40  ? 14.973  -11.945 4.080   1.00 0.00 ? 40  ILE A CA   1  
ATOM 562   C C    . ILE A 1 40  ? 15.808  -13.214 3.943   1.00 0.00 ? 40  ILE A C    1  
ATOM 563   O O    . ILE A 1 40  ? 16.390  -13.477 2.891   1.00 0.00 ? 40  ILE A O    1  
ATOM 564   C CB   . ILE A 1 40  ? 13.480  -12.323 4.069   1.00 0.00 ? 40  ILE A CB   1  
ATOM 565   C CG1  . ILE A 1 40  ? 12.616  -11.070 3.905   1.00 0.00 ? 40  ILE A CG1  1  
ATOM 566   C CG2  . ILE A 1 40  ? 13.112  -13.063 5.346   1.00 0.00 ? 40  ILE A CG2  1  
ATOM 567   C CD1  . ILE A 1 40  ? 11.174  -11.372 3.564   1.00 0.00 ? 40  ILE A CD1  1  
ATOM 568   H H    . ILE A 1 40  ? 15.495  -11.324 2.125   1.00 0.00 ? 40  ILE A H    1  
ATOM 569   H HA   . ILE A 1 40  ? 15.199  -11.479 5.028   1.00 0.00 ? 40  ILE A HA   1  
ATOM 570   H HB   . ILE A 1 40  ? 13.305  -12.984 3.235   1.00 0.00 ? 40  ILE A HB   1  
ATOM 571   H HG12 . ILE A 1 40  ? 12.629  -10.509 4.825   1.00 0.00 ? 40  ILE A HG12 1  
ATOM 572   H HG13 . ILE A 1 40  ? 13.025  -10.462 3.111   1.00 0.00 ? 40  ILE A HG13 1  
ATOM 573   H HG21 . ILE A 1 40  ? 13.295  -14.119 5.215   1.00 0.00 ? 40  ILE A HG21 1  
ATOM 574   H HG22 . ILE A 1 40  ? 13.713  -12.693 6.162   1.00 0.00 ? 40  ILE A HG22 1  
ATOM 575   H HG23 . ILE A 1 40  ? 12.067  -12.903 5.566   1.00 0.00 ? 40  ILE A HG23 1  
ATOM 576   H HD11 . ILE A 1 40  ? 10.675  -11.775 4.434   1.00 0.00 ? 40  ILE A HD11 1  
ATOM 577   H HD12 . ILE A 1 40  ? 10.678  -10.463 3.256   1.00 0.00 ? 40  ILE A HD12 1  
ATOM 578   H HD13 . ILE A 1 40  ? 11.136  -12.094 2.762   1.00 0.00 ? 40  ILE A HD13 1  
ATOM 579   N N    . LYS A 1 41  ? 15.860  -13.999 5.014   1.00 0.00 ? 41  LYS A N    1  
ATOM 580   C CA   . LYS A 1 41  ? 16.621  -15.243 5.014   1.00 0.00 ? 41  LYS A CA   1  
ATOM 581   C C    . LYS A 1 41  ? 16.253  -16.106 3.811   1.00 0.00 ? 41  LYS A C    1  
ATOM 582   O O    . LYS A 1 41  ? 15.075  -16.313 3.520   1.00 0.00 ? 41  LYS A O    1  
ATOM 583   C CB   . LYS A 1 41  ? 16.367  -16.020 6.308   1.00 0.00 ? 41  LYS A CB   1  
ATOM 584   C CG   . LYS A 1 41  ? 17.544  -16.875 6.745   1.00 0.00 ? 41  LYS A CG   1  
ATOM 585   C CD   . LYS A 1 41  ? 17.493  -18.257 6.114   1.00 0.00 ? 41  LYS A CD   1  
ATOM 586   C CE   . LYS A 1 41  ? 16.530  -19.172 6.854   1.00 0.00 ? 41  LYS A CE   1  
ATOM 587   N NZ   . LYS A 1 41  ? 17.148  -19.756 8.077   1.00 0.00 ? 41  LYS A NZ   1  
ATOM 588   H H    . LYS A 1 41  ? 15.374  -13.736 5.824   1.00 0.00 ? 41  LYS A H    1  
ATOM 589   H HA   . LYS A 1 41  ? 17.669  -14.992 4.955   1.00 0.00 ? 41  LYS A HA   1  
ATOM 590   H HB2  . LYS A 1 41  ? 16.146  -15.317 7.098   1.00 0.00 ? 41  LYS A HB2  1  
ATOM 591   H HB3  . LYS A 1 41  ? 15.513  -16.666 6.164   1.00 0.00 ? 41  LYS A HB3  1  
ATOM 592   H HG2  . LYS A 1 41  ? 18.461  -16.389 6.447   1.00 0.00 ? 41  LYS A HG2  1  
ATOM 593   H HG3  . LYS A 1 41  ? 17.521  -16.979 7.820   1.00 0.00 ? 41  LYS A HG3  1  
ATOM 594   H HD2  . LYS A 1 41  ? 17.168  -18.163 5.089   1.00 0.00 ? 41  LYS A HD2  1  
ATOM 595   H HD3  . LYS A 1 41  ? 18.483  -18.692 6.142   1.00 0.00 ? 41  LYS A HD3  1  
ATOM 596   H HE2  . LYS A 1 41  ? 15.659  -18.602 7.138   1.00 0.00 ? 41  LYS A HE2  1  
ATOM 597   H HE3  . LYS A 1 41  ? 16.236  -19.973 6.192   1.00 0.00 ? 41  LYS A HE3  1  
ATOM 598   H HZ1  . LYS A 1 41  ? 17.002  -20.785 8.094   1.00 0.00 ? 41  LYS A HZ1  1  
ATOM 599   H HZ2  . LYS A 1 41  ? 16.717  -19.341 8.927   1.00 0.00 ? 41  LYS A HZ2  1  
ATOM 600   H HZ3  . LYS A 1 41  ? 18.169  -19.560 8.089   1.00 0.00 ? 41  LYS A HZ3  1  
ATOM 601   N N    . ARG A 1 42  ? 17.269  -16.608 3.116   1.00 0.00 ? 42  ARG A N    1  
ATOM 602   C CA   . ARG A 1 42  ? 17.052  -17.448 1.944   1.00 0.00 ? 42  ARG A CA   1  
ATOM 603   C C    . ARG A 1 42  ? 16.488  -18.807 2.347   1.00 0.00 ? 42  ARG A C    1  
ATOM 604   O O    . ARG A 1 42  ? 15.338  -19.129 2.046   1.00 0.00 ? 42  ARG A O    1  
ATOM 605   C CB   . ARG A 1 42  ? 18.361  -17.635 1.175   1.00 0.00 ? 42  ARG A CB   1  
ATOM 606   C CG   . ARG A 1 42  ? 18.361  -18.848 0.259   1.00 0.00 ? 42  ARG A CG   1  
ATOM 607   C CD   . ARG A 1 42  ? 17.294  -18.732 -0.819  1.00 0.00 ? 42  ARG A CD   1  
ATOM 608   N NE   . ARG A 1 42  ? 17.710  -17.853 -1.908  1.00 0.00 ? 42  ARG A NE   1  
ATOM 609   C CZ   . ARG A 1 42  ? 16.870  -17.345 -2.804  1.00 0.00 ? 42  ARG A CZ   1  
ATOM 610   N NH1  . ARG A 1 42  ? 15.577  -17.628 -2.739  1.00 0.00 ? 42  ARG A NH1  1  
ATOM 611   N NH2  . ARG A 1 42  ? 17.324  -16.553 -3.766  1.00 0.00 ? 42  ARG A NH2  1  
ATOM 612   H H    . ARG A 1 42  ? 18.186  -16.407 3.397   1.00 0.00 ? 42  ARG A H    1  
ATOM 613   H HA   . ARG A 1 42  ? 16.337  -16.950 1.306   1.00 0.00 ? 42  ARG A HA   1  
ATOM 614   H HB2  . ARG A 1 42  ? 18.539  -16.756 0.572   1.00 0.00 ? 42  ARG A HB2  1  
ATOM 615   H HB3  . ARG A 1 42  ? 19.168  -17.745 1.883   1.00 0.00 ? 42  ARG A HB3  1  
ATOM 616   H HG2  . ARG A 1 42  ? 19.328  -18.929 -0.215  1.00 0.00 ? 42  ARG A HG2  1  
ATOM 617   H HG3  . ARG A 1 42  ? 18.171  -19.732 0.848   1.00 0.00 ? 42  ARG A HG3  1  
ATOM 618   H HD2  . ARG A 1 42  ? 17.098  -19.716 -1.218  1.00 0.00 ? 42  ARG A HD2  1  
ATOM 619   H HD3  . ARG A 1 42  ? 16.393  -18.338 -0.374  1.00 0.00 ? 42  ARG A HD3  1  
ATOM 620   H HE   . ARG A 1 42  ? 18.662  -17.631 -1.975  1.00 0.00 ? 42  ARG A HE   1  
ATOM 621   H HH11 . ARG A 1 42  ? 15.231  -18.224 -2.015  1.00 0.00 ? 42  ARG A HH11 1  
ATOM 622   H HH12 . ARG A 1 42  ? 14.946  -17.243 -3.414  1.00 0.00 ? 42  ARG A HH12 1  
ATOM 623   H HH21 . ARG A 1 42  ? 18.299  -16.337 -3.818  1.00 0.00 ? 42  ARG A HH21 1  
ATOM 624   H HH22 . ARG A 1 42  ? 16.692  -16.171 -4.440  1.00 0.00 ? 42  ARG A HH22 1  
ATOM 625   N N    . LEU A 1 43  ? 17.305  -19.602 3.030   1.00 0.00 ? 43  LEU A N    1  
ATOM 626   C CA   . LEU A 1 43  ? 16.889  -20.928 3.474   1.00 0.00 ? 43  LEU A CA   1  
ATOM 627   C C    . LEU A 1 43  ? 15.409  -20.938 3.843   1.00 0.00 ? 43  LEU A C    1  
ATOM 628   O O    . LEU A 1 43  ? 14.720  -21.942 3.660   1.00 0.00 ? 43  LEU A O    1  
ATOM 629   C CB   . LEU A 1 43  ? 17.728  -21.372 4.674   1.00 0.00 ? 43  LEU A CB   1  
ATOM 630   C CG   . LEU A 1 43  ? 19.024  -22.116 4.348   1.00 0.00 ? 43  LEU A CG   1  
ATOM 631   C CD1  . LEU A 1 43  ? 20.158  -21.133 4.106   1.00 0.00 ? 43  LEU A CD1  1  
ATOM 632   C CD2  . LEU A 1 43  ? 19.381  -23.080 5.469   1.00 0.00 ? 43  LEU A CD2  1  
ATOM 633   H H    . LEU A 1 43  ? 18.210  -19.291 3.241   1.00 0.00 ? 43  LEU A H    1  
ATOM 634   H HA   . LEU A 1 43  ? 17.050  -21.616 2.658   1.00 0.00 ? 43  LEU A HA   1  
ATOM 635   H HB2  . LEU A 1 43  ? 17.987  -20.491 5.241   1.00 0.00 ? 43  LEU A HB2  1  
ATOM 636   H HB3  . LEU A 1 43  ? 17.116  -22.022 5.282   1.00 0.00 ? 43  LEU A HB3  1  
ATOM 637   H HG   . LEU A 1 43  ? 18.883  -22.692 3.443   1.00 0.00 ? 43  LEU A HG   1  
ATOM 638   H HD11 . LEU A 1 43  ? 21.022  -21.431 4.680   1.00 0.00 ? 43  LEU A HD11 1  
ATOM 639   H HD12 . LEU A 1 43  ? 19.848  -20.144 4.409   1.00 0.00 ? 43  LEU A HD12 1  
ATOM 640   H HD13 . LEU A 1 43  ? 20.409  -21.124 3.055   1.00 0.00 ? 43  LEU A HD13 1  
ATOM 641   H HD21 . LEU A 1 43  ? 18.794  -23.981 5.371   1.00 0.00 ? 43  LEU A HD21 1  
ATOM 642   H HD22 . LEU A 1 43  ? 19.173  -22.616 6.422   1.00 0.00 ? 43  LEU A HD22 1  
ATOM 643   H HD23 . LEU A 1 43  ? 20.432  -23.326 5.411   1.00 0.00 ? 43  LEU A HD23 1  
ATOM 644   N N    . LYS A 1 44  ? 14.926  -19.815 4.361   1.00 0.00 ? 44  LYS A N    1  
ATOM 645   C CA   . LYS A 1 44  ? 13.526  -19.692 4.753   1.00 0.00 ? 44  LYS A CA   1  
ATOM 646   C C    . LYS A 1 44  ? 12.611  -20.308 3.700   1.00 0.00 ? 44  LYS A C    1  
ATOM 647   O O    . LYS A 1 44  ? 12.786  -20.082 2.503   1.00 0.00 ? 44  LYS A O    1  
ATOM 648   C CB   . LYS A 1 44  ? 13.161  -18.221 4.963   1.00 0.00 ? 44  LYS A CB   1  
ATOM 649   C CG   . LYS A 1 44  ? 11.862  -18.019 5.724   1.00 0.00 ? 44  LYS A CG   1  
ATOM 650   C CD   . LYS A 1 44  ? 11.436  -16.561 5.724   1.00 0.00 ? 44  LYS A CD   1  
ATOM 651   C CE   . LYS A 1 44  ? 10.666  -16.205 4.462   1.00 0.00 ? 44  LYS A CE   1  
ATOM 652   N NZ   . LYS A 1 44  ? 9.678   -15.117 4.703   1.00 0.00 ? 44  LYS A NZ   1  
ATOM 653   H H    . LYS A 1 44  ? 15.525  -19.048 4.483   1.00 0.00 ? 44  LYS A H    1  
ATOM 654   H HA   . LYS A 1 44  ? 13.394  -20.224 5.683   1.00 0.00 ? 44  LYS A HA   1  
ATOM 655   H HB2  . LYS A 1 44  ? 13.956  -17.741 5.516   1.00 0.00 ? 44  LYS A HB2  1  
ATOM 656   H HB3  . LYS A 1 44  ? 13.067  -17.744 3.998   1.00 0.00 ? 44  LYS A HB3  1  
ATOM 657   H HG2  . LYS A 1 44  ? 11.087  -18.609 5.257   1.00 0.00 ? 44  LYS A HG2  1  
ATOM 658   H HG3  . LYS A 1 44  ? 11.999  -18.345 6.745   1.00 0.00 ? 44  LYS A HG3  1  
ATOM 659   H HD2  . LYS A 1 44  ? 10.805  -16.379 6.581   1.00 0.00 ? 44  LYS A HD2  1  
ATOM 660   H HD3  . LYS A 1 44  ? 12.318  -15.938 5.785   1.00 0.00 ? 44  LYS A HD3  1  
ATOM 661   H HE2  . LYS A 1 44  ? 11.366  -15.882 3.707   1.00 0.00 ? 44  LYS A HE2  1  
ATOM 662   H HE3  . LYS A 1 44  ? 10.143  -17.084 4.115   1.00 0.00 ? 44  LYS A HE3  1  
ATOM 663   H HZ1  . LYS A 1 44  ? 9.259   -15.218 5.650   1.00 0.00 ? 44  LYS A HZ1  1  
ATOM 664   H HZ2  . LYS A 1 44  ? 8.919   -15.160 3.993   1.00 0.00 ? 44  LYS A HZ2  1  
ATOM 665   H HZ3  . LYS A 1 44  ? 10.144  -14.190 4.640   1.00 0.00 ? 44  LYS A HZ3  1  
ATOM 666   N N    . ASN A 1 45  ? 11.634  -21.086 4.154   1.00 0.00 ? 45  ASN A N    1  
ATOM 667   C CA   . ASN A 1 45  ? 10.690  -21.734 3.251   1.00 0.00 ? 45  ASN A CA   1  
ATOM 668   C C    . ASN A 1 45  ? 9.308   -21.836 3.889   1.00 0.00 ? 45  ASN A C    1  
ATOM 669   O O    . ASN A 1 45  ? 9.144   -22.446 4.945   1.00 0.00 ? 45  ASN A O    1  
ATOM 670   C CB   . ASN A 1 45  ? 11.192  -23.128 2.869   1.00 0.00 ? 45  ASN A CB   1  
ATOM 671   C CG   . ASN A 1 45  ? 10.853  -24.172 3.916   1.00 0.00 ? 45  ASN A CG   1  
ATOM 672   O OD1  . ASN A 1 45  ? 11.652  -24.454 4.808   1.00 0.00 ? 45  ASN A OD1  1  
ATOM 673   N ND2  . ASN A 1 45  ? 9.663   -24.751 3.810   1.00 0.00 ? 45  ASN A ND2  1  
ATOM 674   H H    . ASN A 1 45  ? 11.545  -21.229 5.120   1.00 0.00 ? 45  ASN A H    1  
ATOM 675   H HA   . ASN A 1 45  ? 10.618  -21.130 2.358   1.00 0.00 ? 45  ASN A HA   1  
ATOM 676   H HB2  . ASN A 1 45  ? 10.739  -23.424 1.934   1.00 0.00 ? 45  ASN A HB2  1  
ATOM 677   H HB3  . ASN A 1 45  ? 12.265  -23.098 2.750   1.00 0.00 ? 45  ASN A HB3  1  
ATOM 678   H HD21 . ASN A 1 45  ? 9.078   -24.476 3.072   1.00 0.00 ? 45  ASN A HD21 1  
ATOM 679   H HD22 . ASN A 1 45  ? 9.417   -25.428 4.473   1.00 0.00 ? 45  ASN A HD22 1  
ATOM 680   N N    . GLY A 1 46  ? 8.316   -21.236 3.239   1.00 0.00 ? 46  GLY A N    1  
ATOM 681   C CA   . GLY A 1 46  ? 6.961   -21.272 3.758   1.00 0.00 ? 46  GLY A CA   1  
ATOM 682   C C    . GLY A 1 46  ? 5.931   -20.884 2.715   1.00 0.00 ? 46  GLY A C    1  
ATOM 683   O O    . GLY A 1 46  ? 6.156   -21.057 1.518   1.00 0.00 ? 46  GLY A O    1  
ATOM 684   H H    . GLY A 1 46  ? 8.505   -20.765 2.401   1.00 0.00 ? 46  GLY A H    1  
ATOM 685   H HA2  . GLY A 1 46  ? 6.747   -22.271 4.107   1.00 0.00 ? 46  GLY A HA2  1  
ATOM 686   H HA3  . GLY A 1 46  ? 6.888   -20.587 4.590   1.00 0.00 ? 46  GLY A HA3  1  
ATOM 687   N N    . GLU A 1 47  ? 4.797   -20.361 3.172   1.00 0.00 ? 47  GLU A N    1  
ATOM 688   C CA   . GLU A 1 47  ? 3.728   -19.951 2.269   1.00 0.00 ? 47  GLU A CA   1  
ATOM 689   C C    . GLU A 1 47  ? 3.285   -18.521 2.564   1.00 0.00 ? 47  GLU A C    1  
ATOM 690   O O    . GLU A 1 47  ? 2.478   -17.947 1.833   1.00 0.00 ? 47  GLU A O    1  
ATOM 691   C CB   . GLU A 1 47  ? 2.535   -20.902 2.391   1.00 0.00 ? 47  GLU A CB   1  
ATOM 692   C CG   . GLU A 1 47  ? 1.897   -20.904 3.770   1.00 0.00 ? 47  GLU A CG   1  
ATOM 693   C CD   . GLU A 1 47  ? 0.413   -21.213 3.726   1.00 0.00 ? 47  GLU A CD   1  
ATOM 694   O OE1  . GLU A 1 47  ? -0.382  -20.273 3.515   1.00 0.00 ? 47  GLU A OE1  1  
ATOM 695   O OE2  . GLU A 1 47  ? 0.046   -22.393 3.902   1.00 0.00 ? 47  GLU A OE2  1  
ATOM 696   H H    . GLU A 1 47  ? 4.676   -20.249 4.138   1.00 0.00 ? 47  GLU A H    1  
ATOM 697   H HA   . GLU A 1 47  ? 4.110   -19.996 1.260   1.00 0.00 ? 47  GLU A HA   1  
ATOM 698   H HB2  . GLU A 1 47  ? 1.784   -20.612 1.670   1.00 0.00 ? 47  GLU A HB2  1  
ATOM 699   H HB3  . GLU A 1 47  ? 2.866   -21.905 2.169   1.00 0.00 ? 47  GLU A HB3  1  
ATOM 700   H HG2  . GLU A 1 47  ? 2.386   -21.651 4.377   1.00 0.00 ? 47  GLU A HG2  1  
ATOM 701   H HG3  . GLU A 1 47  ? 2.034   -19.931 4.218   1.00 0.00 ? 47  GLU A HG3  1  
ATOM 702   N N    . GLU A 1 48  ? 3.818   -17.953 3.641   1.00 0.00 ? 48  GLU A N    1  
ATOM 703   C CA   . GLU A 1 48  ? 3.477   -16.590 4.033   1.00 0.00 ? 48  GLU A CA   1  
ATOM 704   C C    . GLU A 1 48  ? 3.886   -15.594 2.952   1.00 0.00 ? 48  GLU A C    1  
ATOM 705   O O    . GLU A 1 48  ? 4.495   -15.965 1.948   1.00 0.00 ? 48  GLU A O    1  
ATOM 706   C CB   . GLU A 1 48  ? 4.156   -16.232 5.357   1.00 0.00 ? 48  GLU A CB   1  
ATOM 707   C CG   . GLU A 1 48  ? 3.865   -17.216 6.477   1.00 0.00 ? 48  GLU A CG   1  
ATOM 708   C CD   . GLU A 1 48  ? 2.624   -16.850 7.268   1.00 0.00 ? 48  GLU A CD   1  
ATOM 709   O OE1  . GLU A 1 48  ? 2.520   -15.683 7.699   1.00 0.00 ? 48  GLU A OE1  1  
ATOM 710   O OE2  . GLU A 1 48  ? 1.759   -17.730 7.455   1.00 0.00 ? 48  GLU A OE2  1  
ATOM 711   H H    . GLU A 1 48  ? 4.456   -18.461 4.184   1.00 0.00 ? 48  GLU A H    1  
ATOM 712   H HA   . GLU A 1 48  ? 2.406   -16.541 4.164   1.00 0.00 ? 48  GLU A HA   1  
ATOM 713   H HB2  . GLU A 1 48  ? 5.225   -16.199 5.202   1.00 0.00 ? 48  GLU A HB2  1  
ATOM 714   H HB3  . GLU A 1 48  ? 3.817   -15.255 5.668   1.00 0.00 ? 48  GLU A HB3  1  
ATOM 715   H HG2  . GLU A 1 48  ? 3.724   -18.198 6.048   1.00 0.00 ? 48  GLU A HG2  1  
ATOM 716   H HG3  . GLU A 1 48  ? 4.710   -17.237 7.149   1.00 0.00 ? 48  GLU A HG3  1  
ATOM 717   N N    . LEU A 1 49  ? 3.548   -14.327 3.165   1.00 0.00 ? 49  LEU A N    1  
ATOM 718   C CA   . LEU A 1 49  ? 3.879   -13.276 2.210   1.00 0.00 ? 49  LEU A CA   1  
ATOM 719   C C    . LEU A 1 49  ? 4.698   -12.174 2.875   1.00 0.00 ? 49  LEU A C    1  
ATOM 720   O O    . LEU A 1 49  ? 4.602   -11.957 4.083   1.00 0.00 ? 49  LEU A O    1  
ATOM 721   C CB   . LEU A 1 49  ? 2.602   -12.686 1.608   1.00 0.00 ? 49  LEU A CB   1  
ATOM 722   C CG   . LEU A 1 49  ? 1.368   -12.695 2.510   1.00 0.00 ? 49  LEU A CG   1  
ATOM 723   C CD1  . LEU A 1 49  ? 0.931   -14.123 2.801   1.00 0.00 ? 49  LEU A CD1  1  
ATOM 724   C CD2  . LEU A 1 49  ? 1.649   -11.947 3.806   1.00 0.00 ? 49  LEU A CD2  1  
ATOM 725   H H    . LEU A 1 49  ? 3.064   -14.092 3.984   1.00 0.00 ? 49  LEU A H    1  
ATOM 726   H HA   . LEU A 1 49  ? 4.468   -13.719 1.421   1.00 0.00 ? 49  LEU A HA   1  
ATOM 727   H HB2  . LEU A 1 49  ? 2.807   -11.661 1.339   1.00 0.00 ? 49  LEU A HB2  1  
ATOM 728   H HB3  . LEU A 1 49  ? 2.367   -13.250 0.717   1.00 0.00 ? 49  LEU A HB3  1  
ATOM 729   H HG   . LEU A 1 49  ? 0.555   -12.195 2.003   1.00 0.00 ? 49  LEU A HG   1  
ATOM 730   H HD11 . LEU A 1 49  ? -0.102  -14.248 2.514   1.00 0.00 ? 49  LEU A HD11 1  
ATOM 731   H HD12 . LEU A 1 49  ? 1.038   -14.324 3.857   1.00 0.00 ? 49  LEU A HD12 1  
ATOM 732   H HD13 . LEU A 1 49  ? 1.547   -14.809 2.240   1.00 0.00 ? 49  LEU A HD13 1  
ATOM 733   H HD21 . LEU A 1 49  ? 1.862   -12.656 4.592   1.00 0.00 ? 49  LEU A HD21 1  
ATOM 734   H HD22 . LEU A 1 49  ? 0.784   -11.359 4.075   1.00 0.00 ? 49  LEU A HD22 1  
ATOM 735   H HD23 . LEU A 1 49  ? 2.499   -11.295 3.667   1.00 0.00 ? 49  LEU A HD23 1  
ATOM 736   N N    . LYS A 1 50  ? 5.502   -11.479 2.077   1.00 0.00 ? 50  LYS A N    1  
ATOM 737   C CA   . LYS A 1 50  ? 6.336   -10.397 2.586   1.00 0.00 ? 50  LYS A CA   1  
ATOM 738   C C    . LYS A 1 50  ? 6.078   -9.104  1.819   1.00 0.00 ? 50  LYS A C    1  
ATOM 739   O O    . LYS A 1 50  ? 6.459   -8.021  2.262   1.00 0.00 ? 50  LYS A O    1  
ATOM 740   C CB   . LYS A 1 50  ? 7.816   -10.774 2.486   1.00 0.00 ? 50  LYS A CB   1  
ATOM 741   C CG   . LYS A 1 50  ? 8.220   -11.291 1.116   1.00 0.00 ? 50  LYS A CG   1  
ATOM 742   C CD   . LYS A 1 50  ? 8.057   -12.799 1.018   1.00 0.00 ? 50  LYS A CD   1  
ATOM 743   C CE   . LYS A 1 50  ? 9.274   -13.527 1.569   1.00 0.00 ? 50  LYS A CE   1  
ATOM 744   N NZ   . LYS A 1 50  ? 9.316   -14.948 1.126   1.00 0.00 ? 50  LYS A NZ   1  
ATOM 745   H H    . LYS A 1 50  ? 5.535   -11.699 1.122   1.00 0.00 ? 50  LYS A H    1  
ATOM 746   H HA   . LYS A 1 50  ? 6.082   -10.242 3.624   1.00 0.00 ? 50  LYS A HA   1  
ATOM 747   H HB2  . LYS A 1 50  ? 8.413   -9.903  2.710   1.00 0.00 ? 50  LYS A HB2  1  
ATOM 748   H HB3  . LYS A 1 50  ? 8.028   -11.544 3.215   1.00 0.00 ? 50  LYS A HB3  1  
ATOM 749   H HG2  . LYS A 1 50  ? 7.598   -10.823 0.367   1.00 0.00 ? 50  LYS A HG2  1  
ATOM 750   H HG3  . LYS A 1 50  ? 9.255   -11.037 0.937   1.00 0.00 ? 50  LYS A HG3  1  
ATOM 751   H HD2  . LYS A 1 50  ? 7.187   -13.096 1.584   1.00 0.00 ? 50  LYS A HD2  1  
ATOM 752   H HD3  . LYS A 1 50  ? 7.925   -13.071 -0.019  1.00 0.00 ? 50  LYS A HD3  1  
ATOM 753   H HE2  . LYS A 1 50  ? 10.164  -13.025 1.225   1.00 0.00 ? 50  LYS A HE2  1  
ATOM 754   H HE3  . LYS A 1 50  ? 9.237   -13.496 2.648   1.00 0.00 ? 50  LYS A HE3  1  
ATOM 755   H HZ1  . LYS A 1 50  ? 9.227   -15.003 0.091   1.00 0.00 ? 50  LYS A HZ1  1  
ATOM 756   H HZ2  . LYS A 1 50  ? 8.535   -15.481 1.559   1.00 0.00 ? 50  LYS A HZ2  1  
ATOM 757   H HZ3  . LYS A 1 50  ? 10.217  -15.384 1.409   1.00 0.00 ? 50  LYS A HZ3  1  
ATOM 758   N N    . GLY A 1 51  ? 5.425   -9.225  0.667   1.00 0.00 ? 51  GLY A N    1  
ATOM 759   C CA   . GLY A 1 51  ? 5.126   -8.058  -0.142  1.00 0.00 ? 51  GLY A CA   1  
ATOM 760   C C    . GLY A 1 51  ? 4.494   -6.940  0.663   1.00 0.00 ? 51  GLY A C    1  
ATOM 761   O O    . GLY A 1 51  ? 4.280   -7.079  1.868   1.00 0.00 ? 51  GLY A O    1  
ATOM 762   H H    . GLY A 1 51  ? 5.145   -10.114 0.364   1.00 0.00 ? 51  GLY A H    1  
ATOM 763   H HA2  . GLY A 1 51  ? 6.042   -7.695  -0.584  1.00 0.00 ? 51  GLY A HA2  1  
ATOM 764   H HA3  . GLY A 1 51  ? 4.447   -8.346  -0.931  1.00 0.00 ? 51  GLY A HA3  1  
ATOM 765   N N    . ILE A 1 52  ? 4.195   -5.830  -0.002  1.00 0.00 ? 52  ILE A N    1  
ATOM 766   C CA   . ILE A 1 52  ? 3.584   -4.684  0.661   1.00 0.00 ? 52  ILE A CA   1  
ATOM 767   C C    . ILE A 1 52  ? 2.065   -4.811  0.689   1.00 0.00 ? 52  ILE A C    1  
ATOM 768   O O    . ILE A 1 52  ? 1.437   -5.103  -0.329  1.00 0.00 ? 52  ILE A O    1  
ATOM 769   C CB   . ILE A 1 52  ? 3.965   -3.363  -0.033  1.00 0.00 ? 52  ILE A CB   1  
ATOM 770   C CG1  . ILE A 1 52  ? 5.447   -3.371  -0.414  1.00 0.00 ? 52  ILE A CG1  1  
ATOM 771   C CG2  . ILE A 1 52  ? 3.651   -2.180  0.870   1.00 0.00 ? 52  ILE A CG2  1  
ATOM 772   C CD1  . ILE A 1 52  ? 6.364   -3.740  0.731   1.00 0.00 ? 52  ILE A CD1  1  
ATOM 773   H H    . ILE A 1 52  ? 4.390   -5.780  -0.961  1.00 0.00 ? 52  ILE A H    1  
ATOM 774   H HA   . ILE A 1 52  ? 3.951   -4.652  1.677   1.00 0.00 ? 52  ILE A HA   1  
ATOM 775   H HB   . ILE A 1 52  ? 3.371   -3.269  -0.929  1.00 0.00 ? 52  ILE A HB   1  
ATOM 776   H HG12 . ILE A 1 52  ? 5.604   -4.084  -1.208  1.00 0.00 ? 52  ILE A HG12 1  
ATOM 777   H HG13 . ILE A 1 52  ? 5.727   -2.386  -0.760  1.00 0.00 ? 52  ILE A HG13 1  
ATOM 778   H HG21 . ILE A 1 52  ? 2.600   -2.187  1.120   1.00 0.00 ? 52  ILE A HG21 1  
ATOM 779   H HG22 . ILE A 1 52  ? 4.235   -2.254  1.775   1.00 0.00 ? 52  ILE A HG22 1  
ATOM 780   H HG23 . ILE A 1 52  ? 3.894   -1.261  0.358   1.00 0.00 ? 52  ILE A HG23 1  
ATOM 781   H HD11 . ILE A 1 52  ? 5.783   -3.847  1.636   1.00 0.00 ? 52  ILE A HD11 1  
ATOM 782   H HD12 . ILE A 1 52  ? 6.857   -4.675  0.510   1.00 0.00 ? 52  ILE A HD12 1  
ATOM 783   H HD13 . ILE A 1 52  ? 7.102   -2.965  0.866   1.00 0.00 ? 52  ILE A HD13 1  
ATOM 784   N N    . PHE A 1 53  ? 1.480   -4.588  1.861   1.00 0.00 ? 53  PHE A N    1  
ATOM 785   C CA   . PHE A 1 53  ? 0.033   -4.676  2.022   1.00 0.00 ? 53  PHE A CA   1  
ATOM 786   C C    . PHE A 1 53  ? -0.529  -3.383  2.606   1.00 0.00 ? 53  PHE A C    1  
ATOM 787   O O    . PHE A 1 53  ? 0.113   -2.731  3.430   1.00 0.00 ? 53  PHE A O    1  
ATOM 788   C CB   . PHE A 1 53  ? -0.330  -5.857  2.926   1.00 0.00 ? 53  PHE A CB   1  
ATOM 789   C CG   . PHE A 1 53  ? 0.085   -7.188  2.368   1.00 0.00 ? 53  PHE A CG   1  
ATOM 790   C CD1  . PHE A 1 53  ? 1.423   -7.479  2.155   1.00 0.00 ? 53  PHE A CD1  1  
ATOM 791   C CD2  . PHE A 1 53  ? -0.864  -8.148  2.055   1.00 0.00 ? 53  PHE A CD2  1  
ATOM 792   C CE1  . PHE A 1 53  ? 1.807   -8.704  1.642   1.00 0.00 ? 53  PHE A CE1  1  
ATOM 793   C CE2  . PHE A 1 53  ? -0.485  -9.375  1.542   1.00 0.00 ? 53  PHE A CE2  1  
ATOM 794   C CZ   . PHE A 1 53  ? 0.852   -9.652  1.334   1.00 0.00 ? 53  PHE A CZ   1  
ATOM 795   H H    . PHE A 1 53  ? 2.034   -4.359  2.636   1.00 0.00 ? 53  PHE A H    1  
ATOM 796   H HA   . PHE A 1 53  ? -0.399  -4.835  1.046   1.00 0.00 ? 53  PHE A HA   1  
ATOM 797   H HB2  . PHE A 1 53  ? 0.157   -5.732  3.881   1.00 0.00 ? 53  PHE A HB2  1  
ATOM 798   H HB3  . PHE A 1 53  ? -1.399  -5.874  3.071   1.00 0.00 ? 53  PHE A HB3  1  
ATOM 799   H HD1  . PHE A 1 53  ? 2.171   -6.737  2.396   1.00 0.00 ? 53  PHE A HD1  1  
ATOM 800   H HD2  . PHE A 1 53  ? -1.910  -7.933  2.215   1.00 0.00 ? 53  PHE A HD2  1  
ATOM 801   H HE1  . PHE A 1 53  ? 2.854   -8.917  1.481   1.00 0.00 ? 53  PHE A HE1  1  
ATOM 802   H HE2  . PHE A 1 53  ? -1.234  -10.114 1.302   1.00 0.00 ? 53  PHE A HE2  1  
ATOM 803   H HZ   . PHE A 1 53  ? 1.150   -10.610 0.934   1.00 0.00 ? 53  PHE A HZ   1  
ATOM 804   N N    . ILE A 1 54  ? -1.731  -3.019  2.172   1.00 0.00 ? 54  ILE A N    1  
ATOM 805   C CA   . ILE A 1 54  ? -2.380  -1.805  2.651   1.00 0.00 ? 54  ILE A CA   1  
ATOM 806   C C    . ILE A 1 54  ? -2.545  -1.831  4.166   1.00 0.00 ? 54  ILE A C    1  
ATOM 807   O O    . ILE A 1 54  ? -3.249  -2.682  4.711   1.00 0.00 ? 54  ILE A O    1  
ATOM 808   C CB   . ILE A 1 54  ? -3.761  -1.610  1.998   1.00 0.00 ? 54  ILE A CB   1  
ATOM 809   C CG1  . ILE A 1 54  ? -3.640  -1.652  0.473   1.00 0.00 ? 54  ILE A CG1  1  
ATOM 810   C CG2  . ILE A 1 54  ? -4.380  -0.295  2.449   1.00 0.00 ? 54  ILE A CG2  1  
ATOM 811   C CD1  . ILE A 1 54  ? -4.908  -1.247  -0.245  1.00 0.00 ? 54  ILE A CD1  1  
ATOM 812   H H    . ILE A 1 54  ? -2.192  -3.580  1.514   1.00 0.00 ? 54  ILE A H    1  
ATOM 813   H HA   . ILE A 1 54  ? -1.755  -0.965  2.382   1.00 0.00 ? 54  ILE A HA   1  
ATOM 814   H HB   . ILE A 1 54  ? -4.405  -2.413  2.323   1.00 0.00 ? 54  ILE A HB   1  
ATOM 815   H HG12 . ILE A 1 54  ? -2.854  -0.982  0.162   1.00 0.00 ? 54  ILE A HG12 1  
ATOM 816   H HG13 . ILE A 1 54  ? -3.391  -2.658  0.167   1.00 0.00 ? 54  ILE A HG13 1  
ATOM 817   H HG21 . ILE A 1 54  ? -5.454  -0.399  2.495   1.00 0.00 ? 54  ILE A HG21 1  
ATOM 818   H HG22 . ILE A 1 54  ? -4.002  -0.038  3.428   1.00 0.00 ? 54  ILE A HG22 1  
ATOM 819   H HG23 . ILE A 1 54  ? -4.123  0.484   1.748   1.00 0.00 ? 54  ILE A HG23 1  
ATOM 820   H HD11 . ILE A 1 54  ? -5.118  -1.957  -1.032  1.00 0.00 ? 54  ILE A HD11 1  
ATOM 821   H HD12 . ILE A 1 54  ? -5.730  -1.234  0.455   1.00 0.00 ? 54  ILE A HD12 1  
ATOM 822   H HD13 . ILE A 1 54  ? -4.782  -0.264  -0.673  1.00 0.00 ? 54  ILE A HD13 1  
ATOM 823   N N    . LYS A 1 55  ? -1.893  -0.892  4.843   1.00 0.00 ? 55  LYS A N    1  
ATOM 824   C CA   . LYS A 1 55  ? -1.969  -0.804  6.297   1.00 0.00 ? 55  LYS A CA   1  
ATOM 825   C C    . LYS A 1 55  ? -3.301  -0.203  6.737   1.00 0.00 ? 55  LYS A C    1  
ATOM 826   O O    . LYS A 1 55  ? -3.974  -0.741  7.616   1.00 0.00 ? 55  LYS A O    1  
ATOM 827   C CB   . LYS A 1 55  ? -0.813  0.039   6.839   1.00 0.00 ? 55  LYS A CB   1  
ATOM 828   C CG   . LYS A 1 55  ? -1.055  0.575   8.239   1.00 0.00 ? 55  LYS A CG   1  
ATOM 829   C CD   . LYS A 1 55  ? -1.395  -0.542  9.212   1.00 0.00 ? 55  LYS A CD   1  
ATOM 830   C CE   . LYS A 1 55  ? -2.180  -0.021  10.406  1.00 0.00 ? 55  LYS A CE   1  
ATOM 831   N NZ   . LYS A 1 55  ? -3.649  -0.063  10.165  1.00 0.00 ? 55  LYS A NZ   1  
ATOM 832   H H    . LYS A 1 55  ? -1.348  -0.242  4.353   1.00 0.00 ? 55  LYS A H    1  
ATOM 833   H HA   . LYS A 1 55  ? -1.891  -1.805  6.694   1.00 0.00 ? 55  LYS A HA   1  
ATOM 834   H HB2  . LYS A 1 55  ? 0.081   -0.567  6.856   1.00 0.00 ? 55  LYS A HB2  1  
ATOM 835   H HB3  . LYS A 1 55  ? -0.655  0.879   6.177   1.00 0.00 ? 55  LYS A HB3  1  
ATOM 836   H HG2  . LYS A 1 55  ? -0.162  1.076   8.582   1.00 0.00 ? 55  LYS A HG2  1  
ATOM 837   H HG3  . LYS A 1 55  ? -1.876  1.277   8.209   1.00 0.00 ? 55  LYS A HG3  1  
ATOM 838   H HD2  . LYS A 1 55  ? -1.990  -1.284  8.701   1.00 0.00 ? 55  LYS A HD2  1  
ATOM 839   H HD3  . LYS A 1 55  ? -0.478  -0.993  9.564   1.00 0.00 ? 55  LYS A HD3  1  
ATOM 840   H HE2  . LYS A 1 55  ? -1.948  -0.629  11.266  1.00 0.00 ? 55  LYS A HE2  1  
ATOM 841   H HE3  . LYS A 1 55  ? -1.884  1.000   10.597  1.00 0.00 ? 55  LYS A HE3  1  
ATOM 842   H HZ1  . LYS A 1 55  ? -4.147  0.486   10.894  1.00 0.00 ? 55  LYS A HZ1  1  
ATOM 843   H HZ2  . LYS A 1 55  ? -3.988  -1.046  10.195  1.00 0.00 ? 55  LYS A HZ2  1  
ATOM 844   H HZ3  . LYS A 1 55  ? -3.870  0.339   9.232   1.00 0.00 ? 55  LYS A HZ3  1  
ATOM 845   N N    . GLN A 1 56  ? -3.674  0.912   6.118   1.00 0.00 ? 56  GLN A N    1  
ATOM 846   C CA   . GLN A 1 56  ? -4.925  1.585   6.447   1.00 0.00 ? 56  GLN A CA   1  
ATOM 847   C C    . GLN A 1 56  ? -5.259  2.651   5.408   1.00 0.00 ? 56  GLN A C    1  
ATOM 848   O O    . GLN A 1 56  ? -4.366  3.254   4.813   1.00 0.00 ? 56  GLN A O    1  
ATOM 849   C CB   . GLN A 1 56  ? -4.839  2.219   7.836   1.00 0.00 ? 56  GLN A CB   1  
ATOM 850   C CG   . GLN A 1 56  ? -5.481  3.595   7.918   1.00 0.00 ? 56  GLN A CG   1  
ATOM 851   C CD   . GLN A 1 56  ? -5.793  4.009   9.342   1.00 0.00 ? 56  GLN A CD   1  
ATOM 852   O OE1  . GLN A 1 56  ? -5.769  3.188   10.259  1.00 0.00 ? 56  GLN A OE1  1  
ATOM 853   N NE2  . GLN A 1 56  ? -6.090  5.289   9.535   1.00 0.00 ? 56  GLN A NE2  1  
ATOM 854   H H    . GLN A 1 56  ? -3.094  1.292   5.426   1.00 0.00 ? 56  GLN A H    1  
ATOM 855   H HA   . GLN A 1 56  ? -5.710  0.843   6.448   1.00 0.00 ? 56  GLN A HA   1  
ATOM 856   H HB2  . GLN A 1 56  ? -5.333  1.572   8.545   1.00 0.00 ? 56  GLN A HB2  1  
ATOM 857   H HB3  . GLN A 1 56  ? -3.799  2.314   8.111   1.00 0.00 ? 56  GLN A HB3  1  
ATOM 858   H HG2  . GLN A 1 56  ? -4.805  4.320   7.489   1.00 0.00 ? 56  GLN A HG2  1  
ATOM 859   H HG3  . GLN A 1 56  ? -6.400  3.583   7.351   1.00 0.00 ? 56  GLN A HG3  1  
ATOM 860   H HE21 . GLN A 1 56  ? -6.091  5.886   8.757   1.00 0.00 ? 56  GLN A HE21 1  
ATOM 861   H HE22 . GLN A 1 56  ? -6.297  5.584   10.445  1.00 0.00 ? 56  GLN A HE22 1  
ATOM 862   N N    . VAL A 1 57  ? -6.552  2.877   5.194   1.00 0.00 ? 57  VAL A N    1  
ATOM 863   C CA   . VAL A 1 57  ? -7.004  3.871   4.227   1.00 0.00 ? 57  VAL A CA   1  
ATOM 864   C C    . VAL A 1 57  ? -8.042  4.802   4.842   1.00 0.00 ? 57  VAL A C    1  
ATOM 865   O O    . VAL A 1 57  ? -9.053  4.352   5.384   1.00 0.00 ? 57  VAL A O    1  
ATOM 866   C CB   . VAL A 1 57  ? -7.605  3.203   2.976   1.00 0.00 ? 57  VAL A CB   1  
ATOM 867   C CG1  . VAL A 1 57  ? -8.525  4.169   2.246   1.00 0.00 ? 57  VAL A CG1  1  
ATOM 868   C CG2  . VAL A 1 57  ? -6.501  2.706   2.055   1.00 0.00 ? 57  VAL A CG2  1  
ATOM 869   H H    . VAL A 1 57  ? -7.217  2.364   5.699   1.00 0.00 ? 57  VAL A H    1  
ATOM 870   H HA   . VAL A 1 57  ? -6.147  4.454   3.922   1.00 0.00 ? 57  VAL A HA   1  
ATOM 871   H HB   . VAL A 1 57  ? -8.191  2.353   3.293   1.00 0.00 ? 57  VAL A HB   1  
ATOM 872   H HG11 . VAL A 1 57  ? -7.975  5.062   1.984   1.00 0.00 ? 57  VAL A HG11 1  
ATOM 873   H HG12 . VAL A 1 57  ? -8.901  3.700   1.348   1.00 0.00 ? 57  VAL A HG12 1  
ATOM 874   H HG13 . VAL A 1 57  ? -9.353  4.433   2.888   1.00 0.00 ? 57  VAL A HG13 1  
ATOM 875   H HG21 . VAL A 1 57  ? -5.773  2.155   2.631   1.00 0.00 ? 57  VAL A HG21 1  
ATOM 876   H HG22 . VAL A 1 57  ? -6.926  2.062   1.300   1.00 0.00 ? 57  VAL A HG22 1  
ATOM 877   H HG23 . VAL A 1 57  ? -6.021  3.549   1.580   1.00 0.00 ? 57  VAL A HG23 1  
ATOM 878   N N    . LEU A 1 58  ? -7.788  6.103   4.754   1.00 0.00 ? 58  LEU A N    1  
ATOM 879   C CA   . LEU A 1 58  ? -8.702  7.100   5.301   1.00 0.00 ? 58  LEU A CA   1  
ATOM 880   C C    . LEU A 1 58  ? -9.971  7.194   4.461   1.00 0.00 ? 58  LEU A C    1  
ATOM 881   O O    . LEU A 1 58  ? -10.095 6.533   3.430   1.00 0.00 ? 58  LEU A O    1  
ATOM 882   C CB   . LEU A 1 58  ? -8.017  8.466   5.366   1.00 0.00 ? 58  LEU A CB   1  
ATOM 883   C CG   . LEU A 1 58  ? -6.780  8.555   6.260   1.00 0.00 ? 58  LEU A CG   1  
ATOM 884   C CD1  . LEU A 1 58  ? -5.652  7.704   5.697   1.00 0.00 ? 58  LEU A CD1  1  
ATOM 885   C CD2  . LEU A 1 58  ? -6.334  10.002  6.412   1.00 0.00 ? 58  LEU A CD2  1  
ATOM 886   H H    . LEU A 1 58  ? -6.967  6.401   4.310   1.00 0.00 ? 58  LEU A H    1  
ATOM 887   H HA   . LEU A 1 58  ? -8.968  6.792   6.301   1.00 0.00 ? 58  LEU A HA   1  
ATOM 888   H HB2  . LEU A 1 58  ? -7.721  8.736   4.364   1.00 0.00 ? 58  LEU A HB2  1  
ATOM 889   H HB3  . LEU A 1 58  ? -8.741  9.181   5.730   1.00 0.00 ? 58  LEU A HB3  1  
ATOM 890   H HG   . LEU A 1 58  ? -7.025  8.175   7.242   1.00 0.00 ? 58  LEU A HG   1  
ATOM 891   H HD11 . LEU A 1 58  ? -5.544  7.903   4.641   1.00 0.00 ? 58  LEU A HD11 1  
ATOM 892   H HD12 . LEU A 1 58  ? -5.881  6.659   5.845   1.00 0.00 ? 58  LEU A HD12 1  
ATOM 893   H HD13 . LEU A 1 58  ? -4.730  7.946   6.206   1.00 0.00 ? 58  LEU A HD13 1  
ATOM 894   H HD21 . LEU A 1 58  ? -5.679  10.089  7.266   1.00 0.00 ? 58  LEU A HD21 1  
ATOM 895   H HD22 . LEU A 1 58  ? -7.200  10.632  6.555   1.00 0.00 ? 58  LEU A HD22 1  
ATOM 896   H HD23 . LEU A 1 58  ? -5.808  10.312  5.520   1.00 0.00 ? 58  LEU A HD23 1  
ATOM 897   N N    . GLU A 1 59  ? -10.910 8.022   4.907   1.00 0.00 ? 59  GLU A N    1  
ATOM 898   C CA   . GLU A 1 59  ? -12.170 8.204   4.195   1.00 0.00 ? 59  GLU A CA   1  
ATOM 899   C C    . GLU A 1 59  ? -12.161 9.505   3.397   1.00 0.00 ? 59  GLU A C    1  
ATOM 900   O O    . GLU A 1 59  ? -12.584 9.539   2.241   1.00 0.00 ? 59  GLU A O    1  
ATOM 901   C CB   . GLU A 1 59  ? -13.342 8.204   5.179   1.00 0.00 ? 59  GLU A CB   1  
ATOM 902   C CG   . GLU A 1 59  ? -14.703 8.230   4.503   1.00 0.00 ? 59  GLU A CG   1  
ATOM 903   C CD   . GLU A 1 59  ? -15.823 7.803   5.431   1.00 0.00 ? 59  GLU A CD   1  
ATOM 904   O OE1  . GLU A 1 59  ? -15.522 7.281   6.525   1.00 0.00 ? 59  GLU A OE1  1  
ATOM 905   O OE2  . GLU A 1 59  ? -17.002 7.990   5.064   1.00 0.00 ? 59  GLU A OE2  1  
ATOM 906   H H    . GLU A 1 59  ? -10.753 8.522   5.735   1.00 0.00 ? 59  GLU A H    1  
ATOM 907   H HA   . GLU A 1 59  ? -12.286 7.377   3.511   1.00 0.00 ? 59  GLU A HA   1  
ATOM 908   H HB2  . GLU A 1 59  ? -13.283 7.315   5.790   1.00 0.00 ? 59  GLU A HB2  1  
ATOM 909   H HB3  . GLU A 1 59  ? -13.262 9.073   5.814   1.00 0.00 ? 59  GLU A HB3  1  
ATOM 910   H HG2  . GLU A 1 59  ? -14.902 9.235   4.163   1.00 0.00 ? 59  GLU A HG2  1  
ATOM 911   H HG3  . GLU A 1 59  ? -14.683 7.561   3.655   1.00 0.00 ? 59  GLU A HG3  1  
ATOM 912   N N    . ASP A 1 60  ? -11.678 10.572  4.023   1.00 0.00 ? 60  ASP A N    1  
ATOM 913   C CA   . ASP A 1 60  ? -11.614 11.876  3.373   1.00 0.00 ? 60  ASP A CA   1  
ATOM 914   C C    . ASP A 1 60  ? -10.370 11.984  2.496   1.00 0.00 ? 60  ASP A C    1  
ATOM 915   O O    . ASP A 1 60  ? -9.727  13.033  2.440   1.00 0.00 ? 60  ASP A O    1  
ATOM 916   C CB   . ASP A 1 60  ? -11.614 12.992  4.418   1.00 0.00 ? 60  ASP A CB   1  
ATOM 917   C CG   . ASP A 1 60  ? -10.230 13.271  4.968   1.00 0.00 ? 60  ASP A CG   1  
ATOM 918   O OD1  . ASP A 1 60  ? -9.505  12.300  5.271   1.00 0.00 ? 60  ASP A OD1  1  
ATOM 919   O OD2  . ASP A 1 60  ? -9.871  14.460  5.098   1.00 0.00 ? 60  ASP A OD2  1  
ATOM 920   H H    . ASP A 1 60  ? -11.356 10.481  4.945   1.00 0.00 ? 60  ASP A H    1  
ATOM 921   H HA   . ASP A 1 60  ? -12.489 11.979  2.749   1.00 0.00 ? 60  ASP A HA   1  
ATOM 922   H HB2  . ASP A 1 60  ? -11.992 13.898  3.967   1.00 0.00 ? 60  ASP A HB2  1  
ATOM 923   H HB3  . ASP A 1 60  ? -12.258 12.708  5.238   1.00 0.00 ? 60  ASP A HB3  1  
ATOM 924   N N    . SER A 1 61  ? -10.036 10.894  1.813   1.00 0.00 ? 61  SER A N    1  
ATOM 925   C CA   . SER A 1 61  ? -8.867  10.865  0.942   1.00 0.00 ? 61  SER A CA   1  
ATOM 926   C C    . SER A 1 61  ? -9.244  10.391  -0.458  1.00 0.00 ? 61  SER A C    1  
ATOM 927   O O    . SER A 1 61  ? -10.335 9.871   -0.693  1.00 0.00 ? 61  SER A O    1  
ATOM 928   C CB   . SER A 1 61  ? -7.790  9.951   1.530   1.00 0.00 ? 61  SER A CB   1  
ATOM 929   O OG   . SER A 1 61  ? -7.609  8.796   0.730   1.00 0.00 ? 61  SER A OG   1  
ATOM 930   H H    . SER A 1 61  ? -10.589 10.089  1.899   1.00 0.00 ? 61  SER A H    1  
ATOM 931   H HA   . SER A 1 61  ? -8.478  11.870  0.877   1.00 0.00 ? 61  SER A HA   1  
ATOM 932   H HB2  . SER A 1 61  ? -6.855  10.488  1.582   1.00 0.00 ? 61  SER A HB2  1  
ATOM 933   H HB3  . SER A 1 61  ? -8.085  9.645   2.523   1.00 0.00 ? 61  SER A HB3  1  
ATOM 934   H HG   . SER A 1 61  ? -8.064  8.053   1.133   1.00 0.00 ? 61  SER A HG   1  
ATOM 935   N N    . PRO A 1 62  ? -8.319  10.574  -1.412  1.00 0.00 ? 62  PRO A N    1  
ATOM 936   C CA   . PRO A 1 62  ? -8.530  10.171  -2.806  1.00 0.00 ? 62  PRO A CA   1  
ATOM 937   C C    . PRO A 1 62  ? -8.547  8.656   -2.976  1.00 0.00 ? 62  PRO A C    1  
ATOM 938   O O    . PRO A 1 62  ? -9.043  8.140   -3.977  1.00 0.00 ? 62  PRO A O    1  
ATOM 939   C CB   . PRO A 1 62  ? -7.329  10.778  -3.536  1.00 0.00 ? 62  PRO A CB   1  
ATOM 940   C CG   . PRO A 1 62  ? -6.274  10.901  -2.491  1.00 0.00 ? 62  PRO A CG   1  
ATOM 941   C CD   . PRO A 1 62  ? -6.997  11.186  -1.204  1.00 0.00 ? 62  PRO A CD   1  
ATOM 942   H HA   . PRO A 1 62  ? -9.443  10.588  -3.205  1.00 0.00 ? 62  PRO A HA   1  
ATOM 943   H HB2  . PRO A 1 62  ? -7.020  10.118  -4.335  1.00 0.00 ? 62  PRO A HB2  1  
ATOM 944   H HB3  . PRO A 1 62  ? -7.598  11.742  -3.941  1.00 0.00 ? 62  PRO A HB3  1  
ATOM 945   H HG2  . PRO A 1 62  ? -5.723  9.975   -2.415  1.00 0.00 ? 62  PRO A HG2  1  
ATOM 946   H HG3  . PRO A 1 62  ? -5.609  11.716  -2.736  1.00 0.00 ? 62  PRO A HG3  1  
ATOM 947   H HD2  . PRO A 1 62  ? -6.484  10.725  -0.373  1.00 0.00 ? 62  PRO A HD2  1  
ATOM 948   H HD3  . PRO A 1 62  ? -7.086  12.252  -1.050  1.00 0.00 ? 62  PRO A HD3  1  
ATOM 949   N N    . ALA A 1 63  ? -8.003  7.949   -1.991  1.00 0.00 ? 63  ALA A N    1  
ATOM 950   C CA   . ALA A 1 63  ? -7.959  6.492   -2.031  1.00 0.00 ? 63  ALA A CA   1  
ATOM 951   C C    . ALA A 1 63  ? -9.152  5.886   -1.300  1.00 0.00 ? 63  ALA A C    1  
ATOM 952   O O    . ALA A 1 63  ? -9.558  4.760   -1.581  1.00 0.00 ? 63  ALA A O    1  
ATOM 953   C CB   . ALA A 1 63  ? -6.656  5.987   -1.428  1.00 0.00 ? 63  ALA A CB   1  
ATOM 954   H H    . ALA A 1 63  ? -7.624  8.417   -1.219  1.00 0.00 ? 63  ALA A H    1  
ATOM 955   H HA   . ALA A 1 63  ? -7.990  6.186   -3.067  1.00 0.00 ? 63  ALA A HA   1  
ATOM 956   H HB1  . ALA A 1 63  ? -6.630  6.227   -0.376  1.00 0.00 ? 63  ALA A HB1  1  
ATOM 957   H HB2  . ALA A 1 63  ? -6.593  4.916   -1.556  1.00 0.00 ? 63  ALA A HB2  1  
ATOM 958   H HB3  . ALA A 1 63  ? -5.823  6.460   -1.926  1.00 0.00 ? 63  ALA A HB3  1  
ATOM 959   N N    . GLY A 1 64  ? -9.710  6.642   -0.359  1.00 0.00 ? 64  GLY A N    1  
ATOM 960   C CA   . GLY A 1 64  ? -10.851 6.162   0.398   1.00 0.00 ? 64  GLY A CA   1  
ATOM 961   C C    . GLY A 1 64  ? -12.158 6.336   -0.349  1.00 0.00 ? 64  GLY A C    1  
ATOM 962   O O    . GLY A 1 64  ? -13.148 5.669   -0.048  1.00 0.00 ? 64  GLY A O    1  
ATOM 963   H H    . GLY A 1 64  ? -9.344  7.533   -0.178  1.00 0.00 ? 64  GLY A H    1  
ATOM 964   H HA2  . GLY A 1 64  ? -10.709 5.114   0.616   1.00 0.00 ? 64  GLY A HA2  1  
ATOM 965   H HA3  . GLY A 1 64  ? -10.907 6.708   1.329   1.00 0.00 ? 64  GLY A HA3  1  
ATOM 966   N N    . LYS A 1 65  ? -12.163 7.235   -1.327  1.00 0.00 ? 65  LYS A N    1  
ATOM 967   C CA   . LYS A 1 65  ? -13.358 7.496   -2.121  1.00 0.00 ? 65  LYS A CA   1  
ATOM 968   C C    . LYS A 1 65  ? -13.485 6.491   -3.261  1.00 0.00 ? 65  LYS A C    1  
ATOM 969   O O    . LYS A 1 65  ? -14.590 6.148   -3.681  1.00 0.00 ? 65  LYS A O    1  
ATOM 970   C CB   . LYS A 1 65  ? -13.321 8.919   -2.684  1.00 0.00 ? 65  LYS A CB   1  
ATOM 971   C CG   . LYS A 1 65  ? -13.438 9.997   -1.620  1.00 0.00 ? 65  LYS A CG   1  
ATOM 972   C CD   . LYS A 1 65  ? -13.960 11.300  -2.202  1.00 0.00 ? 65  LYS A CD   1  
ATOM 973   C CE   . LYS A 1 65  ? -13.499 12.499  -1.387  1.00 0.00 ? 65  LYS A CE   1  
ATOM 974   N NZ   . LYS A 1 65  ? -14.335 12.698  -0.171  1.00 0.00 ? 65  LYS A NZ   1  
ATOM 975   H H    . LYS A 1 65  ? -11.342 7.735   -1.521  1.00 0.00 ? 65  LYS A H    1  
ATOM 976   H HA   . LYS A 1 65  ? -14.215 7.397   -1.473  1.00 0.00 ? 65  LYS A HA   1  
ATOM 977   H HB2  . LYS A 1 65  ? -12.388 9.061   -3.210  1.00 0.00 ? 65  LYS A HB2  1  
ATOM 978   H HB3  . LYS A 1 65  ? -14.139 9.039   -3.380  1.00 0.00 ? 65  LYS A HB3  1  
ATOM 979   H HG2  . LYS A 1 65  ? -14.118 9.660   -0.852  1.00 0.00 ? 65  LYS A HG2  1  
ATOM 980   H HG3  . LYS A 1 65  ? -12.462 10.171  -1.189  1.00 0.00 ? 65  LYS A HG3  1  
ATOM 981   H HD2  . LYS A 1 65  ? -13.595 11.405  -3.213  1.00 0.00 ? 65  LYS A HD2  1  
ATOM 982   H HD3  . LYS A 1 65  ? -15.040 11.274  -2.208  1.00 0.00 ? 65  LYS A HD3  1  
ATOM 983   H HE2  . LYS A 1 65  ? -12.474 12.340  -1.086  1.00 0.00 ? 65  LYS A HE2  1  
ATOM 984   H HE3  . LYS A 1 65  ? -13.560 13.382  -2.005  1.00 0.00 ? 65  LYS A HE3  1  
ATOM 985   H HZ1  . LYS A 1 65  ? -14.337 11.834  0.407   1.00 0.00 ? 65  LYS A HZ1  1  
ATOM 986   H HZ2  . LYS A 1 65  ? -15.314 12.922  -0.444  1.00 0.00 ? 65  LYS A HZ2  1  
ATOM 987   H HZ3  . LYS A 1 65  ? -13.958 13.482  0.398   1.00 0.00 ? 65  LYS A HZ3  1  
ATOM 988   N N    . THR A 1 66  ? -12.345 6.019   -3.757  1.00 0.00 ? 66  THR A N    1  
ATOM 989   C CA   . THR A 1 66  ? -12.328 5.052   -4.848  1.00 0.00 ? 66  THR A CA   1  
ATOM 990   C C    . THR A 1 66  ? -12.880 3.705   -4.397  1.00 0.00 ? 66  THR A C    1  
ATOM 991   O O    . THR A 1 66  ? -13.191 2.844   -5.219  1.00 0.00 ? 66  THR A O    1  
ATOM 992   C CB   . THR A 1 66  ? -10.904 4.853   -5.400  1.00 0.00 ? 66  THR A CB   1  
ATOM 993   O OG1  . THR A 1 66  ? -10.191 3.913   -4.589  1.00 0.00 ? 66  THR A OG1  1  
ATOM 994   C CG2  . THR A 1 66  ? -10.149 6.173   -5.438  1.00 0.00 ? 66  THR A CG2  1  
ATOM 995   H H    . THR A 1 66  ? -11.496 6.330   -3.380  1.00 0.00 ? 66  THR A H    1  
ATOM 996   H HA   . THR A 1 66  ? -12.950 5.437   -5.644  1.00 0.00 ? 66  THR A HA   1  
ATOM 997   H HB   . THR A 1 66  ? -10.976 4.467   -6.407  1.00 0.00 ? 66  THR A HB   1  
ATOM 998   H HG1  . THR A 1 66  ? -10.052 4.285   -3.715  1.00 0.00 ? 66  THR A HG1  1  
ATOM 999   H HG21 . THR A 1 66  ? -9.285  6.111   -4.794  1.00 0.00 ? 66  THR A HG21 1  
ATOM 1000  H HG22 . THR A 1 66  ? -10.795 6.968   -5.097  1.00 0.00 ? 66  THR A HG22 1  
ATOM 1001  H HG23 . THR A 1 66  ? -9.831  6.376   -6.450  1.00 0.00 ? 66  THR A HG23 1  
ATOM 1002  N N    . ASN A 1 67  ? -12.998 3.528   -3.085  1.00 0.00 ? 67  ASN A N    1  
ATOM 1003  C CA   . ASN A 1 67  ? -13.512 2.284   -2.524  1.00 0.00 ? 67  ASN A CA   1  
ATOM 1004  C C    . ASN A 1 67  ? -12.907 1.077   -3.233  1.00 0.00 ? 67  ASN A C    1  
ATOM 1005  O O    . ASN A 1 67  ? -13.482 -0.011  -3.229  1.00 0.00 ? 67  ASN A O    1  
ATOM 1006  C CB   . ASN A 1 67  ? -15.038 2.243   -2.635  1.00 0.00 ? 67  ASN A CB   1  
ATOM 1007  C CG   . ASN A 1 67  ? -15.719 2.373   -1.286  1.00 0.00 ? 67  ASN A CG   1  
ATOM 1008  O OD1  . ASN A 1 67  ? -15.069 2.319   -0.242  1.00 0.00 ? 67  ASN A OD1  1  
ATOM 1009  N ND2  . ASN A 1 67  ? -17.036 2.545   -1.303  1.00 0.00 ? 67  ASN A ND2  1  
ATOM 1010  H H    . ASN A 1 67  ? -12.733 4.252   -2.479  1.00 0.00 ? 67  ASN A H    1  
ATOM 1011  H HA   . ASN A 1 67  ? -13.235 2.251   -1.481  1.00 0.00 ? 67  ASN A HA   1  
ATOM 1012  H HB2  . ASN A 1 67  ? -15.369 3.056   -3.264  1.00 0.00 ? 67  ASN A HB2  1  
ATOM 1013  H HB3  . ASN A 1 67  ? -15.335 1.305   -3.079  1.00 0.00 ? 67  ASN A HB3  1  
ATOM 1014  H HD21 . ASN A 1 67  ? -17.488 2.577   -2.172  1.00 0.00 ? 67  ASN A HD21 1  
ATOM 1015  H HD22 . ASN A 1 67  ? -17.502 2.632   -0.446  1.00 0.00 ? 67  ASN A HD22 1  
ATOM 1016  N N    . ALA A 1 68  ? -11.742 1.277   -3.840  1.00 0.00 ? 68  ALA A N    1  
ATOM 1017  C CA   . ALA A 1 68  ? -11.056 0.205   -4.551  1.00 0.00 ? 68  ALA A CA   1  
ATOM 1018  C C    . ALA A 1 68  ? -9.806  -0.241  -3.800  1.00 0.00 ? 68  ALA A C    1  
ATOM 1019  O O    . ALA A 1 68  ? -9.054  -1.092  -4.276  1.00 0.00 ? 68  ALA A O    1  
ATOM 1020  C CB   . ALA A 1 68  ? -10.697 0.651   -5.961  1.00 0.00 ? 68  ALA A CB   1  
ATOM 1021  H H    . ALA A 1 68  ? -11.333 2.167   -3.808  1.00 0.00 ? 68  ALA A H    1  
ATOM 1022  H HA   . ALA A 1 68  ? -11.735 -0.633  -4.628  1.00 0.00 ? 68  ALA A HA   1  
ATOM 1023  H HB1  . ALA A 1 68  ? -11.256 1.541   -6.209  1.00 0.00 ? 68  ALA A HB1  1  
ATOM 1024  H HB2  . ALA A 1 68  ? -9.639  0.864   -6.011  1.00 0.00 ? 68  ALA A HB2  1  
ATOM 1025  H HB3  . ALA A 1 68  ? -10.941 -0.135  -6.660  1.00 0.00 ? 68  ALA A HB3  1  
ATOM 1026  N N    . LEU A 1 69  ? -9.589  0.341   -2.626  1.00 0.00 ? 69  LEU A N    1  
ATOM 1027  C CA   . LEU A 1 69  ? -8.428  0.005   -1.809  1.00 0.00 ? 69  LEU A CA   1  
ATOM 1028  C C    . LEU A 1 69  ? -8.795  -0.027  -0.329  1.00 0.00 ? 69  LEU A C    1  
ATOM 1029  O O    . LEU A 1 69  ? -9.469  0.872   0.174   1.00 0.00 ? 69  LEU A O    1  
ATOM 1030  C CB   . LEU A 1 69  ? -7.303  1.013   -2.046  1.00 0.00 ? 69  LEU A CB   1  
ATOM 1031  C CG   . LEU A 1 69  ? -6.963  1.309   -3.508  1.00 0.00 ? 69  LEU A CG   1  
ATOM 1032  C CD1  . LEU A 1 69  ? -6.267  2.655   -3.632  1.00 0.00 ? 69  LEU A CD1  1  
ATOM 1033  C CD2  . LEU A 1 69  ? -6.095  0.201   -4.087  1.00 0.00 ? 69  LEU A CD2  1  
ATOM 1034  H H    . LEU A 1 69  ? -10.223 1.012   -2.300  1.00 0.00 ? 69  LEU A H    1  
ATOM 1035  H HA   . LEU A 1 69  ? -8.088  -0.977  -2.104  1.00 0.00 ? 69  LEU A HA   1  
ATOM 1036  H HB2  . LEU A 1 69  ? -7.589  1.943   -1.579  1.00 0.00 ? 69  LEU A HB2  1  
ATOM 1037  H HB3  . LEU A 1 69  ? -6.411  0.632   -1.569  1.00 0.00 ? 69  LEU A HB3  1  
ATOM 1038  H HG   . LEU A 1 69  ? -7.878  1.352   -4.082  1.00 0.00 ? 69  LEU A HG   1  
ATOM 1039  H HD11 . LEU A 1 69  ? -5.201  2.503   -3.708  1.00 0.00 ? 69  LEU A HD11 1  
ATOM 1040  H HD12 . LEU A 1 69  ? -6.484  3.255   -2.761  1.00 0.00 ? 69  LEU A HD12 1  
ATOM 1041  H HD13 . LEU A 1 69  ? -6.622  3.163   -4.517  1.00 0.00 ? 69  LEU A HD13 1  
ATOM 1042  H HD21 . LEU A 1 69  ? -6.470  -0.078  -5.061  1.00 0.00 ? 69  LEU A HD21 1  
ATOM 1043  H HD22 . LEU A 1 69  ? -6.121  -0.656  -3.431  1.00 0.00 ? 69  LEU A HD22 1  
ATOM 1044  H HD23 . LEU A 1 69  ? -5.077  0.553   -4.180  1.00 0.00 ? 69  LEU A HD23 1  
ATOM 1045  N N    . LYS A 1 70  ? -8.344  -1.066  0.365   1.00 0.00 ? 70  LYS A N    1  
ATOM 1046  C CA   . LYS A 1 70  ? -8.621  -1.214  1.789   1.00 0.00 ? 70  LYS A CA   1  
ATOM 1047  C C    . LYS A 1 70  ? -7.481  -1.945  2.492   1.00 0.00 ? 70  LYS A C    1  
ATOM 1048  O O    . LYS A 1 70  ? -6.685  -2.636  1.854   1.00 0.00 ? 70  LYS A O    1  
ATOM 1049  C CB   . LYS A 1 70  ? -9.933  -1.973  1.998   1.00 0.00 ? 70  LYS A CB   1  
ATOM 1050  C CG   . LYS A 1 70  ? -10.976 -1.691  0.930   1.00 0.00 ? 70  LYS A CG   1  
ATOM 1051  C CD   . LYS A 1 70  ? -11.703 -0.383  1.192   1.00 0.00 ? 70  LYS A CD   1  
ATOM 1052  C CE   . LYS A 1 70  ? -12.924 -0.591  2.075   1.00 0.00 ? 70  LYS A CE   1  
ATOM 1053  N NZ   . LYS A 1 70  ? -13.707 0.665   2.244   1.00 0.00 ? 70  LYS A NZ   1  
ATOM 1054  H H    . LYS A 1 70  ? -7.811  -1.751  -0.092  1.00 0.00 ? 70  LYS A H    1  
ATOM 1055  H HA   . LYS A 1 70  ? -8.715  -0.226  2.213   1.00 0.00 ? 70  LYS A HA   1  
ATOM 1056  H HB2  . LYS A 1 70  ? -9.726  -3.033  1.999   1.00 0.00 ? 70  LYS A HB2  1  
ATOM 1057  H HB3  . LYS A 1 70  ? -10.347 -1.695  2.957   1.00 0.00 ? 70  LYS A HB3  1  
ATOM 1058  H HG2  . LYS A 1 70  ? -10.487 -1.632  -0.031  1.00 0.00 ? 70  LYS A HG2  1  
ATOM 1059  H HG3  . LYS A 1 70  ? -11.696 -2.497  0.921   1.00 0.00 ? 70  LYS A HG3  1  
ATOM 1060  H HD2  . LYS A 1 70  ? -11.029 0.301   1.686   1.00 0.00 ? 70  LYS A HD2  1  
ATOM 1061  H HD3  . LYS A 1 70  ? -12.019 0.039   0.249   1.00 0.00 ? 70  LYS A HD3  1  
ATOM 1062  H HE2  . LYS A 1 70  ? -13.556 -1.340  1.622   1.00 0.00 ? 70  LYS A HE2  1  
ATOM 1063  H HE3  . LYS A 1 70  ? -12.597 -0.935  3.045   1.00 0.00 ? 70  LYS A HE3  1  
ATOM 1064  H HZ1  . LYS A 1 70  ? -13.377 1.181   3.085   1.00 0.00 ? 70  LYS A HZ1  1  
ATOM 1065  H HZ2  . LYS A 1 70  ? -14.716 0.443   2.360   1.00 0.00 ? 70  LYS A HZ2  1  
ATOM 1066  H HZ3  . LYS A 1 70  ? -13.591 1.274   1.409   1.00 0.00 ? 70  LYS A HZ3  1  
ATOM 1067  N N    . THR A 1 71  ? -7.409  -1.790  3.810   1.00 0.00 ? 71  THR A N    1  
ATOM 1068  C CA   . THR A 1 71  ? -6.367  -2.436  4.599   1.00 0.00 ? 71  THR A CA   1  
ATOM 1069  C C    . THR A 1 71  ? -6.391  -3.948  4.409   1.00 0.00 ? 71  THR A C    1  
ATOM 1070  O O    . THR A 1 71  ? -7.453  -4.569  4.426   1.00 0.00 ? 71  THR A O    1  
ATOM 1071  C CB   . THR A 1 71  ? -6.519  -2.116  6.099   1.00 0.00 ? 71  THR A CB   1  
ATOM 1072  O OG1  . THR A 1 71  ? -5.387  -2.612  6.822   1.00 0.00 ? 71  THR A OG1  1  
ATOM 1073  C CG2  . THR A 1 71  ? -7.793  -2.730  6.657   1.00 0.00 ? 71  THR A CG2  1  
ATOM 1074  H H    . THR A 1 71  ? -8.072  -1.228  4.262   1.00 0.00 ? 71  THR A H    1  
ATOM 1075  H HA   . THR A 1 71  ? -5.412  -2.056  4.266   1.00 0.00 ? 71  THR A HA   1  
ATOM 1076  H HB   . THR A 1 71  ? -6.571  -1.043  6.219   1.00 0.00 ? 71  THR A HB   1  
ATOM 1077  H HG1  . THR A 1 71  ? -5.433  -2.311  7.733   1.00 0.00 ? 71  THR A HG1  1  
ATOM 1078  H HG21 . THR A 1 71  ? -8.638  -2.401  6.071   1.00 0.00 ? 71  THR A HG21 1  
ATOM 1079  H HG22 . THR A 1 71  ? -7.924  -2.418  7.683   1.00 0.00 ? 71  THR A HG22 1  
ATOM 1080  H HG23 . THR A 1 71  ? -7.723  -3.807  6.614   1.00 0.00 ? 71  THR A HG23 1  
ATOM 1081  N N    . GLY A 1 72  ? -5.212  -4.536  4.230   1.00 0.00 ? 72  GLY A N    1  
ATOM 1082  C CA   . GLY A 1 72  ? -5.120  -5.972  4.040   1.00 0.00 ? 72  GLY A CA   1  
ATOM 1083  C C    . GLY A 1 72  ? -4.699  -6.345  2.633   1.00 0.00 ? 72  GLY A C    1  
ATOM 1084  O O    . GLY A 1 72  ? -4.046  -7.367  2.423   1.00 0.00 ? 72  GLY A O    1  
ATOM 1085  H H    . GLY A 1 72  ? -4.398  -3.990  4.227   1.00 0.00 ? 72  GLY A H    1  
ATOM 1086  H HA2  . GLY A 1 72  ? -4.400  -6.371  4.738   1.00 0.00 ? 72  GLY A HA2  1  
ATOM 1087  H HA3  . GLY A 1 72  ? -6.085  -6.413  4.243   1.00 0.00 ? 72  GLY A HA3  1  
ATOM 1088  N N    . ASP A 1 73  ? -5.075  -5.516  1.665   1.00 0.00 ? 73  ASP A N    1  
ATOM 1089  C CA   . ASP A 1 73  ? -4.732  -5.764  0.270   1.00 0.00 ? 73  ASP A CA   1  
ATOM 1090  C C    . ASP A 1 73  ? -3.227  -5.946  0.103   1.00 0.00 ? 73  ASP A C    1  
ATOM 1091  O O    . ASP A 1 73  ? -2.451  -5.662  1.016   1.00 0.00 ? 73  ASP A O    1  
ATOM 1092  C CB   . ASP A 1 73  ? -5.219  -4.611  -0.610  1.00 0.00 ? 73  ASP A CB   1  
ATOM 1093  C CG   . ASP A 1 73  ? -6.623  -4.837  -1.136  1.00 0.00 ? 73  ASP A CG   1  
ATOM 1094  O OD1  . ASP A 1 73  ? -6.769  -5.546  -2.153  1.00 0.00 ? 73  ASP A OD1  1  
ATOM 1095  O OD2  . ASP A 1 73  ? -7.576  -4.304  -0.529  1.00 0.00 ? 73  ASP A OD2  1  
ATOM 1096  H H    . ASP A 1 73  ? -5.594  -4.717  1.895   1.00 0.00 ? 73  ASP A H    1  
ATOM 1097  H HA   . ASP A 1 73  ? -5.228  -6.672  -0.037  1.00 0.00 ? 73  ASP A HA   1  
ATOM 1098  H HB2  . ASP A 1 73  ? -5.214  -3.698  -0.032  1.00 0.00 ? 73  ASP A HB2  1  
ATOM 1099  H HB3  . ASP A 1 73  ? -4.551  -4.503  -1.452  1.00 0.00 ? 73  ASP A HB3  1  
ATOM 1100  N N    . LYS A 1 74  ? -2.820  -6.424  -1.068  1.00 0.00 ? 74  LYS A N    1  
ATOM 1101  C CA   . LYS A 1 74  ? -1.407  -6.646  -1.355  1.00 0.00 ? 74  LYS A CA   1  
ATOM 1102  C C    . LYS A 1 74  ? -0.963  -5.827  -2.563  1.00 0.00 ? 74  LYS A C    1  
ATOM 1103  O O    . LYS A 1 74  ? -1.319  -6.138  -3.700  1.00 0.00 ? 74  LYS A O    1  
ATOM 1104  C CB   . LYS A 1 74  ? -1.144  -8.132  -1.608  1.00 0.00 ? 74  LYS A CB   1  
ATOM 1105  C CG   . LYS A 1 74  ? 0.308   -8.447  -1.923  1.00 0.00 ? 74  LYS A CG   1  
ATOM 1106  C CD   . LYS A 1 74  ? 0.516   -9.932  -2.166  1.00 0.00 ? 74  LYS A CD   1  
ATOM 1107  C CE   . LYS A 1 74  ? 1.768   -10.193 -2.990  1.00 0.00 ? 74  LYS A CE   1  
ATOM 1108  N NZ   . LYS A 1 74  ? 2.992   -10.231 -2.142  1.00 0.00 ? 74  LYS A NZ   1  
ATOM 1109  H H    . LYS A 1 74  ? -3.486  -6.633  -1.756  1.00 0.00 ? 74  LYS A H    1  
ATOM 1110  H HA   . LYS A 1 74  ? -0.840  -6.330  -0.493  1.00 0.00 ? 74  LYS A HA   1  
ATOM 1111  H HB2  . LYS A 1 74  ? -1.430  -8.690  -0.729  1.00 0.00 ? 74  LYS A HB2  1  
ATOM 1112  H HB3  . LYS A 1 74  ? -1.750  -8.455  -2.442  1.00 0.00 ? 74  LYS A HB3  1  
ATOM 1113  H HG2  . LYS A 1 74  ? 0.601   -7.904  -2.809  1.00 0.00 ? 74  LYS A HG2  1  
ATOM 1114  H HG3  . LYS A 1 74  ? 0.923   -8.138  -1.089  1.00 0.00 ? 74  LYS A HG3  1  
ATOM 1115  H HD2  . LYS A 1 74  ? 0.615   -10.434 -1.214  1.00 0.00 ? 74  LYS A HD2  1  
ATOM 1116  H HD3  . LYS A 1 74  ? -0.341  -10.325 -2.694  1.00 0.00 ? 74  LYS A HD3  1  
ATOM 1117  H HE2  . LYS A 1 74  ? 1.660   -11.140 -3.494  1.00 0.00 ? 74  LYS A HE2  1  
ATOM 1118  H HE3  . LYS A 1 74  ? 1.871   -9.405  -3.721  1.00 0.00 ? 74  LYS A HE3  1  
ATOM 1119  H HZ1  . LYS A 1 74  ? 3.636   -9.459  -2.409  1.00 0.00 ? 74  LYS A HZ1  1  
ATOM 1120  H HZ2  . LYS A 1 74  ? 3.484   -11.138 -2.268  1.00 0.00 ? 74  LYS A HZ2  1  
ATOM 1121  H HZ3  . LYS A 1 74  ? 2.736   -10.124 -1.140  1.00 0.00 ? 74  LYS A HZ3  1  
ATOM 1122  N N    . ILE A 1 75  ? -0.184  -4.781  -2.308  1.00 0.00 ? 75  ILE A N    1  
ATOM 1123  C CA   . ILE A 1 75  ? 0.310   -3.920  -3.376  1.00 0.00 ? 75  ILE A CA   1  
ATOM 1124  C C    . ILE A 1 75  ? 1.447   -4.590  -4.140  1.00 0.00 ? 75  ILE A C    1  
ATOM 1125  O O    . ILE A 1 75  ? 2.497   -4.894  -3.573  1.00 0.00 ? 75  ILE A O    1  
ATOM 1126  C CB   . ILE A 1 75  ? 0.803   -2.568  -2.826  1.00 0.00 ? 75  ILE A CB   1  
ATOM 1127  C CG1  . ILE A 1 75  ? -0.197  -2.010  -1.811  1.00 0.00 ? 75  ILE A CG1  1  
ATOM 1128  C CG2  . ILE A 1 75  ? 1.019   -1.581  -3.963  1.00 0.00 ? 75  ILE A CG2  1  
ATOM 1129  C CD1  . ILE A 1 75  ? 0.304   -0.786  -1.079  1.00 0.00 ? 75  ILE A CD1  1  
ATOM 1130  H H    . ILE A 1 75  ? 0.065   -4.584  -1.382  1.00 0.00 ? 75  ILE A H    1  
ATOM 1131  H HA   . ILE A 1 75  ? -0.507  -3.732  -4.058  1.00 0.00 ? 75  ILE A HA   1  
ATOM 1132  H HB   . ILE A 1 75  ? 1.751   -2.728  -2.336  1.00 0.00 ? 75  ILE A HB   1  
ATOM 1133  H HG12 . ILE A 1 75  ? -1.107  -1.740  -2.323  1.00 0.00 ? 75  ILE A HG12 1  
ATOM 1134  H HG13 . ILE A 1 75  ? -0.415  -2.772  -1.076  1.00 0.00 ? 75  ILE A HG13 1  
ATOM 1135  H HG21 . ILE A 1 75  ? 1.484   -2.087  -4.796  1.00 0.00 ? 75  ILE A HG21 1  
ATOM 1136  H HG22 . ILE A 1 75  ? 0.067   -1.178  -4.275  1.00 0.00 ? 75  ILE A HG22 1  
ATOM 1137  H HG23 . ILE A 1 75  ? 1.658   -0.778  -3.627  1.00 0.00 ? 75  ILE A HG23 1  
ATOM 1138  H HD11 . ILE A 1 75  ? 0.277   0.067   -1.743  1.00 0.00 ? 75  ILE A HD11 1  
ATOM 1139  H HD12 . ILE A 1 75  ? -0.326  -0.594  -0.223  1.00 0.00 ? 75  ILE A HD12 1  
ATOM 1140  H HD13 . ILE A 1 75  ? 1.319   -0.952  -0.750  1.00 0.00 ? 75  ILE A HD13 1  
ATOM 1141  N N    . LEU A 1 76  ? 1.231   -4.816  -5.432  1.00 0.00 ? 76  LEU A N    1  
ATOM 1142  C CA   . LEU A 1 76  ? 2.238   -5.448  -6.276  1.00 0.00 ? 76  LEU A CA   1  
ATOM 1143  C C    . LEU A 1 76  ? 2.954   -4.413  -7.138  1.00 0.00 ? 76  LEU A C    1  
ATOM 1144  O O    . LEU A 1 76  ? 4.079   -4.635  -7.585  1.00 0.00 ? 76  LEU A O    1  
ATOM 1145  C CB   . LEU A 1 76  ? 1.591   -6.510  -7.167  1.00 0.00 ? 76  LEU A CB   1  
ATOM 1146  C CG   . LEU A 1 76  ? 0.422   -7.280  -6.553  1.00 0.00 ? 76  LEU A CG   1  
ATOM 1147  C CD1  . LEU A 1 76  ? -0.557  -7.716  -7.633  1.00 0.00 ? 76  LEU A CD1  1  
ATOM 1148  C CD2  . LEU A 1 76  ? 0.927   -8.484  -5.771  1.00 0.00 ? 76  LEU A CD2  1  
ATOM 1149  H H    . LEU A 1 76  ? 0.375   -4.551  -5.827  1.00 0.00 ? 76  LEU A H    1  
ATOM 1150  H HA   . LEU A 1 76  ? 2.961   -5.924  -5.631  1.00 0.00 ? 76  LEU A HA   1  
ATOM 1151  H HB2  . LEU A 1 76  ? 1.232   -6.019  -8.059  1.00 0.00 ? 76  LEU A HB2  1  
ATOM 1152  H HB3  . LEU A 1 76  ? 2.355   -7.226  -7.436  1.00 0.00 ? 76  LEU A HB3  1  
ATOM 1153  H HG   . LEU A 1 76  ? -0.107  -6.632  -5.867  1.00 0.00 ? 76  LEU A HG   1  
ATOM 1154  H HD11 . LEU A 1 76  ? -0.352  -7.173  -8.543  1.00 0.00 ? 76  LEU A HD11 1  
ATOM 1155  H HD12 . LEU A 1 76  ? -1.566  -7.509  -7.309  1.00 0.00 ? 76  LEU A HD12 1  
ATOM 1156  H HD13 . LEU A 1 76  ? -0.446  -8.776  -7.811  1.00 0.00 ? 76  LEU A HD13 1  
ATOM 1157  H HD21 . LEU A 1 76  ? 0.312   -8.628  -4.895  1.00 0.00 ? 76  LEU A HD21 1  
ATOM 1158  H HD22 . LEU A 1 76  ? 1.950   -8.312  -5.470  1.00 0.00 ? 76  LEU A HD22 1  
ATOM 1159  H HD23 . LEU A 1 76  ? 0.879   -9.364  -6.396  1.00 0.00 ? 76  LEU A HD23 1  
ATOM 1160  N N    . GLU A 1 77  ? 2.295   -3.281  -7.364  1.00 0.00 ? 77  GLU A N    1  
ATOM 1161  C CA   . GLU A 1 77  ? 2.871   -2.211  -8.171  1.00 0.00 ? 77  GLU A CA   1  
ATOM 1162  C C    . GLU A 1 77  ? 2.073   -0.920  -8.012  1.00 0.00 ? 77  GLU A C    1  
ATOM 1163  O O    . GLU A 1 77  ? 0.871   -0.949  -7.746  1.00 0.00 ? 77  GLU A O    1  
ATOM 1164  C CB   . GLU A 1 77  ? 2.912   -2.619  -9.645  1.00 0.00 ? 77  GLU A CB   1  
ATOM 1165  C CG   . GLU A 1 77  ? 4.075   -2.014  -10.412 1.00 0.00 ? 77  GLU A CG   1  
ATOM 1166  C CD   . GLU A 1 77  ? 3.912   -2.141  -11.915 1.00 0.00 ? 77  GLU A CD   1  
ATOM 1167  O OE1  . GLU A 1 77  ? 2.833   -1.779  -12.428 1.00 0.00 ? 77  GLU A OE1  1  
ATOM 1168  O OE2  . GLU A 1 77  ? 4.865   -2.603  -12.577 1.00 0.00 ? 77  GLU A OE2  1  
ATOM 1169  H H    . GLU A 1 77  ? 1.401   -3.163  -6.981  1.00 0.00 ? 77  GLU A H    1  
ATOM 1170  H HA   . GLU A 1 77  ? 3.879   -2.042  -7.826  1.00 0.00 ? 77  GLU A HA   1  
ATOM 1171  H HB2  . GLU A 1 77  ? 2.987   -3.695  -9.707  1.00 0.00 ? 77  GLU A HB2  1  
ATOM 1172  H HB3  . GLU A 1 77  ? 1.993   -2.305  -10.119 1.00 0.00 ? 77  GLU A HB3  1  
ATOM 1173  H HG2  . GLU A 1 77  ? 4.149   -0.966  -10.161 1.00 0.00 ? 77  GLU A HG2  1  
ATOM 1174  H HG3  . GLU A 1 77  ? 4.984   -2.518  -10.120 1.00 0.00 ? 77  GLU A HG3  1  
ATOM 1175  N N    . VAL A 1 78  ? 2.751   0.212   -8.175  1.00 0.00 ? 78  VAL A N    1  
ATOM 1176  C CA   . VAL A 1 78  ? 2.107   1.514   -8.050  1.00 0.00 ? 78  VAL A CA   1  
ATOM 1177  C C    . VAL A 1 78  ? 2.689   2.512   -9.043  1.00 0.00 ? 78  VAL A C    1  
ATOM 1178  O O    . VAL A 1 78  ? 3.901   2.723   -9.089  1.00 0.00 ? 78  VAL A O    1  
ATOM 1179  C CB   . VAL A 1 78  ? 2.255   2.078   -6.624  1.00 0.00 ? 78  VAL A CB   1  
ATOM 1180  C CG1  . VAL A 1 78  ? 3.423   3.050   -6.553  1.00 0.00 ? 78  VAL A CG1  1  
ATOM 1181  C CG2  . VAL A 1 78  ? 0.964   2.750   -6.181  1.00 0.00 ? 78  VAL A CG2  1  
ATOM 1182  H H    . VAL A 1 78  ? 3.707   0.170   -8.385  1.00 0.00 ? 78  VAL A H    1  
ATOM 1183  H HA   . VAL A 1 78  ? 1.054   1.386   -8.256  1.00 0.00 ? 78  VAL A HA   1  
ATOM 1184  H HB   . VAL A 1 78  ? 2.458   1.257   -5.953  1.00 0.00 ? 78  VAL A HB   1  
ATOM 1185  H HG11 . VAL A 1 78  ? 4.329   2.546   -6.855  1.00 0.00 ? 78  VAL A HG11 1  
ATOM 1186  H HG12 . VAL A 1 78  ? 3.237   3.885   -7.214  1.00 0.00 ? 78  VAL A HG12 1  
ATOM 1187  H HG13 . VAL A 1 78  ? 3.531   3.409   -5.541  1.00 0.00 ? 78  VAL A HG13 1  
ATOM 1188  H HG21 . VAL A 1 78  ? 0.725   3.555   -6.859  1.00 0.00 ? 78  VAL A HG21 1  
ATOM 1189  H HG22 . VAL A 1 78  ? 0.163   2.026   -6.185  1.00 0.00 ? 78  VAL A HG22 1  
ATOM 1190  H HG23 . VAL A 1 78  ? 1.087   3.145   -5.183  1.00 0.00 ? 78  VAL A HG23 1  
ATOM 1191  N N    . SER A 1 79  ? 1.817   3.126   -9.837  1.00 0.00 ? 79  SER A N    1  
ATOM 1192  C CA   . SER A 1 79  ? 2.244   4.101   -10.833 1.00 0.00 ? 79  SER A CA   1  
ATOM 1193  C C    . SER A 1 79  ? 3.207   3.469   -11.834 1.00 0.00 ? 79  SER A C    1  
ATOM 1194  O O    . SER A 1 79  ? 3.921   4.168   -12.552 1.00 0.00 ? 79  SER A O    1  
ATOM 1195  C CB   . SER A 1 79  ? 2.911   5.298   -10.153 1.00 0.00 ? 79  SER A CB   1  
ATOM 1196  O OG   . SER A 1 79  ? 2.735   6.480   -10.913 1.00 0.00 ? 79  SER A OG   1  
ATOM 1197  H H    . SER A 1 79  ? 0.863   2.915   -9.752  1.00 0.00 ? 79  SER A H    1  
ATOM 1198  H HA   . SER A 1 79  ? 1.366   4.441   -11.362 1.00 0.00 ? 79  SER A HA   1  
ATOM 1199  H HB2  . SER A 1 79  ? 2.474   5.443   -9.177  1.00 0.00 ? 79  SER A HB2  1  
ATOM 1200  H HB3  . SER A 1 79  ? 3.969   5.105   -10.049 1.00 0.00 ? 79  SER A HB3  1  
ATOM 1201  H HG   . SER A 1 79  ? 2.154   6.300   -11.656 1.00 0.00 ? 79  SER A HG   1  
ATOM 1202  N N    . GLY A 1 80  ? 3.220   2.140   -11.875 1.00 0.00 ? 80  GLY A N    1  
ATOM 1203  C CA   . GLY A 1 80  ? 4.098   1.435   -12.790 1.00 0.00 ? 80  GLY A CA   1  
ATOM 1204  C C    . GLY A 1 80  ? 5.443   1.110   -12.169 1.00 0.00 ? 80  GLY A C    1  
ATOM 1205  O O    . GLY A 1 80  ? 6.464   1.092   -12.856 1.00 0.00 ? 80  GLY A O    1  
ATOM 1206  H H    . GLY A 1 80  ? 2.629   1.634   -11.279 1.00 0.00 ? 80  GLY A H    1  
ATOM 1207  H HA2  . GLY A 1 80  ? 3.621   0.514   -13.092 1.00 0.00 ? 80  GLY A HA2  1  
ATOM 1208  H HA3  . GLY A 1 80  ? 4.258   2.050   -13.664 1.00 0.00 ? 80  GLY A HA3  1  
ATOM 1209  N N    . VAL A 1 81  ? 5.444   0.853   -10.865 1.00 0.00 ? 81  VAL A N    1  
ATOM 1210  C CA   . VAL A 1 81  ? 6.673   0.528   -10.151 1.00 0.00 ? 81  VAL A CA   1  
ATOM 1211  C C    . VAL A 1 81  ? 6.505   -0.737  -9.316  1.00 0.00 ? 81  VAL A C    1  
ATOM 1212  O O    . VAL A 1 81  ? 5.601   -0.829  -8.486  1.00 0.00 ? 81  VAL A O    1  
ATOM 1213  C CB   . VAL A 1 81  ? 7.110   1.683   -9.231  1.00 0.00 ? 81  VAL A CB   1  
ATOM 1214  C CG1  . VAL A 1 81  ? 6.367   1.621   -7.905  1.00 0.00 ? 81  VAL A CG1  1  
ATOM 1215  C CG2  . VAL A 1 81  ? 8.615   1.648   -9.011  1.00 0.00 ? 81  VAL A CG2  1  
ATOM 1216  H H    . VAL A 1 81  ? 4.598   0.882   -10.371 1.00 0.00 ? 81  VAL A H    1  
ATOM 1217  H HA   . VAL A 1 81  ? 7.451   0.364   -10.883 1.00 0.00 ? 81  VAL A HA   1  
ATOM 1218  H HB   . VAL A 1 81  ? 6.860   2.616   -9.715  1.00 0.00 ? 81  VAL A HB   1  
ATOM 1219  H HG11 . VAL A 1 81  ? 6.383   2.594   -7.438  1.00 0.00 ? 81  VAL A HG11 1  
ATOM 1220  H HG12 . VAL A 1 81  ? 5.344   1.320   -8.079  1.00 0.00 ? 81  VAL A HG12 1  
ATOM 1221  H HG13 . VAL A 1 81  ? 6.848   0.903   -7.257  1.00 0.00 ? 81  VAL A HG13 1  
ATOM 1222  H HG21 . VAL A 1 81  ? 8.928   2.555   -8.516  1.00 0.00 ? 81  VAL A HG21 1  
ATOM 1223  H HG22 . VAL A 1 81  ? 8.868   0.796   -8.397  1.00 0.00 ? 81  VAL A HG22 1  
ATOM 1224  H HG23 . VAL A 1 81  ? 9.117   1.567   -9.964  1.00 0.00 ? 81  VAL A HG23 1  
ATOM 1225  N N    . ASP A 1 82  ? 7.383   -1.708  -9.542  1.00 0.00 ? 82  ASP A N    1  
ATOM 1226  C CA   . ASP A 1 82  ? 7.333   -2.968  -8.809  1.00 0.00 ? 82  ASP A CA   1  
ATOM 1227  C C    . ASP A 1 82  ? 7.673   -2.754  -7.337  1.00 0.00 ? 82  ASP A C    1  
ATOM 1228  O O    . ASP A 1 82  ? 8.811   -2.433  -6.992  1.00 0.00 ? 82  ASP A O    1  
ATOM 1229  C CB   . ASP A 1 82  ? 8.300   -3.980  -9.426  1.00 0.00 ? 82  ASP A CB   1  
ATOM 1230  C CG   . ASP A 1 82  ? 7.977   -5.407  -9.029  1.00 0.00 ? 82  ASP A CG   1  
ATOM 1231  O OD1  . ASP A 1 82  ? 6.981   -5.956  -9.546  1.00 0.00 ? 82  ASP A OD1  1  
ATOM 1232  O OD2  . ASP A 1 82  ? 8.720   -5.975  -8.202  1.00 0.00 ? 82  ASP A OD2  1  
ATOM 1233  H H    . ASP A 1 82  ? 8.081   -1.575  -10.217 1.00 0.00 ? 82  ASP A H    1  
ATOM 1234  H HA   . ASP A 1 82  ? 6.328   -3.355  -8.881  1.00 0.00 ? 82  ASP A HA   1  
ATOM 1235  H HB2  . ASP A 1 82  ? 8.250   -3.906  -10.503 1.00 0.00 ? 82  ASP A HB2  1  
ATOM 1236  H HB3  . ASP A 1 82  ? 9.305   -3.753  -9.100  1.00 0.00 ? 82  ASP A HB3  1  
ATOM 1237  N N    . LEU A 1 83  ? 6.679   -2.933  -6.474  1.00 0.00 ? 83  LEU A N    1  
ATOM 1238  C CA   . LEU A 1 83  ? 6.871   -2.759  -5.039  1.00 0.00 ? 83  LEU A CA   1  
ATOM 1239  C C    . LEU A 1 83  ? 6.727   -4.088  -4.305  1.00 0.00 ? 83  LEU A C    1  
ATOM 1240  O O    . LEU A 1 83  ? 6.858   -4.150  -3.083  1.00 0.00 ? 83  LEU A O    1  
ATOM 1241  C CB   . LEU A 1 83  ? 5.864   -1.748  -4.488  1.00 0.00 ? 83  LEU A CB   1  
ATOM 1242  C CG   . LEU A 1 83  ? 5.992   -0.318  -5.014  1.00 0.00 ? 83  LEU A CG   1  
ATOM 1243  C CD1  . LEU A 1 83  ? 5.087   0.622   -4.233  1.00 0.00 ? 83  LEU A CD1  1  
ATOM 1244  C CD2  . LEU A 1 83  ? 7.439   0.149   -4.942  1.00 0.00 ? 83  LEU A CD2  1  
ATOM 1245  H H    . LEU A 1 83  ? 5.794   -3.188  -6.809  1.00 0.00 ? 83  LEU A H    1  
ATOM 1246  H HA   . LEU A 1 83  ? 7.870   -2.381  -4.882  1.00 0.00 ? 83  LEU A HA   1  
ATOM 1247  H HB2  . LEU A 1 83  ? 4.874   -2.102  -4.731  1.00 0.00 ? 83  LEU A HB2  1  
ATOM 1248  H HB3  . LEU A 1 83  ? 5.980   -1.718  -3.414  1.00 0.00 ? 83  LEU A HB3  1  
ATOM 1249  H HG   . LEU A 1 83  ? 5.683   -0.293  -6.051  1.00 0.00 ? 83  LEU A HG   1  
ATOM 1250  H HD11 . LEU A 1 83  ? 4.270   0.941   -4.863  1.00 0.00 ? 83  LEU A HD11 1  
ATOM 1251  H HD12 . LEU A 1 83  ? 5.653   1.484   -3.913  1.00 0.00 ? 83  LEU A HD12 1  
ATOM 1252  H HD13 . LEU A 1 83  ? 4.695   0.107   -3.368  1.00 0.00 ? 83  LEU A HD13 1  
ATOM 1253  H HD21 . LEU A 1 83  ? 7.469   1.229   -4.943  1.00 0.00 ? 83  LEU A HD21 1  
ATOM 1254  H HD22 . LEU A 1 83  ? 7.981   -0.227  -5.796  1.00 0.00 ? 83  LEU A HD22 1  
ATOM 1255  H HD23 . LEU A 1 83  ? 7.892   -0.223  -4.035  1.00 0.00 ? 83  LEU A HD23 1  
ATOM 1256  N N    . GLN A 1 84  ? 6.460   -5.149  -5.059  1.00 0.00 ? 84  GLN A N    1  
ATOM 1257  C CA   . GLN A 1 84  ? 6.300   -6.477  -4.480  1.00 0.00 ? 84  GLN A CA   1  
ATOM 1258  C C    . GLN A 1 84  ? 7.441   -6.792  -3.518  1.00 0.00 ? 84  GLN A C    1  
ATOM 1259  O O    . GLN A 1 84  ? 7.229   -6.935  -2.315  1.00 0.00 ? 84  GLN A O    1  
ATOM 1260  C CB   . GLN A 1 84  ? 6.241   -7.535  -5.584  1.00 0.00 ? 84  GLN A CB   1  
ATOM 1261  C CG   . GLN A 1 84  ? 4.872   -7.662  -6.232  1.00 0.00 ? 84  GLN A CG   1  
ATOM 1262  C CD   . GLN A 1 84  ? 4.865   -8.635  -7.394  1.00 0.00 ? 84  GLN A CD   1  
ATOM 1263  O OE1  . GLN A 1 84  ? 5.172   -9.816  -7.231  1.00 0.00 ? 84  GLN A OE1  1  
ATOM 1264  N NE2  . GLN A 1 84  ? 4.512   -8.144  -8.576  1.00 0.00 ? 84  GLN A NE2  1  
ATOM 1265  H H    . GLN A 1 84  ? 6.367   -5.036  -6.028  1.00 0.00 ? 84  GLN A H    1  
ATOM 1266  H HA   . GLN A 1 84  ? 5.370   -6.490  -3.932  1.00 0.00 ? 84  GLN A HA   1  
ATOM 1267  H HB2  . GLN A 1 84  ? 6.957   -7.278  -6.350  1.00 0.00 ? 84  GLN A HB2  1  
ATOM 1268  H HB3  . GLN A 1 84  ? 6.505   -8.493  -5.162  1.00 0.00 ? 84  GLN A HB3  1  
ATOM 1269  H HG2  . GLN A 1 84  ? 4.167   -8.006  -5.490  1.00 0.00 ? 84  GLN A HG2  1  
ATOM 1270  H HG3  . GLN A 1 84  ? 4.568   -6.690  -6.593  1.00 0.00 ? 84  GLN A HG3  1  
ATOM 1271  H HE21 . GLN A 1 84  ? 4.281   -7.192  -8.631  1.00 0.00 ? 84  GLN A HE21 1  
ATOM 1272  H HE22 . GLN A 1 84  ? 4.500   -8.750  -9.345  1.00 0.00 ? 84  GLN A HE22 1  
ATOM 1273  N N    . ASN A 1 85  ? 8.651   -6.900  -4.058  1.00 0.00 ? 85  ASN A N    1  
ATOM 1274  C CA   . ASN A 1 85  ? 9.825   -7.199  -3.247  1.00 0.00 ? 85  ASN A CA   1  
ATOM 1275  C C    . ASN A 1 85  ? 10.442  -5.919  -2.690  1.00 0.00 ? 85  ASN A C    1  
ATOM 1276  O O    . ASN A 1 85  ? 11.581  -5.919  -2.224  1.00 0.00 ? 85  ASN A O    1  
ATOM 1277  C CB   . ASN A 1 85  ? 10.863  -7.959  -4.076  1.00 0.00 ? 85  ASN A CB   1  
ATOM 1278  C CG   . ASN A 1 85  ? 10.468  -9.404  -4.312  1.00 0.00 ? 85  ASN A CG   1  
ATOM 1279  O OD1  . ASN A 1 85  ? 10.449  -10.213 -3.384  1.00 0.00 ? 85  ASN A OD1  1  
ATOM 1280  N ND2  . ASN A 1 85  ? 10.150  -9.735  -5.558  1.00 0.00 ? 85  ASN A ND2  1  
ATOM 1281  H H    . ASN A 1 85  ? 8.756   -6.775  -5.024  1.00 0.00 ? 85  ASN A H    1  
ATOM 1282  H HA   . ASN A 1 85  ? 9.510   -7.821  -2.423  1.00 0.00 ? 85  ASN A HA   1  
ATOM 1283  H HB2  . ASN A 1 85  ? 10.973  -7.475  -5.035  1.00 0.00 ? 85  ASN A HB2  1  
ATOM 1284  H HB3  . ASN A 1 85  ? 11.810  -7.943  -3.559  1.00 0.00 ? 85  ASN A HB3  1  
ATOM 1285  H HD21 . ASN A 1 85  ? 10.188  -9.037  -6.246  1.00 0.00 ? 85  ASN A HD21 1  
ATOM 1286  H HD22 . ASN A 1 85  ? 9.891   -10.662 -5.739  1.00 0.00 ? 85  ASN A HD22 1  
ATOM 1287  N N    . ALA A 1 86  ? 9.681   -4.831  -2.741  1.00 0.00 ? 86  ALA A N    1  
ATOM 1288  C CA   . ALA A 1 86  ? 10.151  -3.546  -2.239  1.00 0.00 ? 86  ALA A CA   1  
ATOM 1289  C C    . ALA A 1 86  ? 9.872   -3.404  -0.746  1.00 0.00 ? 86  ALA A C    1  
ATOM 1290  O O    . ALA A 1 86  ? 8.806   -3.786  -0.265  1.00 0.00 ? 86  ALA A O    1  
ATOM 1291  C CB   . ALA A 1 86  ? 9.498   -2.408  -3.010  1.00 0.00 ? 86  ALA A CB   1  
ATOM 1292  H H    . ALA A 1 86  ? 8.781   -4.895  -3.124  1.00 0.00 ? 86  ALA A H    1  
ATOM 1293  H HA   . ALA A 1 86  ? 11.218  -3.494  -2.402  1.00 0.00 ? 86  ALA A HA   1  
ATOM 1294  H HB1  . ALA A 1 86  ? 9.789   -1.464  -2.573  1.00 0.00 ? 86  ALA A HB1  1  
ATOM 1295  H HB2  . ALA A 1 86  ? 9.820   -2.442  -4.041  1.00 0.00 ? 86  ALA A HB2  1  
ATOM 1296  H HB3  . ALA A 1 86  ? 8.425   -2.511  -2.964  1.00 0.00 ? 86  ALA A HB3  1  
ATOM 1297  N N    . SER A 1 87  ? 10.839  -2.853  -0.018  1.00 0.00 ? 87  SER A N    1  
ATOM 1298  C CA   . SER A 1 87  ? 10.699  -2.666  1.421   1.00 0.00 ? 87  SER A CA   1  
ATOM 1299  C C    . SER A 1 87  ? 9.624   -1.628  1.731   1.00 0.00 ? 87  SER A C    1  
ATOM 1300  O O    . SER A 1 87  ? 8.947   -1.130  0.832   1.00 0.00 ? 87  SER A O    1  
ATOM 1301  C CB   . SER A 1 87  ? 12.033  -2.233  2.032   1.00 0.00 ? 87  SER A CB   1  
ATOM 1302  O OG   . SER A 1 87  ? 12.223  -0.835  1.905   1.00 0.00 ? 87  SER A OG   1  
ATOM 1303  H H    . SER A 1 87  ? 11.666  -2.569  -0.460  1.00 0.00 ? 87  SER A H    1  
ATOM 1304  H HA   . SER A 1 87  ? 10.405  -3.611  1.852   1.00 0.00 ? 87  SER A HA   1  
ATOM 1305  H HB2  . SER A 1 87  ? 12.047  -2.492  3.080   1.00 0.00 ? 87  SER A HB2  1  
ATOM 1306  H HB3  . SER A 1 87  ? 12.840  -2.743  1.525   1.00 0.00 ? 87  SER A HB3  1  
ATOM 1307  H HG   . SER A 1 87  ? 13.108  -0.661  1.575   1.00 0.00 ? 87  SER A HG   1  
ATOM 1308  N N    . HIS A 1 88  ? 9.474   -1.306  3.012   1.00 0.00 ? 88  HIS A N    1  
ATOM 1309  C CA   . HIS A 1 88  ? 8.482   -0.327  3.444   1.00 0.00 ? 88  HIS A CA   1  
ATOM 1310  C C    . HIS A 1 88  ? 8.773   1.043   2.839   1.00 0.00 ? 88  HIS A C    1  
ATOM 1311  O O    . HIS A 1 88  ? 7.863   1.742   2.393   1.00 0.00 ? 88  HIS A O    1  
ATOM 1312  C CB   . HIS A 1 88  ? 8.460   -0.230  4.969   1.00 0.00 ? 88  HIS A CB   1  
ATOM 1313  C CG   . HIS A 1 88  ? 7.119   0.136   5.527   1.00 0.00 ? 88  HIS A CG   1  
ATOM 1314  N ND1  . HIS A 1 88  ? 6.953   1.034   6.559   1.00 0.00 ? 88  HIS A ND1  1  
ATOM 1315  C CD2  . HIS A 1 88  ? 5.876   -0.280  5.188   1.00 0.00 ? 88  HIS A CD2  1  
ATOM 1316  C CE1  . HIS A 1 88  ? 5.666   1.154   6.833   1.00 0.00 ? 88  HIS A CE1  1  
ATOM 1317  N NE2  . HIS A 1 88  ? 4.991   0.368   6.015   1.00 0.00 ? 88  HIS A NE2  1  
ATOM 1318  H H    . HIS A 1 88  ? 10.044  -1.737  3.683   1.00 0.00 ? 88  HIS A H    1  
ATOM 1319  H HA   . HIS A 1 88  ? 7.515   -0.661  3.099   1.00 0.00 ? 88  HIS A HA   1  
ATOM 1320  H HB2  . HIS A 1 88  ? 8.743   -1.185  5.388   1.00 0.00 ? 88  HIS A HB2  1  
ATOM 1321  H HB3  . HIS A 1 88  ? 9.169   0.521   5.287   1.00 0.00 ? 88  HIS A HB3  1  
ATOM 1322  H HD1  . HIS A 1 88  ? 7.671   1.511   7.024   1.00 0.00 ? 88  HIS A HD1  1  
ATOM 1323  H HD2  . HIS A 1 88  ? 5.626   -0.989  4.412   1.00 0.00 ? 88  HIS A HD2  1  
ATOM 1324  H HE1  . HIS A 1 88  ? 5.238   1.788   7.595   1.00 0.00 ? 88  HIS A HE1  1  
ATOM 1325  N N    . SER A 1 89  ? 10.048  1.422   2.829   1.00 0.00 ? 89  SER A N    1  
ATOM 1326  C CA   . SER A 1 89  ? 10.458  2.710   2.284   1.00 0.00 ? 89  SER A CA   1  
ATOM 1327  C C    . SER A 1 89  ? 10.481  2.673   0.759   1.00 0.00 ? 89  SER A C    1  
ATOM 1328  O O    . SER A 1 89  ? 10.084  3.632   0.099   1.00 0.00 ? 89  SER A O    1  
ATOM 1329  C CB   . SER A 1 89  ? 11.839  3.097   2.817   1.00 0.00 ? 89  SER A CB   1  
ATOM 1330  O OG   . SER A 1 89  ? 11.774  3.466   4.183   1.00 0.00 ? 89  SER A OG   1  
ATOM 1331  H H    . SER A 1 89  ? 10.728  0.820   3.200   1.00 0.00 ? 89  SER A H    1  
ATOM 1332  H HA   . SER A 1 89  ? 9.739   3.450   2.604   1.00 0.00 ? 89  SER A HA   1  
ATOM 1333  H HB2  . SER A 1 89  ? 12.509  2.257   2.715   1.00 0.00 ? 89  SER A HB2  1  
ATOM 1334  H HB3  . SER A 1 89  ? 12.221  3.932   2.248   1.00 0.00 ? 89  SER A HB3  1  
ATOM 1335  H HG   . SER A 1 89  ? 10.877  3.733   4.401   1.00 0.00 ? 89  SER A HG   1  
ATOM 1336  N N    . GLU A 1 90  ? 10.948  1.557   0.208   1.00 0.00 ? 90  GLU A N    1  
ATOM 1337  C CA   . GLU A 1 90  ? 11.024  1.394   -1.239  1.00 0.00 ? 90  GLU A CA   1  
ATOM 1338  C C    . GLU A 1 90  ? 9.660   1.625   -1.885  1.00 0.00 ? 90  GLU A C    1  
ATOM 1339  O O    . GLU A 1 90  ? 9.566   2.171   -2.983  1.00 0.00 ? 90  GLU A O    1  
ATOM 1340  C CB   . GLU A 1 90  ? 11.537  -0.003  -1.592  1.00 0.00 ? 90  GLU A CB   1  
ATOM 1341  C CG   . GLU A 1 90  ? 12.986  -0.236  -1.200  1.00 0.00 ? 90  GLU A CG   1  
ATOM 1342  C CD   . GLU A 1 90  ? 13.957  0.156   -2.297  1.00 0.00 ? 90  GLU A CD   1  
ATOM 1343  O OE1  . GLU A 1 90  ? 13.834  -0.379  -3.418  1.00 0.00 ? 90  GLU A OE1  1  
ATOM 1344  O OE2  . GLU A 1 90  ? 14.840  0.999   -2.033  1.00 0.00 ? 90  GLU A OE2  1  
ATOM 1345  H H    . GLU A 1 90  ? 11.249  0.827   0.788   1.00 0.00 ? 90  GLU A H    1  
ATOM 1346  H HA   . GLU A 1 90  ? 11.717  2.129   -1.620  1.00 0.00 ? 90  GLU A HA   1  
ATOM 1347  H HB2  . GLU A 1 90  ? 10.926  -0.736  -1.086  1.00 0.00 ? 90  GLU A HB2  1  
ATOM 1348  H HB3  . GLU A 1 90  ? 11.447  -0.148  -2.658  1.00 0.00 ? 90  GLU A HB3  1  
ATOM 1349  H HG2  . GLU A 1 90  ? 13.207  0.349   -0.319  1.00 0.00 ? 90  GLU A HG2  1  
ATOM 1350  H HG3  . GLU A 1 90  ? 13.122  -1.284  -0.977  1.00 0.00 ? 90  GLU A HG3  1  
ATOM 1351  N N    . ALA A 1 91  ? 8.606   1.204   -1.193  1.00 0.00 ? 91  ALA A N    1  
ATOM 1352  C CA   . ALA A 1 91  ? 7.248   1.366   -1.697  1.00 0.00 ? 91  ALA A CA   1  
ATOM 1353  C C    . ALA A 1 91  ? 6.726   2.773   -1.428  1.00 0.00 ? 91  ALA A C    1  
ATOM 1354  O O    . ALA A 1 91  ? 6.054   3.368   -2.270  1.00 0.00 ? 91  ALA A O    1  
ATOM 1355  C CB   . ALA A 1 91  ? 6.326   0.330   -1.071  1.00 0.00 ? 91  ALA A CB   1  
ATOM 1356  H H    . ALA A 1 91  ? 8.745   0.776   -0.323  1.00 0.00 ? 91  ALA A H    1  
ATOM 1357  H HA   . ALA A 1 91  ? 7.266   1.197   -2.764  1.00 0.00 ? 91  ALA A HA   1  
ATOM 1358  H HB1  . ALA A 1 91  ? 6.513   -0.635  -1.517  1.00 0.00 ? 91  ALA A HB1  1  
ATOM 1359  H HB2  . ALA A 1 91  ? 6.514   0.278   -0.008  1.00 0.00 ? 91  ALA A HB2  1  
ATOM 1360  H HB3  . ALA A 1 91  ? 5.298   0.613   -1.242  1.00 0.00 ? 91  ALA A HB3  1  
ATOM 1361  N N    . VAL A 1 92  ? 7.040   3.300   -0.248  1.00 0.00 ? 92  VAL A N    1  
ATOM 1362  C CA   . VAL A 1 92  ? 6.603   4.638   0.132   1.00 0.00 ? 92  VAL A CA   1  
ATOM 1363  C C    . VAL A 1 92  ? 7.017   5.668   -0.913  1.00 0.00 ? 92  VAL A C    1  
ATOM 1364  O O    . VAL A 1 92  ? 6.179   6.392   -1.450  1.00 0.00 ? 92  VAL A O    1  
ATOM 1365  C CB   . VAL A 1 92  ? 7.179   5.049   1.500   1.00 0.00 ? 92  VAL A CB   1  
ATOM 1366  C CG1  . VAL A 1 92  ? 7.196   6.564   1.639   1.00 0.00 ? 92  VAL A CG1  1  
ATOM 1367  C CG2  . VAL A 1 92  ? 6.381   4.411   2.627   1.00 0.00 ? 92  VAL A CG2  1  
ATOM 1368  H H    . VAL A 1 92  ? 7.579   2.776   0.381   1.00 0.00 ? 92  VAL A H    1  
ATOM 1369  H HA   . VAL A 1 92  ? 5.525   4.628   0.207   1.00 0.00 ? 92  VAL A HA   1  
ATOM 1370  H HB   . VAL A 1 92  ? 8.197   4.693   1.561   1.00 0.00 ? 92  VAL A HB   1  
ATOM 1371  H HG11 . VAL A 1 92  ? 6.250   6.966   1.305   1.00 0.00 ? 92  VAL A HG11 1  
ATOM 1372  H HG12 . VAL A 1 92  ? 7.357   6.829   2.673   1.00 0.00 ? 92  VAL A HG12 1  
ATOM 1373  H HG13 . VAL A 1 92  ? 7.993   6.971   1.034   1.00 0.00 ? 92  VAL A HG13 1  
ATOM 1374  H HG21 . VAL A 1 92  ? 5.628   5.102   2.972   1.00 0.00 ? 92  VAL A HG21 1  
ATOM 1375  H HG22 . VAL A 1 92  ? 5.907   3.510   2.266   1.00 0.00 ? 92  VAL A HG22 1  
ATOM 1376  H HG23 . VAL A 1 92  ? 7.045   4.165   3.444   1.00 0.00 ? 92  VAL A HG23 1  
ATOM 1377  N N    . GLU A 1 93  ? 8.314   5.729   -1.194  1.00 0.00 ? 93  GLU A N    1  
ATOM 1378  C CA   . GLU A 1 93  ? 8.839   6.672   -2.175  1.00 0.00 ? 93  GLU A CA   1  
ATOM 1379  C C    . GLU A 1 93  ? 8.120   6.523   -3.512  1.00 0.00 ? 93  GLU A C    1  
ATOM 1380  O O    . GLU A 1 93  ? 7.936   7.497   -4.242  1.00 0.00 ? 93  GLU A O    1  
ATOM 1381  C CB   . GLU A 1 93  ? 10.343  6.461   -2.365  1.00 0.00 ? 93  GLU A CB   1  
ATOM 1382  C CG   . GLU A 1 93  ? 11.116  6.380   -1.059  1.00 0.00 ? 93  GLU A CG   1  
ATOM 1383  C CD   . GLU A 1 93  ? 12.525  6.927   -1.181  1.00 0.00 ? 93  GLU A CD   1  
ATOM 1384  O OE1  . GLU A 1 93  ? 12.865  7.457   -2.259  1.00 0.00 ? 93  GLU A OE1  1  
ATOM 1385  O OE2  . GLU A 1 93  ? 13.287  6.825   -0.197  1.00 0.00 ? 93  GLU A OE2  1  
ATOM 1386  H H    . GLU A 1 93  ? 8.933   5.126   -0.732  1.00 0.00 ? 93  GLU A H    1  
ATOM 1387  H HA   . GLU A 1 93  ? 8.670   7.670   -1.799  1.00 0.00 ? 93  GLU A HA   1  
ATOM 1388  H HB2  . GLU A 1 93  ? 10.499  5.541   -2.910  1.00 0.00 ? 93  GLU A HB2  1  
ATOM 1389  H HB3  . GLU A 1 93  ? 10.739  7.282   -2.943  1.00 0.00 ? 93  GLU A HB3  1  
ATOM 1390  H HG2  . GLU A 1 93  ? 10.589  6.948   -0.308  1.00 0.00 ? 93  GLU A HG2  1  
ATOM 1391  H HG3  . GLU A 1 93  ? 11.172  5.345   -0.753  1.00 0.00 ? 93  GLU A HG3  1  
ATOM 1392  N N    . ALA A 1 94  ? 7.718   5.296   -3.827  1.00 0.00 ? 94  ALA A N    1  
ATOM 1393  C CA   . ALA A 1 94  ? 7.018   5.019   -5.076  1.00 0.00 ? 94  ALA A CA   1  
ATOM 1394  C C    . ALA A 1 94  ? 5.678   5.744   -5.127  1.00 0.00 ? 94  ALA A C    1  
ATOM 1395  O O    . ALA A 1 94  ? 5.342   6.377   -6.128  1.00 0.00 ? 94  ALA A O    1  
ATOM 1396  C CB   . ALA A 1 94  ? 6.816   3.520   -5.246  1.00 0.00 ? 94  ALA A CB   1  
ATOM 1397  H H    . ALA A 1 94  ? 7.894   4.561   -3.205  1.00 0.00 ? 94  ALA A H    1  
ATOM 1398  H HA   . ALA A 1 94  ? 7.636   5.369   -5.890  1.00 0.00 ? 94  ALA A HA   1  
ATOM 1399  H HB1  . ALA A 1 94  ? 5.836   3.334   -5.658  1.00 0.00 ? 94  ALA A HB1  1  
ATOM 1400  H HB2  . ALA A 1 94  ? 7.569   3.130   -5.916  1.00 0.00 ? 94  ALA A HB2  1  
ATOM 1401  H HB3  . ALA A 1 94  ? 6.902   3.034   -4.285  1.00 0.00 ? 94  ALA A HB3  1  
ATOM 1402  N N    . ILE A 1 95  ? 4.916   5.647   -4.042  1.00 0.00 ? 95  ILE A N    1  
ATOM 1403  C CA   . ILE A 1 95  ? 3.612   6.294   -3.964  1.00 0.00 ? 95  ILE A CA   1  
ATOM 1404  C C    . ILE A 1 95  ? 3.752   7.812   -3.962  1.00 0.00 ? 95  ILE A C    1  
ATOM 1405  O O    . ILE A 1 95  ? 2.944   8.523   -4.561  1.00 0.00 ? 95  ILE A O    1  
ATOM 1406  C CB   . ILE A 1 95  ? 2.842   5.858   -2.704  1.00 0.00 ? 95  ILE A CB   1  
ATOM 1407  C CG1  . ILE A 1 95  ? 2.394   4.401   -2.832  1.00 0.00 ? 95  ILE A CG1  1  
ATOM 1408  C CG2  . ILE A 1 95  ? 1.644   6.768   -2.475  1.00 0.00 ? 95  ILE A CG2  1  
ATOM 1409  C CD1  . ILE A 1 95  ? 3.424   3.408   -2.339  1.00 0.00 ? 95  ILE A CD1  1  
ATOM 1410  H H    . ILE A 1 95  ? 5.239   5.128   -3.276  1.00 0.00 ? 95  ILE A H    1  
ATOM 1411  H HA   . ILE A 1 95  ? 3.041   5.997   -4.832  1.00 0.00 ? 95  ILE A HA   1  
ATOM 1412  H HB   . ILE A 1 95  ? 3.502   5.952   -1.855  1.00 0.00 ? 95  ILE A HB   1  
ATOM 1413  H HG12 . ILE A 1 95  ? 1.493   4.256   -2.257  1.00 0.00 ? 95  ILE A HG12 1  
ATOM 1414  H HG13 . ILE A 1 95  ? 2.193   4.184   -3.871  1.00 0.00 ? 95  ILE A HG13 1  
ATOM 1415  H HG21 . ILE A 1 95  ? 1.976   7.794   -2.422  1.00 0.00 ? 95  ILE A HG21 1  
ATOM 1416  H HG22 . ILE A 1 95  ? 0.947   6.658   -3.292  1.00 0.00 ? 95  ILE A HG22 1  
ATOM 1417  H HG23 . ILE A 1 95  ? 1.159   6.499   -1.549  1.00 0.00 ? 95  ILE A HG23 1  
ATOM 1418  H HD11 . ILE A 1 95  ? 4.058   3.109   -3.162  1.00 0.00 ? 95  ILE A HD11 1  
ATOM 1419  H HD12 . ILE A 1 95  ? 4.027   3.865   -1.569  1.00 0.00 ? 95  ILE A HD12 1  
ATOM 1420  H HD13 . ILE A 1 95  ? 2.923   2.539   -1.938  1.00 0.00 ? 95  ILE A HD13 1  
ATOM 1421  N N    . LYS A 1 96  ? 4.784   8.305   -3.285  1.00 0.00 ? 96  LYS A N    1  
ATOM 1422  C CA   . LYS A 1 96  ? 5.033   9.739   -3.206  1.00 0.00 ? 96  LYS A CA   1  
ATOM 1423  C C    . LYS A 1 96  ? 5.717   10.243  -4.473  1.00 0.00 ? 96  LYS A C    1  
ATOM 1424  O O    . LYS A 1 96  ? 5.589   11.412  -4.836  1.00 0.00 ? 96  LYS A O    1  
ATOM 1425  C CB   . LYS A 1 96  ? 5.897   10.061  -1.985  1.00 0.00 ? 96  LYS A CB   1  
ATOM 1426  C CG   . LYS A 1 96  ? 7.389   10.042  -2.273  1.00 0.00 ? 96  LYS A CG   1  
ATOM 1427  C CD   . LYS A 1 96  ? 8.204   10.162  -0.997  1.00 0.00 ? 96  LYS A CD   1  
ATOM 1428  C CE   . LYS A 1 96  ? 8.286   11.605  -0.521  1.00 0.00 ? 96  LYS A CE   1  
ATOM 1429  N NZ   . LYS A 1 96  ? 8.520   11.693  0.947   1.00 0.00 ? 96  LYS A NZ   1  
ATOM 1430  H H    . LYS A 1 96  ? 5.394   7.688   -2.828  1.00 0.00 ? 96  LYS A H    1  
ATOM 1431  H HA   . LYS A 1 96  ? 4.081   10.237  -3.104  1.00 0.00 ? 96  LYS A HA   1  
ATOM 1432  H HB2  . LYS A 1 96  ? 5.635   11.044  -1.622  1.00 0.00 ? 96  LYS A HB2  1  
ATOM 1433  H HB3  . LYS A 1 96  ? 5.692   9.335   -1.212  1.00 0.00 ? 96  LYS A HB3  1  
ATOM 1434  H HG2  . LYS A 1 96  ? 7.640   9.112   -2.761  1.00 0.00 ? 96  LYS A HG2  1  
ATOM 1435  H HG3  . LYS A 1 96  ? 7.631   10.870  -2.924  1.00 0.00 ? 96  LYS A HG3  1  
ATOM 1436  H HD2  . LYS A 1 96  ? 7.740   9.567   -0.225  1.00 0.00 ? 96  LYS A HD2  1  
ATOM 1437  H HD3  . LYS A 1 96  ? 9.204   9.797   -1.183  1.00 0.00 ? 96  LYS A HD3  1  
ATOM 1438  H HE2  . LYS A 1 96  ? 9.098   12.095  -1.037  1.00 0.00 ? 96  LYS A HE2  1  
ATOM 1439  H HE3  . LYS A 1 96  ? 7.357   12.101  -0.760  1.00 0.00 ? 96  LYS A HE3  1  
ATOM 1440  H HZ1  . LYS A 1 96  ? 9.111   10.897  1.263   1.00 0.00 ? 96  LYS A HZ1  1  
ATOM 1441  H HZ2  . LYS A 1 96  ? 7.613   11.661  1.455   1.00 0.00 ? 96  LYS A HZ2  1  
ATOM 1442  H HZ3  . LYS A 1 96  ? 9.004   12.584  1.179   1.00 0.00 ? 96  LYS A HZ3  1  
ATOM 1443  N N    . ASN A 1 97  ? 6.442   9.353   -5.143  1.00 0.00 ? 97  ASN A N    1  
ATOM 1444  C CA   . ASN A 1 97  ? 7.145   9.708   -6.370  1.00 0.00 ? 97  ASN A CA   1  
ATOM 1445  C C    . ASN A 1 97  ? 6.438   9.125   -7.590  1.00 0.00 ? 97  ASN A C    1  
ATOM 1446  O O    . ASN A 1 97  ? 7.030   9.001   -8.662  1.00 0.00 ? 97  ASN A O    1  
ATOM 1447  C CB   . ASN A 1 97  ? 8.591   9.209   -6.317  1.00 0.00 ? 97  ASN A CB   1  
ATOM 1448  C CG   . ASN A 1 97  ? 9.352   9.768   -5.131  1.00 0.00 ? 97  ASN A CG   1  
ATOM 1449  O OD1  . ASN A 1 97  ? 9.392   10.981  -4.921  1.00 0.00 ? 97  ASN A OD1  1  
ATOM 1450  N ND2  . ASN A 1 97  ? 9.962   8.885   -4.350  1.00 0.00 ? 97  ASN A ND2  1  
ATOM 1451  H H    . ASN A 1 97  ? 6.506   8.436   -4.804  1.00 0.00 ? 97  ASN A H    1  
ATOM 1452  H HA   . ASN A 1 97  ? 7.148   10.785  -6.451  1.00 0.00 ? 97  ASN A HA   1  
ATOM 1453  H HB2  . ASN A 1 97  ? 8.590   8.131   -6.244  1.00 0.00 ? 97  ASN A HB2  1  
ATOM 1454  H HB3  . ASN A 1 97  ? 9.101   9.504   -7.222  1.00 0.00 ? 97  ASN A HB3  1  
ATOM 1455  H HD21 . ASN A 1 97  ? 9.887   7.935   -4.578  1.00 0.00 ? 97  ASN A HD21 1  
ATOM 1456  H HD22 . ASN A 1 97  ? 10.461  9.219   -3.576  1.00 0.00 ? 97  ASN A HD22 1  
ATOM 1457  N N    . ALA A 1 98  ? 5.170   8.769   -7.418  1.00 0.00 ? 98  ALA A N    1  
ATOM 1458  C CA   . ALA A 1 98  ? 4.381   8.202   -8.505  1.00 0.00 ? 98  ALA A CA   1  
ATOM 1459  C C    . ALA A 1 98  ? 3.854   9.295   -9.429  1.00 0.00 ? 98  ALA A C    1  
ATOM 1460  O O    . ALA A 1 98  ? 3.053   10.134  -9.021  1.00 0.00 ? 98  ALA A O    1  
ATOM 1461  C CB   . ALA A 1 98  ? 3.229   7.379   -7.948  1.00 0.00 ? 98  ALA A CB   1  
ATOM 1462  H H    . ALA A 1 98  ? 4.754   8.893   -6.540  1.00 0.00 ? 98  ALA A H    1  
ATOM 1463  H HA   . ALA A 1 98  ? 5.022   7.542   -9.073  1.00 0.00 ? 98  ALA A HA   1  
ATOM 1464  H HB1  . ALA A 1 98  ? 3.562   6.366   -7.775  1.00 0.00 ? 98  ALA A HB1  1  
ATOM 1465  H HB2  . ALA A 1 98  ? 2.896   7.813   -7.016  1.00 0.00 ? 98  ALA A HB2  1  
ATOM 1466  H HB3  . ALA A 1 98  ? 2.414   7.375   -8.656  1.00 0.00 ? 98  ALA A HB3  1  
ATOM 1467  N N    . GLY A 1 99  ? 4.311   9.278   -10.678 1.00 0.00 ? 99  GLY A N    1  
ATOM 1468  C CA   . GLY A 1 99  ? 3.875   10.274  -11.640 1.00 0.00 ? 99  GLY A CA   1  
ATOM 1469  C C    . GLY A 1 99  ? 2.365   10.363  -11.738 1.00 0.00 ? 99  GLY A C    1  
ATOM 1470  O O    . GLY A 1 99  ? 1.736   9.583   -12.451 1.00 0.00 ? 99  GLY A O    1  
ATOM 1471  H H    . GLY A 1 99  ? 4.949   8.585   -10.948 1.00 0.00 ? 99  GLY A H    1  
ATOM 1472  H HA2  . GLY A 1 99  ? 4.265   11.237  -11.347 1.00 0.00 ? 99  GLY A HA2  1  
ATOM 1473  H HA3  . GLY A 1 99  ? 4.272   10.016  -12.612 1.00 0.00 ? 99  GLY A HA3  1  
ATOM 1474  N N    . ASN A 1 100 ? 1.783   11.317  -11.018 1.00 0.00 ? 100 ASN A N    1  
ATOM 1475  C CA   . ASN A 1 100 ? 0.337   11.504  -11.025 1.00 0.00 ? 100 ASN A CA   1  
ATOM 1476  C C    . ASN A 1 100 ? -0.231  11.306  -12.427 1.00 0.00 ? 100 ASN A C    1  
ATOM 1477  O O    . ASN A 1 100 ? 0.323   11.778  -13.420 1.00 0.00 ? 100 ASN A O    1  
ATOM 1478  C CB   . ASN A 1 100 ? -0.020  12.900  -10.511 1.00 0.00 ? 100 ASN A CB   1  
ATOM 1479  C CG   . ASN A 1 100 ? -1.518  13.131  -10.457 1.00 0.00 ? 100 ASN A CG   1  
ATOM 1480  O OD1  . ASN A 1 100 ? -2.212  13.017  -11.467 1.00 0.00 ? 100 ASN A OD1  1  
ATOM 1481  N ND2  . ASN A 1 100 ? -2.023  13.458  -9.273  1.00 0.00 ? 100 ASN A ND2  1  
ATOM 1482  H H    . ASN A 1 100 ? 2.339   11.908  -10.469 1.00 0.00 ? 100 ASN A H    1  
ATOM 1483  H HA   . ASN A 1 100 ? -0.096  10.766  -10.366 1.00 0.00 ? 100 ASN A HA   1  
ATOM 1484  H HB2  . ASN A 1 100 ? 0.380   13.024  -9.515  1.00 0.00 ? 100 ASN A HB2  1  
ATOM 1485  H HB3  . ASN A 1 100 ? 0.417   13.641  -11.164 1.00 0.00 ? 100 ASN A HB3  1  
ATOM 1486  H HD21 . ASN A 1 100 ? -1.411  13.531  -8.512  1.00 0.00 ? 100 ASN A HD21 1  
ATOM 1487  H HD22 . ASN A 1 100 ? -2.989  13.612  -9.209  1.00 0.00 ? 100 ASN A HD22 1  
ATOM 1488  N N    . PRO A 1 101 ? -1.362  10.590  -12.512 1.00 0.00 ? 101 PRO A N    1  
ATOM 1489  C CA   . PRO A 1 101 ? -2.030  10.023  -11.336 1.00 0.00 ? 101 PRO A CA   1  
ATOM 1490  C C    . PRO A 1 101 ? -1.237  8.878   -10.716 1.00 0.00 ? 101 PRO A C    1  
ATOM 1491  O O    . PRO A 1 101 ? -0.251  8.410   -11.287 1.00 0.00 ? 101 PRO A O    1  
ATOM 1492  C CB   . PRO A 1 101 ? -3.359  9.511   -11.896 1.00 0.00 ? 101 PRO A CB   1  
ATOM 1493  C CG   . PRO A 1 101 ? -3.088  9.251   -13.338 1.00 0.00 ? 101 PRO A CG   1  
ATOM 1494  C CD   . PRO A 1 101 ? -2.077  10.280  -13.761 1.00 0.00 ? 101 PRO A CD   1  
ATOM 1495  H HA   . PRO A 1 101 ? -2.220  10.776  -10.586 1.00 0.00 ? 101 PRO A HA   1  
ATOM 1496  H HB2  . PRO A 1 101 ? -3.647  8.607   -11.378 1.00 0.00 ? 101 PRO A HB2  1  
ATOM 1497  H HB3  . PRO A 1 101 ? -4.122  10.264  -11.768 1.00 0.00 ? 101 PRO A HB3  1  
ATOM 1498  H HG2  . PRO A 1 101 ? -2.686  8.257   -13.463 1.00 0.00 ? 101 PRO A HG2  1  
ATOM 1499  H HG3  . PRO A 1 101 ? -3.998  9.364   -13.908 1.00 0.00 ? 101 PRO A HG3  1  
ATOM 1500  H HD2  . PRO A 1 101 ? -1.404  9.867   -14.498 1.00 0.00 ? 101 PRO A HD2  1  
ATOM 1501  H HD3  . PRO A 1 101 ? -2.572  11.158  -14.149 1.00 0.00 ? 101 PRO A HD3  1  
ATOM 1502  N N    . VAL A 1 102 ? -1.673  8.429   -9.543  1.00 0.00 ? 102 VAL A N    1  
ATOM 1503  C CA   . VAL A 1 102 ? -1.004  7.337   -8.846  1.00 0.00 ? 102 VAL A CA   1  
ATOM 1504  C C    . VAL A 1 102 ? -1.804  6.043   -8.956  1.00 0.00 ? 102 VAL A C    1  
ATOM 1505  O O    . VAL A 1 102 ? -2.743  5.814   -8.194  1.00 0.00 ? 102 VAL A O    1  
ATOM 1506  C CB   . VAL A 1 102 ? -0.790  7.669   -7.357  1.00 0.00 ? 102 VAL A CB   1  
ATOM 1507  C CG1  . VAL A 1 102 ? 0.104   6.628   -6.701  1.00 0.00 ? 102 VAL A CG1  1  
ATOM 1508  C CG2  . VAL A 1 102 ? -0.201  9.064   -7.203  1.00 0.00 ? 102 VAL A CG2  1  
ATOM 1509  H H    . VAL A 1 102 ? -2.464  8.842   -9.138  1.00 0.00 ? 102 VAL A H    1  
ATOM 1510  H HA   . VAL A 1 102 ? -0.037  7.191   -9.304  1.00 0.00 ? 102 VAL A HA   1  
ATOM 1511  H HB   . VAL A 1 102 ? -1.750  7.651   -6.863  1.00 0.00 ? 102 VAL A HB   1  
ATOM 1512  H HG11 . VAL A 1 102 ? -0.476  5.744   -6.481  1.00 0.00 ? 102 VAL A HG11 1  
ATOM 1513  H HG12 . VAL A 1 102 ? 0.912   6.374   -7.371  1.00 0.00 ? 102 VAL A HG12 1  
ATOM 1514  H HG13 . VAL A 1 102 ? 0.509   7.029   -5.783  1.00 0.00 ? 102 VAL A HG13 1  
ATOM 1515  H HG21 . VAL A 1 102 ? 0.811   9.071   -7.580  1.00 0.00 ? 102 VAL A HG21 1  
ATOM 1516  H HG22 . VAL A 1 102 ? -0.798  9.770   -7.760  1.00 0.00 ? 102 VAL A HG22 1  
ATOM 1517  H HG23 . VAL A 1 102 ? -0.198  9.340   -6.158  1.00 0.00 ? 102 VAL A HG23 1  
ATOM 1518  N N    . VAL A 1 103 ? -1.425  5.199   -9.911  1.00 0.00 ? 103 VAL A N    1  
ATOM 1519  C CA   . VAL A 1 103 ? -2.105  3.927   -10.120 1.00 0.00 ? 103 VAL A CA   1  
ATOM 1520  C C    . VAL A 1 103 ? -1.701  2.907   -9.062  1.00 0.00 ? 103 VAL A C    1  
ATOM 1521  O O    . VAL A 1 103 ? -0.563  2.903   -8.591  1.00 0.00 ? 103 VAL A O    1  
ATOM 1522  C CB   . VAL A 1 103 ? -1.801  3.351   -11.516 1.00 0.00 ? 103 VAL A CB   1  
ATOM 1523  C CG1  . VAL A 1 103 ? -2.851  2.324   -11.911 1.00 0.00 ? 103 VAL A CG1  1  
ATOM 1524  C CG2  . VAL A 1 103 ? -1.720  4.467   -12.547 1.00 0.00 ? 103 VAL A CG2  1  
ATOM 1525  H H    . VAL A 1 103 ? -0.669  5.438   -10.487 1.00 0.00 ? 103 VAL A H    1  
ATOM 1526  H HA   . VAL A 1 103 ? -3.169  4.102   -10.050 1.00 0.00 ? 103 VAL A HA   1  
ATOM 1527  H HB   . VAL A 1 103 ? -0.842  2.856   -11.478 1.00 0.00 ? 103 VAL A HB   1  
ATOM 1528  H HG11 . VAL A 1 103 ? -3.243  1.852   -11.023 1.00 0.00 ? 103 VAL A HG11 1  
ATOM 1529  H HG12 . VAL A 1 103 ? -3.652  2.815   -12.443 1.00 0.00 ? 103 VAL A HG12 1  
ATOM 1530  H HG13 . VAL A 1 103 ? -2.401  1.576   -12.547 1.00 0.00 ? 103 VAL A HG13 1  
ATOM 1531  H HG21 . VAL A 1 103 ? -2.181  4.142   -13.467 1.00 0.00 ? 103 VAL A HG21 1  
ATOM 1532  H HG22 . VAL A 1 103 ? -2.238  5.339   -12.173 1.00 0.00 ? 103 VAL A HG22 1  
ATOM 1533  H HG23 . VAL A 1 103 ? -0.685  4.715   -12.730 1.00 0.00 ? 103 VAL A HG23 1  
ATOM 1534  N N    . PHE A 1 104 ? -2.639  2.041   -8.693  1.00 0.00 ? 104 PHE A N    1  
ATOM 1535  C CA   . PHE A 1 104 ? -2.381  1.015   -7.690  1.00 0.00 ? 104 PHE A CA   1  
ATOM 1536  C C    . PHE A 1 104 ? -2.748  -0.368  -8.220  1.00 0.00 ? 104 PHE A C    1  
ATOM 1537  O O    . PHE A 1 104 ? -3.845  -0.574  -8.739  1.00 0.00 ? 104 PHE A O    1  
ATOM 1538  C CB   . PHE A 1 104 ? -3.171  1.311   -6.413  1.00 0.00 ? 104 PHE A CB   1  
ATOM 1539  C CG   . PHE A 1 104 ? -2.402  2.117   -5.406  1.00 0.00 ? 104 PHE A CG   1  
ATOM 1540  C CD1  . PHE A 1 104 ? -2.300  3.493   -5.533  1.00 0.00 ? 104 PHE A CD1  1  
ATOM 1541  C CD2  . PHE A 1 104 ? -1.780  1.500   -4.333  1.00 0.00 ? 104 PHE A CD2  1  
ATOM 1542  C CE1  . PHE A 1 104 ? -1.594  4.239   -4.608  1.00 0.00 ? 104 PHE A CE1  1  
ATOM 1543  C CE2  . PHE A 1 104 ? -1.073  2.240   -3.405  1.00 0.00 ? 104 PHE A CE2  1  
ATOM 1544  C CZ   . PHE A 1 104 ? -0.978  3.611   -3.543  1.00 0.00 ? 104 PHE A CZ   1  
ATOM 1545  H H    . PHE A 1 104 ? -3.527  2.095   -9.106  1.00 0.00 ? 104 PHE A H    1  
ATOM 1546  H HA   . PHE A 1 104 ? -1.326  1.032   -7.463  1.00 0.00 ? 104 PHE A HA   1  
ATOM 1547  H HB2  . PHE A 1 104 ? -4.062  1.863   -6.669  1.00 0.00 ? 104 PHE A HB2  1  
ATOM 1548  H HB3  . PHE A 1 104 ? -3.451  0.378   -5.948  1.00 0.00 ? 104 PHE A HB3  1  
ATOM 1549  H HD1  . PHE A 1 104 ? -2.782  3.986   -6.367  1.00 0.00 ? 104 PHE A HD1  1  
ATOM 1550  H HD2  . PHE A 1 104 ? -1.852  0.428   -4.224  1.00 0.00 ? 104 PHE A HD2  1  
ATOM 1551  H HE1  . PHE A 1 104 ? -1.522  5.311   -4.720  1.00 0.00 ? 104 PHE A HE1  1  
ATOM 1552  H HE2  . PHE A 1 104 ? -0.592  1.747   -2.573  1.00 0.00 ? 104 PHE A HE2  1  
ATOM 1553  H HZ   . PHE A 1 104 ? -0.427  4.192   -2.819  1.00 0.00 ? 104 PHE A HZ   1  
ATOM 1554  N N    . ILE A 1 105 ? -1.822  -1.311  -8.085  1.00 0.00 ? 105 ILE A N    1  
ATOM 1555  C CA   . ILE A 1 105 ? -2.048  -2.674  -8.549  1.00 0.00 ? 105 ILE A CA   1  
ATOM 1556  C C    . ILE A 1 105 ? -2.011  -3.663  -7.389  1.00 0.00 ? 105 ILE A C    1  
ATOM 1557  O O    . ILE A 1 105 ? -0.956  -4.198  -7.048  1.00 0.00 ? 105 ILE A O    1  
ATOM 1558  C CB   . ILE A 1 105 ? -1.001  -3.092  -9.599  1.00 0.00 ? 105 ILE A CB   1  
ATOM 1559  C CG1  . ILE A 1 105 ? -0.869  -2.014  -10.676 1.00 0.00 ? 105 ILE A CG1  1  
ATOM 1560  C CG2  . ILE A 1 105 ? -1.380  -4.428  -10.222 1.00 0.00 ? 105 ILE A CG2  1  
ATOM 1561  C CD1  . ILE A 1 105 ? -0.415  -2.551  -12.016 1.00 0.00 ? 105 ILE A CD1  1  
ATOM 1562  H H    . ILE A 1 105 ? -0.968  -1.085  -7.663  1.00 0.00 ? 105 ILE A H    1  
ATOM 1563  H HA   . ILE A 1 105 ? -3.025  -2.712  -9.009  1.00 0.00 ? 105 ILE A HA   1  
ATOM 1564  H HB   . ILE A 1 105 ? -0.052  -3.211  -9.100  1.00 0.00 ? 105 ILE A HB   1  
ATOM 1565  H HG12 . ILE A 1 105 ? -1.826  -1.536  -10.818 1.00 0.00 ? 105 ILE A HG12 1  
ATOM 1566  H HG13 . ILE A 1 105 ? -0.148  -1.278  -10.351 1.00 0.00 ? 105 ILE A HG13 1  
ATOM 1567  H HG21 . ILE A 1 105 ? -2.045  -4.959  -9.557  1.00 0.00 ? 105 ILE A HG21 1  
ATOM 1568  H HG22 . ILE A 1 105 ? -1.877  -4.256  -11.165 1.00 0.00 ? 105 ILE A HG22 1  
ATOM 1569  H HG23 . ILE A 1 105 ? -0.489  -5.015  -10.385 1.00 0.00 ? 105 ILE A HG23 1  
ATOM 1570  H HD11 . ILE A 1 105 ? 0.177   -3.442  -11.864 1.00 0.00 ? 105 ILE A HD11 1  
ATOM 1571  H HD12 . ILE A 1 105 ? -1.278  -2.792  -12.618 1.00 0.00 ? 105 ILE A HD12 1  
ATOM 1572  H HD13 . ILE A 1 105 ? 0.180   -1.805  -12.520 1.00 0.00 ? 105 ILE A HD13 1  
ATOM 1573  N N    . VAL A 1 106 ? -3.171  -3.904  -6.786  1.00 0.00 ? 106 VAL A N    1  
ATOM 1574  C CA   . VAL A 1 106 ? -3.272  -4.831  -5.665  1.00 0.00 ? 106 VAL A CA   1  
ATOM 1575  C C    . VAL A 1 106 ? -4.251  -5.959  -5.973  1.00 0.00 ? 106 VAL A C    1  
ATOM 1576  O O    . VAL A 1 106 ? -4.850  -5.998  -7.047  1.00 0.00 ? 106 VAL A O    1  
ATOM 1577  C CB   . VAL A 1 106 ? -3.723  -4.112  -4.380  1.00 0.00 ? 106 VAL A CB   1  
ATOM 1578  C CG1  . VAL A 1 106 ? -2.790  -2.953  -4.062  1.00 0.00 ? 106 VAL A CG1  1  
ATOM 1579  C CG2  . VAL A 1 106 ? -5.159  -3.629  -4.516  1.00 0.00 ? 106 VAL A CG2  1  
ATOM 1580  H H    . VAL A 1 106 ? -3.978  -3.447  -7.103  1.00 0.00 ? 106 VAL A H    1  
ATOM 1581  H HA   . VAL A 1 106 ? -2.293  -5.254  -5.492  1.00 0.00 ? 106 VAL A HA   1  
ATOM 1582  H HB   . VAL A 1 106 ? -3.678  -4.816  -3.563  1.00 0.00 ? 106 VAL A HB   1  
ATOM 1583  H HG11 . VAL A 1 106 ? -2.217  -3.186  -3.176  1.00 0.00 ? 106 VAL A HG11 1  
ATOM 1584  H HG12 . VAL A 1 106 ? -2.120  -2.791  -4.893  1.00 0.00 ? 106 VAL A HG12 1  
ATOM 1585  H HG13 . VAL A 1 106 ? -3.372  -2.060  -3.888  1.00 0.00 ? 106 VAL A HG13 1  
ATOM 1586  H HG21 . VAL A 1 106 ? -5.402  -3.509  -5.562  1.00 0.00 ? 106 VAL A HG21 1  
ATOM 1587  H HG22 . VAL A 1 106 ? -5.825  -4.353  -4.072  1.00 0.00 ? 106 VAL A HG22 1  
ATOM 1588  H HG23 . VAL A 1 106 ? -5.270  -2.680  -4.010  1.00 0.00 ? 106 VAL A HG23 1  
ATOM 1589  N N    . GLN A 1 107 ? -4.407  -6.875  -5.022  1.00 0.00 ? 107 GLN A N    1  
ATOM 1590  C CA   . GLN A 1 107 ? -5.313  -8.005  -5.192  1.00 0.00 ? 107 GLN A CA   1  
ATOM 1591  C C    . GLN A 1 107 ? -6.104  -8.265  -3.914  1.00 0.00 ? 107 GLN A C    1  
ATOM 1592  O O    . GLN A 1 107 ? -5.563  -8.772  -2.931  1.00 0.00 ? 107 GLN A O    1  
ATOM 1593  C CB   . GLN A 1 107 ? -4.531  -9.258  -5.586  1.00 0.00 ? 107 GLN A CB   1  
ATOM 1594  C CG   . GLN A 1 107 ? -3.337  -8.973  -6.483  1.00 0.00 ? 107 GLN A CG   1  
ATOM 1595  C CD   . GLN A 1 107 ? -2.842  -10.210 -7.207  1.00 0.00 ? 107 GLN A CD   1  
ATOM 1596  O OE1  . GLN A 1 107 ? -1.654  -10.533 -7.167  1.00 0.00 ? 107 GLN A OE1  1  
ATOM 1597  N NE2  . GLN A 1 107 ? -3.752  -10.910 -7.873  1.00 0.00 ? 107 GLN A NE2  1  
ATOM 1598  H H    . GLN A 1 107 ? -3.902  -6.789  -4.188  1.00 0.00 ? 107 GLN A H    1  
ATOM 1599  H HA   . GLN A 1 107 ? -6.005  -7.759  -5.983  1.00 0.00 ? 107 GLN A HA   1  
ATOM 1600  H HB2  . GLN A 1 107 ? -4.173  -9.742  -4.690  1.00 0.00 ? 107 GLN A HB2  1  
ATOM 1601  H HB3  . GLN A 1 107 ? -5.194  -9.932  -6.110  1.00 0.00 ? 107 GLN A HB3  1  
ATOM 1602  H HG2  . GLN A 1 107 ? -3.623  -8.236  -7.219  1.00 0.00 ? 107 GLN A HG2  1  
ATOM 1603  H HG3  . GLN A 1 107 ? -2.533  -8.582  -5.877  1.00 0.00 ? 107 GLN A HG3  1  
ATOM 1604  H HE21 . GLN A 1 107 ? -4.680  -10.593 -7.862  1.00 0.00 ? 107 GLN A HE21 1  
ATOM 1605  H HE22 . GLN A 1 107 ? -3.460  -11.714 -8.350  1.00 0.00 ? 107 GLN A HE22 1  
ATOM 1606  N N    . SER A 1 108 ? -7.386  -7.916  -3.935  1.00 0.00 ? 108 SER A N    1  
ATOM 1607  C CA   . SER A 1 108 ? -8.250  -8.108  -2.776  1.00 0.00 ? 108 SER A CA   1  
ATOM 1608  C C    . SER A 1 108 ? -8.588  -9.584  -2.590  1.00 0.00 ? 108 SER A C    1  
ATOM 1609  O O    . SER A 1 108 ? -9.115  -10.231 -3.495  1.00 0.00 ? 108 SER A O    1  
ATOM 1610  C CB   . SER A 1 108 ? -9.536  -7.294  -2.931  1.00 0.00 ? 108 SER A CB   1  
ATOM 1611  O OG   . SER A 1 108 ? -10.571 -7.816  -2.116  1.00 0.00 ? 108 SER A OG   1  
ATOM 1612  H H    . SER A 1 108 ? -7.759  -7.516  -4.748  1.00 0.00 ? 108 SER A H    1  
ATOM 1613  H HA   . SER A 1 108 ? -7.717  -7.760  -1.903  1.00 0.00 ? 108 SER A HA   1  
ATOM 1614  H HB2  . SER A 1 108 ? -9.348  -6.271  -2.642  1.00 0.00 ? 108 SER A HB2  1  
ATOM 1615  H HB3  . SER A 1 108 ? -9.855  -7.324  -3.963  1.00 0.00 ? 108 SER A HB3  1  
ATOM 1616  H HG   . SER A 1 108 ? -10.690 -7.252  -1.349  1.00 0.00 ? 108 SER A HG   1  
ATOM 1617  N N    . LEU A 1 109 ? -8.281  -10.110 -1.409  1.00 0.00 ? 109 LEU A N    1  
ATOM 1618  C CA   . LEU A 1 109 ? -8.552  -11.511 -1.102  1.00 0.00 ? 109 LEU A CA   1  
ATOM 1619  C C    . LEU A 1 109 ? -10.049 -11.800 -1.154  1.00 0.00 ? 109 LEU A C    1  
ATOM 1620  O O    . LEU A 1 109 ? -10.866 -10.883 -1.243  1.00 0.00 ? 109 LEU A O    1  
ATOM 1621  C CB   . LEU A 1 109 ? -8.000  -11.866 0.280   1.00 0.00 ? 109 LEU A CB   1  
ATOM 1622  C CG   . LEU A 1 109 ? -6.561  -12.382 0.315   1.00 0.00 ? 109 LEU A CG   1  
ATOM 1623  C CD1  . LEU A 1 109 ? -6.097  -12.572 1.751   1.00 0.00 ? 109 LEU A CD1  1  
ATOM 1624  C CD2  . LEU A 1 109 ? -6.443  -13.685 -0.462  1.00 0.00 ? 109 LEU A CD2  1  
ATOM 1625  H H    . LEU A 1 109 ? -7.863  -9.545  -0.727  1.00 0.00 ? 109 LEU A H    1  
ATOM 1626  H HA   . LEU A 1 109 ? -8.055  -12.115 -1.846  1.00 0.00 ? 109 LEU A HA   1  
ATOM 1627  H HB2  . LEU A 1 109 ? -8.048  -10.980 0.893   1.00 0.00 ? 109 LEU A HB2  1  
ATOM 1628  H HB3  . LEU A 1 109 ? -8.637  -12.630 0.703   1.00 0.00 ? 109 LEU A HB3  1  
ATOM 1629  H HG   . LEU A 1 109 ? -5.913  -11.654 -0.151  1.00 0.00 ? 109 LEU A HG   1  
ATOM 1630  H HD11 . LEU A 1 109 ? -5.165  -13.116 1.759   1.00 0.00 ? 109 LEU A HD11 1  
ATOM 1631  H HD12 . LEU A 1 109 ? -6.844  -13.127 2.300   1.00 0.00 ? 109 LEU A HD12 1  
ATOM 1632  H HD13 . LEU A 1 109 ? -5.955  -11.606 2.213   1.00 0.00 ? 109 LEU A HD13 1  
ATOM 1633  H HD21 . LEU A 1 109 ? -6.294  -13.468 -1.509  1.00 0.00 ? 109 LEU A HD21 1  
ATOM 1634  H HD22 . LEU A 1 109 ? -7.348  -14.261 -0.339  1.00 0.00 ? 109 LEU A HD22 1  
ATOM 1635  H HD23 . LEU A 1 109 ? -5.602  -14.252 -0.088  1.00 0.00 ? 109 LEU A HD23 1  
ATOM 1636  N N    . SER A 1 110 ? -10.402 -13.080 -1.096  1.00 0.00 ? 110 SER A N    1  
ATOM 1637  C CA   . SER A 1 110 ? -11.800 -13.490 -1.138  1.00 0.00 ? 110 SER A CA   1  
ATOM 1638  C C    . SER A 1 110 ? -12.615 -12.752 -0.079  1.00 0.00 ? 110 SER A C    1  
ATOM 1639  O O    . SER A 1 110 ? -12.798 -13.245 1.034   1.00 0.00 ? 110 SER A O    1  
ATOM 1640  C CB   . SER A 1 110 ? -11.917 -15.001 -0.926  1.00 0.00 ? 110 SER A CB   1  
ATOM 1641  O OG   . SER A 1 110 ? -13.257 -15.376 -0.655  1.00 0.00 ? 110 SER A OG   1  
ATOM 1642  H H    . SER A 1 110 ? -9.704  -13.765 -1.025  1.00 0.00 ? 110 SER A H    1  
ATOM 1643  H HA   . SER A 1 110 ? -12.190 -13.241 -2.113  1.00 0.00 ? 110 SER A HA   1  
ATOM 1644  H HB2  . SER A 1 110 ? -11.586 -15.513 -1.816  1.00 0.00 ? 110 SER A HB2  1  
ATOM 1645  H HB3  . SER A 1 110 ? -11.298 -15.293 -0.090  1.00 0.00 ? 110 SER A HB3  1  
ATOM 1646  H HG   . SER A 1 110 ? -13.268 -16.232 -0.221  1.00 0.00 ? 110 SER A HG   1  
ATOM 1647  N N    . SER A 1 111 ? -13.102 -11.568 -0.436  1.00 0.00 ? 111 SER A N    1  
ATOM 1648  C CA   . SER A 1 111 ? -13.894 -10.759 0.484   1.00 0.00 ? 111 SER A CA   1  
ATOM 1649  C C    . SER A 1 111 ? -14.827 -9.825  -0.281  1.00 0.00 ? 111 SER A C    1  
ATOM 1650  O O    . SER A 1 111 ? -14.888 -9.858  -1.510  1.00 0.00 ? 111 SER A O    1  
ATOM 1651  C CB   . SER A 1 111 ? -12.977 -9.946  1.400   1.00 0.00 ? 111 SER A CB   1  
ATOM 1652  O OG   . SER A 1 111 ? -13.719 -9.005  2.157   1.00 0.00 ? 111 SER A OG   1  
ATOM 1653  H H    . SER A 1 111 ? -12.921 -11.229 -1.338  1.00 0.00 ? 111 SER A H    1  
ATOM 1654  H HA   . SER A 1 111 ? -14.489 -11.429 1.086   1.00 0.00 ? 111 SER A HA   1  
ATOM 1655  H HB2  . SER A 1 111 ? -12.467 -10.613 2.078   1.00 0.00 ? 111 SER A HB2  1  
ATOM 1656  H HB3  . SER A 1 111 ? -12.251 -9.416  0.800   1.00 0.00 ? 111 SER A HB3  1  
ATOM 1657  H HG   . SER A 1 111 ? -13.932 -9.380  3.014   1.00 0.00 ? 111 SER A HG   1  
ATOM 1658  N N    . THR A 1 112 ? -15.553 -8.991  0.457   1.00 0.00 ? 112 THR A N    1  
ATOM 1659  C CA   . THR A 1 112 ? -16.485 -8.048  -0.149  1.00 0.00 ? 112 THR A CA   1  
ATOM 1660  C C    . THR A 1 112 ? -16.293 -6.645  0.416   1.00 0.00 ? 112 THR A C    1  
ATOM 1661  O O    . THR A 1 112 ? -15.998 -6.461  1.597   1.00 0.00 ? 112 THR A O    1  
ATOM 1662  C CB   . THR A 1 112 ? -17.946 -8.482  0.070   1.00 0.00 ? 112 THR A CB   1  
ATOM 1663  O OG1  . THR A 1 112 ? -18.180 -8.730  1.461   1.00 0.00 ? 112 THR A OG1  1  
ATOM 1664  C CG2  . THR A 1 112 ? -18.266 -9.733  -0.734  1.00 0.00 ? 112 THR A CG2  1  
ATOM 1665  H H    . THR A 1 112 ? -15.461 -9.013  1.432   1.00 0.00 ? 112 THR A H    1  
ATOM 1666  H HA   . THR A 1 112 ? -16.293 -8.027  -1.212  1.00 0.00 ? 112 THR A HA   1  
ATOM 1667  H HB   . THR A 1 112 ? -18.596 -7.684  -0.259  1.00 0.00 ? 112 THR A HB   1  
ATOM 1668  H HG1  . THR A 1 112 ? -18.666 -9.552  1.562   1.00 0.00 ? 112 THR A HG1  1  
ATOM 1669  H HG21 . THR A 1 112 ? -19.326 -9.932  -0.682  1.00 0.00 ? 112 THR A HG21 1  
ATOM 1670  H HG22 . THR A 1 112 ? -17.722 -10.572 -0.326  1.00 0.00 ? 112 THR A HG22 1  
ATOM 1671  H HG23 . THR A 1 112 ? -17.977 -9.582  -1.764  1.00 0.00 ? 112 THR A HG23 1  
ATOM 1672  N N    . PRO A 1 113 ? -16.464 -5.631  -0.445  1.00 0.00 ? 113 PRO A N    1  
ATOM 1673  C CA   . PRO A 1 113 ? -16.315 -4.226  -0.053  1.00 0.00 ? 113 PRO A CA   1  
ATOM 1674  C C    . PRO A 1 113 ? -17.436 -3.761  0.871   1.00 0.00 ? 113 PRO A C    1  
ATOM 1675  O O    . PRO A 1 113 ? -18.158 -4.575  1.445   1.00 0.00 ? 113 PRO A O    1  
ATOM 1676  C CB   . PRO A 1 113 ? -16.375 -3.477  -1.386  1.00 0.00 ? 113 PRO A CB   1  
ATOM 1677  C CG   . PRO A 1 113 ? -17.151 -4.373  -2.289  1.00 0.00 ? 113 PRO A CG   1  
ATOM 1678  C CD   . PRO A 1 113 ? -16.816 -5.777  -1.867  1.00 0.00 ? 113 PRO A CD   1  
ATOM 1679  H HA   . PRO A 1 113 ? -15.361 -4.045  0.421   1.00 0.00 ? 113 PRO A HA   1  
ATOM 1680  H HB2  . PRO A 1 113 ? -16.873 -2.528  -1.247  1.00 0.00 ? 113 PRO A HB2  1  
ATOM 1681  H HB3  . PRO A 1 113 ? -15.374 -3.314  -1.757  1.00 0.00 ? 113 PRO A HB3  1  
ATOM 1682  H HG2  . PRO A 1 113 ? -18.207 -4.188  -2.171  1.00 0.00 ? 113 PRO A HG2  1  
ATOM 1683  H HG3  . PRO A 1 113 ? -16.852 -4.209  -3.314  1.00 0.00 ? 113 PRO A HG3  1  
ATOM 1684  H HD2  . PRO A 1 113 ? -17.673 -6.422  -1.988  1.00 0.00 ? 113 PRO A HD2  1  
ATOM 1685  H HD3  . PRO A 1 113 ? -15.977 -6.152  -2.435  1.00 0.00 ? 113 PRO A HD3  1  
ATOM 1686  N N    . ARG A 1 114 ? -17.575 -2.446  1.008   1.00 0.00 ? 114 ARG A N    1  
ATOM 1687  C CA   . ARG A 1 114 ? -18.607 -1.873  1.863   1.00 0.00 ? 114 ARG A CA   1  
ATOM 1688  C C    . ARG A 1 114 ? -19.373 -0.776  1.129   1.00 0.00 ? 114 ARG A C    1  
ATOM 1689  O O    . ARG A 1 114 ? -18.872 -0.191  0.169   1.00 0.00 ? 114 ARG A O    1  
ATOM 1690  C CB   . ARG A 1 114 ? -17.985 -1.307  3.141   1.00 0.00 ? 114 ARG A CB   1  
ATOM 1691  C CG   . ARG A 1 114 ? -18.935 -0.436  3.947   1.00 0.00 ? 114 ARG A CG   1  
ATOM 1692  C CD   . ARG A 1 114 ? -20.053 -1.258  4.570   1.00 0.00 ? 114 ARG A CD   1  
ATOM 1693  N NE   . ARG A 1 114 ? -21.207 -0.435  4.922   1.00 0.00 ? 114 ARG A NE   1  
ATOM 1694  C CZ   . ARG A 1 114 ? -22.294 -0.911  5.519   1.00 0.00 ? 114 ARG A CZ   1  
ATOM 1695  N NH1  . ARG A 1 114 ? -22.375 -2.198  5.827   1.00 0.00 ? 114 ARG A NH1  1  
ATOM 1696  N NH2  . ARG A 1 114 ? -23.303 -0.099  5.808   1.00 0.00 ? 114 ARG A NH2  1  
ATOM 1697  H H    . ARG A 1 114 ? -16.968 -1.848  0.524   1.00 0.00 ? 114 ARG A H    1  
ATOM 1698  H HA   . ARG A 1 114 ? -19.296 -2.661  2.127   1.00 0.00 ? 114 ARG A HA   1  
ATOM 1699  H HB2  . ARG A 1 114 ? -17.667 -2.129  3.767   1.00 0.00 ? 114 ARG A HB2  1  
ATOM 1700  H HB3  . ARG A 1 114 ? -17.124 -0.713  2.876   1.00 0.00 ? 114 ARG A HB3  1  
ATOM 1701  H HG2  . ARG A 1 114 ? -18.381 0.051   4.735   1.00 0.00 ? 114 ARG A HG2  1  
ATOM 1702  H HG3  . ARG A 1 114 ? -19.367 0.308   3.295   1.00 0.00 ? 114 ARG A HG3  1  
ATOM 1703  H HD2  . ARG A 1 114 ? -20.364 -2.013  3.862   1.00 0.00 ? 114 ARG A HD2  1  
ATOM 1704  H HD3  . ARG A 1 114 ? -19.676 -1.736  5.462   1.00 0.00 ? 114 ARG A HD3  1  
ATOM 1705  H HE   . ARG A 1 114 ? -21.168 0.519   4.703   1.00 0.00 ? 114 ARG A HE   1  
ATOM 1706  H HH11 . ARG A 1 114 ? -21.616 -2.812  5.612   1.00 0.00 ? 114 ARG A HH11 1  
ATOM 1707  H HH12 . ARG A 1 114 ? -23.195 -2.554  6.278   1.00 0.00 ? 114 ARG A HH12 1  
ATOM 1708  H HH21 . ARG A 1 114 ? -23.245 0.872   5.577   1.00 0.00 ? 114 ARG A HH21 1  
ATOM 1709  H HH22 . ARG A 1 114 ? -24.121 -0.458  6.256   1.00 0.00 ? 114 ARG A HH22 1  
ATOM 1710  N N    . VAL A 1 115 ? -20.590 -0.502  1.588   1.00 0.00 ? 115 VAL A N    1  
ATOM 1711  C CA   . VAL A 1 115 ? -21.425 0.525   0.976   1.00 0.00 ? 115 VAL A CA   1  
ATOM 1712  C C    . VAL A 1 115 ? -21.349 1.832   1.756   1.00 0.00 ? 115 VAL A C    1  
ATOM 1713  O O    . VAL A 1 115 ? -20.910 1.855   2.907   1.00 0.00 ? 115 VAL A O    1  
ATOM 1714  C CB   . VAL A 1 115 ? -22.896 0.075   0.891   1.00 0.00 ? 115 VAL A CB   1  
ATOM 1715  C CG1  . VAL A 1 115 ? -23.507 -0.017  2.281   1.00 0.00 ? 115 VAL A CG1  1  
ATOM 1716  C CG2  . VAL A 1 115 ? -23.693 1.026   0.011   1.00 0.00 ? 115 VAL A CG2  1  
ATOM 1717  H H    . VAL A 1 115 ? -20.935 -1.002  2.357   1.00 0.00 ? 115 VAL A H    1  
ATOM 1718  H HA   . VAL A 1 115 ? -21.064 0.694   -0.028  1.00 0.00 ? 115 VAL A HA   1  
ATOM 1719  H HB   . VAL A 1 115 ? -22.926 -0.907  0.444   1.00 0.00 ? 115 VAL A HB   1  
ATOM 1720  H HG11 . VAL A 1 115 ? -24.276 -0.776  2.287   1.00 0.00 ? 115 VAL A HG11 1  
ATOM 1721  H HG12 . VAL A 1 115 ? -22.740 -0.274  2.996   1.00 0.00 ? 115 VAL A HG12 1  
ATOM 1722  H HG13 . VAL A 1 115 ? -23.942 0.936   2.546   1.00 0.00 ? 115 VAL A HG13 1  
ATOM 1723  H HG21 . VAL A 1 115 ? -23.172 1.174   -0.923  1.00 0.00 ? 115 VAL A HG21 1  
ATOM 1724  H HG22 . VAL A 1 115 ? -24.668 0.603   -0.183  1.00 0.00 ? 115 VAL A HG22 1  
ATOM 1725  H HG23 . VAL A 1 115 ? -23.806 1.975   0.515   1.00 0.00 ? 115 VAL A HG23 1  
ATOM 1726  N N    . ILE A 1 116 ? -21.779 2.918   1.123   1.00 0.00 ? 116 ILE A N    1  
ATOM 1727  C CA   . ILE A 1 116 ? -21.761 4.230   1.759   1.00 0.00 ? 116 ILE A CA   1  
ATOM 1728  C C    . ILE A 1 116 ? -22.955 4.406   2.690   1.00 0.00 ? 116 ILE A C    1  
ATOM 1729  O O    . ILE A 1 116 ? -24.019 3.818   2.494   1.00 0.00 ? 116 ILE A O    1  
ATOM 1730  C CB   . ILE A 1 116 ? -21.767 5.362   0.715   1.00 0.00 ? 116 ILE A CB   1  
ATOM 1731  C CG1  . ILE A 1 116 ? -23.204 5.749   0.358   1.00 0.00 ? 116 ILE A CG1  1  
ATOM 1732  C CG2  . ILE A 1 116 ? -21.003 4.938   -0.531  1.00 0.00 ? 116 ILE A CG2  1  
ATOM 1733  C CD1  . ILE A 1 116 ? -23.770 6.843   1.236   1.00 0.00 ? 116 ILE A CD1  1  
ATOM 1734  H H    . ILE A 1 116 ? -22.117 2.836   0.207   1.00 0.00 ? 116 ILE A H    1  
ATOM 1735  H HA   . ILE A 1 116 ? -20.852 4.307   2.338   1.00 0.00 ? 116 ILE A HA   1  
ATOM 1736  H HB   . ILE A 1 116 ? -21.266 6.218   1.141   1.00 0.00 ? 116 ILE A HB   1  
ATOM 1737  H HG12 . ILE A 1 116 ? -23.234 6.095   -0.663  1.00 0.00 ? 116 ILE A HG12 1  
ATOM 1738  H HG13 . ILE A 1 116 ? -23.838 4.880   0.459   1.00 0.00 ? 116 ILE A HG13 1  
ATOM 1739  H HG21 . ILE A 1 116 ? -21.546 4.154   -1.037  1.00 0.00 ? 116 ILE A HG21 1  
ATOM 1740  H HG22 . ILE A 1 116 ? -20.894 5.784   -1.192  1.00 0.00 ? 116 ILE A HG22 1  
ATOM 1741  H HG23 . ILE A 1 116 ? -20.026 4.574   -0.248  1.00 0.00 ? 116 ILE A HG23 1  
ATOM 1742  H HD11 . ILE A 1 116 ? -24.107 7.663   0.618   1.00 0.00 ? 116 ILE A HD11 1  
ATOM 1743  H HD12 . ILE A 1 116 ? -24.604 6.455   1.803   1.00 0.00 ? 116 ILE A HD12 1  
ATOM 1744  H HD13 . ILE A 1 116 ? -23.006 7.194   1.913   1.00 0.00 ? 116 ILE A HD13 1  
ATOM 1745  N N    . PRO A 1 117 ? -22.779 5.236   3.728   1.00 0.00 ? 117 PRO A N    1  
ATOM 1746  C CA   . PRO A 1 117 ? -23.832 5.512   4.710   1.00 0.00 ? 117 PRO A CA   1  
ATOM 1747  C C    . PRO A 1 117 ? -24.973 6.334   4.120   1.00 0.00 ? 117 PRO A C    1  
ATOM 1748  O O    . PRO A 1 117 ? -26.139 5.949   4.210   1.00 0.00 ? 117 PRO A O    1  
ATOM 1749  C CB   . PRO A 1 117 ? -23.105 6.308   5.797   1.00 0.00 ? 117 PRO A CB   1  
ATOM 1750  C CG   . PRO A 1 117 ? -21.953 6.940   5.096   1.00 0.00 ? 117 PRO A CG   1  
ATOM 1751  C CD   . PRO A 1 117 ? -21.537 5.971   4.024   1.00 0.00 ? 117 PRO A CD   1  
ATOM 1752  H HA   . PRO A 1 117 ? -24.228 4.600   5.133   1.00 0.00 ? 117 PRO A HA   1  
ATOM 1753  H HB2  . PRO A 1 117 ? -23.773 7.050   6.210   1.00 0.00 ? 117 PRO A HB2  1  
ATOM 1754  H HB3  . PRO A 1 117 ? -22.774 5.639   6.577   1.00 0.00 ? 117 PRO A HB3  1  
ATOM 1755  H HG2  . PRO A 1 117 ? -22.260 7.877   4.656   1.00 0.00 ? 117 PRO A HG2  1  
ATOM 1756  H HG3  . PRO A 1 117 ? -21.143 7.099   5.792   1.00 0.00 ? 117 PRO A HG3  1  
ATOM 1757  H HD2  . PRO A 1 117 ? -21.186 6.501   3.152   1.00 0.00 ? 117 PRO A HD2  1  
ATOM 1758  H HD3  . PRO A 1 117 ? -20.774 5.303   4.395   1.00 0.00 ? 117 PRO A HD3  1  
ATOM 1759  N N    . GLY A 1 1   ? 17.891  -29.983 -7.590  1.00 0.00 ? 1   GLY A N    2  
ATOM 1760  C CA   . GLY A 1 1   ? 16.493  -30.052 -7.204  1.00 0.00 ? 1   GLY A CA   2  
ATOM 1761  C C    . GLY A 1 1   ? 16.295  -30.727 -5.862  1.00 0.00 ? 1   GLY A C    2  
ATOM 1762  O O    . GLY A 1 1   ? 15.443  -31.603 -5.719  1.00 0.00 ? 1   GLY A O    2  
ATOM 1763  H H1   . GLY A 1 1   ? 18.566  -30.465 -7.068  1.00 0.00 ? 1   GLY A H1   2  
ATOM 1764  H HA2  . GLY A 1 1   ? 16.095  -29.049 -7.154  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1765  H HA3  . GLY A 1 1   ? 15.951  -30.606 -7.956  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1766  N N    . SER A 1 2   ? 17.086  -30.319 -4.874  1.00 0.00 ? 2   SER A N    2  
ATOM 1767  C CA   . SER A 1 2   ? 16.997  -30.894 -3.537  1.00 0.00 ? 2   SER A CA   2  
ATOM 1768  C C    . SER A 1 2   ? 15.712  -30.456 -2.841  1.00 0.00 ? 2   SER A C    2  
ATOM 1769  O O    . SER A 1 2   ? 15.252  -29.328 -3.016  1.00 0.00 ? 2   SER A O    2  
ATOM 1770  C CB   . SER A 1 2   ? 18.210  -30.482 -2.700  1.00 0.00 ? 2   SER A CB   2  
ATOM 1771  O OG   . SER A 1 2   ? 18.052  -30.872 -1.347  1.00 0.00 ? 2   SER A OG   2  
ATOM 1772  H H    . SER A 1 2   ? 17.746  -29.616 -5.049  1.00 0.00 ? 2   SER A H    2  
ATOM 1773  H HA   . SER A 1 2   ? 16.989  -31.969 -3.638  1.00 0.00 ? 2   SER A HA   2  
ATOM 1774  H HB2  . SER A 1 2   ? 19.095  -30.955 -3.097  1.00 0.00 ? 2   SER A HB2  2  
ATOM 1775  H HB3  . SER A 1 2   ? 18.324  -29.409 -2.742  1.00 0.00 ? 2   SER A HB3  2  
ATOM 1776  H HG   . SER A 1 2   ? 18.847  -31.318 -1.047  1.00 0.00 ? 2   SER A HG   2  
ATOM 1777  N N    . SER A 1 3   ? 15.138  -31.357 -2.050  1.00 0.00 ? 3   SER A N    2  
ATOM 1778  C CA   . SER A 1 3   ? 13.903  -31.066 -1.330  1.00 0.00 ? 3   SER A CA   2  
ATOM 1779  C C    . SER A 1 3   ? 14.171  -30.145 -0.143  1.00 0.00 ? 3   SER A C    2  
ATOM 1780  O O    . SER A 1 3   ? 15.276  -30.116 0.398   1.00 0.00 ? 3   SER A O    2  
ATOM 1781  C CB   . SER A 1 3   ? 13.252  -32.363 -0.847  1.00 0.00 ? 3   SER A CB   2  
ATOM 1782  O OG   . SER A 1 3   ? 12.980  -33.233 -1.933  1.00 0.00 ? 3   SER A OG   2  
ATOM 1783  H H    . SER A 1 3   ? 15.553  -32.239 -1.951  1.00 0.00 ? 3   SER A H    2  
ATOM 1784  H HA   . SER A 1 3   ? 13.231  -30.568 -2.012  1.00 0.00 ? 3   SER A HA   2  
ATOM 1785  H HB2  . SER A 1 3   ? 13.917  -32.863 -0.159  1.00 0.00 ? 3   SER A HB2  2  
ATOM 1786  H HB3  . SER A 1 3   ? 12.324  -32.131 -0.345  1.00 0.00 ? 3   SER A HB3  2  
ATOM 1787  H HG   . SER A 1 3   ? 12.230  -33.791 -1.716  1.00 0.00 ? 3   SER A HG   2  
ATOM 1788  N N    . GLY A 1 4   ? 13.150  -29.393 0.257   1.00 0.00 ? 4   GLY A N    2  
ATOM 1789  C CA   . GLY A 1 4   ? 13.294  -28.481 1.376   1.00 0.00 ? 4   GLY A CA   2  
ATOM 1790  C C    . GLY A 1 4   ? 12.247  -27.385 1.369   1.00 0.00 ? 4   GLY A C    2  
ATOM 1791  O O    . GLY A 1 4   ? 12.004  -26.743 2.391   1.00 0.00 ? 4   GLY A O    2  
ATOM 1792  H H    . GLY A 1 4   ? 12.292  -29.458 -0.213  1.00 0.00 ? 4   GLY A H    2  
ATOM 1793  H HA2  . GLY A 1 4   ? 13.208  -29.041 2.296   1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1794  H HA3  . GLY A 1 4   ? 14.274  -28.028 1.333   1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1795  N N    . SER A 1 5   ? 11.627  -27.168 0.214   1.00 0.00 ? 5   SER A N    2  
ATOM 1796  C CA   . SER A 1 5   ? 10.605  -26.137 0.077   1.00 0.00 ? 5   SER A CA   2  
ATOM 1797  C C    . SER A 1 5   ? 9.255   -26.642 0.577   1.00 0.00 ? 5   SER A C    2  
ATOM 1798  O O    . SER A 1 5   ? 8.809   -27.728 0.206   1.00 0.00 ? 5   SER A O    2  
ATOM 1799  C CB   . SER A 1 5   ? 10.488  -25.696 -1.384  1.00 0.00 ? 5   SER A CB   2  
ATOM 1800  O OG   . SER A 1 5   ? 9.677   -24.541 -1.504  1.00 0.00 ? 5   SER A OG   2  
ATOM 1801  H H    . SER A 1 5   ? 11.866  -27.713 -0.566  1.00 0.00 ? 5   SER A H    2  
ATOM 1802  H HA   . SER A 1 5   ? 10.905  -25.291 0.677   1.00 0.00 ? 5   SER A HA   2  
ATOM 1803  H HB2  . SER A 1 5   ? 11.472  -25.472 -1.769  1.00 0.00 ? 5   SER A HB2  2  
ATOM 1804  H HB3  . SER A 1 5   ? 10.047  -26.494 -1.964  1.00 0.00 ? 5   SER A HB3  2  
ATOM 1805  H HG   . SER A 1 5   ? 9.995   -23.862 -0.904  1.00 0.00 ? 5   SER A HG   2  
ATOM 1806  N N    . SER A 1 6   ? 8.608   -25.845 1.421   1.00 0.00 ? 6   SER A N    2  
ATOM 1807  C CA   . SER A 1 6   ? 7.310   -26.211 1.976   1.00 0.00 ? 6   SER A CA   2  
ATOM 1808  C C    . SER A 1 6   ? 6.468   -24.969 2.254   1.00 0.00 ? 6   SER A C    2  
ATOM 1809  O O    . SER A 1 6   ? 6.909   -24.047 2.939   1.00 0.00 ? 6   SER A O    2  
ATOM 1810  C CB   . SER A 1 6   ? 7.492   -27.016 3.264   1.00 0.00 ? 6   SER A CB   2  
ATOM 1811  O OG   . SER A 1 6   ? 6.268   -27.134 3.969   1.00 0.00 ? 6   SER A OG   2  
ATOM 1812  H H    . SER A 1 6   ? 9.016   -24.991 1.679   1.00 0.00 ? 6   SER A H    2  
ATOM 1813  H HA   . SER A 1 6   ? 6.799   -26.823 1.248   1.00 0.00 ? 6   SER A HA   2  
ATOM 1814  H HB2  . SER A 1 6   ? 7.849   -28.005 3.021   1.00 0.00 ? 6   SER A HB2  2  
ATOM 1815  H HB3  . SER A 1 6   ? 8.212   -26.519 3.898   1.00 0.00 ? 6   SER A HB3  2  
ATOM 1816  H HG   . SER A 1 6   ? 6.408   -27.641 4.772   1.00 0.00 ? 6   SER A HG   2  
ATOM 1817  N N    . GLY A 1 7   ? 5.253   -24.954 1.715   1.00 0.00 ? 7   GLY A N    2  
ATOM 1818  C CA   . GLY A 1 7   ? 4.367   -23.821 1.915   1.00 0.00 ? 7   GLY A CA   2  
ATOM 1819  C C    . GLY A 1 7   ? 2.904   -24.209 1.838   1.00 0.00 ? 7   GLY A C    2  
ATOM 1820  O O    . GLY A 1 7   ? 2.244   -24.027 0.815   1.00 0.00 ? 7   GLY A O    2  
ATOM 1821  H H    . GLY A 1 7   ? 4.955   -25.717 1.178   1.00 0.00 ? 7   GLY A H    2  
ATOM 1822  H HA2  . GLY A 1 7   ? 4.565   -23.391 2.885   1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1823  H HA3  . GLY A 1 7   ? 4.572   -23.081 1.155   1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1824  N N    . PRO A 1 8   ? 2.375   -24.759 2.941   1.00 0.00 ? 8   PRO A N    2  
ATOM 1825  C CA   . PRO A 1 8   ? 0.975   -25.186 3.019   1.00 0.00 ? 8   PRO A CA   2  
ATOM 1826  C C    . PRO A 1 8   ? 0.008   -24.006 3.025   1.00 0.00 ? 8   PRO A C    2  
ATOM 1827  O O    . PRO A 1 8   ? -1.206  -24.188 3.096   1.00 0.00 ? 8   PRO A O    2  
ATOM 1828  C CB   . PRO A 1 8   ? 0.907   -25.939 4.351   1.00 0.00 ? 8   PRO A CB   2  
ATOM 1829  C CG   . PRO A 1 8   ? 2.011   -25.362 5.168   1.00 0.00 ? 8   PRO A CG   2  
ATOM 1830  C CD   . PRO A 1 8   ? 3.103   -25.005 4.198   1.00 0.00 ? 8   PRO A CD   2  
ATOM 1831  H HA   . PRO A 1 8   ? 0.719   -25.856 2.212   1.00 0.00 ? 8   PRO A HA   2  
ATOM 1832  H HB2  . PRO A 1 8   ? -0.056  -25.773 4.812   1.00 0.00 ? 8   PRO A HB2  2  
ATOM 1833  H HB3  . PRO A 1 8   ? 1.054   -26.994 4.179   1.00 0.00 ? 8   PRO A HB3  2  
ATOM 1834  H HG2  . PRO A 1 8   ? 1.664   -24.479 5.683   1.00 0.00 ? 8   PRO A HG2  2  
ATOM 1835  H HG3  . PRO A 1 8   ? 2.365   -26.096 5.876   1.00 0.00 ? 8   PRO A HG3  2  
ATOM 1836  H HD2  . PRO A 1 8   ? 3.622   -24.116 4.523   1.00 0.00 ? 8   PRO A HD2  2  
ATOM 1837  H HD3  . PRO A 1 8   ? 3.793   -25.828 4.087   1.00 0.00 ? 8   PRO A HD3  2  
ATOM 1838  N N    . ASN A 1 9   ? 0.556   -22.798 2.950   1.00 0.00 ? 9   ASN A N    2  
ATOM 1839  C CA   . ASN A 1 9   ? -0.258  -21.588 2.946   1.00 0.00 ? 9   ASN A CA   2  
ATOM 1840  C C    . ASN A 1 9   ? -1.577  -21.823 2.217   1.00 0.00 ? 9   ASN A C    2  
ATOM 1841  O O    . ASN A 1 9   ? -1.641  -22.595 1.260   1.00 0.00 ? 9   ASN A O    2  
ATOM 1842  C CB   . ASN A 1 9   ? 0.504   -20.437 2.287   1.00 0.00 ? 9   ASN A CB   2  
ATOM 1843  C CG   . ASN A 1 9   ? 1.379   -19.685 3.271   1.00 0.00 ? 9   ASN A CG   2  
ATOM 1844  O OD1  . ASN A 1 9   ? 1.465   -20.046 4.445   1.00 0.00 ? 9   ASN A OD1  2  
ATOM 1845  N ND2  . ASN A 1 9   ? 2.034   -18.632 2.795   1.00 0.00 ? 9   ASN A ND2  2  
ATOM 1846  H H    . ASN A 1 9   ? 1.532   -22.717 2.895   1.00 0.00 ? 9   ASN A H    2  
ATOM 1847  H HA   . ASN A 1 9   ? -0.469  -21.328 3.972   1.00 0.00 ? 9   ASN A HA   2  
ATOM 1848  H HB2  . ASN A 1 9   ? 1.135   -20.832 1.504   1.00 0.00 ? 9   ASN A HB2  2  
ATOM 1849  H HB3  . ASN A 1 9   ? -0.203  -19.743 1.858   1.00 0.00 ? 9   ASN A HB3  2  
ATOM 1850  H HD21 . ASN A 1 9   ? 1.918   -18.403 1.849   1.00 0.00 ? 9   ASN A HD21 2  
ATOM 1851  H HD22 . ASN A 1 9   ? 2.608   -18.128 3.410   1.00 0.00 ? 9   ASN A HD22 2  
ATOM 1852  N N    . PHE A 1 10  ? -2.628  -21.151 2.675   1.00 0.00 ? 10  PHE A N    2  
ATOM 1853  C CA   . PHE A 1 10  ? -3.947  -21.286 2.067   1.00 0.00 ? 10  PHE A CA   2  
ATOM 1854  C C    . PHE A 1 10  ? -4.600  -19.920 1.876   1.00 0.00 ? 10  PHE A C    2  
ATOM 1855  O O    . PHE A 1 10  ? -4.844  -19.197 2.842   1.00 0.00 ? 10  PHE A O    2  
ATOM 1856  C CB   . PHE A 1 10  ? -4.842  -22.176 2.931   1.00 0.00 ? 10  PHE A CB   2  
ATOM 1857  C CG   . PHE A 1 10  ? -5.867  -22.940 2.143   1.00 0.00 ? 10  PHE A CG   2  
ATOM 1858  C CD1  . PHE A 1 10  ? -6.190  -22.562 0.850   1.00 0.00 ? 10  PHE A CD1  2  
ATOM 1859  C CD2  . PHE A 1 10  ? -6.509  -24.037 2.696   1.00 0.00 ? 10  PHE A CD2  2  
ATOM 1860  C CE1  . PHE A 1 10  ? -7.133  -23.263 0.122   1.00 0.00 ? 10  PHE A CE1  2  
ATOM 1861  C CE2  . PHE A 1 10  ? -7.452  -24.742 1.973   1.00 0.00 ? 10  PHE A CE2  2  
ATOM 1862  C CZ   . PHE A 1 10  ? -7.765  -24.354 0.685   1.00 0.00 ? 10  PHE A CZ   2  
ATOM 1863  H H    . PHE A 1 10  ? -2.514  -20.550 3.441   1.00 0.00 ? 10  PHE A H    2  
ATOM 1864  H HA   . PHE A 1 10  ? -3.819  -21.748 1.100   1.00 0.00 ? 10  PHE A HA   2  
ATOM 1865  H HB2  . PHE A 1 10  ? -4.227  -22.891 3.456   1.00 0.00 ? 10  PHE A HB2  2  
ATOM 1866  H HB3  . PHE A 1 10  ? -5.363  -21.561 3.649   1.00 0.00 ? 10  PHE A HB3  2  
ATOM 1867  H HD1  . PHE A 1 10  ? -5.696  -21.708 0.409   1.00 0.00 ? 10  PHE A HD1  2  
ATOM 1868  H HD2  . PHE A 1 10  ? -6.266  -24.341 3.704   1.00 0.00 ? 10  PHE A HD2  2  
ATOM 1869  H HE1  . PHE A 1 10  ? -7.375  -22.957 -0.884  1.00 0.00 ? 10  PHE A HE1  2  
ATOM 1870  H HE2  . PHE A 1 10  ? -7.945  -25.595 2.416   1.00 0.00 ? 10  PHE A HE2  2  
ATOM 1871  H HZ   . PHE A 1 10  ? -8.502  -24.904 0.118   1.00 0.00 ? 10  PHE A HZ   2  
ATOM 1872  N N    . SER A 1 11  ? -4.881  -19.574 0.624   1.00 0.00 ? 11  SER A N    2  
ATOM 1873  C CA   . SER A 1 11  ? -5.502  -18.294 0.305   1.00 0.00 ? 11  SER A CA   2  
ATOM 1874  C C    . SER A 1 11  ? -6.212  -18.356 -1.044  1.00 0.00 ? 11  SER A C    2  
ATOM 1875  O O    . SER A 1 11  ? -5.965  -19.255 -1.848  1.00 0.00 ? 11  SER A O    2  
ATOM 1876  C CB   . SER A 1 11  ? -4.451  -17.183 0.291   1.00 0.00 ? 11  SER A CB   2  
ATOM 1877  O OG   . SER A 1 11  ? -3.333  -17.548 -0.500  1.00 0.00 ? 11  SER A OG   2  
ATOM 1878  H H    . SER A 1 11  ? -4.663  -20.195 -0.103  1.00 0.00 ? 11  SER A H    2  
ATOM 1879  H HA   . SER A 1 11  ? -6.231  -18.079 1.072   1.00 0.00 ? 11  SER A HA   2  
ATOM 1880  H HB2  . SER A 1 11  ? -4.887  -16.284 -0.117  1.00 0.00 ? 11  SER A HB2  2  
ATOM 1881  H HB3  . SER A 1 11  ? -4.117  -16.995 1.301   1.00 0.00 ? 11  SER A HB3  2  
ATOM 1882  H HG   . SER A 1 11  ? -3.598  -17.608 -1.420  1.00 0.00 ? 11  SER A HG   2  
ATOM 1883  N N    . HIS A 1 12  ? -7.095  -17.392 -1.286  1.00 0.00 ? 12  HIS A N    2  
ATOM 1884  C CA   . HIS A 1 12  ? -7.841  -17.336 -2.538  1.00 0.00 ? 12  HIS A CA   2  
ATOM 1885  C C    . HIS A 1 12  ? -7.788  -15.934 -3.139  1.00 0.00 ? 12  HIS A C    2  
ATOM 1886  O O    . HIS A 1 12  ? -8.793  -15.223 -3.168  1.00 0.00 ? 12  HIS A O    2  
ATOM 1887  C CB   . HIS A 1 12  ? -9.295  -17.750 -2.309  1.00 0.00 ? 12  HIS A CB   2  
ATOM 1888  C CG   . HIS A 1 12  ? -9.967  -18.280 -3.538  1.00 0.00 ? 12  HIS A CG   2  
ATOM 1889  N ND1  . HIS A 1 12  ? -9.342  -18.356 -4.765  1.00 0.00 ? 12  HIS A ND1  2  
ATOM 1890  C CD2  . HIS A 1 12  ? -11.218 -18.762 -3.725  1.00 0.00 ? 12  HIS A CD2  2  
ATOM 1891  C CE1  . HIS A 1 12  ? -10.179 -18.861 -5.653  1.00 0.00 ? 12  HIS A CE1  2  
ATOM 1892  N NE2  . HIS A 1 12  ? -11.325 -19.117 -5.047  1.00 0.00 ? 12  HIS A NE2  2  
ATOM 1893  H H    . HIS A 1 12  ? -7.248  -16.703 -0.606  1.00 0.00 ? 12  HIS A H    2  
ATOM 1894  H HA   . HIS A 1 12  ? -7.383  -18.027 -3.229  1.00 0.00 ? 12  HIS A HA   2  
ATOM 1895  H HB2  . HIS A 1 12  ? -9.327  -18.523 -1.555  1.00 0.00 ? 12  HIS A HB2  2  
ATOM 1896  H HB3  . HIS A 1 12  ? -9.857  -16.894 -1.965  1.00 0.00 ? 12  HIS A HB3  2  
ATOM 1897  H HD1  . HIS A 1 12  ? -8.421  -18.080 -4.956  1.00 0.00 ? 12  HIS A HD1  2  
ATOM 1898  H HD2  . HIS A 1 12  ? -11.990 -18.852 -2.974  1.00 0.00 ? 12  HIS A HD2  2  
ATOM 1899  H HE1  . HIS A 1 12  ? -9.964  -19.037 -6.696  1.00 0.00 ? 12  HIS A HE1  2  
ATOM 1900  N N    . TRP A 1 13  ? -6.612  -15.544 -3.615  1.00 0.00 ? 13  TRP A N    2  
ATOM 1901  C CA   . TRP A 1 13  ? -6.428  -14.227 -4.214  1.00 0.00 ? 13  TRP A CA   2  
ATOM 1902  C C    . TRP A 1 13  ? -6.795  -14.246 -5.693  1.00 0.00 ? 13  TRP A C    2  
ATOM 1903  O O    . TRP A 1 13  ? -6.161  -14.935 -6.491  1.00 0.00 ? 13  TRP A O    2  
ATOM 1904  C CB   . TRP A 1 13  ? -4.982  -13.762 -4.040  1.00 0.00 ? 13  TRP A CB   2  
ATOM 1905  C CG   . TRP A 1 13  ? -4.544  -13.704 -2.608  1.00 0.00 ? 13  TRP A CG   2  
ATOM 1906  C CD1  . TRP A 1 13  ? -4.235  -14.762 -1.802  1.00 0.00 ? 13  TRP A CD1  2  
ATOM 1907  C CD2  . TRP A 1 13  ? -4.369  -12.526 -1.813  1.00 0.00 ? 13  TRP A CD2  2  
ATOM 1908  N NE1  . TRP A 1 13  ? -3.878  -14.313 -0.553  1.00 0.00 ? 13  TRP A NE1  2  
ATOM 1909  C CE2  . TRP A 1 13  ? -3.951  -12.945 -0.534  1.00 0.00 ? 13  TRP A CE2  2  
ATOM 1910  C CE3  . TRP A 1 13  ? -4.521  -11.159 -2.057  1.00 0.00 ? 13  TRP A CE3  2  
ATOM 1911  C CZ2  . TRP A 1 13  ? -3.687  -12.045 0.494   1.00 0.00 ? 13  TRP A CZ2  2  
ATOM 1912  C CZ3  . TRP A 1 13  ? -4.259  -10.266 -1.035  1.00 0.00 ? 13  TRP A CZ3  2  
ATOM 1913  C CH2  . TRP A 1 13  ? -3.845  -10.712 0.228   1.00 0.00 ? 13  TRP A CH2  2  
ATOM 1914  H H    . TRP A 1 13  ? -5.847  -16.156 -3.562  1.00 0.00 ? 13  TRP A H    2  
ATOM 1915  H HA   . TRP A 1 13  ? -7.082  -13.537 -3.701  1.00 0.00 ? 13  TRP A HA   2  
ATOM 1916  H HB2  . TRP A 1 13  ? -4.326  -14.443 -4.562  1.00 0.00 ? 13  TRP A HB2  2  
ATOM 1917  H HB3  . TRP A 1 13  ? -4.876  -12.773 -4.462  1.00 0.00 ? 13  TRP A HB3  2  
ATOM 1918  H HD1  . TRP A 1 13  ? -4.272  -15.794 -2.113  1.00 0.00 ? 13  TRP A HD1  2  
ATOM 1919  H HE1  . TRP A 1 13  ? -3.613  -14.880 0.201   1.00 0.00 ? 13  TRP A HE1  2  
ATOM 1920  H HE3  . TRP A 1 13  ? -4.839  -10.796 -3.023  1.00 0.00 ? 13  TRP A HE3  2  
ATOM 1921  H HZ2  . TRP A 1 13  ? -3.367  -12.372 1.473   1.00 0.00 ? 13  TRP A HZ2  2  
ATOM 1922  H HZ3  . TRP A 1 13  ? -4.372  -9.206  -1.204  1.00 0.00 ? 13  TRP A HZ3  2  
ATOM 1923  H HH2  . TRP A 1 13  ? -3.652  -9.980  0.996   1.00 0.00 ? 13  TRP A HH2  2  
ATOM 1924  N N    . GLY A 1 14  ? -7.824  -13.485 -6.054  1.00 0.00 ? 14  GLY A N    2  
ATOM 1925  C CA   . GLY A 1 14  ? -8.257  -13.429 -7.438  1.00 0.00 ? 14  GLY A CA   2  
ATOM 1926  C C    . GLY A 1 14  ? -7.331  -12.596 -8.302  1.00 0.00 ? 14  GLY A C    2  
ATOM 1927  O O    . GLY A 1 14  ? -6.164  -12.383 -7.972  1.00 0.00 ? 14  GLY A O    2  
ATOM 1928  H H    . GLY A 1 14  ? -8.293  -12.956 -5.374  1.00 0.00 ? 14  GLY A H    2  
ATOM 1929  H HA2  . GLY A 1 14  ? -8.295  -14.434 -7.832  1.00 0.00 ? 14  GLY A HA2  2  
ATOM 1930  H HA3  . GLY A 1 14  ? -9.248  -13.001 -7.476  1.00 0.00 ? 14  GLY A HA3  2  
ATOM 1931  N N    . PRO A 1 15  ? -7.853  -12.111 -9.438  1.00 0.00 ? 15  PRO A N    2  
ATOM 1932  C CA   . PRO A 1 15  ? -7.082  -11.291 -10.377 1.00 0.00 ? 15  PRO A CA   2  
ATOM 1933  C C    . PRO A 1 15  ? -6.768  -9.908  -9.815  1.00 0.00 ? 15  PRO A C    2  
ATOM 1934  O O    . PRO A 1 15  ? -7.420  -9.425  -8.889  1.00 0.00 ? 15  PRO A O    2  
ATOM 1935  C CB   . PRO A 1 15  ? -8.006  -11.177 -11.592 1.00 0.00 ? 15  PRO A CB   2  
ATOM 1936  C CG   . PRO A 1 15  ? -9.378  -11.366 -11.043 1.00 0.00 ? 15  PRO A CG   2  
ATOM 1937  C CD   . PRO A 1 15  ? -9.237  -12.326 -9.894  1.00 0.00 ? 15  PRO A CD   2  
ATOM 1938  H HA   . PRO A 1 15  ? -6.162  -11.777 -10.666 1.00 0.00 ? 15  PRO A HA   2  
ATOM 1939  H HB2  . PRO A 1 15  ? -7.891  -10.203 -12.045 1.00 0.00 ? 15  PRO A HB2  2  
ATOM 1940  H HB3  . PRO A 1 15  ? -7.760  -11.946 -12.309 1.00 0.00 ? 15  PRO A HB3  2  
ATOM 1941  H HG2  . PRO A 1 15  ? -9.768  -10.421 -10.695 1.00 0.00 ? 15  PRO A HG2  2  
ATOM 1942  H HG3  . PRO A 1 15  ? -10.023 -11.782 -11.802 1.00 0.00 ? 15  PRO A HG3  2  
ATOM 1943  H HD2  . PRO A 1 15  ? -9.942  -12.086 -9.113  1.00 0.00 ? 15  PRO A HD2  2  
ATOM 1944  H HD3  . PRO A 1 15  ? -9.377  -13.342 -10.233 1.00 0.00 ? 15  PRO A HD3  2  
ATOM 1945  N N    . PRO A 1 16  ? -5.747  -9.254  -10.388 1.00 0.00 ? 16  PRO A N    2  
ATOM 1946  C CA   . PRO A 1 16  ? -5.325  -7.917  -9.961  1.00 0.00 ? 16  PRO A CA   2  
ATOM 1947  C C    . PRO A 1 16  ? -6.345  -6.843  -10.324 1.00 0.00 ? 16  PRO A C    2  
ATOM 1948  O O    . PRO A 1 16  ? -7.154  -7.025  -11.234 1.00 0.00 ? 16  PRO A O    2  
ATOM 1949  C CB   . PRO A 1 16  ? -4.019  -7.695  -10.728 1.00 0.00 ? 16  PRO A CB   2  
ATOM 1950  C CG   . PRO A 1 16  ? -4.133  -8.567  -11.930 1.00 0.00 ? 16  PRO A CG   2  
ATOM 1951  C CD   . PRO A 1 16  ? -4.926  -9.769  -11.496 1.00 0.00 ? 16  PRO A CD   2  
ATOM 1952  H HA   . PRO A 1 16  ? -5.131  -7.882  -8.899  1.00 0.00 ? 16  PRO A HA   2  
ATOM 1953  H HB2  . PRO A 1 16  ? -3.931  -6.653  -11.001 1.00 0.00 ? 16  PRO A HB2  2  
ATOM 1954  H HB3  . PRO A 1 16  ? -3.181  -7.983  -10.110 1.00 0.00 ? 16  PRO A HB3  2  
ATOM 1955  H HG2  . PRO A 1 16  ? -4.651  -8.040  -12.718 1.00 0.00 ? 16  PRO A HG2  2  
ATOM 1956  H HG3  . PRO A 1 16  ? -3.150  -8.867  -12.261 1.00 0.00 ? 16  PRO A HG3  2  
ATOM 1957  H HD2  . PRO A 1 16  ? -5.548  -10.122 -12.305 1.00 0.00 ? 16  PRO A HD2  2  
ATOM 1958  H HD3  . PRO A 1 16  ? -4.267  -10.553 -11.155 1.00 0.00 ? 16  PRO A HD3  2  
ATOM 1959  N N    . ARG A 1 17  ? -6.300  -5.724  -9.608  1.00 0.00 ? 17  ARG A N    2  
ATOM 1960  C CA   . ARG A 1 17  ? -7.221  -4.621  -9.856  1.00 0.00 ? 17  ARG A CA   2  
ATOM 1961  C C    . ARG A 1 17  ? -6.473  -3.293  -9.927  1.00 0.00 ? 17  ARG A C    2  
ATOM 1962  O O    . ARG A 1 17  ? -5.848  -2.869  -8.954  1.00 0.00 ? 17  ARG A O    2  
ATOM 1963  C CB   . ARG A 1 17  ? -8.285  -4.561  -8.758  1.00 0.00 ? 17  ARG A CB   2  
ATOM 1964  C CG   . ARG A 1 17  ? -7.756  -4.913  -7.377  1.00 0.00 ? 17  ARG A CG   2  
ATOM 1965  C CD   . ARG A 1 17  ? -8.832  -4.762  -6.314  1.00 0.00 ? 17  ARG A CD   2  
ATOM 1966  N NE   . ARG A 1 17  ? -9.935  -5.698  -6.515  1.00 0.00 ? 17  ARG A NE   2  
ATOM 1967  C CZ   . ARG A 1 17  ? -11.011 -5.745  -5.736  1.00 0.00 ? 17  ARG A CZ   2  
ATOM 1968  N NH1  . ARG A 1 17  ? -11.127 -4.913  -4.711  1.00 0.00 ? 17  ARG A NH1  2  
ATOM 1969  N NH2  . ARG A 1 17  ? -11.973 -6.625  -5.984  1.00 0.00 ? 17  ARG A NH2  2  
ATOM 1970  H H    . ARG A 1 17  ? -5.632  -5.638  -8.896  1.00 0.00 ? 17  ARG A H    2  
ATOM 1971  H HA   . ARG A 1 17  ? -7.705  -4.800  -10.804 1.00 0.00 ? 17  ARG A HA   2  
ATOM 1972  H HB2  . ARG A 1 17  ? -8.691  -3.561  -8.720  1.00 0.00 ? 17  ARG A HB2  2  
ATOM 1973  H HB3  . ARG A 1 17  ? -9.077  -5.253  -9.003  1.00 0.00 ? 17  ARG A HB3  2  
ATOM 1974  H HG2  . ARG A 1 17  ? -7.412  -5.936  -7.383  1.00 0.00 ? 17  ARG A HG2  2  
ATOM 1975  H HG3  . ARG A 1 17  ? -6.933  -4.256  -7.140  1.00 0.00 ? 17  ARG A HG3  2  
ATOM 1976  H HD2  . ARG A 1 17  ? -8.391  -4.945  -5.345  1.00 0.00 ? 17  ARG A HD2  2  
ATOM 1977  H HD3  . ARG A 1 17  ? -9.216  -3.754  -6.350  1.00 0.00 ? 17  ARG A HD3  2  
ATOM 1978  H HE   . ARG A 1 17  ? -9.870  -6.322  -7.267  1.00 0.00 ? 17  ARG A HE   2  
ATOM 1979  H HH11 . ARG A 1 17  ? -10.405 -4.248  -4.522  1.00 0.00 ? 17  ARG A HH11 2  
ATOM 1980  H HH12 . ARG A 1 17  ? -11.939 -4.950  -4.127  1.00 0.00 ? 17  ARG A HH12 2  
ATOM 1981  H HH21 . ARG A 1 17  ? -11.888 -7.253  -6.757  1.00 0.00 ? 17  ARG A HH21 2  
ATOM 1982  H HH22 . ARG A 1 17  ? -12.781 -6.659  -5.398  1.00 0.00 ? 17  ARG A HH22 2  
ATOM 1983  N N    . ILE A 1 18  ? -6.541  -2.643  -11.083 1.00 0.00 ? 18  ILE A N    2  
ATOM 1984  C CA   . ILE A 1 18  ? -5.871  -1.364  -11.280 1.00 0.00 ? 18  ILE A CA   2  
ATOM 1985  C C    . ILE A 1 18  ? -6.786  -0.201  -10.913 1.00 0.00 ? 18  ILE A C    2  
ATOM 1986  O O    . ILE A 1 18  ? -7.942  -0.150  -11.333 1.00 0.00 ? 18  ILE A O    2  
ATOM 1987  C CB   . ILE A 1 18  ? -5.402  -1.192  -12.737 1.00 0.00 ? 18  ILE A CB   2  
ATOM 1988  C CG1  . ILE A 1 18  ? -4.125  -1.999  -12.983 1.00 0.00 ? 18  ILE A CG1  2  
ATOM 1989  C CG2  . ILE A 1 18  ? -5.174  0.279   -13.051 1.00 0.00 ? 18  ILE A CG2  2  
ATOM 1990  C CD1  . ILE A 1 18  ? -3.617  -1.908  -14.405 1.00 0.00 ? 18  ILE A CD1  2  
ATOM 1991  H H    . ILE A 1 18  ? -7.055  -3.032  -11.821 1.00 0.00 ? 18  ILE A H    2  
ATOM 1992  H HA   . ILE A 1 18  ? -5.002  -1.341  -10.638 1.00 0.00 ? 18  ILE A HA   2  
ATOM 1993  H HB   . ILE A 1 18  ? -6.181  -1.558  -13.388 1.00 0.00 ? 18  ILE A HB   2  
ATOM 1994  H HG12 . ILE A 1 18  ? -3.347  -1.637  -12.330 1.00 0.00 ? 18  ILE A HG12 2  
ATOM 1995  H HG13 . ILE A 1 18  ? -4.318  -3.039  -12.765 1.00 0.00 ? 18  ILE A HG13 2  
ATOM 1996  H HG21 . ILE A 1 18  ? -4.350  0.376   -13.742 1.00 0.00 ? 18  ILE A HG21 2  
ATOM 1997  H HG22 . ILE A 1 18  ? -6.067  0.694   -13.495 1.00 0.00 ? 18  ILE A HG22 2  
ATOM 1998  H HG23 . ILE A 1 18  ? -4.945  0.810   -12.140 1.00 0.00 ? 18  ILE A HG23 2  
ATOM 1999  H HD11 . ILE A 1 18  ? -4.454  -1.789  -15.079 1.00 0.00 ? 18  ILE A HD11 2  
ATOM 2000  H HD12 . ILE A 1 18  ? -2.958  -1.057  -14.499 1.00 0.00 ? 18  ILE A HD12 2  
ATOM 2001  H HD13 . ILE A 1 18  ? -3.080  -2.810  -14.655 1.00 0.00 ? 18  ILE A HD13 2  
ATOM 2002  N N    . VAL A 1 19  ? -6.261  0.733   -10.127 1.00 0.00 ? 19  VAL A N    2  
ATOM 2003  C CA   . VAL A 1 19  ? -7.029  1.898   -9.704  1.00 0.00 ? 19  VAL A CA   2  
ATOM 2004  C C    . VAL A 1 19  ? -6.166  3.155   -9.701  1.00 0.00 ? 19  VAL A C    2  
ATOM 2005  O O    . VAL A 1 19  ? -5.081  3.172   -9.121  1.00 0.00 ? 19  VAL A O    2  
ATOM 2006  C CB   . VAL A 1 19  ? -7.628  1.696   -8.300  1.00 0.00 ? 19  VAL A CB   2  
ATOM 2007  C CG1  . VAL A 1 19  ? -8.484  2.891   -7.907  1.00 0.00 ? 19  VAL A CG1  2  
ATOM 2008  C CG2  . VAL A 1 19  ? -8.438  0.409   -8.246  1.00 0.00 ? 19  VAL A CG2  2  
ATOM 2009  H H    . VAL A 1 19  ? -5.334  0.637   -9.824  1.00 0.00 ? 19  VAL A H    2  
ATOM 2010  H HA   . VAL A 1 19  ? -7.842  2.033   -10.403 1.00 0.00 ? 19  VAL A HA   2  
ATOM 2011  H HB   . VAL A 1 19  ? -6.816  1.616   -7.592  1.00 0.00 ? 19  VAL A HB   2  
ATOM 2012  H HG11 . VAL A 1 19  ? -8.896  2.730   -6.921  1.00 0.00 ? 19  VAL A HG11 2  
ATOM 2013  H HG12 . VAL A 1 19  ? -7.876  3.784   -7.903  1.00 0.00 ? 19  VAL A HG12 2  
ATOM 2014  H HG13 . VAL A 1 19  ? -9.289  3.006   -8.618  1.00 0.00 ? 19  VAL A HG13 2  
ATOM 2015  H HG21 . VAL A 1 19  ? -9.443  0.602   -8.589  1.00 0.00 ? 19  VAL A HG21 2  
ATOM 2016  H HG22 . VAL A 1 19  ? -7.976  -0.332  -8.880  1.00 0.00 ? 19  VAL A HG22 2  
ATOM 2017  H HG23 . VAL A 1 19  ? -8.468  0.045   -7.229  1.00 0.00 ? 19  VAL A HG23 2  
ATOM 2018  N N    . GLU A 1 20  ? -6.656  4.205   -10.353 1.00 0.00 ? 20  GLU A N    2  
ATOM 2019  C CA   . GLU A 1 20  ? -5.928  5.466   -10.425 1.00 0.00 ? 20  GLU A CA   2  
ATOM 2020  C C    . GLU A 1 20  ? -6.284  6.368   -9.246  1.00 0.00 ? 20  GLU A C    2  
ATOM 2021  O O    . GLU A 1 20  ? -7.457  6.651   -9.001  1.00 0.00 ? 20  GLU A O    2  
ATOM 2022  C CB   . GLU A 1 20  ? -6.235  6.183   -11.741 1.00 0.00 ? 20  GLU A CB   2  
ATOM 2023  C CG   . GLU A 1 20  ? -5.555  5.558   -12.947 1.00 0.00 ? 20  GLU A CG   2  
ATOM 2024  C CD   . GLU A 1 20  ? -6.442  4.559   -13.664 1.00 0.00 ? 20  GLU A CD   2  
ATOM 2025  O OE1  . GLU A 1 20  ? -7.301  3.944   -12.998 1.00 0.00 ? 20  GLU A OE1  2  
ATOM 2026  O OE2  . GLU A 1 20  ? -6.278  4.391   -14.891 1.00 0.00 ? 20  GLU A OE2  2  
ATOM 2027  H H    . GLU A 1 20  ? -7.527  4.129   -10.795 1.00 0.00 ? 20  GLU A H    2  
ATOM 2028  H HA   . GLU A 1 20  ? -4.873  5.242   -10.385 1.00 0.00 ? 20  GLU A HA   2  
ATOM 2029  H HB2  . GLU A 1 20  ? -7.302  6.167   -11.906 1.00 0.00 ? 20  GLU A HB2  2  
ATOM 2030  H HB3  . GLU A 1 20  ? -5.908  7.209   -11.662 1.00 0.00 ? 20  GLU A HB3  2  
ATOM 2031  H HG2  . GLU A 1 20  ? -5.288  6.341   -13.641 1.00 0.00 ? 20  GLU A HG2  2  
ATOM 2032  H HG3  . GLU A 1 20  ? -4.660  5.051   -12.618 1.00 0.00 ? 20  GLU A HG3  2  
ATOM 2033  N N    . ILE A 1 21  ? -5.265  6.815   -8.521  1.00 0.00 ? 21  ILE A N    2  
ATOM 2034  C CA   . ILE A 1 21  ? -5.470  7.684   -7.370  1.00 0.00 ? 21  ILE A CA   2  
ATOM 2035  C C    . ILE A 1 21  ? -4.730  9.007   -7.541  1.00 0.00 ? 21  ILE A C    2  
ATOM 2036  O O    . ILE A 1 21  ? -3.505  9.065   -7.428  1.00 0.00 ? 21  ILE A O    2  
ATOM 2037  C CB   . ILE A 1 21  ? -5.001  7.012   -6.066  1.00 0.00 ? 21  ILE A CB   2  
ATOM 2038  C CG1  . ILE A 1 21  ? -5.379  5.529   -6.067  1.00 0.00 ? 21  ILE A CG1  2  
ATOM 2039  C CG2  . ILE A 1 21  ? -5.604  7.717   -4.860  1.00 0.00 ? 21  ILE A CG2  2  
ATOM 2040  C CD1  . ILE A 1 21  ? -4.900  4.783   -4.841  1.00 0.00 ? 21  ILE A CD1  2  
ATOM 2041  H H    . ILE A 1 21  ? -4.353  6.554   -8.767  1.00 0.00 ? 21  ILE A H    2  
ATOM 2042  H HA   . ILE A 1 21  ? -6.528  7.884   -7.288  1.00 0.00 ? 21  ILE A HA   2  
ATOM 2043  H HB   . ILE A 1 21  ? -3.927  7.103   -6.006  1.00 0.00 ? 21  ILE A HB   2  
ATOM 2044  H HG12 . ILE A 1 21  ? -6.452  5.437   -6.112  1.00 0.00 ? 21  ILE A HG12 2  
ATOM 2045  H HG13 . ILE A 1 21  ? -4.944  5.056   -6.935  1.00 0.00 ? 21  ILE A HG13 2  
ATOM 2046  H HG21 . ILE A 1 21  ? -5.152  7.335   -3.956  1.00 0.00 ? 21  ILE A HG21 2  
ATOM 2047  H HG22 . ILE A 1 21  ? -5.418  8.778   -4.934  1.00 0.00 ? 21  ILE A HG22 2  
ATOM 2048  H HG23 . ILE A 1 21  ? -6.668  7.538   -4.833  1.00 0.00 ? 21  ILE A HG23 2  
ATOM 2049  H HD11 . ILE A 1 21  ? -3.924  5.150   -4.555  1.00 0.00 ? 21  ILE A HD11 2  
ATOM 2050  H HD12 . ILE A 1 21  ? -5.595  4.940   -4.029  1.00 0.00 ? 21  ILE A HD12 2  
ATOM 2051  H HD13 . ILE A 1 21  ? -4.837  3.728   -5.063  1.00 0.00 ? 21  ILE A HD13 2  
ATOM 2052  N N    . PHE A 1 22  ? -5.482  10.068  -7.812  1.00 0.00 ? 22  PHE A N    2  
ATOM 2053  C CA   . PHE A 1 22  ? -4.898  11.392  -7.998  1.00 0.00 ? 22  PHE A CA   2  
ATOM 2054  C C    . PHE A 1 22  ? -4.408  11.961  -6.670  1.00 0.00 ? 22  PHE A C    2  
ATOM 2055  O O    . PHE A 1 22  ? -5.161  12.038  -5.699  1.00 0.00 ? 22  PHE A O    2  
ATOM 2056  C CB   . PHE A 1 22  ? -5.921  12.340  -8.626  1.00 0.00 ? 22  PHE A CB   2  
ATOM 2057  C CG   . PHE A 1 22  ? -5.711  12.560  -10.097 1.00 0.00 ? 22  PHE A CG   2  
ATOM 2058  C CD1  . PHE A 1 22  ? -5.988  11.554  -11.008 1.00 0.00 ? 22  PHE A CD1  2  
ATOM 2059  C CD2  . PHE A 1 22  ? -5.235  13.773  -10.568 1.00 0.00 ? 22  PHE A CD2  2  
ATOM 2060  C CE1  . PHE A 1 22  ? -5.795  11.753  -12.362 1.00 0.00 ? 22  PHE A CE1  2  
ATOM 2061  C CE2  . PHE A 1 22  ? -5.040  13.979  -11.921 1.00 0.00 ? 22  PHE A CE2  2  
ATOM 2062  C CZ   . PHE A 1 22  ? -5.321  12.968  -12.819 1.00 0.00 ? 22  PHE A CZ   2  
ATOM 2063  H H    . PHE A 1 22  ? -6.453  9.959   -7.890  1.00 0.00 ? 22  PHE A H    2  
ATOM 2064  H HA   . PHE A 1 22  ? -4.056  11.291  -8.665  1.00 0.00 ? 22  PHE A HA   2  
ATOM 2065  H HB2  . PHE A 1 22  ? -6.911  11.931  -8.491  1.00 0.00 ? 22  PHE A HB2  2  
ATOM 2066  H HB3  . PHE A 1 22  ? -5.862  13.299  -8.134  1.00 0.00 ? 22  PHE A HB3  2  
ATOM 2067  H HD1  . PHE A 1 22  ? -6.360  10.604  -10.652 1.00 0.00 ? 22  PHE A HD1  2  
ATOM 2068  H HD2  . PHE A 1 22  ? -5.015  14.565  -9.866  1.00 0.00 ? 22  PHE A HD2  2  
ATOM 2069  H HE1  . PHE A 1 22  ? -6.016  10.961  -13.062 1.00 0.00 ? 22  PHE A HE1  2  
ATOM 2070  H HE2  . PHE A 1 22  ? -4.670  14.929  -12.275 1.00 0.00 ? 22  PHE A HE2  2  
ATOM 2071  H HZ   . PHE A 1 22  ? -5.169  13.126  -13.876 1.00 0.00 ? 22  PHE A HZ   2  
ATOM 2072  N N    . ARG A 1 23  ? -3.140  12.359  -6.635  1.00 0.00 ? 23  ARG A N    2  
ATOM 2073  C CA   . ARG A 1 23  ? -2.548  12.920  -5.427  1.00 0.00 ? 23  ARG A CA   2  
ATOM 2074  C C    . ARG A 1 23  ? -3.356  14.116  -4.930  1.00 0.00 ? 23  ARG A C    2  
ATOM 2075  O O    . ARG A 1 23  ? -4.153  14.689  -5.672  1.00 0.00 ? 23  ARG A O    2  
ATOM 2076  C CB   . ARG A 1 23  ? -1.102  13.342  -5.690  1.00 0.00 ? 23  ARG A CB   2  
ATOM 2077  C CG   . ARG A 1 23  ? -0.274  12.275  -6.388  1.00 0.00 ? 23  ARG A CG   2  
ATOM 2078  C CD   . ARG A 1 23  ? 0.638   11.550  -5.411  1.00 0.00 ? 23  ARG A CD   2  
ATOM 2079  N NE   . ARG A 1 23  ? 1.316   12.473  -4.506  1.00 0.00 ? 23  ARG A NE   2  
ATOM 2080  C CZ   . ARG A 1 23  ? 2.449   13.098  -4.807  1.00 0.00 ? 23  ARG A CZ   2  
ATOM 2081  N NH1  . ARG A 1 23  ? 3.028   12.899  -5.983  1.00 0.00 ? 23  ARG A NH1  2  
ATOM 2082  N NH2  . ARG A 1 23  ? 3.006   13.924  -3.930  1.00 0.00 ? 23  ARG A NH2  2  
ATOM 2083  H H    . ARG A 1 23  ? -2.590  12.272  -7.441  1.00 0.00 ? 23  ARG A H    2  
ATOM 2084  H HA   . ARG A 1 23  ? -2.557  12.153  -4.666  1.00 0.00 ? 23  ARG A HA   2  
ATOM 2085  H HB2  . ARG A 1 23  ? -1.104  14.227  -6.310  1.00 0.00 ? 23  ARG A HB2  2  
ATOM 2086  H HB3  . ARG A 1 23  ? -0.630  13.574  -4.748  1.00 0.00 ? 23  ARG A HB3  2  
ATOM 2087  H HG2  . ARG A 1 23  ? -0.939  11.557  -6.844  1.00 0.00 ? 23  ARG A HG2  2  
ATOM 2088  H HG3  . ARG A 1 23  ? 0.330   12.744  -7.151  1.00 0.00 ? 23  ARG A HG3  2  
ATOM 2089  H HD2  . ARG A 1 23  ? 0.043   10.861  -4.828  1.00 0.00 ? 23  ARG A HD2  2  
ATOM 2090  H HD3  . ARG A 1 23  ? 1.379   10.999  -5.971  1.00 0.00 ? 23  ARG A HD3  2  
ATOM 2091  H HE   . ARG A 1 23  ? 0.906   12.635  -3.631  1.00 0.00 ? 23  ARG A HE   2  
ATOM 2092  H HH11 . ARG A 1 23  ? 2.610   12.278  -6.646  1.00 0.00 ? 23  ARG A HH11 2  
ATOM 2093  H HH12 . ARG A 1 23  ? 3.880   13.371  -6.208  1.00 0.00 ? 23  ARG A HH12 2  
ATOM 2094  H HH21 . ARG A 1 23  ? 2.573   14.077  -3.043  1.00 0.00 ? 23  ARG A HH21 2  
ATOM 2095  H HH22 . ARG A 1 23  ? 3.859   14.393  -4.158  1.00 0.00 ? 23  ARG A HH22 2  
ATOM 2096  N N    . GLU A 1 24  ? -3.143  14.485  -3.671  1.00 0.00 ? 24  GLU A N    2  
ATOM 2097  C CA   . GLU A 1 24  ? -3.853  15.611  -3.076  1.00 0.00 ? 24  GLU A CA   2  
ATOM 2098  C C    . GLU A 1 24  ? -2.872  16.658  -2.554  1.00 0.00 ? 24  GLU A C    2  
ATOM 2099  O O    . GLU A 1 24  ? -1.747  16.349  -2.161  1.00 0.00 ? 24  GLU A O    2  
ATOM 2100  C CB   . GLU A 1 24  ? -4.756  15.131  -1.938  1.00 0.00 ? 24  GLU A CB   2  
ATOM 2101  C CG   . GLU A 1 24  ? -6.165  14.780  -2.386  1.00 0.00 ? 24  GLU A CG   2  
ATOM 2102  C CD   . GLU A 1 24  ? -6.811  15.885  -3.198  1.00 0.00 ? 24  GLU A CD   2  
ATOM 2103  O OE1  . GLU A 1 24  ? -7.441  16.776  -2.590  1.00 0.00 ? 24  GLU A OE1  2  
ATOM 2104  O OE2  . GLU A 1 24  ? -6.687  15.860  -4.440  1.00 0.00 ? 24  GLU A OE2  2  
ATOM 2105  H H    . GLU A 1 24  ? -2.495  13.988  -3.130  1.00 0.00 ? 24  GLU A H    2  
ATOM 2106  H HA   . GLU A 1 24  ? -4.465  16.060  -3.843  1.00 0.00 ? 24  GLU A HA   2  
ATOM 2107  H HB2  . GLU A 1 24  ? -4.313  14.253  -1.490  1.00 0.00 ? 24  GLU A HB2  2  
ATOM 2108  H HB3  . GLU A 1 24  ? -4.821  15.910  -1.193  1.00 0.00 ? 24  GLU A HB3  2  
ATOM 2109  H HG2  . GLU A 1 24  ? -6.125  13.886  -2.991  1.00 0.00 ? 24  GLU A HG2  2  
ATOM 2110  H HG3  . GLU A 1 24  ? -6.771  14.594  -1.511  1.00 0.00 ? 24  GLU A HG3  2  
ATOM 2111  N N    . PRO A 1 25  ? -3.307  17.927  -2.552  1.00 0.00 ? 25  PRO A N    2  
ATOM 2112  C CA   . PRO A 1 25  ? -2.484  19.045  -2.081  1.00 0.00 ? 25  PRO A CA   2  
ATOM 2113  C C    . PRO A 1 25  ? -2.270  19.012  -0.572  1.00 0.00 ? 25  PRO A C    2  
ATOM 2114  O O    . PRO A 1 25  ? -1.319  18.402  -0.084  1.00 0.00 ? 25  PRO A O    2  
ATOM 2115  C CB   . PRO A 1 25  ? -3.300  20.277  -2.479  1.00 0.00 ? 25  PRO A CB   2  
ATOM 2116  C CG   . PRO A 1 25  ? -4.708  19.795  -2.542  1.00 0.00 ? 25  PRO A CG   2  
ATOM 2117  C CD   . PRO A 1 25  ? -4.637  18.367  -3.007  1.00 0.00 ? 25  PRO A CD   2  
ATOM 2118  H HA   . PRO A 1 25  ? -1.526  19.069  -2.580  1.00 0.00 ? 25  PRO A HA   2  
ATOM 2119  H HB2  . PRO A 1 25  ? -3.179  21.049  -1.731  1.00 0.00 ? 25  PRO A HB2  2  
ATOM 2120  H HB3  . PRO A 1 25  ? -2.965  20.642  -3.438  1.00 0.00 ? 25  PRO A HB3  2  
ATOM 2121  H HG2  . PRO A 1 25  ? -5.159  19.849  -1.563  1.00 0.00 ? 25  PRO A HG2  2  
ATOM 2122  H HG3  . PRO A 1 25  ? -5.269  20.391  -3.248  1.00 0.00 ? 25  PRO A HG3  2  
ATOM 2123  H HD2  . PRO A 1 25  ? -5.417  17.780  -2.545  1.00 0.00 ? 25  PRO A HD2  2  
ATOM 2124  H HD3  . PRO A 1 25  ? -4.711  18.316  -4.083  1.00 0.00 ? 25  PRO A HD3  2  
ATOM 2125  N N    . ASN A 1 26  ? -3.159  19.672  0.162   1.00 0.00 ? 26  ASN A N    2  
ATOM 2126  C CA   . ASN A 1 26  ? -3.067  19.718  1.617   1.00 0.00 ? 26  ASN A CA   2  
ATOM 2127  C C    . ASN A 1 26  ? -2.941  18.313  2.199   1.00 0.00 ? 26  ASN A C    2  
ATOM 2128  O O    . ASN A 1 26  ? -2.283  18.108  3.219   1.00 0.00 ? 26  ASN A O    2  
ATOM 2129  C CB   . ASN A 1 26  ? -4.293  20.418  2.205   1.00 0.00 ? 26  ASN A CB   2  
ATOM 2130  C CG   . ASN A 1 26  ? -4.466  21.827  1.672   1.00 0.00 ? 26  ASN A CG   2  
ATOM 2131  O OD1  . ASN A 1 26  ? -3.757  22.747  2.079   1.00 0.00 ? 26  ASN A OD1  2  
ATOM 2132  N ND2  . ASN A 1 26  ? -5.412  22.002  0.757   1.00 0.00 ? 26  ASN A ND2  2  
ATOM 2133  H H    . ASN A 1 26  ? -3.896  20.139  -0.285  1.00 0.00 ? 26  ASN A H    2  
ATOM 2134  H HA   . ASN A 1 26  ? -2.183  20.282  1.875   1.00 0.00 ? 26  ASN A HA   2  
ATOM 2135  H HB2  . ASN A 1 26  ? -5.178  19.849  1.957   1.00 0.00 ? 26  ASN A HB2  2  
ATOM 2136  H HB3  . ASN A 1 26  ? -4.192  20.468  3.279   1.00 0.00 ? 26  ASN A HB3  2  
ATOM 2137  H HD21 . ASN A 1 26  ? -5.939  21.223  0.481   1.00 0.00 ? 26  ASN A HD21 2  
ATOM 2138  H HD22 . ASN A 1 26  ? -5.545  22.903  0.395   1.00 0.00 ? 26  ASN A HD22 2  
ATOM 2139  N N    . VAL A 1 27  ? -3.576  17.347  1.542   1.00 0.00 ? 27  VAL A N    2  
ATOM 2140  C CA   . VAL A 1 27  ? -3.534  15.961  1.992   1.00 0.00 ? 27  VAL A CA   2  
ATOM 2141  C C    . VAL A 1 27  ? -2.868  15.066  0.954   1.00 0.00 ? 27  VAL A C    2  
ATOM 2142  O O    . VAL A 1 27  ? -2.813  15.404  -0.229  1.00 0.00 ? 27  VAL A O    2  
ATOM 2143  C CB   . VAL A 1 27  ? -4.947  15.424  2.287   1.00 0.00 ? 27  VAL A CB   2  
ATOM 2144  C CG1  . VAL A 1 27  ? -5.690  15.135  0.991   1.00 0.00 ? 27  VAL A CG1  2  
ATOM 2145  C CG2  . VAL A 1 27  ? -4.873  14.179  3.157   1.00 0.00 ? 27  VAL A CG2  2  
ATOM 2146  H H    . VAL A 1 27  ? -4.084  17.572  0.735   1.00 0.00 ? 27  VAL A H    2  
ATOM 2147  H HA   . VAL A 1 27  ? -2.960  15.924  2.907   1.00 0.00 ? 27  VAL A HA   2  
ATOM 2148  H HB   . VAL A 1 27  ? -5.494  16.183  2.827   1.00 0.00 ? 27  VAL A HB   2  
ATOM 2149  H HG11 . VAL A 1 27  ? -5.077  14.510  0.357   1.00 0.00 ? 27  VAL A HG11 2  
ATOM 2150  H HG12 . VAL A 1 27  ? -6.617  14.626  1.212   1.00 0.00 ? 27  VAL A HG12 2  
ATOM 2151  H HG13 . VAL A 1 27  ? -5.901  16.064  0.482   1.00 0.00 ? 27  VAL A HG13 2  
ATOM 2152  H HG21 . VAL A 1 27  ? -5.676  14.195  3.879   1.00 0.00 ? 27  VAL A HG21 2  
ATOM 2153  H HG22 . VAL A 1 27  ? -4.964  13.300  2.536   1.00 0.00 ? 27  VAL A HG22 2  
ATOM 2154  H HG23 . VAL A 1 27  ? -3.925  14.157  3.674   1.00 0.00 ? 27  VAL A HG23 2  
ATOM 2155  N N    . SER A 1 28  ? -2.363  13.921  1.403   1.00 0.00 ? 28  SER A N    2  
ATOM 2156  C CA   . SER A 1 28  ? -1.697  12.978  0.513   1.00 0.00 ? 28  SER A CA   2  
ATOM 2157  C C    . SER A 1 28  ? -2.699  11.993  -0.082  1.00 0.00 ? 28  SER A C    2  
ATOM 2158  O O    . SER A 1 28  ? -3.909  12.216  -0.035  1.00 0.00 ? 28  SER A O    2  
ATOM 2159  C CB   . SER A 1 28  ? -0.604  12.218  1.267   1.00 0.00 ? 28  SER A CB   2  
ATOM 2160  O OG   . SER A 1 28  ? 0.448   11.840  0.396   1.00 0.00 ? 28  SER A OG   2  
ATOM 2161  H H    . SER A 1 28  ? -2.439  13.708  2.357   1.00 0.00 ? 28  SER A H    2  
ATOM 2162  H HA   . SER A 1 28  ? -1.244  13.541  -0.288  1.00 0.00 ? 28  SER A HA   2  
ATOM 2163  H HB2  . SER A 1 28  ? -0.202  12.849  2.045   1.00 0.00 ? 28  SER A HB2  2  
ATOM 2164  H HB3  . SER A 1 28  ? -1.028  11.327  1.709   1.00 0.00 ? 28  SER A HB3  2  
ATOM 2165  H HG   . SER A 1 28  ? 0.890   11.063  0.746   1.00 0.00 ? 28  SER A HG   2  
ATOM 2166  N N    . LEU A 1 29  ? -2.186  10.903  -0.641  1.00 0.00 ? 29  LEU A N    2  
ATOM 2167  C CA   . LEU A 1 29  ? -3.034  9.882   -1.247  1.00 0.00 ? 29  LEU A CA   2  
ATOM 2168  C C    . LEU A 1 29  ? -4.024  9.323   -0.229  1.00 0.00 ? 29  LEU A C    2  
ATOM 2169  O O    . LEU A 1 29  ? -5.134  8.926   -0.581  1.00 0.00 ? 29  LEU A O    2  
ATOM 2170  C CB   . LEU A 1 29  ? -2.177  8.750   -1.816  1.00 0.00 ? 29  LEU A CB   2  
ATOM 2171  C CG   . LEU A 1 29  ? -1.865  8.831   -3.311  1.00 0.00 ? 29  LEU A CG   2  
ATOM 2172  C CD1  . LEU A 1 29  ? -1.280  7.517   -3.806  1.00 0.00 ? 29  LEU A CD1  2  
ATOM 2173  C CD2  . LEU A 1 29  ? -3.118  9.189   -4.098  1.00 0.00 ? 29  LEU A CD2  2  
ATOM 2174  H H    . LEU A 1 29  ? -1.214  10.780  -0.648  1.00 0.00 ? 29  LEU A H    2  
ATOM 2175  H HA   . LEU A 1 29  ? -3.586  10.344  -2.051  1.00 0.00 ? 29  LEU A HA   2  
ATOM 2176  H HB2  . LEU A 1 29  ? -1.238  8.746   -1.283  1.00 0.00 ? 29  LEU A HB2  2  
ATOM 2177  H HB3  . LEU A 1 29  ? -2.696  7.820   -1.635  1.00 0.00 ? 29  LEU A HB3  2  
ATOM 2178  H HG   . LEU A 1 29  ? -1.131  9.607   -3.478  1.00 0.00 ? 29  LEU A HG   2  
ATOM 2179  H HD11 . LEU A 1 29  ? -1.257  6.805   -2.995  1.00 0.00 ? 29  LEU A HD11 2  
ATOM 2180  H HD12 . LEU A 1 29  ? -0.277  7.684   -4.168  1.00 0.00 ? 29  LEU A HD12 2  
ATOM 2181  H HD13 . LEU A 1 29  ? -1.892  7.131   -4.608  1.00 0.00 ? 29  LEU A HD13 2  
ATOM 2182  H HD21 . LEU A 1 29  ? -3.131  10.252  -4.288  1.00 0.00 ? 29  LEU A HD21 2  
ATOM 2183  H HD22 . LEU A 1 29  ? -3.992  8.914   -3.527  1.00 0.00 ? 29  LEU A HD22 2  
ATOM 2184  H HD23 . LEU A 1 29  ? -3.118  8.655   -5.037  1.00 0.00 ? 29  LEU A HD23 2  
ATOM 2185  N N    . GLY A 1 30  ? -3.613  9.296   1.035   1.00 0.00 ? 30  GLY A N    2  
ATOM 2186  C CA   . GLY A 1 30  ? -4.476  8.786   2.084   1.00 0.00 ? 30  GLY A CA   2  
ATOM 2187  C C    . GLY A 1 30  ? -4.357  7.284   2.255   1.00 0.00 ? 30  GLY A C    2  
ATOM 2188  O O    . GLY A 1 30  ? -5.198  6.657   2.900   1.00 0.00 ? 30  GLY A O    2  
ATOM 2189  H H    . GLY A 1 30  ? -2.717  9.625   1.257   1.00 0.00 ? 30  GLY A H    2  
ATOM 2190  H HA2  . GLY A 1 30  ? -4.214  9.265   3.016   1.00 0.00 ? 30  GLY A HA2  2  
ATOM 2191  H HA3  . GLY A 1 30  ? -5.501  9.028   1.842   1.00 0.00 ? 30  GLY A HA3  2  
ATOM 2192  N N    . ILE A 1 31  ? -3.310  6.706   1.674   1.00 0.00 ? 31  ILE A N    2  
ATOM 2193  C CA   . ILE A 1 31  ? -3.085  5.269   1.765   1.00 0.00 ? 31  ILE A CA   2  
ATOM 2194  C C    . ILE A 1 31  ? -1.837  4.959   2.585   1.00 0.00 ? 31  ILE A C    2  
ATOM 2195  O O    . ILE A 1 31  ? -0.890  5.744   2.614   1.00 0.00 ? 31  ILE A O    2  
ATOM 2196  C CB   . ILE A 1 31  ? -2.940  4.633   0.370   1.00 0.00 ? 31  ILE A CB   2  
ATOM 2197  C CG1  . ILE A 1 31  ? -4.018  5.169   -0.574  1.00 0.00 ? 31  ILE A CG1  2  
ATOM 2198  C CG2  . ILE A 1 31  ? -3.020  3.117   0.468   1.00 0.00 ? 31  ILE A CG2  2  
ATOM 2199  C CD1  . ILE A 1 31  ? -3.795  4.793   -2.022  1.00 0.00 ? 31  ILE A CD1  2  
ATOM 2200  H H    . ILE A 1 31  ? -2.675  7.259   1.174   1.00 0.00 ? 31  ILE A H    2  
ATOM 2201  H HA   . ILE A 1 31  ? -3.942  4.827   2.252   1.00 0.00 ? 31  ILE A HA   2  
ATOM 2202  H HB   . ILE A 1 31  ? -1.968  4.893   -0.021  1.00 0.00 ? 31  ILE A HB   2  
ATOM 2203  H HG12 . ILE A 1 31  ? -4.977  4.776   -0.274  1.00 0.00 ? 31  ILE A HG12 2  
ATOM 2204  H HG13 . ILE A 1 31  ? -4.039  6.247   -0.509  1.00 0.00 ? 31  ILE A HG13 2  
ATOM 2205  H HG21 . ILE A 1 31  ? -2.043  2.719   0.701   1.00 0.00 ? 31  ILE A HG21 2  
ATOM 2206  H HG22 . ILE A 1 31  ? -3.714  2.843   1.248   1.00 0.00 ? 31  ILE A HG22 2  
ATOM 2207  H HG23 . ILE A 1 31  ? -3.358  2.712   -0.474  1.00 0.00 ? 31  ILE A HG23 2  
ATOM 2208  H HD11 . ILE A 1 31  ? -3.663  5.691   -2.610  1.00 0.00 ? 31  ILE A HD11 2  
ATOM 2209  H HD12 . ILE A 1 31  ? -2.911  4.178   -2.103  1.00 0.00 ? 31  ILE A HD12 2  
ATOM 2210  H HD13 . ILE A 1 31  ? -4.650  4.246   -2.389  1.00 0.00 ? 31  ILE A HD13 2  
ATOM 2211  N N    . SER A 1 32  ? -1.843  3.807   3.249   1.00 0.00 ? 32  SER A N    2  
ATOM 2212  C CA   . SER A 1 32  ? -0.712  3.394   4.071   1.00 0.00 ? 32  SER A CA   2  
ATOM 2213  C C    . SER A 1 32  ? -0.322  1.950   3.772   1.00 0.00 ? 32  SER A C    2  
ATOM 2214  O O    . SER A 1 32  ? -1.004  1.255   3.018   1.00 0.00 ? 32  SER A O    2  
ATOM 2215  C CB   . SER A 1 32  ? -1.052  3.544   5.556   1.00 0.00 ? 32  SER A CB   2  
ATOM 2216  O OG   . SER A 1 32  ? -1.268  4.904   5.894   1.00 0.00 ? 32  SER A OG   2  
ATOM 2217  H H    . SER A 1 32  ? -2.628  3.224   3.186   1.00 0.00 ? 32  SER A H    2  
ATOM 2218  H HA   . SER A 1 32  ? 0.123   4.036   3.835   1.00 0.00 ? 32  SER A HA   2  
ATOM 2219  H HB2  . SER A 1 32  ? -1.948  2.984   5.776   1.00 0.00 ? 32  SER A HB2  2  
ATOM 2220  H HB3  . SER A 1 32  ? -0.234  3.163   6.150   1.00 0.00 ? 32  SER A HB3  2  
ATOM 2221  H HG   . SER A 1 32  ? -1.692  4.956   6.753   1.00 0.00 ? 32  SER A HG   2  
ATOM 2222  N N    . ILE A 1 33  ? 0.780   1.505   4.367   1.00 0.00 ? 33  ILE A N    2  
ATOM 2223  C CA   . ILE A 1 33  ? 1.261   0.144   4.165   1.00 0.00 ? 33  ILE A CA   2  
ATOM 2224  C C    . ILE A 1 33  ? 1.873   -0.418  5.443   1.00 0.00 ? 33  ILE A C    2  
ATOM 2225  O O    . ILE A 1 33  ? 2.417   0.324   6.262   1.00 0.00 ? 33  ILE A O    2  
ATOM 2226  C CB   . ILE A 1 33  ? 2.306   0.078   3.036   1.00 0.00 ? 33  ILE A CB   2  
ATOM 2227  C CG1  . ILE A 1 33  ? 3.411   1.109   3.274   1.00 0.00 ? 33  ILE A CG1  2  
ATOM 2228  C CG2  . ILE A 1 33  ? 1.642   0.307   1.686   1.00 0.00 ? 33  ILE A CG2  2  
ATOM 2229  C CD1  . ILE A 1 33  ? 4.610   0.929   2.369   1.00 0.00 ? 33  ILE A CD1  2  
ATOM 2230  H H    . ILE A 1 33  ? 1.280   2.107   4.956   1.00 0.00 ? 33  ILE A H    2  
ATOM 2231  H HA   . ILE A 1 33  ? 0.417   -0.469  3.883   1.00 0.00 ? 33  ILE A HA   2  
ATOM 2232  H HB   . ILE A 1 33  ? 2.739   -0.910  3.034   1.00 0.00 ? 33  ILE A HB   2  
ATOM 2233  H HG12 . ILE A 1 33  ? 3.015   2.098   3.105   1.00 0.00 ? 33  ILE A HG12 2  
ATOM 2234  H HG13 . ILE A 1 33  ? 3.751   1.032   4.296   1.00 0.00 ? 33  ILE A HG13 2  
ATOM 2235  H HG21 . ILE A 1 33  ? 2.298   -0.037  0.900   1.00 0.00 ? 33  ILE A HG21 2  
ATOM 2236  H HG22 . ILE A 1 33  ? 0.714   -0.242  1.644   1.00 0.00 ? 33  ILE A HG22 2  
ATOM 2237  H HG23 . ILE A 1 33  ? 1.445   1.360   1.555   1.00 0.00 ? 33  ILE A HG23 2  
ATOM 2238  H HD11 . ILE A 1 33  ? 4.621   1.713   1.626   1.00 0.00 ? 33  ILE A HD11 2  
ATOM 2239  H HD12 . ILE A 1 33  ? 5.515   0.979   2.956   1.00 0.00 ? 33  ILE A HD12 2  
ATOM 2240  H HD13 . ILE A 1 33  ? 4.551   -0.031  1.878   1.00 0.00 ? 33  ILE A HD13 2  
ATOM 2241  N N    . VAL A 1 34  ? 1.784   -1.734  5.607   1.00 0.00 ? 34  VAL A N    2  
ATOM 2242  C CA   . VAL A 1 34  ? 2.332   -2.396  6.785   1.00 0.00 ? 34  VAL A CA   2  
ATOM 2243  C C    . VAL A 1 34  ? 3.639   -3.109  6.455   1.00 0.00 ? 34  VAL A C    2  
ATOM 2244  O O    . VAL A 1 34  ? 4.073   -3.132  5.304   1.00 0.00 ? 34  VAL A O    2  
ATOM 2245  C CB   . VAL A 1 34  ? 1.337   -3.417  7.369   1.00 0.00 ? 34  VAL A CB   2  
ATOM 2246  C CG1  . VAL A 1 34  ? -0.095  -2.983  7.095   1.00 0.00 ? 34  VAL A CG1  2  
ATOM 2247  C CG2  . VAL A 1 34  ? 1.601   -4.803  6.801   1.00 0.00 ? 34  VAL A CG2  2  
ATOM 2248  H H    . VAL A 1 34  ? 1.339   -2.272  4.920   1.00 0.00 ? 34  VAL A H    2  
ATOM 2249  H HA   . VAL A 1 34  ? 2.523   -1.642  7.534   1.00 0.00 ? 34  VAL A HA   2  
ATOM 2250  H HB   . VAL A 1 34  ? 1.479   -3.456  8.439   1.00 0.00 ? 34  VAL A HB   2  
ATOM 2251  H HG11 . VAL A 1 34  ? -0.764  -3.807  7.294   1.00 0.00 ? 34  VAL A HG11 2  
ATOM 2252  H HG12 . VAL A 1 34  ? -0.348  -2.150  7.734   1.00 0.00 ? 34  VAL A HG12 2  
ATOM 2253  H HG13 . VAL A 1 34  ? -0.189  -2.686  6.061   1.00 0.00 ? 34  VAL A HG13 2  
ATOM 2254  H HG21 . VAL A 1 34  ? 2.575   -5.143  7.119   1.00 0.00 ? 34  VAL A HG21 2  
ATOM 2255  H HG22 . VAL A 1 34  ? 0.846   -5.487  7.157   1.00 0.00 ? 34  VAL A HG22 2  
ATOM 2256  H HG23 . VAL A 1 34  ? 1.569   -4.763  5.721   1.00 0.00 ? 34  VAL A HG23 2  
ATOM 2257  N N    . GLY A 1 35  ? 4.263   -3.691  7.475   1.00 0.00 ? 35  GLY A N    2  
ATOM 2258  C CA   . GLY A 1 35  ? 5.515   -4.397  7.274   1.00 0.00 ? 35  GLY A CA   2  
ATOM 2259  C C    . GLY A 1 35  ? 6.373   -3.761  6.198   1.00 0.00 ? 35  GLY A C    2  
ATOM 2260  O O    . GLY A 1 35  ? 6.660   -2.566  6.250   1.00 0.00 ? 35  GLY A O    2  
ATOM 2261  H H    . GLY A 1 35  ? 3.870   -3.641  8.372   1.00 0.00 ? 35  GLY A H    2  
ATOM 2262  H HA2  . GLY A 1 35  ? 6.065   -4.404  8.203   1.00 0.00 ? 35  GLY A HA2  2  
ATOM 2263  H HA3  . GLY A 1 35  ? 5.298   -5.416  6.989   1.00 0.00 ? 35  GLY A HA3  2  
ATOM 2264  N N    . GLY A 1 36  ? 6.785   -4.563  5.221   1.00 0.00 ? 36  GLY A N    2  
ATOM 2265  C CA   . GLY A 1 36  ? 7.613   -4.053  4.143   1.00 0.00 ? 36  GLY A CA   2  
ATOM 2266  C C    . GLY A 1 36  ? 8.969   -4.728  4.086   1.00 0.00 ? 36  GLY A C    2  
ATOM 2267  O O    . GLY A 1 36  ? 9.268   -5.453  3.137   1.00 0.00 ? 36  GLY A O    2  
ATOM 2268  H H    . GLY A 1 36  ? 6.525   -5.508  5.231   1.00 0.00 ? 36  GLY A H    2  
ATOM 2269  H HA2  . GLY A 1 36  ? 7.102   -4.213  3.205   1.00 0.00 ? 36  GLY A HA2  2  
ATOM 2270  H HA3  . GLY A 1 36  ? 7.757   -2.993  4.286   1.00 0.00 ? 36  GLY A HA3  2  
ATOM 2271  N N    . GLN A 1 37  ? 9.792   -4.487  5.102   1.00 0.00 ? 37  GLN A N    2  
ATOM 2272  C CA   . GLN A 1 37  ? 11.124  -5.075  5.161   1.00 0.00 ? 37  GLN A CA   2  
ATOM 2273  C C    . GLN A 1 37  ? 11.126  -6.481  4.569   1.00 0.00 ? 37  GLN A C    2  
ATOM 2274  O O    . GLN A 1 37  ? 10.112  -7.179  4.596   1.00 0.00 ? 37  GLN A O    2  
ATOM 2275  C CB   . GLN A 1 37  ? 11.623  -5.117  6.606   1.00 0.00 ? 37  GLN A CB   2  
ATOM 2276  C CG   . GLN A 1 37  ? 11.055  -6.274  7.412   1.00 0.00 ? 37  GLN A CG   2  
ATOM 2277  C CD   . GLN A 1 37  ? 10.342  -5.815  8.669   1.00 0.00 ? 37  GLN A CD   2  
ATOM 2278  O OE1  . GLN A 1 37  ? 10.957  -5.255  9.576   1.00 0.00 ? 37  GLN A OE1  2  
ATOM 2279  N NE2  . GLN A 1 37  ? 9.036   -6.051  8.729   1.00 0.00 ? 37  GLN A NE2  2  
ATOM 2280  H H    . GLN A 1 37  ? 9.495   -3.900  5.828   1.00 0.00 ? 37  GLN A H    2  
ATOM 2281  H HA   . GLN A 1 37  ? 11.787  -4.453  4.579   1.00 0.00 ? 37  GLN A HA   2  
ATOM 2282  H HB2  . GLN A 1 37  ? 12.699  -5.204  6.601   1.00 0.00 ? 37  GLN A HB2  2  
ATOM 2283  H HB3  . GLN A 1 37  ? 11.346  -4.196  7.097   1.00 0.00 ? 37  GLN A HB3  2  
ATOM 2284  H HG2  . GLN A 1 37  ? 10.352  -6.815  6.796   1.00 0.00 ? 37  GLN A HG2  2  
ATOM 2285  H HG3  . GLN A 1 37  ? 11.864  -6.931  7.694   1.00 0.00 ? 37  GLN A HG3  2  
ATOM 2286  H HE21 . GLN A 1 37  ? 8.613   -6.503  7.969   1.00 0.00 ? 37  GLN A HE21 2  
ATOM 2287  H HE22 . GLN A 1 37  ? 8.551   -5.766  9.530   1.00 0.00 ? 37  GLN A HE22 2  
ATOM 2288  N N    . THR A 1 38  ? 12.271  -6.891  4.033   1.00 0.00 ? 38  THR A N    2  
ATOM 2289  C CA   . THR A 1 38  ? 12.404  -8.213  3.433   1.00 0.00 ? 38  THR A CA   2  
ATOM 2290  C C    . THR A 1 38  ? 13.835  -8.466  2.972   1.00 0.00 ? 38  THR A C    2  
ATOM 2291  O O    . THR A 1 38  ? 14.729  -7.656  3.218   1.00 0.00 ? 38  THR A O    2  
ATOM 2292  C CB   . THR A 1 38  ? 11.453  -8.384  2.233   1.00 0.00 ? 38  THR A CB   2  
ATOM 2293  O OG1  . THR A 1 38  ? 11.510  -9.731  1.751   1.00 0.00 ? 38  THR A OG1  2  
ATOM 2294  C CG2  . THR A 1 38  ? 11.818  -7.422  1.112   1.00 0.00 ? 38  THR A CG2  2  
ATOM 2295  H H    . THR A 1 38  ? 13.044  -6.289  4.041   1.00 0.00 ? 38  THR A H    2  
ATOM 2296  H HA   . THR A 1 38  ? 12.142  -8.947  4.181   1.00 0.00 ? 38  THR A HA   2  
ATOM 2297  H HB   . THR A 1 38  ? 10.445  -8.168  2.559   1.00 0.00 ? 38  THR A HB   2  
ATOM 2298  H HG1  . THR A 1 38  ? 11.239  -10.332 2.448   1.00 0.00 ? 38  THR A HG1  2  
ATOM 2299  H HG21 . THR A 1 38  ? 11.831  -6.412  1.495   1.00 0.00 ? 38  THR A HG21 2  
ATOM 2300  H HG22 . THR A 1 38  ? 11.087  -7.498  0.321   1.00 0.00 ? 38  THR A HG22 2  
ATOM 2301  H HG23 . THR A 1 38  ? 12.795  -7.673  0.726   1.00 0.00 ? 38  THR A HG23 2  
ATOM 2302  N N    . VAL A 1 39  ? 14.046  -9.595  2.303   1.00 0.00 ? 39  VAL A N    2  
ATOM 2303  C CA   . VAL A 1 39  ? 15.369  -9.954  1.806   1.00 0.00 ? 39  VAL A CA   2  
ATOM 2304  C C    . VAL A 1 39  ? 15.273  -10.716 0.489   1.00 0.00 ? 39  VAL A C    2  
ATOM 2305  O O    . VAL A 1 39  ? 14.367  -11.527 0.294   1.00 0.00 ? 39  VAL A O    2  
ATOM 2306  C CB   . VAL A 1 39  ? 16.138  -10.812 2.828   1.00 0.00 ? 39  VAL A CB   2  
ATOM 2307  C CG1  . VAL A 1 39  ? 15.693  -10.482 4.245   1.00 0.00 ? 39  VAL A CG1  2  
ATOM 2308  C CG2  . VAL A 1 39  ? 15.948  -12.292 2.532   1.00 0.00 ? 39  VAL A CG2  2  
ATOM 2309  H H    . VAL A 1 39  ? 13.293  -10.201 2.139   1.00 0.00 ? 39  VAL A H    2  
ATOM 2310  H HA   . VAL A 1 39  ? 15.923  -9.041  1.644   1.00 0.00 ? 39  VAL A HA   2  
ATOM 2311  H HB   . VAL A 1 39  ? 17.190  -10.582 2.742   1.00 0.00 ? 39  VAL A HB   2  
ATOM 2312  H HG11 . VAL A 1 39  ? 15.609  -9.411  4.355   1.00 0.00 ? 39  VAL A HG11 2  
ATOM 2313  H HG12 . VAL A 1 39  ? 14.735  -10.942 4.438   1.00 0.00 ? 39  VAL A HG12 2  
ATOM 2314  H HG13 . VAL A 1 39  ? 16.422  -10.859 4.948   1.00 0.00 ? 39  VAL A HG13 2  
ATOM 2315  H HG21 . VAL A 1 39  ? 16.405  -12.531 1.583   1.00 0.00 ? 39  VAL A HG21 2  
ATOM 2316  H HG22 . VAL A 1 39  ? 16.410  -12.877 3.313   1.00 0.00 ? 39  VAL A HG22 2  
ATOM 2317  H HG23 . VAL A 1 39  ? 14.892  -12.518 2.489   1.00 0.00 ? 39  VAL A HG23 2  
ATOM 2318  N N    . ILE A 1 40  ? 16.213  -10.450 -0.411  1.00 0.00 ? 40  ILE A N    2  
ATOM 2319  C CA   . ILE A 1 40  ? 16.236  -11.112 -1.710  1.00 0.00 ? 40  ILE A CA   2  
ATOM 2320  C C    . ILE A 1 40  ? 17.343  -12.159 -1.774  1.00 0.00 ? 40  ILE A C    2  
ATOM 2321  O O    . ILE A 1 40  ? 18.392  -12.009 -1.148  1.00 0.00 ? 40  ILE A O    2  
ATOM 2322  C CB   . ILE A 1 40  ? 16.434  -10.100 -2.854  1.00 0.00 ? 40  ILE A CB   2  
ATOM 2323  C CG1  . ILE A 1 40  ? 15.640  -8.822  -2.578  1.00 0.00 ? 40  ILE A CG1  2  
ATOM 2324  C CG2  . ILE A 1 40  ? 16.016  -10.714 -4.182  1.00 0.00 ? 40  ILE A CG2  2  
ATOM 2325  C CD1  . ILE A 1 40  ? 15.656  -7.840  -3.728  1.00 0.00 ? 40  ILE A CD1  2  
ATOM 2326  H H    . ILE A 1 40  ? 16.909  -9.794  -0.197  1.00 0.00 ? 40  ILE A H    2  
ATOM 2327  H HA   . ILE A 1 40  ? 15.283  -11.602 -1.850  1.00 0.00 ? 40  ILE A HA   2  
ATOM 2328  H HB   . ILE A 1 40  ? 17.484  -9.858  -2.911  1.00 0.00 ? 40  ILE A HB   2  
ATOM 2329  H HG12 . ILE A 1 40  ? 14.612  -9.081  -2.377  1.00 0.00 ? 40  ILE A HG12 2  
ATOM 2330  H HG13 . ILE A 1 40  ? 16.058  -8.328  -1.712  1.00 0.00 ? 40  ILE A HG13 2  
ATOM 2331  H HG21 . ILE A 1 40  ? 14.960  -10.550 -4.337  1.00 0.00 ? 40  ILE A HG21 2  
ATOM 2332  H HG22 . ILE A 1 40  ? 16.573  -10.251 -4.983  1.00 0.00 ? 40  ILE A HG22 2  
ATOM 2333  H HG23 . ILE A 1 40  ? 16.218  -11.774 -4.168  1.00 0.00 ? 40  ILE A HG23 2  
ATOM 2334  H HD11 . ILE A 1 40  ? 16.619  -7.352  -3.771  1.00 0.00 ? 40  ILE A HD11 2  
ATOM 2335  H HD12 . ILE A 1 40  ? 15.480  -8.367  -4.654  1.00 0.00 ? 40  ILE A HD12 2  
ATOM 2336  H HD13 . ILE A 1 40  ? 14.884  -7.100  -3.581  1.00 0.00 ? 40  ILE A HD13 2  
ATOM 2337  N N    . LYS A 1 41  ? 17.102  -13.220 -2.536  1.00 0.00 ? 41  LYS A N    2  
ATOM 2338  C CA   . LYS A 1 41  ? 18.079  -14.292 -2.687  1.00 0.00 ? 41  LYS A CA   2  
ATOM 2339  C C    . LYS A 1 41  ? 18.131  -14.782 -4.130  1.00 0.00 ? 41  LYS A C    2  
ATOM 2340  O O    . LYS A 1 41  ? 17.100  -14.913 -4.789  1.00 0.00 ? 41  LYS A O    2  
ATOM 2341  C CB   . LYS A 1 41  ? 17.737  -15.456 -1.754  1.00 0.00 ? 41  LYS A CB   2  
ATOM 2342  C CG   . LYS A 1 41  ? 18.368  -15.338 -0.377  1.00 0.00 ? 41  LYS A CG   2  
ATOM 2343  C CD   . LYS A 1 41  ? 19.736  -15.996 -0.333  1.00 0.00 ? 41  LYS A CD   2  
ATOM 2344  C CE   . LYS A 1 41  ? 20.805  -15.102 -0.944  1.00 0.00 ? 41  LYS A CE   2  
ATOM 2345  N NZ   . LYS A 1 41  ? 20.728  -13.710 -0.421  1.00 0.00 ? 41  LYS A NZ   2  
ATOM 2346  H H    . LYS A 1 41  ? 16.246  -13.283 -3.011  1.00 0.00 ? 41  LYS A H    2  
ATOM 2347  H HA   . LYS A 1 41  ? 19.047  -13.899 -2.417  1.00 0.00 ? 41  LYS A HA   2  
ATOM 2348  H HB2  . LYS A 1 41  ? 16.664  -15.501 -1.633  1.00 0.00 ? 41  LYS A HB2  2  
ATOM 2349  H HB3  . LYS A 1 41  ? 18.078  -16.376 -2.206  1.00 0.00 ? 41  LYS A HB3  2  
ATOM 2350  H HG2  . LYS A 1 41  ? 18.475  -14.293 -0.128  1.00 0.00 ? 41  LYS A HG2  2  
ATOM 2351  H HG3  . LYS A 1 41  ? 17.724  -15.818 0.346   1.00 0.00 ? 41  LYS A HG3  2  
ATOM 2352  H HD2  . LYS A 1 41  ? 19.997  -16.198 0.695   1.00 0.00 ? 41  LYS A HD2  2  
ATOM 2353  H HD3  . LYS A 1 41  ? 19.698  -16.925 -0.885  1.00 0.00 ? 41  LYS A HD3  2  
ATOM 2354  H HE2  . LYS A 1 41  ? 21.775  -15.512 -0.710  1.00 0.00 ? 41  LYS A HE2  2  
ATOM 2355  H HE3  . LYS A 1 41  ? 20.670  -15.083 -2.015  1.00 0.00 ? 41  LYS A HE3  2  
ATOM 2356  H HZ1  . LYS A 1 41  ? 20.193  -13.692 0.471   1.00 0.00 ? 41  LYS A HZ1  2  
ATOM 2357  H HZ2  . LYS A 1 41  ? 20.252  -13.095 -1.111  1.00 0.00 ? 41  LYS A HZ2  2  
ATOM 2358  H HZ3  . LYS A 1 41  ? 21.684  -13.340 -0.246  1.00 0.00 ? 41  LYS A HZ3  2  
ATOM 2359  N N    . ARG A 1 42  ? 19.339  -15.053 -4.615  1.00 0.00 ? 42  ARG A N    2  
ATOM 2360  C CA   . ARG A 1 42  ? 19.525  -15.529 -5.980  1.00 0.00 ? 42  ARG A CA   2  
ATOM 2361  C C    . ARG A 1 42  ? 19.463  -17.053 -6.038  1.00 0.00 ? 42  ARG A C    2  
ATOM 2362  O O    . ARG A 1 42  ? 19.783  -17.659 -7.061  1.00 0.00 ? 42  ARG A O    2  
ATOM 2363  C CB   . ARG A 1 42  ? 20.864  -15.041 -6.535  1.00 0.00 ? 42  ARG A CB   2  
ATOM 2364  C CG   . ARG A 1 42  ? 20.953  -15.098 -8.051  1.00 0.00 ? 42  ARG A CG   2  
ATOM 2365  C CD   . ARG A 1 42  ? 22.105  -14.255 -8.574  1.00 0.00 ? 42  ARG A CD   2  
ATOM 2366  N NE   . ARG A 1 42  ? 23.306  -14.401 -7.755  1.00 0.00 ? 42  ARG A NE   2  
ATOM 2367  C CZ   . ARG A 1 42  ? 24.453  -13.785 -8.018  1.00 0.00 ? 42  ARG A CZ   2  
ATOM 2368  N NH1  . ARG A 1 42  ? 24.555  -12.986 -9.071  1.00 0.00 ? 42  ARG A NH1  2  
ATOM 2369  N NH2  . ARG A 1 42  ? 25.502  -13.968 -7.225  1.00 0.00 ? 42  ARG A NH2  2  
ATOM 2370  H H    . ARG A 1 42  ? 20.124  -14.929 -4.041  1.00 0.00 ? 42  ARG A H    2  
ATOM 2371  H HA   . ARG A 1 42  ? 18.726  -15.125 -6.584  1.00 0.00 ? 42  ARG A HA   2  
ATOM 2372  H HB2  . ARG A 1 42  ? 21.018  -14.018 -6.226  1.00 0.00 ? 42  ARG A HB2  2  
ATOM 2373  H HB3  . ARG A 1 42  ? 21.654  -15.654 -6.127  1.00 0.00 ? 42  ARG A HB3  2  
ATOM 2374  H HG2  . ARG A 1 42  ? 21.104  -16.123 -8.356  1.00 0.00 ? 42  ARG A HG2  2  
ATOM 2375  H HG3  . ARG A 1 42  ? 20.029  -14.729 -8.470  1.00 0.00 ? 42  ARG A HG3  2  
ATOM 2376  H HD2  . ARG A 1 42  ? 22.330  -14.563 -9.584  1.00 0.00 ? 42  ARG A HD2  2  
ATOM 2377  H HD3  . ARG A 1 42  ? 21.804  -13.218 -8.574  1.00 0.00 ? 42  ARG A HD3  2  
ATOM 2378  H HE   . ARG A 1 42  ? 23.252  -14.987 -6.972  1.00 0.00 ? 42  ARG A HE   2  
ATOM 2379  H HH11 . ARG A 1 42  ? 23.766  -12.845 -9.669  1.00 0.00 ? 42  ARG A HH11 2  
ATOM 2380  H HH12 . ARG A 1 42  ? 25.420  -12.523 -9.265  1.00 0.00 ? 42  ARG A HH12 2  
ATOM 2381  H HH21 . ARG A 1 42  ? 25.429  -14.570 -6.431  1.00 0.00 ? 42  ARG A HH21 2  
ATOM 2382  H HH22 . ARG A 1 42  ? 26.365  -13.505 -7.424  1.00 0.00 ? 42  ARG A HH22 2  
ATOM 2383  N N    . LEU A 1 43  ? 19.050  -17.665 -4.934  1.00 0.00 ? 43  LEU A N    2  
ATOM 2384  C CA   . LEU A 1 43  ? 18.947  -19.118 -4.858  1.00 0.00 ? 43  LEU A CA   2  
ATOM 2385  C C    . LEU A 1 43  ? 17.511  -19.575 -5.095  1.00 0.00 ? 43  LEU A C    2  
ATOM 2386  O O    . LEU A 1 43  ? 17.271  -20.613 -5.711  1.00 0.00 ? 43  LEU A O    2  
ATOM 2387  C CB   . LEU A 1 43  ? 19.433  -19.613 -3.494  1.00 0.00 ? 43  LEU A CB   2  
ATOM 2388  C CG   . LEU A 1 43  ? 20.654  -18.897 -2.917  1.00 0.00 ? 43  LEU A CG   2  
ATOM 2389  C CD1  . LEU A 1 43  ? 21.081  -19.542 -1.607  1.00 0.00 ? 43  LEU A CD1  2  
ATOM 2390  C CD2  . LEU A 1 43  ? 21.801  -18.908 -3.917  1.00 0.00 ? 43  LEU A CD2  2  
ATOM 2391  H H    . LEU A 1 43  ? 18.809  -17.128 -4.150  1.00 0.00 ? 43  LEU A H    2  
ATOM 2392  H HA   . LEU A 1 43  ? 19.576  -19.536 -5.629  1.00 0.00 ? 43  LEU A HA   2  
ATOM 2393  H HB2  . LEU A 1 43  ? 18.621  -19.500 -2.793  1.00 0.00 ? 43  LEU A HB2  2  
ATOM 2394  H HB3  . LEU A 1 43  ? 19.678  -20.661 -3.592  1.00 0.00 ? 43  LEU A HB3  2  
ATOM 2395  H HG   . LEU A 1 43  ? 20.397  -17.867 -2.713  1.00 0.00 ? 43  LEU A HG   2  
ATOM 2396  H HD11 . LEU A 1 43  ? 20.273  -20.147 -1.224  1.00 0.00 ? 43  LEU A HD11 2  
ATOM 2397  H HD12 . LEU A 1 43  ? 21.325  -18.772 -0.890  1.00 0.00 ? 43  LEU A HD12 2  
ATOM 2398  H HD13 . LEU A 1 43  ? 21.948  -20.163 -1.777  1.00 0.00 ? 43  LEU A HD13 2  
ATOM 2399  H HD21 . LEU A 1 43  ? 21.998  -17.900 -4.249  1.00 0.00 ? 43  LEU A HD21 2  
ATOM 2400  H HD22 . LEU A 1 43  ? 21.533  -19.521 -4.765  1.00 0.00 ? 43  LEU A HD22 2  
ATOM 2401  H HD23 . LEU A 1 43  ? 22.685  -19.313 -3.446  1.00 0.00 ? 43  LEU A HD23 2  
ATOM 2402  N N    . LYS A 1 44  ? 16.557  -18.791 -4.603  1.00 0.00 ? 44  LYS A N    2  
ATOM 2403  C CA   . LYS A 1 44  ? 15.144  -19.111 -4.764  1.00 0.00 ? 44  LYS A CA   2  
ATOM 2404  C C    . LYS A 1 44  ? 14.269  -17.922 -4.380  1.00 0.00 ? 44  LYS A C    2  
ATOM 2405  O O    . LYS A 1 44  ? 14.764  -16.910 -3.885  1.00 0.00 ? 44  LYS A O    2  
ATOM 2406  C CB   . LYS A 1 44  ? 14.775  -20.326 -3.909  1.00 0.00 ? 44  LYS A CB   2  
ATOM 2407  C CG   . LYS A 1 44  ? 13.576  -21.097 -4.433  1.00 0.00 ? 44  LYS A CG   2  
ATOM 2408  C CD   . LYS A 1 44  ? 13.583  -22.537 -3.950  1.00 0.00 ? 44  LYS A CD   2  
ATOM 2409  C CE   . LYS A 1 44  ? 13.939  -22.627 -2.473  1.00 0.00 ? 44  LYS A CE   2  
ATOM 2410  N NZ   . LYS A 1 44  ? 15.408  -22.750 -2.263  1.00 0.00 ? 44  LYS A NZ   2  
ATOM 2411  H H    . LYS A 1 44  ? 16.811  -17.975 -4.121  1.00 0.00 ? 44  LYS A H    2  
ATOM 2412  H HA   . LYS A 1 44  ? 14.973  -19.347 -5.803  1.00 0.00 ? 44  LYS A HA   2  
ATOM 2413  H HB2  . LYS A 1 44  ? 15.621  -20.997 -3.875  1.00 0.00 ? 44  LYS A HB2  2  
ATOM 2414  H HB3  . LYS A 1 44  ? 14.551  -19.991 -2.907  1.00 0.00 ? 44  LYS A HB3  2  
ATOM 2415  H HG2  . LYS A 1 44  ? 12.672  -20.617 -4.088  1.00 0.00 ? 44  LYS A HG2  2  
ATOM 2416  H HG3  . LYS A 1 44  ? 13.599  -21.089 -5.514  1.00 0.00 ? 44  LYS A HG3  2  
ATOM 2417  H HD2  . LYS A 1 44  ? 12.603  -22.963 -4.098  1.00 0.00 ? 44  LYS A HD2  2  
ATOM 2418  H HD3  . LYS A 1 44  ? 14.311  -23.096 -4.521  1.00 0.00 ? 44  LYS A HD3  2  
ATOM 2419  H HE2  . LYS A 1 44  ? 13.586  -21.737 -1.977  1.00 0.00 ? 44  LYS A HE2  2  
ATOM 2420  H HE3  . LYS A 1 44  ? 13.450  -23.493 -2.051  1.00 0.00 ? 44  LYS A HE3  2  
ATOM 2421  H HZ1  . LYS A 1 44  ? 15.863  -23.114 -3.124  1.00 0.00 ? 44  LYS A HZ1  2  
ATOM 2422  H HZ2  . LYS A 1 44  ? 15.603  -23.402 -1.477  1.00 0.00 ? 44  LYS A HZ2  2  
ATOM 2423  H HZ3  . LYS A 1 44  ? 15.815  -21.820 -2.036  1.00 0.00 ? 44  LYS A HZ3  2  
ATOM 2424  N N    . ASN A 1 45  ? 12.967  -18.052 -4.610  1.00 0.00 ? 45  ASN A N    2  
ATOM 2425  C CA   . ASN A 1 45  ? 12.023  -16.988 -4.287  1.00 0.00 ? 45  ASN A CA   2  
ATOM 2426  C C    . ASN A 1 45  ? 11.030  -17.446 -3.222  1.00 0.00 ? 45  ASN A C    2  
ATOM 2427  O O    . ASN A 1 45  ? 10.869  -18.641 -2.982  1.00 0.00 ? 45  ASN A O    2  
ATOM 2428  C CB   . ASN A 1 45  ? 11.272  -16.545 -5.544  1.00 0.00 ? 45  ASN A CB   2  
ATOM 2429  C CG   . ASN A 1 45  ? 10.115  -15.617 -5.229  1.00 0.00 ? 45  ASN A CG   2  
ATOM 2430  O OD1  . ASN A 1 45  ? 10.279  -14.617 -4.530  1.00 0.00 ? 45  ASN A OD1  2  
ATOM 2431  N ND2  . ASN A 1 45  ? 8.936   -15.945 -5.745  1.00 0.00 ? 45  ASN A ND2  2  
ATOM 2432  H H    . ASN A 1 45  ? 12.632  -18.883 -5.007  1.00 0.00 ? 45  ASN A H    2  
ATOM 2433  H HA   . ASN A 1 45  ? 12.586  -16.152 -3.901  1.00 0.00 ? 45  ASN A HA   2  
ATOM 2434  H HB2  . ASN A 1 45  ? 11.956  -16.026 -6.200  1.00 0.00 ? 45  ASN A HB2  2  
ATOM 2435  H HB3  . ASN A 1 45  ? 10.884  -17.416 -6.050  1.00 0.00 ? 45  ASN A HB3  2  
ATOM 2436  H HD21 . ASN A 1 45  ? 8.880   -16.756 -6.292  1.00 0.00 ? 45  ASN A HD21 2  
ATOM 2437  H HD22 . ASN A 1 45  ? 8.171   -15.362 -5.558  1.00 0.00 ? 45  ASN A HD22 2  
ATOM 2438  N N    . GLY A 1 46  ? 10.367  -16.484 -2.588  1.00 0.00 ? 46  GLY A N    2  
ATOM 2439  C CA   . GLY A 1 46  ? 9.398   -16.808 -1.557  1.00 0.00 ? 46  GLY A CA   2  
ATOM 2440  C C    . GLY A 1 46  ? 8.046   -16.170 -1.811  1.00 0.00 ? 46  GLY A C    2  
ATOM 2441  O O    . GLY A 1 46  ? 7.966   -15.004 -2.196  1.00 0.00 ? 46  GLY A O    2  
ATOM 2442  H H    . GLY A 1 46  ? 10.536  -15.547 -2.821  1.00 0.00 ? 46  GLY A H    2  
ATOM 2443  H HA2  . GLY A 1 46  ? 9.276   -17.880 -1.516  1.00 0.00 ? 46  GLY A HA2  2  
ATOM 2444  H HA3  . GLY A 1 46  ? 9.773   -16.462 -0.605  1.00 0.00 ? 46  GLY A HA3  2  
ATOM 2445  N N    . GLU A 1 47  ? 6.982   -16.937 -1.596  1.00 0.00 ? 47  GLU A N    2  
ATOM 2446  C CA   . GLU A 1 47  ? 5.627   -16.440 -1.807  1.00 0.00 ? 47  GLU A CA   2  
ATOM 2447  C C    . GLU A 1 47  ? 4.973   -16.065 -0.480  1.00 0.00 ? 47  GLU A C    2  
ATOM 2448  O O    . GLU A 1 47  ? 3.820   -15.635 -0.445  1.00 0.00 ? 47  GLU A O    2  
ATOM 2449  C CB   . GLU A 1 47  ? 4.780   -17.491 -2.527  1.00 0.00 ? 47  GLU A CB   2  
ATOM 2450  C CG   . GLU A 1 47  ? 5.161   -18.921 -2.182  1.00 0.00 ? 47  GLU A CG   2  
ATOM 2451  C CD   . GLU A 1 47  ? 6.207   -19.489 -3.121  1.00 0.00 ? 47  GLU A CD   2  
ATOM 2452  O OE1  . GLU A 1 47  ? 6.520   -18.826 -4.132  1.00 0.00 ? 47  GLU A OE1  2  
ATOM 2453  O OE2  . GLU A 1 47  ? 6.711   -20.598 -2.845  1.00 0.00 ? 47  GLU A OE2  2  
ATOM 2454  H H    . GLU A 1 47  ? 7.110   -17.859 -1.289  1.00 0.00 ? 47  GLU A H    2  
ATOM 2455  H HA   . GLU A 1 47  ? 5.691   -15.557 -2.425  1.00 0.00 ? 47  GLU A HA   2  
ATOM 2456  H HB2  . GLU A 1 47  ? 3.743   -17.342 -2.264  1.00 0.00 ? 47  GLU A HB2  2  
ATOM 2457  H HB3  . GLU A 1 47  ? 4.894   -17.358 -3.593  1.00 0.00 ? 47  GLU A HB3  2  
ATOM 2458  H HG2  . GLU A 1 47  ? 5.554   -18.942 -1.176  1.00 0.00 ? 47  GLU A HG2  2  
ATOM 2459  H HG3  . GLU A 1 47  ? 4.277   -19.538 -2.234  1.00 0.00 ? 47  GLU A HG3  2  
ATOM 2460  N N    . GLU A 1 48  ? 5.717   -16.233 0.609   1.00 0.00 ? 48  GLU A N    2  
ATOM 2461  C CA   . GLU A 1 48  ? 5.208   -15.914 1.937   1.00 0.00 ? 48  GLU A CA   2  
ATOM 2462  C C    . GLU A 1 48  ? 4.814   -14.442 2.030   1.00 0.00 ? 48  GLU A C    2  
ATOM 2463  O O    . GLU A 1 48  ? 4.998   -13.678 1.082   1.00 0.00 ? 48  GLU A O    2  
ATOM 2464  C CB   . GLU A 1 48  ? 6.258   -16.240 3.002   1.00 0.00 ? 48  GLU A CB   2  
ATOM 2465  C CG   . GLU A 1 48  ? 6.160   -17.658 3.538   1.00 0.00 ? 48  GLU A CG   2  
ATOM 2466  C CD   . GLU A 1 48  ? 6.527   -18.702 2.501   1.00 0.00 ? 48  GLU A CD   2  
ATOM 2467  O OE1  . GLU A 1 48  ? 5.714   -18.935 1.582   1.00 0.00 ? 48  GLU A OE1  2  
ATOM 2468  O OE2  . GLU A 1 48  ? 7.626   -19.285 2.608   1.00 0.00 ? 48  GLU A OE2  2  
ATOM 2469  H H    . GLU A 1 48  ? 6.629   -16.580 0.516   1.00 0.00 ? 48  GLU A H    2  
ATOM 2470  H HA   . GLU A 1 48  ? 4.332   -16.520 2.111   1.00 0.00 ? 48  GLU A HA   2  
ATOM 2471  H HB2  . GLU A 1 48  ? 7.241   -16.106 2.574   1.00 0.00 ? 48  GLU A HB2  2  
ATOM 2472  H HB3  . GLU A 1 48  ? 6.139   -15.556 3.829   1.00 0.00 ? 48  GLU A HB3  2  
ATOM 2473  H HG2  . GLU A 1 48  ? 6.829   -17.758 4.379   1.00 0.00 ? 48  GLU A HG2  2  
ATOM 2474  H HG3  . GLU A 1 48  ? 5.145   -17.837 3.864   1.00 0.00 ? 48  GLU A HG3  2  
ATOM 2475  N N    . LEU A 1 49  ? 4.272   -14.053 3.179   1.00 0.00 ? 49  LEU A N    2  
ATOM 2476  C CA   . LEU A 1 49  ? 3.851   -12.673 3.397   1.00 0.00 ? 49  LEU A CA   2  
ATOM 2477  C C    . LEU A 1 49  ? 5.056   -11.765 3.621   1.00 0.00 ? 49  LEU A C    2  
ATOM 2478  O O    . LEU A 1 49  ? 5.354   -11.379 4.752   1.00 0.00 ? 49  LEU A O    2  
ATOM 2479  C CB   . LEU A 1 49  ? 2.906   -12.591 4.597   1.00 0.00 ? 49  LEU A CB   2  
ATOM 2480  C CG   . LEU A 1 49  ? 1.419   -12.778 4.294   1.00 0.00 ? 49  LEU A CG   2  
ATOM 2481  C CD1  . LEU A 1 49  ? 0.842   -11.522 3.657   1.00 0.00 ? 49  LEU A CD1  2  
ATOM 2482  C CD2  . LEU A 1 49  ? 1.205   -13.983 3.389   1.00 0.00 ? 49  LEU A CD2  2  
ATOM 2483  H H    . LEU A 1 49  ? 4.151   -14.707 3.897   1.00 0.00 ? 49  LEU A H    2  
ATOM 2484  H HA   . LEU A 1 49  ? 3.326   -12.343 2.512   1.00 0.00 ? 49  LEU A HA   2  
ATOM 2485  H HB2  . LEU A 1 49  ? 3.198   -13.355 5.300   1.00 0.00 ? 49  LEU A HB2  2  
ATOM 2486  H HB3  . LEU A 1 49  ? 3.033   -11.619 5.051   1.00 0.00 ? 49  LEU A HB3  2  
ATOM 2487  H HG   . LEU A 1 49  ? 0.888   -12.955 5.219   1.00 0.00 ? 49  LEU A HG   2  
ATOM 2488  H HD11 . LEU A 1 49  ? -0.019  -11.197 4.220   1.00 0.00 ? 49  LEU A HD11 2  
ATOM 2489  H HD12 . LEU A 1 49  ? 0.548   -11.737 2.640   1.00 0.00 ? 49  LEU A HD12 2  
ATOM 2490  H HD13 . LEU A 1 49  ? 1.590   -10.743 3.658   1.00 0.00 ? 49  LEU A HD13 2  
ATOM 2491  H HD21 . LEU A 1 49  ? 1.772   -13.854 2.479   1.00 0.00 ? 49  LEU A HD21 2  
ATOM 2492  H HD22 . LEU A 1 49  ? 0.156   -14.072 3.151   1.00 0.00 ? 49  LEU A HD22 2  
ATOM 2493  H HD23 . LEU A 1 49  ? 1.537   -14.877 3.897   1.00 0.00 ? 49  LEU A HD23 2  
ATOM 2494  N N    . LYS A 1 50  ? 5.744   -11.426 2.537   1.00 0.00 ? 50  LYS A N    2  
ATOM 2495  C CA   . LYS A 1 50  ? 6.915   -10.560 2.613   1.00 0.00 ? 50  LYS A CA   2  
ATOM 2496  C C    . LYS A 1 50  ? 6.743   -9.332  1.725   1.00 0.00 ? 50  LYS A C    2  
ATOM 2497  O O    . LYS A 1 50  ? 7.488   -8.360  1.842   1.00 0.00 ? 50  LYS A O    2  
ATOM 2498  C CB   . LYS A 1 50  ? 8.172   -11.329 2.199   1.00 0.00 ? 50  LYS A CB   2  
ATOM 2499  C CG   . LYS A 1 50  ? 8.472   -11.248 0.712   1.00 0.00 ? 50  LYS A CG   2  
ATOM 2500  C CD   . LYS A 1 50  ? 9.170   -12.503 0.215   1.00 0.00 ? 50  LYS A CD   2  
ATOM 2501  C CE   . LYS A 1 50  ? 9.819   -12.279 -1.142  1.00 0.00 ? 50  LYS A CE   2  
ATOM 2502  N NZ   . LYS A 1 50  ? 8.896   -11.598 -2.092  1.00 0.00 ? 50  LYS A NZ   2  
ATOM 2503  H H    . LYS A 1 50  ? 5.457   -11.765 1.663   1.00 0.00 ? 50  LYS A H    2  
ATOM 2504  H HA   . LYS A 1 50  ? 7.023   -10.237 3.637   1.00 0.00 ? 50  LYS A HA   2  
ATOM 2505  H HB2  . LYS A 1 50  ? 9.018   -10.930 2.738   1.00 0.00 ? 50  LYS A HB2  2  
ATOM 2506  H HB3  . LYS A 1 50  ? 8.046   -12.370 2.463   1.00 0.00 ? 50  LYS A HB3  2  
ATOM 2507  H HG2  . LYS A 1 50  ? 7.544   -11.128 0.173   1.00 0.00 ? 50  LYS A HG2  2  
ATOM 2508  H HG3  . LYS A 1 50  ? 9.110   -10.396 0.529   1.00 0.00 ? 50  LYS A HG3  2  
ATOM 2509  H HD2  . LYS A 1 50  ? 9.934   -12.785 0.924   1.00 0.00 ? 50  LYS A HD2  2  
ATOM 2510  H HD3  . LYS A 1 50  ? 8.444   -13.299 0.131   1.00 0.00 ? 50  LYS A HD3  2  
ATOM 2511  H HE2  . LYS A 1 50  ? 10.699  -11.670 -1.010  1.00 0.00 ? 50  LYS A HE2  2  
ATOM 2512  H HE3  . LYS A 1 50  ? 10.102  -13.237 -1.553  1.00 0.00 ? 50  LYS A HE3  2  
ATOM 2513  H HZ1  . LYS A 1 50  ? 9.170   -10.601 -2.204  1.00 0.00 ? 50  LYS A HZ1  2  
ATOM 2514  H HZ2  . LYS A 1 50  ? 7.920   -11.641 -1.735  1.00 0.00 ? 50  LYS A HZ2  2  
ATOM 2515  H HZ3  . LYS A 1 50  ? 8.933   -12.063 -3.022  1.00 0.00 ? 50  LYS A HZ3  2  
ATOM 2516  N N    . GLY A 1 51  ? 5.753   -9.383  0.838   1.00 0.00 ? 51  GLY A N    2  
ATOM 2517  C CA   . GLY A 1 51  ? 5.500   -8.267  -0.055  1.00 0.00 ? 51  GLY A CA   2  
ATOM 2518  C C    . GLY A 1 51  ? 4.979   -7.046  0.675   1.00 0.00 ? 51  GLY A C    2  
ATOM 2519  O O    . GLY A 1 51  ? 5.277   -6.845  1.853   1.00 0.00 ? 51  GLY A O    2  
ATOM 2520  H H    . GLY A 1 51  ? 5.191   -10.184 0.790   1.00 0.00 ? 51  GLY A H    2  
ATOM 2521  H HA2  . GLY A 1 51  ? 6.420   -8.008  -0.559  1.00 0.00 ? 51  GLY A HA2  2  
ATOM 2522  H HA3  . GLY A 1 51  ? 4.771   -8.570  -0.792  1.00 0.00 ? 51  GLY A HA3  2  
ATOM 2523  N N    . ILE A 1 52  ? 4.202   -6.227  -0.024  1.00 0.00 ? 52  ILE A N    2  
ATOM 2524  C CA   . ILE A 1 52  ? 3.639   -5.018  0.566   1.00 0.00 ? 52  ILE A CA   2  
ATOM 2525  C C    . ILE A 1 52  ? 2.119   -5.105  0.653   1.00 0.00 ? 52  ILE A C    2  
ATOM 2526  O O    . ILE A 1 52  ? 1.453   -5.493  -0.307  1.00 0.00 ? 52  ILE A O    2  
ATOM 2527  C CB   . ILE A 1 52  ? 4.025   -3.765  -0.242  1.00 0.00 ? 52  ILE A CB   2  
ATOM 2528  C CG1  . ILE A 1 52  ? 5.547   -3.638  -0.332  1.00 0.00 ? 52  ILE A CG1  2  
ATOM 2529  C CG2  . ILE A 1 52  ? 3.421   -2.520  0.390   1.00 0.00 ? 52  ILE A CG2  2  
ATOM 2530  C CD1  . ILE A 1 52  ? 6.244   -3.768  1.004   1.00 0.00 ? 52  ILE A CD1  2  
ATOM 2531  H H    . ILE A 1 52  ? 4.001   -6.440  -0.959  1.00 0.00 ? 52  ILE A H    2  
ATOM 2532  H HA   . ILE A 1 52  ? 4.041   -4.917  1.563   1.00 0.00 ? 52  ILE A HA   2  
ATOM 2533  H HB   . ILE A 1 52  ? 3.620   -3.867  -1.237  1.00 0.00 ? 52  ILE A HB   2  
ATOM 2534  H HG12 . ILE A 1 52  ? 5.929   -4.410  -0.981  1.00 0.00 ? 52  ILE A HG12 2  
ATOM 2535  H HG13 . ILE A 1 52  ? 5.796   -2.671  -0.745  1.00 0.00 ? 52  ILE A HG13 2  
ATOM 2536  H HG21 . ILE A 1 52  ? 2.388   -2.710  0.643   1.00 0.00 ? 52  ILE A HG21 2  
ATOM 2537  H HG22 . ILE A 1 52  ? 3.969   -2.270  1.285   1.00 0.00 ? 52  ILE A HG22 2  
ATOM 2538  H HG23 . ILE A 1 52  ? 3.475   -1.699  -0.308  1.00 0.00 ? 52  ILE A HG23 2  
ATOM 2539  H HD11 . ILE A 1 52  ? 6.661   -4.761  1.097   1.00 0.00 ? 52  ILE A HD11 2  
ATOM 2540  H HD12 . ILE A 1 52  ? 7.038   -3.038  1.069   1.00 0.00 ? 52  ILE A HD12 2  
ATOM 2541  H HD13 . ILE A 1 52  ? 5.534   -3.601  1.799   1.00 0.00 ? 52  ILE A HD13 2  
ATOM 2542  N N    . PHE A 1 53  ? 1.577   -4.740  1.810   1.00 0.00 ? 53  PHE A N    2  
ATOM 2543  C CA   . PHE A 1 53  ? 0.134   -4.776  2.023   1.00 0.00 ? 53  PHE A CA   2  
ATOM 2544  C C    . PHE A 1 53  ? -0.359  -3.464  2.626   1.00 0.00 ? 53  PHE A C    2  
ATOM 2545  O O    . PHE A 1 53  ? 0.306   -2.872  3.477   1.00 0.00 ? 53  PHE A O    2  
ATOM 2546  C CB   . PHE A 1 53  ? -0.239  -5.944  2.938   1.00 0.00 ? 53  PHE A CB   2  
ATOM 2547  C CG   . PHE A 1 53  ? 0.207   -7.280  2.417   1.00 0.00 ? 53  PHE A CG   2  
ATOM 2548  C CD1  . PHE A 1 53  ? 1.511   -7.711  2.602   1.00 0.00 ? 53  PHE A CD1  2  
ATOM 2549  C CD2  . PHE A 1 53  ? -0.678  -8.105  1.742   1.00 0.00 ? 53  PHE A CD2  2  
ATOM 2550  C CE1  . PHE A 1 53  ? 1.923   -8.940  2.122   1.00 0.00 ? 53  PHE A CE1  2  
ATOM 2551  C CE2  . PHE A 1 53  ? -0.271  -9.336  1.260   1.00 0.00 ? 53  PHE A CE2  2  
ATOM 2552  C CZ   . PHE A 1 53  ? 1.031   -9.754  1.452   1.00 0.00 ? 53  PHE A CZ   2  
ATOM 2553  H H    . PHE A 1 53  ? 2.160   -4.440  2.538   1.00 0.00 ? 53  PHE A H    2  
ATOM 2554  H HA   . PHE A 1 53  ? -0.338  -4.917  1.063   1.00 0.00 ? 53  PHE A HA   2  
ATOM 2555  H HB2  . PHE A 1 53  ? 0.220   -5.796  3.904   1.00 0.00 ? 53  PHE A HB2  2  
ATOM 2556  H HB3  . PHE A 1 53  ? -1.311  -5.972  3.054   1.00 0.00 ? 53  PHE A HB3  2  
ATOM 2557  H HD1  . PHE A 1 53  ? 2.209   -7.077  3.127   1.00 0.00 ? 53  PHE A HD1  2  
ATOM 2558  H HD2  . PHE A 1 53  ? -1.698  -7.779  1.591   1.00 0.00 ? 53  PHE A HD2  2  
ATOM 2559  H HE1  . PHE A 1 53  ? 2.942   -9.265  2.274   1.00 0.00 ? 53  PHE A HE1  2  
ATOM 2560  H HE2  . PHE A 1 53  ? -0.972  -9.969  0.736   1.00 0.00 ? 53  PHE A HE2  2  
ATOM 2561  H HZ   . PHE A 1 53  ? 1.351   -10.714 1.076   1.00 0.00 ? 53  PHE A HZ   2  
ATOM 2562  N N    . ILE A 1 54  ? -1.527  -3.017  2.180   1.00 0.00 ? 54  ILE A N    2  
ATOM 2563  C CA   . ILE A 1 54  ? -2.110  -1.776  2.675   1.00 0.00 ? 54  ILE A CA   2  
ATOM 2564  C C    . ILE A 1 54  ? -2.246  -1.801  4.194   1.00 0.00 ? 54  ILE A C    2  
ATOM 2565  O O    . ILE A 1 54  ? -2.625  -2.817  4.778   1.00 0.00 ? 54  ILE A O    2  
ATOM 2566  C CB   . ILE A 1 54  ? -3.494  -1.515  2.051   1.00 0.00 ? 54  ILE A CB   2  
ATOM 2567  C CG1  . ILE A 1 54  ? -3.386  -1.455  0.526   1.00 0.00 ? 54  ILE A CG1  2  
ATOM 2568  C CG2  . ILE A 1 54  ? -4.086  -0.224  2.597   1.00 0.00 ? 54  ILE A CG2  2  
ATOM 2569  C CD1  . ILE A 1 54  ? -4.591  -0.828  -0.140  1.00 0.00 ? 54  ILE A CD1  2  
ATOM 2570  H H    . ILE A 1 54  ? -2.009  -3.534  1.501   1.00 0.00 ? 54  ILE A H    2  
ATOM 2571  H HA   . ILE A 1 54  ? -1.453  -0.965  2.397   1.00 0.00 ? 54  ILE A HA   2  
ATOM 2572  H HB   . ILE A 1 54  ? -4.148  -2.328  2.327   1.00 0.00 ? 54  ILE A HB   2  
ATOM 2573  H HG12 . ILE A 1 54  ? -2.518  -0.875  0.255   1.00 0.00 ? 54  ILE A HG12 2  
ATOM 2574  H HG13 . ILE A 1 54  ? -3.278  -2.459  0.141   1.00 0.00 ? 54  ILE A HG13 2  
ATOM 2575  H HG21 . ILE A 1 54  ? -3.638  0.619   2.092   1.00 0.00 ? 54  ILE A HG21 2  
ATOM 2576  H HG22 . ILE A 1 54  ? -5.152  -0.219  2.429   1.00 0.00 ? 54  ILE A HG22 2  
ATOM 2577  H HG23 . ILE A 1 54  ? -3.887  -0.156  3.656   1.00 0.00 ? 54  ILE A HG23 2  
ATOM 2578  H HD11 . ILE A 1 54  ? -5.458  -1.451  0.025   1.00 0.00 ? 54  ILE A HD11 2  
ATOM 2579  H HD12 . ILE A 1 54  ? -4.767  0.151   0.281   1.00 0.00 ? 54  ILE A HD12 2  
ATOM 2580  H HD13 . ILE A 1 54  ? -4.410  -0.737  -1.201  1.00 0.00 ? 54  ILE A HD13 2  
ATOM 2581  N N    . LYS A 1 55  ? -1.937  -0.676  4.829   1.00 0.00 ? 55  LYS A N    2  
ATOM 2582  C CA   . LYS A 1 55  ? -2.027  -0.566  6.280   1.00 0.00 ? 55  LYS A CA   2  
ATOM 2583  C C    . LYS A 1 55  ? -3.343  0.083   6.696   1.00 0.00 ? 55  LYS A C    2  
ATOM 2584  O O    . LYS A 1 55  ? -4.033  -0.408  7.589   1.00 0.00 ? 55  LYS A O    2  
ATOM 2585  C CB   . LYS A 1 55  ? -0.851  0.247   6.825   1.00 0.00 ? 55  LYS A CB   2  
ATOM 2586  C CG   . LYS A 1 55  ? -1.100  0.826   8.207   1.00 0.00 ? 55  LYS A CG   2  
ATOM 2587  C CD   . LYS A 1 55  ? -1.504  -0.252  9.199   1.00 0.00 ? 55  LYS A CD   2  
ATOM 2588  C CE   . LYS A 1 55  ? -2.303  0.327   10.356  1.00 0.00 ? 55  LYS A CE   2  
ATOM 2589  N NZ   . LYS A 1 55  ? -1.422  0.787   11.464  1.00 0.00 ? 55  LYS A NZ   2  
ATOM 2590  H H    . LYS A 1 55  ? -1.641  0.100   4.308   1.00 0.00 ? 55  LYS A H    2  
ATOM 2591  H HA   . LYS A 1 55  ? -1.986  -1.563  6.692   1.00 0.00 ? 55  LYS A HA   2  
ATOM 2592  H HB2  . LYS A 1 55  ? 0.019   -0.391  6.876   1.00 0.00 ? 55  LYS A HB2  2  
ATOM 2593  H HB3  . LYS A 1 55  ? -0.648  1.063   6.147   1.00 0.00 ? 55  LYS A HB3  2  
ATOM 2594  H HG2  . LYS A 1 55  ? -0.195  1.301   8.557   1.00 0.00 ? 55  LYS A HG2  2  
ATOM 2595  H HG3  . LYS A 1 55  ? -1.892  1.559   8.143   1.00 0.00 ? 55  LYS A HG3  2  
ATOM 2596  H HD2  . LYS A 1 55  ? -2.109  -0.988  8.691   1.00 0.00 ? 55  LYS A HD2  2  
ATOM 2597  H HD3  . LYS A 1 55  ? -0.612  -0.723  9.588   1.00 0.00 ? 55  LYS A HD3  2  
ATOM 2598  H HE2  . LYS A 1 55  ? -2.880  1.165   9.994   1.00 0.00 ? 55  LYS A HE2  2  
ATOM 2599  H HE3  . LYS A 1 55  ? -2.971  -0.434  10.731  1.00 0.00 ? 55  LYS A HE3  2  
ATOM 2600  H HZ1  . LYS A 1 55  ? -1.310  1.820   11.426  1.00 0.00 ? 55  LYS A HZ1  2  
ATOM 2601  H HZ2  . LYS A 1 55  ? -0.484  0.344   11.382  1.00 0.00 ? 55  LYS A HZ2  2  
ATOM 2602  H HZ3  . LYS A 1 55  ? -1.836  0.527   12.382  1.00 0.00 ? 55  LYS A HZ3  2  
ATOM 2603  N N    . GLN A 1 56  ? -3.686  1.188   6.041   1.00 0.00 ? 56  GLN A N    2  
ATOM 2604  C CA   . GLN A 1 56  ? -4.920  1.903   6.343   1.00 0.00 ? 56  GLN A CA   2  
ATOM 2605  C C    . GLN A 1 56  ? -5.193  2.982   5.300   1.00 0.00 ? 56  GLN A C    2  
ATOM 2606  O O    . GLN A 1 56  ? -4.267  3.541   4.713   1.00 0.00 ? 56  GLN A O    2  
ATOM 2607  C CB   . GLN A 1 56  ? -4.842  2.531   7.735   1.00 0.00 ? 56  GLN A CB   2  
ATOM 2608  C CG   . GLN A 1 56  ? -5.374  3.955   7.791   1.00 0.00 ? 56  GLN A CG   2  
ATOM 2609  C CD   . GLN A 1 56  ? -5.652  4.419   9.207   1.00 0.00 ? 56  GLN A CD   2  
ATOM 2610  O OE1  . GLN A 1 56  ? -5.705  3.614   10.138  1.00 0.00 ? 56  GLN A OE1  2  
ATOM 2611  N NE2  . GLN A 1 56  ? -5.830  5.723   9.379   1.00 0.00 ? 56  GLN A NE2  2  
ATOM 2612  H H    . GLN A 1 56  ? -3.094  1.530   5.339   1.00 0.00 ? 56  GLN A H    2  
ATOM 2613  H HA   . GLN A 1 56  ? -5.729  1.189   6.324   1.00 0.00 ? 56  GLN A HA   2  
ATOM 2614  H HB2  . GLN A 1 56  ? -5.417  1.928   8.422   1.00 0.00 ? 56  GLN A HB2  2  
ATOM 2615  H HB3  . GLN A 1 56  ? -3.811  2.543   8.055   1.00 0.00 ? 56  GLN A HB3  2  
ATOM 2616  H HG2  . GLN A 1 56  ? -4.644  4.616   7.349   1.00 0.00 ? 56  GLN A HG2  2  
ATOM 2617  H HG3  . GLN A 1 56  ? -6.292  4.004   7.225   1.00 0.00 ? 56  GLN A HG3  2  
ATOM 2618  H HE21 . GLN A 1 56  ? -5.775  6.305   8.591   1.00 0.00 ? 56  GLN A HE21 2  
ATOM 2619  H HE22 . GLN A 1 56  ? -6.012  6.051   10.283  1.00 0.00 ? 56  GLN A HE22 2  
ATOM 2620  N N    . VAL A 1 57  ? -6.471  3.269   5.074   1.00 0.00 ? 57  VAL A N    2  
ATOM 2621  C CA   . VAL A 1 57  ? -6.866  4.282   4.102   1.00 0.00 ? 57  VAL A CA   2  
ATOM 2622  C C    . VAL A 1 57  ? -7.851  5.274   4.711   1.00 0.00 ? 57  VAL A C    2  
ATOM 2623  O O    . VAL A 1 57  ? -8.887  4.884   5.253   1.00 0.00 ? 57  VAL A O    2  
ATOM 2624  C CB   . VAL A 1 57  ? -7.504  3.643   2.854   1.00 0.00 ? 57  VAL A CB   2  
ATOM 2625  C CG1  . VAL A 1 57  ? -8.389  4.648   2.132   1.00 0.00 ? 57  VAL A CG1  2  
ATOM 2626  C CG2  . VAL A 1 57  ? -6.429  3.103   1.924   1.00 0.00 ? 57  VAL A CG2  2  
ATOM 2627  H H    . VAL A 1 57  ? -7.164  2.790   5.573   1.00 0.00 ? 57  VAL A H    2  
ATOM 2628  H HA   . VAL A 1 57  ? -5.978  4.814   3.794   1.00 0.00 ? 57  VAL A HA   2  
ATOM 2629  H HB   . VAL A 1 57  ? -8.123  2.817   3.173   1.00 0.00 ? 57  VAL A HB   2  
ATOM 2630  H HG11 . VAL A 1 57  ? -7.805  5.519   1.872   1.00 0.00 ? 57  VAL A HG11 2  
ATOM 2631  H HG12 . VAL A 1 57  ? -8.787  4.199   1.234   1.00 0.00 ? 57  VAL A HG12 2  
ATOM 2632  H HG13 . VAL A 1 57  ? -9.202  4.942   2.780   1.00 0.00 ? 57  VAL A HG13 2  
ATOM 2633  H HG21 . VAL A 1 57  ? -5.710  2.535   2.495   1.00 0.00 ? 57  VAL A HG21 2  
ATOM 2634  H HG22 . VAL A 1 57  ? -6.884  2.465   1.181   1.00 0.00 ? 57  VAL A HG22 2  
ATOM 2635  H HG23 . VAL A 1 57  ? -5.929  3.926   1.434   1.00 0.00 ? 57  VAL A HG23 2  
ATOM 2636  N N    . LEU A 1 58  ? -7.522  6.557   4.619   1.00 0.00 ? 58  LEU A N    2  
ATOM 2637  C CA   . LEU A 1 58  ? -8.378  7.607   5.161   1.00 0.00 ? 58  LEU A CA   2  
ATOM 2638  C C    . LEU A 1 58  ? -9.664  7.734   4.350   1.00 0.00 ? 58  LEU A C    2  
ATOM 2639  O O    . LEU A 1 58  ? -9.826  7.080   3.321   1.00 0.00 ? 58  LEU A O    2  
ATOM 2640  C CB   . LEU A 1 58  ? -7.634  8.944   5.172   1.00 0.00 ? 58  LEU A CB   2  
ATOM 2641  C CG   . LEU A 1 58  ? -6.377  9.005   6.040   1.00 0.00 ? 58  LEU A CG   2  
ATOM 2642  C CD1  . LEU A 1 58  ? -5.295  8.097   5.476   1.00 0.00 ? 58  LEU A CD1  2  
ATOM 2643  C CD2  . LEU A 1 58  ? -5.872  10.436  6.147   1.00 0.00 ? 58  LEU A CD2  2  
ATOM 2644  H H    . LEU A 1 58  ? -6.685  6.806   4.177   1.00 0.00 ? 58  LEU A H    2  
ATOM 2645  H HA   . LEU A 1 58  ? -8.632  7.337   6.175   1.00 0.00 ? 58  LEU A HA   2  
ATOM 2646  H HB2  . LEU A 1 58  ? -7.347  9.171   4.157   1.00 0.00 ? 58  LEU A HB2  2  
ATOM 2647  H HB3  . LEU A 1 58  ? -8.320  9.700   5.528   1.00 0.00 ? 58  LEU A HB3  2  
ATOM 2648  H HG   . LEU A 1 58  ? -6.617  8.658   7.036   1.00 0.00 ? 58  LEU A HG   2  
ATOM 2649  H HD11 . LEU A 1 58  ? -4.350  8.332   5.941   1.00 0.00 ? 58  LEU A HD11 2  
ATOM 2650  H HD12 . LEU A 1 58  ? -5.218  8.248   4.409   1.00 0.00 ? 58  LEU A HD12 2  
ATOM 2651  H HD13 . LEU A 1 58  ? -5.550  7.067   5.675   1.00 0.00 ? 58  LEU A HD13 2  
ATOM 2652  H HD21 . LEU A 1 58  ? -5.317  10.690  5.256   1.00 0.00 ? 58  LEU A HD21 2  
ATOM 2653  H HD22 . LEU A 1 58  ? -5.229  10.527  7.010   1.00 0.00 ? 58  LEU A HD22 2  
ATOM 2654  H HD23 . LEU A 1 58  ? -6.713  11.107  6.252   1.00 0.00 ? 58  LEU A HD23 2  
ATOM 2655  N N    . GLU A 1 59  ? -10.573 8.582   4.821   1.00 0.00 ? 59  GLU A N    2  
ATOM 2656  C CA   . GLU A 1 59  ? -11.843 8.796   4.138   1.00 0.00 ? 59  GLU A CA   2  
ATOM 2657  C C    . GLU A 1 59  ? -11.804 10.073  3.302   1.00 0.00 ? 59  GLU A C    2  
ATOM 2658  O O    . GLU A 1 59  ? -12.263 10.094  2.160   1.00 0.00 ? 59  GLU A O    2  
ATOM 2659  C CB   . GLU A 1 59  ? -12.987 8.872   5.152   1.00 0.00 ? 59  GLU A CB   2  
ATOM 2660  C CG   . GLU A 1 59  ? -14.359 8.999   4.513   1.00 0.00 ? 59  GLU A CG   2  
ATOM 2661  C CD   . GLU A 1 59  ? -15.477 8.556   5.438   1.00 0.00 ? 59  GLU A CD   2  
ATOM 2662  O OE1  . GLU A 1 59  ? -15.868 9.351   6.318   1.00 0.00 ? 59  GLU A OE1  2  
ATOM 2663  O OE2  . GLU A 1 59  ? -15.959 7.415   5.282   1.00 0.00 ? 59  GLU A OE2  2  
ATOM 2664  H H    . GLU A 1 59  ? -10.385 9.076   5.646   1.00 0.00 ? 59  GLU A H    2  
ATOM 2665  H HA   . GLU A 1 59  ? -12.012 7.956   3.481   1.00 0.00 ? 59  GLU A HA   2  
ATOM 2666  H HB2  . GLU A 1 59  ? -12.975 7.977   5.757   1.00 0.00 ? 59  GLU A HB2  2  
ATOM 2667  H HB3  . GLU A 1 59  ? -12.829 9.729   5.790   1.00 0.00 ? 59  GLU A HB3  2  
ATOM 2668  H HG2  . GLU A 1 59  ? -14.523 10.032  4.245   1.00 0.00 ? 59  GLU A HG2  2  
ATOM 2669  H HG3  . GLU A 1 59  ? -14.386 8.389   3.622   1.00 0.00 ? 59  GLU A HG3  2  
ATOM 2670  N N    . ASP A 1 60  ? -11.254 11.134  3.881   1.00 0.00 ? 60  ASP A N    2  
ATOM 2671  C CA   . ASP A 1 60  ? -11.154 12.415  3.191   1.00 0.00 ? 60  ASP A CA   2  
ATOM 2672  C C    . ASP A 1 60  ? -9.936  12.444  2.273   1.00 0.00 ? 60  ASP A C    2  
ATOM 2673  O O    . ASP A 1 60  ? -9.253  13.462  2.163   1.00 0.00 ? 60  ASP A O    2  
ATOM 2674  C CB   . ASP A 1 60  ? -11.072 13.559  4.203   1.00 0.00 ? 60  ASP A CB   2  
ATOM 2675  C CG   . ASP A 1 60  ? -11.013 14.919  3.537   1.00 0.00 ? 60  ASP A CG   2  
ATOM 2676  O OD1  . ASP A 1 60  ? -12.080 15.431  3.137   1.00 0.00 ? 60  ASP A OD1  2  
ATOM 2677  O OD2  . ASP A 1 60  ? -9.901  15.472  3.415   1.00 0.00 ? 60  ASP A OD2  2  
ATOM 2678  H H    . ASP A 1 60  ? -10.906 11.054  4.794   1.00 0.00 ? 60  ASP A H    2  
ATOM 2679  H HA   . ASP A 1 60  ? -12.043 12.540  2.592   1.00 0.00 ? 60  ASP A HA   2  
ATOM 2680  H HB2  . ASP A 1 60  ? -11.943 13.529  4.842   1.00 0.00 ? 60  ASP A HB2  2  
ATOM 2681  H HB3  . ASP A 1 60  ? -10.185 13.434  4.806   1.00 0.00 ? 60  ASP A HB3  2  
ATOM 2682  N N    . SER A 1 61  ? -9.670  11.320  1.615   1.00 0.00 ? 61  SER A N    2  
ATOM 2683  C CA   . SER A 1 61  ? -8.532  11.215  0.710   1.00 0.00 ? 61  SER A CA   2  
ATOM 2684  C C    . SER A 1 61  ? -8.970  10.689  -0.654  1.00 0.00 ? 61  SER A C    2  
ATOM 2685  O O    . SER A 1 61  ? -10.090 10.211  -0.834  1.00 0.00 ? 61  SER A O    2  
ATOM 2686  C CB   . SER A 1 61  ? -7.464  10.295  1.304   1.00 0.00 ? 61  SER A CB   2  
ATOM 2687  O OG   . SER A 1 61  ? -7.333  9.107   0.544   1.00 0.00 ? 61  SER A OG   2  
ATOM 2688  H H    . SER A 1 61  ? -10.253 10.542  1.744   1.00 0.00 ? 61  SER A H    2  
ATOM 2689  H HA   . SER A 1 61  ? -8.115  12.203  0.585   1.00 0.00 ? 61  SER A HA   2  
ATOM 2690  H HB2  . SER A 1 61  ? -6.514  10.809  1.312   1.00 0.00 ? 61  SER A HB2  2  
ATOM 2691  H HB3  . SER A 1 61  ? -7.740  10.034  2.315   1.00 0.00 ? 61  SER A HB3  2  
ATOM 2692  H HG   . SER A 1 61  ? -7.757  8.381   1.009   1.00 0.00 ? 61  SER A HG   2  
ATOM 2693  N N    . PRO A 1 62  ? -8.065  10.780  -1.640  1.00 0.00 ? 62  PRO A N    2  
ATOM 2694  C CA   . PRO A 1 62  ? -8.333  10.319  -3.006  1.00 0.00 ? 62  PRO A CA   2  
ATOM 2695  C C    . PRO A 1 62  ? -8.424  8.800   -3.097  1.00 0.00 ? 62  PRO A C    2  
ATOM 2696  O O    . PRO A 1 62  ? -9.032  8.260   -4.021  1.00 0.00 ? 62  PRO A O    2  
ATOM 2697  C CB   . PRO A 1 62  ? -7.126  10.831  -3.796  1.00 0.00 ? 62  PRO A CB   2  
ATOM 2698  C CG   . PRO A 1 62  ? -6.037  10.956  -2.787  1.00 0.00 ? 62  PRO A CG   2  
ATOM 2699  C CD   . PRO A 1 62  ? -6.710  11.340  -1.498  1.00 0.00 ? 62  PRO A CD   2  
ATOM 2700  H HA   . PRO A 1 62  ? -9.237  10.758  -3.402  1.00 0.00 ? 62  PRO A HA   2  
ATOM 2701  H HB2  . PRO A 1 62  ? -6.870  10.118  -4.568  1.00 0.00 ? 62  PRO A HB2  2  
ATOM 2702  H HB3  . PRO A 1 62  ? -7.362  11.785  -4.243  1.00 0.00 ? 62  PRO A HB3  2  
ATOM 2703  H HG2  . PRO A 1 62  ? -5.528  10.011  -2.677  1.00 0.00 ? 62  PRO A HG2  2  
ATOM 2704  H HG3  . PRO A 1 62  ? -5.343  11.725  -3.090  1.00 0.00 ? 62  PRO A HG3  2  
ATOM 2705  H HD2  . PRO A 1 62  ? -6.196  10.897  -0.658  1.00 0.00 ? 62  PRO A HD2  2  
ATOM 2706  H HD3  . PRO A 1 62  ? -6.746  12.414  -1.397  1.00 0.00 ? 62  PRO A HD3  2  
ATOM 2707  N N    . ALA A 1 63  ? -7.818  8.116   -2.132  1.00 0.00 ? 63  ALA A N    2  
ATOM 2708  C CA   . ALA A 1 63  ? -7.833  6.659   -2.103  1.00 0.00 ? 63  ALA A CA   2  
ATOM 2709  C C    . ALA A 1 63  ? -9.054  6.138   -1.351  1.00 0.00 ? 63  ALA A C    2  
ATOM 2710  O O    . ALA A 1 63  ? -9.553  5.051   -1.637  1.00 0.00 ? 63  ALA A O    2  
ATOM 2711  C CB   . ALA A 1 63  ? -6.555  6.130   -1.469  1.00 0.00 ? 63  ALA A CB   2  
ATOM 2712  H H    . ALA A 1 63  ? -7.350  8.603   -1.423  1.00 0.00 ? 63  ALA A H    2  
ATOM 2713  H HA   . ALA A 1 63  ? -7.874  6.305   -3.123  1.00 0.00 ? 63  ALA A HA   2  
ATOM 2714  H HB1  . ALA A 1 63  ? -6.528  5.054   -1.559  1.00 0.00 ? 63  ALA A HB1  2  
ATOM 2715  H HB2  . ALA A 1 63  ? -5.701  6.556   -1.975  1.00 0.00 ? 63  ALA A HB2  2  
ATOM 2716  H HB3  . ALA A 1 63  ? -6.530  6.405   -0.426  1.00 0.00 ? 63  ALA A HB3  2  
ATOM 2717  N N    . GLY A 1 64  ? -9.528  6.921   -0.387  1.00 0.00 ? 64  GLY A N    2  
ATOM 2718  C CA   . GLY A 1 64  ? -10.686 6.521   0.391   1.00 0.00 ? 64  GLY A CA   2  
ATOM 2719  C C    . GLY A 1 64  ? -11.976 6.609   -0.401  1.00 0.00 ? 64  GLY A C    2  
ATOM 2720  O O    . GLY A 1 64  ? -12.928 5.875   -0.134  1.00 0.00 ? 64  GLY A O    2  
ATOM 2721  H H    . GLY A 1 64  ? -9.089  7.778   -0.204  1.00 0.00 ? 64  GLY A H    2  
ATOM 2722  H HA2  . GLY A 1 64  ? -10.548 5.503   0.724   1.00 0.00 ? 64  GLY A HA2  2  
ATOM 2723  H HA3  . GLY A 1 64  ? -10.764 7.164   1.256   1.00 0.00 ? 64  GLY A HA3  2  
ATOM 2724  N N    . LYS A 1 65  ? -12.009 7.509   -1.377  1.00 0.00 ? 65  LYS A N    2  
ATOM 2725  C CA   . LYS A 1 65  ? -13.191 7.692   -2.211  1.00 0.00 ? 65  LYS A CA   2  
ATOM 2726  C C    . LYS A 1 65  ? -13.302 6.579   -3.248  1.00 0.00 ? 65  LYS A C    2  
ATOM 2727  O O    . LYS A 1 65  ? -14.393 6.075   -3.519  1.00 0.00 ? 65  LYS A O    2  
ATOM 2728  C CB   . LYS A 1 65  ? -13.142 9.052   -2.910  1.00 0.00 ? 65  LYS A CB   2  
ATOM 2729  C CG   . LYS A 1 65  ? -13.105 10.229  -1.950  1.00 0.00 ? 65  LYS A CG   2  
ATOM 2730  C CD   . LYS A 1 65  ? -13.803 11.446  -2.532  1.00 0.00 ? 65  LYS A CD   2  
ATOM 2731  C CE   . LYS A 1 65  ? -13.453 12.710  -1.763  1.00 0.00 ? 65  LYS A CE   2  
ATOM 2732  N NZ   . LYS A 1 65  ? -14.165 13.902  -2.302  1.00 0.00 ? 65  LYS A NZ   2  
ATOM 2733  H H    . LYS A 1 65  ? -11.218 8.065   -1.541  1.00 0.00 ? 65  LYS A H    2  
ATOM 2734  H HA   . LYS A 1 65  ? -14.058 7.657   -1.569  1.00 0.00 ? 65  LYS A HA   2  
ATOM 2735  H HB2  . LYS A 1 65  ? -12.260 9.092   -3.531  1.00 0.00 ? 65  LYS A HB2  2  
ATOM 2736  H HB3  . LYS A 1 65  ? -14.017 9.153   -3.536  1.00 0.00 ? 65  LYS A HB3  2  
ATOM 2737  H HG2  . LYS A 1 65  ? -13.599 9.948   -1.032  1.00 0.00 ? 65  LYS A HG2  2  
ATOM 2738  H HG3  . LYS A 1 65  ? -12.074 10.480  -1.744  1.00 0.00 ? 65  LYS A HG3  2  
ATOM 2739  H HD2  . LYS A 1 65  ? -13.498 11.568  -3.561  1.00 0.00 ? 65  LYS A HD2  2  
ATOM 2740  H HD3  . LYS A 1 65  ? -14.872 11.292  -2.488  1.00 0.00 ? 65  LYS A HD3  2  
ATOM 2741  H HE2  . LYS A 1 65  ? -13.729 12.575  -0.729  1.00 0.00 ? 65  LYS A HE2  2  
ATOM 2742  H HE3  . LYS A 1 65  ? -12.388 12.875  -1.833  1.00 0.00 ? 65  LYS A HE3  2  
ATOM 2743  H HZ1  . LYS A 1 65  ? -13.704 14.774  -1.970  1.00 0.00 ? 65  LYS A HZ1  2  
ATOM 2744  H HZ2  . LYS A 1 65  ? -15.154 13.902  -1.983  1.00 0.00 ? 65  LYS A HZ2  2  
ATOM 2745  H HZ3  . LYS A 1 65  ? -14.148 13.888  -3.342  1.00 0.00 ? 65  LYS A HZ3  2  
ATOM 2746  N N    . THR A 1 66  ? -12.167 6.198   -3.825  1.00 0.00 ? 66  THR A N    2  
ATOM 2747  C CA   . THR A 1 66  ? -12.137 5.144   -4.831  1.00 0.00 ? 66  THR A CA   2  
ATOM 2748  C C    . THR A 1 66  ? -12.739 3.852   -4.293  1.00 0.00 ? 66  THR A C    2  
ATOM 2749  O O    . THR A 1 66  ? -13.152 2.982   -5.058  1.00 0.00 ? 66  THR A O    2  
ATOM 2750  C CB   . THR A 1 66  ? -10.700 4.866   -5.311  1.00 0.00 ? 66  THR A CB   2  
ATOM 2751  O OG1  . THR A 1 66  ? -9.998  4.092   -4.332  1.00 0.00 ? 66  THR A OG1  2  
ATOM 2752  C CG2  . THR A 1 66  ? -9.954  6.167   -5.567  1.00 0.00 ? 66  THR A CG2  2  
ATOM 2753  H H    . THR A 1 66  ? -11.330 6.637   -3.566  1.00 0.00 ? 66  THR A H    2  
ATOM 2754  H HA   . THR A 1 66  ? -12.719 5.476   -5.679  1.00 0.00 ? 66  THR A HA   2  
ATOM 2755  H HB   . THR A 1 66  ? -10.747 4.308   -6.235  1.00 0.00 ? 66  THR A HB   2  
ATOM 2756  H HG1  . THR A 1 66  ? -9.719  4.663   -3.612  1.00 0.00 ? 66  THR A HG1  2  
ATOM 2757  H HG21 . THR A 1 66  ? -10.584 7.002   -5.300  1.00 0.00 ? 66  THR A HG21 2  
ATOM 2758  H HG22 . THR A 1 66  ? -9.694  6.233   -6.613  1.00 0.00 ? 66  THR A HG22 2  
ATOM 2759  H HG23 . THR A 1 66  ? -9.054  6.189   -4.970  1.00 0.00 ? 66  THR A HG23 2  
ATOM 2760  N N    . ASN A 1 67  ? -12.787 3.733   -2.970  1.00 0.00 ? 67  ASN A N    2  
ATOM 2761  C CA   . ASN A 1 67  ? -13.340 2.545   -2.328  1.00 0.00 ? 67  ASN A CA   2  
ATOM 2762  C C    . ASN A 1 67  ? -12.909 1.280   -3.063  1.00 0.00 ? 67  ASN A C    2  
ATOM 2763  O O    . ASN A 1 67  ? -13.586 0.254   -3.003  1.00 0.00 ? 67  ASN A O    2  
ATOM 2764  C CB   . ASN A 1 67  ? -14.867 2.628   -2.284  1.00 0.00 ? 67  ASN A CB   2  
ATOM 2765  C CG   . ASN A 1 67  ? -15.463 1.754   -1.198  1.00 0.00 ? 67  ASN A CG   2  
ATOM 2766  O OD1  . ASN A 1 67  ? -15.752 0.578   -1.421  1.00 0.00 ? 67  ASN A OD1  2  
ATOM 2767  N ND2  . ASN A 1 67  ? -15.648 2.326   -0.014  1.00 0.00 ? 67  ASN A ND2  2  
ATOM 2768  H H    . ASN A 1 67  ? -12.442 4.461   -2.411  1.00 0.00 ? 67  ASN A H    2  
ATOM 2769  H HA   . ASN A 1 67  ? -12.961 2.508   -1.318  1.00 0.00 ? 67  ASN A HA   2  
ATOM 2770  H HB2  . ASN A 1 67  ? -15.161 3.651   -2.097  1.00 0.00 ? 67  ASN A HB2  2  
ATOM 2771  H HB3  . ASN A 1 67  ? -15.267 2.312   -3.236  1.00 0.00 ? 67  ASN A HB3  2  
ATOM 2772  H HD21 . ASN A 1 67  ? -15.395 3.267   0.091   1.00 0.00 ? 67  ASN A HD21 2  
ATOM 2773  H HD22 . ASN A 1 67  ? -16.031 1.783   0.707   1.00 0.00 ? 67  ASN A HD22 2  
ATOM 2774  N N    . ALA A 1 68  ? -11.779 1.361   -3.757  1.00 0.00 ? 68  ALA A N    2  
ATOM 2775  C CA   . ALA A 1 68  ? -11.256 0.222   -4.502  1.00 0.00 ? 68  ALA A CA   2  
ATOM 2776  C C    . ALA A 1 68  ? -10.018 -0.355  -3.825  1.00 0.00 ? 68  ALA A C    2  
ATOM 2777  O O    . ALA A 1 68  ? -9.427  -1.322  -4.308  1.00 0.00 ? 68  ALA A O    2  
ATOM 2778  C CB   . ALA A 1 68  ? -10.936 0.629   -5.933  1.00 0.00 ? 68  ALA A CB   2  
ATOM 2779  H H    . ALA A 1 68  ? -11.284 2.206   -3.768  1.00 0.00 ? 68  ALA A H    2  
ATOM 2780  H HA   . ALA A 1 68  ? -12.024 -0.538  -4.533  1.00 0.00 ? 68  ALA A HA   2  
ATOM 2781  H HB1  . ALA A 1 68  ? -11.590 1.434   -6.232  1.00 0.00 ? 68  ALA A HB1  2  
ATOM 2782  H HB2  . ALA A 1 68  ? -9.909  0.958   -5.991  1.00 0.00 ? 68  ALA A HB2  2  
ATOM 2783  H HB3  . ALA A 1 68  ? -11.082 -0.217  -6.588  1.00 0.00 ? 68  ALA A HB3  2  
ATOM 2784  N N    . LEU A 1 69  ? -9.629  0.243   -2.704  1.00 0.00 ? 69  LEU A N    2  
ATOM 2785  C CA   . LEU A 1 69  ? -8.460  -0.211  -1.960  1.00 0.00 ? 69  LEU A CA   2  
ATOM 2786  C C    . LEU A 1 69  ? -8.678  -0.062  -0.458  1.00 0.00 ? 69  LEU A C    2  
ATOM 2787  O O    . LEU A 1 69  ? -9.184  0.959   0.009   1.00 0.00 ? 69  LEU A O    2  
ATOM 2788  C CB   . LEU A 1 69  ? -7.221  0.577   -2.388  1.00 0.00 ? 69  LEU A CB   2  
ATOM 2789  C CG   . LEU A 1 69  ? -6.979  0.682   -3.894  1.00 0.00 ? 69  LEU A CG   2  
ATOM 2790  C CD1  . LEU A 1 69  ? -6.240  1.968   -4.228  1.00 0.00 ? 69  LEU A CD1  2  
ATOM 2791  C CD2  . LEU A 1 69  ? -6.202  -0.527  -4.395  1.00 0.00 ? 69  LEU A CD2  2  
ATOM 2792  H H    . LEU A 1 69  ? -10.140 1.008   -2.368  1.00 0.00 ? 69  LEU A H    2  
ATOM 2793  H HA   . LEU A 1 69  ? -8.308  -1.256  -2.187  1.00 0.00 ? 69  LEU A HA   2  
ATOM 2794  H HB2  . LEU A 1 69  ? -7.315  1.579   -1.998  1.00 0.00 ? 69  LEU A HB2  2  
ATOM 2795  H HB3  . LEU A 1 69  ? -6.357  0.100   -1.945  1.00 0.00 ? 69  LEU A HB3  2  
ATOM 2796  H HG   . LEU A 1 69  ? -7.932  0.703   -4.404  1.00 0.00 ? 69  LEU A HG   2  
ATOM 2797  H HD11 . LEU A 1 69  ? -6.925  2.801   -4.176  1.00 0.00 ? 69  LEU A HD11 2  
ATOM 2798  H HD12 . LEU A 1 69  ? -5.831  1.900   -5.225  1.00 0.00 ? 69  LEU A HD12 2  
ATOM 2799  H HD13 . LEU A 1 69  ? -5.438  2.117   -3.520  1.00 0.00 ? 69  LEU A HD13 2  
ATOM 2800  H HD21 . LEU A 1 69  ? -5.163  -0.261  -4.519  1.00 0.00 ? 69  LEU A HD21 2  
ATOM 2801  H HD22 . LEU A 1 69  ? -6.608  -0.848  -5.343  1.00 0.00 ? 69  LEU A HD22 2  
ATOM 2802  H HD23 . LEU A 1 69  ? -6.284  -1.331  -3.677  1.00 0.00 ? 69  LEU A HD23 2  
ATOM 2803  N N    . LYS A 1 70  ? -8.291  -1.085  0.296   1.00 0.00 ? 70  LYS A N    2  
ATOM 2804  C CA   . LYS A 1 70  ? -8.440  -1.067  1.747   1.00 0.00 ? 70  LYS A CA   2  
ATOM 2805  C C    . LYS A 1 70  ? -7.324  -1.861  2.418   1.00 0.00 ? 70  LYS A C    2  
ATOM 2806  O O    . LYS A 1 70  ? -6.725  -2.748  1.809   1.00 0.00 ? 70  LYS A O    2  
ATOM 2807  C CB   . LYS A 1 70  ? -9.801  -1.641  2.147   1.00 0.00 ? 70  LYS A CB   2  
ATOM 2808  C CG   . LYS A 1 70  ? -10.920 -1.280  1.185   1.00 0.00 ? 70  LYS A CG   2  
ATOM 2809  C CD   . LYS A 1 70  ? -11.440 0.125   1.438   1.00 0.00 ? 70  LYS A CD   2  
ATOM 2810  C CE   . LYS A 1 70  ? -12.158 0.681   0.218   1.00 0.00 ? 70  LYS A CE   2  
ATOM 2811  N NZ   . LYS A 1 70  ? -13.320 -0.164  -0.175  1.00 0.00 ? 70  LYS A NZ   2  
ATOM 2812  H H    . LYS A 1 70  ? -7.893  -1.872  -0.134  1.00 0.00 ? 70  LYS A H    2  
ATOM 2813  H HA   . LYS A 1 70  ? -8.382  -0.040  2.073   1.00 0.00 ? 70  LYS A HA   2  
ATOM 2814  H HB2  . LYS A 1 70  ? -9.725  -2.718  2.190   1.00 0.00 ? 70  LYS A HB2  2  
ATOM 2815  H HB3  . LYS A 1 70  ? -10.062 -1.268  3.127   1.00 0.00 ? 70  LYS A HB3  2  
ATOM 2816  H HG2  . LYS A 1 70  ? -10.546 -1.338  0.174   1.00 0.00 ? 70  LYS A HG2  2  
ATOM 2817  H HG3  . LYS A 1 70  ? -11.732 -1.983  1.312   1.00 0.00 ? 70  LYS A HG3  2  
ATOM 2818  H HD2  . LYS A 1 70  ? -12.131 0.100   2.268   1.00 0.00 ? 70  LYS A HD2  2  
ATOM 2819  H HD3  . LYS A 1 70  ? -10.607 0.770   1.680   1.00 0.00 ? 70  LYS A HD3  2  
ATOM 2820  H HE2  . LYS A 1 70  ? -12.508 1.676   0.445   1.00 0.00 ? 70  LYS A HE2  2  
ATOM 2821  H HE3  . LYS A 1 70  ? -11.460 0.724   -0.606  1.00 0.00 ? 70  LYS A HE3  2  
ATOM 2822  H HZ1  . LYS A 1 70  ? -13.244 -1.103  0.265   1.00 0.00 ? 70  LYS A HZ1  2  
ATOM 2823  H HZ2  . LYS A 1 70  ? -13.345 -0.277  -1.209  1.00 0.00 ? 70  LYS A HZ2  2  
ATOM 2824  H HZ3  . LYS A 1 70  ? -14.207 0.282   0.135   1.00 0.00 ? 70  LYS A HZ3  2  
ATOM 2825  N N    . THR A 1 71  ? -7.050  -1.538  3.678   1.00 0.00 ? 71  THR A N    2  
ATOM 2826  C CA   . THR A 1 71  ? -6.007  -2.220  4.433   1.00 0.00 ? 71  THR A CA   2  
ATOM 2827  C C    . THR A 1 71  ? -6.096  -3.731  4.252   1.00 0.00 ? 71  THR A C    2  
ATOM 2828  O O    . THR A 1 71  ? -7.184  -4.305  4.274   1.00 0.00 ? 71  THR A O    2  
ATOM 2829  C CB   . THR A 1 71  ? -6.091  -1.889  5.935   1.00 0.00 ? 71  THR A CB   2  
ATOM 2830  O OG1  . THR A 1 71  ? -4.971  -2.454  6.625   1.00 0.00 ? 71  THR A OG1  2  
ATOM 2831  C CG2  . THR A 1 71  ? -7.384  -2.421  6.535   1.00 0.00 ? 71  THR A CG2  2  
ATOM 2832  H H    . THR A 1 71  ? -7.562  -0.822  4.110   1.00 0.00 ? 71  THR A H    2  
ATOM 2833  H HA   . THR A 1 71  ? -5.050  -1.879  4.063   1.00 0.00 ? 71  THR A HA   2  
ATOM 2834  H HB   . THR A 1 71  ? -6.072  -0.815  6.052   1.00 0.00 ? 71  THR A HB   2  
ATOM 2835  H HG1  . THR A 1 71  ? -5.270  -2.861  7.442   1.00 0.00 ? 71  THR A HG1  2  
ATOM 2836  H HG21 . THR A 1 71  ? -7.488  -2.056  7.545   1.00 0.00 ? 71  THR A HG21 2  
ATOM 2837  H HG22 . THR A 1 71  ? -7.359  -3.501  6.542   1.00 0.00 ? 71  THR A HG22 2  
ATOM 2838  H HG23 . THR A 1 71  ? -8.221  -2.084  5.942   1.00 0.00 ? 71  THR A HG23 2  
ATOM 2839  N N    . GLY A 1 72  ? -4.945  -4.371  4.073   1.00 0.00 ? 72  GLY A N    2  
ATOM 2840  C CA   . GLY A 1 72  ? -4.916  -5.811  3.891   1.00 0.00 ? 72  GLY A CA   2  
ATOM 2841  C C    . GLY A 1 72  ? -4.585  -6.209  2.467   1.00 0.00 ? 72  GLY A C    2  
ATOM 2842  O O    . GLY A 1 72  ? -3.945  -7.234  2.234   1.00 0.00 ? 72  GLY A O    2  
ATOM 2843  H H    . GLY A 1 72  ? -4.107  -3.861  4.065   1.00 0.00 ? 72  GLY A H    2  
ATOM 2844  H HA2  . GLY A 1 72  ? -4.174  -6.231  4.553   1.00 0.00 ? 72  GLY A HA2  2  
ATOM 2845  H HA3  . GLY A 1 72  ? -5.884  -6.214  4.150   1.00 0.00 ? 72  GLY A HA3  2  
ATOM 2846  N N    . ASP A 1 73  ? -5.024  -5.397  1.511   1.00 0.00 ? 73  ASP A N    2  
ATOM 2847  C CA   . ASP A 1 73  ? -4.771  -5.671  0.101   1.00 0.00 ? 73  ASP A CA   2  
ATOM 2848  C C    . ASP A 1 73  ? -3.275  -5.794  -0.169  1.00 0.00 ? 73  ASP A C    2  
ATOM 2849  O O    . ASP A 1 73  ? -2.460  -5.135  0.476   1.00 0.00 ? 73  ASP A O    2  
ATOM 2850  C CB   . ASP A 1 73  ? -5.369  -4.564  -0.770  1.00 0.00 ? 73  ASP A CB   2  
ATOM 2851  C CG   . ASP A 1 73  ? -6.804  -4.852  -1.167  1.00 0.00 ? 73  ASP A CG   2  
ATOM 2852  O OD1  . ASP A 1 73  ? -7.624  -5.130  -0.267  1.00 0.00 ? 73  ASP A OD1  2  
ATOM 2853  O OD2  . ASP A 1 73  ? -7.107  -4.800  -2.377  1.00 0.00 ? 73  ASP A OD2  2  
ATOM 2854  H H    . ASP A 1 73  ? -5.529  -4.595  1.759   1.00 0.00 ? 73  ASP A H    2  
ATOM 2855  H HA   . ASP A 1 73  ? -5.247  -6.607  -0.146  1.00 0.00 ? 73  ASP A HA   2  
ATOM 2856  H HB2  . ASP A 1 73  ? -5.346  -3.633  -0.224  1.00 0.00 ? 73  ASP A HB2  2  
ATOM 2857  H HB3  . ASP A 1 73  ? -4.779  -4.465  -1.669  1.00 0.00 ? 73  ASP A HB3  2  
ATOM 2858  N N    . LYS A 1 74  ? -2.920  -6.645  -1.126  1.00 0.00 ? 74  LYS A N    2  
ATOM 2859  C CA   . LYS A 1 74  ? -1.522  -6.857  -1.483  1.00 0.00 ? 74  LYS A CA   2  
ATOM 2860  C C    . LYS A 1 74  ? -1.127  -5.989  -2.674  1.00 0.00 ? 74  LYS A C    2  
ATOM 2861  O O    . LYS A 1 74  ? -1.628  -6.175  -3.783  1.00 0.00 ? 74  LYS A O    2  
ATOM 2862  C CB   . LYS A 1 74  ? -1.275  -8.331  -1.809  1.00 0.00 ? 74  LYS A CB   2  
ATOM 2863  C CG   . LYS A 1 74  ? 0.190   -8.671  -2.020  1.00 0.00 ? 74  LYS A CG   2  
ATOM 2864  C CD   . LYS A 1 74  ? 0.375   -10.126 -2.415  1.00 0.00 ? 74  LYS A CD   2  
ATOM 2865  C CE   . LYS A 1 74  ? 1.732   -10.361 -3.059  1.00 0.00 ? 74  LYS A CE   2  
ATOM 2866  N NZ   . LYS A 1 74  ? 2.848   -10.128 -2.101  1.00 0.00 ? 74  LYS A NZ   2  
ATOM 2867  H H    . LYS A 1 74  ? -3.616  -7.143  -1.606  1.00 0.00 ? 74  LYS A H    2  
ATOM 2868  H HA   . LYS A 1 74  ? -0.917  -6.578  -0.633  1.00 0.00 ? 74  LYS A HA   2  
ATOM 2869  H HB2  . LYS A 1 74  ? -1.650  -8.935  -0.996  1.00 0.00 ? 74  LYS A HB2  2  
ATOM 2870  H HB3  . LYS A 1 74  ? -1.814  -8.583  -2.711  1.00 0.00 ? 74  LYS A HB3  2  
ATOM 2871  H HG2  . LYS A 1 74  ? 0.587   -8.043  -2.804  1.00 0.00 ? 74  LYS A HG2  2  
ATOM 2872  H HG3  . LYS A 1 74  ? 0.729   -8.485  -1.101  1.00 0.00 ? 74  LYS A HG3  2  
ATOM 2873  H HD2  . LYS A 1 74  ? 0.296   -10.743 -1.532  1.00 0.00 ? 74  LYS A HD2  2  
ATOM 2874  H HD3  . LYS A 1 74  ? -0.400  -10.400 -3.118  1.00 0.00 ? 74  LYS A HD3  2  
ATOM 2875  H HE2  . LYS A 1 74  ? 1.778   -11.380 -3.410  1.00 0.00 ? 74  LYS A HE2  2  
ATOM 2876  H HE3  . LYS A 1 74  ? 1.841   -9.687  -3.895  1.00 0.00 ? 74  LYS A HE3  2  
ATOM 2877  H HZ1  . LYS A 1 74  ? 2.553   -9.456  -1.364  1.00 0.00 ? 74  LYS A HZ1  2  
ATOM 2878  H HZ2  . LYS A 1 74  ? 3.673   -9.738  -2.601  1.00 0.00 ? 74  LYS A HZ2  2  
ATOM 2879  H HZ3  . LYS A 1 74  ? 3.124   -11.023 -1.648  1.00 0.00 ? 74  LYS A HZ3  2  
ATOM 2880  N N    . ILE A 1 75  ? -0.225  -5.042  -2.436  1.00 0.00 ? 75  ILE A N    2  
ATOM 2881  C CA   . ILE A 1 75  ? 0.238   -4.148  -3.490  1.00 0.00 ? 75  ILE A CA   2  
ATOM 2882  C C    . ILE A 1 75  ? 1.368   -4.784  -4.293  1.00 0.00 ? 75  ILE A C    2  
ATOM 2883  O O    . ILE A 1 75  ? 2.422   -5.113  -3.749  1.00 0.00 ? 75  ILE A O    2  
ATOM 2884  C CB   . ILE A 1 75  ? 0.725   -2.805  -2.915  1.00 0.00 ? 75  ILE A CB   2  
ATOM 2885  C CG1  . ILE A 1 75  ? -0.208  -2.335  -1.798  1.00 0.00 ? 75  ILE A CG1  2  
ATOM 2886  C CG2  . ILE A 1 75  ? 0.812   -1.758  -4.016  1.00 0.00 ? 75  ILE A CG2  2  
ATOM 2887  C CD1  . ILE A 1 75  ? 0.358   -1.199  -0.975  1.00 0.00 ? 75  ILE A CD1  2  
ATOM 2888  H H    . ILE A 1 75  ? 0.137   -4.943  -1.532  1.00 0.00 ? 75  ILE A H    2  
ATOM 2889  H HA   . ILE A 1 75  ? -0.594  -3.953  -4.151  1.00 0.00 ? 75  ILE A HA   2  
ATOM 2890  H HB   . ILE A 1 75  ? 1.715   -2.950  -2.510  1.00 0.00 ? 75  ILE A HB   2  
ATOM 2891  H HG12 . ILE A 1 75  ? -1.137  -1.999  -2.231  1.00 0.00 ? 75  ILE A HG12 2  
ATOM 2892  H HG13 . ILE A 1 75  ? -0.405  -3.163  -1.132  1.00 0.00 ? 75  ILE A HG13 2  
ATOM 2893  H HG21 . ILE A 1 75  ? -0.171  -1.357  -4.209  1.00 0.00 ? 75  ILE A HG21 2  
ATOM 2894  H HG22 . ILE A 1 75  ? 1.470   -0.961  -3.702  1.00 0.00 ? 75  ILE A HG22 2  
ATOM 2895  H HG23 . ILE A 1 75  ? 1.199   -2.212  -4.915  1.00 0.00 ? 75  ILE A HG23 2  
ATOM 2896  H HD11 . ILE A 1 75  ? 0.508   -0.336  -1.608  1.00 0.00 ? 75  ILE A HD11 2  
ATOM 2897  H HD12 . ILE A 1 75  ? -0.333  -0.948  -0.184  1.00 0.00 ? 75  ILE A HD12 2  
ATOM 2898  H HD13 . ILE A 1 75  ? 1.303   -1.500  -0.547  1.00 0.00 ? 75  ILE A HD13 2  
ATOM 2899  N N    . LEU A 1 76  ? 1.141   -4.953  -5.591  1.00 0.00 ? 76  LEU A N    2  
ATOM 2900  C CA   . LEU A 1 76  ? 2.140   -5.548  -6.472  1.00 0.00 ? 76  LEU A CA   2  
ATOM 2901  C C    . LEU A 1 76  ? 2.865   -4.475  -7.277  1.00 0.00 ? 76  LEU A C    2  
ATOM 2902  O O    . LEU A 1 76  ? 4.011   -4.659  -7.684  1.00 0.00 ? 76  LEU A O    2  
ATOM 2903  C CB   . LEU A 1 76  ? 1.482   -6.554  -7.418  1.00 0.00 ? 76  LEU A CB   2  
ATOM 2904  C CG   . LEU A 1 76  ? 0.244   -7.272  -6.878  1.00 0.00 ? 76  LEU A CG   2  
ATOM 2905  C CD1  . LEU A 1 76  ? -0.690  -7.654  -8.015  1.00 0.00 ? 76  LEU A CD1  2  
ATOM 2906  C CD2  . LEU A 1 76  ? 0.649   -8.504  -6.081  1.00 0.00 ? 76  LEU A CD2  2  
ATOM 2907  H H    . LEU A 1 76  ? 0.281   -4.671  -5.968  1.00 0.00 ? 76  LEU A H    2  
ATOM 2908  H HA   . LEU A 1 76  ? 2.860   -6.065  -5.854  1.00 0.00 ? 76  LEU A HA   2  
ATOM 2909  H HB2  . LEU A 1 76  ? 1.192   -6.025  -8.313  1.00 0.00 ? 76  LEU A HB2  2  
ATOM 2910  H HB3  . LEU A 1 76  ? 2.219   -7.304  -7.667  1.00 0.00 ? 76  LEU A HB3  2  
ATOM 2911  H HG   . LEU A 1 76  ? -0.291  -6.605  -6.216  1.00 0.00 ? 76  LEU A HG   2  
ATOM 2912  H HD11 . LEU A 1 76  ? -1.714  -7.535  -7.696  1.00 0.00 ? 76  LEU A HD11 2  
ATOM 2913  H HD12 . LEU A 1 76  ? -0.517  -8.684  -8.293  1.00 0.00 ? 76  LEU A HD12 2  
ATOM 2914  H HD13 . LEU A 1 76  ? -0.501  -7.016  -8.866  1.00 0.00 ? 76  LEU A HD13 2  
ATOM 2915  H HD21 . LEU A 1 76  ? 1.268   -9.142  -6.693  1.00 0.00 ? 76  LEU A HD21 2  
ATOM 2916  H HD22 . LEU A 1 76  ? -0.237  -9.043  -5.779  1.00 0.00 ? 76  LEU A HD22 2  
ATOM 2917  H HD23 . LEU A 1 76  ? 1.201   -8.199  -5.203  1.00 0.00 ? 76  LEU A HD23 2  
ATOM 2918  N N    . GLU A 1 77  ? 2.189   -3.352  -7.501  1.00 0.00 ? 77  GLU A N    2  
ATOM 2919  C CA   . GLU A 1 77  ? 2.770   -2.248  -8.256  1.00 0.00 ? 77  GLU A CA   2  
ATOM 2920  C C    . GLU A 1 77  ? 1.963   -0.969  -8.058  1.00 0.00 ? 77  GLU A C    2  
ATOM 2921  O O    . GLU A 1 77  ? 0.756   -1.014  -7.816  1.00 0.00 ? 77  GLU A O    2  
ATOM 2922  C CB   . GLU A 1 77  ? 2.835   -2.598  -9.744  1.00 0.00 ? 77  GLU A CB   2  
ATOM 2923  C CG   . GLU A 1 77  ? 4.005   -1.956  -10.470 1.00 0.00 ? 77  GLU A CG   2  
ATOM 2924  C CD   . GLU A 1 77  ? 3.843   -1.983  -11.977 1.00 0.00 ? 77  GLU A CD   2  
ATOM 2925  O OE1  . GLU A 1 77  ? 2.762   -2.394  -12.449 1.00 0.00 ? 77  GLU A OE1  2  
ATOM 2926  O OE2  . GLU A 1 77  ? 4.795   -1.593  -12.684 1.00 0.00 ? 77  GLU A OE2  2  
ATOM 2927  H H    . GLU A 1 77  ? 1.278   -3.265  -7.150  1.00 0.00 ? 77  GLU A H    2  
ATOM 2928  H HA   . GLU A 1 77  ? 3.772   -2.087  -7.890  1.00 0.00 ? 77  GLU A HA   2  
ATOM 2929  H HB2  . GLU A 1 77  ? 2.918   -3.670  -9.846  1.00 0.00 ? 77  GLU A HB2  2  
ATOM 2930  H HB3  . GLU A 1 77  ? 1.922   -2.270  -10.218 1.00 0.00 ? 77  GLU A HB3  2  
ATOM 2931  H HG2  . GLU A 1 77  ? 4.091   -0.928  -10.150 1.00 0.00 ? 77  GLU A HG2  2  
ATOM 2932  H HG3  . GLU A 1 77  ? 4.909   -2.489  -10.210 1.00 0.00 ? 77  GLU A HG3  2  
ATOM 2933  N N    . VAL A 1 78  ? 2.637   0.172   -8.161  1.00 0.00 ? 78  VAL A N    2  
ATOM 2934  C CA   . VAL A 1 78  ? 1.984   1.465   -7.994  1.00 0.00 ? 78  VAL A CA   2  
ATOM 2935  C C    . VAL A 1 78  ? 2.574   2.505   -8.939  1.00 0.00 ? 78  VAL A C    2  
ATOM 2936  O O    . VAL A 1 78  ? 3.785   2.725   -8.958  1.00 0.00 ? 78  VAL A O    2  
ATOM 2937  C CB   . VAL A 1 78  ? 2.109   1.973   -6.546  1.00 0.00 ? 78  VAL A CB   2  
ATOM 2938  C CG1  . VAL A 1 78  ? 3.255   2.965   -6.425  1.00 0.00 ? 78  VAL A CG1  2  
ATOM 2939  C CG2  . VAL A 1 78  ? 0.800   2.600   -6.087  1.00 0.00 ? 78  VAL A CG2  2  
ATOM 2940  H H    . VAL A 1 78  ? 3.597   0.143   -8.356  1.00 0.00 ? 78  VAL A H    2  
ATOM 2941  H HA   . VAL A 1 78  ? 0.935   1.340   -8.221  1.00 0.00 ? 78  VAL A HA   2  
ATOM 2942  H HB   . VAL A 1 78  ? 2.323   1.129   -5.906  1.00 0.00 ? 78  VAL A HB   2  
ATOM 2943  H HG11 . VAL A 1 78  ? 4.174   2.493   -6.740  1.00 0.00 ? 78  VAL A HG11 2  
ATOM 2944  H HG12 . VAL A 1 78  ? 3.057   3.823   -7.051  1.00 0.00 ? 78  VAL A HG12 2  
ATOM 2945  H HG13 . VAL A 1 78  ? 3.349   3.283   -5.397  1.00 0.00 ? 78  VAL A HG13 2  
ATOM 2946  H HG21 . VAL A 1 78  ? 0.911   2.969   -5.079  1.00 0.00 ? 78  VAL A HG21 2  
ATOM 2947  H HG22 . VAL A 1 78  ? 0.544   3.418   -6.744  1.00 0.00 ? 78  VAL A HG22 2  
ATOM 2948  H HG23 . VAL A 1 78  ? 0.016   1.857   -6.114  1.00 0.00 ? 78  VAL A HG23 2  
ATOM 2949  N N    . SER A 1 79  ? 1.711   3.142   -9.723  1.00 0.00 ? 79  SER A N    2  
ATOM 2950  C CA   . SER A 1 79  ? 2.147   4.158   -10.674 1.00 0.00 ? 79  SER A CA   2  
ATOM 2951  C C    . SER A 1 79  ? 3.135   3.573   -11.678 1.00 0.00 ? 79  SER A C    2  
ATOM 2952  O O    . SER A 1 79  ? 3.868   4.305   -12.343 1.00 0.00 ? 79  SER A O    2  
ATOM 2953  C CB   . SER A 1 79  ? 2.788   5.335   -9.937  1.00 0.00 ? 79  SER A CB   2  
ATOM 2954  O OG   . SER A 1 79  ? 2.614   6.544   -10.657 1.00 0.00 ? 79  SER A OG   2  
ATOM 2955  H H    . SER A 1 79  ? 0.757   2.922   -9.662  1.00 0.00 ? 79  SER A H    2  
ATOM 2956  H HA   . SER A 1 79  ? 1.276   4.509   -11.207 1.00 0.00 ? 79  SER A HA   2  
ATOM 2957  H HB2  . SER A 1 79  ? 2.330   5.441   -8.965  1.00 0.00 ? 79  SER A HB2  2  
ATOM 2958  H HB3  . SER A 1 79  ? 3.846   5.149   -9.818  1.00 0.00 ? 79  SER A HB3  2  
ATOM 2959  H HG   . SER A 1 79  ? 2.379   6.344   -11.566 1.00 0.00 ? 79  SER A HG   2  
ATOM 2960  N N    . GLY A 1 80  ? 3.150   2.248   -11.782 1.00 0.00 ? 80  GLY A N    2  
ATOM 2961  C CA   . GLY A 1 80  ? 4.051   1.586   -12.707 1.00 0.00 ? 80  GLY A CA   2  
ATOM 2962  C C    . GLY A 1 80  ? 5.387   1.249   -12.073 1.00 0.00 ? 80  GLY A C    2  
ATOM 2963  O O    . GLY A 1 80  ? 6.422   1.273   -12.739 1.00 0.00 ? 80  GLY A O    2  
ATOM 2964  H H    . GLY A 1 80  ? 2.543   1.715   -11.226 1.00 0.00 ? 80  GLY A H    2  
ATOM 2965  H HA2  . GLY A 1 80  ? 3.589   0.674   -13.053 1.00 0.00 ? 80  GLY A HA2  2  
ATOM 2966  H HA3  . GLY A 1 80  ? 4.221   2.235   -13.553 1.00 0.00 ? 80  GLY A HA3  2  
ATOM 2967  N N    . VAL A 1 81  ? 5.365   0.935   -10.781 1.00 0.00 ? 81  VAL A N    2  
ATOM 2968  C CA   . VAL A 1 81  ? 6.583   0.593   -10.057 1.00 0.00 ? 81  VAL A CA   2  
ATOM 2969  C C    . VAL A 1 81  ? 6.414   -0.709  -9.282  1.00 0.00 ? 81  VAL A C    2  
ATOM 2970  O O    . VAL A 1 81  ? 5.509   -0.840  -8.458  1.00 0.00 ? 81  VAL A O    2  
ATOM 2971  C CB   . VAL A 1 81  ? 6.988   1.711   -9.079  1.00 0.00 ? 81  VAL A CB   2  
ATOM 2972  C CG1  . VAL A 1 81  ? 6.228   1.575   -7.768  1.00 0.00 ? 81  VAL A CG1  2  
ATOM 2973  C CG2  . VAL A 1 81  ? 8.490   1.691   -8.838  1.00 0.00 ? 81  VAL A CG2  2  
ATOM 2974  H H    . VAL A 1 81  ? 4.509   0.934   -10.304 1.00 0.00 ? 81  VAL A H    2  
ATOM 2975  H HA   . VAL A 1 81  ? 7.377   0.470   -10.779 1.00 0.00 ? 81  VAL A HA   2  
ATOM 2976  H HB   . VAL A 1 81  ? 6.728   2.661   -9.522  1.00 0.00 ? 81  VAL A HB   2  
ATOM 2977  H HG11 . VAL A 1 81  ? 6.240   2.520   -7.245  1.00 0.00 ? 81  VAL A HG11 2  
ATOM 2978  H HG12 . VAL A 1 81  ? 5.206   1.288   -7.972  1.00 0.00 ? 81  VAL A HG12 2  
ATOM 2979  H HG13 . VAL A 1 81  ? 6.699   0.819   -7.156  1.00 0.00 ? 81  VAL A HG13 2  
ATOM 2980  H HG21 . VAL A 1 81  ? 8.751   0.813   -8.267  1.00 0.00 ? 81  VAL A HG21 2  
ATOM 2981  H HG22 . VAL A 1 81  ? 9.005   1.670   -9.787  1.00 0.00 ? 81  VAL A HG22 2  
ATOM 2982  H HG23 . VAL A 1 81  ? 8.779   2.576   -8.291  1.00 0.00 ? 81  VAL A HG23 2  
ATOM 2983  N N    . ASP A 1 82  ? 7.291   -1.670  -9.552  1.00 0.00 ? 82  ASP A N    2  
ATOM 2984  C CA   . ASP A 1 82  ? 7.240   -2.963  -8.879  1.00 0.00 ? 82  ASP A CA   2  
ATOM 2985  C C    . ASP A 1 82  ? 7.556   -2.815  -7.394  1.00 0.00 ? 82  ASP A C    2  
ATOM 2986  O O    . ASP A 1 82  ? 8.691   -2.522  -7.016  1.00 0.00 ? 82  ASP A O    2  
ATOM 2987  C CB   . ASP A 1 82  ? 8.223   -3.938  -9.527  1.00 0.00 ? 82  ASP A CB   2  
ATOM 2988  C CG   . ASP A 1 82  ? 8.253   -5.282  -8.826  1.00 0.00 ? 82  ASP A CG   2  
ATOM 2989  O OD1  . ASP A 1 82  ? 7.193   -5.937  -8.754  1.00 0.00 ? 82  ASP A OD1  2  
ATOM 2990  O OD2  . ASP A 1 82  ? 9.337   -5.677  -8.347  1.00 0.00 ? 82  ASP A OD2  2  
ATOM 2991  H H    . ASP A 1 82  ? 7.989   -1.506  -10.220 1.00 0.00 ? 82  ASP A H    2  
ATOM 2992  H HA   . ASP A 1 82  ? 6.238   -3.352  -8.984  1.00 0.00 ? 82  ASP A HA   2  
ATOM 2993  H HB2  . ASP A 1 82  ? 7.936   -4.098  -10.557 1.00 0.00 ? 82  ASP A HB2  2  
ATOM 2994  H HB3  . ASP A 1 82  ? 9.215   -3.513  -9.496  1.00 0.00 ? 82  ASP A HB3  2  
ATOM 2995  N N    . LEU A 1 83  ? 6.545   -3.017  -6.556  1.00 0.00 ? 83  LEU A N    2  
ATOM 2996  C CA   . LEU A 1 83  ? 6.714   -2.905  -5.111  1.00 0.00 ? 83  LEU A CA   2  
ATOM 2997  C C    . LEU A 1 83  ? 6.560   -4.265  -4.438  1.00 0.00 ? 83  LEU A C    2  
ATOM 2998  O O    . LEU A 1 83  ? 6.723   -4.389  -3.225  1.00 0.00 ? 83  LEU A O    2  
ATOM 2999  C CB   . LEU A 1 83  ? 5.697   -1.919  -4.534  1.00 0.00 ? 83  LEU A CB   2  
ATOM 3000  C CG   . LEU A 1 83  ? 5.838   -0.466  -4.988  1.00 0.00 ? 83  LEU A CG   2  
ATOM 3001  C CD1  . LEU A 1 83  ? 4.919   0.437   -4.181  1.00 0.00 ? 83  LEU A CD1  2  
ATOM 3002  C CD2  . LEU A 1 83  ? 7.284   -0.007  -4.865  1.00 0.00 ? 83  LEU A CD2  2  
ATOM 3003  H H    . LEU A 1 83  ? 5.664   -3.248  -6.916  1.00 0.00 ? 83  LEU A H    2  
ATOM 3004  H HA   . LEU A 1 83  ? 7.711   -2.535  -4.923  1.00 0.00 ? 83  LEU A HA   2  
ATOM 3005  H HB2  . LEU A 1 83  ? 4.712   -2.259  -4.814  1.00 0.00 ? 83  LEU A HB2  2  
ATOM 3006  H HB3  . LEU A 1 83  ? 5.792   -1.941  -3.457  1.00 0.00 ? 83  LEU A HB3  2  
ATOM 3007  H HG   . LEU A 1 83  ? 5.550   -0.391  -6.028  1.00 0.00 ? 83  LEU A HG   2  
ATOM 3008  H HD11 . LEU A 1 83  ? 4.451   -0.136  -3.395  1.00 0.00 ? 83  LEU A HD11 2  
ATOM 3009  H HD12 . LEU A 1 83  ? 4.159   0.848   -4.829  1.00 0.00 ? 83  LEU A HD12 2  
ATOM 3010  H HD13 . LEU A 1 83  ? 5.495   1.241   -3.747  1.00 0.00 ? 83  LEU A HD13 2  
ATOM 3011  H HD21 . LEU A 1 83  ? 7.327   1.069   -4.943  1.00 0.00 ? 83  LEU A HD21 2  
ATOM 3012  H HD22 . LEU A 1 83  ? 7.871   -0.450  -5.656  1.00 0.00 ? 83  LEU A HD22 2  
ATOM 3013  H HD23 . LEU A 1 83  ? 7.679   -0.315  -3.907  1.00 0.00 ? 83  LEU A HD23 2  
ATOM 3014  N N    . GLN A 1 84  ? 6.247   -5.282  -5.235  1.00 0.00 ? 84  GLN A N    2  
ATOM 3015  C CA   . GLN A 1 84  ? 6.073   -6.633  -4.715  1.00 0.00 ? 84  GLN A CA   2  
ATOM 3016  C C    . GLN A 1 84  ? 7.153   -6.967  -3.691  1.00 0.00 ? 84  GLN A C    2  
ATOM 3017  O O    . GLN A 1 84  ? 6.878   -7.073  -2.497  1.00 0.00 ? 84  GLN A O    2  
ATOM 3018  C CB   . GLN A 1 84  ? 6.106   -7.650  -5.858  1.00 0.00 ? 84  GLN A CB   2  
ATOM 3019  C CG   . GLN A 1 84  ? 4.787   -7.769  -6.604  1.00 0.00 ? 84  GLN A CG   2  
ATOM 3020  C CD   . GLN A 1 84  ? 4.862   -8.733  -7.772  1.00 0.00 ? 84  GLN A CD   2  
ATOM 3021  O OE1  . GLN A 1 84  ? 5.216   -9.901  -7.607  1.00 0.00 ? 84  GLN A OE1  2  
ATOM 3022  N NE2  . GLN A 1 84  ? 4.529   -8.248  -8.963  1.00 0.00 ? 84  GLN A NE2  2  
ATOM 3023  H H    . GLN A 1 84  ? 6.130   -5.120  -6.194  1.00 0.00 ? 84  GLN A H    2  
ATOM 3024  H HA   . GLN A 1 84  ? 5.109   -6.681  -4.232  1.00 0.00 ? 84  GLN A HA   2  
ATOM 3025  H HB2  . GLN A 1 84  ? 6.869   -7.356  -6.563  1.00 0.00 ? 84  GLN A HB2  2  
ATOM 3026  H HB3  . GLN A 1 84  ? 6.355   -8.620  -5.454  1.00 0.00 ? 84  GLN A HB3  2  
ATOM 3027  H HG2  . GLN A 1 84  ? 4.030   -8.119  -5.918  1.00 0.00 ? 84  GLN A HG2  2  
ATOM 3028  H HG3  . GLN A 1 84  ? 4.510   -6.795  -6.978  1.00 0.00 ? 84  GLN A HG3  2  
ATOM 3029  H HE21 . GLN A 1 84  ? 4.258   -7.307  -9.019  1.00 0.00 ? 84  GLN A HE21 2  
ATOM 3030  H HE22 . GLN A 1 84  ? 4.570   -8.848  -9.735  1.00 0.00 ? 84  GLN A HE22 2  
ATOM 3031  N N    . ASN A 1 85  ? 8.383   -7.130  -4.168  1.00 0.00 ? 85  ASN A N    2  
ATOM 3032  C CA   . ASN A 1 85  ? 9.505   -7.452  -3.293  1.00 0.00 ? 85  ASN A CA   2  
ATOM 3033  C C    . ASN A 1 85  ? 10.191  -6.183  -2.799  1.00 0.00 ? 85  ASN A C    2  
ATOM 3034  O O    . ASN A 1 85  ? 11.409  -6.151  -2.625  1.00 0.00 ? 85  ASN A O    2  
ATOM 3035  C CB   . ASN A 1 85  ? 10.513  -8.338  -4.028  1.00 0.00 ? 85  ASN A CB   2  
ATOM 3036  C CG   . ASN A 1 85  ? 9.842   -9.438  -4.828  1.00 0.00 ? 85  ASN A CG   2  
ATOM 3037  O OD1  . ASN A 1 85  ? 8.944   -10.120 -4.334  1.00 0.00 ? 85  ASN A OD1  2  
ATOM 3038  N ND2  . ASN A 1 85  ? 10.277  -9.615  -6.070  1.00 0.00 ? 85  ASN A ND2  2  
ATOM 3039  H H    . ASN A 1 85  ? 8.540   -7.033  -5.130  1.00 0.00 ? 85  ASN A H    2  
ATOM 3040  H HA   . ASN A 1 85  ? 9.117   -7.993  -2.443  1.00 0.00 ? 85  ASN A HA   2  
ATOM 3041  H HB2  . ASN A 1 85  ? 11.091  -7.727  -4.707  1.00 0.00 ? 85  ASN A HB2  2  
ATOM 3042  H HB3  . ASN A 1 85  ? 11.176  -8.794  -3.308  1.00 0.00 ? 85  ASN A HB3  2  
ATOM 3043  H HD21 . ASN A 1 85  ? 10.995  -9.035  -6.397  1.00 0.00 ? 85  ASN A HD21 2  
ATOM 3044  H HD22 . ASN A 1 85  ? 9.860   -10.319 -6.609  1.00 0.00 ? 85  ASN A HD22 2  
ATOM 3045  N N    . ALA A 1 86  ? 9.400   -5.139  -2.574  1.00 0.00 ? 86  ALA A N    2  
ATOM 3046  C CA   . ALA A 1 86  ? 9.931   -3.868  -2.097  1.00 0.00 ? 86  ALA A CA   2  
ATOM 3047  C C    . ALA A 1 86  ? 9.676   -3.692  -0.603  1.00 0.00 ? 86  ALA A C    2  
ATOM 3048  O O    . ALA A 1 86  ? 8.618   -4.064  -0.096  1.00 0.00 ? 86  ALA A O    2  
ATOM 3049  C CB   . ALA A 1 86  ? 9.319   -2.714  -2.877  1.00 0.00 ? 86  ALA A CB   2  
ATOM 3050  H H    . ALA A 1 86  ? 8.437   -5.226  -2.731  1.00 0.00 ? 86  ALA A H    2  
ATOM 3051  H HA   . ALA A 1 86  ? 10.997  -3.864  -2.273  1.00 0.00 ? 86  ALA A HA   2  
ATOM 3052  H HB1  . ALA A 1 86  ? 9.701   -2.720  -3.887  1.00 0.00 ? 86  ALA A HB1  2  
ATOM 3053  H HB2  . ALA A 1 86  ? 8.244   -2.824  -2.898  1.00 0.00 ? 86  ALA A HB2  2  
ATOM 3054  H HB3  . ALA A 1 86  ? 9.576   -1.780  -2.400  1.00 0.00 ? 86  ALA A HB3  2  
ATOM 3055  N N    . SER A 1 87  ? 10.653  -3.123  0.096   1.00 0.00 ? 87  SER A N    2  
ATOM 3056  C CA   . SER A 1 87  ? 10.536  -2.903  1.533   1.00 0.00 ? 87  SER A CA   2  
ATOM 3057  C C    . SER A 1 87  ? 9.547   -1.780  1.831   1.00 0.00 ? 87  SER A C    2  
ATOM 3058  O O    . SER A 1 87  ? 9.034   -1.130  0.920   1.00 0.00 ? 87  SER A O    2  
ATOM 3059  C CB   . SER A 1 87  ? 11.903  -2.566  2.131   1.00 0.00 ? 87  SER A CB   2  
ATOM 3060  O OG   . SER A 1 87  ? 12.424  -1.372  1.573   1.00 0.00 ? 87  SER A OG   2  
ATOM 3061  H H    . SER A 1 87  ? 11.473  -2.848  -0.365  1.00 0.00 ? 87  SER A H    2  
ATOM 3062  H HA   . SER A 1 87  ? 10.172  -3.816  1.980   1.00 0.00 ? 87  SER A HA   2  
ATOM 3063  H HB2  . SER A 1 87  ? 11.804  -2.437  3.198   1.00 0.00 ? 87  SER A HB2  2  
ATOM 3064  H HB3  . SER A 1 87  ? 12.591  -3.375  1.928   1.00 0.00 ? 87  SER A HB3  2  
ATOM 3065  H HG   . SER A 1 87  ? 12.965  -0.923  2.226   1.00 0.00 ? 87  SER A HG   2  
ATOM 3066  N N    . HIS A 1 88  ? 9.284   -1.558  3.115   1.00 0.00 ? 88  HIS A N    2  
ATOM 3067  C CA   . HIS A 1 88  ? 8.357   -0.514  3.536   1.00 0.00 ? 88  HIS A CA   2  
ATOM 3068  C C    . HIS A 1 88  ? 8.719   0.824   2.898   1.00 0.00 ? 88  HIS A C    2  
ATOM 3069  O O    . HIS A 1 88  ? 7.846   1.562   2.442   1.00 0.00 ? 88  HIS A O    2  
ATOM 3070  C CB   . HIS A 1 88  ? 8.360   -0.383  5.059   1.00 0.00 ? 88  HIS A CB   2  
ATOM 3071  C CG   . HIS A 1 88  ? 7.030   0.004   5.630   1.00 0.00 ? 88  HIS A CG   2  
ATOM 3072  N ND1  . HIS A 1 88  ? 6.890   0.886   6.681   1.00 0.00 ? 88  HIS A ND1  2  
ATOM 3073  C CD2  . HIS A 1 88  ? 5.776   -0.375  5.289   1.00 0.00 ? 88  HIS A CD2  2  
ATOM 3074  C CE1  . HIS A 1 88  ? 5.608   1.031   6.963   1.00 0.00 ? 88  HIS A CE1  2  
ATOM 3075  N NE2  . HIS A 1 88  ? 4.911   0.276   6.133   1.00 0.00 ? 88  HIS A NE2  2  
ATOM 3076  H H    . HIS A 1 88  ? 9.724   -2.109  3.795   1.00 0.00 ? 88  HIS A H    2  
ATOM 3077  H HA   . HIS A 1 88  ? 7.367   -0.798  3.210   1.00 0.00 ? 88  HIS A HA   2  
ATOM 3078  H HB2  . HIS A 1 88  ? 8.645   -1.329  5.495   1.00 0.00 ? 88  HIS A HB2  2  
ATOM 3079  H HB3  . HIS A 1 88  ? 9.078   0.371   5.348   1.00 0.00 ? 88  HIS A HB3  2  
ATOM 3080  H HD1  . HIS A 1 88  ? 7.622   1.337   7.151   1.00 0.00 ? 88  HIS A HD1  2  
ATOM 3081  H HD2  . HIS A 1 88  ? 5.506   -1.064  4.501   1.00 0.00 ? 88  HIS A HD2  2  
ATOM 3082  H HE1  . HIS A 1 88  ? 5.198   1.659   7.739   1.00 0.00 ? 88  HIS A HE1  2  
ATOM 3083  N N    . SER A 1 89  ? 10.012  1.129   2.869   1.00 0.00 ? 89  SER A N    2  
ATOM 3084  C CA   . SER A 1 89  ? 10.490  2.380   2.291   1.00 0.00 ? 89  SER A CA   2  
ATOM 3085  C C    . SER A 1 89  ? 10.413  2.338   0.768   1.00 0.00 ? 89  SER A C    2  
ATOM 3086  O O    . SER A 1 89  ? 9.900   3.261   0.136   1.00 0.00 ? 89  SER A O    2  
ATOM 3087  C CB   . SER A 1 89  ? 11.928  2.655   2.734   1.00 0.00 ? 89  SER A CB   2  
ATOM 3088  O OG   . SER A 1 89  ? 11.983  2.990   4.109   1.00 0.00 ? 89  SER A OG   2  
ATOM 3089  H H    . SER A 1 89  ? 10.660  0.499   3.248   1.00 0.00 ? 89  SER A H    2  
ATOM 3090  H HA   . SER A 1 89  ? 9.853   3.175   2.650   1.00 0.00 ? 89  SER A HA   2  
ATOM 3091  H HB2  . SER A 1 89  ? 12.528  1.773   2.566   1.00 0.00 ? 89  SER A HB2  2  
ATOM 3092  H HB3  . SER A 1 89  ? 12.328  3.477   2.158   1.00 0.00 ? 89  SER A HB3  2  
ATOM 3093  H HG   . SER A 1 89  ? 11.621  2.269   4.630   1.00 0.00 ? 89  SER A HG   2  
ATOM 3094  N N    . GLU A 1 90  ? 10.929  1.260   0.185   1.00 0.00 ? 90  GLU A N    2  
ATOM 3095  C CA   . GLU A 1 90  ? 10.920  1.098   -1.264  1.00 0.00 ? 90  GLU A CA   2  
ATOM 3096  C C    . GLU A 1 90  ? 9.519   1.319   -1.828  1.00 0.00 ? 90  GLU A C    2  
ATOM 3097  O O    . GLU A 1 90  ? 9.359   1.812   -2.944  1.00 0.00 ? 90  GLU A O    2  
ATOM 3098  C CB   . GLU A 1 90  ? 11.422  -0.296  -1.647  1.00 0.00 ? 90  GLU A CB   2  
ATOM 3099  C CG   . GLU A 1 90  ? 12.907  -0.497  -1.400  1.00 0.00 ? 90  GLU A CG   2  
ATOM 3100  C CD   . GLU A 1 90  ? 13.756  -0.105  -2.593  1.00 0.00 ? 90  GLU A CD   2  
ATOM 3101  O OE1  . GLU A 1 90  ? 14.141  1.080   -2.683  1.00 0.00 ? 90  GLU A OE1  2  
ATOM 3102  O OE2  . GLU A 1 90  ? 14.035  -0.981  -3.437  1.00 0.00 ? 90  GLU A OE2  2  
ATOM 3103  H H    . GLU A 1 90  ? 11.324  0.558   0.742   1.00 0.00 ? 90  GLU A H    2  
ATOM 3104  H HA   . GLU A 1 90  ? 11.585  1.838   -1.685  1.00 0.00 ? 90  GLU A HA   2  
ATOM 3105  H HB2  . GLU A 1 90  ? 10.879  -1.031  -1.072  1.00 0.00 ? 90  GLU A HB2  2  
ATOM 3106  H HB3  . GLU A 1 90  ? 11.228  -0.458  -2.697  1.00 0.00 ? 90  GLU A HB3  2  
ATOM 3107  H HG2  . GLU A 1 90  ? 13.203  0.105   -0.554  1.00 0.00 ? 90  GLU A HG2  2  
ATOM 3108  H HG3  . GLU A 1 90  ? 13.084  -1.539  -1.178  1.00 0.00 ? 90  GLU A HG3  2  
ATOM 3109  N N    . ALA A 1 91  ? 8.509   0.951   -1.048  1.00 0.00 ? 91  ALA A N    2  
ATOM 3110  C CA   . ALA A 1 91  ? 7.122   1.109   -1.467  1.00 0.00 ? 91  ALA A CA   2  
ATOM 3111  C C    . ALA A 1 91  ? 6.574   2.469   -1.048  1.00 0.00 ? 91  ALA A C    2  
ATOM 3112  O O    . ALA A 1 91  ? 5.809   3.094   -1.783  1.00 0.00 ? 91  ALA A O    2  
ATOM 3113  C CB   . ALA A 1 91  ? 6.265   -0.008  -0.891  1.00 0.00 ? 91  ALA A CB   2  
ATOM 3114  H H    . ALA A 1 91  ? 8.701   0.564   -0.168  1.00 0.00 ? 91  ALA A H    2  
ATOM 3115  H HA   . ALA A 1 91  ? 7.089   1.036   -2.545  1.00 0.00 ? 91  ALA A HA   2  
ATOM 3116  H HB1  . ALA A 1 91  ? 5.368   0.413   -0.460  1.00 0.00 ? 91  ALA A HB1  2  
ATOM 3117  H HB2  . ALA A 1 91  ? 5.998   -0.698  -1.678  1.00 0.00 ? 91  ALA A HB2  2  
ATOM 3118  H HB3  . ALA A 1 91  ? 6.821   -0.530  -0.127  1.00 0.00 ? 91  ALA A HB3  2  
ATOM 3119  N N    . VAL A 1 92  ? 6.970   2.922   0.137   1.00 0.00 ? 92  VAL A N    2  
ATOM 3120  C CA   . VAL A 1 92  ? 6.519   4.209   0.654   1.00 0.00 ? 92  VAL A CA   2  
ATOM 3121  C C    . VAL A 1 92  ? 6.895   5.343   -0.292  1.00 0.00 ? 92  VAL A C    2  
ATOM 3122  O O    . VAL A 1 92  ? 6.092   6.239   -0.553  1.00 0.00 ? 92  VAL A O    2  
ATOM 3123  C CB   . VAL A 1 92  ? 7.115   4.495   2.045   1.00 0.00 ? 92  VAL A CB   2  
ATOM 3124  C CG1  . VAL A 1 92  ? 7.209   5.994   2.287   1.00 0.00 ? 92  VAL A CG1  2  
ATOM 3125  C CG2  . VAL A 1 92  ? 6.285   3.823   3.128   1.00 0.00 ? 92  VAL A CG2  2  
ATOM 3126  H H    . VAL A 1 92  ? 7.581   2.378   0.677   1.00 0.00 ? 92  VAL A H    2  
ATOM 3127  H HA   . VAL A 1 92  ? 5.443   4.172   0.746   1.00 0.00 ? 92  VAL A HA   2  
ATOM 3128  H HB   . VAL A 1 92  ? 8.113   4.084   2.078   1.00 0.00 ? 92  VAL A HB   2  
ATOM 3129  H HG11 . VAL A 1 92  ? 7.604   6.174   3.275   1.00 0.00 ? 92  VAL A HG11 2  
ATOM 3130  H HG12 . VAL A 1 92  ? 7.863   6.438   1.550   1.00 0.00 ? 92  VAL A HG12 2  
ATOM 3131  H HG13 . VAL A 1 92  ? 6.226   6.434   2.207   1.00 0.00 ? 92  VAL A HG13 2  
ATOM 3132  H HG21 . VAL A 1 92  ? 5.556   3.171   2.671   1.00 0.00 ? 92  VAL A HG21 2  
ATOM 3133  H HG22 . VAL A 1 92  ? 6.933   3.247   3.771   1.00 0.00 ? 92  VAL A HG22 2  
ATOM 3134  H HG23 . VAL A 1 92  ? 5.777   4.577   3.712   1.00 0.00 ? 92  VAL A HG23 2  
ATOM 3135  N N    . GLU A 1 93  ? 8.121   5.298   -0.804  1.00 0.00 ? 93  GLU A N    2  
ATOM 3136  C CA   . GLU A 1 93  ? 8.604   6.324   -1.721  1.00 0.00 ? 93  GLU A CA   2  
ATOM 3137  C C    . GLU A 1 93  ? 7.852   6.265   -3.048  1.00 0.00 ? 93  GLU A C    2  
ATOM 3138  O O    . GLU A 1 93  ? 7.606   7.291   -3.680  1.00 0.00 ? 93  GLU A O    2  
ATOM 3139  C CB   . GLU A 1 93  ? 10.105  6.155   -1.966  1.00 0.00 ? 93  GLU A CB   2  
ATOM 3140  C CG   . GLU A 1 93  ? 10.929  6.112   -0.690  1.00 0.00 ? 93  GLU A CG   2  
ATOM 3141  C CD   . GLU A 1 93  ? 12.318  6.691   -0.872  1.00 0.00 ? 93  GLU A CD   2  
ATOM 3142  O OE1  . GLU A 1 93  ? 12.474  7.920   -0.718  1.00 0.00 ? 93  GLU A OE1  2  
ATOM 3143  O OE2  . GLU A 1 93  ? 13.250  5.914   -1.168  1.00 0.00 ? 93  GLU A OE2  2  
ATOM 3144  H H    . GLU A 1 93  ? 8.715   4.558   -0.558  1.00 0.00 ? 93  GLU A H    2  
ATOM 3145  H HA   . GLU A 1 93  ? 8.429   7.286   -1.265  1.00 0.00 ? 93  GLU A HA   2  
ATOM 3146  H HB2  . GLU A 1 93  ? 10.268  5.235   -2.507  1.00 0.00 ? 93  GLU A HB2  2  
ATOM 3147  H HB3  . GLU A 1 93  ? 10.454  6.982   -2.567  1.00 0.00 ? 93  GLU A HB3  2  
ATOM 3148  H HG2  . GLU A 1 93  ? 10.417  6.678   0.074   1.00 0.00 ? 93  GLU A HG2  2  
ATOM 3149  H HG3  . GLU A 1 93  ? 11.022  5.084   -0.371  1.00 0.00 ? 93  GLU A HG3  2  
ATOM 3150  N N    . ALA A 1 94  ? 7.489   5.055   -3.462  1.00 0.00 ? 94  ALA A N    2  
ATOM 3151  C CA   . ALA A 1 94  ? 6.764   4.862   -4.712  1.00 0.00 ? 94  ALA A CA   2  
ATOM 3152  C C    . ALA A 1 94  ? 5.395   5.531   -4.661  1.00 0.00 ? 94  ALA A C    2  
ATOM 3153  O O    . ALA A 1 94  ? 5.000   6.229   -5.595  1.00 0.00 ? 94  ALA A O    2  
ATOM 3154  C CB   . ALA A 1 94  ? 6.618   3.377   -5.012  1.00 0.00 ? 94  ALA A CB   2  
ATOM 3155  H H    . ALA A 1 94  ? 7.714   4.275   -2.914  1.00 0.00 ? 94  ALA A H    2  
ATOM 3156  H HA   . ALA A 1 94  ? 7.343   5.310   -5.507  1.00 0.00 ? 94  ALA A HA   2  
ATOM 3157  H HB1  . ALA A 1 94  ? 6.712   2.814   -4.096  1.00 0.00 ? 94  ALA A HB1  2  
ATOM 3158  H HB2  . ALA A 1 94  ? 5.647   3.194   -5.451  1.00 0.00 ? 94  ALA A HB2  2  
ATOM 3159  H HB3  . ALA A 1 94  ? 7.389   3.073   -5.704  1.00 0.00 ? 94  ALA A HB3  2  
ATOM 3160  N N    . ILE A 1 95  ? 4.675   5.312   -3.566  1.00 0.00 ? 95  ILE A N    2  
ATOM 3161  C CA   . ILE A 1 95  ? 3.350   5.894   -3.394  1.00 0.00 ? 95  ILE A CA   2  
ATOM 3162  C C    . ILE A 1 95  ? 3.434   7.403   -3.191  1.00 0.00 ? 95  ILE A C    2  
ATOM 3163  O O    . ILE A 1 95  ? 2.572   8.152   -3.651  1.00 0.00 ? 95  ILE A O    2  
ATOM 3164  C CB   . ILE A 1 95  ? 2.610   5.268   -2.198  1.00 0.00 ? 95  ILE A CB   2  
ATOM 3165  C CG1  . ILE A 1 95  ? 2.182   3.836   -2.528  1.00 0.00 ? 95  ILE A CG1  2  
ATOM 3166  C CG2  . ILE A 1 95  ? 1.403   6.113   -1.819  1.00 0.00 ? 95  ILE A CG2  2  
ATOM 3167  C CD1  . ILE A 1 95  ? 3.215   2.796   -2.158  1.00 0.00 ? 95  ILE A CD1  2  
ATOM 3168  H H    . ILE A 1 95  ? 5.044   4.746   -2.856  1.00 0.00 ? 95  ILE A H    2  
ATOM 3169  H HA   . ILE A 1 95  ? 2.779   5.694   -4.290  1.00 0.00 ? 95  ILE A HA   2  
ATOM 3170  H HB   . ILE A 1 95  ? 3.284   5.249   -1.356  1.00 0.00 ? 95  ILE A HB   2  
ATOM 3171  H HG12 . ILE A 1 95  ? 1.274   3.606   -1.993  1.00 0.00 ? 95  ILE A HG12 2  
ATOM 3172  H HG13 . ILE A 1 95  ? 1.998   3.759   -3.590  1.00 0.00 ? 95  ILE A HG13 2  
ATOM 3173  H HG21 . ILE A 1 95  ? 0.860   5.629   -1.021  1.00 0.00 ? 95  ILE A HG21 2  
ATOM 3174  H HG22 . ILE A 1 95  ? 1.735   7.086   -1.489  1.00 0.00 ? 95  ILE A HG22 2  
ATOM 3175  H HG23 . ILE A 1 95  ? 0.758   6.225   -2.677  1.00 0.00 ? 95  ILE A HG23 2  
ATOM 3176  H HD11 . ILE A 1 95  ? 2.736   1.833   -2.053  1.00 0.00 ? 95  ILE A HD11 2  
ATOM 3177  H HD12 . ILE A 1 95  ? 3.965   2.741   -2.933  1.00 0.00 ? 95  ILE A HD12 2  
ATOM 3178  H HD13 . ILE A 1 95  ? 3.682   3.068   -1.223  1.00 0.00 ? 95  ILE A HD13 2  
ATOM 3179  N N    . LYS A 1 96  ? 4.481   7.844   -2.501  1.00 0.00 ? 96  LYS A N    2  
ATOM 3180  C CA   . LYS A 1 96  ? 4.682   9.264   -2.239  1.00 0.00 ? 96  LYS A CA   2  
ATOM 3181  C C    . LYS A 1 96  ? 5.300   9.958   -3.448  1.00 0.00 ? 96  LYS A C    2  
ATOM 3182  O O    . LYS A 1 96  ? 5.127   11.161  -3.641  1.00 0.00 ? 96  LYS A O    2  
ATOM 3183  C CB   . LYS A 1 96  ? 5.579   9.456   -1.014  1.00 0.00 ? 96  LYS A CB   2  
ATOM 3184  C CG   . LYS A 1 96  ? 7.058   9.535   -1.349  1.00 0.00 ? 96  LYS A CG   2  
ATOM 3185  C CD   . LYS A 1 96  ? 7.921   9.354   -0.112  1.00 0.00 ? 96  LYS A CD   2  
ATOM 3186  C CE   . LYS A 1 96  ? 8.042   10.649  0.678   1.00 0.00 ? 96  LYS A CE   2  
ATOM 3187  N NZ   . LYS A 1 96  ? 8.795   10.456  1.947   1.00 0.00 ? 96  LYS A NZ   2  
ATOM 3188  H H    . LYS A 1 96  ? 5.135   7.198   -2.160  1.00 0.00 ? 96  LYS A H    2  
ATOM 3189  H HA   . LYS A 1 96  ? 3.717   9.705   -2.041  1.00 0.00 ? 96  LYS A HA   2  
ATOM 3190  H HB2  . LYS A 1 96  ? 5.294   10.370  -0.514  1.00 0.00 ? 96  LYS A HB2  2  
ATOM 3191  H HB3  . LYS A 1 96  ? 5.428   8.625   -0.339  1.00 0.00 ? 96  LYS A HB3  2  
ATOM 3192  H HG2  . LYS A 1 96  ? 7.299   8.759   -2.060  1.00 0.00 ? 96  LYS A HG2  2  
ATOM 3193  H HG3  . LYS A 1 96  ? 7.267   10.502  -1.785  1.00 0.00 ? 96  LYS A HG3  2  
ATOM 3194  H HD2  . LYS A 1 96  ? 7.475   8.601   0.520   1.00 0.00 ? 96  LYS A HD2  2  
ATOM 3195  H HD3  . LYS A 1 96  ? 8.908   9.035   -0.415  1.00 0.00 ? 96  LYS A HD3  2  
ATOM 3196  H HE2  . LYS A 1 96  ? 8.556   11.378  0.071   1.00 0.00 ? 96  LYS A HE2  2  
ATOM 3197  H HE3  . LYS A 1 96  ? 7.049   11.008  0.909   1.00 0.00 ? 96  LYS A HE3  2  
ATOM 3198  H HZ1  . LYS A 1 96  ? 9.130   11.372  2.308   1.00 0.00 ? 96  LYS A HZ1  2  
ATOM 3199  H HZ2  . LYS A 1 96  ? 9.616   9.839   1.785   1.00 0.00 ? 96  LYS A HZ2  2  
ATOM 3200  H HZ3  . LYS A 1 96  ? 8.182   10.017  2.663   1.00 0.00 ? 96  LYS A HZ3  2  
ATOM 3201  N N    . ASN A 1 97  ? 6.021   9.192   -4.261  1.00 0.00 ? 97  ASN A N    2  
ATOM 3202  C CA   . ASN A 1 97  ? 6.664   9.734   -5.452  1.00 0.00 ? 97  ASN A CA   2  
ATOM 3203  C C    . ASN A 1 97  ? 5.940   9.279   -6.716  1.00 0.00 ? 97  ASN A C    2  
ATOM 3204  O O    . ASN A 1 97  ? 6.440   9.453   -7.827  1.00 0.00 ? 97  ASN A O    2  
ATOM 3205  C CB   . ASN A 1 97  ? 8.131   9.301   -5.507  1.00 0.00 ? 97  ASN A CB   2  
ATOM 3206  C CG   . ASN A 1 97  ? 8.904   9.723   -4.273  1.00 0.00 ? 97  ASN A CG   2  
ATOM 3207  O OD1  . ASN A 1 97  ? 8.904   10.895  -3.897  1.00 0.00 ? 97  ASN A OD1  2  
ATOM 3208  N ND2  . ASN A 1 97  ? 9.570   8.766   -3.636  1.00 0.00 ? 97  ASN A ND2  2  
ATOM 3209  H H    . ASN A 1 97  ? 6.123   8.239   -4.054  1.00 0.00 ? 97  ASN A H    2  
ATOM 3210  H HA   . ASN A 1 97  ? 6.618   10.811  -5.393  1.00 0.00 ? 97  ASN A HA   2  
ATOM 3211  H HB2  . ASN A 1 97  ? 8.179   8.225   -5.588  1.00 0.00 ? 97  ASN A HB2  2  
ATOM 3212  H HB3  . ASN A 1 97  ? 8.599   9.744   -6.373  1.00 0.00 ? 97  ASN A HB3  2  
ATOM 3213  H HD21 . ASN A 1 97  ? 9.525   7.854   -3.993  1.00 0.00 ? 97  ASN A HD21 2  
ATOM 3214  H HD22 . ASN A 1 97  ? 10.078  9.011   -2.835  1.00 0.00 ? 97  ASN A HD22 2  
ATOM 3215  N N    . ALA A 1 98  ? 4.760   8.695   -6.537  1.00 0.00 ? 98  ALA A N    2  
ATOM 3216  C CA   . ALA A 1 98  ? 3.966   8.217   -7.662  1.00 0.00 ? 98  ALA A CA   2  
ATOM 3217  C C    . ALA A 1 98  ? 3.562   9.369   -8.577  1.00 0.00 ? 98  ALA A C    2  
ATOM 3218  O O    . ALA A 1 98  ? 2.792   10.245  -8.185  1.00 0.00 ? 98  ALA A O    2  
ATOM 3219  C CB   . ALA A 1 98  ? 2.732   7.480   -7.163  1.00 0.00 ? 98  ALA A CB   2  
ATOM 3220  H H    . ALA A 1 98  ? 4.414   8.584   -5.627  1.00 0.00 ? 98  ALA A H    2  
ATOM 3221  H HA   . ALA A 1 98  ? 4.570   7.519   -8.224  1.00 0.00 ? 98  ALA A HA   2  
ATOM 3222  H HB1  . ALA A 1 98  ? 2.590   7.688   -6.113  1.00 0.00 ? 98  ALA A HB1  2  
ATOM 3223  H HB2  . ALA A 1 98  ? 1.866   7.812   -7.717  1.00 0.00 ? 98  ALA A HB2  2  
ATOM 3224  H HB3  . ALA A 1 98  ? 2.866   6.418   -7.305  1.00 0.00 ? 98  ALA A HB3  2  
ATOM 3225  N N    . GLY A 1 99  ? 4.087   9.360   -9.799  1.00 0.00 ? 99  GLY A N    2  
ATOM 3226  C CA   . GLY A 1 99  ? 3.769   10.410  -10.750 1.00 0.00 ? 99  GLY A CA   2  
ATOM 3227  C C    . GLY A 1 99  ? 2.280   10.531  -11.004 1.00 0.00 ? 99  GLY A C    2  
ATOM 3228  O O    . GLY A 1 99  ? 1.725   9.813   -11.834 1.00 0.00 ? 99  GLY A O    2  
ATOM 3229  H H    . GLY A 1 99  ? 4.695   8.636   -10.056 1.00 0.00 ? 99  GLY A H    2  
ATOM 3230  H HA2  . GLY A 1 99  ? 4.137   11.350  -10.367 1.00 0.00 ? 99  GLY A HA2  2  
ATOM 3231  H HA3  . GLY A 1 99  ? 4.266   10.194  -11.685 1.00 0.00 ? 99  GLY A HA3  2  
ATOM 3232  N N    . ASN A 1 100 ? 1.631   11.441  -10.285 1.00 0.00 ? 100 ASN A N    2  
ATOM 3233  C CA   . ASN A 1 100 ? 0.196   11.652  -10.435 1.00 0.00 ? 100 ASN A CA   2  
ATOM 3234  C C    . ASN A 1 100 ? -0.229  11.489  -11.891 1.00 0.00 ? 100 ASN A C    2  
ATOM 3235  O O    . ASN A 1 100 ? 0.393   12.024  -12.809 1.00 0.00 ? 100 ASN A O    2  
ATOM 3236  C CB   . ASN A 1 100 ? -0.192  13.045  -9.932  1.00 0.00 ? 100 ASN A CB   2  
ATOM 3237  C CG   . ASN A 1 100 ? -1.259  13.694  -10.792 1.00 0.00 ? 100 ASN A CG   2  
ATOM 3238  O OD1  . ASN A 1 100 ? -1.069  13.893  -11.992 1.00 0.00 ? 100 ASN A OD1  2  
ATOM 3239  N ND2  . ASN A 1 100 ? -2.390  14.026  -10.181 1.00 0.00 ? 100 ASN A ND2  2  
ATOM 3240  H H    . ASN A 1 100 ? 2.128   11.984  -9.638  1.00 0.00 ? 100 ASN A H    2  
ATOM 3241  H HA   . ASN A 1 100 ? -0.313  10.910  -9.838  1.00 0.00 ? 100 ASN A HA   2  
ATOM 3242  H HB2  . ASN A 1 100 ? -0.569  12.964  -8.924  1.00 0.00 ? 100 ASN A HB2  2  
ATOM 3243  H HB3  . ASN A 1 100 ? 0.682   13.678  -9.936  1.00 0.00 ? 100 ASN A HB3  2  
ATOM 3244  H HD21 . ASN A 1 100 ? -2.471  13.838  -9.222  1.00 0.00 ? 100 ASN A HD21 2  
ATOM 3245  H HD22 . ASN A 1 100 ? -3.097  14.447  -10.713 1.00 0.00 ? 100 ASN A HD22 2  
ATOM 3246  N N    . PRO A 1 101 ? -1.315  10.732  -12.110 1.00 0.00 ? 101 PRO A N    2  
ATOM 3247  C CA   . PRO A 1 101 ? -2.063  10.090  -11.025 1.00 0.00 ? 101 PRO A CA   2  
ATOM 3248  C C    . PRO A 1 101 ? -1.281  8.953   -10.375 1.00 0.00 ? 101 PRO A C    2  
ATOM 3249  O O    . PRO A 1 101 ? -0.190  8.601   -10.823 1.00 0.00 ? 101 PRO A O    2  
ATOM 3250  C CB   . PRO A 1 101 ? -3.310  9.547   -11.728 1.00 0.00 ? 101 PRO A CB   2  
ATOM 3251  C CG   . PRO A 1 101 ? -2.894  9.359   -13.146 1.00 0.00 ? 101 PRO A CG   2  
ATOM 3252  C CD   . PRO A 1 101 ? -1.895  10.445  -13.432 1.00 0.00 ? 101 PRO A CD   2  
ATOM 3253  H HA   . PRO A 1 101 ? -2.356  10.803  -10.268 1.00 0.00 ? 101 PRO A HA   2  
ATOM 3254  H HB2  . PRO A 1 101 ? -3.604  8.611   -11.273 1.00 0.00 ? 101 PRO A HB2  2  
ATOM 3255  H HB3  . PRO A 1 101 ? -4.115  10.263  -11.645 1.00 0.00 ? 101 PRO A HB3  2  
ATOM 3256  H HG2  . PRO A 1 101 ? -2.439  8.388   -13.269 1.00 0.00 ? 101 PRO A HG2  2  
ATOM 3257  H HG3  . PRO A 1 101 ? -3.751  9.457   -13.796 1.00 0.00 ? 101 PRO A HG3  2  
ATOM 3258  H HD2  . PRO A 1 101 ? -1.138  10.091  -14.117 1.00 0.00 ? 101 PRO A HD2  2  
ATOM 3259  H HD3  . PRO A 1 101 ? -2.390  11.317  -13.833 1.00 0.00 ? 101 PRO A HD3  2  
ATOM 3260  N N    . VAL A 1 102 ? -1.847  8.382   -9.317  1.00 0.00 ? 102 VAL A N    2  
ATOM 3261  C CA   . VAL A 1 102 ? -1.203  7.284   -8.606  1.00 0.00 ? 102 VAL A CA   2  
ATOM 3262  C C    . VAL A 1 102 ? -1.972  5.981   -8.796  1.00 0.00 ? 102 VAL A C    2  
ATOM 3263  O O    . VAL A 1 102 ? -2.929  5.701   -8.073  1.00 0.00 ? 102 VAL A O    2  
ATOM 3264  C CB   . VAL A 1 102 ? -1.085  7.582   -7.099  1.00 0.00 ? 102 VAL A CB   2  
ATOM 3265  C CG1  . VAL A 1 102 ? -0.138  6.598   -6.432  1.00 0.00 ? 102 VAL A CG1  2  
ATOM 3266  C CG2  . VAL A 1 102 ? -0.624  9.015   -6.875  1.00 0.00 ? 102 VAL A CG2  2  
ATOM 3267  H H    . VAL A 1 102 ? -2.718  8.706   -9.007  1.00 0.00 ? 102 VAL A H    2  
ATOM 3268  H HA   . VAL A 1 102 ? -0.207  7.165   -9.007  1.00 0.00 ? 102 VAL A HA   2  
ATOM 3269  H HB   . VAL A 1 102 ? -2.062  7.467   -6.653  1.00 0.00 ? 102 VAL A HB   2  
ATOM 3270  H HG11 . VAL A 1 102 ? 0.326   5.978   -7.185  1.00 0.00 ? 102 VAL A HG11 2  
ATOM 3271  H HG12 . VAL A 1 102 ? 0.624   7.140   -5.891  1.00 0.00 ? 102 VAL A HG12 2  
ATOM 3272  H HG13 . VAL A 1 102 ? -0.692  5.974   -5.745  1.00 0.00 ? 102 VAL A HG13 2  
ATOM 3273  H HG21 . VAL A 1 102 ? 0.060   9.046   -6.040  1.00 0.00 ? 102 VAL A HG21 2  
ATOM 3274  H HG22 . VAL A 1 102 ? -0.126  9.374   -7.763  1.00 0.00 ? 102 VAL A HG22 2  
ATOM 3275  H HG23 . VAL A 1 102 ? -1.479  9.640   -6.664  1.00 0.00 ? 102 VAL A HG23 2  
ATOM 3276  N N    . VAL A 1 103 ? -1.546  5.186   -9.772  1.00 0.00 ? 103 VAL A N    2  
ATOM 3277  C CA   . VAL A 1 103 ? -2.193  3.911   -10.057 1.00 0.00 ? 103 VAL A CA   2  
ATOM 3278  C C    . VAL A 1 103 ? -1.804  2.855   -9.028  1.00 0.00 ? 103 VAL A C    2  
ATOM 3279  O O    . VAL A 1 103 ? -0.664  2.815   -8.564  1.00 0.00 ? 103 VAL A O    2  
ATOM 3280  C CB   . VAL A 1 103 ? -1.829  3.399   -11.464 1.00 0.00 ? 103 VAL A CB   2  
ATOM 3281  C CG1  . VAL A 1 103 ? -2.850  2.376   -11.940 1.00 0.00 ? 103 VAL A CG1  2  
ATOM 3282  C CG2  . VAL A 1 103 ? -1.727  4.558   -12.442 1.00 0.00 ? 103 VAL A CG2  2  
ATOM 3283  H H    . VAL A 1 103 ? -0.778  5.464   -10.314 1.00 0.00 ? 103 VAL A H    2  
ATOM 3284  H HA   . VAL A 1 103 ? -3.262  4.062   -10.017 1.00 0.00 ? 103 VAL A HA   2  
ATOM 3285  H HB   . VAL A 1 103 ? -0.866  2.914   -11.410 1.00 0.00 ? 103 VAL A HB   2  
ATOM 3286  H HG11 . VAL A 1 103 ? -2.342  1.571   -12.450 1.00 0.00 ? 103 VAL A HG11 2  
ATOM 3287  H HG12 . VAL A 1 103 ? -3.390  1.983   -11.091 1.00 0.00 ? 103 VAL A HG12 2  
ATOM 3288  H HG13 . VAL A 1 103 ? -3.543  2.850   -12.620 1.00 0.00 ? 103 VAL A HG13 2  
ATOM 3289  H HG21 . VAL A 1 103 ? -0.703  4.666   -12.768 1.00 0.00 ? 103 VAL A HG21 2  
ATOM 3290  H HG22 . VAL A 1 103 ? -2.358  4.364   -13.297 1.00 0.00 ? 103 VAL A HG22 2  
ATOM 3291  H HG23 . VAL A 1 103 ? -2.048  5.469   -11.957 1.00 0.00 ? 103 VAL A HG23 2  
ATOM 3292  N N    . PHE A 1 104 ? -2.759  2.001   -8.675  1.00 0.00 ? 104 PHE A N    2  
ATOM 3293  C CA   . PHE A 1 104 ? -2.517  0.945   -7.699  1.00 0.00 ? 104 PHE A CA   2  
ATOM 3294  C C    . PHE A 1 104 ? -2.869  -0.422  -8.279  1.00 0.00 ? 104 PHE A C    2  
ATOM 3295  O O    . PHE A 1 104 ? -3.960  -0.617  -8.817  1.00 0.00 ? 104 PHE A O    2  
ATOM 3296  C CB   . PHE A 1 104 ? -3.332  1.198   -6.429  1.00 0.00 ? 104 PHE A CB   2  
ATOM 3297  C CG   . PHE A 1 104 ? -2.569  1.934   -5.365  1.00 0.00 ? 104 PHE A CG   2  
ATOM 3298  C CD1  . PHE A 1 104 ? -2.541  3.319   -5.346  1.00 0.00 ? 104 PHE A CD1  2  
ATOM 3299  C CD2  . PHE A 1 104 ? -1.880  1.241   -4.383  1.00 0.00 ? 104 PHE A CD2  2  
ATOM 3300  C CE1  . PHE A 1 104 ? -1.840  3.998   -4.368  1.00 0.00 ? 104 PHE A CE1  2  
ATOM 3301  C CE2  . PHE A 1 104 ? -1.177  1.915   -3.402  1.00 0.00 ? 104 PHE A CE2  2  
ATOM 3302  C CZ   . PHE A 1 104 ? -1.158  3.296   -3.394  1.00 0.00 ? 104 PHE A CZ   2  
ATOM 3303  H H    . PHE A 1 104 ? -3.648  2.084   -9.080  1.00 0.00 ? 104 PHE A H    2  
ATOM 3304  H HA   . PHE A 1 104 ? -1.467  0.957   -7.452  1.00 0.00 ? 104 PHE A HA   2  
ATOM 3305  H HB2  . PHE A 1 104 ? -4.202  1.785   -6.679  1.00 0.00 ? 104 PHE A HB2  2  
ATOM 3306  H HB3  . PHE A 1 104 ? -3.647  0.251   -6.018  1.00 0.00 ? 104 PHE A HB3  2  
ATOM 3307  H HD1  . PHE A 1 104 ? -3.075  3.870   -6.107  1.00 0.00 ? 104 PHE A HD1  2  
ATOM 3308  H HD2  . PHE A 1 104 ? -1.895  0.160   -4.387  1.00 0.00 ? 104 PHE A HD2  2  
ATOM 3309  H HE1  . PHE A 1 104 ? -1.827  5.078   -4.364  1.00 0.00 ? 104 PHE A HE1  2  
ATOM 3310  H HE2  . PHE A 1 104 ? -0.645  1.362   -2.642  1.00 0.00 ? 104 PHE A HE2  2  
ATOM 3311  H HZ   . PHE A 1 104 ? -0.609  3.824   -2.630  1.00 0.00 ? 104 PHE A HZ   2  
ATOM 3312  N N    . ILE A 1 105 ? -1.939  -1.364  -8.166  1.00 0.00 ? 105 ILE A N    2  
ATOM 3313  C CA   . ILE A 1 105 ? -2.151  -2.712  -8.679  1.00 0.00 ? 105 ILE A CA   2  
ATOM 3314  C C    . ILE A 1 105 ? -2.103  -3.741  -7.554  1.00 0.00 ? 105 ILE A C    2  
ATOM 3315  O O    . ILE A 1 105 ? -1.043  -4.281  -7.237  1.00 0.00 ? 105 ILE A O    2  
ATOM 3316  C CB   . ILE A 1 105 ? -1.101  -3.082  -9.743  1.00 0.00 ? 105 ILE A CB   2  
ATOM 3317  C CG1  . ILE A 1 105 ? -0.974  -1.960  -10.776 1.00 0.00 ? 105 ILE A CG1  2  
ATOM 3318  C CG2  . ILE A 1 105 ? -1.471  -4.393  -10.419 1.00 0.00 ? 105 ILE A CG2  2  
ATOM 3319  C CD1  . ILE A 1 105 ? -0.500  -2.438  -12.131 1.00 0.00 ? 105 ILE A CD1  2  
ATOM 3320  H H    . ILE A 1 105 ? -1.090  -1.147  -7.728  1.00 0.00 ? 105 ILE A H    2  
ATOM 3321  H HA   . ILE A 1 105 ? -3.128  -2.743  -9.139  1.00 0.00 ? 105 ILE A HA   2  
ATOM 3322  H HB   . ILE A 1 105 ? -0.151  -3.215  -9.248  1.00 0.00 ? 105 ILE A HB   2  
ATOM 3323  H HG12 . ILE A 1 105 ? -1.935  -1.490  -10.908 1.00 0.00 ? 105 ILE A HG12 2  
ATOM 3324  H HG13 . ILE A 1 105 ? -0.266  -1.228  -10.416 1.00 0.00 ? 105 ILE A HG13 2  
ATOM 3325  H HG21 . ILE A 1 105 ? -0.578  -4.975  -10.590 1.00 0.00 ? 105 ILE A HG21 2  
ATOM 3326  H HG22 . ILE A 1 105 ? -2.145  -4.948  -9.783  1.00 0.00 ? 105 ILE A HG22 2  
ATOM 3327  H HG23 . ILE A 1 105 ? -1.953  -4.188  -11.363 1.00 0.00 ? 105 ILE A HG23 2  
ATOM 3328  H HD11 . ILE A 1 105 ? -1.351  -2.751  -12.720 1.00 0.00 ? 105 ILE A HD11 2  
ATOM 3329  H HD12 . ILE A 1 105 ? 0.011   -1.633  -12.639 1.00 0.00 ? 105 ILE A HD12 2  
ATOM 3330  H HD13 . ILE A 1 105 ? 0.174   -3.271  -12.004 1.00 0.00 ? 105 ILE A HD13 2  
ATOM 3331  N N    . VAL A 1 106 ? -3.259  -4.009  -6.955  1.00 0.00 ? 106 VAL A N    2  
ATOM 3332  C CA   . VAL A 1 106 ? -3.350  -4.976  -5.868  1.00 0.00 ? 106 VAL A CA   2  
ATOM 3333  C C    . VAL A 1 106 ? -4.402  -6.039  -6.164  1.00 0.00 ? 106 VAL A C    2  
ATOM 3334  O O    . VAL A 1 106 ? -5.021  -6.034  -7.228  1.00 0.00 ? 106 VAL A O    2  
ATOM 3335  C CB   . VAL A 1 106 ? -3.693  -4.289  -4.533  1.00 0.00 ? 106 VAL A CB   2  
ATOM 3336  C CG1  . VAL A 1 106 ? -2.819  -3.062  -4.324  1.00 0.00 ? 106 VAL A CG1  2  
ATOM 3337  C CG2  . VAL A 1 106 ? -5.167  -3.917  -4.489  1.00 0.00 ? 106 VAL A CG2  2  
ATOM 3338  H H    . VAL A 1 106 ? -4.070  -3.547  -7.252  1.00 0.00 ? 106 VAL A H    2  
ATOM 3339  H HA   . VAL A 1 106 ? -2.387  -5.455  -5.765  1.00 0.00 ? 106 VAL A HA   2  
ATOM 3340  H HB   . VAL A 1 106 ? -3.495  -4.985  -3.731  1.00 0.00 ? 106 VAL A HB   2  
ATOM 3341  H HG11 . VAL A 1 106 ? -2.274  -3.162  -3.397  1.00 0.00 ? 106 VAL A HG11 2  
ATOM 3342  H HG12 . VAL A 1 106 ? -2.122  -2.972  -5.144  1.00 0.00 ? 106 VAL A HG12 2  
ATOM 3343  H HG13 . VAL A 1 106 ? -3.441  -2.180  -4.281  1.00 0.00 ? 106 VAL A HG13 2  
ATOM 3344  H HG21 . VAL A 1 106 ? -5.384  -3.413  -3.559  1.00 0.00 ? 106 VAL A HG21 2  
ATOM 3345  H HG22 . VAL A 1 106 ? -5.398  -3.263  -5.316  1.00 0.00 ? 106 VAL A HG22 2  
ATOM 3346  H HG23 . VAL A 1 106 ? -5.767  -4.813  -4.561  1.00 0.00 ? 106 VAL A HG23 2  
ATOM 3347  N N    . GLN A 1 107 ? -4.599  -6.950  -5.216  1.00 0.00 ? 107 GLN A N    2  
ATOM 3348  C CA   . GLN A 1 107 ? -5.577  -8.020  -5.376  1.00 0.00 ? 107 GLN A CA   2  
ATOM 3349  C C    . GLN A 1 107 ? -6.340  -8.258  -4.078  1.00 0.00 ? 107 GLN A C    2  
ATOM 3350  O O    . GLN A 1 107 ? -5.798  -8.806  -3.119  1.00 0.00 ? 107 GLN A O    2  
ATOM 3351  C CB   . GLN A 1 107 ? -4.884  -9.310  -5.819  1.00 0.00 ? 107 GLN A CB   2  
ATOM 3352  C CG   . GLN A 1 107 ? -3.649  -9.075  -6.674  1.00 0.00 ? 107 GLN A CG   2  
ATOM 3353  C CD   . GLN A 1 107 ? -3.199  -10.324 -7.405  1.00 0.00 ? 107 GLN A CD   2  
ATOM 3354  O OE1  . GLN A 1 107 ? -2.025  -10.693 -7.364  1.00 0.00 ? 107 GLN A OE1  2  
ATOM 3355  N NE2  . GLN A 1 107 ? -4.133  -10.984 -8.080  1.00 0.00 ? 107 GLN A NE2  2  
ATOM 3356  H H    . GLN A 1 107 ? -4.075  -6.901  -4.390  1.00 0.00 ? 107 GLN A H    2  
ATOM 3357  H HA   . GLN A 1 107 ? -6.276  -7.717  -6.141  1.00 0.00 ? 107 GLN A HA   2  
ATOM 3358  H HB2  . GLN A 1 107 ? -4.588  -9.865  -4.941  1.00 0.00 ? 107 GLN A HB2  2  
ATOM 3359  H HB3  . GLN A 1 107 ? -5.583  -9.902  -6.391  1.00 0.00 ? 107 GLN A HB3  2  
ATOM 3360  H HG2  . GLN A 1 107 ? -3.871  -8.310  -7.403  1.00 0.00 ? 107 GLN A HG2  2  
ATOM 3361  H HG3  . GLN A 1 107 ? -2.845  -8.739  -6.036  1.00 0.00 ? 107 GLN A HG3  2  
ATOM 3362  H HE21 . GLN A 1 107 ? -5.048  -10.631 -8.068  1.00 0.00 ? 107 GLN A HE21 2  
ATOM 3363  H HE22 . GLN A 1 107 ? -3.870  -11.795 -8.562  1.00 0.00 ? 107 GLN A HE22 2  
ATOM 3364  N N    . SER A 1 108 ? -7.603  -7.842  -4.055  1.00 0.00 ? 108 SER A N    2  
ATOM 3365  C CA   . SER A 1 108 ? -8.440  -8.007  -2.873  1.00 0.00 ? 108 SER A CA   2  
ATOM 3366  C C    . SER A 1 108 ? -8.840  -9.468  -2.690  1.00 0.00 ? 108 SER A C    2  
ATOM 3367  O O    . SER A 1 108 ? -9.269  -10.130 -3.636  1.00 0.00 ? 108 SER A O    2  
ATOM 3368  C CB   . SER A 1 108 ? -9.691  -7.133  -2.982  1.00 0.00 ? 108 SER A CB   2  
ATOM 3369  O OG   . SER A 1 108 ? -10.739 -7.639  -2.173  1.00 0.00 ? 108 SER A OG   2  
ATOM 3370  H H    . SER A 1 108 ? -7.979  -7.412  -4.852  1.00 0.00 ? 108 SER A H    2  
ATOM 3371  H HA   . SER A 1 108 ? -7.866  -7.693  -2.014  1.00 0.00 ? 108 SER A HA   2  
ATOM 3372  H HB2  . SER A 1 108 ? -9.456  -6.130  -2.660  1.00 0.00 ? 108 SER A HB2  2  
ATOM 3373  H HB3  . SER A 1 108 ? -10.024 -7.113  -4.010  1.00 0.00 ? 108 SER A HB3  2  
ATOM 3374  H HG   . SER A 1 108 ? -10.428 -7.736  -1.270  1.00 0.00 ? 108 SER A HG   2  
ATOM 3375  N N    . LEU A 1 109 ? -8.697  -9.965  -1.466  1.00 0.00 ? 109 LEU A N    2  
ATOM 3376  C CA   . LEU A 1 109 ? -9.043  -11.348 -1.157  1.00 0.00 ? 109 LEU A CA   2  
ATOM 3377  C C    . LEU A 1 109 ? -10.556 -11.546 -1.168  1.00 0.00 ? 109 LEU A C    2  
ATOM 3378  O O    . LEU A 1 109 ? -11.318 -10.590 -1.027  1.00 0.00 ? 109 LEU A O    2  
ATOM 3379  C CB   . LEU A 1 109 ? -8.476  -11.743 0.208   1.00 0.00 ? 109 LEU A CB   2  
ATOM 3380  C CG   . LEU A 1 109 ? -7.067  -12.338 0.201   1.00 0.00 ? 109 LEU A CG   2  
ATOM 3381  C CD1  . LEU A 1 109 ? -6.713  -12.885 1.575   1.00 0.00 ? 109 LEU A CD1  2  
ATOM 3382  C CD2  . LEU A 1 109 ? -6.953  -13.428 -0.854  1.00 0.00 ? 109 LEU A CD2  2  
ATOM 3383  H H    . LEU A 1 109 ? -8.351  -9.389  -0.753  1.00 0.00 ? 109 LEU A H    2  
ATOM 3384  H HA   . LEU A 1 109 ? -8.604  -11.977 -1.916  1.00 0.00 ? 109 LEU A HA   2  
ATOM 3385  H HB2  . LEU A 1 109 ? -8.458  -10.860 0.827   1.00 0.00 ? 109 LEU A HB2  2  
ATOM 3386  H HB3  . LEU A 1 109 ? -9.143  -12.474 0.643   1.00 0.00 ? 109 LEU A HB3  2  
ATOM 3387  H HG   . LEU A 1 109 ? -6.356  -11.561 -0.041  1.00 0.00 ? 109 LEU A HG   2  
ATOM 3388  H HD11 . LEU A 1 109 ? -7.592  -13.316 2.029   1.00 0.00 ? 109 LEU A HD11 2  
ATOM 3389  H HD12 . LEU A 1 109 ? -6.343  -12.084 2.198   1.00 0.00 ? 109 LEU A HD12 2  
ATOM 3390  H HD13 . LEU A 1 109 ? -5.950  -13.644 1.475   1.00 0.00 ? 109 LEU A HD13 2  
ATOM 3391  H HD21 . LEU A 1 109 ? -7.888  -13.964 -0.921  1.00 0.00 ? 109 LEU A HD21 2  
ATOM 3392  H HD22 . LEU A 1 109 ? -6.164  -14.113 -0.581  1.00 0.00 ? 109 LEU A HD22 2  
ATOM 3393  H HD23 . LEU A 1 109 ? -6.725  -12.980 -1.811  1.00 0.00 ? 109 LEU A HD23 2  
ATOM 3394  N N    . SER A 1 110 ? -10.983 -12.794 -1.333  1.00 0.00 ? 110 SER A N    2  
ATOM 3395  C CA   . SER A 1 110 ? -12.404 -13.118 -1.364  1.00 0.00 ? 110 SER A CA   2  
ATOM 3396  C C    . SER A 1 110 ? -13.075 -12.743 -0.046  1.00 0.00 ? 110 SER A C    2  
ATOM 3397  O O    . SER A 1 110 ? -13.378 -13.607 0.777   1.00 0.00 ? 110 SER A O    2  
ATOM 3398  C CB   . SER A 1 110 ? -12.603 -14.608 -1.645  1.00 0.00 ? 110 SER A CB   2  
ATOM 3399  O OG   . SER A 1 110 ? -13.819 -14.839 -2.335  1.00 0.00 ? 110 SER A OG   2  
ATOM 3400  H H    . SER A 1 110 ? -10.325 -13.513 -1.440  1.00 0.00 ? 110 SER A H    2  
ATOM 3401  H HA   . SER A 1 110 ? -12.857 -12.546 -2.160  1.00 0.00 ? 110 SER A HA   2  
ATOM 3402  H HB2  . SER A 1 110 ? -11.786 -14.970 -2.250  1.00 0.00 ? 110 SER A HB2  2  
ATOM 3403  H HB3  . SER A 1 110 ? -12.625 -15.148 -0.710  1.00 0.00 ? 110 SER A HB3  2  
ATOM 3404  H HG   . SER A 1 110 ? -14.423 -15.324 -1.767  1.00 0.00 ? 110 SER A HG   2  
ATOM 3405  N N    . SER A 1 111 ? -13.304 -11.448 0.147   1.00 0.00 ? 111 SER A N    2  
ATOM 3406  C CA   . SER A 1 111 ? -13.936 -10.957 1.367   1.00 0.00 ? 111 SER A CA   2  
ATOM 3407  C C    . SER A 1 111 ? -15.054 -9.972  1.040   1.00 0.00 ? 111 SER A C    2  
ATOM 3408  O O    . SER A 1 111 ? -15.730 -9.463  1.935   1.00 0.00 ? 111 SER A O    2  
ATOM 3409  C CB   . SER A 1 111 ? -12.898 -10.288 2.270   1.00 0.00 ? 111 SER A CB   2  
ATOM 3410  O OG   . SER A 1 111 ? -11.873 -9.677  1.504   1.00 0.00 ? 111 SER A OG   2  
ATOM 3411  H H    . SER A 1 111 ? -13.039 -10.808 -0.546  1.00 0.00 ? 111 SER A H    2  
ATOM 3412  H HA   . SER A 1 111 ? -14.359 -11.805 1.885   1.00 0.00 ? 111 SER A HA   2  
ATOM 3413  H HB2  . SER A 1 111 ? -13.381 -9.532  2.870   1.00 0.00 ? 111 SER A HB2  2  
ATOM 3414  H HB3  . SER A 1 111 ? -12.454 -11.032 2.916   1.00 0.00 ? 111 SER A HB3  2  
ATOM 3415  H HG   . SER A 1 111 ? -11.183 -9.358  2.090   1.00 0.00 ? 111 SER A HG   2  
ATOM 3416  N N    . THR A 1 112 ? -15.242 -9.706  -0.249  1.00 0.00 ? 112 THR A N    2  
ATOM 3417  C CA   . THR A 1 112 ? -16.276 -8.781  -0.695  1.00 0.00 ? 112 THR A CA   2  
ATOM 3418  C C    . THR A 1 112 ? -16.081 -7.400  -0.080  1.00 0.00 ? 112 THR A C    2  
ATOM 3419  O O    . THR A 1 112 ? -15.544 -7.253  1.018   1.00 0.00 ? 112 THR A O    2  
ATOM 3420  C CB   . THR A 1 112 ? -17.683 -9.296  -0.336  1.00 0.00 ? 112 THR A CB   2  
ATOM 3421  O OG1  . THR A 1 112 ? -17.968 -9.023  1.040   1.00 0.00 ? 112 THR A OG1  2  
ATOM 3422  C CG2  . THR A 1 112 ? -17.795 -10.790 -0.596  1.00 0.00 ? 112 THR A CG2  2  
ATOM 3423  H H    . THR A 1 112 ? -14.671 -10.143 -0.914  1.00 0.00 ? 112 THR A H    2  
ATOM 3424  H HA   . THR A 1 112 ? -16.209 -8.699  -1.770  1.00 0.00 ? 112 THR A HA   2  
ATOM 3425  H HB   . THR A 1 112 ? -18.406 -8.783  -0.954  1.00 0.00 ? 112 THR A HB   2  
ATOM 3426  H HG1  . THR A 1 112 ? -18.013 -8.074  1.176   1.00 0.00 ? 112 THR A HG1  2  
ATOM 3427  H HG21 . THR A 1 112 ? -17.246 -11.329 0.161   1.00 0.00 ? 112 THR A HG21 2  
ATOM 3428  H HG22 . THR A 1 112 ? -17.384 -11.018 -1.569  1.00 0.00 ? 112 THR A HG22 2  
ATOM 3429  H HG23 . THR A 1 112 ? -18.834 -11.084 -0.567  1.00 0.00 ? 112 THR A HG23 2  
ATOM 3430  N N    . PRO A 1 113 ? -16.527 -6.361  -0.803  1.00 0.00 ? 113 PRO A N    2  
ATOM 3431  C CA   . PRO A 1 113 ? -16.413 -4.973  -0.347  1.00 0.00 ? 113 PRO A CA   2  
ATOM 3432  C C    . PRO A 1 113 ? -17.332 -4.673  0.833   1.00 0.00 ? 113 PRO A C    2  
ATOM 3433  O O    . PRO A 1 113 ? -17.835 -5.586  1.488   1.00 0.00 ? 113 PRO A O    2  
ATOM 3434  C CB   . PRO A 1 113 ? -16.836 -4.161  -1.574  1.00 0.00 ? 113 PRO A CB   2  
ATOM 3435  C CG   . PRO A 1 113 ? -17.716 -5.078  -2.350  1.00 0.00 ? 113 PRO A CG   2  
ATOM 3436  C CD   . PRO A 1 113 ? -17.177 -6.463  -2.120  1.00 0.00 ? 113 PRO A CD   2  
ATOM 3437  H HA   . PRO A 1 113 ? -15.396 -4.724  -0.081  1.00 0.00 ? 113 PRO A HA   2  
ATOM 3438  H HB2  . PRO A 1 113 ? -17.368 -3.275  -1.256  1.00 0.00 ? 113 PRO A HB2  2  
ATOM 3439  H HB3  . PRO A 1 113 ? -15.962 -3.878  -2.141  1.00 0.00 ? 113 PRO A HB3  2  
ATOM 3440  H HG2  . PRO A 1 113 ? -18.731 -5.006  -1.989  1.00 0.00 ? 113 PRO A HG2  2  
ATOM 3441  H HG3  . PRO A 1 113 ? -17.671 -4.828  -3.400  1.00 0.00 ? 113 PRO A HG3  2  
ATOM 3442  H HD2  . PRO A 1 113 ? -17.982 -7.182  -2.098  1.00 0.00 ? 113 PRO A HD2  2  
ATOM 3443  H HD3  . PRO A 1 113 ? -16.459 -6.720  -2.885  1.00 0.00 ? 113 PRO A HD3  2  
ATOM 3444  N N    . ARG A 1 114 ? -17.547 -3.388  1.098   1.00 0.00 ? 114 ARG A N    2  
ATOM 3445  C CA   . ARG A 1 114 ? -18.405 -2.969  2.200   1.00 0.00 ? 114 ARG A CA   2  
ATOM 3446  C C    . ARG A 1 114 ? -19.427 -1.938  1.730   1.00 0.00 ? 114 ARG A C    2  
ATOM 3447  O O    . ARG A 1 114 ? -19.518 -1.636  0.540   1.00 0.00 ? 114 ARG A O    2  
ATOM 3448  C CB   . ARG A 1 114 ? -17.563 -2.387  3.337   1.00 0.00 ? 114 ARG A CB   2  
ATOM 3449  C CG   . ARG A 1 114 ? -16.349 -3.231  3.690   1.00 0.00 ? 114 ARG A CG   2  
ATOM 3450  C CD   . ARG A 1 114 ? -15.422 -2.499  4.647   1.00 0.00 ? 114 ARG A CD   2  
ATOM 3451  N NE   . ARG A 1 114 ? -15.239 -1.100  4.272   1.00 0.00 ? 114 ARG A NE   2  
ATOM 3452  C CZ   . ARG A 1 114 ? -14.861 -0.154  5.123   1.00 0.00 ? 114 ARG A CZ   2  
ATOM 3453  N NH1  . ARG A 1 114 ? -14.626 -0.455  6.393   1.00 0.00 ? 114 ARG A NH1  2  
ATOM 3454  N NH2  . ARG A 1 114 ? -14.717 1.098   4.706   1.00 0.00 ? 114 ARG A NH2  2  
ATOM 3455  H H    . ARG A 1 114 ? -17.117 -2.706  0.540   1.00 0.00 ? 114 ARG A H    2  
ATOM 3456  H HA   . ARG A 1 114 ? -18.930 -3.840  2.562   1.00 0.00 ? 114 ARG A HA   2  
ATOM 3457  H HB2  . ARG A 1 114 ? -17.219 -1.404  3.048   1.00 0.00 ? 114 ARG A HB2  2  
ATOM 3458  H HB3  . ARG A 1 114 ? -18.181 -2.298  4.217   1.00 0.00 ? 114 ARG A HB3  2  
ATOM 3459  H HG2  . ARG A 1 114 ? -16.682 -4.146  4.157   1.00 0.00 ? 114 ARG A HG2  2  
ATOM 3460  H HG3  . ARG A 1 114 ? -15.808 -3.462  2.784   1.00 0.00 ? 114 ARG A HG3  2  
ATOM 3461  H HD2  . ARG A 1 114 ? -15.844 -2.543  5.640   1.00 0.00 ? 114 ARG A HD2  2  
ATOM 3462  H HD3  . ARG A 1 114 ? -14.461 -2.992  4.643   1.00 0.00 ? 114 ARG A HD3  2  
ATOM 3463  H HE   . ARG A 1 114 ? -15.408 -0.855  3.338   1.00 0.00 ? 114 ARG A HE   2  
ATOM 3464  H HH11 . ARG A 1 114 ? -14.733 -1.397  6.710   1.00 0.00 ? 114 ARG A HH11 2  
ATOM 3465  H HH12 . ARG A 1 114 ? -14.340 0.259   7.032   1.00 0.00 ? 114 ARG A HH12 2  
ATOM 3466  H HH21 . ARG A 1 114 ? -14.893 1.329   3.749   1.00 0.00 ? 114 ARG A HH21 2  
ATOM 3467  H HH22 . ARG A 1 114 ? -14.432 1.809   5.347   1.00 0.00 ? 114 ARG A HH22 2  
ATOM 3468  N N    . VAL A 1 115 ? -20.195 -1.402  2.673   1.00 0.00 ? 115 VAL A N    2  
ATOM 3469  C CA   . VAL A 1 115 ? -21.211 -0.404  2.357   1.00 0.00 ? 115 VAL A CA   2  
ATOM 3470  C C    . VAL A 1 115 ? -20.573 0.919   1.949   1.00 0.00 ? 115 VAL A C    2  
ATOM 3471  O O    . VAL A 1 115 ? -19.426 1.201   2.298   1.00 0.00 ? 115 VAL A O    2  
ATOM 3472  C CB   . VAL A 1 115 ? -22.151 -0.162  3.552   1.00 0.00 ? 115 VAL A CB   2  
ATOM 3473  C CG1  . VAL A 1 115 ? -21.375 0.390   4.739   1.00 0.00 ? 115 VAL A CG1  2  
ATOM 3474  C CG2  . VAL A 1 115 ? -23.280 0.779   3.159   1.00 0.00 ? 115 VAL A CG2  2  
ATOM 3475  H H    . VAL A 1 115 ? -20.075 -1.683  3.604   1.00 0.00 ? 115 VAL A H    2  
ATOM 3476  H HA   . VAL A 1 115 ? -21.800 -0.778  1.532   1.00 0.00 ? 115 VAL A HA   2  
ATOM 3477  H HB   . VAL A 1 115 ? -22.583 -1.108  3.842   1.00 0.00 ? 115 VAL A HB   2  
ATOM 3478  H HG11 . VAL A 1 115 ? -21.269 -0.381  5.489   1.00 0.00 ? 115 VAL A HG11 2  
ATOM 3479  H HG12 . VAL A 1 115 ? -20.397 0.712   4.411   1.00 0.00 ? 115 VAL A HG12 2  
ATOM 3480  H HG13 . VAL A 1 115 ? -21.909 1.229   5.159   1.00 0.00 ? 115 VAL A HG13 2  
ATOM 3481  H HG21 . VAL A 1 115 ? -23.986 0.854   3.973   1.00 0.00 ? 115 VAL A HG21 2  
ATOM 3482  H HG22 . VAL A 1 115 ? -22.874 1.756   2.943   1.00 0.00 ? 115 VAL A HG22 2  
ATOM 3483  H HG23 . VAL A 1 115 ? -23.780 0.395   2.282   1.00 0.00 ? 115 VAL A HG23 2  
ATOM 3484  N N    . ILE A 1 116 ? -21.324 1.727   1.208   1.00 0.00 ? 116 ILE A N    2  
ATOM 3485  C CA   . ILE A 1 116 ? -20.832 3.022   0.754   1.00 0.00 ? 116 ILE A CA   2  
ATOM 3486  C C    . ILE A 1 116 ? -21.671 4.160   1.327   1.00 0.00 ? 116 ILE A C    2  
ATOM 3487  O O    . ILE A 1 116 ? -22.560 4.701   0.669   1.00 0.00 ? 116 ILE A O    2  
ATOM 3488  C CB   . ILE A 1 116 ? -20.838 3.119   -0.783  1.00 0.00 ? 116 ILE A CB   2  
ATOM 3489  C CG1  . ILE A 1 116 ? -22.002 2.313   -1.362  1.00 0.00 ? 116 ILE A CG1  2  
ATOM 3490  C CG2  . ILE A 1 116 ? -19.513 2.629   -1.349  1.00 0.00 ? 116 ILE A CG2  2  
ATOM 3491  C CD1  . ILE A 1 116 ? -23.356 2.938   -1.108  1.00 0.00 ? 116 ILE A CD1  2  
ATOM 3492  H H    . ILE A 1 116 ? -22.230 1.447   0.962   1.00 0.00 ? 116 ILE A H    2  
ATOM 3493  H HA   . ILE A 1 116 ? -19.814 3.131   1.098   1.00 0.00 ? 116 ILE A HA   2  
ATOM 3494  H HB   . ILE A 1 116 ? -20.957 4.156   -1.056  1.00 0.00 ? 116 ILE A HB   2  
ATOM 3495  H HG12 . ILE A 1 116 ? -21.874 2.223   -2.429  1.00 0.00 ? 116 ILE A HG12 2  
ATOM 3496  H HG13 . ILE A 1 116 ? -22.002 1.327   -0.920  1.00 0.00 ? 116 ILE A HG13 2  
ATOM 3497  H HG21 . ILE A 1 116 ? -18.783 3.423   -1.294  1.00 0.00 ? 116 ILE A HG21 2  
ATOM 3498  H HG22 . ILE A 1 116 ? -19.168 1.783   -0.775  1.00 0.00 ? 116 ILE A HG22 2  
ATOM 3499  H HG23 . ILE A 1 116 ? -19.648 2.335   -2.379  1.00 0.00 ? 116 ILE A HG23 2  
ATOM 3500  H HD11 . ILE A 1 116 ? -24.109 2.406   -1.672  1.00 0.00 ? 116 ILE A HD11 2  
ATOM 3501  H HD12 . ILE A 1 116 ? -23.588 2.878   -0.055  1.00 0.00 ? 116 ILE A HD12 2  
ATOM 3502  H HD13 . ILE A 1 116 ? -23.339 3.972   -1.417  1.00 0.00 ? 116 ILE A HD13 2  
ATOM 3503  N N    . PRO A 1 117 ? -21.381 4.535   2.582   1.00 0.00 ? 117 PRO A N    2  
ATOM 3504  C CA   . PRO A 1 117 ? -22.095 5.614   3.270   1.00 0.00 ? 117 PRO A CA   2  
ATOM 3505  C C    . PRO A 1 117 ? -21.778 6.985   2.683   1.00 0.00 ? 117 PRO A C    2  
ATOM 3506  O O    . PRO A 1 117 ? -22.559 7.927   2.824   1.00 0.00 ? 117 PRO A O    2  
ATOM 3507  C CB   . PRO A 1 117 ? -21.582 5.517   4.709   1.00 0.00 ? 117 PRO A CB   2  
ATOM 3508  C CG   . PRO A 1 117 ? -20.242 4.878   4.591   1.00 0.00 ? 117 PRO A CG   2  
ATOM 3509  C CD   . PRO A 1 117 ? -20.334 3.934   3.425   1.00 0.00 ? 117 PRO A CD   2  
ATOM 3510  H HA   . PRO A 1 117 ? -23.163 5.456   3.256   1.00 0.00 ? 117 PRO A HA   2  
ATOM 3511  H HB2  . PRO A 1 117 ? -21.513 6.507   5.137   1.00 0.00 ? 117 PRO A HB2  2  
ATOM 3512  H HB3  . PRO A 1 117 ? -22.257 4.912   5.296   1.00 0.00 ? 117 PRO A HB3  2  
ATOM 3513  H HG2  . PRO A 1 117 ? -19.491 5.632   4.406   1.00 0.00 ? 117 PRO A HG2  2  
ATOM 3514  H HG3  . PRO A 1 117 ? -20.014 4.334   5.496   1.00 0.00 ? 117 PRO A HG3  2  
ATOM 3515  H HD2  . PRO A 1 117 ? -19.392 3.892   2.898   1.00 0.00 ? 117 PRO A HD2  2  
ATOM 3516  H HD3  . PRO A 1 117 ? -20.626 2.949   3.758   1.00 0.00 ? 117 PRO A HD3  2  
ATOM 3517  N N    . GLY A 1 1   ? 19.713  -31.385 -7.097  1.00 0.00 ? 1   GLY A N    3  
ATOM 3518  C CA   . GLY A 1 1   ? 19.591  -29.980 -6.754  1.00 0.00 ? 1   GLY A CA   3  
ATOM 3519  C C    . GLY A 1 1   ? 18.250  -29.400 -7.158  1.00 0.00 ? 1   GLY A C    3  
ATOM 3520  O O    . GLY A 1 1   ? 18.073  -28.962 -8.294  1.00 0.00 ? 1   GLY A O    3  
ATOM 3521  H H1   . GLY A 1 1   ? 20.506  -31.889 -6.815  1.00 0.00 ? 1   GLY A H1   3  
ATOM 3522  H HA2  . GLY A 1 1   ? 19.714  -29.869 -5.687  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3523  H HA3  . GLY A 1 1   ? 20.374  -29.430 -7.256  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3524  N N    . SER A 1 2   ? 17.304  -29.397 -6.225  1.00 0.00 ? 2   SER A N    3  
ATOM 3525  C CA   . SER A 1 2   ? 15.970  -28.871 -6.491  1.00 0.00 ? 2   SER A CA   3  
ATOM 3526  C C    . SER A 1 2   ? 15.978  -27.346 -6.492  1.00 0.00 ? 2   SER A C    3  
ATOM 3527  O O    . SER A 1 2   ? 17.027  -26.719 -6.345  1.00 0.00 ? 2   SER A O    3  
ATOM 3528  C CB   . SER A 1 2   ? 14.978  -29.387 -5.446  1.00 0.00 ? 2   SER A CB   3  
ATOM 3529  O OG   . SER A 1 2   ? 13.647  -29.315 -5.928  1.00 0.00 ? 2   SER A OG   3  
ATOM 3530  H H    . SER A 1 2   ? 17.507  -29.761 -5.337  1.00 0.00 ? 2   SER A H    3  
ATOM 3531  H HA   . SER A 1 2   ? 15.665  -29.219 -7.466  1.00 0.00 ? 2   SER A HA   3  
ATOM 3532  H HB2  . SER A 1 2   ? 15.208  -30.415 -5.211  1.00 0.00 ? 2   SER A HB2  3  
ATOM 3533  H HB3  . SER A 1 2   ? 15.057  -28.786 -4.551  1.00 0.00 ? 2   SER A HB3  3  
ATOM 3534  H HG   . SER A 1 2   ? 13.129  -30.028 -5.546  1.00 0.00 ? 2   SER A HG   3  
ATOM 3535  N N    . SER A 1 3   ? 14.799  -26.754 -6.659  1.00 0.00 ? 3   SER A N    3  
ATOM 3536  C CA   . SER A 1 3   ? 14.670  -25.302 -6.683  1.00 0.00 ? 3   SER A CA   3  
ATOM 3537  C C    . SER A 1 3   ? 13.986  -24.796 -5.416  1.00 0.00 ? 3   SER A C    3  
ATOM 3538  O O    . SER A 1 3   ? 14.629  -24.232 -4.533  1.00 0.00 ? 3   SER A O    3  
ATOM 3539  C CB   . SER A 1 3   ? 13.878  -24.860 -7.915  1.00 0.00 ? 3   SER A CB   3  
ATOM 3540  O OG   . SER A 1 3   ? 12.577  -25.422 -7.914  1.00 0.00 ? 3   SER A OG   3  
ATOM 3541  H H    . SER A 1 3   ? 13.998  -27.308 -6.771  1.00 0.00 ? 3   SER A H    3  
ATOM 3542  H HA   . SER A 1 3   ? 15.663  -24.881 -6.734  1.00 0.00 ? 3   SER A HA   3  
ATOM 3543  H HB2  . SER A 1 3   ? 13.792  -23.784 -7.918  1.00 0.00 ? 3   SER A HB2  3  
ATOM 3544  H HB3  . SER A 1 3   ? 14.396  -25.182 -8.807  1.00 0.00 ? 3   SER A HB3  3  
ATOM 3545  H HG   . SER A 1 3   ? 12.406  -25.837 -8.763  1.00 0.00 ? 3   SER A HG   3  
ATOM 3546  N N    . GLY A 1 4   ? 12.675  -25.003 -5.336  1.00 0.00 ? 4   GLY A N    3  
ATOM 3547  C CA   . GLY A 1 4   ? 11.924  -24.563 -4.175  1.00 0.00 ? 4   GLY A CA   3  
ATOM 3548  C C    . GLY A 1 4   ? 10.425  -24.637 -4.392  1.00 0.00 ? 4   GLY A C    3  
ATOM 3549  O O    . GLY A 1 4   ? 9.725   -23.630 -4.286  1.00 0.00 ? 4   GLY A O    3  
ATOM 3550  H H    . GLY A 1 4   ? 12.214  -25.459 -6.072  1.00 0.00 ? 4   GLY A H    3  
ATOM 3551  H HA2  . GLY A 1 4   ? 12.187  -25.185 -3.333  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3552  H HA3  . GLY A 1 4   ? 12.193  -23.541 -3.953  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3553  N N    . SER A 1 5   ? 9.932   -25.833 -4.697  1.00 0.00 ? 5   SER A N    3  
ATOM 3554  C CA   . SER A 1 5   ? 8.507   -26.034 -4.935  1.00 0.00 ? 5   SER A CA   3  
ATOM 3555  C C    . SER A 1 5   ? 7.807   -26.511 -3.666  1.00 0.00 ? 5   SER A C    3  
ATOM 3556  O O    . SER A 1 5   ? 6.778   -27.185 -3.728  1.00 0.00 ? 5   SER A O    3  
ATOM 3557  C CB   . SER A 1 5   ? 8.294   -27.047 -6.061  1.00 0.00 ? 5   SER A CB   3  
ATOM 3558  O OG   . SER A 1 5   ? 8.446   -26.438 -7.331  1.00 0.00 ? 5   SER A OG   3  
ATOM 3559  H H    . SER A 1 5   ? 10.541  -26.598 -4.767  1.00 0.00 ? 5   SER A H    3  
ATOM 3560  H HA   . SER A 1 5   ? 8.083   -25.086 -5.231  1.00 0.00 ? 5   SER A HA   3  
ATOM 3561  H HB2  . SER A 1 5   ? 9.018   -27.843 -5.967  1.00 0.00 ? 5   SER A HB2  3  
ATOM 3562  H HB3  . SER A 1 5   ? 7.297   -27.457 -5.988  1.00 0.00 ? 5   SER A HB3  3  
ATOM 3563  H HG   . SER A 1 5   ? 7.864   -26.866 -7.963  1.00 0.00 ? 5   SER A HG   3  
ATOM 3564  N N    . SER A 1 6   ? 8.372   -26.156 -2.517  1.00 0.00 ? 6   SER A N    3  
ATOM 3565  C CA   . SER A 1 6   ? 7.805   -26.551 -1.232  1.00 0.00 ? 6   SER A CA   3  
ATOM 3566  C C    . SER A 1 6   ? 7.160   -25.358 -0.533  1.00 0.00 ? 6   SER A C    3  
ATOM 3567  O O    . SER A 1 6   ? 7.725   -24.266 -0.497  1.00 0.00 ? 6   SER A O    3  
ATOM 3568  C CB   . SER A 1 6   ? 8.888   -27.156 -0.338  1.00 0.00 ? 6   SER A CB   3  
ATOM 3569  O OG   . SER A 1 6   ? 8.329   -28.063 0.598   1.00 0.00 ? 6   SER A OG   3  
ATOM 3570  H H    . SER A 1 6   ? 9.191   -25.618 -2.533  1.00 0.00 ? 6   SER A H    3  
ATOM 3571  H HA   . SER A 1 6   ? 7.047   -27.296 -1.420  1.00 0.00 ? 6   SER A HA   3  
ATOM 3572  H HB2  . SER A 1 6   ? 9.603   -27.685 -0.949  1.00 0.00 ? 6   SER A HB2  3  
ATOM 3573  H HB3  . SER A 1 6   ? 9.390   -26.365 0.201   1.00 0.00 ? 6   SER A HB3  3  
ATOM 3574  H HG   . SER A 1 6   ? 8.987   -28.718 0.841   1.00 0.00 ? 6   SER A HG   3  
ATOM 3575  N N    . GLY A 1 7   ? 5.972   -25.576 0.021   1.00 0.00 ? 7   GLY A N    3  
ATOM 3576  C CA   . GLY A 1 7   ? 5.268   -24.511 0.711   1.00 0.00 ? 7   GLY A CA   3  
ATOM 3577  C C    . GLY A 1 7   ? 4.327   -23.750 -0.202  1.00 0.00 ? 7   GLY A C    3  
ATOM 3578  O O    . GLY A 1 7   ? 4.526   -22.569 -0.489  1.00 0.00 ? 7   GLY A O    3  
ATOM 3579  H H    . GLY A 1 7   ? 5.569   -26.467 -0.040  1.00 0.00 ? 7   GLY A H    3  
ATOM 3580  H HA2  . GLY A 1 7   ? 4.699   -24.937 1.523   1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3581  H HA3  . GLY A 1 7   ? 5.993   -23.820 1.117   1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3582  N N    . PRO A 1 8   ? 3.276   -24.434 -0.677  1.00 0.00 ? 8   PRO A N    3  
ATOM 3583  C CA   . PRO A 1 8   ? 2.280   -23.835 -1.571  1.00 0.00 ? 8   PRO A CA   3  
ATOM 3584  C C    . PRO A 1 8   ? 1.412   -22.801 -0.862  1.00 0.00 ? 8   PRO A C    3  
ATOM 3585  O O    . PRO A 1 8   ? 1.474   -22.656 0.358   1.00 0.00 ? 8   PRO A O    3  
ATOM 3586  C CB   . PRO A 1 8   ? 1.434   -25.032 -2.011  1.00 0.00 ? 8   PRO A CB   3  
ATOM 3587  C CG   . PRO A 1 8   ? 1.584   -26.028 -0.913  1.00 0.00 ? 8   PRO A CG   3  
ATOM 3588  C CD   . PRO A 1 8   ? 2.977   -25.844 -0.376  1.00 0.00 ? 8   PRO A CD   3  
ATOM 3589  H HA   . PRO A 1 8   ? 2.745   -23.383 -2.435  1.00 0.00 ? 8   PRO A HA   3  
ATOM 3590  H HB2  . PRO A 1 8   ? 0.404   -24.725 -2.129  1.00 0.00 ? 8   PRO A HB2  3  
ATOM 3591  H HB3  . PRO A 1 8   ? 1.809   -25.418 -2.947  1.00 0.00 ? 8   PRO A HB3  3  
ATOM 3592  H HG2  . PRO A 1 8   ? 0.856   -25.834 -0.140  1.00 0.00 ? 8   PRO A HG2  3  
ATOM 3593  H HG3  . PRO A 1 8   ? 1.462   -27.027 -1.304  1.00 0.00 ? 8   PRO A HG3  3  
ATOM 3594  H HD2  . PRO A 1 8   ? 2.998   -26.025 0.688   1.00 0.00 ? 8   PRO A HD2  3  
ATOM 3595  H HD3  . PRO A 1 8   ? 3.667   -26.501 -0.886  1.00 0.00 ? 8   PRO A HD3  3  
ATOM 3596  N N    . ASN A 1 9   ? 0.603   -22.085 -1.636  1.00 0.00 ? 9   ASN A N    3  
ATOM 3597  C CA   . ASN A 1 9   ? -0.278  -21.063 -1.082  1.00 0.00 ? 9   ASN A CA   3  
ATOM 3598  C C    . ASN A 1 9   ? -1.499  -21.697 -0.423  1.00 0.00 ? 9   ASN A C    3  
ATOM 3599  O O    . ASN A 1 9   ? -1.839  -22.848 -0.698  1.00 0.00 ? 9   ASN A O    3  
ATOM 3600  C CB   . ASN A 1 9   ? -0.722  -20.093 -2.179  1.00 0.00 ? 9   ASN A CB   3  
ATOM 3601  C CG   . ASN A 1 9   ? -0.936  -20.785 -3.511  1.00 0.00 ? 9   ASN A CG   3  
ATOM 3602  O OD1  . ASN A 1 9   ? -1.964  -21.424 -3.733  1.00 0.00 ? 9   ASN A OD1  3  
ATOM 3603  N ND2  . ASN A 1 9   ? 0.039   -20.662 -4.405  1.00 0.00 ? 9   ASN A ND2  3  
ATOM 3604  H H    . ASN A 1 9   ? 0.599   -22.246 -2.603  1.00 0.00 ? 9   ASN A H    3  
ATOM 3605  H HA   . ASN A 1 9   ? 0.277   -20.517 -0.334  1.00 0.00 ? 9   ASN A HA   3  
ATOM 3606  H HB2  . ASN A 1 9   ? -1.651  -19.627 -1.884  1.00 0.00 ? 9   ASN A HB2  3  
ATOM 3607  H HB3  . ASN A 1 9   ? 0.033   -19.332 -2.306  1.00 0.00 ? 9   ASN A HB3  3  
ATOM 3608  H HD21 . ASN A 1 9   ? 0.830   -20.138 -4.158  1.00 0.00 ? 9   ASN A HD21 3  
ATOM 3609  H HD22 . ASN A 1 9   ? -0.074  -21.099 -5.275  1.00 0.00 ? 9   ASN A HD22 3  
ATOM 3610  N N    . PHE A 1 10  ? -2.156  -20.938 0.448   1.00 0.00 ? 10  PHE A N    3  
ATOM 3611  C CA   . PHE A 1 10  ? -3.340  -21.425 1.146   1.00 0.00 ? 10  PHE A CA   3  
ATOM 3612  C C    . PHE A 1 10  ? -4.456  -20.386 1.115   1.00 0.00 ? 10  PHE A C    3  
ATOM 3613  O O    . PHE A 1 10  ? -5.542  -20.608 1.651   1.00 0.00 ? 10  PHE A O    3  
ATOM 3614  C CB   . PHE A 1 10  ? -2.995  -21.776 2.595   1.00 0.00 ? 10  PHE A CB   3  
ATOM 3615  C CG   . PHE A 1 10  ? -1.880  -22.774 2.721   1.00 0.00 ? 10  PHE A CG   3  
ATOM 3616  C CD1  . PHE A 1 10  ? -1.980  -24.023 2.129   1.00 0.00 ? 10  PHE A CD1  3  
ATOM 3617  C CD2  . PHE A 1 10  ? -0.731  -22.463 3.430   1.00 0.00 ? 10  PHE A CD2  3  
ATOM 3618  C CE1  . PHE A 1 10  ? -0.955  -24.943 2.244   1.00 0.00 ? 10  PHE A CE1  3  
ATOM 3619  C CE2  . PHE A 1 10  ? 0.297   -23.380 3.549   1.00 0.00 ? 10  PHE A CE2  3  
ATOM 3620  C CZ   . PHE A 1 10  ? 0.185   -24.621 2.954   1.00 0.00 ? 10  PHE A CZ   3  
ATOM 3621  H H    . PHE A 1 10  ? -1.837  -20.028 0.625   1.00 0.00 ? 10  PHE A H    3  
ATOM 3622  H HA   . PHE A 1 10  ? -3.679  -22.316 0.640   1.00 0.00 ? 10  PHE A HA   3  
ATOM 3623  H HB2  . PHE A 1 10  ? -2.695  -20.878 3.114   1.00 0.00 ? 10  PHE A HB2  3  
ATOM 3624  H HB3  . PHE A 1 10  ? -3.868  -22.190 3.075   1.00 0.00 ? 10  PHE A HB3  3  
ATOM 3625  H HD1  . PHE A 1 10  ? -2.871  -24.276 1.573   1.00 0.00 ? 10  PHE A HD1  3  
ATOM 3626  H HD2  . PHE A 1 10  ? -0.642  -21.492 3.896   1.00 0.00 ? 10  PHE A HD2  3  
ATOM 3627  H HE1  . PHE A 1 10  ? -1.045  -25.913 1.778   1.00 0.00 ? 10  PHE A HE1  3  
ATOM 3628  H HE2  . PHE A 1 10  ? 1.187   -23.124 4.104   1.00 0.00 ? 10  PHE A HE2  3  
ATOM 3629  H HZ   . PHE A 1 10  ? 0.987   -25.339 3.045   1.00 0.00 ? 10  PHE A HZ   3  
ATOM 3630  N N    . SER A 1 11  ? -4.181  -19.249 0.483   1.00 0.00 ? 11  SER A N    3  
ATOM 3631  C CA   . SER A 1 11  ? -5.160  -18.173 0.384   1.00 0.00 ? 11  SER A CA   3  
ATOM 3632  C C    . SER A 1 11  ? -5.860  -18.197 -0.971  1.00 0.00 ? 11  SER A C    3  
ATOM 3633  O O    . SER A 1 11  ? -5.562  -19.036 -1.822  1.00 0.00 ? 11  SER A O    3  
ATOM 3634  C CB   . SER A 1 11  ? -4.482  -16.818 0.596   1.00 0.00 ? 11  SER A CB   3  
ATOM 3635  O OG   . SER A 1 11  ? -5.420  -15.836 1.002   1.00 0.00 ? 11  SER A OG   3  
ATOM 3636  H H    . SER A 1 11  ? -3.297  -19.131 0.075   1.00 0.00 ? 11  SER A H    3  
ATOM 3637  H HA   . SER A 1 11  ? -5.896  -18.322 1.160   1.00 0.00 ? 11  SER A HA   3  
ATOM 3638  H HB2  . SER A 1 11  ? -3.725  -16.912 1.360   1.00 0.00 ? 11  SER A HB2  3  
ATOM 3639  H HB3  . SER A 1 11  ? -4.023  -16.500 -0.329  1.00 0.00 ? 11  SER A HB3  3  
ATOM 3640  H HG   . SER A 1 11  ? -5.355  -15.704 1.951   1.00 0.00 ? 11  SER A HG   3  
ATOM 3641  N N    . HIS A 1 12  ? -6.794  -17.271 -1.164  1.00 0.00 ? 12  HIS A N    3  
ATOM 3642  C CA   . HIS A 1 12  ? -7.538  -17.185 -2.416  1.00 0.00 ? 12  HIS A CA   3  
ATOM 3643  C C    . HIS A 1 12  ? -7.509  -15.764 -2.968  1.00 0.00 ? 12  HIS A C    3  
ATOM 3644  O O    . HIS A 1 12  ? -8.491  -15.028 -2.867  1.00 0.00 ? 12  HIS A O    3  
ATOM 3645  C CB   . HIS A 1 12  ? -8.984  -17.634 -2.206  1.00 0.00 ? 12  HIS A CB   3  
ATOM 3646  C CG   . HIS A 1 12  ? -9.633  -18.165 -3.447  1.00 0.00 ? 12  HIS A CG   3  
ATOM 3647  N ND1  . HIS A 1 12  ? -9.325  -17.708 -4.711  1.00 0.00 ? 12  HIS A ND1  3  
ATOM 3648  C CD2  . HIS A 1 12  ? -10.576 -19.121 -3.613  1.00 0.00 ? 12  HIS A CD2  3  
ATOM 3649  C CE1  . HIS A 1 12  ? -10.053 -18.359 -5.601  1.00 0.00 ? 12  HIS A CE1  3  
ATOM 3650  N NE2  . HIS A 1 12  ? -10.820 -19.223 -4.961  1.00 0.00 ? 12  HIS A NE2  3  
ATOM 3651  H H    . HIS A 1 12  ? -6.987  -16.631 -0.448  1.00 0.00 ? 12  HIS A H    3  
ATOM 3652  H HA   . HIS A 1 12  ? -7.066  -17.845 -3.128  1.00 0.00 ? 12  HIS A HA   3  
ATOM 3653  H HB2  . HIS A 1 12  ? -9.007  -18.415 -1.460  1.00 0.00 ? 12  HIS A HB2  3  
ATOM 3654  H HB3  . HIS A 1 12  ? -9.568  -16.794 -1.859  1.00 0.00 ? 12  HIS A HB3  3  
ATOM 3655  H HD1  . HIS A 1 12  ? -8.673  -17.009 -4.924  1.00 0.00 ? 12  HIS A HD1  3  
ATOM 3656  H HD2  . HIS A 1 12  ? -11.051 -19.698 -2.831  1.00 0.00 ? 12  HIS A HD2  3  
ATOM 3657  H HE1  . HIS A 1 12  ? -10.025 -18.211 -6.670  1.00 0.00 ? 12  HIS A HE1  3  
ATOM 3658  N N    . TRP A 1 13  ? -6.377  -15.384 -3.551  1.00 0.00 ? 13  TRP A N    3  
ATOM 3659  C CA   . TRP A 1 13  ? -6.221  -14.049 -4.119  1.00 0.00 ? 13  TRP A CA   3  
ATOM 3660  C C    . TRP A 1 13  ? -6.624  -14.033 -5.589  1.00 0.00 ? 13  TRP A C    3  
ATOM 3661  O O    . TRP A 1 13  ? -5.985  -14.670 -6.425  1.00 0.00 ? 13  TRP A O    3  
ATOM 3662  C CB   . TRP A 1 13  ? -4.774  -13.575 -3.968  1.00 0.00 ? 13  TRP A CB   3  
ATOM 3663  C CG   . TRP A 1 13  ? -4.302  -13.553 -2.546  1.00 0.00 ? 13  TRP A CG   3  
ATOM 3664  C CD1  . TRP A 1 13  ? -3.933  -14.627 -1.788  1.00 0.00 ? 13  TRP A CD1  3  
ATOM 3665  C CD2  . TRP A 1 13  ? -4.149  -12.399 -1.712  1.00 0.00 ? 13  TRP A CD2  3  
ATOM 3666  N NE1  . TRP A 1 13  ? -3.560  -14.211 -0.533  1.00 0.00 ? 13  TRP A NE1  3  
ATOM 3667  C CE2  . TRP A 1 13  ? -3.683  -12.849 -0.461  1.00 0.00 ? 13  TRP A CE2  3  
ATOM 3668  C CE3  . TRP A 1 13  ? -4.358  -11.031 -1.901  1.00 0.00 ? 13  TRP A CE3  3  
ATOM 3669  C CZ2  . TRP A 1 13  ? -3.425  -11.977 0.594   1.00 0.00 ? 13  TRP A CZ2  3  
ATOM 3670  C CZ3  . TRP A 1 13  ? -4.102  -10.167 -0.853  1.00 0.00 ? 13  TRP A CZ3  3  
ATOM 3671  C CH2  . TRP A 1 13  ? -3.638  -10.643 0.381   1.00 0.00 ? 13  TRP A CH2  3  
ATOM 3672  H H    . TRP A 1 13  ? -5.629  -16.015 -3.601  1.00 0.00 ? 13  TRP A H    3  
ATOM 3673  H HA   . TRP A 1 13  ? -6.868  -13.379 -3.572  1.00 0.00 ? 13  TRP A HA   3  
ATOM 3674  H HB2  . TRP A 1 13  ? -4.126  -14.235 -4.525  1.00 0.00 ? 13  TRP A HB2  3  
ATOM 3675  H HB3  . TRP A 1 13  ? -4.689  -12.574 -4.365  1.00 0.00 ? 13  TRP A HB3  3  
ATOM 3676  H HD1  . TRP A 1 13  ? -3.940  -15.649 -2.137  1.00 0.00 ? 13  TRP A HD1  3  
ATOM 3677  H HE1  . TRP A 1 13  ? -3.254  -14.796 0.193   1.00 0.00 ? 13  TRP A HE1  3  
ATOM 3678  H HE3  . TRP A 1 13  ? -4.715  -10.645 -2.844  1.00 0.00 ? 13  TRP A HE3  3  
ATOM 3679  H HZ2  . TRP A 1 13  ? -3.067  -12.328 1.551   1.00 0.00 ? 13  TRP A HZ2  3  
ATOM 3680  H HZ3  . TRP A 1 13  ? -4.258  -9.106  -0.980  1.00 0.00 ? 13  TRP A HZ3  3  
ATOM 3681  H HH2  . TRP A 1 13  ? -3.452  -9.932  1.172   1.00 0.00 ? 13  TRP A HH2  3  
ATOM 3682  N N    . GLY A 1 14  ? -7.689  -13.299 -5.898  1.00 0.00 ? 14  GLY A N    3  
ATOM 3683  C CA   . GLY A 1 14  ? -8.158  -13.213 -7.269  1.00 0.00 ? 14  GLY A CA   3  
ATOM 3684  C C    . GLY A 1 14  ? -7.244  -12.379 -8.144  1.00 0.00 ? 14  GLY A C    3  
ATOM 3685  O O    . GLY A 1 14  ? -6.084  -12.134 -7.811  1.00 0.00 ? 14  GLY A O    3  
ATOM 3686  H H    . GLY A 1 14  ? -8.160  -12.812 -5.190  1.00 0.00 ? 14  GLY A H    3  
ATOM 3687  H HA2  . GLY A 1 14  ? -8.221  -14.210 -7.679  1.00 0.00 ? 14  GLY A HA2  3  
ATOM 3688  H HA3  . GLY A 1 14  ? -9.143  -12.770 -7.273  1.00 0.00 ? 14  GLY A HA3  3  
ATOM 3689  N N    . PRO A 1 15  ? -7.768  -11.929 -9.294  1.00 0.00 ? 15  PRO A N    3  
ATOM 3690  C CA   . PRO A 1 15  ? -7.007  -11.111 -10.243 1.00 0.00 ? 15  PRO A CA   3  
ATOM 3691  C C    . PRO A 1 15  ? -6.727  -9.711  -9.709  1.00 0.00 ? 15  PRO A C    3  
ATOM 3692  O O    . PRO A 1 15  ? -7.411  -9.213  -8.814  1.00 0.00 ? 15  PRO A O    3  
ATOM 3693  C CB   . PRO A 1 15  ? -7.925  -11.042 -11.467 1.00 0.00 ? 15  PRO A CB   3  
ATOM 3694  C CG   . PRO A 1 15  ? -9.297  -11.248 -10.923 1.00 0.00 ? 15  PRO A CG   3  
ATOM 3695  C CD   . PRO A 1 15  ? -9.143  -12.182 -9.754  1.00 0.00 ? 15  PRO A CD   3  
ATOM 3696  H HA   . PRO A 1 15  ? -6.075  -11.584 -10.516 1.00 0.00 ? 15  PRO A HA   3  
ATOM 3697  H HB2  . PRO A 1 15  ? -7.827  -10.075 -11.939 1.00 0.00 ? 15  PRO A HB2  3  
ATOM 3698  H HB3  . PRO A 1 15  ? -7.657  -11.820 -12.166 1.00 0.00 ? 15  PRO A HB3  3  
ATOM 3699  H HG2  . PRO A 1 15  ? -9.708  -10.305 -10.598 1.00 0.00 ? 15  PRO A HG2  3  
ATOM 3700  H HG3  . PRO A 1 15  ? -9.927  -11.694 -11.678 1.00 0.00 ? 15  PRO A HG3  3  
ATOM 3701  H HD2  . PRO A 1 15  ? -9.859  -11.941 -8.982  1.00 0.00 ? 15  PRO A HD2  3  
ATOM 3702  H HD3  . PRO A 1 15  ? -9.260  -13.207 -10.073 1.00 0.00 ? 15  PRO A HD3  3  
ATOM 3703  N N    . PRO A 1 16  ? -5.696  -9.059  -10.267 1.00 0.00 ? 16  PRO A N    3  
ATOM 3704  C CA   . PRO A 1 16  ? -5.303  -7.706  -9.862  1.00 0.00 ? 16  PRO A CA   3  
ATOM 3705  C C    . PRO A 1 16  ? -6.324  -6.654  -10.283 1.00 0.00 ? 16  PRO A C    3  
ATOM 3706  O O    . PRO A 1 16  ? -7.102  -6.868  -11.213 1.00 0.00 ? 16  PRO A O    3  
ATOM 3707  C CB   . PRO A 1 16  ? -3.977  -7.487  -10.596 1.00 0.00 ? 16  PRO A CB   3  
ATOM 3708  C CG   . PRO A 1 16  ? -4.046  -8.391  -11.779 1.00 0.00 ? 16  PRO A CG   3  
ATOM 3709  C CD   . PRO A 1 16  ? -4.837  -9.591  -11.338 1.00 0.00 ? 16  PRO A CD   3  
ATOM 3710  H HA   . PRO A 1 16  ? -5.141  -7.642  -8.796  1.00 0.00 ? 16  PRO A HA   3  
ATOM 3711  H HB2  . PRO A 1 16  ? -3.894  -6.451  -10.893 1.00 0.00 ? 16  PRO A HB2  3  
ATOM 3712  H HB3  . PRO A 1 16  ? -3.155  -7.749  -9.947  1.00 0.00 ? 16  PRO A HB3  3  
ATOM 3713  H HG2  . PRO A 1 16  ? -4.546  -7.891  -12.594 1.00 0.00 ? 16  PRO A HG2  3  
ATOM 3714  H HG3  . PRO A 1 16  ? -3.050  -8.686  -12.073 1.00 0.00 ? 16  PRO A HG3  3  
ATOM 3715  H HD2  . PRO A 1 16  ? -5.431  -9.972  -12.155 1.00 0.00 ? 16  PRO A HD2  3  
ATOM 3716  H HD3  . PRO A 1 16  ? -4.179  -10.358 -10.957 1.00 0.00 ? 16  PRO A HD3  3  
ATOM 3717  N N    . ARG A 1 17  ? -6.316  -5.519  -9.593  1.00 0.00 ? 17  ARG A N    3  
ATOM 3718  C CA   . ARG A 1 17  ? -7.242  -4.434  -9.895  1.00 0.00 ? 17  ARG A CA   3  
ATOM 3719  C C    . ARG A 1 17  ? -6.506  -3.101  -9.991  1.00 0.00 ? 17  ARG A C    3  
ATOM 3720  O O    . ARG A 1 17  ? -5.839  -2.680  -9.045  1.00 0.00 ? 17  ARG A O    3  
ATOM 3721  C CB   . ARG A 1 17  ? -8.331  -4.352  -8.824  1.00 0.00 ? 17  ARG A CB   3  
ATOM 3722  C CG   . ARG A 1 17  ? -7.829  -4.648  -7.420  1.00 0.00 ? 17  ARG A CG   3  
ATOM 3723  C CD   . ARG A 1 17  ? -8.916  -4.427  -6.381  1.00 0.00 ? 17  ARG A CD   3  
ATOM 3724  N NE   . ARG A 1 17  ? -10.002 -5.395  -6.511  1.00 0.00 ? 17  ARG A NE   3  
ATOM 3725  C CZ   . ARG A 1 17  ? -11.013 -5.485  -5.654  1.00 0.00 ? 17  ARG A CZ   3  
ATOM 3726  N NH1  . ARG A 1 17  ? -11.077 -4.671  -4.610  1.00 0.00 ? 17  ARG A NH1  3  
ATOM 3727  N NH2  . ARG A 1 17  ? -11.964 -6.392  -5.841  1.00 0.00 ? 17  ARG A NH2  3  
ATOM 3728  H H    . ARG A 1 17  ? -5.672  -5.408  -8.862  1.00 0.00 ? 17  ARG A H    3  
ATOM 3729  H HA   . ARG A 1 17  ? -7.703  -4.647  -10.848 1.00 0.00 ? 17  ARG A HA   3  
ATOM 3730  H HB2  . ARG A 1 17  ? -8.752  -3.357  -8.829  1.00 0.00 ? 17  ARG A HB2  3  
ATOM 3731  H HB3  . ARG A 1 17  ? -9.108  -5.064  -9.062  1.00 0.00 ? 17  ARG A HB3  3  
ATOM 3732  H HG2  . ARG A 1 17  ? -7.504  -5.677  -7.373  1.00 0.00 ? 17  ARG A HG2  3  
ATOM 3733  H HG3  . ARG A 1 17  ? -6.996  -3.995  -7.201  1.00 0.00 ? 17  ARG A HG3  3  
ATOM 3734  H HD2  . ARG A 1 17  ? -8.480  -4.521  -5.397  1.00 0.00 ? 17  ARG A HD2  3  
ATOM 3735  H HD3  . ARG A 1 17  ? -9.316  -3.432  -6.503  1.00 0.00 ? 17  ARG A HD3  3  
ATOM 3736  H HE   . ARG A 1 17  ? -9.975  -6.007  -7.276  1.00 0.00 ? 17  ARG A HE   3  
ATOM 3737  H HH11 . ARG A 1 17  ? -10.362 -3.986  -4.468  1.00 0.00 ? 17  ARG A HH11 3  
ATOM 3738  H HH12 . ARG A 1 17  ? -11.840 -4.740  -3.967  1.00 0.00 ? 17  ARG A HH12 3  
ATOM 3739  H HH21 . ARG A 1 17  ? -11.920 -7.008  -6.627  1.00 0.00 ? 17  ARG A HH21 3  
ATOM 3740  H HH22 . ARG A 1 17  ? -12.724 -6.460  -5.196  1.00 0.00 ? 17  ARG A HH22 3  
ATOM 3741  N N    . ILE A 1 18  ? -6.633  -2.443  -11.138 1.00 0.00 ? 18  ILE A N    3  
ATOM 3742  C CA   . ILE A 1 18  ? -5.980  -1.158  -11.356 1.00 0.00 ? 18  ILE A CA   3  
ATOM 3743  C C    . ILE A 1 18  ? -6.871  -0.005  -10.906 1.00 0.00 ? 18  ILE A C    3  
ATOM 3744  O O    . ILE A 1 18  ? -8.059  0.039   -11.228 1.00 0.00 ? 18  ILE A O    3  
ATOM 3745  C CB   . ILE A 1 18  ? -5.612  -0.958  -12.838 1.00 0.00 ? 18  ILE A CB   3  
ATOM 3746  C CG1  . ILE A 1 18  ? -4.324  -1.714  -13.172 1.00 0.00 ? 18  ILE A CG1  3  
ATOM 3747  C CG2  . ILE A 1 18  ? -5.459  0.523   -13.151 1.00 0.00 ? 18  ILE A CG2  3  
ATOM 3748  C CD1  . ILE A 1 18  ? -3.990  -1.716  -14.648 1.00 0.00 ? 18  ILE A CD1  3  
ATOM 3749  H H    . ILE A 1 18  ? -7.178  -2.830  -11.854 1.00 0.00 ? 18  ILE A H    3  
ATOM 3750  H HA   . ILE A 1 18  ? -5.070  -1.143  -10.774 1.00 0.00 ? 18  ILE A HA   3  
ATOM 3751  H HB   . ILE A 1 18  ? -6.417  -1.348  -13.442 1.00 0.00 ? 18  ILE A HB   3  
ATOM 3752  H HG12 . ILE A 1 18  ? -3.500  -1.259  -12.647 1.00 0.00 ? 18  ILE A HG12 3  
ATOM 3753  H HG13 . ILE A 1 18  ? -4.426  -2.741  -12.853 1.00 0.00 ? 18  ILE A HG13 3  
ATOM 3754  H HG21 . ILE A 1 18  ? -4.730  0.651   -13.937 1.00 0.00 ? 18  ILE A HG21 3  
ATOM 3755  H HG22 . ILE A 1 18  ? -6.409  0.922   -13.474 1.00 0.00 ? 18  ILE A HG22 3  
ATOM 3756  H HG23 . ILE A 1 18  ? -5.131  1.046   -12.266 1.00 0.00 ? 18  ILE A HG23 3  
ATOM 3757  H HD11 . ILE A 1 18  ? -4.872  -1.977  -15.216 1.00 0.00 ? 18  ILE A HD11 3  
ATOM 3758  H HD12 . ILE A 1 18  ? -3.652  -0.733  -14.942 1.00 0.00 ? 18  ILE A HD12 3  
ATOM 3759  H HD13 . ILE A 1 18  ? -3.212  -2.438  -14.840 1.00 0.00 ? 18  ILE A HD13 3  
ATOM 3760  N N    . VAL A 1 19  ? -6.290  0.928   -10.159 1.00 0.00 ? 19  VAL A N    3  
ATOM 3761  C CA   . VAL A 1 19  ? -7.030  2.084   -9.666  1.00 0.00 ? 19  VAL A CA   3  
ATOM 3762  C C    . VAL A 1 19  ? -6.161  3.336   -9.672  1.00 0.00 ? 19  VAL A C    3  
ATOM 3763  O O    . VAL A 1 19  ? -5.094  3.365   -9.059  1.00 0.00 ? 19  VAL A O    3  
ATOM 3764  C CB   . VAL A 1 19  ? -7.558  1.845   -8.239  1.00 0.00 ? 19  VAL A CB   3  
ATOM 3765  C CG1  . VAL A 1 19  ? -8.341  3.054   -7.750  1.00 0.00 ? 19  VAL A CG1  3  
ATOM 3766  C CG2  . VAL A 1 19  ? -8.416  0.590   -8.192  1.00 0.00 ? 19  VAL A CG2  3  
ATOM 3767  H H    . VAL A 1 19  ? -5.340  0.838   -9.935  1.00 0.00 ? 19  VAL A H    3  
ATOM 3768  H HA   . VAL A 1 19  ? -7.876  2.242   -10.319 1.00 0.00 ? 19  VAL A HA   3  
ATOM 3769  H HB   . VAL A 1 19  ? -6.712  1.702   -7.583  1.00 0.00 ? 19  VAL A HB   3  
ATOM 3770  H HG11 . VAL A 1 19  ? -9.113  3.296   -8.466  1.00 0.00 ? 19  VAL A HG11 3  
ATOM 3771  H HG12 . VAL A 1 19  ? -8.792  2.829   -6.795  1.00 0.00 ? 19  VAL A HG12 3  
ATOM 3772  H HG13 . VAL A 1 19  ? -7.673  3.896   -7.644  1.00 0.00 ? 19  VAL A HG13 3  
ATOM 3773  H HG21 . VAL A 1 19  ? -8.486  0.239   -7.174  1.00 0.00 ? 19  VAL A HG21 3  
ATOM 3774  H HG22 . VAL A 1 19  ? -9.404  0.816   -8.565  1.00 0.00 ? 19  VAL A HG22 3  
ATOM 3775  H HG23 . VAL A 1 19  ? -7.967  -0.177  -8.807  1.00 0.00 ? 19  VAL A HG23 3  
ATOM 3776  N N    . GLU A 1 20  ? -6.625  4.370   -10.367 1.00 0.00 ? 20  GLU A N    3  
ATOM 3777  C CA   . GLU A 1 20  ? -5.889  5.625   -10.452 1.00 0.00 ? 20  GLU A CA   3  
ATOM 3778  C C    . GLU A 1 20  ? -6.204  6.522   -9.258  1.00 0.00 ? 20  GLU A C    3  
ATOM 3779  O O    . GLU A 1 20  ? -7.365  6.836   -8.993  1.00 0.00 ? 20  GLU A O    3  
ATOM 3780  C CB   . GLU A 1 20  ? -6.227  6.354   -11.755 1.00 0.00 ? 20  GLU A CB   3  
ATOM 3781  C CG   . GLU A 1 20  ? -5.321  5.978   -12.915 1.00 0.00 ? 20  GLU A CG   3  
ATOM 3782  C CD   . GLU A 1 20  ? -6.010  6.110   -14.259 1.00 0.00 ? 20  GLU A CD   3  
ATOM 3783  O OE1  . GLU A 1 20  ? -7.175  5.675   -14.375 1.00 0.00 ? 20  GLU A OE1  3  
ATOM 3784  O OE2  . GLU A 1 20  ? -5.384  6.648   -15.196 1.00 0.00 ? 20  GLU A OE2  3  
ATOM 3785  H H    . GLU A 1 20  ? -7.482  4.285   -10.834 1.00 0.00 ? 20  GLU A H    3  
ATOM 3786  H HA   . GLU A 1 20  ? -4.835  5.393   -10.444 1.00 0.00 ? 20  GLU A HA   3  
ATOM 3787  H HB2  . GLU A 1 20  ? -7.246  6.121   -12.029 1.00 0.00 ? 20  GLU A HB2  3  
ATOM 3788  H HB3  . GLU A 1 20  ? -6.143  7.418   -11.590 1.00 0.00 ? 20  GLU A HB3  3  
ATOM 3789  H HG2  . GLU A 1 20  ? -4.458  6.626   -12.906 1.00 0.00 ? 20  GLU A HG2  3  
ATOM 3790  H HG3  . GLU A 1 20  ? -5.003  4.953   -12.789 1.00 0.00 ? 20  GLU A HG3  3  
ATOM 3791  N N    . ILE A 1 21  ? -5.162  6.931   -8.542  1.00 0.00 ? 21  ILE A N    3  
ATOM 3792  C CA   . ILE A 1 21  ? -5.327  7.792   -7.377  1.00 0.00 ? 21  ILE A CA   3  
ATOM 3793  C C    . ILE A 1 21  ? -4.526  9.081   -7.529  1.00 0.00 ? 21  ILE A C    3  
ATOM 3794  O O    . ILE A 1 21  ? -3.297  9.057   -7.591  1.00 0.00 ? 21  ILE A O    3  
ATOM 3795  C CB   . ILE A 1 21  ? -4.891  7.079   -6.084  1.00 0.00 ? 21  ILE A CB   3  
ATOM 3796  C CG1  . ILE A 1 21  ? -5.285  5.601   -6.133  1.00 0.00 ? 21  ILE A CG1  3  
ATOM 3797  C CG2  . ILE A 1 21  ? -5.509  7.758   -4.871  1.00 0.00 ? 21  ILE A CG2  3  
ATOM 3798  C CD1  . ILE A 1 21  ? -4.944  4.843   -4.869  1.00 0.00 ? 21  ILE A CD1  3  
ATOM 3799  H H    . ILE A 1 21  ? -4.261  6.648   -8.803  1.00 0.00 ? 21  ILE A H    3  
ATOM 3800  H HA   . ILE A 1 21  ? -6.375  8.040   -7.292  1.00 0.00 ? 21  ILE A HA   3  
ATOM 3801  H HB   . ILE A 1 21  ? -3.817  7.156   -6.002  1.00 0.00 ? 21  ILE A HB   3  
ATOM 3802  H HG12 . ILE A 1 21  ? -6.349  5.524   -6.289  1.00 0.00 ? 21  ILE A HG12 3  
ATOM 3803  H HG13 . ILE A 1 21  ? -4.769  5.126   -6.955  1.00 0.00 ? 21  ILE A HG13 3  
ATOM 3804  H HG21 . ILE A 1 21  ? -6.579  7.611   -4.882  1.00 0.00 ? 21  ILE A HG21 3  
ATOM 3805  H HG22 . ILE A 1 21  ? -5.097  7.328   -3.970  1.00 0.00 ? 21  ILE A HG22 3  
ATOM 3806  H HG23 . ILE A 1 21  ? -5.290  8.814   -4.899  1.00 0.00 ? 21  ILE A HG23 3  
ATOM 3807  H HD11 . ILE A 1 21  ? -4.853  3.790   -5.094  1.00 0.00 ? 21  ILE A HD11 3  
ATOM 3808  H HD12 . ILE A 1 21  ? -4.008  5.207   -4.471  1.00 0.00 ? 21  ILE A HD12 3  
ATOM 3809  H HD13 . ILE A 1 21  ? -5.727  4.988   -4.139  1.00 0.00 ? 21  ILE A HD13 3  
ATOM 3810  N N    . PHE A 1 22  ? -5.232  10.206  -7.586  1.00 0.00 ? 22  PHE A N    3  
ATOM 3811  C CA   . PHE A 1 22  ? -4.587  11.506  -7.729  1.00 0.00 ? 22  PHE A CA   3  
ATOM 3812  C C    . PHE A 1 22  ? -4.087  12.017  -6.381  1.00 0.00 ? 22  PHE A C    3  
ATOM 3813  O O    . PHE A 1 22  ? -4.839  12.067  -5.407  1.00 0.00 ? 22  PHE A O    3  
ATOM 3814  C CB   . PHE A 1 22  ? -5.559  12.516  -8.342  1.00 0.00 ? 22  PHE A CB   3  
ATOM 3815  C CG   . PHE A 1 22  ? -5.347  12.737  -9.812  1.00 0.00 ? 22  PHE A CG   3  
ATOM 3816  C CD1  . PHE A 1 22  ? -5.801  11.810  -10.737 1.00 0.00 ? 22  PHE A CD1  3  
ATOM 3817  C CD2  . PHE A 1 22  ? -4.694  13.870  -10.269 1.00 0.00 ? 22  PHE A CD2  3  
ATOM 3818  C CE1  . PHE A 1 22  ? -5.608  12.010  -12.092 1.00 0.00 ? 22  PHE A CE1  3  
ATOM 3819  C CE2  . PHE A 1 22  ? -4.499  14.075  -11.622 1.00 0.00 ? 22  PHE A CE2  3  
ATOM 3820  C CZ   . PHE A 1 22  ? -4.955  13.144  -12.534 1.00 0.00 ? 22  PHE A CZ   3  
ATOM 3821  H H    . PHE A 1 22  ? -6.209  10.160  -7.532  1.00 0.00 ? 22  PHE A H    3  
ATOM 3822  H HA   . PHE A 1 22  ? -3.743  11.385  -8.391  1.00 0.00 ? 22  PHE A HA   3  
ATOM 3823  H HB2  . PHE A 1 22  ? -6.570  12.163  -8.202  1.00 0.00 ? 22  PHE A HB2  3  
ATOM 3824  H HB3  . PHE A 1 22  ? -5.442  13.466  -7.842  1.00 0.00 ? 22  PHE A HB3  3  
ATOM 3825  H HD1  . PHE A 1 22  ? -6.312  10.923  -10.392 1.00 0.00 ? 22  PHE A HD1  3  
ATOM 3826  H HD2  . PHE A 1 22  ? -4.336  14.599  -9.557  1.00 0.00 ? 22  PHE A HD2  3  
ATOM 3827  H HE1  . PHE A 1 22  ? -5.966  11.280  -12.802 1.00 0.00 ? 22  PHE A HE1  3  
ATOM 3828  H HE2  . PHE A 1 22  ? -3.988  14.962  -11.966 1.00 0.00 ? 22  PHE A HE2  3  
ATOM 3829  H HZ   . PHE A 1 22  ? -4.804  13.302  -13.592 1.00 0.00 ? 22  PHE A HZ   3  
ATOM 3830  N N    . ARG A 1 23  ? -2.814  12.394  -6.333  1.00 0.00 ? 23  ARG A N    3  
ATOM 3831  C CA   . ARG A 1 23  ? -2.212  12.899  -5.105  1.00 0.00 ? 23  ARG A CA   3  
ATOM 3832  C C    . ARG A 1 23  ? -2.867  14.209  -4.678  1.00 0.00 ? 23  ARG A C    3  
ATOM 3833  O O    . ARG A 1 23  ? -3.346  14.975  -5.513  1.00 0.00 ? 23  ARG A O    3  
ATOM 3834  C CB   . ARG A 1 23  ? -0.709  13.106  -5.295  1.00 0.00 ? 23  ARG A CB   3  
ATOM 3835  C CG   . ARG A 1 23  ? -0.002  11.907  -5.906  1.00 0.00 ? 23  ARG A CG   3  
ATOM 3836  C CD   . ARG A 1 23  ? 1.395   12.269  -6.387  1.00 0.00 ? 23  ARG A CD   3  
ATOM 3837  N NE   . ARG A 1 23  ? 1.392   13.466  -7.224  1.00 0.00 ? 23  ARG A NE   3  
ATOM 3838  C CZ   . ARG A 1 23  ? 2.497   14.084  -7.626  1.00 0.00 ? 23  ARG A CZ   3  
ATOM 3839  N NH1  . ARG A 1 23  ? 3.687   13.620  -7.271  1.00 0.00 ? 23  ARG A NH1  3  
ATOM 3840  N NH2  . ARG A 1 23  ? 2.413   15.168  -8.387  1.00 0.00 ? 23  ARG A NH2  3  
ATOM 3841  H H    . ARG A 1 23  ? -2.265  12.330  -7.143  1.00 0.00 ? 23  ARG A H    3  
ATOM 3842  H HA   . ARG A 1 23  ? -2.370  12.162  -4.331  1.00 0.00 ? 23  ARG A HA   3  
ATOM 3843  H HB2  . ARG A 1 23  ? -0.553  13.956  -5.943  1.00 0.00 ? 23  ARG A HB2  3  
ATOM 3844  H HB3  . ARG A 1 23  ? -0.261  13.309  -4.334  1.00 0.00 ? 23  ARG A HB3  3  
ATOM 3845  H HG2  . ARG A 1 23  ? 0.077   11.129  -5.162  1.00 0.00 ? 23  ARG A HG2  3  
ATOM 3846  H HG3  . ARG A 1 23  ? -0.580  11.548  -6.745  1.00 0.00 ? 23  ARG A HG3  3  
ATOM 3847  H HD2  . ARG A 1 23  ? 2.023   12.445  -5.527  1.00 0.00 ? 23  ARG A HD2  3  
ATOM 3848  H HD3  . ARG A 1 23  ? 1.790   11.442  -6.958  1.00 0.00 ? 23  ARG A HD3  3  
ATOM 3849  H HE   . ARG A 1 23  ? 0.523   13.826  -7.498  1.00 0.00 ? 23  ARG A HE   3  
ATOM 3850  H HH11 . ARG A 1 23  ? 3.753   12.803  -6.699  1.00 0.00 ? 23  ARG A HH11 3  
ATOM 3851  H HH12 . ARG A 1 23  ? 4.517   14.086  -7.576  1.00 0.00 ? 23  ARG A HH12 3  
ATOM 3852  H HH21 . ARG A 1 23  ? 1.518   15.521  -8.657  1.00 0.00 ? 23  ARG A HH21 3  
ATOM 3853  H HH22 . ARG A 1 23  ? 3.245   15.632  -8.689  1.00 0.00 ? 23  ARG A HH22 3  
ATOM 3854  N N    . GLU A 1 24  ? -2.883  14.459  -3.372  1.00 0.00 ? 24  GLU A N    3  
ATOM 3855  C CA   . GLU A 1 24  ? -3.480  15.676  -2.835  1.00 0.00 ? 24  GLU A CA   3  
ATOM 3856  C C    . GLU A 1 24  ? -2.423  16.553  -2.170  1.00 0.00 ? 24  GLU A C    3  
ATOM 3857  O O    . GLU A 1 24  ? -1.418  16.070  -1.649  1.00 0.00 ? 24  GLU A O    3  
ATOM 3858  C CB   . GLU A 1 24  ? -4.579  15.330  -1.828  1.00 0.00 ? 24  GLU A CB   3  
ATOM 3859  C CG   . GLU A 1 24  ? -5.953  15.168  -2.457  1.00 0.00 ? 24  GLU A CG   3  
ATOM 3860  C CD   . GLU A 1 24  ? -6.532  16.484  -2.940  1.00 0.00 ? 24  GLU A CD   3  
ATOM 3861  O OE1  . GLU A 1 24  ? -7.191  17.173  -2.133  1.00 0.00 ? 24  GLU A OE1  3  
ATOM 3862  O OE2  . GLU A 1 24  ? -6.328  16.824  -4.123  1.00 0.00 ? 24  GLU A OE2  3  
ATOM 3863  H H    . GLU A 1 24  ? -2.485  13.809  -2.756  1.00 0.00 ? 24  GLU A H    3  
ATOM 3864  H HA   . GLU A 1 24  ? -3.918  16.222  -3.658  1.00 0.00 ? 24  GLU A HA   3  
ATOM 3865  H HB2  . GLU A 1 24  ? -4.320  14.405  -1.334  1.00 0.00 ? 24  GLU A HB2  3  
ATOM 3866  H HB3  . GLU A 1 24  ? -4.635  16.118  -1.091  1.00 0.00 ? 24  GLU A HB3  3  
ATOM 3867  H HG2  . GLU A 1 24  ? -5.872  14.498  -3.300  1.00 0.00 ? 24  GLU A HG2  3  
ATOM 3868  H HG3  . GLU A 1 24  ? -6.623  14.744  -1.724  1.00 0.00 ? 24  GLU A HG3  3  
ATOM 3869  N N    . PRO A 1 25  ? -2.654  17.874  -2.189  1.00 0.00 ? 25  PRO A N    3  
ATOM 3870  C CA   . PRO A 1 25  ? -1.734  18.847  -1.593  1.00 0.00 ? 25  PRO A CA   3  
ATOM 3871  C C    . PRO A 1 25  ? -1.718  18.773  -0.070  1.00 0.00 ? 25  PRO A C    3  
ATOM 3872  O O    . PRO A 1 25  ? -0.942  18.019  0.516   1.00 0.00 ? 25  PRO A O    3  
ATOM 3873  C CB   . PRO A 1 25  ? -2.293  20.195  -2.057  1.00 0.00 ? 25  PRO A CB   3  
ATOM 3874  C CG   . PRO A 1 25  ? -3.740  19.939  -2.305  1.00 0.00 ? 25  PRO A CG   3  
ATOM 3875  C CD   . PRO A 1 25  ? -3.832  18.520  -2.794  1.00 0.00 ? 25  PRO A CD   3  
ATOM 3876  H HA   . PRO A 1 25  ? -0.729  18.724  -1.969  1.00 0.00 ? 25  PRO A HA   3  
ATOM 3877  H HB2  . PRO A 1 25  ? -2.149  20.933  -1.281  1.00 0.00 ? 25  PRO A HB2  3  
ATOM 3878  H HB3  . PRO A 1 25  ? -1.787  20.508  -2.958  1.00 0.00 ? 25  PRO A HB3  3  
ATOM 3879  H HG2  . PRO A 1 25  ? -4.296  20.057  -1.388  1.00 0.00 ? 25  PRO A HG2  3  
ATOM 3880  H HG3  . PRO A 1 25  ? -4.108  20.619  -3.059  1.00 0.00 ? 25  PRO A HG3  3  
ATOM 3881  H HD2  . PRO A 1 25  ? -4.745  18.060  -2.446  1.00 0.00 ? 25  PRO A HD2  3  
ATOM 3882  H HD3  . PRO A 1 25  ? -3.777  18.488  -3.872  1.00 0.00 ? 25  PRO A HD3  3  
ATOM 3883  N N    . ASN A 1 26  ? -2.581  19.560  0.565   1.00 0.00 ? 26  ASN A N    3  
ATOM 3884  C CA   . ASN A 1 26  ? -2.665  19.582  2.021   1.00 0.00 ? 26  ASN A CA   3  
ATOM 3885  C C    . ASN A 1 26  ? -2.729  18.166  2.584   1.00 0.00 ? 26  ASN A C    3  
ATOM 3886  O O    . ASN A 1 26  ? -2.172  17.882  3.644   1.00 0.00 ? 26  ASN A O    3  
ATOM 3887  C CB   . ASN A 1 26  ? -3.893  20.377  2.469   1.00 0.00 ? 26  ASN A CB   3  
ATOM 3888  C CG   . ASN A 1 26  ? -3.592  21.852  2.654   1.00 0.00 ? 26  ASN A CG   3  
ATOM 3889  O OD1  . ASN A 1 26  ? -2.751  22.227  3.471   1.00 0.00 ? 26  ASN A OD1  3  
ATOM 3890  N ND2  . ASN A 1 26  ? -4.278  22.696  1.893   1.00 0.00 ? 26  ASN A ND2  3  
ATOM 3891  H H    . ASN A 1 26  ? -3.174  20.139  0.043   1.00 0.00 ? 26  ASN A H    3  
ATOM 3892  H HA   . ASN A 1 26  ? -1.777  20.067  2.397   1.00 0.00 ? 26  ASN A HA   3  
ATOM 3893  H HB2  . ASN A 1 26  ? -4.669  20.279  1.724   1.00 0.00 ? 26  ASN A HB2  3  
ATOM 3894  H HB3  . ASN A 1 26  ? -4.249  19.981  3.408   1.00 0.00 ? 26  ASN A HB3  3  
ATOM 3895  H HD21 . ASN A 1 26  ? -4.932  22.326  1.264   1.00 0.00 ? 26  ASN A HD21 3  
ATOM 3896  H HD22 . ASN A 1 26  ? -4.103  23.655  1.992   1.00 0.00 ? 26  ASN A HD22 3  
ATOM 3897  N N    . VAL A 1 27  ? -3.413  17.280  1.867   1.00 0.00 ? 27  VAL A N    3  
ATOM 3898  C CA   . VAL A 1 27  ? -3.549  15.892  2.293   1.00 0.00 ? 27  VAL A CA   3  
ATOM 3899  C C    . VAL A 1 27  ? -2.870  14.946  1.310   1.00 0.00 ? 27  VAL A C    3  
ATOM 3900  O O    . VAL A 1 27  ? -2.844  15.199  0.105   1.00 0.00 ? 27  VAL A O    3  
ATOM 3901  C CB   . VAL A 1 27  ? -5.029  15.491  2.436   1.00 0.00 ? 27  VAL A CB   3  
ATOM 3902  C CG1  . VAL A 1 27  ? -5.710  15.472  1.076   1.00 0.00 ? 27  VAL A CG1  3  
ATOM 3903  C CG2  . VAL A 1 27  ? -5.151  14.139  3.121   1.00 0.00 ? 27  VAL A CG2  3  
ATOM 3904  H H    . VAL A 1 27  ? -3.835  17.566  1.030   1.00 0.00 ? 27  VAL A H    3  
ATOM 3905  H HA   . VAL A 1 27  ? -3.076  15.792  3.259   1.00 0.00 ? 27  VAL A HA   3  
ATOM 3906  H HB   . VAL A 1 27  ? -5.524  16.229  3.050   1.00 0.00 ? 27  VAL A HB   3  
ATOM 3907  H HG11 . VAL A 1 27  ? -5.645  16.452  0.626   1.00 0.00 ? 27  VAL A HG11 3  
ATOM 3908  H HG12 . VAL A 1 27  ? -5.223  14.749  0.439   1.00 0.00 ? 27  VAL A HG12 3  
ATOM 3909  H HG13 . VAL A 1 27  ? -6.749  15.202  1.198   1.00 0.00 ? 27  VAL A HG13 3  
ATOM 3910  H HG21 . VAL A 1 27  ? -6.044  13.639  2.777   1.00 0.00 ? 27  VAL A HG21 3  
ATOM 3911  H HG22 . VAL A 1 27  ? -4.287  13.537  2.884   1.00 0.00 ? 27  VAL A HG22 3  
ATOM 3912  H HG23 . VAL A 1 27  ? -5.207  14.281  4.191   1.00 0.00 ? 27  VAL A HG23 3  
ATOM 3913  N N    . SER A 1 28  ? -2.321  13.854  1.831   1.00 0.00 ? 28  SER A N    3  
ATOM 3914  C CA   . SER A 1 28  ? -1.638  12.870  0.999   1.00 0.00 ? 28  SER A CA   3  
ATOM 3915  C C    . SER A 1 28  ? -2.642  11.953  0.306   1.00 0.00 ? 28  SER A C    3  
ATOM 3916  O O    . SER A 1 28  ? -3.840  12.236  0.277   1.00 0.00 ? 28  SER A O    3  
ATOM 3917  C CB   . SER A 1 28  ? -0.671  12.039  1.845   1.00 0.00 ? 28  SER A CB   3  
ATOM 3918  O OG   . SER A 1 28  ? 0.445   11.618  1.079   1.00 0.00 ? 28  SER A OG   3  
ATOM 3919  H H    . SER A 1 28  ? -2.374  13.707  2.799   1.00 0.00 ? 28  SER A H    3  
ATOM 3920  H HA   . SER A 1 28  ? -1.076  13.404  0.247   1.00 0.00 ? 28  SER A HA   3  
ATOM 3921  H HB2  . SER A 1 28  ? -0.319  12.633  2.674   1.00 0.00 ? 28  SER A HB2  3  
ATOM 3922  H HB3  . SER A 1 28  ? -1.185  11.166  2.221   1.00 0.00 ? 28  SER A HB3  3  
ATOM 3923  H HG   . SER A 1 28  ? 1.042   12.358  0.950   1.00 0.00 ? 28  SER A HG   3  
ATOM 3924  N N    . LEU A 1 29  ? -2.144  10.855  -0.251  1.00 0.00 ? 29  LEU A N    3  
ATOM 3925  C CA   . LEU A 1 29  ? -2.996  9.895   -0.944  1.00 0.00 ? 29  LEU A CA   3  
ATOM 3926  C C    . LEU A 1 29  ? -4.026  9.295   0.007   1.00 0.00 ? 29  LEU A C    3  
ATOM 3927  O O    . LEU A 1 29  ? -5.123  8.920   -0.406  1.00 0.00 ? 29  LEU A O    3  
ATOM 3928  C CB   . LEU A 1 29  ? -2.147  8.783   -1.563  1.00 0.00 ? 29  LEU A CB   3  
ATOM 3929  C CG   . LEU A 1 29  ? -1.799  8.949   -3.043  1.00 0.00 ? 29  LEU A CG   3  
ATOM 3930  C CD1  . LEU A 1 29  ? -1.221  7.658   -3.602  1.00 0.00 ? 29  LEU A CD1  3  
ATOM 3931  C CD2  . LEU A 1 29  ? -3.027  9.372   -3.835  1.00 0.00 ? 29  LEU A CD2  3  
ATOM 3932  H H    . LEU A 1 29  ? -1.181  10.684  -0.195  1.00 0.00 ? 29  LEU A H    3  
ATOM 3933  H HA   . LEU A 1 29  ? -3.515  10.422  -1.732  1.00 0.00 ? 29  LEU A HA   3  
ATOM 3934  H HB2  . LEU A 1 29  ? -1.222  8.728   -1.010  1.00 0.00 ? 29  LEU A HB2  3  
ATOM 3935  H HB3  . LEU A 1 29  ? -2.688  7.854   -1.451  1.00 0.00 ? 29  LEU A HB3  3  
ATOM 3936  H HG   . LEU A 1 29  ? -1.050  9.722   -3.146  1.00 0.00 ? 29  LEU A HG   3  
ATOM 3937  H HD11 . LEU A 1 29  ? -1.751  7.387   -4.502  1.00 0.00 ? 29  LEU A HD11 3  
ATOM 3938  H HD12 . LEU A 1 29  ? -1.325  6.870   -2.871  1.00 0.00 ? 29  LEU A HD12 3  
ATOM 3939  H HD13 . LEU A 1 29  ? -0.174  7.802   -3.829  1.00 0.00 ? 29  LEU A HD13 3  
ATOM 3940  H HD21 . LEU A 1 29  ? -3.178  10.436  -3.724  1.00 0.00 ? 29  LEU A HD21 3  
ATOM 3941  H HD22 . LEU A 1 29  ? -3.894  8.845   -3.465  1.00 0.00 ? 29  LEU A HD22 3  
ATOM 3942  H HD23 . LEU A 1 29  ? -2.881  9.136   -4.879  1.00 0.00 ? 29  LEU A HD23 3  
ATOM 3943  N N    . GLY A 1 30  ? -3.666  9.209   1.284   1.00 0.00 ? 30  GLY A N    3  
ATOM 3944  C CA   . GLY A 1 30  ? -4.571  8.655   2.274   1.00 0.00 ? 30  GLY A CA   3  
ATOM 3945  C C    . GLY A 1 30  ? -4.427  7.153   2.416   1.00 0.00 ? 30  GLY A C    3  
ATOM 3946  O O    . GLY A 1 30  ? -5.270  6.497   3.029   1.00 0.00 ? 30  GLY A O    3  
ATOM 3947  H H    . GLY A 1 30  ? -2.779  9.524   1.556   1.00 0.00 ? 30  GLY A H    3  
ATOM 3948  H HA2  . GLY A 1 30  ? -4.369  9.118   3.229   1.00 0.00 ? 30  GLY A HA2  3  
ATOM 3949  H HA3  . GLY A 1 30  ? -5.587  8.882   1.984   1.00 0.00 ? 30  GLY A HA3  3  
ATOM 3950  N N    . ILE A 1 31  ? -3.358  6.607   1.846   1.00 0.00 ? 31  ILE A N    3  
ATOM 3951  C CA   . ILE A 1 31  ? -3.108  5.172   1.911   1.00 0.00 ? 31  ILE A CA   3  
ATOM 3952  C C    . ILE A 1 31  ? -1.877  4.867   2.758   1.00 0.00 ? 31  ILE A C    3  
ATOM 3953  O O    . ILE A 1 31  ? -0.940  5.664   2.819   1.00 0.00 ? 31  ILE A O    3  
ATOM 3954  C CB   . ILE A 1 31  ? -2.914  4.570   0.507   1.00 0.00 ? 31  ILE A CB   3  
ATOM 3955  C CG1  . ILE A 1 31  ? -3.959  5.130   -0.460  1.00 0.00 ? 31  ILE A CG1  3  
ATOM 3956  C CG2  . ILE A 1 31  ? -2.998  3.052   0.566   1.00 0.00 ? 31  ILE A CG2  3  
ATOM 3957  C CD1  . ILE A 1 31  ? -3.711  4.750   -1.903  1.00 0.00 ? 31  ILE A CD1  3  
ATOM 3958  H H    . ILE A 1 31  ? -2.723  7.182   1.371   1.00 0.00 ? 31  ILE A H    3  
ATOM 3959  H HA   . ILE A 1 31  ? -3.969  4.704   2.366   1.00 0.00 ? 31  ILE A HA   3  
ATOM 3960  H HB   . ILE A 1 31  ? -1.929  4.839   0.158   1.00 0.00 ? 31  ILE A HB   3  
ATOM 3961  H HG12 . ILE A 1 31  ? -4.933  4.759   -0.183  1.00 0.00 ? 31  ILE A HG12 3  
ATOM 3962  H HG13 . ILE A 1 31  ? -3.956  6.209   -0.396  1.00 0.00 ? 31  ILE A HG13 3  
ATOM 3963  H HG21 . ILE A 1 31  ? -2.039  2.649   0.857   1.00 0.00 ? 31  ILE A HG21 3  
ATOM 3964  H HG22 . ILE A 1 31  ? -3.745  2.761   1.290   1.00 0.00 ? 31  ILE A HG22 3  
ATOM 3965  H HG23 . ILE A 1 31  ? -3.270  2.669   -0.406  1.00 0.00 ? 31  ILE A HG23 3  
ATOM 3966  H HD11 . ILE A 1 31  ? -3.807  5.626   -2.528  1.00 0.00 ? 31  ILE A HD11 3  
ATOM 3967  H HD12 . ILE A 1 31  ? -2.714  4.346   -2.004  1.00 0.00 ? 31  ILE A HD12 3  
ATOM 3968  H HD13 . ILE A 1 31  ? -4.433  4.009   -2.210  1.00 0.00 ? 31  ILE A HD13 3  
ATOM 3969  N N    . SER A 1 32  ? -1.884  3.708   3.408   1.00 0.00 ? 32  SER A N    3  
ATOM 3970  C CA   . SER A 1 32  ? -0.769  3.298   4.252   1.00 0.00 ? 32  SER A CA   3  
ATOM 3971  C C    . SER A 1 32  ? -0.374  1.852   3.967   1.00 0.00 ? 32  SER A C    3  
ATOM 3972  O O    . SER A 1 32  ? -1.064  1.142   3.234   1.00 0.00 ? 32  SER A O    3  
ATOM 3973  C CB   . SER A 1 32  ? -1.135  3.456   5.729   1.00 0.00 ? 32  SER A CB   3  
ATOM 3974  O OG   . SER A 1 32  ? -1.368  4.816   6.054   1.00 0.00 ? 32  SER A OG   3  
ATOM 3975  H H    . SER A 1 32  ? -2.661  3.116   3.319   1.00 0.00 ? 32  SER A H    3  
ATOM 3976  H HA   . SER A 1 32  ? 0.071   3.938   4.027   1.00 0.00 ? 32  SER A HA   3  
ATOM 3977  H HB2  . SER A 1 32  ? -2.030  2.891   5.939   1.00 0.00 ? 32  SER A HB2  3  
ATOM 3978  H HB3  . SER A 1 32  ? -0.324  3.086   6.340   1.00 0.00 ? 32  SER A HB3  3  
ATOM 3979  H HG   . SER A 1 32  ? -1.764  4.874   6.927   1.00 0.00 ? 32  SER A HG   3  
ATOM 3980  N N    . ILE A 1 33  ? 0.739   1.423   4.551   1.00 0.00 ? 33  ILE A N    3  
ATOM 3981  C CA   . ILE A 1 33  ? 1.226   0.062   4.361   1.00 0.00 ? 33  ILE A CA   3  
ATOM 3982  C C    . ILE A 1 33  ? 1.861   -0.478  5.638   1.00 0.00 ? 33  ILE A C    3  
ATOM 3983  O O    . ILE A 1 33  ? 2.433   0.275   6.426   1.00 0.00 ? 33  ILE A O    3  
ATOM 3984  C CB   . ILE A 1 33  ? 2.254   -0.014  3.217   1.00 0.00 ? 33  ILE A CB   3  
ATOM 3985  C CG1  . ILE A 1 33  ? 3.356   1.027   3.423   1.00 0.00 ? 33  ILE A CG1  3  
ATOM 3986  C CG2  . ILE A 1 33  ? 1.569   0.191   1.874   1.00 0.00 ? 33  ILE A CG2  3  
ATOM 3987  C CD1  . ILE A 1 33  ? 4.552   0.828   2.519   1.00 0.00 ? 33  ILE A CD1  3  
ATOM 3988  H H    . ILE A 1 33  ? 1.246   2.036   5.124   1.00 0.00 ? 33  ILE A H    3  
ATOM 3989  H HA   . ILE A 1 33  ? 0.381   -0.560  4.101   1.00 0.00 ? 33  ILE A HA   3  
ATOM 3990  H HB   . ILE A 1 33  ? 2.694   -1.000  3.223   1.00 0.00 ? 33  ILE A HB   3  
ATOM 3991  H HG12 . ILE A 1 33  ? 2.956   2.009   3.231   1.00 0.00 ? 33  ILE A HG12 3  
ATOM 3992  H HG13 . ILE A 1 33  ? 3.701   0.977   4.446   1.00 0.00 ? 33  ILE A HG13 3  
ATOM 3993  H HG21 . ILE A 1 33  ? 0.965   1.086   1.911   1.00 0.00 ? 33  ILE A HG21 3  
ATOM 3994  H HG22 . ILE A 1 33  ? 2.316   0.294   1.101   1.00 0.00 ? 33  ILE A HG22 3  
ATOM 3995  H HG23 . ILE A 1 33  ? 0.940   -0.658  1.657   1.00 0.00 ? 33  ILE A HG23 3  
ATOM 3996  H HD11 . ILE A 1 33  ? 5.460   0.995   3.080   1.00 0.00 ? 33  ILE A HD11 3  
ATOM 3997  H HD12 . ILE A 1 33  ? 4.549   -0.181  2.133   1.00 0.00 ? 33  ILE A HD12 3  
ATOM 3998  H HD13 . ILE A 1 33  ? 4.504   1.528   1.698   1.00 0.00 ? 33  ILE A HD13 3  
ATOM 3999  N N    . VAL A 1 34  ? 1.759   -1.789  5.834   1.00 0.00 ? 34  VAL A N    3  
ATOM 4000  C CA   . VAL A 1 34  ? 2.326   -2.432  7.014   1.00 0.00 ? 34  VAL A CA   3  
ATOM 4001  C C    . VAL A 1 34  ? 3.635   -3.139  6.679   1.00 0.00 ? 34  VAL A C    3  
ATOM 4002  O O    . VAL A 1 34  ? 4.067   -3.153  5.527   1.00 0.00 ? 34  VAL A O    3  
ATOM 4003  C CB   . VAL A 1 34  ? 1.346   -3.451  7.624   1.00 0.00 ? 34  VAL A CB   3  
ATOM 4004  C CG1  . VAL A 1 34  ? -0.092  -3.045  7.339   1.00 0.00 ? 34  VAL A CG1  3  
ATOM 4005  C CG2  . VAL A 1 34  ? 1.630   -4.847  7.091   1.00 0.00 ? 34  VAL A CG2  3  
ATOM 4006  H H    . VAL A 1 34  ? 1.292   -2.337  5.170   1.00 0.00 ? 34  VAL A H    3  
ATOM 4007  H HA   . VAL A 1 34  ? 2.521   -1.665  7.750   1.00 0.00 ? 34  VAL A HA   3  
ATOM 4008  H HB   . VAL A 1 34  ? 1.489   -3.461  8.694   1.00 0.00 ? 34  VAL A HB   3  
ATOM 4009  H HG11 . VAL A 1 34  ? -0.191  -2.777  6.298   1.00 0.00 ? 34  VAL A HG11 3  
ATOM 4010  H HG12 . VAL A 1 34  ? -0.751  -3.872  7.564   1.00 0.00 ? 34  VAL A HG12 3  
ATOM 4011  H HG13 . VAL A 1 34  ? -0.355  -2.198  7.955   1.00 0.00 ? 34  VAL A HG13 3  
ATOM 4012  H HG21 . VAL A 1 34  ? 2.569   -5.201  7.490   1.00 0.00 ? 34  VAL A HG21 3  
ATOM 4013  H HG22 . VAL A 1 34  ? 0.836   -5.515  7.391   1.00 0.00 ? 34  VAL A HG22 3  
ATOM 4014  H HG23 . VAL A 1 34  ? 1.686   -4.817  6.012   1.00 0.00 ? 34  VAL A HG23 3  
ATOM 4015  N N    . GLY A 1 35  ? 4.261   -3.726  7.694   1.00 0.00 ? 35  GLY A N    3  
ATOM 4016  C CA   . GLY A 1 35  ? 5.514   -4.428  7.487   1.00 0.00 ? 35  GLY A CA   3  
ATOM 4017  C C    . GLY A 1 35  ? 6.499   -3.623  6.662   1.00 0.00 ? 35  GLY A C    3  
ATOM 4018  O O    . GLY A 1 35  ? 6.580   -2.403  6.795   1.00 0.00 ? 35  GLY A O    3  
ATOM 4019  H H    . GLY A 1 35  ? 3.868   -3.682  8.591   1.00 0.00 ? 35  GLY A H    3  
ATOM 4020  H HA2  . GLY A 1 35  ? 5.956   -4.644  8.448   1.00 0.00 ? 35  GLY A HA2  3  
ATOM 4021  H HA3  . GLY A 1 35  ? 5.312   -5.359  6.977   1.00 0.00 ? 35  GLY A HA3  3  
ATOM 4022  N N    . GLY A 1 36  ? 7.253   -4.309  5.808   1.00 0.00 ? 36  GLY A N    3  
ATOM 4023  C CA   . GLY A 1 36  ? 8.230   -3.635  4.973   1.00 0.00 ? 36  GLY A CA   3  
ATOM 4024  C C    . GLY A 1 36  ? 9.529   -3.363  5.705   1.00 0.00 ? 36  GLY A C    3  
ATOM 4025  O O    . GLY A 1 36  ? 9.536   -3.174  6.921   1.00 0.00 ? 36  GLY A O    3  
ATOM 4026  H H    . GLY A 1 36  ? 7.145   -5.282  5.745   1.00 0.00 ? 36  GLY A H    3  
ATOM 4027  H HA2  . GLY A 1 36  ? 8.436   -4.250  4.111   1.00 0.00 ? 36  GLY A HA2  3  
ATOM 4028  H HA3  . GLY A 1 36  ? 7.814   -2.695  4.641   1.00 0.00 ? 36  GLY A HA3  3  
ATOM 4029  N N    . GLN A 1 37  ? 10.631  -3.344  4.963   1.00 0.00 ? 37  GLN A N    3  
ATOM 4030  C CA   . GLN A 1 37  ? 11.943  -3.095  5.550   1.00 0.00 ? 37  GLN A CA   3  
ATOM 4031  C C    . GLN A 1 37  ? 12.309  -4.189  6.547   1.00 0.00 ? 37  GLN A C    3  
ATOM 4032  O O    . GLN A 1 37  ? 12.620  -3.910  7.706   1.00 0.00 ? 37  GLN A O    3  
ATOM 4033  C CB   . GLN A 1 37  ? 11.965  -1.731  6.241   1.00 0.00 ? 37  GLN A CB   3  
ATOM 4034  C CG   . GLN A 1 37  ? 12.322  -0.583  5.309   1.00 0.00 ? 37  GLN A CG   3  
ATOM 4035  C CD   . GLN A 1 37  ? 12.541  0.722   6.049   1.00 0.00 ? 37  GLN A CD   3  
ATOM 4036  O OE1  . GLN A 1 37  ? 13.589  1.355   5.918   1.00 0.00 ? 37  GLN A OE1  3  
ATOM 4037  N NE2  . GLN A 1 37  ? 11.551  1.132   6.832   1.00 0.00 ? 37  GLN A NE2  3  
ATOM 4038  H H    . GLN A 1 37  ? 10.561  -3.501  3.999   1.00 0.00 ? 37  GLN A H    3  
ATOM 4039  H HA   . GLN A 1 37  ? 12.669  -3.096  4.751   1.00 0.00 ? 37  GLN A HA   3  
ATOM 4040  H HB2  . GLN A 1 37  ? 10.989  -1.536  6.659   1.00 0.00 ? 37  GLN A HB2  3  
ATOM 4041  H HB3  . GLN A 1 37  ? 12.692  -1.757  7.039   1.00 0.00 ? 37  GLN A HB3  3  
ATOM 4042  H HG2  . GLN A 1 37  ? 13.229  -0.835  4.780   1.00 0.00 ? 37  GLN A HG2  3  
ATOM 4043  H HG3  . GLN A 1 37  ? 11.518  -0.449  4.601   1.00 0.00 ? 37  GLN A HG3  3  
ATOM 4044  H HE21 . GLN A 1 37  ? 10.745  0.576   6.889   1.00 0.00 ? 37  GLN A HE21 3  
ATOM 4045  H HE22 . GLN A 1 37  ? 11.666  1.972   7.322   1.00 0.00 ? 37  GLN A HE22 3  
ATOM 4046  N N    . THR A 1 38  ? 12.270  -5.437  6.090   1.00 0.00 ? 38  THR A N    3  
ATOM 4047  C CA   . THR A 1 38  ? 12.596  -6.574  6.942   1.00 0.00 ? 38  THR A CA   3  
ATOM 4048  C C    . THR A 1 38  ? 13.706  -7.420  6.329   1.00 0.00 ? 38  THR A C    3  
ATOM 4049  O O    . THR A 1 38  ? 14.389  -8.168  7.030   1.00 0.00 ? 38  THR A O    3  
ATOM 4050  C CB   . THR A 1 38  ? 11.363  -7.464  7.187   1.00 0.00 ? 38  THR A CB   3  
ATOM 4051  O OG1  . THR A 1 38  ? 11.771  -8.734  7.707   1.00 0.00 ? 38  THR A OG1  3  
ATOM 4052  C CG2  . THR A 1 38  ? 10.577  -7.667  5.900   1.00 0.00 ? 38  THR A CG2  3  
ATOM 4053  H H    . THR A 1 38  ? 12.015  -5.596  5.157   1.00 0.00 ? 38  THR A H    3  
ATOM 4054  H HA   . THR A 1 38  ? 12.932  -6.191  7.895   1.00 0.00 ? 38  THR A HA   3  
ATOM 4055  H HB   . THR A 1 38  ? 10.723  -6.977  7.909   1.00 0.00 ? 38  THR A HB   3  
ATOM 4056  H HG1  . THR A 1 38  ? 11.017  -9.173  8.110   1.00 0.00 ? 38  THR A HG1  3  
ATOM 4057  H HG21 . THR A 1 38  ? 10.006  -6.776  5.684   1.00 0.00 ? 38  THR A HG21 3  
ATOM 4058  H HG22 . THR A 1 38  ? 9.906   -8.505  6.016   1.00 0.00 ? 38  THR A HG22 3  
ATOM 4059  H HG23 . THR A 1 38  ? 11.261  -7.862  5.088   1.00 0.00 ? 38  THR A HG23 3  
ATOM 4060  N N    . VAL A 1 39  ? 13.881  -7.297  5.018   1.00 0.00 ? 39  VAL A N    3  
ATOM 4061  C CA   . VAL A 1 39  ? 14.911  -8.050  4.310   1.00 0.00 ? 39  VAL A CA   3  
ATOM 4062  C C    . VAL A 1 39  ? 15.293  -7.364  3.004   1.00 0.00 ? 39  VAL A C    3  
ATOM 4063  O O    . VAL A 1 39  ? 14.431  -6.880  2.270   1.00 0.00 ? 39  VAL A O    3  
ATOM 4064  C CB   . VAL A 1 39  ? 14.446  -9.487  4.006   1.00 0.00 ? 39  VAL A CB   3  
ATOM 4065  C CG1  . VAL A 1 39  ? 15.290  -10.098 2.898   1.00 0.00 ? 39  VAL A CG1  3  
ATOM 4066  C CG2  . VAL A 1 39  ? 14.503  -10.342 5.264   1.00 0.00 ? 39  VAL A CG2  3  
ATOM 4067  H H    . VAL A 1 39  ? 13.306  -6.685  4.513   1.00 0.00 ? 39  VAL A H    3  
ATOM 4068  H HA   . VAL A 1 39  ? 15.782  -8.103  4.947   1.00 0.00 ? 39  VAL A HA   3  
ATOM 4069  H HB   . VAL A 1 39  ? 13.421  -9.448  3.668   1.00 0.00 ? 39  VAL A HB   3  
ATOM 4070  H HG11 . VAL A 1 39  ? 14.903  -9.787  1.939   1.00 0.00 ? 39  VAL A HG11 3  
ATOM 4071  H HG12 . VAL A 1 39  ? 16.313  -9.766  3.000   1.00 0.00 ? 39  VAL A HG12 3  
ATOM 4072  H HG13 . VAL A 1 39  ? 15.251  -11.175 2.969   1.00 0.00 ? 39  VAL A HG13 3  
ATOM 4073  H HG21 . VAL A 1 39  ? 15.396  -10.104 5.821   1.00 0.00 ? 39  VAL A HG21 3  
ATOM 4074  H HG22 . VAL A 1 39  ? 13.634  -10.143 5.872   1.00 0.00 ? 39  VAL A HG22 3  
ATOM 4075  H HG23 . VAL A 1 39  ? 14.518  -11.386 4.989   1.00 0.00 ? 39  VAL A HG23 3  
ATOM 4076  N N    . ILE A 1 40  ? 16.590  -7.327  2.719   1.00 0.00 ? 40  ILE A N    3  
ATOM 4077  C CA   . ILE A 1 40  ? 17.086  -6.701  1.499   1.00 0.00 ? 40  ILE A CA   3  
ATOM 4078  C C    . ILE A 1 40  ? 17.787  -7.719  0.606   1.00 0.00 ? 40  ILE A C    3  
ATOM 4079  O O    . ILE A 1 40  ? 17.931  -7.509  -0.599  1.00 0.00 ? 40  ILE A O    3  
ATOM 4080  C CB   . ILE A 1 40  ? 18.062  -5.552  1.813   1.00 0.00 ? 40  ILE A CB   3  
ATOM 4081  C CG1  . ILE A 1 40  ? 17.334  -4.420  2.541   1.00 0.00 ? 40  ILE A CG1  3  
ATOM 4082  C CG2  . ILE A 1 40  ? 18.705  -5.039  0.533   1.00 0.00 ? 40  ILE A CG2  3  
ATOM 4083  C CD1  . ILE A 1 40  ? 18.245  -3.571  3.400   1.00 0.00 ? 40  ILE A CD1  3  
ATOM 4084  H H    . ILE A 1 40  ? 17.229  -7.730  3.343   1.00 0.00 ? 40  ILE A H    3  
ATOM 4085  H HA   . ILE A 1 40  ? 16.240  -6.293  0.966   1.00 0.00 ? 40  ILE A HA   3  
ATOM 4086  H HB   . ILE A 1 40  ? 18.844  -5.937  2.451   1.00 0.00 ? 40  ILE A HB   3  
ATOM 4087  H HG12 . ILE A 1 40  ? 16.868  -3.774  1.814   1.00 0.00 ? 40  ILE A HG12 3  
ATOM 4088  H HG13 . ILE A 1 40  ? 16.574  -4.844  3.181   1.00 0.00 ? 40  ILE A HG13 3  
ATOM 4089  H HG21 . ILE A 1 40  ? 19.261  -4.137  0.746   1.00 0.00 ? 40  ILE A HG21 3  
ATOM 4090  H HG22 . ILE A 1 40  ? 19.375  -5.789  0.141   1.00 0.00 ? 40  ILE A HG22 3  
ATOM 4091  H HG23 . ILE A 1 40  ? 17.937  -4.825  -0.195  1.00 0.00 ? 40  ILE A HG23 3  
ATOM 4092  H HD11 . ILE A 1 40  ? 19.118  -3.288  2.830   1.00 0.00 ? 40  ILE A HD11 3  
ATOM 4093  H HD12 . ILE A 1 40  ? 17.718  -2.681  3.714   1.00 0.00 ? 40  ILE A HD12 3  
ATOM 4094  H HD13 . ILE A 1 40  ? 18.550  -4.134  4.269   1.00 0.00 ? 40  ILE A HD13 3  
ATOM 4095  N N    . LYS A 1 41  ? 18.221  -8.823  1.204   1.00 0.00 ? 41  LYS A N    3  
ATOM 4096  C CA   . LYS A 1 41  ? 18.905  -9.877  0.463   1.00 0.00 ? 41  LYS A CA   3  
ATOM 4097  C C    . LYS A 1 41  ? 18.207  -11.219 0.657   1.00 0.00 ? 41  LYS A C    3  
ATOM 4098  O O    . LYS A 1 41  ? 17.465  -11.410 1.621   1.00 0.00 ? 41  LYS A O    3  
ATOM 4099  C CB   . LYS A 1 41  ? 20.364  -9.979  0.911   1.00 0.00 ? 41  LYS A CB   3  
ATOM 4100  C CG   . LYS A 1 41  ? 20.967  -8.649  1.330   1.00 0.00 ? 41  LYS A CG   3  
ATOM 4101  C CD   . LYS A 1 41  ? 20.627  -8.313  2.773   1.00 0.00 ? 41  LYS A CD   3  
ATOM 4102  C CE   . LYS A 1 41  ? 21.672  -7.397  3.392   1.00 0.00 ? 41  LYS A CE   3  
ATOM 4103  N NZ   . LYS A 1 41  ? 21.121  -6.625  4.540   1.00 0.00 ? 41  LYS A NZ   3  
ATOM 4104  H H    . LYS A 1 41  ? 18.077  -8.933  2.167   1.00 0.00 ? 41  LYS A H    3  
ATOM 4105  H HA   . LYS A 1 41  ? 18.876  -9.618  -0.585  1.00 0.00 ? 41  LYS A HA   3  
ATOM 4106  H HB2  . LYS A 1 41  ? 20.425  -10.658 1.749   1.00 0.00 ? 41  LYS A HB2  3  
ATOM 4107  H HB3  . LYS A 1 41  ? 20.952  -10.375 0.095   1.00 0.00 ? 41  LYS A HB3  3  
ATOM 4108  H HG2  . LYS A 1 41  ? 22.040  -8.702  1.227   1.00 0.00 ? 41  LYS A HG2  3  
ATOM 4109  H HG3  . LYS A 1 41  ? 20.579  -7.871  0.688   1.00 0.00 ? 41  LYS A HG3  3  
ATOM 4110  H HD2  . LYS A 1 41  ? 19.668  -7.819  2.802   1.00 0.00 ? 41  LYS A HD2  3  
ATOM 4111  H HD3  . LYS A 1 41  ? 20.580  -9.229  3.345   1.00 0.00 ? 41  LYS A HD3  3  
ATOM 4112  H HE2  . LYS A 1 41  ? 22.499  -7.998  3.738   1.00 0.00 ? 41  LYS A HE2  3  
ATOM 4113  H HE3  . LYS A 1 41  ? 22.018  -6.707  2.638   1.00 0.00 ? 41  LYS A HE3  3  
ATOM 4114  H HZ1  . LYS A 1 41  ? 21.586  -5.697  4.603   1.00 0.00 ? 41  LYS A HZ1  3  
ATOM 4115  H HZ2  . LYS A 1 41  ? 21.282  -7.142  5.428   1.00 0.00 ? 41  LYS A HZ2  3  
ATOM 4116  H HZ3  . LYS A 1 41  ? 20.098  -6.481  4.416   1.00 0.00 ? 41  LYS A HZ3  3  
ATOM 4117  N N    . ARG A 1 42  ? 18.451  -12.147 -0.263  1.00 0.00 ? 42  ARG A N    3  
ATOM 4118  C CA   . ARG A 1 42  ? 17.846  -13.471 -0.192  1.00 0.00 ? 42  ARG A CA   3  
ATOM 4119  C C    . ARG A 1 42  ? 18.365  -14.242 1.019   1.00 0.00 ? 42  ARG A C    3  
ATOM 4120  O O    . ARG A 1 42  ? 19.321  -15.011 0.916   1.00 0.00 ? 42  ARG A O    3  
ATOM 4121  C CB   . ARG A 1 42  ? 18.136  -14.257 -1.472  1.00 0.00 ? 42  ARG A CB   3  
ATOM 4122  C CG   . ARG A 1 42  ? 17.433  -13.702 -2.700  1.00 0.00 ? 42  ARG A CG   3  
ATOM 4123  C CD   . ARG A 1 42  ? 16.023  -14.257 -2.832  1.00 0.00 ? 42  ARG A CD   3  
ATOM 4124  N NE   . ARG A 1 42  ? 15.589  -14.321 -4.225  1.00 0.00 ? 42  ARG A NE   3  
ATOM 4125  C CZ   . ARG A 1 42  ? 16.058  -15.202 -5.101  1.00 0.00 ? 42  ARG A CZ   3  
ATOM 4126  N NH1  . ARG A 1 42  ? 16.972  -16.089 -4.730  1.00 0.00 ? 42  ARG A NH1  3  
ATOM 4127  N NH2  . ARG A 1 42  ? 15.614  -15.198 -6.351  1.00 0.00 ? 42  ARG A NH2  3  
ATOM 4128  H H    . ARG A 1 42  ? 19.052  -11.935 -1.008  1.00 0.00 ? 42  ARG A H    3  
ATOM 4129  H HA   . ARG A 1 42  ? 16.779  -13.344 -0.092  1.00 0.00 ? 42  ARG A HA   3  
ATOM 4130  H HB2  . ARG A 1 42  ? 19.201  -14.242 -1.657  1.00 0.00 ? 42  ARG A HB2  3  
ATOM 4131  H HB3  . ARG A 1 42  ? 17.818  -15.279 -1.332  1.00 0.00 ? 42  ARG A HB3  3  
ATOM 4132  H HG2  . ARG A 1 42  ? 17.378  -12.627 -2.617  1.00 0.00 ? 42  ARG A HG2  3  
ATOM 4133  H HG3  . ARG A 1 42  ? 18.000  -13.969 -3.579  1.00 0.00 ? 42  ARG A HG3  3  
ATOM 4134  H HD2  . ARG A 1 42  ? 16.001  -15.251 -2.412  1.00 0.00 ? 42  ARG A HD2  3  
ATOM 4135  H HD3  . ARG A 1 42  ? 15.347  -13.619 -2.283  1.00 0.00 ? 42  ARG A HD3  3  
ATOM 4136  H HE   . ARG A 1 42  ? 14.914  -13.675 -4.520  1.00 0.00 ? 42  ARG A HE   3  
ATOM 4137  H HH11 . ARG A 1 42  ? 17.308  -16.095 -3.789  1.00 0.00 ? 42  ARG A HH11 3  
ATOM 4138  H HH12 . ARG A 1 42  ? 17.323  -16.752 -5.392  1.00 0.00 ? 42  ARG A HH12 3  
ATOM 4139  H HH21 . ARG A 1 42  ? 14.925  -14.532 -6.634  1.00 0.00 ? 42  ARG A HH21 3  
ATOM 4140  H HH22 . ARG A 1 42  ? 15.968  -15.861 -7.010  1.00 0.00 ? 42  ARG A HH22 3  
ATOM 4141  N N    . LEU A 1 43  ? 17.728  -14.029 2.165   1.00 0.00 ? 43  LEU A N    3  
ATOM 4142  C CA   . LEU A 1 43  ? 18.125  -14.703 3.397   1.00 0.00 ? 43  LEU A CA   3  
ATOM 4143  C C    . LEU A 1 43  ? 17.129  -15.798 3.764   1.00 0.00 ? 43  LEU A C    3  
ATOM 4144  O O    . LEU A 1 43  ? 17.488  -16.971 3.865   1.00 0.00 ? 43  LEU A O    3  
ATOM 4145  C CB   . LEU A 1 43  ? 18.236  -13.694 4.541   1.00 0.00 ? 43  LEU A CB   3  
ATOM 4146  C CG   . LEU A 1 43  ? 19.069  -12.444 4.255   1.00 0.00 ? 43  LEU A CG   3  
ATOM 4147  C CD1  . LEU A 1 43  ? 18.971  -11.461 5.411   1.00 0.00 ? 43  LEU A CD1  3  
ATOM 4148  C CD2  . LEU A 1 43  ? 20.521  -12.820 3.994   1.00 0.00 ? 43  LEU A CD2  3  
ATOM 4149  H H    . LEU A 1 43  ? 16.974  -13.405 2.185   1.00 0.00 ? 43  LEU A H    3  
ATOM 4150  H HA   . LEU A 1 43  ? 19.092  -15.154 3.231   1.00 0.00 ? 43  LEU A HA   3  
ATOM 4151  H HB2  . LEU A 1 43  ? 17.237  -13.373 4.797   1.00 0.00 ? 43  LEU A HB2  3  
ATOM 4152  H HB3  . LEU A 1 43  ? 18.677  -14.201 5.387   1.00 0.00 ? 43  LEU A HB3  3  
ATOM 4153  H HG   . LEU A 1 43  ? 18.685  -11.957 3.370   1.00 0.00 ? 43  LEU A HG   3  
ATOM 4154  H HD11 . LEU A 1 43  ? 18.905  -10.456 5.024   1.00 0.00 ? 43  LEU A HD11 3  
ATOM 4155  H HD12 . LEU A 1 43  ? 19.848  -11.550 6.035   1.00 0.00 ? 43  LEU A HD12 3  
ATOM 4156  H HD13 . LEU A 1 43  ? 18.090  -11.681 5.997   1.00 0.00 ? 43  LEU A HD13 3  
ATOM 4157  H HD21 . LEU A 1 43  ? 21.144  -11.945 4.103   1.00 0.00 ? 43  LEU A HD21 3  
ATOM 4158  H HD22 . LEU A 1 43  ? 20.617  -13.208 2.991   1.00 0.00 ? 43  LEU A HD22 3  
ATOM 4159  H HD23 . LEU A 1 43  ? 20.830  -13.574 4.704   1.00 0.00 ? 43  LEU A HD23 3  
ATOM 4160  N N    . LYS A 1 44  ? 15.874  -15.407 3.962   1.00 0.00 ? 44  LYS A N    3  
ATOM 4161  C CA   . LYS A 1 44  ? 14.823  -16.354 4.314   1.00 0.00 ? 44  LYS A CA   3  
ATOM 4162  C C    . LYS A 1 44  ? 13.625  -16.210 3.381   1.00 0.00 ? 44  LYS A C    3  
ATOM 4163  O O    . LYS A 1 44  ? 13.565  -15.285 2.572   1.00 0.00 ? 44  LYS A O    3  
ATOM 4164  C CB   . LYS A 1 44  ? 14.382  -16.142 5.764   1.00 0.00 ? 44  LYS A CB   3  
ATOM 4165  C CG   . LYS A 1 44  ? 14.465  -14.695 6.219   1.00 0.00 ? 44  LYS A CG   3  
ATOM 4166  C CD   . LYS A 1 44  ? 15.853  -14.351 6.733   1.00 0.00 ? 44  LYS A CD   3  
ATOM 4167  C CE   . LYS A 1 44  ? 16.059  -14.845 8.156   1.00 0.00 ? 44  LYS A CE   3  
ATOM 4168  N NZ   . LYS A 1 44  ? 15.358  -13.985 9.149   1.00 0.00 ? 44  LYS A NZ   3  
ATOM 4169  H H    . LYS A 1 44  ? 15.649  -14.457 3.867   1.00 0.00 ? 44  LYS A H    3  
ATOM 4170  H HA   . LYS A 1 44  ? 15.227  -17.350 4.212   1.00 0.00 ? 44  LYS A HA   3  
ATOM 4171  H HB2  . LYS A 1 44  ? 13.359  -16.473 5.869   1.00 0.00 ? 44  LYS A HB2  3  
ATOM 4172  H HB3  . LYS A 1 44  ? 15.012  -16.737 6.410   1.00 0.00 ? 44  LYS A HB3  3  
ATOM 4173  H HG2  . LYS A 1 44  ? 14.231  -14.051 5.385   1.00 0.00 ? 44  LYS A HG2  3  
ATOM 4174  H HG3  . LYS A 1 44  ? 13.748  -14.535 7.012   1.00 0.00 ? 44  LYS A HG3  3  
ATOM 4175  H HD2  . LYS A 1 44  ? 16.589  -14.813 6.093   1.00 0.00 ? 44  LYS A HD2  3  
ATOM 4176  H HD3  . LYS A 1 44  ? 15.979  -13.277 6.712   1.00 0.00 ? 44  LYS A HD3  3  
ATOM 4177  H HE2  . LYS A 1 44  ? 15.678  -15.852 8.232   1.00 0.00 ? 44  LYS A HE2  3  
ATOM 4178  H HE3  . LYS A 1 44  ? 17.117  -14.843 8.374   1.00 0.00 ? 44  LYS A HE3  3  
ATOM 4179  H HZ1  . LYS A 1 44  ? 15.528  -12.981 8.936   1.00 0.00 ? 44  LYS A HZ1  3  
ATOM 4180  H HZ2  . LYS A 1 44  ? 15.707  -14.189 10.108  1.00 0.00 ? 44  LYS A HZ2  3  
ATOM 4181  H HZ3  . LYS A 1 44  ? 14.334  -14.166 9.119   1.00 0.00 ? 44  LYS A HZ3  3  
ATOM 4182  N N    . ASN A 1 45  ? 12.674  -17.131 3.500   1.00 0.00 ? 45  ASN A N    3  
ATOM 4183  C CA   . ASN A 1 45  ? 11.477  -17.105 2.667   1.00 0.00 ? 45  ASN A CA   3  
ATOM 4184  C C    . ASN A 1 45  ? 10.231  -16.859 3.513   1.00 0.00 ? 45  ASN A C    3  
ATOM 4185  O O    . ASN A 1 45  ? 9.626   -15.790 3.449   1.00 0.00 ? 45  ASN A O    3  
ATOM 4186  C CB   . ASN A 1 45  ? 11.336  -18.422 1.901   1.00 0.00 ? 45  ASN A CB   3  
ATOM 4187  C CG   . ASN A 1 45  ? 10.513  -18.269 0.636   1.00 0.00 ? 45  ASN A CG   3  
ATOM 4188  O OD1  . ASN A 1 45  ? 11.000  -18.513 -0.468  1.00 0.00 ? 45  ASN A OD1  3  
ATOM 4189  N ND2  . ASN A 1 45  ? 9.258   -17.863 0.792   1.00 0.00 ? 45  ASN A ND2  3  
ATOM 4190  H H    . ASN A 1 45  ? 12.780  -17.844 4.163   1.00 0.00 ? 45  ASN A H    3  
ATOM 4191  H HA   . ASN A 1 45  ? 11.583  -16.297 1.960   1.00 0.00 ? 45  ASN A HA   3  
ATOM 4192  H HB2  . ASN A 1 45  ? 12.318  -18.779 1.627   1.00 0.00 ? 45  ASN A HB2  3  
ATOM 4193  H HB3  . ASN A 1 45  ? 10.855  -19.151 2.536   1.00 0.00 ? 45  ASN A HB3  3  
ATOM 4194  H HD21 . ASN A 1 45  ? 8.938   -17.687 1.702   1.00 0.00 ? 45  ASN A HD21 3  
ATOM 4195  H HD22 . ASN A 1 45  ? 8.704   -17.756 -0.009  1.00 0.00 ? 45  ASN A HD22 3  
ATOM 4196  N N    . GLY A 1 46  ? 9.854   -17.858 4.306   1.00 0.00 ? 46  GLY A N    3  
ATOM 4197  C CA   . GLY A 1 46  ? 8.683   -17.730 5.153   1.00 0.00 ? 46  GLY A CA   3  
ATOM 4198  C C    . GLY A 1 46  ? 7.682   -18.847 4.931   1.00 0.00 ? 46  GLY A C    3  
ATOM 4199  O O    . GLY A 1 46  ? 7.875   -19.698 4.063   1.00 0.00 ? 46  GLY A O    3  
ATOM 4200  H H    . GLY A 1 46  ? 10.375  -18.688 4.315   1.00 0.00 ? 46  GLY A H    3  
ATOM 4201  H HA2  . GLY A 1 46  ? 8.996   -17.742 6.186   1.00 0.00 ? 46  GLY A HA2  3  
ATOM 4202  H HA3  . GLY A 1 46  ? 8.202   -16.786 4.944   1.00 0.00 ? 46  GLY A HA3  3  
ATOM 4203  N N    . GLU A 1 47  ? 6.611   -18.845 5.718   1.00 0.00 ? 47  GLU A N    3  
ATOM 4204  C CA   . GLU A 1 47  ? 5.578   -19.868 5.604   1.00 0.00 ? 47  GLU A CA   3  
ATOM 4205  C C    . GLU A 1 47  ? 4.347   -19.320 4.889   1.00 0.00 ? 47  GLU A C    3  
ATOM 4206  O O    . GLU A 1 47  ? 3.413   -20.062 4.584   1.00 0.00 ? 47  GLU A O    3  
ATOM 4207  C CB   . GLU A 1 47  ? 5.188   -20.388 6.990   1.00 0.00 ? 47  GLU A CB   3  
ATOM 4208  C CG   . GLU A 1 47  ? 4.623   -19.315 7.905   1.00 0.00 ? 47  GLU A CG   3  
ATOM 4209  C CD   . GLU A 1 47  ? 3.118   -19.178 7.784   1.00 0.00 ? 47  GLU A CD   3  
ATOM 4210  O OE1  . GLU A 1 47  ? 2.442   -20.208 7.582   1.00 0.00 ? 47  GLU A OE1  3  
ATOM 4211  O OE2  . GLU A 1 47  ? 2.616   -18.039 7.890   1.00 0.00 ? 47  GLU A OE2  3  
ATOM 4212  H H    . GLU A 1 47  ? 6.514   -18.140 6.392   1.00 0.00 ? 47  GLU A H    3  
ATOM 4213  H HA   . GLU A 1 47  ? 5.982   -20.685 5.025   1.00 0.00 ? 47  GLU A HA   3  
ATOM 4214  H HB2  . GLU A 1 47  ? 4.445   -21.162 6.875   1.00 0.00 ? 47  GLU A HB2  3  
ATOM 4215  H HB3  . GLU A 1 47  ? 6.064   -20.809 7.462   1.00 0.00 ? 47  GLU A HB3  3  
ATOM 4216  H HG2  . GLU A 1 47  ? 4.865   -19.567 8.927   1.00 0.00 ? 47  GLU A HG2  3  
ATOM 4217  H HG3  . GLU A 1 47  ? 5.078   -18.368 7.652   1.00 0.00 ? 47  GLU A HG3  3  
ATOM 4218  N N    . GLU A 1 48  ? 4.353   -18.018 4.626   1.00 0.00 ? 48  GLU A N    3  
ATOM 4219  C CA   . GLU A 1 48  ? 3.236   -17.370 3.948   1.00 0.00 ? 48  GLU A CA   3  
ATOM 4220  C C    . GLU A 1 48  ? 3.735   -16.366 2.913   1.00 0.00 ? 48  GLU A C    3  
ATOM 4221  O O    . GLU A 1 48  ? 4.933   -16.097 2.820   1.00 0.00 ? 48  GLU A O    3  
ATOM 4222  C CB   . GLU A 1 48  ? 2.333   -16.667 4.964   1.00 0.00 ? 48  GLU A CB   3  
ATOM 4223  C CG   . GLU A 1 48  ? 2.966   -15.436 5.590   1.00 0.00 ? 48  GLU A CG   3  
ATOM 4224  C CD   . GLU A 1 48  ? 1.969   -14.599 6.368   1.00 0.00 ? 48  GLU A CD   3  
ATOM 4225  O OE1  . GLU A 1 48  ? 0.944   -14.196 5.779   1.00 0.00 ? 48  GLU A OE1  3  
ATOM 4226  O OE2  . GLU A 1 48  ? 2.213   -14.348 7.567   1.00 0.00 ? 48  GLU A OE2  3  
ATOM 4227  H H    . GLU A 1 48  ? 5.127   -17.479 4.894   1.00 0.00 ? 48  GLU A H    3  
ATOM 4228  H HA   . GLU A 1 48  ? 2.666   -18.135 3.443   1.00 0.00 ? 48  GLU A HA   3  
ATOM 4229  H HB2  . GLU A 1 48  ? 1.421   -16.366 4.469   1.00 0.00 ? 48  GLU A HB2  3  
ATOM 4230  H HB3  . GLU A 1 48  ? 2.090   -17.362 5.753   1.00 0.00 ? 48  GLU A HB3  3  
ATOM 4231  H HG2  . GLU A 1 48  ? 3.749   -15.752 6.263   1.00 0.00 ? 48  GLU A HG2  3  
ATOM 4232  H HG3  . GLU A 1 48  ? 3.391   -14.826 4.806   1.00 0.00 ? 48  GLU A HG3  3  
ATOM 4233  N N    . LEU A 1 49  ? 2.808   -15.815 2.137   1.00 0.00 ? 49  LEU A N    3  
ATOM 4234  C CA   . LEU A 1 49  ? 3.153   -14.840 1.108   1.00 0.00 ? 49  LEU A CA   3  
ATOM 4235  C C    . LEU A 1 49  ? 3.825   -13.616 1.721   1.00 0.00 ? 49  LEU A C    3  
ATOM 4236  O O    . LEU A 1 49  ? 3.904   -13.484 2.942   1.00 0.00 ? 49  LEU A O    3  
ATOM 4237  C CB   . LEU A 1 49  ? 1.900   -14.418 0.338   1.00 0.00 ? 49  LEU A CB   3  
ATOM 4238  C CG   . LEU A 1 49  ? 1.026   -13.357 1.009   1.00 0.00 ? 49  LEU A CG   3  
ATOM 4239  C CD1  . LEU A 1 49  ? 0.373   -12.465 -0.035  1.00 0.00 ? 49  LEU A CD1  3  
ATOM 4240  C CD2  . LEU A 1 49  ? -0.029  -14.014 1.888   1.00 0.00 ? 49  LEU A CD2  3  
ATOM 4241  H H    . LEU A 1 49  ? 1.870   -16.069 2.259   1.00 0.00 ? 49  LEU A H    3  
ATOM 4242  H HA   . LEU A 1 49  ? 3.844   -15.311 0.424   1.00 0.00 ? 49  LEU A HA   3  
ATOM 4243  H HB2  . LEU A 1 49  ? 2.215   -14.030 -0.618  1.00 0.00 ? 49  LEU A HB2  3  
ATOM 4244  H HB3  . LEU A 1 49  ? 1.294   -15.299 0.185   1.00 0.00 ? 49  LEU A HB3  3  
ATOM 4245  H HG   . LEU A 1 49  ? 1.647   -12.734 1.639   1.00 0.00 ? 49  LEU A HG   3  
ATOM 4246  H HD11 . LEU A 1 49  ? 0.806   -12.668 -1.003  1.00 0.00 ? 49  LEU A HD11 3  
ATOM 4247  H HD12 . LEU A 1 49  ? 0.537   -11.430 0.223   1.00 0.00 ? 49  LEU A HD12 3  
ATOM 4248  H HD13 . LEU A 1 49  ? -0.688  -12.665 -0.066  1.00 0.00 ? 49  LEU A HD13 3  
ATOM 4249  H HD21 . LEU A 1 49  ? -0.140  -13.448 2.800   1.00 0.00 ? 49  LEU A HD21 3  
ATOM 4250  H HD22 . LEU A 1 49  ? 0.277   -15.022 2.124   1.00 0.00 ? 49  LEU A HD22 3  
ATOM 4251  H HD23 . LEU A 1 49  ? -0.972  -14.037 1.361   1.00 0.00 ? 49  LEU A HD23 3  
ATOM 4252  N N    . LYS A 1 50  ? 4.305   -12.721 0.865   1.00 0.00 ? 50  LYS A N    3  
ATOM 4253  C CA   . LYS A 1 50  ? 4.967   -11.504 1.320   1.00 0.00 ? 50  LYS A CA   3  
ATOM 4254  C C    . LYS A 1 50  ? 4.712   -10.352 0.354   1.00 0.00 ? 50  LYS A C    3  
ATOM 4255  O O    . LYS A 1 50  ? 4.358   -10.567 -0.804  1.00 0.00 ? 50  LYS A O    3  
ATOM 4256  C CB   . LYS A 1 50  ? 6.473   -11.741 1.462   1.00 0.00 ? 50  LYS A CB   3  
ATOM 4257  C CG   . LYS A 1 50  ? 7.259   -11.433 0.200   1.00 0.00 ? 50  LYS A CG   3  
ATOM 4258  C CD   . LYS A 1 50  ? 8.754   -11.591 0.421   1.00 0.00 ? 50  LYS A CD   3  
ATOM 4259  C CE   . LYS A 1 50  ? 9.463   -12.025 -0.852  1.00 0.00 ? 50  LYS A CE   3  
ATOM 4260  N NZ   . LYS A 1 50  ? 9.916   -10.858 -1.660  1.00 0.00 ? 50  LYS A NZ   3  
ATOM 4261  H H    . LYS A 1 50  ? 4.212   -12.882 -0.098  1.00 0.00 ? 50  LYS A H    3  
ATOM 4262  H HA   . LYS A 1 50  ? 4.559   -11.246 2.285   1.00 0.00 ? 50  LYS A HA   3  
ATOM 4263  H HB2  . LYS A 1 50  ? 6.850   -11.115 2.258   1.00 0.00 ? 50  LYS A HB2  3  
ATOM 4264  H HB3  . LYS A 1 50  ? 6.639   -12.777 1.721   1.00 0.00 ? 50  LYS A HB3  3  
ATOM 4265  H HG2  . LYS A 1 50  ? 6.948   -12.111 -0.581  1.00 0.00 ? 50  LYS A HG2  3  
ATOM 4266  H HG3  . LYS A 1 50  ? 7.054   -10.415 -0.102  1.00 0.00 ? 50  LYS A HG3  3  
ATOM 4267  H HD2  . LYS A 1 50  ? 9.163   -10.645 0.743   1.00 0.00 ? 50  LYS A HD2  3  
ATOM 4268  H HD3  . LYS A 1 50  ? 8.919   -12.336 1.187   1.00 0.00 ? 50  LYS A HD3  3  
ATOM 4269  H HE2  . LYS A 1 50  ? 10.321  -12.622 -0.585  1.00 0.00 ? 50  LYS A HE2  3  
ATOM 4270  H HE3  . LYS A 1 50  ? 8.782   -12.618 -1.444  1.00 0.00 ? 50  LYS A HE3  3  
ATOM 4271  H HZ1  . LYS A 1 50  ? 9.108   -10.429 -2.153  1.00 0.00 ? 50  LYS A HZ1  3  
ATOM 4272  H HZ2  . LYS A 1 50  ? 10.617  -11.163 -2.365  1.00 0.00 ? 50  LYS A HZ2  3  
ATOM 4273  H HZ3  . LYS A 1 50  ? 10.351  -10.143 -1.042  1.00 0.00 ? 50  LYS A HZ3  3  
ATOM 4274  N N    . GLY A 1 51  ? 4.897   -9.127  0.839   1.00 0.00 ? 51  GLY A N    3  
ATOM 4275  C CA   . GLY A 1 51  ? 4.683   -7.959  0.004   1.00 0.00 ? 51  GLY A CA   3  
ATOM 4276  C C    . GLY A 1 51  ? 4.116   -6.788  0.781   1.00 0.00 ? 51  GLY A C    3  
ATOM 4277  O O    . GLY A 1 51  ? 3.820   -6.908  1.970   1.00 0.00 ? 51  GLY A O    3  
ATOM 4278  H H    . GLY A 1 51  ? 5.180   -9.016  1.770   1.00 0.00 ? 51  GLY A H    3  
ATOM 4279  H HA2  . GLY A 1 51  ? 5.626   -7.665  -0.433  1.00 0.00 ? 51  GLY A HA2  3  
ATOM 4280  H HA3  . GLY A 1 51  ? 3.996   -8.218  -0.788  1.00 0.00 ? 51  GLY A HA3  3  
ATOM 4281  N N    . ILE A 1 52  ? 3.965   -5.652  0.108   1.00 0.00 ? 52  ILE A N    3  
ATOM 4282  C CA   . ILE A 1 52  ? 3.430   -4.454  0.743   1.00 0.00 ? 52  ILE A CA   3  
ATOM 4283  C C    . ILE A 1 52  ? 1.909   -4.515  0.841   1.00 0.00 ? 52  ILE A C    3  
ATOM 4284  O O    . ILE A 1 52  ? 1.207   -4.389  -0.162  1.00 0.00 ? 52  ILE A O    3  
ATOM 4285  C CB   . ILE A 1 52  ? 3.833   -3.181  -0.025  1.00 0.00 ? 52  ILE A CB   3  
ATOM 4286  C CG1  . ILE A 1 52  ? 5.348   -3.142  -0.231  1.00 0.00 ? 52  ILE A CG1  3  
ATOM 4287  C CG2  . ILE A 1 52  ? 3.361   -1.941  0.720   1.00 0.00 ? 52  ILE A CG2  3  
ATOM 4288  C CD1  . ILE A 1 52  ? 6.136   -3.276  1.053   1.00 0.00 ? 52  ILE A CD1  3  
ATOM 4289  H H    . ILE A 1 52  ? 4.219   -5.618  -0.837  1.00 0.00 ? 52  ILE A H    3  
ATOM 4290  H HA   . ILE A 1 52  ? 3.842   -4.393  1.741   1.00 0.00 ? 52  ILE A HA   3  
ATOM 4291  H HB   . ILE A 1 52  ? 3.346   -3.200  -0.988  1.00 0.00 ? 52  ILE A HB   3  
ATOM 4292  H HG12 . ILE A 1 52  ? 5.638   -3.950  -0.883  1.00 0.00 ? 52  ILE A HG12 3  
ATOM 4293  H HG13 . ILE A 1 52  ? 5.617   -2.201  -0.689  1.00 0.00 ? 52  ILE A HG13 3  
ATOM 4294  H HG21 . ILE A 1 52  ? 2.287   -1.861  0.641   1.00 0.00 ? 52  ILE A HG21 3  
ATOM 4295  H HG22 . ILE A 1 52  ? 3.640   -2.019  1.760   1.00 0.00 ? 52  ILE A HG22 3  
ATOM 4296  H HG23 . ILE A 1 52  ? 3.820   -1.065  0.288   1.00 0.00 ? 52  ILE A HG23 3  
ATOM 4297  H HD11 . ILE A 1 52  ? 6.547   -4.273  1.121   1.00 0.00 ? 52  ILE A HD11 3  
ATOM 4298  H HD12 . ILE A 1 52  ? 6.941   -2.555  1.060   1.00 0.00 ? 52  ILE A HD12 3  
ATOM 4299  H HD13 . ILE A 1 52  ? 5.485   -3.098  1.896   1.00 0.00 ? 52  ILE A HD13 3  
ATOM 4300  N N    . PHE A 1 53  ? 1.407   -4.709  2.056   1.00 0.00 ? 53  PHE A N    3  
ATOM 4301  C CA   . PHE A 1 53  ? -0.031  -4.787  2.285   1.00 0.00 ? 53  PHE A CA   3  
ATOM 4302  C C    . PHE A 1 53  ? -0.564  -3.472  2.846   1.00 0.00 ? 53  PHE A C    3  
ATOM 4303  O O    . PHE A 1 53  ? 0.052   -2.863  3.722   1.00 0.00 ? 53  PHE A O    3  
ATOM 4304  C CB   . PHE A 1 53  ? -0.354  -5.932  3.246   1.00 0.00 ? 53  PHE A CB   3  
ATOM 4305  C CG   . PHE A 1 53  ? 0.208   -7.256  2.812   1.00 0.00 ? 53  PHE A CG   3  
ATOM 4306  C CD1  . PHE A 1 53  ? 1.484   -7.639  3.192   1.00 0.00 ? 53  PHE A CD1  3  
ATOM 4307  C CD2  . PHE A 1 53  ? -0.539  -8.117  2.025   1.00 0.00 ? 53  PHE A CD2  3  
ATOM 4308  C CE1  . PHE A 1 53  ? 2.005   -8.856  2.793   1.00 0.00 ? 53  PHE A CE1  3  
ATOM 4309  C CE2  . PHE A 1 53  ? -0.024  -9.335  1.623   1.00 0.00 ? 53  PHE A CE2  3  
ATOM 4310  C CZ   . PHE A 1 53  ? 1.249   -9.705  2.009   1.00 0.00 ? 53  PHE A CZ   3  
ATOM 4311  H H    . PHE A 1 53  ? 2.019   -4.803  2.816   1.00 0.00 ? 53  PHE A H    3  
ATOM 4312  H HA   . PHE A 1 53  ? -0.507  -4.979  1.336   1.00 0.00 ? 53  PHE A HA   3  
ATOM 4313  H HB2  . PHE A 1 53  ? 0.053   -5.703  4.219   1.00 0.00 ? 53  PHE A HB2  3  
ATOM 4314  H HB3  . PHE A 1 53  ? -1.426  -6.035  3.324   1.00 0.00 ? 53  PHE A HB3  3  
ATOM 4315  H HD1  . PHE A 1 53  ? 2.076   -6.977  3.806   1.00 0.00 ? 53  PHE A HD1  3  
ATOM 4316  H HD2  . PHE A 1 53  ? -1.536  -7.828  1.722   1.00 0.00 ? 53  PHE A HD2  3  
ATOM 4317  H HE1  . PHE A 1 53  ? 3.000   -9.143  3.097   1.00 0.00 ? 53  PHE A HE1  3  
ATOM 4318  H HE2  . PHE A 1 53  ? -0.618  -9.997  1.010   1.00 0.00 ? 53  PHE A HE2  3  
ATOM 4319  H HZ   . PHE A 1 53  ? 1.653   -10.656 1.696   1.00 0.00 ? 53  PHE A HZ   3  
ATOM 4320  N N    . ILE A 1 54  ? -1.712  -3.039  2.335   1.00 0.00 ? 54  ILE A N    3  
ATOM 4321  C CA   . ILE A 1 54  ? -2.328  -1.797  2.784   1.00 0.00 ? 54  ILE A CA   3  
ATOM 4322  C C    . ILE A 1 54  ? -2.520  -1.795  4.297   1.00 0.00 ? 54  ILE A C    3  
ATOM 4323  O O    . ILE A 1 54  ? -3.178  -2.676  4.852   1.00 0.00 ? 54  ILE A O    3  
ATOM 4324  C CB   . ILE A 1 54  ? -3.691  -1.567  2.104   1.00 0.00 ? 54  ILE A CB   3  
ATOM 4325  C CG1  . ILE A 1 54  ? -3.527  -1.530  0.584   1.00 0.00 ? 54  ILE A CG1  3  
ATOM 4326  C CG2  . ILE A 1 54  ? -4.321  -0.276  2.606   1.00 0.00 ? 54  ILE A CG2  3  
ATOM 4327  C CD1  . ILE A 1 54  ? -4.764  -1.058  -0.146  1.00 0.00 ? 54  ILE A CD1  3  
ATOM 4328  H H    . ILE A 1 54  ? -2.155  -3.568  1.639   1.00 0.00 ? 54  ILE A H    3  
ATOM 4329  H HA   . ILE A 1 54  ? -1.671  -0.983  2.514   1.00 0.00 ? 54  ILE A HA   3  
ATOM 4330  H HB   . ILE A 1 54  ? -4.343  -2.384  2.370   1.00 0.00 ? 54  ILE A HB   3  
ATOM 4331  H HG12 . ILE A 1 54  ? -2.718  -0.863  0.331   1.00 0.00 ? 54  ILE A HG12 3  
ATOM 4332  H HG13 . ILE A 1 54  ? -3.292  -2.524  0.231   1.00 0.00 ? 54  ILE A HG13 3  
ATOM 4333  H HG21 . ILE A 1 54  ? -4.000  0.547   1.984   1.00 0.00 ? 54  ILE A HG21 3  
ATOM 4334  H HG22 . ILE A 1 54  ? -5.396  -0.360  2.562   1.00 0.00 ? 54  ILE A HG22 3  
ATOM 4335  H HG23 . ILE A 1 54  ? -4.014  -0.098  3.625   1.00 0.00 ? 54  ILE A HG23 3  
ATOM 4336  H HD11 . ILE A 1 54  ? -5.493  -1.856  -0.173  1.00 0.00 ? 54  ILE A HD11 3  
ATOM 4337  H HD12 . ILE A 1 54  ? -5.184  -0.206  0.369   1.00 0.00 ? 54  ILE A HD12 3  
ATOM 4338  H HD13 . ILE A 1 54  ? -4.503  -0.776  -1.155  1.00 0.00 ? 54  ILE A HD13 3  
ATOM 4339  N N    . LYS A 1 55  ? -1.943  -0.799  4.960   1.00 0.00 ? 55  LYS A N    3  
ATOM 4340  C CA   . LYS A 1 55  ? -2.053  -0.678  6.409   1.00 0.00 ? 55  LYS A CA   3  
ATOM 4341  C C    . LYS A 1 55  ? -3.385  -0.050  6.803   1.00 0.00 ? 55  LYS A C    3  
ATOM 4342  O O    . LYS A 1 55  ? -4.079  -0.550  7.688   1.00 0.00 ? 55  LYS A O    3  
ATOM 4343  C CB   . LYS A 1 55  ? -0.897  0.160   6.960   1.00 0.00 ? 55  LYS A CB   3  
ATOM 4344  C CG   . LYS A 1 55  ? -1.179  0.758   8.328   1.00 0.00 ? 55  LYS A CG   3  
ATOM 4345  C CD   . LYS A 1 55  ? -1.628  -0.303  9.319   1.00 0.00 ? 55  LYS A CD   3  
ATOM 4346  C CE   . LYS A 1 55  ? -2.430  0.304   10.460  1.00 0.00 ? 55  LYS A CE   3  
ATOM 4347  N NZ   . LYS A 1 55  ? -1.553  0.759   11.573  1.00 0.00 ? 55  LYS A NZ   3  
ATOM 4348  H H    . LYS A 1 55  ? -1.431  -0.127  4.462   1.00 0.00 ? 55  LYS A H    3  
ATOM 4349  H HA   . LYS A 1 55  ? -1.998  -1.671  6.829   1.00 0.00 ? 55  LYS A HA   3  
ATOM 4350  H HB2  . LYS A 1 55  ? -0.019  -0.464  7.037   1.00 0.00 ? 55  LYS A HB2  3  
ATOM 4351  H HB3  . LYS A 1 55  ? -0.695  0.969   6.272   1.00 0.00 ? 55  LYS A HB3  3  
ATOM 4352  H HG2  . LYS A 1 55  ? -0.278  1.224   8.699   1.00 0.00 ? 55  LYS A HG2  3  
ATOM 4353  H HG3  . LYS A 1 55  ? -1.958  1.501   8.232   1.00 0.00 ? 55  LYS A HG3  3  
ATOM 4354  H HD2  . LYS A 1 55  ? -2.244  -1.025  8.805   1.00 0.00 ? 55  LYS A HD2  3  
ATOM 4355  H HD3  . LYS A 1 55  ? -0.755  -0.795  9.725   1.00 0.00 ? 55  LYS A HD3  3  
ATOM 4356  H HE2  . LYS A 1 55  ? -2.986  1.148   10.082  1.00 0.00 ? 55  LYS A HE2  3  
ATOM 4357  H HE3  . LYS A 1 55  ? -3.117  -0.440  10.834  1.00 0.00 ? 55  LYS A HE3  3  
ATOM 4358  H HZ1  . LYS A 1 55  ? -2.086  0.773   12.466  1.00 0.00 ? 55  LYS A HZ1  3  
ATOM 4359  H HZ2  . LYS A 1 55  ? -1.198  1.718   11.380  1.00 0.00 ? 55  LYS A HZ2  3  
ATOM 4360  H HZ3  . LYS A 1 55  ? -0.742  0.116   11.676  1.00 0.00 ? 55  LYS A HZ3  3  
ATOM 4361  N N    . GLN A 1 56  ? -3.736  1.048   6.141   1.00 0.00 ? 56  GLN A N    3  
ATOM 4362  C CA   . GLN A 1 56  ? -4.986  1.743   6.423   1.00 0.00 ? 56  GLN A CA   3  
ATOM 4363  C C    . GLN A 1 56  ? -5.264  2.811   5.370   1.00 0.00 ? 56  GLN A C    3  
ATOM 4364  O O    . GLN A 1 56  ? -4.341  3.389   4.798   1.00 0.00 ? 56  GLN A O    3  
ATOM 4365  C CB   . GLN A 1 56  ? -4.937  2.381   7.812   1.00 0.00 ? 56  GLN A CB   3  
ATOM 4366  C CG   . GLN A 1 56  ? -5.533  3.778   7.862   1.00 0.00 ? 56  GLN A CG   3  
ATOM 4367  C CD   . GLN A 1 56  ? -5.878  4.216   9.272   1.00 0.00 ? 56  GLN A CD   3  
ATOM 4368  O OE1  . GLN A 1 56  ? -6.564  3.504   10.005  1.00 0.00 ? 56  GLN A OE1  3  
ATOM 4369  N NE2  . GLN A 1 56  ? -5.402  5.394   9.659   1.00 0.00 ? 56  GLN A NE2  3  
ATOM 4370  H H    . GLN A 1 56  ? -3.140  1.398   5.447   1.00 0.00 ? 56  GLN A H    3  
ATOM 4371  H HA   . GLN A 1 56  ? -5.783  1.015   6.399   1.00 0.00 ? 56  GLN A HA   3  
ATOM 4372  H HB2  . GLN A 1 56  ? -5.483  1.755   8.502   1.00 0.00 ? 56  GLN A HB2  3  
ATOM 4373  H HB3  . GLN A 1 56  ? -3.907  2.442   8.131   1.00 0.00 ? 56  GLN A HB3  3  
ATOM 4374  H HG2  . GLN A 1 56  ? -4.819  4.476   7.450   1.00 0.00 ? 56  GLN A HG2  3  
ATOM 4375  H HG3  . GLN A 1 56  ? -6.433  3.793   7.266   1.00 0.00 ? 56  GLN A HG3  3  
ATOM 4376  H HE21 . GLN A 1 56  ? -4.863  5.908   9.021   1.00 0.00 ? 56  GLN A HE21 3  
ATOM 4377  H HE22 . GLN A 1 56  ? -5.610  5.702   10.565  1.00 0.00 ? 56  GLN A HE22 3  
ATOM 4378  N N    . VAL A 1 57  ? -6.544  3.067   5.119   1.00 0.00 ? 57  VAL A N    3  
ATOM 4379  C CA   . VAL A 1 57  ? -6.945  4.066   4.135   1.00 0.00 ? 57  VAL A CA   3  
ATOM 4380  C C    . VAL A 1 57  ? -7.980  5.024   4.714   1.00 0.00 ? 57  VAL A C    3  
ATOM 4381  O O    . VAL A 1 57  ? -9.008  4.599   5.242   1.00 0.00 ? 57  VAL A O    3  
ATOM 4382  C CB   . VAL A 1 57  ? -7.524  3.406   2.869   1.00 0.00 ? 57  VAL A CB   3  
ATOM 4383  C CG1  . VAL A 1 57  ? -8.397  4.391   2.106   1.00 0.00 ? 57  VAL A CG1  3  
ATOM 4384  C CG2  . VAL A 1 57  ? -6.405  2.877   1.985   1.00 0.00 ? 57  VAL A CG2  3  
ATOM 4385  H H    . VAL A 1 57  ? -7.236  2.573   5.607   1.00 0.00 ? 57  VAL A H    3  
ATOM 4386  H HA   . VAL A 1 57  ? -6.066  4.628   3.853   1.00 0.00 ? 57  VAL A HA   3  
ATOM 4387  H HB   . VAL A 1 57  ? -8.141  2.573   3.172   1.00 0.00 ? 57  VAL A HB   3  
ATOM 4388  H HG11 . VAL A 1 57  ? -8.752  3.927   1.197   1.00 0.00 ? 57  VAL A HG11 3  
ATOM 4389  H HG12 . VAL A 1 57  ? -9.240  4.676   2.719   1.00 0.00 ? 57  VAL A HG12 3  
ATOM 4390  H HG13 . VAL A 1 57  ? -7.818  5.268   1.858   1.00 0.00 ? 57  VAL A HG13 3  
ATOM 4391  H HG21 . VAL A 1 57  ? -5.709  2.310   2.586   1.00 0.00 ? 57  VAL A HG21 3  
ATOM 4392  H HG22 . VAL A 1 57  ? -6.823  2.239   1.220   1.00 0.00 ? 57  VAL A HG22 3  
ATOM 4393  H HG23 . VAL A 1 57  ? -5.889  3.705   1.522   1.00 0.00 ? 57  VAL A HG23 3  
ATOM 4394  N N    . LEU A 1 58  ? -7.701  6.319   4.612   1.00 0.00 ? 58  LEU A N    3  
ATOM 4395  C CA   . LEU A 1 58  ? -8.609  7.339   5.126   1.00 0.00 ? 58  LEU A CA   3  
ATOM 4396  C C    . LEU A 1 58  ? -9.849  7.457   4.247   1.00 0.00 ? 58  LEU A C    3  
ATOM 4397  O O    . LEU A 1 58  ? -9.928  6.843   3.183   1.00 0.00 ? 58  LEU A O    3  
ATOM 4398  C CB   . LEU A 1 58  ? -7.896  8.690   5.205   1.00 0.00 ? 58  LEU A CB   3  
ATOM 4399  C CG   . LEU A 1 58  ? -6.683  8.756   6.134   1.00 0.00 ? 58  LEU A CG   3  
ATOM 4400  C CD1  . LEU A 1 58  ? -5.563  7.869   5.614   1.00 0.00 ? 58  LEU A CD1  3  
ATOM 4401  C CD2  . LEU A 1 58  ? -6.203  10.192  6.284   1.00 0.00 ? 58  LEU A CD2  3  
ATOM 4402  H H    . LEU A 1 58  ? -6.867  6.596   4.182   1.00 0.00 ? 58  LEU A H    3  
ATOM 4403  H HA   . LEU A 1 58  ? -8.912  7.043   6.119   1.00 0.00 ? 58  LEU A HA   3  
ATOM 4404  H HB2  . LEU A 1 58  ? -7.565  8.948   4.211   1.00 0.00 ? 58  LEU A HB2  3  
ATOM 4405  H HB3  . LEU A 1 58  ? -8.614  9.423   5.545   1.00 0.00 ? 58  LEU A HB3  3  
ATOM 4406  H HG   . LEU A 1 58  ? -6.967  8.394   7.113   1.00 0.00 ? 58  LEU A HG   3  
ATOM 4407  H HD11 . LEU A 1 58  ? -4.653  8.083   6.154   1.00 0.00 ? 58  LEU A HD11 3  
ATOM 4408  H HD12 . LEU A 1 58  ? -5.411  8.061   4.562   1.00 0.00 ? 58  LEU A HD12 3  
ATOM 4409  H HD13 . LEU A 1 58  ? -5.830  6.832   5.755   1.00 0.00 ? 58  LEU A HD13 3  
ATOM 4410  H HD21 . LEU A 1 58  ? -5.514  10.257  7.113   1.00 0.00 ? 58  LEU A HD21 3  
ATOM 4411  H HD22 . LEU A 1 58  ? -7.049  10.837  6.467   1.00 0.00 ? 58  LEU A HD22 3  
ATOM 4412  H HD23 . LEU A 1 58  ? -5.705  10.501  5.376   1.00 0.00 ? 58  LEU A HD23 3  
ATOM 4413  N N    . GLU A 1 59  ? -10.815 8.252   4.698   1.00 0.00 ? 59  GLU A N    3  
ATOM 4414  C CA   . GLU A 1 59  ? -12.051 8.451   3.951   1.00 0.00 ? 59  GLU A CA   3  
ATOM 4415  C C    . GLU A 1 59  ? -12.002 9.751   3.154   1.00 0.00 ? 59  GLU A C    3  
ATOM 4416  O O    . GLU A 1 59  ? -12.401 9.793   1.990   1.00 0.00 ? 59  GLU A O    3  
ATOM 4417  C CB   . GLU A 1 59  ? -13.251 8.467   4.901   1.00 0.00 ? 59  GLU A CB   3  
ATOM 4418  C CG   . GLU A 1 59  ? -14.588 8.592   4.191   1.00 0.00 ? 59  GLU A CG   3  
ATOM 4419  C CD   . GLU A 1 59  ? -15.757 8.203   5.075   1.00 0.00 ? 59  GLU A CD   3  
ATOM 4420  O OE1  . GLU A 1 59  ? -16.258 9.078   5.813   1.00 0.00 ? 59  GLU A OE1  3  
ATOM 4421  O OE2  . GLU A 1 59  ? -16.170 7.026   5.030   1.00 0.00 ? 59  GLU A OE2  3  
ATOM 4422  H H    . GLU A 1 59  ? -10.693 8.714   5.553   1.00 0.00 ? 59  GLU A H    3  
ATOM 4423  H HA   . GLU A 1 59  ? -12.160 7.625   3.264   1.00 0.00 ? 59  GLU A HA   3  
ATOM 4424  H HB2  . GLU A 1 59  ? -13.254 7.551   5.473   1.00 0.00 ? 59  GLU A HB2  3  
ATOM 4425  H HB3  . GLU A 1 59  ? -13.147 9.303   5.577   1.00 0.00 ? 59  GLU A HB3  3  
ATOM 4426  H HG2  . GLU A 1 59  ? -14.720 9.617   3.877   1.00 0.00 ? 59  GLU A HG2  3  
ATOM 4427  H HG3  . GLU A 1 59  ? -14.582 7.949   3.324   1.00 0.00 ? 59  GLU A HG3  3  
ATOM 4428  N N    . ASP A 1 60  ? -11.511 10.809  3.789   1.00 0.00 ? 60  ASP A N    3  
ATOM 4429  C CA   . ASP A 1 60  ? -11.408 12.111  3.140   1.00 0.00 ? 60  ASP A CA   3  
ATOM 4430  C C    . ASP A 1 60  ? -10.139 12.200  2.298   1.00 0.00 ? 60  ASP A C    3  
ATOM 4431  O O    . ASP A 1 60  ? -9.483  13.241  2.255   1.00 0.00 ? 60  ASP A O    3  
ATOM 4432  C CB   . ASP A 1 60  ? -11.422 13.228  4.185   1.00 0.00 ? 60  ASP A CB   3  
ATOM 4433  C CG   . ASP A 1 60  ? -10.048 13.492  4.768   1.00 0.00 ? 60  ASP A CG   3  
ATOM 4434  O OD1  . ASP A 1 60  ? -9.317  12.514  5.031   1.00 0.00 ? 60  ASP A OD1  3  
ATOM 4435  O OD2  . ASP A 1 60  ? -9.703  14.677  4.960   1.00 0.00 ? 60  ASP A OD2  3  
ATOM 4436  H H    . ASP A 1 60  ? -11.209 10.712  4.717   1.00 0.00 ? 60  ASP A H    3  
ATOM 4437  H HA   . ASP A 1 60  ? -12.264 12.227  2.492   1.00 0.00 ? 60  ASP A HA   3  
ATOM 4438  H HB2  . ASP A 1 60  ? -11.778 14.138  3.725   1.00 0.00 ? 60  ASP A HB2  3  
ATOM 4439  H HB3  . ASP A 1 60  ? -12.088 12.951  4.989   1.00 0.00 ? 60  ASP A HB3  3  
ATOM 4440  N N    . SER A 1 61  ? -9.799  11.102  1.631   1.00 0.00 ? 61  SER A N    3  
ATOM 4441  C CA   . SER A 1 61  ? -8.605  11.055  0.795   1.00 0.00 ? 61  SER A CA   3  
ATOM 4442  C C    . SER A 1 61  ? -8.948  10.583  -0.615  1.00 0.00 ? 61  SER A C    3  
ATOM 4443  O O    . SER A 1 61  ? -10.039 10.076  -0.879  1.00 0.00 ? 61  SER A O    3  
ATOM 4444  C CB   . SER A 1 61  ? -7.559  10.127  1.415   1.00 0.00 ? 61  SER A CB   3  
ATOM 4445  O OG   . SER A 1 61  ? -7.377  8.964   0.626   1.00 0.00 ? 61  SER A OG   3  
ATOM 4446  H H    . SER A 1 61  ? -10.363 10.304  1.706   1.00 0.00 ? 61  SER A H    3  
ATOM 4447  H HA   . SER A 1 61  ? -8.200  12.054  0.739   1.00 0.00 ? 61  SER A HA   3  
ATOM 4448  H HB2  . SER A 1 61  ? -6.617  10.649  1.487   1.00 0.00 ? 61  SER A HB2  3  
ATOM 4449  H HB3  . SER A 1 61  ? -7.883  9.832   2.402   1.00 0.00 ? 61  SER A HB3  3  
ATOM 4450  H HG   . SER A 1 61  ? -7.807  8.218   1.052   1.00 0.00 ? 61  SER A HG   3  
ATOM 4451  N N    . PRO A 1 62  ? -7.995  10.752  -1.543  1.00 0.00 ? 62  PRO A N    3  
ATOM 4452  C CA   . PRO A 1 62  ? -8.172  10.350  -2.942  1.00 0.00 ? 62  PRO A CA   3  
ATOM 4453  C C    . PRO A 1 62  ? -8.203  8.835   -3.110  1.00 0.00 ? 62  PRO A C    3  
ATOM 4454  O O    . PRO A 1 62  ? -8.690  8.323   -4.117  1.00 0.00 ? 62  PRO A O    3  
ATOM 4455  C CB   . PRO A 1 62  ? -6.943  10.940  -3.638  1.00 0.00 ? 62  PRO A CB   3  
ATOM 4456  C CG   . PRO A 1 62  ? -5.916  11.051  -2.564  1.00 0.00 ? 62  PRO A CG   3  
ATOM 4457  C CD   . PRO A 1 62  ? -6.671  11.349  -1.298  1.00 0.00 ? 62  PRO A CD   3  
ATOM 4458  H HA   . PRO A 1 62  ? -9.068  10.777  -3.367  1.00 0.00 ? 62  PRO A HA   3  
ATOM 4459  H HB2  . PRO A 1 62  ? -6.620  10.275  -4.427  1.00 0.00 ? 62  PRO A HB2  3  
ATOM 4460  H HB3  . PRO A 1 62  ? -7.188  11.906  -4.051  1.00 0.00 ? 62  PRO A HB3  3  
ATOM 4461  H HG2  . PRO A 1 62  ? -5.379  10.119  -2.471  1.00 0.00 ? 62  PRO A HG2  3  
ATOM 4462  H HG3  . PRO A 1 62  ? -5.234  11.857  -2.791  1.00 0.00 ? 62  PRO A HG3  3  
ATOM 4463  H HD2  . PRO A 1 62  ? -6.188  10.882  -0.452  1.00 0.00 ? 62  PRO A HD2  3  
ATOM 4464  H HD3  . PRO A 1 62  ? -6.752  12.415  -1.149  1.00 0.00 ? 62  PRO A HD3  3  
ATOM 4465  N N    . ALA A 1 63  ? -7.681  8.123   -2.116  1.00 0.00 ? 63  ALA A N    3  
ATOM 4466  C CA   . ALA A 1 63  ? -7.652  6.666   -2.153  1.00 0.00 ? 63  ALA A CA   3  
ATOM 4467  C C    . ALA A 1 63  ? -8.882  6.075   -1.472  1.00 0.00 ? 63  ALA A C    3  
ATOM 4468  O O    . ALA A 1 63  ? -9.308  4.966   -1.792  1.00 0.00 ? 63  ALA A O    3  
ATOM 4469  C CB   . ALA A 1 63  ? -6.382  6.146   -1.497  1.00 0.00 ? 63  ALA A CB   3  
ATOM 4470  H H    . ALA A 1 63  ? -7.308  8.589   -1.339  1.00 0.00 ? 63  ALA A H    3  
ATOM 4471  H HA   . ALA A 1 63  ? -7.645  6.359   -3.189  1.00 0.00 ? 63  ALA A HA   3  
ATOM 4472  H HB1  . ALA A 1 63  ? -6.329  5.075   -1.615  1.00 0.00 ? 63  ALA A HB1  3  
ATOM 4473  H HB2  . ALA A 1 63  ? -5.523  6.604   -1.966  1.00 0.00 ? 63  ALA A HB2  3  
ATOM 4474  H HB3  . ALA A 1 63  ? -6.393  6.393   -0.446  1.00 0.00 ? 63  ALA A HB3  3  
ATOM 4475  N N    . GLY A 1 64  ? -9.448  6.823   -0.529  1.00 0.00 ? 64  GLY A N    3  
ATOM 4476  C CA   . GLY A 1 64  ? -10.623 6.356   0.183   1.00 0.00 ? 64  GLY A CA   3  
ATOM 4477  C C    . GLY A 1 64  ? -11.886 6.464   -0.648  1.00 0.00 ? 64  GLY A C    3  
ATOM 4478  O O    . GLY A 1 64  ? -12.751 5.590   -0.594  1.00 0.00 ? 64  GLY A O    3  
ATOM 4479  H H    . GLY A 1 64  ? -9.064  7.700   -0.316  1.00 0.00 ? 64  GLY A H    3  
ATOM 4480  H HA2  . GLY A 1 64  ? -10.474 5.323   0.461   1.00 0.00 ? 64  GLY A HA2  3  
ATOM 4481  H HA3  . GLY A 1 64  ? -10.744 6.945   1.080   1.00 0.00 ? 64  GLY A HA3  3  
ATOM 4482  N N    . LYS A 1 65  ? -11.994 7.542   -1.418  1.00 0.00 ? 65  LYS A N    3  
ATOM 4483  C CA   . LYS A 1 65  ? -13.161 7.764   -2.264  1.00 0.00 ? 65  LYS A CA   3  
ATOM 4484  C C    . LYS A 1 65  ? -13.267 6.686   -3.338  1.00 0.00 ? 65  LYS A C    3  
ATOM 4485  O O    . LYS A 1 65  ? -14.361 6.226   -3.666  1.00 0.00 ? 65  LYS A O    3  
ATOM 4486  C CB   . LYS A 1 65  ? -13.088 9.145   -2.917  1.00 0.00 ? 65  LYS A CB   3  
ATOM 4487  C CG   . LYS A 1 65  ? -13.155 10.292  -1.924  1.00 0.00 ? 65  LYS A CG   3  
ATOM 4488  C CD   . LYS A 1 65  ? -13.631 11.575  -2.585  1.00 0.00 ? 65  LYS A CD   3  
ATOM 4489  C CE   . LYS A 1 65  ? -13.182 12.803  -1.807  1.00 0.00 ? 65  LYS A CE   3  
ATOM 4490  N NZ   . LYS A 1 65  ? -13.606 14.066  -2.472  1.00 0.00 ? 65  LYS A NZ   3  
ATOM 4491  H H    . LYS A 1 65  ? -11.271 8.204   -1.418  1.00 0.00 ? 65  LYS A H    3  
ATOM 4492  H HA   . LYS A 1 65  ? -14.039 7.717   -1.637  1.00 0.00 ? 65  LYS A HA   3  
ATOM 4493  H HB2  . LYS A 1 65  ? -12.159 9.223   -3.463  1.00 0.00 ? 65  LYS A HB2  3  
ATOM 4494  H HB3  . LYS A 1 65  ? -13.911 9.247   -3.609  1.00 0.00 ? 65  LYS A HB3  3  
ATOM 4495  H HG2  . LYS A 1 65  ? -13.843 10.032  -1.133  1.00 0.00 ? 65  LYS A HG2  3  
ATOM 4496  H HG3  . LYS A 1 65  ? -12.171 10.455  -1.509  1.00 0.00 ? 65  LYS A HG3  3  
ATOM 4497  H HD2  . LYS A 1 65  ? -13.223 11.628  -3.584  1.00 0.00 ? 65  LYS A HD2  3  
ATOM 4498  H HD3  . LYS A 1 65  ? -14.710 11.566  -2.635  1.00 0.00 ? 65  LYS A HD3  3  
ATOM 4499  H HE2  . LYS A 1 65  ? -13.614 12.764  -0.819  1.00 0.00 ? 65  LYS A HE2  3  
ATOM 4500  H HE3  . LYS A 1 65  ? -12.105 12.790  -1.730  1.00 0.00 ? 65  LYS A HE3  3  
ATOM 4501  H HZ1  . LYS A 1 65  ? -13.204 14.885  -1.973  1.00 0.00 ? 65  LYS A HZ1  3  
ATOM 4502  H HZ2  . LYS A 1 65  ? -14.643 14.144  -2.463  1.00 0.00 ? 65  LYS A HZ2  3  
ATOM 4503  H HZ3  . LYS A 1 65  ? -13.278 14.079  -3.458  1.00 0.00 ? 65  LYS A HZ3  3  
ATOM 4504  N N    . THR A 1 66  ? -12.122 6.286   -3.884  1.00 0.00 ? 66  THR A N    3  
ATOM 4505  C CA   . THR A 1 66  ? -12.086 5.263   -4.921  1.00 0.00 ? 66  THR A CA   3  
ATOM 4506  C C    . THR A 1 66  ? -12.771 3.983   -4.454  1.00 0.00 ? 66  THR A C    3  
ATOM 4507  O O    . THR A 1 66  ? -13.210 3.172   -5.268  1.00 0.00 ? 66  THR A O    3  
ATOM 4508  C CB   . THR A 1 66  ? -10.640 4.935   -5.337  1.00 0.00 ? 66  THR A CB   3  
ATOM 4509  O OG1  . THR A 1 66  ? -10.123 3.877   -4.522  1.00 0.00 ? 66  THR A OG1  3  
ATOM 4510  C CG2  . THR A 1 66  ? -9.749  6.162   -5.208  1.00 0.00 ? 66  THR A CG2  3  
ATOM 4511  H H    . THR A 1 66  ? -11.283 6.691   -3.581  1.00 0.00 ? 66  THR A H    3  
ATOM 4512  H HA   . THR A 1 66  ? -12.609 5.645   -5.785  1.00 0.00 ? 66  THR A HA   3  
ATOM 4513  H HB   . THR A 1 66  ? -10.642 4.617   -6.369  1.00 0.00 ? 66  THR A HB   3  
ATOM 4514  H HG1  . THR A 1 66  ? -9.913  4.218   -3.649  1.00 0.00 ? 66  THR A HG1  3  
ATOM 4515  H HG21 . THR A 1 66  ? -9.384  6.236   -4.195  1.00 0.00 ? 66  THR A HG21 3  
ATOM 4516  H HG22 . THR A 1 66  ? -10.317 7.047   -5.451  1.00 0.00 ? 66  THR A HG22 3  
ATOM 4517  H HG23 . THR A 1 66  ? -8.913  6.072   -5.886  1.00 0.00 ? 66  THR A HG23 3  
ATOM 4518  N N    . ASN A 1 67  ? -12.858 3.809   -3.140  1.00 0.00 ? 67  ASN A N    3  
ATOM 4519  C CA   . ASN A 1 67  ? -13.490 2.627   -2.565  1.00 0.00 ? 67  ASN A CA   3  
ATOM 4520  C C    . ASN A 1 67  ? -13.068 1.367   -3.314  1.00 0.00 ? 67  ASN A C    3  
ATOM 4521  O O    . ASN A 1 67  ? -13.773 0.358   -3.299  1.00 0.00 ? 67  ASN A O    3  
ATOM 4522  C CB   . ASN A 1 67  ? -15.013 2.770   -2.600  1.00 0.00 ? 67  ASN A CB   3  
ATOM 4523  C CG   . ASN A 1 67  ? -15.699 1.905   -1.560  1.00 0.00 ? 67  ASN A CG   3  
ATOM 4524  O OD1  . ASN A 1 67  ? -15.558 0.682   -1.563  1.00 0.00 ? 67  ASN A OD1  3  
ATOM 4525  N ND2  . ASN A 1 67  ? -16.447 2.538   -0.664  1.00 0.00 ? 67  ASN A ND2  3  
ATOM 4526  H H    . ASN A 1 67  ? -12.489 4.492   -2.541  1.00 0.00 ? 67  ASN A H    3  
ATOM 4527  H HA   . ASN A 1 67  ? -13.169 2.546   -1.538  1.00 0.00 ? 67  ASN A HA   3  
ATOM 4528  H HB2  . ASN A 1 67  ? -15.276 3.801   -2.413  1.00 0.00 ? 67  ASN A HB2  3  
ATOM 4529  H HB3  . ASN A 1 67  ? -15.373 2.482   -3.576  1.00 0.00 ? 67  ASN A HB3  3  
ATOM 4530  H HD21 . ASN A 1 67  ? -16.513 3.515   -0.723  1.00 0.00 ? 67  ASN A HD21 3  
ATOM 4531  H HD22 . ASN A 1 67  ? -16.901 2.004   0.020   1.00 0.00 ? 67  ASN A HD22 3  
ATOM 4532  N N    . ALA A 1 68  ? -11.914 1.432   -3.969  1.00 0.00 ? 68  ALA A N    3  
ATOM 4533  C CA   . ALA A 1 68  ? -11.396 0.296   -4.721  1.00 0.00 ? 68  ALA A CA   3  
ATOM 4534  C C    . ALA A 1 68  ? -10.212 -0.344  -4.005  1.00 0.00 ? 68  ALA A C    3  
ATOM 4535  O O    . ALA A 1 68  ? -9.682  -1.363  -4.448  1.00 0.00 ? 68  ALA A O    3  
ATOM 4536  C CB   . ALA A 1 68  ? -10.996 0.730   -6.123  1.00 0.00 ? 68  ALA A CB   3  
ATOM 4537  H H    . ALA A 1 68  ? -11.397 2.264   -3.944  1.00 0.00 ? 68  ALA A H    3  
ATOM 4538  H HA   . ALA A 1 68  ? -12.188 -0.434  -4.809  1.00 0.00 ? 68  ALA A HA   3  
ATOM 4539  H HB1  . ALA A 1 68  ? -9.974  1.078   -6.114  1.00 0.00 ? 68  ALA A HB1  3  
ATOM 4540  H HB2  . ALA A 1 68  ? -11.085 -0.109  -6.798  1.00 0.00 ? 68  ALA A HB2  3  
ATOM 4541  H HB3  . ALA A 1 68  ? -11.645 1.528   -6.452  1.00 0.00 ? 68  ALA A HB3  3  
ATOM 4542  N N    . LEU A 1 69  ? -9.801  0.261   -2.896  1.00 0.00 ? 69  LEU A N    3  
ATOM 4543  C CA   . LEU A 1 69  ? -8.678  -0.250  -2.117  1.00 0.00 ? 69  LEU A CA   3  
ATOM 4544  C C    . LEU A 1 69  ? -8.991  -0.220  -0.625  1.00 0.00 ? 69  LEU A C    3  
ATOM 4545  O O    . LEU A 1 69  ? -9.516  0.767   -0.109  1.00 0.00 ? 69  LEU A O    3  
ATOM 4546  C CB   . LEU A 1 69  ? -7.419  0.572   -2.402  1.00 0.00 ? 69  LEU A CB   3  
ATOM 4547  C CG   . LEU A 1 69  ? -7.083  0.796   -3.877  1.00 0.00 ? 69  LEU A CG   3  
ATOM 4548  C CD1  . LEU A 1 69  ? -6.240  2.050   -4.047  1.00 0.00 ? 69  LEU A CD1  3  
ATOM 4549  C CD2  . LEU A 1 69  ? -6.362  -0.416  -4.449  1.00 0.00 ? 69  LEU A CD2  3  
ATOM 4550  H H    . LEU A 1 69  ? -10.263 1.070   -2.592  1.00 0.00 ? 69  LEU A H    3  
ATOM 4551  H HA   . LEU A 1 69  ? -8.505  -1.273  -2.417  1.00 0.00 ? 69  LEU A HA   3  
ATOM 4552  H HB2  . LEU A 1 69  ? -7.545  1.539   -1.941  1.00 0.00 ? 69  LEU A HB2  3  
ATOM 4553  H HB3  . LEU A 1 69  ? -6.583  0.063   -1.944  1.00 0.00 ? 69  LEU A HB3  3  
ATOM 4554  H HG   . LEU A 1 69  ? -8.001  0.933   -4.432  1.00 0.00 ? 69  LEU A HG   3  
ATOM 4555  H HD11 . LEU A 1 69  ? -5.592  1.935   -4.903  1.00 0.00 ? 69  LEU A HD11 3  
ATOM 4556  H HD12 . LEU A 1 69  ? -5.643  2.206   -3.161  1.00 0.00 ? 69  LEU A HD12 3  
ATOM 4557  H HD13 . LEU A 1 69  ? -6.888  2.901   -4.198  1.00 0.00 ? 69  LEU A HD13 3  
ATOM 4558  H HD21 . LEU A 1 69  ? -6.759  -0.642  -5.427  1.00 0.00 ? 69  LEU A HD21 3  
ATOM 4559  H HD22 . LEU A 1 69  ? -6.507  -1.263  -3.796  1.00 0.00 ? 69  LEU A HD22 3  
ATOM 4560  H HD23 . LEU A 1 69  ? -5.306  -0.201  -4.530  1.00 0.00 ? 69  LEU A HD23 3  
ATOM 4561  N N    . LYS A 1 70  ? -8.665  -1.308  0.064   1.00 0.00 ? 70  LYS A N    3  
ATOM 4562  C CA   . LYS A 1 70  ? -8.908  -1.408  1.499   1.00 0.00 ? 70  LYS A CA   3  
ATOM 4563  C C    . LYS A 1 70  ? -7.667  -1.913  2.227   1.00 0.00 ? 70  LYS A C    3  
ATOM 4564  O O    . LYS A 1 70  ? -6.698  -2.344  1.600   1.00 0.00 ? 70  LYS A O    3  
ATOM 4565  C CB   . LYS A 1 70  ? -10.089 -2.341  1.773   1.00 0.00 ? 70  LYS A CB   3  
ATOM 4566  C CG   . LYS A 1 70  ? -10.114 -3.570  0.881   1.00 0.00 ? 70  LYS A CG   3  
ATOM 4567  C CD   . LYS A 1 70  ? -9.426  -4.753  1.541   1.00 0.00 ? 70  LYS A CD   3  
ATOM 4568  C CE   . LYS A 1 70  ? -10.171 -5.206  2.788   1.00 0.00 ? 70  LYS A CE   3  
ATOM 4569  N NZ   . LYS A 1 70  ? -9.992  -6.662  3.043   1.00 0.00 ? 70  LYS A NZ   3  
ATOM 4570  H H    . LYS A 1 70  ? -8.249  -2.063  -0.403  1.00 0.00 ? 70  LYS A H    3  
ATOM 4571  H HA   . LYS A 1 70  ? -9.148  -0.420  1.864   1.00 0.00 ? 70  LYS A HA   3  
ATOM 4572  H HB2  . LYS A 1 70  ? -10.041 -2.669  2.801   1.00 0.00 ? 70  LYS A HB2  3  
ATOM 4573  H HB3  . LYS A 1 70  ? -11.008 -1.793  1.622   1.00 0.00 ? 70  LYS A HB3  3  
ATOM 4574  H HG2  . LYS A 1 70  ? -11.140 -3.833  0.674   1.00 0.00 ? 70  LYS A HG2  3  
ATOM 4575  H HG3  . LYS A 1 70  ? -9.605  -3.341  -0.045  1.00 0.00 ? 70  LYS A HG3  3  
ATOM 4576  H HD2  . LYS A 1 70  ? -9.388  -5.574  0.841   1.00 0.00 ? 70  LYS A HD2  3  
ATOM 4577  H HD3  . LYS A 1 70  ? -8.421  -4.466  1.818   1.00 0.00 ? 70  LYS A HD3  3  
ATOM 4578  H HE2  . LYS A 1 70  ? -9.798  -4.652  3.635   1.00 0.00 ? 70  LYS A HE2  3  
ATOM 4579  H HE3  . LYS A 1 70  ? -11.223 -4.998  2.657   1.00 0.00 ? 70  LYS A HE3  3  
ATOM 4580  H HZ1  . LYS A 1 70  ? -9.582  -7.123  2.207   1.00 0.00 ? 70  LYS A HZ1  3  
ATOM 4581  H HZ2  . LYS A 1 70  ? -10.910 -7.103  3.255   1.00 0.00 ? 70  LYS A HZ2  3  
ATOM 4582  H HZ3  . LYS A 1 70  ? -9.356  -6.807  3.853   1.00 0.00 ? 70  LYS A HZ3  3  
ATOM 4583  N N    . THR A 1 71  ? -7.702  -1.859  3.555   1.00 0.00 ? 71  THR A N    3  
ATOM 4584  C CA   . THR A 1 71  ? -6.581  -2.312  4.368   1.00 0.00 ? 71  THR A CA   3  
ATOM 4585  C C    . THR A 1 71  ? -6.458  -3.831  4.340   1.00 0.00 ? 71  THR A C    3  
ATOM 4586  O O    . THR A 1 71  ? -7.454  -4.546  4.441   1.00 0.00 ? 71  THR A O    3  
ATOM 4587  C CB   . THR A 1 71  ? -6.723  -1.847  5.830   1.00 0.00 ? 71  THR A CB   3  
ATOM 4588  O OG1  . THR A 1 71  ? -5.536  -2.167  6.564   1.00 0.00 ? 71  THR A OG1  3  
ATOM 4589  C CG2  . THR A 1 71  ? -7.926  -2.502  6.491   1.00 0.00 ? 71  THR A CG2  3  
ATOM 4590  H H    . THR A 1 71  ? -8.502  -1.505  3.997   1.00 0.00 ? 71  THR A H    3  
ATOM 4591  H HA   . THR A 1 71  ? -5.678  -1.880  3.962   1.00 0.00 ? 71  THR A HA   3  
ATOM 4592  H HB   . THR A 1 71  ? -6.865  -0.776  5.839   1.00 0.00 ? 71  THR A HB   3  
ATOM 4593  H HG1  . THR A 1 71  ? -5.667  -1.958  7.492   1.00 0.00 ? 71  THR A HG1  3  
ATOM 4594  H HG21 . THR A 1 71  ? -8.801  -2.353  5.876   1.00 0.00 ? 71  THR A HG21 3  
ATOM 4595  H HG22 . THR A 1 71  ? -8.090  -2.058  7.462   1.00 0.00 ? 71  THR A HG22 3  
ATOM 4596  H HG23 . THR A 1 71  ? -7.743  -3.560  6.605   1.00 0.00 ? 71  THR A HG23 3  
ATOM 4597  N N    . GLY A 1 72  ? -5.229  -4.319  4.202   1.00 0.00 ? 72  GLY A N    3  
ATOM 4598  C CA   . GLY A 1 72  ? -4.999  -5.751  4.163   1.00 0.00 ? 72  GLY A CA   3  
ATOM 4599  C C    . GLY A 1 72  ? -4.623  -6.241  2.779   1.00 0.00 ? 72  GLY A C    3  
ATOM 4600  O O    . GLY A 1 72  ? -3.944  -7.258  2.636   1.00 0.00 ? 72  GLY A O    3  
ATOM 4601  H H    . GLY A 1 72  ? -4.472  -3.701  4.126   1.00 0.00 ? 72  GLY A H    3  
ATOM 4602  H HA2  . GLY A 1 72  ? -4.203  -5.996  4.849   1.00 0.00 ? 72  GLY A HA2  3  
ATOM 4603  H HA3  . GLY A 1 72  ? -5.900  -6.257  4.478   1.00 0.00 ? 72  GLY A HA3  3  
ATOM 4604  N N    . ASP A 1 73  ? -5.066  -5.517  1.756   1.00 0.00 ? 73  ASP A N    3  
ATOM 4605  C CA   . ASP A 1 73  ? -4.772  -5.884  0.376   1.00 0.00 ? 73  ASP A CA   3  
ATOM 4606  C C    . ASP A 1 73  ? -3.277  -6.119  0.183   1.00 0.00 ? 73  ASP A C    3  
ATOM 4607  O O    . ASP A 1 73  ? -2.482  -5.921  1.102   1.00 0.00 ? 73  ASP A O    3  
ATOM 4608  C CB   . ASP A 1 73  ? -5.256  -4.791  -0.579  1.00 0.00 ? 73  ASP A CB   3  
ATOM 4609  C CG   . ASP A 1 73  ? -6.680  -5.020  -1.046  1.00 0.00 ? 73  ASP A CG   3  
ATOM 4610  O OD1  . ASP A 1 73  ? -6.875  -5.819  -1.986  1.00 0.00 ? 73  ASP A OD1  3  
ATOM 4611  O OD2  . ASP A 1 73  ? -7.599  -4.401  -0.471  1.00 0.00 ? 73  ASP A OD2  3  
ATOM 4612  H H    . ASP A 1 73  ? -5.603  -4.716  1.935   1.00 0.00 ? 73  ASP A H    3  
ATOM 4613  H HA   . ASP A 1 73  ? -5.299  -6.800  0.157   1.00 0.00 ? 73  ASP A HA   3  
ATOM 4614  H HB2  . ASP A 1 73  ? -5.211  -3.836  -0.075  1.00 0.00 ? 73  ASP A HB2  3  
ATOM 4615  H HB3  . ASP A 1 73  ? -4.611  -4.767  -1.445  1.00 0.00 ? 73  ASP A HB3  3  
ATOM 4616  N N    . LYS A 1 74  ? -2.900  -6.545  -1.018  1.00 0.00 ? 74  LYS A N    3  
ATOM 4617  C CA   . LYS A 1 74  ? -1.501  -6.808  -1.334  1.00 0.00 ? 74  LYS A CA   3  
ATOM 4618  C C    . LYS A 1 74  ? -1.053  -5.992  -2.542  1.00 0.00 ? 74  LYS A C    3  
ATOM 4619  O O    . LYS A 1 74  ? -1.353  -6.342  -3.684  1.00 0.00 ? 74  LYS A O    3  
ATOM 4620  C CB   . LYS A 1 74  ? -1.290  -8.299  -1.604  1.00 0.00 ? 74  LYS A CB   3  
ATOM 4621  C CG   . LYS A 1 74  ? 0.159   -8.669  -1.871  1.00 0.00 ? 74  LYS A CG   3  
ATOM 4622  C CD   . LYS A 1 74  ? 0.272   -10.023 -2.553  1.00 0.00 ? 74  LYS A CD   3  
ATOM 4623  C CE   . LYS A 1 74  ? 1.701   -10.311 -2.985  1.00 0.00 ? 74  LYS A CE   3  
ATOM 4624  N NZ   . LYS A 1 74  ? 1.788   -11.531 -3.835  1.00 0.00 ? 74  LYS A NZ   3  
ATOM 4625  H H    . LYS A 1 74  ? -3.581  -6.684  -1.711  1.00 0.00 ? 74  LYS A H    3  
ATOM 4626  H HA   . LYS A 1 74  ? -0.909  -6.518  -0.479  1.00 0.00 ? 74  LYS A HA   3  
ATOM 4627  H HB2  . LYS A 1 74  ? -1.631  -8.860  -0.747  1.00 0.00 ? 74  LYS A HB2  3  
ATOM 4628  H HB3  . LYS A 1 74  ? -1.877  -8.583  -2.466  1.00 0.00 ? 74  LYS A HB3  3  
ATOM 4629  H HG2  . LYS A 1 74  ? 0.601   -7.919  -2.509  1.00 0.00 ? 74  LYS A HG2  3  
ATOM 4630  H HG3  . LYS A 1 74  ? 0.691   -8.704  -0.931  1.00 0.00 ? 74  LYS A HG3  3  
ATOM 4631  H HD2  . LYS A 1 74  ? -0.046  -10.791 -1.864  1.00 0.00 ? 74  LYS A HD2  3  
ATOM 4632  H HD3  . LYS A 1 74  ? -0.367  -10.032 -3.424  1.00 0.00 ? 74  LYS A HD3  3  
ATOM 4633  H HE2  . LYS A 1 74  ? 2.072   -9.466  -3.544  1.00 0.00 ? 74  LYS A HE2  3  
ATOM 4634  H HE3  . LYS A 1 74  ? 2.308   -10.454 -2.103  1.00 0.00 ? 74  LYS A HE3  3  
ATOM 4635  H HZ1  . LYS A 1 74  ? 1.340   -11.356 -4.757  1.00 0.00 ? 74  LYS A HZ1  3  
ATOM 4636  H HZ2  . LYS A 1 74  ? 1.304   -12.325 -3.371  1.00 0.00 ? 74  LYS A HZ2  3  
ATOM 4637  H HZ3  . LYS A 1 74  ? 2.784   -11.789 -3.989  1.00 0.00 ? 74  LYS A HZ3  3  
ATOM 4638  N N    . ILE A 1 75  ? -0.334  -4.906  -2.284  1.00 0.00 ? 75  ILE A N    3  
ATOM 4639  C CA   . ILE A 1 75  ? 0.157   -4.043  -3.351  1.00 0.00 ? 75  ILE A CA   3  
ATOM 4640  C C    . ILE A 1 75  ? 1.272   -4.723  -4.138  1.00 0.00 ? 75  ILE A C    3  
ATOM 4641  O O    . ILE A 1 75  ? 2.331   -5.035  -3.592  1.00 0.00 ? 75  ILE A O    3  
ATOM 4642  C CB   . ILE A 1 75  ? 0.678   -2.703  -2.798  1.00 0.00 ? 75  ILE A CB   3  
ATOM 4643  C CG1  . ILE A 1 75  ? -0.324  -2.114  -1.803  1.00 0.00 ? 75  ILE A CG1  3  
ATOM 4644  C CG2  . ILE A 1 75  ? 0.940   -1.727  -3.935  1.00 0.00 ? 75  ILE A CG2  3  
ATOM 4645  C CD1  . ILE A 1 75  ? 0.171   -0.859  -1.118  1.00 0.00 ? 75  ILE A CD1  3  
ATOM 4646  H H    . ILE A 1 75  ? -0.128  -4.679  -1.353  1.00 0.00 ? 75  ILE A H    3  
ATOM 4647  H HA   . ILE A 1 75  ? -0.667  -3.838  -4.019  1.00 0.00 ? 75  ILE A HA   3  
ATOM 4648  H HB   . ILE A 1 75  ? 1.612   -2.888  -2.291  1.00 0.00 ? 75  ILE A HB   3  
ATOM 4649  H HG12 . ILE A 1 75  ? -1.237  -1.869  -2.322  1.00 0.00 ? 75  ILE A HG12 3  
ATOM 4650  H HG13 . ILE A 1 75  ? -0.536  -2.848  -1.039  1.00 0.00 ? 75  ILE A HG13 3  
ATOM 4651  H HG21 . ILE A 1 75  ? 0.929   -2.258  -4.875  1.00 0.00 ? 75  ILE A HG21 3  
ATOM 4652  H HG22 . ILE A 1 75  ? 0.171   -0.969  -3.942  1.00 0.00 ? 75  ILE A HG22 3  
ATOM 4653  H HG23 . ILE A 1 75  ? 1.904   -1.262  -3.795  1.00 0.00 ? 75  ILE A HG23 3  
ATOM 4654  H HD11 . ILE A 1 75  ? -0.252  -0.800  -0.125  1.00 0.00 ? 75  ILE A HD11 3  
ATOM 4655  H HD12 . ILE A 1 75  ? 1.249   -0.889  -1.047  1.00 0.00 ? 75  ILE A HD12 3  
ATOM 4656  H HD13 . ILE A 1 75  ? -0.129  0.006   -1.689  1.00 0.00 ? 75  ILE A HD13 3  
ATOM 4657  N N    . LEU A 1 76  ? 1.029   -4.948  -5.424  1.00 0.00 ? 76  LEU A N    3  
ATOM 4658  C CA   . LEU A 1 76  ? 2.013   -5.589  -6.289  1.00 0.00 ? 76  LEU A CA   3  
ATOM 4659  C C    . LEU A 1 76  ? 2.742   -4.557  -7.144  1.00 0.00 ? 76  LEU A C    3  
ATOM 4660  O O    . LEU A 1 76  ? 3.871   -4.783  -7.578  1.00 0.00 ? 76  LEU A O    3  
ATOM 4661  C CB   . LEU A 1 76  ? 1.335   -6.625  -7.187  1.00 0.00 ? 76  LEU A CB   3  
ATOM 4662  C CG   . LEU A 1 76  ? 0.133   -7.353  -6.583  1.00 0.00 ? 76  LEU A CG   3  
ATOM 4663  C CD1  . LEU A 1 76  ? -0.831  -7.789  -7.676  1.00 0.00 ? 76  LEU A CD1  3  
ATOM 4664  C CD2  . LEU A 1 76  ? 0.592   -8.550  -5.764  1.00 0.00 ? 76  LEU A CD2  3  
ATOM 4665  H H    . LEU A 1 76  ? 0.167   -4.677  -5.803  1.00 0.00 ? 76  LEU A H    3  
ATOM 4666  H HA   . LEU A 1 76  ? 2.733   -6.088  -5.658  1.00 0.00 ? 76  LEU A HA   3  
ATOM 4667  H HB2  . LEU A 1 76  ? 1.000   -6.119  -8.080  1.00 0.00 ? 76  LEU A HB2  3  
ATOM 4668  H HB3  . LEU A 1 76  ? 2.074   -7.367  -7.451  1.00 0.00 ? 76  LEU A HB3  3  
ATOM 4669  H HG   . LEU A 1 76  ? -0.394  -6.677  -5.924  1.00 0.00 ? 76  LEU A HG   3  
ATOM 4670  H HD11 . LEU A 1 76  ? -1.845  -7.606  -7.355  1.00 0.00 ? 76  LEU A HD11 3  
ATOM 4671  H HD12 . LEU A 1 76  ? -0.700  -8.843  -7.871  1.00 0.00 ? 76  LEU A HD12 3  
ATOM 4672  H HD13 . LEU A 1 76  ? -0.630  -7.229  -8.577  1.00 0.00 ? 76  LEU A HD13 3  
ATOM 4673  H HD21 . LEU A 1 76  ? 1.602   -8.386  -5.420  1.00 0.00 ? 76  LEU A HD21 3  
ATOM 4674  H HD22 . LEU A 1 76  ? 0.560   -9.439  -6.378  1.00 0.00 ? 76  LEU A HD22 3  
ATOM 4675  H HD23 . LEU A 1 76  ? -0.063  -8.677  -4.914  1.00 0.00 ? 76  LEU A HD23 3  
ATOM 4676  N N    . GLU A 1 77  ? 2.088   -3.423  -7.379  1.00 0.00 ? 77  GLU A N    3  
ATOM 4677  C CA   . GLU A 1 77  ? 2.676   -2.356  -8.181  1.00 0.00 ? 77  GLU A CA   3  
ATOM 4678  C C    . GLU A 1 77  ? 1.881   -1.062  -8.029  1.00 0.00 ? 77  GLU A C    3  
ATOM 4679  O O    . GLU A 1 77  ? 0.680   -1.085  -7.763  1.00 0.00 ? 77  GLU A O    3  
ATOM 4680  C CB   . GLU A 1 77  ? 2.729   -2.765  -9.654  1.00 0.00 ? 77  GLU A CB   3  
ATOM 4681  C CG   . GLU A 1 77  ? 3.914   -2.183  -10.405 1.00 0.00 ? 77  GLU A CG   3  
ATOM 4682  C CD   . GLU A 1 77  ? 3.762   -2.292  -11.910 1.00 0.00 ? 77  GLU A CD   3  
ATOM 4683  O OE1  . GLU A 1 77  ? 2.633   -2.555  -12.374 1.00 0.00 ? 77  GLU A OE1  3  
ATOM 4684  O OE2  . GLU A 1 77  ? 4.772   -2.116  -12.623 1.00 0.00 ? 77  GLU A OE2  3  
ATOM 4685  H H    . GLU A 1 77  ? 1.191   -3.302  -7.005  1.00 0.00 ? 77  GLU A H    3  
ATOM 4686  H HA   . GLU A 1 77  ? 3.682   -2.191  -7.826  1.00 0.00 ? 77  GLU A HA   3  
ATOM 4687  H HB2  . GLU A 1 77  ? 2.784   -3.842  -9.715  1.00 0.00 ? 77  GLU A HB2  3  
ATOM 4688  H HB3  . GLU A 1 77  ? 1.823   -2.433  -10.140 1.00 0.00 ? 77  GLU A HB3  3  
ATOM 4689  H HG2  . GLU A 1 77  ? 4.012   -1.140  -10.144 1.00 0.00 ? 77  GLU A HG2  3  
ATOM 4690  H HG3  . GLU A 1 77  ? 4.807   -2.713  -10.109 1.00 0.00 ? 77  GLU A HG3  3  
ATOM 4691  N N    . VAL A 1 78  ? 2.563   0.067   -8.199  1.00 0.00 ? 78  VAL A N    3  
ATOM 4692  C CA   . VAL A 1 78  ? 1.922   1.371   -8.082  1.00 0.00 ? 78  VAL A CA   3  
ATOM 4693  C C    . VAL A 1 78  ? 2.532   2.372   -9.057  1.00 0.00 ? 78  VAL A C    3  
ATOM 4694  O O    . VAL A 1 78  ? 3.745   2.580   -9.071  1.00 0.00 ? 78  VAL A O    3  
ATOM 4695  C CB   . VAL A 1 78  ? 2.040   1.928   -6.651  1.00 0.00 ? 78  VAL A CB   3  
ATOM 4696  C CG1  . VAL A 1 78  ? 3.226   2.875   -6.542  1.00 0.00 ? 78  VAL A CG1  3  
ATOM 4697  C CG2  . VAL A 1 78  ? 0.751   2.626   -6.243  1.00 0.00 ? 78  VAL A CG2  3  
ATOM 4698  H H    . VAL A 1 78  ? 3.519   0.021   -8.409  1.00 0.00 ? 78  VAL A H    3  
ATOM 4699  H HA   . VAL A 1 78  ? 0.874   1.251   -8.314  1.00 0.00 ? 78  VAL A HA   3  
ATOM 4700  H HB   . VAL A 1 78  ? 2.205   1.100   -5.977  1.00 0.00 ? 78  VAL A HB   3  
ATOM 4701  H HG11 . VAL A 1 78  ? 3.327   3.209   -5.520  1.00 0.00 ? 78  VAL A HG11 3  
ATOM 4702  H HG12 . VAL A 1 78  ? 4.126   2.360   -6.845  1.00 0.00 ? 78  VAL A HG12 3  
ATOM 4703  H HG13 . VAL A 1 78  ? 3.065   3.728   -7.185  1.00 0.00 ? 78  VAL A HG13 3  
ATOM 4704  H HG21 . VAL A 1 78  ? 0.853   3.014   -5.241  1.00 0.00 ? 78  VAL A HG21 3  
ATOM 4705  H HG22 . VAL A 1 78  ? 0.551   3.438   -6.926  1.00 0.00 ? 78  VAL A HG22 3  
ATOM 4706  H HG23 . VAL A 1 78  ? -0.066  1.920   -6.274  1.00 0.00 ? 78  VAL A HG23 3  
ATOM 4707  N N    . SER A 1 79  ? 1.682   2.990   -9.871  1.00 0.00 ? 79  SER A N    3  
ATOM 4708  C CA   . SER A 1 79  ? 2.137   3.968   -10.852 1.00 0.00 ? 79  SER A CA   3  
ATOM 4709  C C    . SER A 1 79  ? 3.107   3.332   -11.844 1.00 0.00 ? 79  SER A C    3  
ATOM 4710  O O    . SER A 1 79  ? 3.825   4.027   -12.560 1.00 0.00 ? 79  SER A O    3  
ATOM 4711  C CB   . SER A 1 79  ? 2.809   5.151   -10.152 1.00 0.00 ? 79  SER A CB   3  
ATOM 4712  O OG   . SER A 1 79  ? 2.661   6.341   -10.906 1.00 0.00 ? 79  SER A OG   3  
ATOM 4713  H H    . SER A 1 79  ? 0.726   2.781   -9.811  1.00 0.00 ? 79  SER A H    3  
ATOM 4714  H HA   . SER A 1 79  ? 1.272   4.324   -11.391 1.00 0.00 ? 79  SER A HA   3  
ATOM 4715  H HB2  . SER A 1 79  ? 2.357   5.295   -9.182  1.00 0.00 ? 79  SER A HB2  3  
ATOM 4716  H HB3  . SER A 1 79  ? 3.862   4.943   -10.032 1.00 0.00 ? 79  SER A HB3  3  
ATOM 4717  H HG   . SER A 1 79  ? 1.772   6.383   -11.267 1.00 0.00 ? 79  SER A HG   3  
ATOM 4718  N N    . GLY A 1 80  ? 3.121   2.003   -11.878 1.00 0.00 ? 80  GLY A N    3  
ATOM 4719  C CA   . GLY A 1 80  ? 4.005   1.293   -12.784 1.00 0.00 ? 80  GLY A CA   3  
ATOM 4720  C C    . GLY A 1 80  ? 5.338   0.956   -12.147 1.00 0.00 ? 80  GLY A C    3  
ATOM 4721  O O    . GLY A 1 80  ? 6.369   0.934   -12.820 1.00 0.00 ? 80  GLY A O    3  
ATOM 4722  H H    . GLY A 1 80  ? 2.525   1.500   -11.284 1.00 0.00 ? 80  GLY A H    3  
ATOM 4723  H HA2  . GLY A 1 80  ? 3.525   0.378   -13.096 1.00 0.00 ? 80  GLY A HA2  3  
ATOM 4724  H HA3  . GLY A 1 80  ? 4.181   1.910   -13.653 1.00 0.00 ? 80  GLY A HA3  3  
ATOM 4725  N N    . VAL A 1 81  ? 5.320   0.693   -10.844 1.00 0.00 ? 81  VAL A N    3  
ATOM 4726  C CA   . VAL A 1 81  ? 6.537   0.356   -10.115 1.00 0.00 ? 81  VAL A CA   3  
ATOM 4727  C C    . VAL A 1 81  ? 6.346   -0.907  -9.282  1.00 0.00 ? 81  VAL A C    3  
ATOM 4728  O O    . VAL A 1 81  ? 5.433   -0.989  -8.460  1.00 0.00 ? 81  VAL A O    3  
ATOM 4729  C CB   . VAL A 1 81  ? 6.974   1.507   -9.190  1.00 0.00 ? 81  VAL A CB   3  
ATOM 4730  C CG1  . VAL A 1 81  ? 6.216   1.451   -7.872  1.00 0.00 ? 81  VAL A CG1  3  
ATOM 4731  C CG2  . VAL A 1 81  ? 8.476   1.458   -8.953  1.00 0.00 ? 81  VAL A CG2  3  
ATOM 4732  H H    . VAL A 1 81  ? 4.468   0.726   -10.362 1.00 0.00 ? 81  VAL A H    3  
ATOM 4733  H HA   . VAL A 1 81  ? 7.322   0.184   -10.837 1.00 0.00 ? 81  VAL A HA   3  
ATOM 4734  H HB   . VAL A 1 81  ? 6.738   2.442   -9.676  1.00 0.00 ? 81  VAL A HB   3  
ATOM 4735  H HG11 . VAL A 1 81  ? 5.191   1.166   -8.059  1.00 0.00 ? 81  VAL A HG11 3  
ATOM 4736  H HG12 . VAL A 1 81  ? 6.680   0.725   -7.220  1.00 0.00 ? 81  VAL A HG12 3  
ATOM 4737  H HG13 . VAL A 1 81  ? 6.239   2.423   -7.403  1.00 0.00 ? 81  VAL A HG13 3  
ATOM 4738  H HG21 . VAL A 1 81  ? 8.800   2.382   -8.497  1.00 0.00 ? 81  VAL A HG21 3  
ATOM 4739  H HG22 . VAL A 1 81  ? 8.710   0.632   -8.298  1.00 0.00 ? 81  VAL A HG22 3  
ATOM 4740  H HG23 . VAL A 1 81  ? 8.986   1.324   -9.896  1.00 0.00 ? 81  VAL A HG23 3  
ATOM 4741  N N    . ASP A 1 82  ? 7.214   -1.889  -9.499  1.00 0.00 ? 82  ASP A N    3  
ATOM 4742  C CA   . ASP A 1 82  ? 7.143   -3.148  -8.767  1.00 0.00 ? 82  ASP A CA   3  
ATOM 4743  C C    . ASP A 1 82  ? 7.466   -2.937  -7.291  1.00 0.00 ? 82  ASP A C    3  
ATOM 4744  O O    . ASP A 1 82  ? 8.605   -2.639  -6.930  1.00 0.00 ? 82  ASP A O    3  
ATOM 4745  C CB   . ASP A 1 82  ? 8.107   -4.169  -9.372  1.00 0.00 ? 82  ASP A CB   3  
ATOM 4746  C CG   . ASP A 1 82  ? 7.643   -5.598  -9.164  1.00 0.00 ? 82  ASP A CG   3  
ATOM 4747  O OD1  . ASP A 1 82  ? 6.446   -5.795  -8.866  1.00 0.00 ? 82  ASP A OD1  3  
ATOM 4748  O OD2  . ASP A 1 82  ? 8.476   -6.518  -9.299  1.00 0.00 ? 82  ASP A OD2  3  
ATOM 4749  H H    . ASP A 1 82  ? 7.921   -1.763  -10.167 1.00 0.00 ? 82  ASP A H    3  
ATOM 4750  H HA   . ASP A 1 82  ? 6.135   -3.524  -8.851  1.00 0.00 ? 82  ASP A HA   3  
ATOM 4751  H HB2  . ASP A 1 82  ? 8.192   -3.990  -10.434 1.00 0.00 ? 82  ASP A HB2  3  
ATOM 4752  H HB3  . ASP A 1 82  ? 9.078   -4.055  -8.913  1.00 0.00 ? 82  ASP A HB3  3  
ATOM 4753  N N    . LEU A 1 83  ? 6.456   -3.094  -6.441  1.00 0.00 ? 83  LEU A N    3  
ATOM 4754  C CA   . LEU A 1 83  ? 6.632   -2.920  -5.004  1.00 0.00 ? 83  LEU A CA   3  
ATOM 4755  C C    . LEU A 1 83  ? 6.487   -4.250  -4.272  1.00 0.00 ? 83  LEU A C    3  
ATOM 4756  O O    . LEU A 1 83  ? 6.710   -4.333  -3.065  1.00 0.00 ? 83  LEU A O    3  
ATOM 4757  C CB   . LEU A 1 83  ? 5.614   -1.914  -4.463  1.00 0.00 ? 83  LEU A CB   3  
ATOM 4758  C CG   . LEU A 1 83  ? 5.752   -0.479  -4.973  1.00 0.00 ? 83  LEU A CG   3  
ATOM 4759  C CD1  . LEU A 1 83  ? 4.829   0.452   -4.203  1.00 0.00 ? 83  LEU A CD1  3  
ATOM 4760  C CD2  . LEU A 1 83  ? 7.196   -0.012  -4.866  1.00 0.00 ? 83  LEU A CD2  3  
ATOM 4761  H H    . LEU A 1 83  ? 5.572   -3.332  -6.788  1.00 0.00 ? 83  LEU A H    3  
ATOM 4762  H HA   . LEU A 1 83  ? 7.628   -2.537  -4.836  1.00 0.00 ? 83  LEU A HA   3  
ATOM 4763  H HB2  . LEU A 1 83  ? 4.629   -2.266  -4.729  1.00 0.00 ? 83  LEU A HB2  3  
ATOM 4764  H HB3  . LEU A 1 83  ? 5.709   -1.895  -3.387  1.00 0.00 ? 83  LEU A HB3  3  
ATOM 4765  H HG   . LEU A 1 83  ? 5.465   -0.445  -6.015  1.00 0.00 ? 83  LEU A HG   3  
ATOM 4766  H HD11 . LEU A 1 83  ? 5.399   1.283   -3.815  1.00 0.00 ? 83  LEU A HD11 3  
ATOM 4767  H HD12 . LEU A 1 83  ? 4.376   -0.087  -3.384  1.00 0.00 ? 83  LEU A HD12 3  
ATOM 4768  H HD13 . LEU A 1 83  ? 4.057   0.820   -4.862  1.00 0.00 ? 83  LEU A HD13 3  
ATOM 4769  H HD21 . LEU A 1 83  ? 7.234   1.064   -4.950  1.00 0.00 ? 83  LEU A HD21 3  
ATOM 4770  H HD22 . LEU A 1 83  ? 7.778   -0.456  -5.659  1.00 0.00 ? 83  LEU A HD22 3  
ATOM 4771  H HD23 . LEU A 1 83  ? 7.602   -0.313  -3.910  1.00 0.00 ? 83  LEU A HD23 3  
ATOM 4772  N N    . GLN A 1 84  ? 6.114   -5.289  -5.013  1.00 0.00 ? 84  GLN A N    3  
ATOM 4773  C CA   . GLN A 1 84  ? 5.941   -6.616  -4.435  1.00 0.00 ? 84  GLN A CA   3  
ATOM 4774  C C    . GLN A 1 84  ? 7.023   -6.904  -3.399  1.00 0.00 ? 84  GLN A C    3  
ATOM 4775  O O    . GLN A 1 84  ? 6.744   -6.995  -2.205  1.00 0.00 ? 84  GLN A O    3  
ATOM 4776  C CB   . GLN A 1 84  ? 5.972   -7.682  -5.532  1.00 0.00 ? 84  GLN A CB   3  
ATOM 4777  C CG   . GLN A 1 84  ? 4.606   -7.979  -6.129  1.00 0.00 ? 84  GLN A CG   3  
ATOM 4778  C CD   . GLN A 1 84  ? 4.649   -9.091  -7.160  1.00 0.00 ? 84  GLN A CD   3  
ATOM 4779  O OE1  . GLN A 1 84  ? 4.720   -10.270 -6.814  1.00 0.00 ? 84  GLN A OE1  3  
ATOM 4780  N NE2  . GLN A 1 84  ? 4.606   -8.719  -8.434  1.00 0.00 ? 84  GLN A NE2  3  
ATOM 4781  H H    . GLN A 1 84  ? 5.951   -5.160  -5.970  1.00 0.00 ? 84  GLN A H    3  
ATOM 4782  H HA   . GLN A 1 84  ? 4.978   -6.642  -3.947  1.00 0.00 ? 84  GLN A HA   3  
ATOM 4783  H HB2  . GLN A 1 84  ? 6.623   -7.346  -6.325  1.00 0.00 ? 84  GLN A HB2  3  
ATOM 4784  H HB3  . GLN A 1 84  ? 6.365   -8.598  -5.116  1.00 0.00 ? 84  GLN A HB3  3  
ATOM 4785  H HG2  . GLN A 1 84  ? 3.935   -8.272  -5.335  1.00 0.00 ? 84  GLN A HG2  3  
ATOM 4786  H HG3  . GLN A 1 84  ? 4.232   -7.083  -6.603  1.00 0.00 ? 84  GLN A HG3  3  
ATOM 4787  H HE21 . GLN A 1 84  ? 4.551   -7.761  -8.634  1.00 0.00 ? 84  GLN A HE21 3  
ATOM 4788  H HE22 . GLN A 1 84  ? 4.633   -9.416  -9.120  1.00 0.00 ? 84  GLN A HE22 3  
ATOM 4789  N N    . ASN A 1 85  ? 8.259   -7.047  -3.866  1.00 0.00 ? 85  ASN A N    3  
ATOM 4790  C CA   . ASN A 1 85  ? 9.384   -7.325  -2.981  1.00 0.00 ? 85  ASN A CA   3  
ATOM 4791  C C    . ASN A 1 85  ? 10.069  -6.033  -2.549  1.00 0.00 ? 85  ASN A C    3  
ATOM 4792  O O    . ASN A 1 85  ? 11.286  -5.994  -2.368  1.00 0.00 ? 85  ASN A O    3  
ATOM 4793  C CB   . ASN A 1 85  ? 10.392  -8.243  -3.675  1.00 0.00 ? 85  ASN A CB   3  
ATOM 4794  C CG   . ASN A 1 85  ? 10.442  -8.018  -5.174  1.00 0.00 ? 85  ASN A CG   3  
ATOM 4795  O OD1  . ASN A 1 85  ? 10.480  -6.879  -5.641  1.00 0.00 ? 85  ASN A OD1  3  
ATOM 4796  N ND2  . ASN A 1 85  ? 10.441  -9.106  -5.936  1.00 0.00 ? 85  ASN A ND2  3  
ATOM 4797  H H    . ASN A 1 85  ? 8.419   -6.963  -4.830  1.00 0.00 ? 85  ASN A H    3  
ATOM 4798  H HA   . ASN A 1 85  ? 8.999   -7.825  -2.104  1.00 0.00 ? 85  ASN A HA   3  
ATOM 4799  H HB2  . ASN A 1 85  ? 11.376  -8.059  -3.270  1.00 0.00 ? 85  ASN A HB2  3  
ATOM 4800  H HB3  . ASN A 1 85  ? 10.119  -9.272  -3.493  1.00 0.00 ? 85  ASN A HB3  3  
ATOM 4801  H HD21 . ASN A 1 85  ? 10.410  -9.980  -5.495  1.00 0.00 ? 85  ASN A HD21 3  
ATOM 4802  H HD22 . ASN A 1 85  ? 10.474  -8.989  -6.908  1.00 0.00 ? 85  ASN A HD22 3  
ATOM 4803  N N    . ALA A 1 86  ? 9.280   -4.977  -2.385  1.00 0.00 ? 86  ALA A N    3  
ATOM 4804  C CA   . ALA A 1 86  ? 9.809   -3.683  -1.972  1.00 0.00 ? 86  ALA A CA   3  
ATOM 4805  C C    . ALA A 1 86  ? 9.602   -3.457  -0.478  1.00 0.00 ? 86  ALA A C    3  
ATOM 4806  O O    . ALA A 1 86  ? 8.525   -3.721  0.056   1.00 0.00 ? 86  ALA A O    3  
ATOM 4807  C CB   . ALA A 1 86  ? 9.158   -2.566  -2.772  1.00 0.00 ? 86  ALA A CB   3  
ATOM 4808  H H    . ALA A 1 86  ? 8.317   -5.070  -2.544  1.00 0.00 ? 86  ALA A H    3  
ATOM 4809  H HA   . ALA A 1 86  ? 10.869  -3.674  -2.183  1.00 0.00 ? 86  ALA A HA   3  
ATOM 4810  H HB1  . ALA A 1 86  ? 9.473   -1.611  -2.380  1.00 0.00 ? 86  ALA A HB1  3  
ATOM 4811  H HB2  . ALA A 1 86  ? 9.454   -2.646  -3.808  1.00 0.00 ? 86  ALA A HB2  3  
ATOM 4812  H HB3  . ALA A 1 86  ? 8.084   -2.649  -2.697  1.00 0.00 ? 86  ALA A HB3  3  
ATOM 4813  N N    . SER A 1 87  ? 10.641  -2.967  0.191   1.00 0.00 ? 87  SER A N    3  
ATOM 4814  C CA   . SER A 1 87  ? 10.574  -2.709  1.625   1.00 0.00 ? 87  SER A CA   3  
ATOM 4815  C C    . SER A 1 87  ? 9.485   -1.689  1.943   1.00 0.00 ? 87  SER A C    3  
ATOM 4816  O O    . SER A 1 87  ? 8.743   -1.260  1.059   1.00 0.00 ? 87  SER A O    3  
ATOM 4817  C CB   . SER A 1 87  ? 11.925  -2.207  2.138   1.00 0.00 ? 87  SER A CB   3  
ATOM 4818  O OG   . SER A 1 87  ? 12.309  -1.013  1.479   1.00 0.00 ? 87  SER A OG   3  
ATOM 4819  H H    . SER A 1 87  ? 11.473  -2.777  -0.291  1.00 0.00 ? 87  SER A H    3  
ATOM 4820  H HA   . SER A 1 87  ? 10.335  -3.640  2.118   1.00 0.00 ? 87  SER A HA   3  
ATOM 4821  H HB2  . SER A 1 87  ? 11.855  -2.013  3.197   1.00 0.00 ? 87  SER A HB2  3  
ATOM 4822  H HB3  . SER A 1 87  ? 12.678  -2.962  1.959   1.00 0.00 ? 87  SER A HB3  3  
ATOM 4823  H HG   . SER A 1 87  ? 12.696  -0.406  2.114   1.00 0.00 ? 87  SER A HG   3  
ATOM 4824  N N    . HIS A 1 88  ? 9.396   -1.305  3.213   1.00 0.00 ? 88  HIS A N    3  
ATOM 4825  C CA   . HIS A 1 88  ? 8.399   -0.334  3.649   1.00 0.00 ? 88  HIS A CA   3  
ATOM 4826  C C    . HIS A 1 88  ? 8.660   1.032   3.024   1.00 0.00 ? 88  HIS A C    3  
ATOM 4827  O O    . HIS A 1 88  ? 7.727   1.759   2.683   1.00 0.00 ? 88  HIS A O    3  
ATOM 4828  C CB   . HIS A 1 88  ? 8.402   -0.219  5.174   1.00 0.00 ? 88  HIS A CB   3  
ATOM 4829  C CG   . HIS A 1 88  ? 7.054   0.080   5.755   1.00 0.00 ? 88  HIS A CG   3  
ATOM 4830  N ND1  . HIS A 1 88  ? 6.863   0.960   6.799   1.00 0.00 ? 88  HIS A ND1  3  
ATOM 4831  C CD2  . HIS A 1 88  ? 5.826   -0.387  5.429   1.00 0.00 ? 88  HIS A CD2  3  
ATOM 4832  C CE1  . HIS A 1 88  ? 5.576   1.019   7.093   1.00 0.00 ? 88  HIS A CE1  3  
ATOM 4833  N NE2  . HIS A 1 88  ? 4.925   0.211   6.276   1.00 0.00 ? 88  HIS A NE2  3  
ATOM 4834  H H    . HIS A 1 88  ? 10.016  -1.683  3.871   1.00 0.00 ? 88  HIS A H    3  
ATOM 4835  H HA   . HIS A 1 88  ? 7.431   -0.685  3.326   1.00 0.00 ? 88  HIS A HA   3  
ATOM 4836  H HB2  . HIS A 1 88  ? 8.745   -1.151  5.598   1.00 0.00 ? 88  HIS A HB2  3  
ATOM 4837  H HB3  . HIS A 1 88  ? 9.074   0.574   5.468   1.00 0.00 ? 88  HIS A HB3  3  
ATOM 4838  H HD1  . HIS A 1 88  ? 7.566   1.464   7.258   1.00 0.00 ? 88  HIS A HD1  3  
ATOM 4839  H HD2  . HIS A 1 88  ? 5.596   -1.100  4.649   1.00 0.00 ? 88  HIS A HD2  3  
ATOM 4840  H HE1  . HIS A 1 88  ? 5.132   1.625   7.868   1.00 0.00 ? 88  HIS A HE1  3  
ATOM 4841  N N    . SER A 1 89  ? 9.936   1.376   2.877   1.00 0.00 ? 89  SER A N    3  
ATOM 4842  C CA   . SER A 1 89  ? 10.320  2.658   2.297   1.00 0.00 ? 89  SER A CA   3  
ATOM 4843  C C    . SER A 1 89  ? 10.322  2.585   0.773   1.00 0.00 ? 89  SER A C    3  
ATOM 4844  O O    . SER A 1 89  ? 9.901   3.522   0.096   1.00 0.00 ? 89  SER A O    3  
ATOM 4845  C CB   . SER A 1 89  ? 11.703  3.076   2.801   1.00 0.00 ? 89  SER A CB   3  
ATOM 4846  O OG   . SER A 1 89  ? 11.603  3.831   3.996   1.00 0.00 ? 89  SER A OG   3  
ATOM 4847  H H    . SER A 1 89  ? 10.635  0.754   3.168   1.00 0.00 ? 89  SER A H    3  
ATOM 4848  H HA   . SER A 1 89  ? 9.594   3.394   2.609   1.00 0.00 ? 89  SER A HA   3  
ATOM 4849  H HB2  . SER A 1 89  ? 12.294  2.194   2.995   1.00 0.00 ? 89  SER A HB2  3  
ATOM 4850  H HB3  . SER A 1 89  ? 12.190  3.679   2.048   1.00 0.00 ? 89  SER A HB3  3  
ATOM 4851  H HG   . SER A 1 89  ? 12.434  3.786   4.474   1.00 0.00 ? 89  SER A HG   3  
ATOM 4852  N N    . GLU A 1 90  ? 10.801  1.465   0.241   1.00 0.00 ? 90  GLU A N    3  
ATOM 4853  C CA   . GLU A 1 90  ? 10.859  1.270   -1.203  1.00 0.00 ? 90  GLU A CA   3  
ATOM 4854  C C    . GLU A 1 90  ? 9.498   1.527   -1.843  1.00 0.00 ? 90  GLU A C    3  
ATOM 4855  O O    . GLU A 1 90  ? 9.410   2.059   -2.949  1.00 0.00 ? 90  GLU A O    3  
ATOM 4856  C CB   . GLU A 1 90  ? 11.328  -0.149  -1.530  1.00 0.00 ? 90  GLU A CB   3  
ATOM 4857  C CG   . GLU A 1 90  ? 12.814  -0.368  -1.300  1.00 0.00 ? 90  GLU A CG   3  
ATOM 4858  C CD   . GLU A 1 90  ? 13.656  0.044   -2.493  1.00 0.00 ? 90  GLU A CD   3  
ATOM 4859  O OE1  . GLU A 1 90  ? 13.479  1.181   -2.978  1.00 0.00 ? 90  GLU A OE1  3  
ATOM 4860  O OE2  . GLU A 1 90  ? 14.490  -0.771  -2.940  1.00 0.00 ? 90  GLU A OE2  3  
ATOM 4861  H H    . GLU A 1 90  ? 11.123  0.753   0.833   1.00 0.00 ? 90  GLU A H    3  
ATOM 4862  H HA   . GLU A 1 90  ? 11.571  1.975   -1.605  1.00 0.00 ? 90  GLU A HA   3  
ATOM 4863  H HB2  . GLU A 1 90  ? 10.782  -0.847  -0.912  1.00 0.00 ? 90  GLU A HB2  3  
ATOM 4864  H HB3  . GLU A 1 90  ? 11.112  -0.357  -2.568  1.00 0.00 ? 90  GLU A HB3  3  
ATOM 4865  H HG2  . GLU A 1 90  ? 13.122  0.214   -0.444  1.00 0.00 ? 90  GLU A HG2  3  
ATOM 4866  H HG3  . GLU A 1 90  ? 12.985  -1.416  -1.102  1.00 0.00 ? 90  GLU A HG3  3  
ATOM 4867  N N    . ALA A 1 91  ? 8.438   1.145   -1.137  1.00 0.00 ? 91  ALA A N    3  
ATOM 4868  C CA   . ALA A 1 91  ? 7.081   1.336   -1.634  1.00 0.00 ? 91  ALA A CA   3  
ATOM 4869  C C    . ALA A 1 91  ? 6.569   2.735   -1.310  1.00 0.00 ? 91  ALA A C    3  
ATOM 4870  O O    . ALA A 1 91  ? 5.889   3.362   -2.122  1.00 0.00 ? 91  ALA A O    3  
ATOM 4871  C CB   . ALA A 1 91  ? 6.152   0.283   -1.049  1.00 0.00 ? 91  ALA A CB   3  
ATOM 4872  H H    . ALA A 1 91  ? 8.572   0.727   -0.262  1.00 0.00 ? 91  ALA A H    3  
ATOM 4873  H HA   . ALA A 1 91  ? 7.097   1.209   -2.707  1.00 0.00 ? 91  ALA A HA   3  
ATOM 4874  H HB1  . ALA A 1 91  ? 5.174   0.713   -0.891  1.00 0.00 ? 91  ALA A HB1  3  
ATOM 4875  H HB2  . ALA A 1 91  ? 6.073   -0.548  -1.735  1.00 0.00 ? 91  ALA A HB2  3  
ATOM 4876  H HB3  . ALA A 1 91  ? 6.550   -0.064  -0.107  1.00 0.00 ? 91  ALA A HB3  3  
ATOM 4877  N N    . VAL A 1 92  ? 6.899   3.219   -0.117  1.00 0.00 ? 92  VAL A N    3  
ATOM 4878  C CA   . VAL A 1 92  ? 6.472   4.545   0.315   1.00 0.00 ? 92  VAL A CA   3  
ATOM 4879  C C    . VAL A 1 92  ? 6.867   5.608   -0.704  1.00 0.00 ? 92  VAL A C    3  
ATOM 4880  O O    . VAL A 1 92  ? 6.057   6.457   -1.074  1.00 0.00 ? 92  VAL A O    3  
ATOM 4881  C CB   . VAL A 1 92  ? 7.077   4.911   1.683   1.00 0.00 ? 92  VAL A CB   3  
ATOM 4882  C CG1  . VAL A 1 92  ? 7.038   6.417   1.899   1.00 0.00 ? 92  VAL A CG1  3  
ATOM 4883  C CG2  . VAL A 1 92  ? 6.343   4.185   2.801   1.00 0.00 ? 92  VAL A CG2  3  
ATOM 4884  H H    . VAL A 1 92  ? 7.443   2.672   0.487   1.00 0.00 ? 92  VAL A H    3  
ATOM 4885  H HA   . VAL A 1 92  ? 5.396   4.535   0.411   1.00 0.00 ? 92  VAL A HA   3  
ATOM 4886  H HB   . VAL A 1 92  ? 8.110   4.595   1.694   1.00 0.00 ? 92  VAL A HB   3  
ATOM 4887  H HG11 . VAL A 1 92  ? 7.379   6.646   2.898   1.00 0.00 ? 92  VAL A HG11 3  
ATOM 4888  H HG12 . VAL A 1 92  ? 7.681   6.900   1.178   1.00 0.00 ? 92  VAL A HG12 3  
ATOM 4889  H HG13 . VAL A 1 92  ? 6.026   6.772   1.774   1.00 0.00 ? 92  VAL A HG13 3  
ATOM 4890  H HG21 . VAL A 1 92  ? 5.682   4.874   3.304   1.00 0.00 ? 92  VAL A HG21 3  
ATOM 4891  H HG22 . VAL A 1 92  ? 5.769   3.372   2.384   1.00 0.00 ? 92  VAL A HG22 3  
ATOM 4892  H HG23 . VAL A 1 92  ? 7.061   3.794   3.508   1.00 0.00 ? 92  VAL A HG23 3  
ATOM 4893  N N    . GLU A 1 93  ? 8.117   5.554   -1.154  1.00 0.00 ? 93  GLU A N    3  
ATOM 4894  C CA   . GLU A 1 93  ? 8.619   6.513   -2.130  1.00 0.00 ? 93  GLU A CA   3  
ATOM 4895  C C    . GLU A 1 93  ? 7.886   6.369   -3.461  1.00 0.00 ? 93  GLU A C    3  
ATOM 4896  O O    . GLU A 1 93  ? 7.699   7.345   -4.187  1.00 0.00 ? 93  GLU A O    3  
ATOM 4897  C CB   . GLU A 1 93  ? 10.123  6.321   -2.340  1.00 0.00 ? 93  GLU A CB   3  
ATOM 4898  C CG   . GLU A 1 93  ? 10.918  6.284   -1.046  1.00 0.00 ? 93  GLU A CG   3  
ATOM 4899  C CD   . GLU A 1 93  ? 12.317  6.847   -1.205  1.00 0.00 ? 93  GLU A CD   3  
ATOM 4900  O OE1  . GLU A 1 93  ? 12.440  8.028   -1.594  1.00 0.00 ? 93  GLU A OE1  3  
ATOM 4901  O OE2  . GLU A 1 93  ? 13.288  6.109   -0.941  1.00 0.00 ? 93  GLU A OE2  3  
ATOM 4902  H H    . GLU A 1 93  ? 8.715   4.853   -0.821  1.00 0.00 ? 93  GLU A H    3  
ATOM 4903  H HA   . GLU A 1 93  ? 8.443   7.505   -1.742  1.00 0.00 ? 93  GLU A HA   3  
ATOM 4904  H HB2  . GLU A 1 93  ? 10.285  5.392   -2.866  1.00 0.00 ? 93  GLU A HB2  3  
ATOM 4905  H HB3  . GLU A 1 93  ? 10.496  7.135   -2.944  1.00 0.00 ? 93  GLU A HB3  3  
ATOM 4906  H HG2  . GLU A 1 93  ? 10.396  6.864   -0.301  1.00 0.00 ? 93  GLU A HG2  3  
ATOM 4907  H HG3  . GLU A 1 93  ? 10.994  5.259   -0.715  1.00 0.00 ? 93  GLU A HG3  3  
ATOM 4908  N N    . ALA A 1 94  ? 7.474   5.145   -3.773  1.00 0.00 ? 94  ALA A N    3  
ATOM 4909  C CA   . ALA A 1 94  ? 6.760   4.873   -5.015  1.00 0.00 ? 94  ALA A CA   3  
ATOM 4910  C C    . ALA A 1 94  ? 5.403   5.567   -5.031  1.00 0.00 ? 94  ALA A C    3  
ATOM 4911  O O    . ALA A 1 94  ? 5.067   6.272   -5.983  1.00 0.00 ? 94  ALA A O    3  
ATOM 4912  C CB   . ALA A 1 94  ? 6.591   3.373   -5.208  1.00 0.00 ? 94  ALA A CB   3  
ATOM 4913  H H    . ALA A 1 94  ? 7.653   4.408   -3.153  1.00 0.00 ? 94  ALA A H    3  
ATOM 4914  H HA   . ALA A 1 94  ? 7.357   5.251   -5.832  1.00 0.00 ? 94  ALA A HA   3  
ATOM 4915  H HB1  . ALA A 1 94  ? 7.369   3.004   -5.859  1.00 0.00 ? 94  ALA A HB1  3  
ATOM 4916  H HB2  . ALA A 1 94  ? 6.657   2.878   -4.250  1.00 0.00 ? 94  ALA A HB2  3  
ATOM 4917  H HB3  . ALA A 1 94  ? 5.626   3.174   -5.651  1.00 0.00 ? 94  ALA A HB3  3  
ATOM 4918  N N    . ILE A 1 95  ? 4.626   5.362   -3.973  1.00 0.00 ? 95  ILE A N    3  
ATOM 4919  C CA   . ILE A 1 95  ? 3.305   5.969   -3.867  1.00 0.00 ? 95  ILE A CA   3  
ATOM 4920  C C    . ILE A 1 95  ? 3.404   7.488   -3.774  1.00 0.00 ? 95  ILE A C    3  
ATOM 4921  O O    . ILE A 1 95  ? 2.552   8.210   -4.293  1.00 0.00 ? 95  ILE A O    3  
ATOM 4922  C CB   . ILE A 1 95  ? 2.539   5.440   -2.640  1.00 0.00 ? 95  ILE A CB   3  
ATOM 4923  C CG1  . ILE A 1 95  ? 2.221   3.953   -2.812  1.00 0.00 ? 95  ILE A CG1  3  
ATOM 4924  C CG2  . ILE A 1 95  ? 1.262   6.239   -2.427  1.00 0.00 ? 95  ILE A CG2  3  
ATOM 4925  C CD1  . ILE A 1 95  ? 3.274   3.039   -2.227  1.00 0.00 ? 95  ILE A CD1  3  
ATOM 4926  H H    . ILE A 1 95  ? 4.949   4.790   -3.246  1.00 0.00 ? 95  ILE A H    3  
ATOM 4927  H HA   . ILE A 1 95  ? 2.746   5.709   -4.755  1.00 0.00 ? 95  ILE A HA   3  
ATOM 4928  H HB   . ILE A 1 95  ? 3.165   5.569   -1.770  1.00 0.00 ? 95  ILE A HB   3  
ATOM 4929  H HG12 . ILE A 1 95  ? 1.284   3.733   -2.326  1.00 0.00 ? 95  ILE A HG12 3  
ATOM 4930  H HG13 . ILE A 1 95  ? 2.136   3.731   -3.866  1.00 0.00 ? 95  ILE A HG13 3  
ATOM 4931  H HG21 . ILE A 1 95  ? 0.818   5.963   -1.483  1.00 0.00 ? 95  ILE A HG21 3  
ATOM 4932  H HG22 . ILE A 1 95  ? 1.495   7.293   -2.420  1.00 0.00 ? 95  ILE A HG22 3  
ATOM 4933  H HG23 . ILE A 1 95  ? 0.568   6.029   -3.227  1.00 0.00 ? 95  ILE A HG23 3  
ATOM 4934  H HD11 . ILE A 1 95  ? 3.807   3.558   -1.443  1.00 0.00 ? 95  ILE A HD11 3  
ATOM 4935  H HD12 . ILE A 1 95  ? 2.800   2.159   -1.816  1.00 0.00 ? 95  ILE A HD12 3  
ATOM 4936  H HD13 . ILE A 1 95  ? 3.968   2.746   -3.000  1.00 0.00 ? 95  ILE A HD13 3  
ATOM 4937  N N    . LYS A 1 96  ? 4.450   7.968   -3.110  1.00 0.00 ? 96  LYS A N    3  
ATOM 4938  C CA   . LYS A 1 96  ? 4.664   9.402   -2.951  1.00 0.00 ? 96  LYS A CA   3  
ATOM 4939  C C    . LYS A 1 96  ? 5.301   9.999   -4.202  1.00 0.00 ? 96  LYS A C    3  
ATOM 4940  O O    . LYS A 1 96  ? 5.094   11.170  -4.516  1.00 0.00 ? 96  LYS A O    3  
ATOM 4941  C CB   . LYS A 1 96  ? 5.551   9.674   -1.734  1.00 0.00 ? 96  LYS A CB   3  
ATOM 4942  C CG   . LYS A 1 96  ? 7.032   9.743   -2.064  1.00 0.00 ? 96  LYS A CG   3  
ATOM 4943  C CD   . LYS A 1 96  ? 7.885   9.723   -0.807  1.00 0.00 ? 96  LYS A CD   3  
ATOM 4944  C CE   . LYS A 1 96  ? 9.355   9.945   -1.128  1.00 0.00 ? 96  LYS A CE   3  
ATOM 4945  N NZ   . LYS A 1 96  ? 10.123  10.388  0.069   1.00 0.00 ? 96  LYS A NZ   3  
ATOM 4946  H H    . LYS A 1 96  ? 5.095   7.342   -2.719  1.00 0.00 ? 96  LYS A H    3  
ATOM 4947  H HA   . LYS A 1 96  ? 3.702   9.865   -2.796  1.00 0.00 ? 96  LYS A HA   3  
ATOM 4948  H HB2  . LYS A 1 96  ? 5.257   10.614  -1.293  1.00 0.00 ? 96  LYS A HB2  3  
ATOM 4949  H HB3  . LYS A 1 96  ? 5.402   8.884   -1.011  1.00 0.00 ? 96  LYS A HB3  3  
ATOM 4950  H HG2  . LYS A 1 96  ? 7.295   8.895   -2.679  1.00 0.00 ? 96  LYS A HG2  3  
ATOM 4951  H HG3  . LYS A 1 96  ? 7.228   10.657  -2.607  1.00 0.00 ? 96  LYS A HG3  3  
ATOM 4952  H HD2  . LYS A 1 96  ? 7.551   10.506  -0.143  1.00 0.00 ? 96  LYS A HD2  3  
ATOM 4953  H HD3  . LYS A 1 96  ? 7.772   8.764   -0.321  1.00 0.00 ? 96  LYS A HD3  3  
ATOM 4954  H HE2  . LYS A 1 96  ? 9.775   9.019   -1.491  1.00 0.00 ? 96  LYS A HE2  3  
ATOM 4955  H HE3  . LYS A 1 96  ? 9.433   10.701  -1.895  1.00 0.00 ? 96  LYS A HE3  3  
ATOM 4956  H HZ1  . LYS A 1 96  ? 9.827   11.344  0.350   1.00 0.00 ? 96  LYS A HZ1  3  
ATOM 4957  H HZ2  . LYS A 1 96  ? 11.141  10.401  -0.145  1.00 0.00 ? 96  LYS A HZ2  3  
ATOM 4958  H HZ3  . LYS A 1 96  ? 9.955   9.737   0.862   1.00 0.00 ? 96  LYS A HZ3  3  
ATOM 4959  N N    . ASN A 1 97  ? 6.076   9.185   -4.912  1.00 0.00 ? 97  ASN A N    3  
ATOM 4960  C CA   . ASN A 1 97  ? 6.743   9.633   -6.129  1.00 0.00 ? 97  ASN A CA   3  
ATOM 4961  C C    . ASN A 1 97  ? 6.056   9.064   -7.367  1.00 0.00 ? 97  ASN A C    3  
ATOM 4962  O O    . ASN A 1 97  ? 6.627   9.054   -8.456  1.00 0.00 ? 97  ASN A O    3  
ATOM 4963  C CB   . ASN A 1 97  ? 8.215   9.217   -6.112  1.00 0.00 ? 97  ASN A CB   3  
ATOM 4964  C CG   . ASN A 1 97  ? 8.935   9.688   -4.863  1.00 0.00 ? 97  ASN A CG   3  
ATOM 4965  O OD1  . ASN A 1 97  ? 8.807   10.844  -4.459  1.00 0.00 ? 97  ASN A OD1  3  
ATOM 4966  N ND2  . ASN A 1 97  ? 9.698   8.793   -4.247  1.00 0.00 ? 97  ASN A ND2  3  
ATOM 4967  H H    . ASN A 1 97  ? 6.203   8.261   -4.610  1.00 0.00 ? 97  ASN A H    3  
ATOM 4968  H HA   . ASN A 1 97  ? 6.683   10.711  -6.161  1.00 0.00 ? 97  ASN A HA   3  
ATOM 4969  H HB2  . ASN A 1 97  ? 8.278   8.139   -6.155  1.00 0.00 ? 97  ASN A HB2  3  
ATOM 4970  H HB3  . ASN A 1 97  ? 8.712   9.637   -6.973  1.00 0.00 ? 97  ASN A HB3  3  
ATOM 4971  H HD21 . ASN A 1 97  ? 9.752   7.891   -4.626  1.00 0.00 ? 97  ASN A HD21 3  
ATOM 4972  H HD22 . ASN A 1 97  ? 10.174  9.071   -3.437  1.00 0.00 ? 97  ASN A HD22 3  
ATOM 4973  N N    . ALA A 1 98  ? 4.826   8.593   -7.190  1.00 0.00 ? 98  ALA A N    3  
ATOM 4974  C CA   . ALA A 1 98  ? 4.060   8.025   -8.292  1.00 0.00 ? 98  ALA A CA   3  
ATOM 4975  C C    . ALA A 1 98  ? 3.614   9.109   -9.267  1.00 0.00 ? 98  ALA A C    3  
ATOM 4976  O O    . ALA A 1 98  ? 2.762   9.935   -8.945  1.00 0.00 ? 98  ALA A O    3  
ATOM 4977  C CB   . ALA A 1 98  ? 2.855   7.263   -7.760  1.00 0.00 ? 98  ALA A CB   3  
ATOM 4978  H H    . ALA A 1 98  ? 4.424   8.629   -6.297  1.00 0.00 ? 98  ALA A H    3  
ATOM 4979  H HA   . ALA A 1 98  ? 4.696   7.324   -8.814  1.00 0.00 ? 98  ALA A HA   3  
ATOM 4980  H HB1  . ALA A 1 98  ? 3.131   6.235   -7.578  1.00 0.00 ? 98  ALA A HB1  3  
ATOM 4981  H HB2  . ALA A 1 98  ? 2.523   7.716   -6.837  1.00 0.00 ? 98  ALA A HB2  3  
ATOM 4982  H HB3  . ALA A 1 98  ? 2.057   7.299   -8.487  1.00 0.00 ? 98  ALA A HB3  3  
ATOM 4983  N N    . GLY A 1 99  ? 4.198   9.101   -10.462 1.00 0.00 ? 99  GLY A N    3  
ATOM 4984  C CA   . GLY A 1 99  ? 3.848   10.090  -11.465 1.00 0.00 ? 99  GLY A CA   3  
ATOM 4985  C C    . GLY A 1 99  ? 2.350   10.270  -11.604 1.00 0.00 ? 99  GLY A C    3  
ATOM 4986  O O    . GLY A 1 99  ? 1.694   9.529   -12.335 1.00 0.00 ? 99  GLY A O    3  
ATOM 4987  H H    . GLY A 1 99  ? 4.872   8.418   -10.663 1.00 0.00 ? 99  GLY A H    3  
ATOM 4988  H HA2  . GLY A 1 99  ? 4.291   11.036  -11.192 1.00 0.00 ? 99  GLY A HA2  3  
ATOM 4989  H HA3  . GLY A 1 99  ? 4.251   9.777   -12.417 1.00 0.00 ? 99  GLY A HA3  3  
ATOM 4990  N N    . ASN A 1 100 ? 1.806   11.257  -10.899 1.00 0.00 ? 100 ASN A N    3  
ATOM 4991  C CA   . ASN A 1 100 ? 0.375   11.530  -10.945 1.00 0.00 ? 100 ASN A CA   3  
ATOM 4992  C C    . ASN A 1 100 ? -0.174  11.322  -12.353 1.00 0.00 ? 100 ASN A C    3  
ATOM 4993  O O    . ASN A 1 100 ? 0.391   11.790  -13.342 1.00 0.00 ? 100 ASN A O    3  
ATOM 4994  C CB   . ASN A 1 100 ? 0.093   12.961  -10.482 1.00 0.00 ? 100 ASN A CB   3  
ATOM 4995  C CG   . ASN A 1 100 ? -1.387  13.221  -10.275 1.00 0.00 ? 100 ASN A CG   3  
ATOM 4996  O OD1  . ASN A 1 100 ? -2.188  13.083  -11.199 1.00 0.00 ? 100 ASN A OD1  3  
ATOM 4997  N ND2  . ASN A 1 100 ? -1.756  13.600  -9.057  1.00 0.00 ? 100 ASN A ND2  3  
ATOM 4998  H H    . ASN A 1 100 ? 2.381   11.814  -10.333 1.00 0.00 ? 100 ASN A H    3  
ATOM 4999  H HA   . ASN A 1 100 ? -0.116  10.842  -10.274 1.00 0.00 ? 100 ASN A HA   3  
ATOM 5000  H HB2  . ASN A 1 100 ? 0.604   13.138  -9.547  1.00 0.00 ? 100 ASN A HB2  3  
ATOM 5001  H HB3  . ASN A 1 100 ? 0.461   13.653  -11.225 1.00 0.00 ? 100 ASN A HB3  3  
ATOM 5002  H HD21 . ASN A 1 100 ? -1.063  13.690  -8.369  1.00 0.00 ? 100 ASN A HD21 3  
ATOM 5003  H HD22 . ASN A 1 100 ? -2.707  13.774  -8.895  1.00 0.00 ? 100 ASN A HD22 3  
ATOM 5004  N N    . PRO A 1 101 ? -1.302  10.603  -12.448 1.00 0.00 ? 101 PRO A N    3  
ATOM 5005  C CA   . PRO A 1 101 ? -1.983  10.040  -11.278 1.00 0.00 ? 101 PRO A CA   3  
ATOM 5006  C C    . PRO A 1 101 ? -1.194  8.901   -10.641 1.00 0.00 ? 101 PRO A C    3  
ATOM 5007  O O    . PRO A 1 101 ? -0.133  8.516   -11.132 1.00 0.00 ? 101 PRO A O    3  
ATOM 5008  C CB   . PRO A 1 101 ? -3.303  9.520   -11.852 1.00 0.00 ? 101 PRO A CB   3  
ATOM 5009  C CG   . PRO A 1 101 ? -3.013  9.253   -13.289 1.00 0.00 ? 101 PRO A CG   3  
ATOM 5010  C CD   . PRO A 1 101 ? -2.000  10.283  -13.705 1.00 0.00 ? 101 PRO A CD   3  
ATOM 5011  H HA   . PRO A 1 101 ? -2.185  10.796  -10.534 1.00 0.00 ? 101 PRO A HA   3  
ATOM 5012  H HB2  . PRO A 1 101 ? -3.594  8.618   -11.333 1.00 0.00 ? 101 PRO A HB2  3  
ATOM 5013  H HB3  . PRO A 1 101 ? -4.070  10.271  -11.738 1.00 0.00 ? 101 PRO A HB3  3  
ATOM 5014  H HG2  . PRO A 1 101 ? -2.606  8.259   -13.403 1.00 0.00 ? 101 PRO A HG2  3  
ATOM 5015  H HG3  . PRO A 1 101 ? -3.916  9.359   -13.871 1.00 0.00 ? 101 PRO A HG3  3  
ATOM 5016  H HD2  . PRO A 1 101 ? -1.316  9.868   -14.431 1.00 0.00 ? 101 PRO A HD2  3  
ATOM 5017  H HD3  . PRO A 1 101 ? -2.492  11.157  -14.105 1.00 0.00 ? 101 PRO A HD3  3  
ATOM 5018  N N    . VAL A 1 102 ? -1.720  8.364   -9.544  1.00 0.00 ? 102 VAL A N    3  
ATOM 5019  C CA   . VAL A 1 102 ? -1.065  7.268   -8.840  1.00 0.00 ? 102 VAL A CA   3  
ATOM 5020  C C    . VAL A 1 102 ? -1.875  5.981   -8.955  1.00 0.00 ? 102 VAL A C    3  
ATOM 5021  O O    . VAL A 1 102 ? -2.797  5.743   -8.174  1.00 0.00 ? 102 VAL A O    3  
ATOM 5022  C CB   . VAL A 1 102 ? -0.859  7.601   -7.351  1.00 0.00 ? 102 VAL A CB   3  
ATOM 5023  C CG1  . VAL A 1 102 ? 0.059   6.579   -6.697  1.00 0.00 ? 102 VAL A CG1  3  
ATOM 5024  C CG2  . VAL A 1 102 ? -0.303  9.008   -7.192  1.00 0.00 ? 102 VAL A CG2  3  
ATOM 5025  H H    . VAL A 1 102 ? -2.568  8.714   -9.200  1.00 0.00 ? 102 VAL A H    3  
ATOM 5026  H HA   . VAL A 1 102 ? -0.096  7.113   -9.291  1.00 0.00 ? 102 VAL A HA   3  
ATOM 5027  H HB   . VAL A 1 102 ? -1.818  7.558   -6.857  1.00 0.00 ? 102 VAL A HB   3  
ATOM 5028  H HG11 . VAL A 1 102 ? -0.536  5.837   -6.185  1.00 0.00 ? 102 VAL A HG11 3  
ATOM 5029  H HG12 . VAL A 1 102 ? 0.661   6.099   -7.455  1.00 0.00 ? 102 VAL A HG12 3  
ATOM 5030  H HG13 . VAL A 1 102 ? 0.703   7.076   -5.987  1.00 0.00 ? 102 VAL A HG13 3  
ATOM 5031  H HG21 . VAL A 1 102 ? -0.864  9.534   -6.435  1.00 0.00 ? 102 VAL A HG21 3  
ATOM 5032  H HG22 . VAL A 1 102 ? 0.735   8.953   -6.898  1.00 0.00 ? 102 VAL A HG22 3  
ATOM 5033  H HG23 . VAL A 1 102 ? -0.383  9.535   -8.131  1.00 0.00 ? 102 VAL A HG23 3  
ATOM 5034  N N    . VAL A 1 103 ? -1.523  5.152   -9.933  1.00 0.00 ? 103 VAL A N    3  
ATOM 5035  C CA   . VAL A 1 103 ? -2.215  3.887   -10.149 1.00 0.00 ? 103 VAL A CA   3  
ATOM 5036  C C    . VAL A 1 103 ? -1.823  2.859   -9.094  1.00 0.00 ? 103 VAL A C    3  
ATOM 5037  O O    . VAL A 1 103 ? -0.670  2.802   -8.665  1.00 0.00 ? 103 VAL A O    3  
ATOM 5038  C CB   . VAL A 1 103 ? -1.914  3.314   -11.546 1.00 0.00 ? 103 VAL A CB   3  
ATOM 5039  C CG1  . VAL A 1 103 ? -2.999  2.336   -11.968 1.00 0.00 ? 103 VAL A CG1  3  
ATOM 5040  C CG2  . VAL A 1 103 ? -1.773  4.437   -12.563 1.00 0.00 ? 103 VAL A CG2  3  
ATOM 5041  H H    . VAL A 1 103 ? -0.780  5.397   -10.522 1.00 0.00 ? 103 VAL A H    3  
ATOM 5042  H HA   . VAL A 1 103 ? -3.278  4.072   -10.080 1.00 0.00 ? 103 VAL A HA   3  
ATOM 5043  H HB   . VAL A 1 103 ? -0.977  2.779   -11.500 1.00 0.00 ? 103 VAL A HB   3  
ATOM 5044  H HG11 . VAL A 1 103 ? -3.076  1.546   -11.235 1.00 0.00 ? 103 VAL A HG11 3  
ATOM 5045  H HG12 . VAL A 1 103 ? -3.944  2.854   -12.040 1.00 0.00 ? 103 VAL A HG12 3  
ATOM 5046  H HG13 . VAL A 1 103 ? -2.748  1.911   -12.929 1.00 0.00 ? 103 VAL A HG13 3  
ATOM 5047  H HG21 . VAL A 1 103 ? -2.060  4.077   -13.540 1.00 0.00 ? 103 VAL A HG21 3  
ATOM 5048  H HG22 . VAL A 1 103 ? -2.411  5.260   -12.280 1.00 0.00 ? 103 VAL A HG22 3  
ATOM 5049  H HG23 . VAL A 1 103 ? -0.746  4.771   -12.591 1.00 0.00 ? 103 VAL A HG23 3  
ATOM 5050  N N    . PHE A 1 104 ? -2.789  2.045   -8.680  1.00 0.00 ? 104 PHE A N    3  
ATOM 5051  C CA   . PHE A 1 104 ? -2.545  1.018   -7.675  1.00 0.00 ? 104 PHE A CA   3  
ATOM 5052  C C    . PHE A 1 104 ? -2.944  -0.359  -8.197  1.00 0.00 ? 104 PHE A C    3  
ATOM 5053  O O    . PHE A 1 104 ? -4.040  -0.540  -8.727  1.00 0.00 ? 104 PHE A O    3  
ATOM 5054  C CB   . PHE A 1 104 ? -3.319  1.334   -6.394  1.00 0.00 ? 104 PHE A CB   3  
ATOM 5055  C CG   . PHE A 1 104 ? -2.542  2.166   -5.414  1.00 0.00 ? 104 PHE A CG   3  
ATOM 5056  C CD1  . PHE A 1 104 ? -2.548  3.549   -5.500  1.00 0.00 ? 104 PHE A CD1  3  
ATOM 5057  C CD2  . PHE A 1 104 ? -1.805  1.565   -4.406  1.00 0.00 ? 104 PHE A CD2  3  
ATOM 5058  C CE1  . PHE A 1 104 ? -1.835  4.317   -4.600  1.00 0.00 ? 104 PHE A CE1  3  
ATOM 5059  C CE2  . PHE A 1 104 ? -1.090  2.328   -3.503  1.00 0.00 ? 104 PHE A CE2  3  
ATOM 5060  C CZ   . PHE A 1 104 ? -1.104  3.706   -3.600  1.00 0.00 ? 104 PHE A CZ   3  
ATOM 5061  H H    . PHE A 1 104 ? -3.688  2.139   -9.060  1.00 0.00 ? 104 PHE A H    3  
ATOM 5062  H HA   . PHE A 1 104 ? -1.489  1.014   -7.456  1.00 0.00 ? 104 PHE A HA   3  
ATOM 5063  H HB2  . PHE A 1 104 ? -4.217  1.876   -6.649  1.00 0.00 ? 104 PHE A HB2  3  
ATOM 5064  H HB3  . PHE A 1 104 ? -3.587  0.409   -5.906  1.00 0.00 ? 104 PHE A HB3  3  
ATOM 5065  H HD1  . PHE A 1 104 ? -3.120  4.028   -6.282  1.00 0.00 ? 104 PHE A HD1  3  
ATOM 5066  H HD2  . PHE A 1 104 ? -1.792  0.487   -4.329  1.00 0.00 ? 104 PHE A HD2  3  
ATOM 5067  H HE1  . PHE A 1 104 ? -1.848  5.394   -4.679  1.00 0.00 ? 104 PHE A HE1  3  
ATOM 5068  H HE2  . PHE A 1 104 ? -0.518  1.848   -2.722  1.00 0.00 ? 104 PHE A HE2  3  
ATOM 5069  H HZ   . PHE A 1 104 ? -0.546  4.304   -2.895  1.00 0.00 ? 104 PHE A HZ   3  
ATOM 5070  N N    . ILE A 1 105 ? -2.046  -1.327  -8.043  1.00 0.00 ? 105 ILE A N    3  
ATOM 5071  C CA   . ILE A 1 105 ? -2.304  -2.687  -8.498  1.00 0.00 ? 105 ILE A CA   3  
ATOM 5072  C C    . ILE A 1 105 ? -2.274  -3.671  -7.333  1.00 0.00 ? 105 ILE A C    3  
ATOM 5073  O O    . ILE A 1 105 ? -1.227  -4.227  -7.002  1.00 0.00 ? 105 ILE A O    3  
ATOM 5074  C CB   . ILE A 1 105 ? -1.277  -3.131  -9.557  1.00 0.00 ? 105 ILE A CB   3  
ATOM 5075  C CG1  . ILE A 1 105 ? -1.114  -2.048  -10.625 1.00 0.00 ? 105 ILE A CG1  3  
ATOM 5076  C CG2  . ILE A 1 105 ? -1.704  -4.447  -10.189 1.00 0.00 ? 105 ILE A CG2  3  
ATOM 5077  C CD1  . ILE A 1 105 ? -0.680  -2.588  -11.970 1.00 0.00 ? 105 ILE A CD1  3  
ATOM 5078  H H    . ILE A 1 105 ? -1.190  -1.121  -7.613  1.00 0.00 ? 105 ILE A H    3  
ATOM 5079  H HA   . ILE A 1 105 ? -3.287  -2.707  -8.947  1.00 0.00 ? 105 ILE A HA   3  
ATOM 5080  H HB   . ILE A 1 105 ? -0.330  -3.286  -9.064  1.00 0.00 ? 105 ILE A HB   3  
ATOM 5081  H HG12 . ILE A 1 105 ? -2.056  -1.540  -10.761 1.00 0.00 ? 105 ILE A HG12 3  
ATOM 5082  H HG13 . ILE A 1 105 ? -0.370  -1.337  -10.296 1.00 0.00 ? 105 ILE A HG13 3  
ATOM 5083  H HG21 . ILE A 1 105 ? -2.390  -4.958  -9.529  1.00 0.00 ? 105 ILE A HG21 3  
ATOM 5084  H HG22 . ILE A 1 105 ? -2.192  -4.252  -11.132 1.00 0.00 ? 105 ILE A HG22 3  
ATOM 5085  H HG23 . ILE A 1 105 ? -0.835  -5.066  -10.354 1.00 0.00 ? 105 ILE A HG23 3  
ATOM 5086  H HD11 . ILE A 1 105 ? -0.208  -1.799  -12.539 1.00 0.00 ? 105 ILE A HD11 3  
ATOM 5087  H HD12 . ILE A 1 105 ? 0.024   -3.394  -11.825 1.00 0.00 ? 105 ILE A HD12 3  
ATOM 5088  H HD13 . ILE A 1 105 ? -1.541  -2.953  -12.508 1.00 0.00 ? 105 ILE A HD13 3  
ATOM 5089  N N    . VAL A 1 106 ? -3.432  -3.884  -6.715  1.00 0.00 ? 106 VAL A N    3  
ATOM 5090  C CA   . VAL A 1 106 ? -3.540  -4.804  -5.589  1.00 0.00 ? 106 VAL A CA   3  
ATOM 5091  C C    . VAL A 1 106 ? -4.542  -5.915  -5.881  1.00 0.00 ? 106 VAL A C    3  
ATOM 5092  O O    . VAL A 1 106 ? -5.149  -5.950  -6.951  1.00 0.00 ? 106 VAL A O    3  
ATOM 5093  C CB   . VAL A 1 106 ? -3.965  -4.069  -4.304  1.00 0.00 ? 106 VAL A CB   3  
ATOM 5094  C CG1  . VAL A 1 106 ? -2.941  -3.007  -3.932  1.00 0.00 ? 106 VAL A CG1  3  
ATOM 5095  C CG2  . VAL A 1 106 ? -5.346  -3.454  -4.473  1.00 0.00 ? 106 VAL A CG2  3  
ATOM 5096  H H    . VAL A 1 106 ? -4.233  -3.412  -7.025  1.00 0.00 ? 106 VAL A H    3  
ATOM 5097  H HA   . VAL A 1 106 ? -2.567  -5.244  -5.423  1.00 0.00 ? 106 VAL A HA   3  
ATOM 5098  H HB   . VAL A 1 106 ? -4.011  -4.790  -3.500  1.00 0.00 ? 106 VAL A HB   3  
ATOM 5099  H HG11 . VAL A 1 106 ? -2.395  -3.325  -3.056  1.00 0.00 ? 106 VAL A HG11 3  
ATOM 5100  H HG12 . VAL A 1 106 ? -2.255  -2.865  -4.754  1.00 0.00 ? 106 VAL A HG12 3  
ATOM 5101  H HG13 . VAL A 1 106 ? -3.448  -2.077  -3.722  1.00 0.00 ? 106 VAL A HG13 3  
ATOM 5102  H HG21 . VAL A 1 106 ? -5.267  -2.546  -5.052  1.00 0.00 ? 106 VAL A HG21 3  
ATOM 5103  H HG22 . VAL A 1 106 ? -5.990  -4.154  -4.985  1.00 0.00 ? 106 VAL A HG22 3  
ATOM 5104  H HG23 . VAL A 1 106 ? -5.761  -3.227  -3.502  1.00 0.00 ? 106 VAL A HG23 3  
ATOM 5105  N N    . GLN A 1 107 ? -4.709  -6.820  -4.923  1.00 0.00 ? 107 GLN A N    3  
ATOM 5106  C CA   . GLN A 1 107 ? -5.638  -7.933  -5.077  1.00 0.00 ? 107 GLN A CA   3  
ATOM 5107  C C    . GLN A 1 107 ? -6.376  -8.212  -3.772  1.00 0.00 ? 107 GLN A C    3  
ATOM 5108  O O    . GLN A 1 107 ? -5.797  -8.730  -2.818  1.00 0.00 ? 107 GLN A O    3  
ATOM 5109  C CB   . GLN A 1 107 ? -4.892  -9.188  -5.533  1.00 0.00 ? 107 GLN A CB   3  
ATOM 5110  C CG   . GLN A 1 107 ? -3.700  -8.895  -6.430  1.00 0.00 ? 107 GLN A CG   3  
ATOM 5111  C CD   . GLN A 1 107 ? -3.096  -10.151 -7.027  1.00 0.00 ? 107 GLN A CD   3  
ATOM 5112  O OE1  . GLN A 1 107 ? -1.910  -10.430 -6.848  1.00 0.00 ? 107 GLN A OE1  3  
ATOM 5113  N NE2  . GLN A 1 107 ? -3.911  -10.919 -7.742  1.00 0.00 ? 107 GLN A NE2  3  
ATOM 5114  H H    . GLN A 1 107 ? -4.196  -6.738  -4.092  1.00 0.00 ? 107 GLN A H    3  
ATOM 5115  H HA   . GLN A 1 107 ? -6.359  -7.660  -5.833  1.00 0.00 ? 107 GLN A HA   3  
ATOM 5116  H HB2  . GLN A 1 107 ? -4.537  -9.718  -4.662  1.00 0.00 ? 107 GLN A HB2  3  
ATOM 5117  H HB3  . GLN A 1 107 ? -5.577  -9.823  -6.076  1.00 0.00 ? 107 GLN A HB3  3  
ATOM 5118  H HG2  . GLN A 1 107 ? -4.022  -8.252  -7.236  1.00 0.00 ? 107 GLN A HG2  3  
ATOM 5119  H HG3  . GLN A 1 107 ? -2.943  -8.391  -5.848  1.00 0.00 ? 107 GLN A HG3  3  
ATOM 5120  H HE21 . GLN A 1 107 ? -4.844  -10.634 -7.844  1.00 0.00 ? 107 GLN A HE21 3  
ATOM 5121  H HE22 . GLN A 1 107 ? -3.547  -11.736 -8.140  1.00 0.00 ? 107 GLN A HE22 3  
ATOM 5122  N N    . SER A 1 108 ? -7.659  -7.864  -3.738  1.00 0.00 ? 108 SER A N    3  
ATOM 5123  C CA   . SER A 1 108 ? -8.476  -8.073  -2.548  1.00 0.00 ? 108 SER A CA   3  
ATOM 5124  C C    . SER A 1 108 ? -8.831  -9.548  -2.385  1.00 0.00 ? 108 SER A C    3  
ATOM 5125  O O    . SER A 1 108 ? -9.339  -10.182 -3.311  1.00 0.00 ? 108 SER A O    3  
ATOM 5126  C CB   . SER A 1 108 ? -9.753  -7.234  -2.627  1.00 0.00 ? 108 SER A CB   3  
ATOM 5127  O OG   . SER A 1 108 ? -10.571 -7.443  -1.488  1.00 0.00 ? 108 SER A OG   3  
ATOM 5128  H H    . SER A 1 108 ? -8.064  -7.455  -4.531  1.00 0.00 ? 108 SER A H    3  
ATOM 5129  H HA   . SER A 1 108 ? -7.900  -7.757  -1.691  1.00 0.00 ? 108 SER A HA   3  
ATOM 5130  H HB2  . SER A 1 108 ? -9.491  -6.189  -2.680  1.00 0.00 ? 108 SER A HB2  3  
ATOM 5131  H HB3  . SER A 1 108 ? -10.309 -7.512  -3.511  1.00 0.00 ? 108 SER A HB3  3  
ATOM 5132  H HG   . SER A 1 108 ? -11.010 -8.294  -1.561  1.00 0.00 ? 108 SER A HG   3  
ATOM 5133  N N    . LEU A 1 109 ? -8.561  -10.087 -1.202  1.00 0.00 ? 109 LEU A N    3  
ATOM 5134  C CA   . LEU A 1 109 ? -8.852  -11.488 -0.915  1.00 0.00 ? 109 LEU A CA   3  
ATOM 5135  C C    . LEU A 1 109 ? -10.356 -11.740 -0.902  1.00 0.00 ? 109 LEU A C    3  
ATOM 5136  O O    . LEU A 1 109 ? -11.148 -10.818 -0.710  1.00 0.00 ? 109 LEU A O    3  
ATOM 5137  C CB   . LEU A 1 109 ? -8.243  -11.891 0.429   1.00 0.00 ? 109 LEU A CB   3  
ATOM 5138  C CG   . LEU A 1 109 ? -6.816  -12.438 0.383   1.00 0.00 ? 109 LEU A CG   3  
ATOM 5139  C CD1  . LEU A 1 109 ? -6.419  -13.007 1.736   1.00 0.00 ? 109 LEU A CD1  3  
ATOM 5140  C CD2  . LEU A 1 109 ? -6.686  -13.497 -0.702  1.00 0.00 ? 109 LEU A CD2  3  
ATOM 5141  H H    . LEU A 1 109 ? -8.157  -9.532  -0.503  1.00 0.00 ? 109 LEU A H    3  
ATOM 5142  H HA   . LEU A 1 109 ? -8.406  -12.085 -1.697  1.00 0.00 ? 109 LEU A HA   3  
ATOM 5143  H HB2  . LEU A 1 109 ? -8.243  -11.020 1.066   1.00 0.00 ? 109 LEU A HB2  3  
ATOM 5144  H HB3  . LEU A 1 109 ? -8.877  -12.652 0.863   1.00 0.00 ? 109 LEU A HB3  3  
ATOM 5145  H HG   . LEU A 1 109 ? -6.136  -11.632 0.148   1.00 0.00 ? 109 LEU A HG   3  
ATOM 5146  H HD11 . LEU A 1 109 ? -5.419  -13.410 1.678   1.00 0.00 ? 109 LEU A HD11 3  
ATOM 5147  H HD12 . LEU A 1 109 ? -7.107  -13.791 2.013   1.00 0.00 ? 109 LEU A HD12 3  
ATOM 5148  H HD13 . LEU A 1 109 ? -6.449  -12.223 2.479   1.00 0.00 ? 109 LEU A HD13 3  
ATOM 5149  H HD21 . LEU A 1 109 ? -6.466  -13.021 -1.645  1.00 0.00 ? 109 LEU A HD21 3  
ATOM 5150  H HD22 . LEU A 1 109 ? -7.613  -14.045 -0.782  1.00 0.00 ? 109 LEU A HD22 3  
ATOM 5151  H HD23 . LEU A 1 109 ? -5.887  -14.178 -0.446  1.00 0.00 ? 109 LEU A HD23 3  
ATOM 5152  N N    . SER A 1 110 ? -10.742 -12.996 -1.104  1.00 0.00 ? 110 SER A N    3  
ATOM 5153  C CA   . SER A 1 110 ? -12.152 -13.369 -1.117  1.00 0.00 ? 110 SER A CA   3  
ATOM 5154  C C    . SER A 1 110 ? -12.930 -12.588 -0.063  1.00 0.00 ? 110 SER A C    3  
ATOM 5155  O O    . SER A 1 110 ? -12.878 -12.904 1.125   1.00 0.00 ? 110 SER A O    3  
ATOM 5156  C CB   . SER A 1 110 ? -12.305 -14.872 -0.871  1.00 0.00 ? 110 SER A CB   3  
ATOM 5157  O OG   . SER A 1 110 ? -13.594 -15.322 -1.252  1.00 0.00 ? 110 SER A OG   3  
ATOM 5158  H H    . SER A 1 110 ? -10.063 -13.687 -1.251  1.00 0.00 ? 110 SER A H    3  
ATOM 5159  H HA   . SER A 1 110 ? -12.549 -13.131 -2.092  1.00 0.00 ? 110 SER A HA   3  
ATOM 5160  H HB2  . SER A 1 110 ? -11.565 -15.406 -1.447  1.00 0.00 ? 110 SER A HB2  3  
ATOM 5161  H HB3  . SER A 1 110 ? -12.161 -15.078 0.180   1.00 0.00 ? 110 SER A HB3  3  
ATOM 5162  H HG   . SER A 1 110 ? -14.243 -15.010 -0.618  1.00 0.00 ? 110 SER A HG   3  
ATOM 5163  N N    . SER A 1 111 ? -13.652 -11.564 -0.508  1.00 0.00 ? 111 SER A N    3  
ATOM 5164  C CA   . SER A 1 111 ? -14.439 -10.733 0.396   1.00 0.00 ? 111 SER A CA   3  
ATOM 5165  C C    . SER A 1 111 ? -15.474 -9.921  -0.376  1.00 0.00 ? 111 SER A C    3  
ATOM 5166  O O    . SER A 1 111 ? -15.558 -10.003 -1.602  1.00 0.00 ? 111 SER A O    3  
ATOM 5167  C CB   . SER A 1 111 ? -13.525 -9.796  1.187   1.00 0.00 ? 111 SER A CB   3  
ATOM 5168  O OG   . SER A 1 111 ? -14.236 -9.151  2.230   1.00 0.00 ? 111 SER A OG   3  
ATOM 5169  H H    . SER A 1 111 ? -13.653 -11.361 -1.467  1.00 0.00 ? 111 SER A H    3  
ATOM 5170  H HA   . SER A 1 111 ? -14.953 -11.388 1.084   1.00 0.00 ? 111 SER A HA   3  
ATOM 5171  H HB2  . SER A 1 111 ? -12.716 -10.366 1.618   1.00 0.00 ? 111 SER A HB2  3  
ATOM 5172  H HB3  . SER A 1 111 ? -13.123 -9.045  0.523   1.00 0.00 ? 111 SER A HB3  3  
ATOM 5173  H HG   . SER A 1 111 ? -13.668 -9.066  2.999   1.00 0.00 ? 111 SER A HG   3  
ATOM 5174  N N    . THR A 1 112 ? -16.263 -9.134  0.351   1.00 0.00 ? 112 THR A N    3  
ATOM 5175  C CA   . THR A 1 112 ? -17.293 -8.307  -0.264  1.00 0.00 ? 112 THR A CA   3  
ATOM 5176  C C    . THR A 1 112 ? -16.990 -6.825  -0.080  1.00 0.00 ? 112 THR A C    3  
ATOM 5177  O O    . THR A 1 112 ? -16.467 -6.396  0.949   1.00 0.00 ? 112 THR A O    3  
ATOM 5178  C CB   . THR A 1 112 ? -18.683 -8.612  0.325   1.00 0.00 ? 112 THR A CB   3  
ATOM 5179  O OG1  . THR A 1 112 ? -18.646 -8.502  1.753   1.00 0.00 ? 112 THR A OG1  3  
ATOM 5180  C CG2  . THR A 1 112 ? -19.144 -10.007 -0.069  1.00 0.00 ? 112 THR A CG2  3  
ATOM 5181  H H    . THR A 1 112 ? -16.147 -9.112  1.323   1.00 0.00 ? 112 THR A H    3  
ATOM 5182  H HA   . THR A 1 112 ? -17.316 -8.532  -1.320  1.00 0.00 ? 112 THR A HA   3  
ATOM 5183  H HB   . THR A 1 112 ? -19.389 -7.893  -0.065  1.00 0.00 ? 112 THR A HB   3  
ATOM 5184  H HG1  . THR A 1 112 ? -18.976 -7.640  2.016   1.00 0.00 ? 112 THR A HG1  3  
ATOM 5185  H HG21 . THR A 1 112 ? -18.367 -10.495 -0.638  1.00 0.00 ? 112 THR A HG21 3  
ATOM 5186  H HG22 . THR A 1 112 ? -20.039 -9.935  -0.669  1.00 0.00 ? 112 THR A HG22 3  
ATOM 5187  H HG23 . THR A 1 112 ? -19.353 -10.582 0.821   1.00 0.00 ? 112 THR A HG23 3  
ATOM 5188  N N    . PRO A 1 113 ? -17.326 -6.020  -1.099  1.00 0.00 ? 113 PRO A N    3  
ATOM 5189  C CA   . PRO A 1 113 ? -17.100 -4.572  -1.073  1.00 0.00 ? 113 PRO A CA   3  
ATOM 5190  C C    . PRO A 1 113 ? -18.014 -3.861  -0.082  1.00 0.00 ? 113 PRO A C    3  
ATOM 5191  O O    . PRO A 1 113 ? -18.611 -4.492  0.791   1.00 0.00 ? 113 PRO A O    3  
ATOM 5192  C CB   . PRO A 1 113 ? -17.421 -4.137  -2.505  1.00 0.00 ? 113 PRO A CB   3  
ATOM 5193  C CG   . PRO A 1 113 ? -18.362 -5.174  -3.014  1.00 0.00 ? 113 PRO A CG   3  
ATOM 5194  C CD   . PRO A 1 113 ? -17.953 -6.463  -2.356  1.00 0.00 ? 113 PRO A CD   3  
ATOM 5195  H HA   . PRO A 1 113 ? -16.071 -4.335  -0.845  1.00 0.00 ? 113 PRO A HA   3  
ATOM 5196  H HB2  . PRO A 1 113 ? -17.880 -3.158  -2.492  1.00 0.00 ? 113 PRO A HB2  3  
ATOM 5197  H HB3  . PRO A 1 113 ? -16.513 -4.107  -3.088  1.00 0.00 ? 113 PRO A HB3  3  
ATOM 5198  H HG2  . PRO A 1 113 ? -19.374 -4.918  -2.740  1.00 0.00 ? 113 PRO A HG2  3  
ATOM 5199  H HG3  . PRO A 1 113 ? -18.271 -5.256  -4.087  1.00 0.00 ? 113 PRO A HG3  3  
ATOM 5200  H HD2  . PRO A 1 113 ? -18.819 -7.077  -2.160  1.00 0.00 ? 113 PRO A HD2  3  
ATOM 5201  H HD3  . PRO A 1 113 ? -17.244 -6.993  -2.974  1.00 0.00 ? 113 PRO A HD3  3  
ATOM 5202  N N    . ARG A 1 114 ? -18.121 -2.543  -0.223  1.00 0.00 ? 114 ARG A N    3  
ATOM 5203  C CA   . ARG A 1 114 ? -18.963 -1.746  0.661   1.00 0.00 ? 114 ARG A CA   3  
ATOM 5204  C C    . ARG A 1 114 ? -19.738 -0.696  -0.128  1.00 0.00 ? 114 ARG A C    3  
ATOM 5205  O O    . ARG A 1 114 ? -19.441 -0.435  -1.294  1.00 0.00 ? 114 ARG A O    3  
ATOM 5206  C CB   . ARG A 1 114 ? -18.112 -1.067  1.736   1.00 0.00 ? 114 ARG A CB   3  
ATOM 5207  C CG   . ARG A 1 114 ? -18.704 0.236   2.248   1.00 0.00 ? 114 ARG A CG   3  
ATOM 5208  C CD   . ARG A 1 114 ? -17.746 0.951   3.188   1.00 0.00 ? 114 ARG A CD   3  
ATOM 5209  N NE   . ARG A 1 114 ? -18.068 2.370   3.322   1.00 0.00 ? 114 ARG A NE   3  
ATOM 5210  C CZ   . ARG A 1 114 ? -17.362 3.217   4.063   1.00 0.00 ? 114 ARG A CZ   3  
ATOM 5211  N NH1  . ARG A 1 114 ? -16.300 2.790   4.733   1.00 0.00 ? 114 ARG A NH1  3  
ATOM 5212  N NH2  . ARG A 1 114 ? -17.717 4.493   4.134   1.00 0.00 ? 114 ARG A NH2  3  
ATOM 5213  H H    . ARG A 1 114 ? -17.621 -2.097  -0.937  1.00 0.00 ? 114 ARG A H    3  
ATOM 5214  H HA   . ARG A 1 114 ? -19.666 -2.412  1.139   1.00 0.00 ? 114 ARG A HA   3  
ATOM 5215  H HB2  . ARG A 1 114 ? -18.003 -1.741  2.572   1.00 0.00 ? 114 ARG A HB2  3  
ATOM 5216  H HB3  . ARG A 1 114 ? -17.136 -0.856  1.324   1.00 0.00 ? 114 ARG A HB3  3  
ATOM 5217  H HG2  . ARG A 1 114 ? -18.914 0.881   1.408   1.00 0.00 ? 114 ARG A HG2  3  
ATOM 5218  H HG3  . ARG A 1 114 ? -19.620 0.020   2.777   1.00 0.00 ? 114 ARG A HG3  3  
ATOM 5219  H HD2  . ARG A 1 114 ? -17.803 0.486   4.161   1.00 0.00 ? 114 ARG A HD2  3  
ATOM 5220  H HD3  . ARG A 1 114 ? -16.743 0.854   2.801   1.00 0.00 ? 114 ARG A HD3  3  
ATOM 5221  H HE   . ARG A 1 114 ? -18.848 2.706   2.835   1.00 0.00 ? 114 ARG A HE   3  
ATOM 5222  H HH11 . ARG A 1 114 ? -16.029 1.829   4.680   1.00 0.00 ? 114 ARG A HH11 3  
ATOM 5223  H HH12 . ARG A 1 114 ? -15.770 3.430   5.289   1.00 0.00 ? 114 ARG A HH12 3  
ATOM 5224  H HH21 . ARG A 1 114 ? -18.517 4.818   3.630   1.00 0.00 ? 114 ARG A HH21 3  
ATOM 5225  H HH22 . ARG A 1 114 ? -17.186 5.129   4.692   1.00 0.00 ? 114 ARG A HH22 3  
ATOM 5226  N N    . VAL A 1 115 ? -20.735 -0.095  0.516   1.00 0.00 ? 115 VAL A N    3  
ATOM 5227  C CA   . VAL A 1 115 ? -21.553 0.927   -0.126  1.00 0.00 ? 115 VAL A CA   3  
ATOM 5228  C C    . VAL A 1 115 ? -21.178 2.320   0.367   1.00 0.00 ? 115 VAL A C    3  
ATOM 5229  O O    . VAL A 1 115 ? -20.452 2.467   1.352   1.00 0.00 ? 115 VAL A O    3  
ATOM 5230  C CB   . VAL A 1 115 ? -23.052 0.690   0.133   1.00 0.00 ? 115 VAL A CB   3  
ATOM 5231  C CG1  . VAL A 1 115 ? -23.897 1.594   -0.752  1.00 0.00 ? 115 VAL A CG1  3  
ATOM 5232  C CG2  . VAL A 1 115 ? -23.407 -0.772  -0.093  1.00 0.00 ? 115 VAL A CG2  3  
ATOM 5233  H H    . VAL A 1 115 ? -20.923 -0.346  1.444   1.00 0.00 ? 115 VAL A H    3  
ATOM 5234  H HA   . VAL A 1 115 ? -21.380 0.874   -1.191  1.00 0.00 ? 115 VAL A HA   3  
ATOM 5235  H HB   . VAL A 1 115 ? -23.262 0.934   1.164   1.00 0.00 ? 115 VAL A HB   3  
ATOM 5236  H HG11 . VAL A 1 115 ? -24.872 1.151   -0.892  1.00 0.00 ? 115 VAL A HG11 3  
ATOM 5237  H HG12 . VAL A 1 115 ? -24.003 2.561   -0.281  1.00 0.00 ? 115 VAL A HG12 3  
ATOM 5238  H HG13 . VAL A 1 115 ? -23.414 1.711   -1.711  1.00 0.00 ? 115 VAL A HG13 3  
ATOM 5239  H HG21 . VAL A 1 115 ? -22.508 -1.370  -0.059  1.00 0.00 ? 115 VAL A HG21 3  
ATOM 5240  H HG22 . VAL A 1 115 ? -24.087 -1.100  0.679   1.00 0.00 ? 115 VAL A HG22 3  
ATOM 5241  H HG23 . VAL A 1 115 ? -23.878 -0.884  -1.058  1.00 0.00 ? 115 VAL A HG23 3  
ATOM 5242  N N    . ILE A 1 116 ? -21.676 3.340   -0.323  1.00 0.00 ? 116 ILE A N    3  
ATOM 5243  C CA   . ILE A 1 116 ? -21.394 4.722   0.046   1.00 0.00 ? 116 ILE A CA   3  
ATOM 5244  C C    . ILE A 1 116 ? -22.671 5.458   0.437   1.00 0.00 ? 116 ILE A C    3  
ATOM 5245  O O    . ILE A 1 116 ? -23.781 5.060   0.080   1.00 0.00 ? 116 ILE A O    3  
ATOM 5246  C CB   . ILE A 1 116 ? -20.708 5.483   -1.104  1.00 0.00 ? 116 ILE A CB   3  
ATOM 5247  C CG1  . ILE A 1 116 ? -21.208 4.967   -2.455  1.00 0.00 ? 116 ILE A CG1  3  
ATOM 5248  C CG2  . ILE A 1 116 ? -19.197 5.343   -1.004  1.00 0.00 ? 116 ILE A CG2  3  
ATOM 5249  C CD1  . ILE A 1 116 ? -22.666 5.273   -2.717  1.00 0.00 ? 116 ILE A CD1  3  
ATOM 5250  H H    . ILE A 1 116 ? -22.248 3.159   -1.098  1.00 0.00 ? 116 ILE A H    3  
ATOM 5251  H HA   . ILE A 1 116 ? -20.724 4.710   0.893   1.00 0.00 ? 116 ILE A HA   3  
ATOM 5252  H HB   . ILE A 1 116 ? -20.956 6.529   -1.012  1.00 0.00 ? 116 ILE A HB   3  
ATOM 5253  H HG12 . ILE A 1 116 ? -20.628 5.421   -3.244  1.00 0.00 ? 116 ILE A HG12 3  
ATOM 5254  H HG13 . ILE A 1 116 ? -21.081 3.895   -2.492  1.00 0.00 ? 116 ILE A HG13 3  
ATOM 5255  H HG21 . ILE A 1 116 ? -18.881 5.570   0.004   1.00 0.00 ? 116 ILE A HG21 3  
ATOM 5256  H HG22 . ILE A 1 116 ? -18.912 4.332   -1.251  1.00 0.00 ? 116 ILE A HG22 3  
ATOM 5257  H HG23 . ILE A 1 116 ? -18.725 6.029   -1.692  1.00 0.00 ? 116 ILE A HG23 3  
ATOM 5258  H HD11 . ILE A 1 116 ? -22.888 5.099   -3.760  1.00 0.00 ? 116 ILE A HD11 3  
ATOM 5259  H HD12 . ILE A 1 116 ? -23.284 4.631   -2.107  1.00 0.00 ? 116 ILE A HD12 3  
ATOM 5260  H HD13 . ILE A 1 116 ? -22.867 6.305   -2.474  1.00 0.00 ? 116 ILE A HD13 3  
ATOM 5261  N N    . PRO A 1 117 ? -22.514 6.558   1.187   1.00 0.00 ? 117 PRO A N    3  
ATOM 5262  C CA   . PRO A 1 117 ? -23.643 7.375   1.641   1.00 0.00 ? 117 PRO A CA   3  
ATOM 5263  C C    . PRO A 1 117 ? -24.309 8.132   0.497   1.00 0.00 ? 117 PRO A C    3  
ATOM 5264  O O    . PRO A 1 117 ? -23.973 7.931   -0.671  1.00 0.00 ? 117 PRO A O    3  
ATOM 5265  C CB   . PRO A 1 117 ? -23.000 8.354   2.626   1.00 0.00 ? 117 PRO A CB   3  
ATOM 5266  C CG   . PRO A 1 117 ? -21.577 8.446   2.194   1.00 0.00 ? 117 PRO A CG   3  
ATOM 5267  C CD   . PRO A 1 117 ? -21.221 7.090   1.650   1.00 0.00 ? 117 PRO A CD   3  
ATOM 5268  H HA   . PRO A 1 117 ? -24.383 6.779   2.155   1.00 0.00 ? 117 PRO A HA   3  
ATOM 5269  H HB2  . PRO A 1 117 ? -23.496 9.312   2.562   1.00 0.00 ? 117 PRO A HB2  3  
ATOM 5270  H HB3  . PRO A 1 117 ? -23.083 7.966   3.631   1.00 0.00 ? 117 PRO A HB3  3  
ATOM 5271  H HG2  . PRO A 1 117 ? -21.475 9.197   1.426   1.00 0.00 ? 117 PRO A HG2  3  
ATOM 5272  H HG3  . PRO A 1 117 ? -20.951 8.685   3.041   1.00 0.00 ? 117 PRO A HG3  3  
ATOM 5273  H HD2  . PRO A 1 117 ? -20.527 7.184   0.828   1.00 0.00 ? 117 PRO A HD2  3  
ATOM 5274  H HD3  . PRO A 1 117 ? -20.805 6.468   2.428   1.00 0.00 ? 117 PRO A HD3  3  
ATOM 5275  N N    . GLY A 1 1   ? 15.200  -23.545 -16.798 1.00 0.00 ? 1   GLY A N    4  
ATOM 5276  C CA   . GLY A 1 1   ? 14.526  -24.703 -17.357 1.00 0.00 ? 1   GLY A CA   4  
ATOM 5277  C C    . GLY A 1 1   ? 13.022  -24.528 -17.408 1.00 0.00 ? 1   GLY A C    4  
ATOM 5278  O O    . GLY A 1 1   ? 12.487  -23.972 -18.367 1.00 0.00 ? 1   GLY A O    4  
ATOM 5279  H H1   . GLY A 1 1   ? 15.808  -23.017 -17.358 1.00 0.00 ? 1   GLY A H1   4  
ATOM 5280  H HA2  . GLY A 1 1   ? 14.894  -24.871 -18.358 1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5281  H HA3  . GLY A 1 1   ? 14.757  -25.566 -16.750 1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5282  N N    . SER A 1 2   ? 12.336  -25.007 -16.375 1.00 0.00 ? 2   SER A N    4  
ATOM 5283  C CA   . SER A 1 2   ? 10.883  -24.907 -16.309 1.00 0.00 ? 2   SER A CA   4  
ATOM 5284  C C    . SER A 1 2   ? 10.403  -24.916 -14.860 1.00 0.00 ? 2   SER A C    4  
ATOM 5285  O O    . SER A 1 2   ? 11.024  -25.530 -13.993 1.00 0.00 ? 2   SER A O    4  
ATOM 5286  C CB   . SER A 1 2   ? 10.235  -26.059 -17.080 1.00 0.00 ? 2   SER A CB   4  
ATOM 5287  O OG   . SER A 1 2   ? 10.963  -26.355 -18.259 1.00 0.00 ? 2   SER A OG   4  
ATOM 5288  H H    . SER A 1 2   ? 12.820  -25.441 -15.641 1.00 0.00 ? 2   SER A H    4  
ATOM 5289  H HA   . SER A 1 2   ? 10.594  -23.972 -16.765 1.00 0.00 ? 2   SER A HA   4  
ATOM 5290  H HB2  . SER A 1 2   ? 10.212  -26.938 -16.455 1.00 0.00 ? 2   SER A HB2  4  
ATOM 5291  H HB3  . SER A 1 2   ? 9.227   -25.783 -17.352 1.00 0.00 ? 2   SER A HB3  4  
ATOM 5292  H HG   . SER A 1 2   ? 11.237  -27.275 -18.244 1.00 0.00 ? 2   SER A HG   4  
ATOM 5293  N N    . SER A 1 3   ? 9.294   -24.230 -14.607 1.00 0.00 ? 3   SER A N    4  
ATOM 5294  C CA   . SER A 1 3   ? 8.731   -24.155 -13.264 1.00 0.00 ? 3   SER A CA   4  
ATOM 5295  C C    . SER A 1 3   ? 7.210   -24.264 -13.305 1.00 0.00 ? 3   SER A C    4  
ATOM 5296  O O    . SER A 1 3   ? 6.619   -24.466 -14.365 1.00 0.00 ? 3   SER A O    4  
ATOM 5297  C CB   . SER A 1 3   ? 9.142   -22.845 -12.588 1.00 0.00 ? 3   SER A CB   4  
ATOM 5298  O OG   . SER A 1 3   ? 8.717   -21.725 -13.346 1.00 0.00 ? 3   SER A OG   4  
ATOM 5299  H H    . SER A 1 3   ? 8.844   -23.760 -15.341 1.00 0.00 ? 3   SER A H    4  
ATOM 5300  H HA   . SER A 1 3   ? 9.125   -24.983 -12.693 1.00 0.00 ? 3   SER A HA   4  
ATOM 5301  H HB2  . SER A 1 3   ? 8.693   -22.792 -11.608 1.00 0.00 ? 3   SER A HB2  4  
ATOM 5302  H HB3  . SER A 1 3   ? 10.218  -22.814 -12.494 1.00 0.00 ? 3   SER A HB3  4  
ATOM 5303  H HG   . SER A 1 3   ? 8.251   -21.110 -12.775 1.00 0.00 ? 3   SER A HG   4  
ATOM 5304  N N    . GLY A 1 4   ? 6.582   -24.128 -12.141 1.00 0.00 ? 4   GLY A N    4  
ATOM 5305  C CA   . GLY A 1 4   ? 5.135   -24.214 -12.064 1.00 0.00 ? 4   GLY A CA   4  
ATOM 5306  C C    . GLY A 1 4   ? 4.549   -23.244 -11.059 1.00 0.00 ? 4   GLY A C    4  
ATOM 5307  O O    . GLY A 1 4   ? 5.258   -22.396 -10.517 1.00 0.00 ? 4   GLY A O    4  
ATOM 5308  H H    . GLY A 1 4   ? 7.105   -23.968 -11.327 1.00 0.00 ? 4   GLY A H    4  
ATOM 5309  H HA2  . GLY A 1 4   ? 4.721   -24.001 -13.039 1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5310  H HA3  . GLY A 1 4   ? 4.860   -25.219 -11.779 1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5311  N N    . SER A 1 5   ? 3.249   -23.366 -10.809 1.00 0.00 ? 5   SER A N    4  
ATOM 5312  C CA   . SER A 1 5   ? 2.566   -22.489 -9.865  1.00 0.00 ? 5   SER A CA   4  
ATOM 5313  C C    . SER A 1 5   ? 2.213   -23.238 -8.584  1.00 0.00 ? 5   SER A C    4  
ATOM 5314  O O    . SER A 1 5   ? 2.280   -22.682 -7.488  1.00 0.00 ? 5   SER A O    4  
ATOM 5315  C CB   . SER A 1 5   ? 1.298   -21.913 -10.498 1.00 0.00 ? 5   SER A CB   4  
ATOM 5316  O OG   . SER A 1 5   ? 1.614   -20.967 -11.505 1.00 0.00 ? 5   SER A OG   4  
ATOM 5317  H H    . SER A 1 5   ? 2.737   -24.062 -11.272 1.00 0.00 ? 5   SER A H    4  
ATOM 5318  H HA   . SER A 1 5   ? 3.236   -21.678 -9.621  1.00 0.00 ? 5   SER A HA   4  
ATOM 5319  H HB2  . SER A 1 5   ? 0.724   -22.713 -10.940 1.00 0.00 ? 5   SER A HB2  4  
ATOM 5320  H HB3  . SER A 1 5   ? 0.708   -21.425 -9.735  1.00 0.00 ? 5   SER A HB3  4  
ATOM 5321  H HG   . SER A 1 5   ? 1.589   -20.083 -11.133 1.00 0.00 ? 5   SER A HG   4  
ATOM 5322  N N    . SER A 1 6   ? 1.838   -24.505 -8.731  1.00 0.00 ? 6   SER A N    4  
ATOM 5323  C CA   . SER A 1 6   ? 1.471   -25.331 -7.587  1.00 0.00 ? 6   SER A CA   4  
ATOM 5324  C C    . SER A 1 6   ? 2.387   -25.052 -6.399  1.00 0.00 ? 6   SER A C    4  
ATOM 5325  O O    . SER A 1 6   ? 3.476   -25.614 -6.295  1.00 0.00 ? 6   SER A O    4  
ATOM 5326  C CB   . SER A 1 6   ? 1.536   -26.813 -7.959  1.00 0.00 ? 6   SER A CB   4  
ATOM 5327  O OG   . SER A 1 6   ? 1.804   -27.614 -6.821  1.00 0.00 ? 6   SER A OG   4  
ATOM 5328  H H    . SER A 1 6   ? 1.804   -24.892 -9.631  1.00 0.00 ? 6   SER A H    4  
ATOM 5329  H HA   . SER A 1 6   ? 0.457   -25.082 -7.310  1.00 0.00 ? 6   SER A HA   4  
ATOM 5330  H HB2  . SER A 1 6   ? 0.592   -27.117 -8.384  1.00 0.00 ? 6   SER A HB2  4  
ATOM 5331  H HB3  . SER A 1 6   ? 2.323   -26.965 -8.684  1.00 0.00 ? 6   SER A HB3  4  
ATOM 5332  H HG   . SER A 1 6   ? 1.095   -28.250 -6.703  1.00 0.00 ? 6   SER A HG   4  
ATOM 5333  N N    . GLY A 1 7   ? 1.936   -24.178 -5.504  1.00 0.00 ? 7   GLY A N    4  
ATOM 5334  C CA   . GLY A 1 7   ? 2.727   -23.839 -4.335  1.00 0.00 ? 7   GLY A CA   4  
ATOM 5335  C C    . GLY A 1 7   ? 1.903   -23.823 -3.063  1.00 0.00 ? 7   GLY A C    4  
ATOM 5336  O O    . GLY A 1 7   ? 0.731   -24.201 -3.052  1.00 0.00 ? 7   GLY A O    4  
ATOM 5337  H H    . GLY A 1 7   ? 1.060   -23.761 -5.638  1.00 0.00 ? 7   GLY A H    4  
ATOM 5338  H HA2  . GLY A 1 7   ? 3.521   -24.562 -4.229  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5339  H HA3  . GLY A 1 7   ? 3.161   -22.861 -4.480  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5340  N N    . PRO A 1 8   ? 2.521   -23.380 -1.958  1.00 0.00 ? 8   PRO A N    4  
ATOM 5341  C CA   . PRO A 1 8   ? 1.857   -23.307 -0.654  1.00 0.00 ? 8   PRO A CA   4  
ATOM 5342  C C    . PRO A 1 8   ? 0.786   -22.223 -0.608  1.00 0.00 ? 8   PRO A C    4  
ATOM 5343  O O    . PRO A 1 8   ? 0.166   -21.992 0.429   1.00 0.00 ? 8   PRO A O    4  
ATOM 5344  C CB   . PRO A 1 8   ? 2.999   -22.971 0.308   1.00 0.00 ? 8   PRO A CB   4  
ATOM 5345  C CG   . PRO A 1 8   ? 4.016   -22.284 -0.536  1.00 0.00 ? 8   PRO A CG   4  
ATOM 5346  C CD   . PRO A 1 8   ? 3.917   -22.914 -1.898  1.00 0.00 ? 8   PRO A CD   4  
ATOM 5347  H HA   . PRO A 1 8   ? 1.419   -24.256 -0.378  1.00 0.00 ? 8   PRO A HA   4  
ATOM 5348  H HB2  . PRO A 1 8   ? 2.633   -22.324 1.093   1.00 0.00 ? 8   PRO A HB2  4  
ATOM 5349  H HB3  . PRO A 1 8   ? 3.392   -23.880 0.738   1.00 0.00 ? 8   PRO A HB3  4  
ATOM 5350  H HG2  . PRO A 1 8   ? 3.793   -21.229 -0.594  1.00 0.00 ? 8   PRO A HG2  4  
ATOM 5351  H HG3  . PRO A 1 8   ? 5.001   -22.439 -0.123  1.00 0.00 ? 8   PRO A HG3  4  
ATOM 5352  H HD2  . PRO A 1 8   ? 4.113   -22.182 -2.668  1.00 0.00 ? 8   PRO A HD2  4  
ATOM 5353  H HD3  . PRO A 1 8   ? 4.604   -23.744 -1.981  1.00 0.00 ? 8   PRO A HD3  4  
ATOM 5354  N N    . ASN A 1 9   ? 0.572   -21.560 -1.741  1.00 0.00 ? 9   ASN A N    4  
ATOM 5355  C CA   . ASN A 1 9   ? -0.424  -20.499 -1.830  1.00 0.00 ? 9   ASN A CA   4  
ATOM 5356  C C    . ASN A 1 9   ? -1.837  -21.075 -1.781  1.00 0.00 ? 9   ASN A C    4  
ATOM 5357  O O    . ASN A 1 9   ? -2.493  -21.226 -2.812  1.00 0.00 ? 9   ASN A O    4  
ATOM 5358  C CB   . ASN A 1 9   ? -0.232  -19.697 -3.118  1.00 0.00 ? 9   ASN A CB   4  
ATOM 5359  C CG   . ASN A 1 9   ? -0.072  -20.588 -4.335  1.00 0.00 ? 9   ASN A CG   4  
ATOM 5360  O OD1  . ASN A 1 9   ? 0.943   -21.266 -4.492  1.00 0.00 ? 9   ASN A OD1  4  
ATOM 5361  N ND2  . ASN A 1 9   ? -1.077  -20.589 -5.204  1.00 0.00 ? 9   ASN A ND2  4  
ATOM 5362  H H    . ASN A 1 9   ? 1.098   -21.790 -2.535  1.00 0.00 ? 9   ASN A H    4  
ATOM 5363  H HA   . ASN A 1 9   ? -0.286  -19.843 -0.984  1.00 0.00 ? 9   ASN A HA   4  
ATOM 5364  H HB2  . ASN A 1 9   ? -1.093  -19.062 -3.271  1.00 0.00 ? 9   ASN A HB2  4  
ATOM 5365  H HB3  . ASN A 1 9   ? 0.651   -19.083 -3.025  1.00 0.00 ? 9   ASN A HB3  4  
ATOM 5366  H HD21 . ASN A 1 9   ? -1.854  -20.023 -5.013  1.00 0.00 ? 9   ASN A HD21 4  
ATOM 5367  H HD22 . ASN A 1 9   ? -1.000  -21.156 -5.999  1.00 0.00 ? 9   ASN A HD22 4  
ATOM 5368  N N    . PHE A 1 10  ? -2.299  -21.393 -0.576  1.00 0.00 ? 10  PHE A N    4  
ATOM 5369  C CA   . PHE A 1 10  ? -3.633  -21.951 -0.393  1.00 0.00 ? 10  PHE A CA   4  
ATOM 5370  C C    . PHE A 1 10  ? -4.687  -20.848 -0.374  1.00 0.00 ? 10  PHE A C    4  
ATOM 5371  O O    . PHE A 1 10  ? -5.862  -21.092 -0.650  1.00 0.00 ? 10  PHE A O    4  
ATOM 5372  C CB   . PHE A 1 10  ? -3.698  -22.756 0.907   1.00 0.00 ? 10  PHE A CB   4  
ATOM 5373  C CG   . PHE A 1 10  ? -4.906  -23.644 1.003   1.00 0.00 ? 10  PHE A CG   4  
ATOM 5374  C CD1  . PHE A 1 10  ? -5.172  -24.583 0.020   1.00 0.00 ? 10  PHE A CD1  4  
ATOM 5375  C CD2  . PHE A 1 10  ? -5.776  -23.538 2.076   1.00 0.00 ? 10  PHE A CD2  4  
ATOM 5376  C CE1  . PHE A 1 10  ? -6.282  -25.402 0.106   1.00 0.00 ? 10  PHE A CE1  4  
ATOM 5377  C CE2  . PHE A 1 10  ? -6.888  -24.354 2.167   1.00 0.00 ? 10  PHE A CE2  4  
ATOM 5378  C CZ   . PHE A 1 10  ? -7.142  -25.286 1.180   1.00 0.00 ? 10  PHE A CZ   4  
ATOM 5379  H H    . PHE A 1 10  ? -1.729  -21.248 0.208   1.00 0.00 ? 10  PHE A H    4  
ATOM 5380  H HA   . PHE A 1 10  ? -3.834  -22.610 -1.224  1.00 0.00 ? 10  PHE A HA   4  
ATOM 5381  H HB2  . PHE A 1 10  ? -2.821  -23.382 0.978   1.00 0.00 ? 10  PHE A HB2  4  
ATOM 5382  H HB3  . PHE A 1 10  ? -3.718  -22.074 1.743   1.00 0.00 ? 10  PHE A HB3  4  
ATOM 5383  H HD1  . PHE A 1 10  ? -4.499  -24.675 -0.822  1.00 0.00 ? 10  PHE A HD1  4  
ATOM 5384  H HD2  . PHE A 1 10  ? -5.579  -22.809 2.848   1.00 0.00 ? 10  PHE A HD2  4  
ATOM 5385  H HE1  . PHE A 1 10  ? -6.478  -26.130 -0.668  1.00 0.00 ? 10  PHE A HE1  4  
ATOM 5386  H HE2  . PHE A 1 10  ? -7.558  -24.261 3.009   1.00 0.00 ? 10  PHE A HE2  4  
ATOM 5387  H HZ   . PHE A 1 10  ? -8.010  -25.925 1.250   1.00 0.00 ? 10  PHE A HZ   4  
ATOM 5388  N N    . SER A 1 11  ? -4.258  -19.634 -0.044  1.00 0.00 ? 11  SER A N    4  
ATOM 5389  C CA   . SER A 1 11  ? -5.165  -18.493 0.016   1.00 0.00 ? 11  SER A CA   4  
ATOM 5390  C C    . SER A 1 11  ? -6.046  -18.433 -1.229  1.00 0.00 ? 11  SER A C    4  
ATOM 5391  O O    . SER A 1 11  ? -5.882  -19.224 -2.158  1.00 0.00 ? 11  SER A O    4  
ATOM 5392  C CB   . SER A 1 11  ? -4.372  -17.192 0.156   1.00 0.00 ? 11  SER A CB   4  
ATOM 5393  O OG   . SER A 1 11  ? -3.771  -17.097 1.436   1.00 0.00 ? 11  SER A OG   4  
ATOM 5394  H H    . SER A 1 11  ? -3.310  -19.503 0.166   1.00 0.00 ? 11  SER A H    4  
ATOM 5395  H HA   . SER A 1 11  ? -5.795  -18.616 0.883   1.00 0.00 ? 11  SER A HA   4  
ATOM 5396  H HB2  . SER A 1 11  ? -3.598  -17.162 -0.595  1.00 0.00 ? 11  SER A HB2  4  
ATOM 5397  H HB3  . SER A 1 11  ? -5.038  -16.352 0.021   1.00 0.00 ? 11  SER A HB3  4  
ATOM 5398  H HG   . SER A 1 11  ? -2.848  -16.849 1.338   1.00 0.00 ? 11  SER A HG   4  
ATOM 5399  N N    . HIS A 1 12  ? -6.982  -17.489 -1.238  1.00 0.00 ? 12  HIS A N    4  
ATOM 5400  C CA   . HIS A 1 12  ? -7.889  -17.325 -2.368  1.00 0.00 ? 12  HIS A CA   4  
ATOM 5401  C C    . HIS A 1 12  ? -7.813  -15.906 -2.924  1.00 0.00 ? 12  HIS A C    4  
ATOM 5402  O O    . HIS A 1 12  ? -8.794  -15.162 -2.888  1.00 0.00 ? 12  HIS A O    4  
ATOM 5403  C CB   . HIS A 1 12  ? -9.324  -17.644 -1.947  1.00 0.00 ? 12  HIS A CB   4  
ATOM 5404  C CG   . HIS A 1 12  ? -10.214 -18.023 -3.091  1.00 0.00 ? 12  HIS A CG   4  
ATOM 5405  N ND1  . HIS A 1 12  ? -10.958 -19.183 -3.113  1.00 0.00 ? 12  HIS A ND1  4  
ATOM 5406  C CD2  . HIS A 1 12  ? -10.477 -17.387 -4.256  1.00 0.00 ? 12  HIS A CD2  4  
ATOM 5407  C CE1  . HIS A 1 12  ? -11.640 -19.246 -4.243  1.00 0.00 ? 12  HIS A CE1  4  
ATOM 5408  N NE2  . HIS A 1 12  ? -11.366 -18.167 -4.954  1.00 0.00 ? 12  HIS A NE2  4  
ATOM 5409  H H    . HIS A 1 12  ? -7.063  -16.889 -0.468  1.00 0.00 ? 12  HIS A H    4  
ATOM 5410  H HA   . HIS A 1 12  ? -7.588  -18.017 -3.140  1.00 0.00 ? 12  HIS A HA   4  
ATOM 5411  H HB2  . HIS A 1 12  ? -9.313  -18.468 -1.249  1.00 0.00 ? 12  HIS A HB2  4  
ATOM 5412  H HB3  . HIS A 1 12  ? -9.753  -16.777 -1.466  1.00 0.00 ? 12  HIS A HB3  4  
ATOM 5413  H HD1  . HIS A 1 12  ? -10.982 -19.861 -2.406  1.00 0.00 ? 12  HIS A HD1  4  
ATOM 5414  H HD2  . HIS A 1 12  ? -10.064 -16.441 -4.579  1.00 0.00 ? 12  HIS A HD2  4  
ATOM 5415  H HE1  . HIS A 1 12  ? -12.308 -20.042 -4.535  1.00 0.00 ? 12  HIS A HE1  4  
ATOM 5416  N N    . TRP A 1 13  ? -6.644  -15.538 -3.435  1.00 0.00 ? 13  TRP A N    4  
ATOM 5417  C CA   . TRP A 1 13  ? -6.441  -14.208 -3.998  1.00 0.00 ? 13  TRP A CA   4  
ATOM 5418  C C    . TRP A 1 13  ? -6.809  -14.180 -5.477  1.00 0.00 ? 13  TRP A C    4  
ATOM 5419  O O    . TRP A 1 13  ? -6.205  -14.878 -6.290  1.00 0.00 ? 13  TRP A O    4  
ATOM 5420  C CB   . TRP A 1 13  ? -4.987  -13.771 -3.813  1.00 0.00 ? 13  TRP A CB   4  
ATOM 5421  C CG   . TRP A 1 13  ? -4.547  -13.759 -2.380  1.00 0.00 ? 13  TRP A CG   4  
ATOM 5422  C CD1  . TRP A 1 13  ? -4.254  -14.843 -1.604  1.00 0.00 ? 13  TRP A CD1  4  
ATOM 5423  C CD2  . TRP A 1 13  ? -4.353  -12.606 -1.553  1.00 0.00 ? 13  TRP A CD2  4  
ATOM 5424  N NE1  . TRP A 1 13  ? -3.890  -14.434 -0.344  1.00 0.00 ? 13  TRP A NE1  4  
ATOM 5425  C CE2  . TRP A 1 13  ? -3.941  -13.067 -0.287  1.00 0.00 ? 13  TRP A CE2  4  
ATOM 5426  C CE3  . TRP A 1 13  ? -4.484  -11.230 -1.759  1.00 0.00 ? 13  TRP A CE3  4  
ATOM 5427  C CZ2  . TRP A 1 13  ? -3.663  -12.199 0.765   1.00 0.00 ? 13  TRP A CZ2  4  
ATOM 5428  C CZ3  . TRP A 1 13  ? -4.208  -10.371 -0.713  1.00 0.00 ? 13  TRP A CZ3  4  
ATOM 5429  C CH2  . TRP A 1 13  ? -3.800  -10.857 0.536   1.00 0.00 ? 13  TRP A CH2  4  
ATOM 5430  H H    . TRP A 1 13  ? -5.900  -16.176 -3.435  1.00 0.00 ? 13  TRP A H    4  
ATOM 5431  H HA   . TRP A 1 13  ? -7.084  -13.522 -3.465  1.00 0.00 ? 13  TRP A HA   4  
ATOM 5432  H HB2  . TRP A 1 13  ? -4.342  -14.448 -4.354  1.00 0.00 ? 13  TRP A HB2  4  
ATOM 5433  H HB3  . TRP A 1 13  ? -4.866  -12.772 -4.208  1.00 0.00 ? 13  TRP A HB3  4  
ATOM 5434  H HD1  . TRP A 1 13  ? -4.308  -15.866 -1.943  1.00 0.00 ? 13  TRP A HD1  4  
ATOM 5435  H HE1  . TRP A 1 13  ? -3.633  -15.027 0.394   1.00 0.00 ? 13  TRP A HE1  4  
ATOM 5436  H HE3  . TRP A 1 13  ? -4.798  -10.836 -2.715  1.00 0.00 ? 13  TRP A HE3  4  
ATOM 5437  H HZ2  . TRP A 1 13  ? -3.347  -12.559 1.734   1.00 0.00 ? 13  TRP A HZ2  4  
ATOM 5438  H HZ3  . TRP A 1 13  ? -4.304  -9.304  -0.854  1.00 0.00 ? 13  TRP A HZ3  4  
ATOM 5439  H HH2  . TRP A 1 13  ? -3.595  -10.149 1.324   1.00 0.00 ? 13  TRP A HH2  4  
ATOM 5440  N N    . GLY A 1 14  ? -7.805  -13.368 -5.819  1.00 0.00 ? 14  GLY A N    4  
ATOM 5441  C CA   . GLY A 1 14  ? -8.236  -13.265 -7.201  1.00 0.00 ? 14  GLY A CA   4  
ATOM 5442  C C    . GLY A 1 14  ? -7.302  -12.412 -8.038  1.00 0.00 ? 14  GLY A C    4  
ATOM 5443  O O    . GLY A 1 14  ? -6.154  -12.167 -7.669  1.00 0.00 ? 14  GLY A O    4  
ATOM 5444  H H    . GLY A 1 14  ? -8.250  -12.834 -5.128  1.00 0.00 ? 14  GLY A H    4  
ATOM 5445  H HA2  . GLY A 1 14  ? -8.281  -14.255 -7.628  1.00 0.00 ? 14  GLY A HA2  4  
ATOM 5446  H HA3  . GLY A 1 14  ? -9.223  -12.827 -7.227  1.00 0.00 ? 14  GLY A HA3  4  
ATOM 5447  N N    . PRO A 1 15  ? -7.797  -11.947 -9.194  1.00 0.00 ? 15  PRO A N    4  
ATOM 5448  C CA   . PRO A 1 15  ? -7.015  -11.111 -10.110 1.00 0.00 ? 15  PRO A CA   4  
ATOM 5449  C C    . PRO A 1 15  ? -6.757  -9.718  -9.546  1.00 0.00 ? 15  PRO A C    4  
ATOM 5450  O O    . PRO A 1 15  ? -7.460  -9.242  -8.655  1.00 0.00 ? 15  PRO A O    4  
ATOM 5451  C CB   . PRO A 1 15  ? -7.899  -11.028 -11.357 1.00 0.00 ? 15  PRO A CB   4  
ATOM 5452  C CG   . PRO A 1 15  ? -9.284  -11.249 -10.855 1.00 0.00 ? 15  PRO A CG   4  
ATOM 5453  C CD   . PRO A 1 15  ? -9.158  -12.200 -9.697  1.00 0.00 ? 15  PRO A CD   4  
ATOM 5454  H HA   . PRO A 1 15  ? -6.073  -11.575 -10.365 1.00 0.00 ? 15  PRO A HA   4  
ATOM 5455  H HB2  . PRO A 1 15  ? -7.793  -10.053 -11.812 1.00 0.00 ? 15  PRO A HB2  4  
ATOM 5456  H HB3  . PRO A 1 15  ? -7.607  -11.793 -12.061 1.00 0.00 ? 15  PRO A HB3  4  
ATOM 5457  H HG2  . PRO A 1 15  ? -9.709  -10.313 -10.527 1.00 0.00 ? 15  PRO A HG2  4  
ATOM 5458  H HG3  . PRO A 1 15  ? -9.891  -11.686 -11.634 1.00 0.00 ? 15  PRO A HG3  4  
ATOM 5459  H HD2  . PRO A 1 15  ? -9.896  -11.974 -8.942  1.00 0.00 ? 15  PRO A HD2  4  
ATOM 5460  H HD3  . PRO A 1 15  ? -9.260  -13.221 -10.034 1.00 0.00 ? 15  PRO A HD3  4  
ATOM 5461  N N    . PRO A 1 16  ? -5.724  -9.046  -10.077 1.00 0.00 ? 16  PRO A N    4  
ATOM 5462  C CA   . PRO A 1 16  ? -5.350  -7.697  -9.642  1.00 0.00 ? 16  PRO A CA   4  
ATOM 5463  C C    . PRO A 1 16  ? -6.375  -6.648  -10.061 1.00 0.00 ? 16  PRO A C    4  
ATOM 5464  O O    . PRO A 1 16  ? -7.159  -6.867  -10.984 1.00 0.00 ? 16  PRO A O    4  
ATOM 5465  C CB   . PRO A 1 16  ? -4.015  -7.453  -10.350 1.00 0.00 ? 16  PRO A CB   4  
ATOM 5466  C CG   . PRO A 1 16  ? -4.056  -8.336  -11.549 1.00 0.00 ? 16  PRO A CG   4  
ATOM 5467  C CD   . PRO A 1 16  ? -4.842  -9.551  -11.142 1.00 0.00 ? 16  PRO A CD   4  
ATOM 5468  H HA   . PRO A 1 16  ? -5.206  -7.650  -8.572  1.00 0.00 ? 16  PRO A HA   4  
ATOM 5469  H HB2  . PRO A 1 16  ? -3.937  -6.411  -10.627 1.00 0.00 ? 16  PRO A HB2  4  
ATOM 5470  H HB3  . PRO A 1 16  ? -3.201  -7.718  -9.692  1.00 0.00 ? 16  PRO A HB3  4  
ATOM 5471  H HG2  . PRO A 1 16  ? -4.547  -7.826  -12.364 1.00 0.00 ? 16  PRO A HG2  4  
ATOM 5472  H HG3  . PRO A 1 16  ? -3.052  -8.616  -11.832 1.00 0.00 ? 16  PRO A HG3  4  
ATOM 5473  H HD2  . PRO A 1 16  ? -5.419  -9.924  -11.976 1.00 0.00 ? 16  PRO A HD2  4  
ATOM 5474  H HD3  . PRO A 1 16  ? -4.182  -10.318 -10.764 1.00 0.00 ? 16  PRO A HD3  4  
ATOM 5475  N N    . ARG A 1 17  ? -6.362  -5.509  -9.376  1.00 0.00 ? 17  ARG A N    4  
ATOM 5476  C CA   . ARG A 1 17  ? -7.291  -4.426  -9.678  1.00 0.00 ? 17  ARG A CA   4  
ATOM 5477  C C    . ARG A 1 17  ? -6.554  -3.096  -9.803  1.00 0.00 ? 17  ARG A C    4  
ATOM 5478  O O    . ARG A 1 17  ? -5.942  -2.622  -8.845  1.00 0.00 ? 17  ARG A O    4  
ATOM 5479  C CB   . ARG A 1 17  ? -8.363  -4.327  -8.590  1.00 0.00 ? 17  ARG A CB   4  
ATOM 5480  C CG   . ARG A 1 17  ? -7.820  -4.511  -7.182  1.00 0.00 ? 17  ARG A CG   4  
ATOM 5481  C CD   . ARG A 1 17  ? -8.943  -4.689  -6.172  1.00 0.00 ? 17  ARG A CD   4  
ATOM 5482  N NE   . ARG A 1 17  ? -8.583  -4.165  -4.857  1.00 0.00 ? 17  ARG A NE   4  
ATOM 5483  C CZ   . ARG A 1 17  ? -9.450  -4.020  -3.861  1.00 0.00 ? 17  ARG A CZ   4  
ATOM 5484  N NH1  . ARG A 1 17  ? -10.721 -4.359  -4.030  1.00 0.00 ? 17  ARG A NH1  4  
ATOM 5485  N NH2  . ARG A 1 17  ? -9.047  -3.536  -2.693  1.00 0.00 ? 17  ARG A NH2  4  
ATOM 5486  H H    . ARG A 1 17  ? -5.713  -5.393  -8.651  1.00 0.00 ? 17  ARG A H    4  
ATOM 5487  H HA   . ARG A 1 17  ? -7.767  -4.650  -10.620 1.00 0.00 ? 17  ARG A HA   4  
ATOM 5488  H HB2  . ARG A 1 17  ? -8.830  -3.355  -8.648  1.00 0.00 ? 17  ARG A HB2  4  
ATOM 5489  H HB3  . ARG A 1 17  ? -9.109  -5.087  -8.767  1.00 0.00 ? 17  ARG A HB3  4  
ATOM 5490  H HG2  . ARG A 1 17  ? -7.190  -5.388  -7.161  1.00 0.00 ? 17  ARG A HG2  4  
ATOM 5491  H HG3  . ARG A 1 17  ? -7.240  -3.642  -6.914  1.00 0.00 ? 17  ARG A HG3  4  
ATOM 5492  H HD2  . ARG A 1 17  ? -9.817  -4.166  -6.530  1.00 0.00 ? 17  ARG A HD2  4  
ATOM 5493  H HD3  . ARG A 1 17  ? -9.164  -5.742  -6.081  1.00 0.00 ? 17  ARG A HD3  4  
ATOM 5494  H HE   . ARG A 1 17  ? -7.649  -3.908  -4.710  1.00 0.00 ? 17  ARG A HE   4  
ATOM 5495  H HH11 . ARG A 1 17  ? -11.027 -4.725  -4.908  1.00 0.00 ? 17  ARG A HH11 4  
ATOM 5496  H HH12 . ARG A 1 17  ? -11.372 -4.250  -3.278  1.00 0.00 ? 17  ARG A HH12 4  
ATOM 5497  H HH21 . ARG A 1 17  ? -8.089  -3.280  -2.562  1.00 0.00 ? 17  ARG A HH21 4  
ATOM 5498  H HH22 . ARG A 1 17  ? -9.700  -3.428  -1.945  1.00 0.00 ? 17  ARG A HH22 4  
ATOM 5499  N N    . ILE A 1 18  ? -6.617  -2.500  -10.988 1.00 0.00 ? 18  ILE A N    4  
ATOM 5500  C CA   . ILE A 1 18  ? -5.956  -1.225  -11.238 1.00 0.00 ? 18  ILE A CA   4  
ATOM 5501  C C    . ILE A 1 18  ? -6.849  -0.055  -10.836 1.00 0.00 ? 18  ILE A C    4  
ATOM 5502  O O    . ILE A 1 18  ? -8.020  0.004   -11.211 1.00 0.00 ? 18  ILE A O    4  
ATOM 5503  C CB   . ILE A 1 18  ? -5.567  -1.073  -12.720 1.00 0.00 ? 18  ILE A CB   4  
ATOM 5504  C CG1  . ILE A 1 18  ? -4.336  -1.926  -13.036 1.00 0.00 ? 18  ILE A CG1  4  
ATOM 5505  C CG2  . ILE A 1 18  ? -5.304  0.389   -13.052 1.00 0.00 ? 18  ILE A CG2  4  
ATOM 5506  C CD1  . ILE A 1 18  ? -3.949  -1.909  -14.498 1.00 0.00 ? 18  ILE A CD1  4  
ATOM 5507  H H    . ILE A 1 18  ? -7.121  -2.927  -11.712 1.00 0.00 ? 18  ILE A H    4  
ATOM 5508  H HA   . ILE A 1 18  ? -5.054  -1.196  -10.644 1.00 0.00 ? 18  ILE A HA   4  
ATOM 5509  H HB   . ILE A 1 18  ? -6.395  -1.411  -13.323 1.00 0.00 ? 18  ILE A HB   4  
ATOM 5510  H HG12 . ILE A 1 18  ? -3.496  -1.560  -12.467 1.00 0.00 ? 18  ILE A HG12 4  
ATOM 5511  H HG13 . ILE A 1 18  ? -4.536  -2.950  -12.756 1.00 0.00 ? 18  ILE A HG13 4  
ATOM 5512  H HG21 . ILE A 1 18  ? -4.993  0.910   -12.158 1.00 0.00 ? 18  ILE A HG21 4  
ATOM 5513  H HG22 . ILE A 1 18  ? -4.525  0.454   -13.795 1.00 0.00 ? 18  ILE A HG22 4  
ATOM 5514  H HG23 . ILE A 1 18  ? -6.207  0.839   -13.435 1.00 0.00 ? 18  ILE A HG23 4  
ATOM 5515  H HD11 . ILE A 1 18  ? -2.933  -1.555  -14.598 1.00 0.00 ? 18  ILE A HD11 4  
ATOM 5516  H HD12 . ILE A 1 18  ? -4.022  -2.909  -14.902 1.00 0.00 ? 18  ILE A HD12 4  
ATOM 5517  H HD13 . ILE A 1 18  ? -4.613  -1.253  -15.040 1.00 0.00 ? 18  ILE A HD13 4  
ATOM 5518  N N    . VAL A 1 19  ? -6.286  0.876   -10.072 1.00 0.00 ? 19  VAL A N    4  
ATOM 5519  C CA   . VAL A 1 19  ? -7.030  2.046   -9.621  1.00 0.00 ? 19  VAL A CA   4  
ATOM 5520  C C    . VAL A 1 19  ? -6.150  3.291   -9.624  1.00 0.00 ? 19  VAL A C    4  
ATOM 5521  O O    . VAL A 1 19  ? -5.099  3.322   -8.983  1.00 0.00 ? 19  VAL A O    4  
ATOM 5522  C CB   . VAL A 1 19  ? -7.601  1.838   -8.206  1.00 0.00 ? 19  VAL A CB   4  
ATOM 5523  C CG1  . VAL A 1 19  ? -8.405  3.053   -7.770  1.00 0.00 ? 19  VAL A CG1  4  
ATOM 5524  C CG2  . VAL A 1 19  ? -8.452  0.578   -8.155  1.00 0.00 ? 19  VAL A CG2  4  
ATOM 5525  H H    . VAL A 1 19  ? -5.349  0.774   -9.805  1.00 0.00 ? 19  VAL A H    4  
ATOM 5526  H HA   . VAL A 1 19  ? -7.856  2.200   -10.301 1.00 0.00 ? 19  VAL A HA   4  
ATOM 5527  H HB   . VAL A 1 19  ? -6.775  1.716   -7.521  1.00 0.00 ? 19  VAL A HB   4  
ATOM 5528  H HG11 . VAL A 1 19  ? -9.172  3.258   -8.503  1.00 0.00 ? 19  VAL A HG11 4  
ATOM 5529  H HG12 . VAL A 1 19  ? -8.865  2.857   -6.812  1.00 0.00 ? 19  VAL A HG12 4  
ATOM 5530  H HG13 . VAL A 1 19  ? -7.750  3.908   -7.687  1.00 0.00 ? 19  VAL A HG13 4  
ATOM 5531  H HG21 . VAL A 1 19  ? -8.022  -0.174  -8.799  1.00 0.00 ? 19  VAL A HG21 4  
ATOM 5532  H HG22 . VAL A 1 19  ? -8.487  0.208   -7.142  1.00 0.00 ? 19  VAL A HG22 4  
ATOM 5533  H HG23 . VAL A 1 19  ? -9.454  0.807   -8.489  1.00 0.00 ? 19  VAL A HG23 4  
ATOM 5534  N N    . GLU A 1 20  ? -6.586  4.316   -10.349 1.00 0.00 ? 20  GLU A N    4  
ATOM 5535  C CA   . GLU A 1 20  ? -5.836  5.564   -10.435 1.00 0.00 ? 20  GLU A CA   4  
ATOM 5536  C C    . GLU A 1 20  ? -6.165  6.478   -9.258  1.00 0.00 ? 20  GLU A C    4  
ATOM 5537  O O    . GLU A 1 20  ? -7.326  6.814   -9.025  1.00 0.00 ? 20  GLU A O    4  
ATOM 5538  C CB   . GLU A 1 20  ? -6.143  6.280   -11.752 1.00 0.00 ? 20  GLU A CB   4  
ATOM 5539  C CG   . GLU A 1 20  ? -5.210  5.893   -12.887 1.00 0.00 ? 20  GLU A CG   4  
ATOM 5540  C CD   . GLU A 1 20  ? -5.888  5.944   -14.243 1.00 0.00 ? 20  GLU A CD   4  
ATOM 5541  O OE1  . GLU A 1 20  ? -6.995  6.516   -14.330 1.00 0.00 ? 20  GLU A OE1  4  
ATOM 5542  O OE2  . GLU A 1 20  ? -5.312  5.413   -15.215 1.00 0.00 ? 20  GLU A OE2  4  
ATOM 5543  H H    . GLU A 1 20  ? -7.431  4.231   -10.838 1.00 0.00 ? 20  GLU A H    4  
ATOM 5544  H HA   . GLU A 1 20  ? -4.785  5.322   -10.404 1.00 0.00 ? 20  GLU A HA   4  
ATOM 5545  H HB2  . GLU A 1 20  ? -7.155  6.045   -12.048 1.00 0.00 ? 20  GLU A HB2  4  
ATOM 5546  H HB3  . GLU A 1 20  ? -6.063  7.345   -11.596 1.00 0.00 ? 20  GLU A HB3  4  
ATOM 5547  H HG2  . GLU A 1 20  ? -4.372  6.573   -12.895 1.00 0.00 ? 20  GLU A HG2  4  
ATOM 5548  H HG3  . GLU A 1 20  ? -4.855  4.887   -12.716 1.00 0.00 ? 20  GLU A HG3  4  
ATOM 5549  N N    . ILE A 1 21  ? -5.134  6.876   -8.520  1.00 0.00 ? 21  ILE A N    4  
ATOM 5550  C CA   . ILE A 1 21  ? -5.313  7.751   -7.368  1.00 0.00 ? 21  ILE A CA   4  
ATOM 5551  C C    . ILE A 1 21  ? -4.526  9.047   -7.535  1.00 0.00 ? 21  ILE A C    4  
ATOM 5552  O O    . ILE A 1 21  ? -3.297  9.035   -7.605  1.00 0.00 ? 21  ILE A O    4  
ATOM 5553  C CB   . ILE A 1 21  ? -4.873  7.061   -6.063  1.00 0.00 ? 21  ILE A CB   4  
ATOM 5554  C CG1  . ILE A 1 21  ? -5.236  5.575   -6.099  1.00 0.00 ? 21  ILE A CG1  4  
ATOM 5555  C CG2  . ILE A 1 21  ? -5.515  7.740   -4.862  1.00 0.00 ? 21  ILE A CG2  4  
ATOM 5556  C CD1  . ILE A 1 21  ? -4.917  4.844   -4.814  1.00 0.00 ? 21  ILE A CD1  4  
ATOM 5557  H H    . ILE A 1 21  ? -4.232  6.575   -8.756  1.00 0.00 ? 21  ILE A H    4  
ATOM 5558  H HA   . ILE A 1 21  ? -6.364  7.988   -7.290  1.00 0.00 ? 21  ILE A HA   4  
ATOM 5559  H HB   . ILE A 1 21  ? -3.802  7.161   -5.973  1.00 0.00 ? 21  ILE A HB   4  
ATOM 5560  H HG12 . ILE A 1 21  ? -6.294  5.474   -6.283  1.00 0.00 ? 21  ILE A HG12 4  
ATOM 5561  H HG13 . ILE A 1 21  ? -4.689  5.098   -6.898  1.00 0.00 ? 21  ILE A HG13 4  
ATOM 5562  H HG21 . ILE A 1 21  ? -5.111  7.321   -3.953  1.00 0.00 ? 21  ILE A HG21 4  
ATOM 5563  H HG22 . ILE A 1 21  ? -5.305  8.799   -4.894  1.00 0.00 ? 21  ILE A HG22 4  
ATOM 5564  H HG23 . ILE A 1 21  ? -6.583  7.583   -4.888  1.00 0.00 ? 21  ILE A HG23 4  
ATOM 5565  H HD11 . ILE A 1 21  ? -3.981  5.210   -4.415  1.00 0.00 ? 21  ILE A HD11 4  
ATOM 5566  H HD12 . ILE A 1 21  ? -5.704  5.017   -4.095  1.00 0.00 ? 21  ILE A HD12 4  
ATOM 5567  H HD13 . ILE A 1 21  ? -4.834  3.786   -5.012  1.00 0.00 ? 21  ILE A HD13 4  
ATOM 5568  N N    . PHE A 1 22  ? -5.243  10.164  -7.596  1.00 0.00 ? 22  PHE A N    4  
ATOM 5569  C CA   . PHE A 1 22  ? -4.612  11.470  -7.753  1.00 0.00 ? 22  PHE A CA   4  
ATOM 5570  C C    . PHE A 1 22  ? -4.131  12.007  -6.409  1.00 0.00 ? 22  PHE A C    4  
ATOM 5571  O O    . PHE A 1 22  ? -4.892  12.066  -5.443  1.00 0.00 ? 22  PHE A O    4  
ATOM 5572  C CB   . PHE A 1 22  ? -5.591  12.459  -8.390  1.00 0.00 ? 22  PHE A CB   4  
ATOM 5573  C CG   . PHE A 1 22  ? -5.355  12.676  -9.857  1.00 0.00 ? 22  PHE A CG   4  
ATOM 5574  C CD1  . PHE A 1 22  ? -5.816  11.759  -10.789 1.00 0.00 ? 22  PHE A CD1  4  
ATOM 5575  C CD2  . PHE A 1 22  ? -4.673  13.795  -10.305 1.00 0.00 ? 22  PHE A CD2  4  
ATOM 5576  C CE1  . PHE A 1 22  ? -5.600  11.956  -12.140 1.00 0.00 ? 22  PHE A CE1  4  
ATOM 5577  C CE2  . PHE A 1 22  ? -4.454  13.998  -11.655 1.00 0.00 ? 22  PHE A CE2  4  
ATOM 5578  C CZ   . PHE A 1 22  ? -4.919  13.077  -12.573 1.00 0.00 ? 22  PHE A CZ   4  
ATOM 5579  H H    . PHE A 1 22  ? -6.220  10.109  -7.534  1.00 0.00 ? 22  PHE A H    4  
ATOM 5580  H HA   . PHE A 1 22  ? -3.761  11.349  -8.405  1.00 0.00 ? 22  PHE A HA   4  
ATOM 5581  H HB2  . PHE A 1 22  ? -6.597  12.088  -8.267  1.00 0.00 ? 22  PHE A HB2  4  
ATOM 5582  H HB3  . PHE A 1 22  ? -5.500  13.413  -7.893  1.00 0.00 ? 22  PHE A HB3  4  
ATOM 5583  H HD1  . PHE A 1 22  ? -6.349  10.883  -10.452 1.00 0.00 ? 22  PHE A HD1  4  
ATOM 5584  H HD2  . PHE A 1 22  ? -4.309  14.517  -9.587  1.00 0.00 ? 22  PHE A HD2  4  
ATOM 5585  H HE1  . PHE A 1 22  ? -5.964  11.235  -12.856 1.00 0.00 ? 22  PHE A HE1  4  
ATOM 5586  H HE2  . PHE A 1 22  ? -3.922  14.875  -11.990 1.00 0.00 ? 22  PHE A HE2  4  
ATOM 5587  H HZ   . PHE A 1 22  ? -4.749  13.233  -13.628 1.00 0.00 ? 22  PHE A HZ   4  
ATOM 5588  N N    . ARG A 1 23  ? -2.861  12.396  -6.354  1.00 0.00 ? 23  ARG A N    4  
ATOM 5589  C CA   . ARG A 1 23  ? -2.277  12.927  -5.129  1.00 0.00 ? 23  ARG A CA   4  
ATOM 5590  C C    . ARG A 1 23  ? -2.943  14.241  -4.733  1.00 0.00 ? 23  ARG A C    4  
ATOM 5591  O O    . ARG A 1 23  ? -3.433  14.980  -5.586  1.00 0.00 ? 23  ARG A O    4  
ATOM 5592  C CB   . ARG A 1 23  ? -0.772  13.138  -5.306  1.00 0.00 ? 23  ARG A CB   4  
ATOM 5593  C CG   . ARG A 1 23  ? -0.053  11.935  -5.894  1.00 0.00 ? 23  ARG A CG   4  
ATOM 5594  C CD   . ARG A 1 23  ? 1.372   12.280  -6.298  1.00 0.00 ? 23  ARG A CD   4  
ATOM 5595  N NE   . ARG A 1 23  ? 2.312   12.102  -5.195  1.00 0.00 ? 23  ARG A NE   4  
ATOM 5596  C CZ   . ARG A 1 23  ? 2.547   13.028  -4.272  1.00 0.00 ? 23  ARG A CZ   4  
ATOM 5597  N NH1  . ARG A 1 23  ? 1.912   14.191  -4.319  1.00 0.00 ? 23  ARG A NH1  4  
ATOM 5598  N NH2  . ARG A 1 23  ? 3.417   12.791  -3.299  1.00 0.00 ? 23  ARG A NH2  4  
ATOM 5599  H H    . ARG A 1 23  ? -2.304  12.324  -7.157  1.00 0.00 ? 23  ARG A H    4  
ATOM 5600  H HA   . ARG A 1 23  ? -2.440  12.204  -4.344  1.00 0.00 ? 23  ARG A HA   4  
ATOM 5601  H HB2  . ARG A 1 23  ? -0.613  13.981  -5.963  1.00 0.00 ? 23  ARG A HB2  4  
ATOM 5602  H HB3  . ARG A 1 23  ? -0.336  13.356  -4.343  1.00 0.00 ? 23  ARG A HB3  4  
ATOM 5603  H HG2  . ARG A 1 23  ? -0.025  11.148  -5.155  1.00 0.00 ? 23  ARG A HG2  4  
ATOM 5604  H HG3  . ARG A 1 23  ? -0.593  11.595  -6.765  1.00 0.00 ? 23  ARG A HG3  4  
ATOM 5605  H HD2  . ARG A 1 23  ? 1.665   11.639  -7.116  1.00 0.00 ? 23  ARG A HD2  4  
ATOM 5606  H HD3  . ARG A 1 23  ? 1.400   13.310  -6.621  1.00 0.00 ? 23  ARG A HD3  4  
ATOM 5607  H HE   . ARG A 1 23  ? 2.792   11.249  -5.141  1.00 0.00 ? 23  ARG A HE   4  
ATOM 5608  H HH11 . ARG A 1 23  ? 1.255   14.372  -5.051  1.00 0.00 ? 23  ARG A HH11 4  
ATOM 5609  H HH12 . ARG A 1 23  ? 2.090   14.886  -3.622  1.00 0.00 ? 23  ARG A HH12 4  
ATOM 5610  H HH21 . ARG A 1 23  ? 3.897   11.915  -3.260  1.00 0.00 ? 23  ARG A HH21 4  
ATOM 5611  H HH22 . ARG A 1 23  ? 3.593   13.489  -2.605  1.00 0.00 ? 23  ARG A HH22 4  
ATOM 5612  N N    . GLU A 1 24  ? -2.957  14.524  -3.434  1.00 0.00 ? 24  GLU A N    4  
ATOM 5613  C CA   . GLU A 1 24  ? -3.565  15.749  -2.927  1.00 0.00 ? 24  GLU A CA   4  
ATOM 5614  C C    . GLU A 1 24  ? -2.522  16.633  -2.250  1.00 0.00 ? 24  GLU A C    4  
ATOM 5615  O O    . GLU A 1 24  ? -1.524  16.157  -1.708  1.00 0.00 ? 24  GLU A O    4  
ATOM 5616  C CB   . GLU A 1 24  ? -4.686  15.417  -1.940  1.00 0.00 ? 24  GLU A CB   4  
ATOM 5617  C CG   . GLU A 1 24  ? -6.042  15.230  -2.600  1.00 0.00 ? 24  GLU A CG   4  
ATOM 5618  C CD   . GLU A 1 24  ? -6.332  16.287  -3.647  1.00 0.00 ? 24  GLU A CD   4  
ATOM 5619  O OE1  . GLU A 1 24  ? -5.934  16.091  -4.814  1.00 0.00 ? 24  GLU A OE1  4  
ATOM 5620  O OE2  . GLU A 1 24  ? -6.958  17.310  -3.299  1.00 0.00 ? 24  GLU A OE2  4  
ATOM 5621  H H    . GLU A 1 24  ? -2.550  13.895  -2.803  1.00 0.00 ? 24  GLU A H    4  
ATOM 5622  H HA   . GLU A 1 24  ? -3.983  16.284  -3.766  1.00 0.00 ? 24  GLU A HA   4  
ATOM 5623  H HB2  . GLU A 1 24  ? -4.433  14.506  -1.419  1.00 0.00 ? 24  GLU A HB2  4  
ATOM 5624  H HB3  . GLU A 1 24  ? -4.766  16.221  -1.223  1.00 0.00 ? 24  GLU A HB3  4  
ATOM 5625  H HG2  . GLU A 1 24  ? -6.066  14.260  -3.073  1.00 0.00 ? 24  GLU A HG2  4  
ATOM 5626  H HG3  . GLU A 1 24  ? -6.807  15.277  -1.839  1.00 0.00 ? 24  GLU A HG3  4  
ATOM 5627  N N    . PRO A 1 25  ? -2.756  17.954  -2.282  1.00 0.00 ? 25  PRO A N    4  
ATOM 5628  C CA   . PRO A 1 25  ? -1.848  18.933  -1.677  1.00 0.00 ? 25  PRO A CA   4  
ATOM 5629  C C    . PRO A 1 25  ? -1.859  18.869  -0.153  1.00 0.00 ? 25  PRO A C    4  
ATOM 5630  O O    . PRO A 1 25  ? -1.091  18.122  0.451   1.00 0.00 ? 25  PRO A O    4  
ATOM 5631  C CB   . PRO A 1 25  ? -2.403  20.276  -2.159  1.00 0.00 ? 25  PRO A CB   4  
ATOM 5632  C CG   . PRO A 1 25  ? -3.845  20.015  -2.431  1.00 0.00 ? 25  PRO A CG   4  
ATOM 5633  C CD   . PRO A 1 25  ? -3.924  18.592  -2.911  1.00 0.00 ? 25  PRO A CD   4  
ATOM 5634  H HA   . PRO A 1 25  ? -0.836  18.811  -2.034  1.00 0.00 ? 25  PRO A HA   4  
ATOM 5635  H HB2  . PRO A 1 25  ? -2.275  21.020  -1.386  1.00 0.00 ? 25  PRO A HB2  4  
ATOM 5636  H HB3  . PRO A 1 25  ? -1.883  20.584  -3.054  1.00 0.00 ? 25  PRO A HB3  4  
ATOM 5637  H HG2  . PRO A 1 25  ? -4.417  20.137  -1.524  1.00 0.00 ? 25  PRO A HG2  4  
ATOM 5638  H HG3  . PRO A 1 25  ? -4.202  20.688  -3.196  1.00 0.00 ? 25  PRO A HG3  4  
ATOM 5639  H HD2  . PRO A 1 25  ? -4.842  18.131  -2.576  1.00 0.00 ? 25  PRO A HD2  4  
ATOM 5640  H HD3  . PRO A 1 25  ? -3.851  18.552  -3.988  1.00 0.00 ? 25  PRO A HD3  4  
ATOM 5641  N N    . ASN A 1 26  ? -2.735  19.658  0.462   1.00 0.00 ? 26  ASN A N    4  
ATOM 5642  C CA   . ASN A 1 26  ? -2.845  19.690  1.915   1.00 0.00 ? 26  ASN A CA   4  
ATOM 5643  C C    . ASN A 1 26  ? -2.901  18.277  2.488   1.00 0.00 ? 26  ASN A C    4  
ATOM 5644  O O    . ASN A 1 26  ? -2.345  18.004  3.552   1.00 0.00 ? 26  ASN A O    4  
ATOM 5645  C CB   . ASN A 1 26  ? -4.090  20.473  2.336   1.00 0.00 ? 26  ASN A CB   4  
ATOM 5646  C CG   . ASN A 1 26  ? -4.165  21.837  1.677   1.00 0.00 ? 26  ASN A CG   4  
ATOM 5647  O OD1  . ASN A 1 26  ? -3.472  22.772  2.079   1.00 0.00 ? 26  ASN A OD1  4  
ATOM 5648  N ND2  . ASN A 1 26  ? -5.011  21.957  0.660   1.00 0.00 ? 26  ASN A ND2  4  
ATOM 5649  H H    . ASN A 1 26  ? -3.321  20.232  -0.075  1.00 0.00 ? 26  ASN A H    4  
ATOM 5650  H HA   . ASN A 1 26  ? -1.969  20.189  2.303   1.00 0.00 ? 26  ASN A HA   4  
ATOM 5651  H HB2  . ASN A 1 26  ? -4.971  19.912  2.059   1.00 0.00 ? 26  ASN A HB2  4  
ATOM 5652  H HB3  . ASN A 1 26  ? -4.077  20.611  3.407   1.00 0.00 ? 26  ASN A HB3  4  
ATOM 5653  H HD21 . ASN A 1 26  ? -5.531  21.169  0.395   1.00 0.00 ? 26  ASN A HD21 4  
ATOM 5654  H HD22 . ASN A 1 26  ? -5.079  22.827  0.216   1.00 0.00 ? 26  ASN A HD22 4  
ATOM 5655  N N    . VAL A 1 27  ? -3.576  17.382  1.775   1.00 0.00 ? 27  VAL A N    4  
ATOM 5656  C CA   . VAL A 1 27  ? -3.704  15.996  2.211   1.00 0.00 ? 27  VAL A CA   4  
ATOM 5657  C C    . VAL A 1 27  ? -2.998  15.050  1.247   1.00 0.00 ? 27  VAL A C    4  
ATOM 5658  O O    . VAL A 1 27  ? -2.938  15.304  0.044   1.00 0.00 ? 27  VAL A O    4  
ATOM 5659  C CB   . VAL A 1 27  ? -5.182  15.580  2.332   1.00 0.00 ? 27  VAL A CB   4  
ATOM 5660  C CG1  . VAL A 1 27  ? -5.857  15.603  0.969   1.00 0.00 ? 27  VAL A CG1  4  
ATOM 5661  C CG2  . VAL A 1 27  ? -5.297  14.204  2.970   1.00 0.00 ? 27  VAL A CG2  4  
ATOM 5662  H H    . VAL A 1 27  ? -3.998  17.659  0.935   1.00 0.00 ? 27  VAL A H    4  
ATOM 5663  H HA   . VAL A 1 27  ? -3.247  15.909  3.186   1.00 0.00 ? 27  VAL A HA   4  
ATOM 5664  H HB   . VAL A 1 27  ? -5.685  16.293  2.969   1.00 0.00 ? 27  VAL A HB   4  
ATOM 5665  H HG11 . VAL A 1 27  ? -5.405  14.858  0.331   1.00 0.00 ? 27  VAL A HG11 4  
ATOM 5666  H HG12 . VAL A 1 27  ? -6.909  15.389  1.084   1.00 0.00 ? 27  VAL A HG12 4  
ATOM 5667  H HG13 . VAL A 1 27  ? -5.734  16.579  0.523   1.00 0.00 ? 27  VAL A HG13 4  
ATOM 5668  H HG21 . VAL A 1 27  ? -5.186  13.444  2.211   1.00 0.00 ? 27  VAL A HG21 4  
ATOM 5669  H HG22 . VAL A 1 27  ? -4.523  14.087  3.713   1.00 0.00 ? 27  VAL A HG22 4  
ATOM 5670  H HG23 . VAL A 1 27  ? -6.265  14.104  3.439   1.00 0.00 ? 27  VAL A HG23 4  
ATOM 5671  N N    . SER A 1 28  ? -2.466  13.956  1.783   1.00 0.00 ? 28  SER A N    4  
ATOM 5672  C CA   . SER A 1 28  ? -1.761  12.971  0.971   1.00 0.00 ? 28  SER A CA   4  
ATOM 5673  C C    . SER A 1 28  ? -2.745  12.029  0.284   1.00 0.00 ? 28  SER A C    4  
ATOM 5674  O O    . SER A 1 28  ? -3.951  12.279  0.262   1.00 0.00 ? 28  SER A O    4  
ATOM 5675  C CB   . SER A 1 28  ? -0.787  12.169  1.835   1.00 0.00 ? 28  SER A CB   4  
ATOM 5676  O OG   . SER A 1 28  ? 0.344   11.760  1.085   1.00 0.00 ? 28  SER A OG   4  
ATOM 5677  H H    . SER A 1 28  ? -2.548  13.809  2.749   1.00 0.00 ? 28  SER A H    4  
ATOM 5678  H HA   . SER A 1 28  ? -1.203  13.504  0.215   1.00 0.00 ? 28  SER A HA   4  
ATOM 5679  H HB2  . SER A 1 28  ? -0.455  12.780  2.660   1.00 0.00 ? 28  SER A HB2  4  
ATOM 5680  H HB3  . SER A 1 28  ? -1.288  11.291  2.216   1.00 0.00 ? 28  SER A HB3  4  
ATOM 5681  H HG   . SER A 1 28  ? 0.958   11.297  1.658   1.00 0.00 ? 28  SER A HG   4  
ATOM 5682  N N    . LEU A 1 29  ? -2.222  10.944  -0.276  1.00 0.00 ? 29  LEU A N    4  
ATOM 5683  C CA   . LEU A 1 29  ? -3.052  9.962   -0.965  1.00 0.00 ? 29  LEU A CA   4  
ATOM 5684  C C    . LEU A 1 29  ? -4.086  9.363   -0.017  1.00 0.00 ? 29  LEU A C    4  
ATOM 5685  O O    . LEU A 1 29  ? -5.178  8.980   -0.434  1.00 0.00 ? 29  LEU A O    4  
ATOM 5686  C CB   . LEU A 1 29  ? -2.181  8.851   -1.554  1.00 0.00 ? 29  LEU A CB   4  
ATOM 5687  C CG   . LEU A 1 29  ? -1.836  8.986   -3.038  1.00 0.00 ? 29  LEU A CG   4  
ATOM 5688  C CD1  . LEU A 1 29  ? -1.234  7.692   -3.565  1.00 0.00 ? 29  LEU A CD1  4  
ATOM 5689  C CD2  . LEU A 1 29  ? -3.071  9.367   -3.841  1.00 0.00 ? 29  LEU A CD2  4  
ATOM 5690  H H    . LEU A 1 29  ? -1.254  10.799  -0.227  1.00 0.00 ? 29  LEU A H    4  
ATOM 5691  H HA   . LEU A 1 29  ? -3.568  10.468  -1.767  1.00 0.00 ? 29  LEU A HA   4  
ATOM 5692  H HB2  . LEU A 1 29  ? -1.255  8.828   -1.000  1.00 0.00 ? 29  LEU A HB2  4  
ATOM 5693  H HB3  . LEU A 1 29  ? -2.703  7.915   -1.419  1.00 0.00 ? 29  LEU A HB3  4  
ATOM 5694  H HG   . LEU A 1 29  ? -1.101  9.769   -3.161  1.00 0.00 ? 29  LEU A HG   4  
ATOM 5695  H HD11 . LEU A 1 29  ? -0.199  7.857   -3.825  1.00 0.00 ? 29  LEU A HD11 4  
ATOM 5696  H HD12 . LEU A 1 29  ? -1.779  7.372   -4.440  1.00 0.00 ? 29  LEU A HD12 4  
ATOM 5697  H HD13 . LEU A 1 29  ? -1.297  6.929   -2.803  1.00 0.00 ? 29  LEU A HD13 4  
ATOM 5698  H HD21 . LEU A 1 29  ? -2.931  9.084   -4.873  1.00 0.00 ? 29  LEU A HD21 4  
ATOM 5699  H HD22 . LEU A 1 29  ? -3.226  10.434  -3.777  1.00 0.00 ? 29  LEU A HD22 4  
ATOM 5700  H HD23 . LEU A 1 29  ? -3.933  8.854   -3.440  1.00 0.00 ? 29  LEU A HD23 4  
ATOM 5701  N N    . GLY A 1 30  ? -3.735  9.288   1.263   1.00 0.00 ? 30  GLY A N    4  
ATOM 5702  C CA   . GLY A 1 30  ? -4.644  8.737   2.251   1.00 0.00 ? 30  GLY A CA   4  
ATOM 5703  C C    . GLY A 1 30  ? -4.480  7.240   2.419   1.00 0.00 ? 30  GLY A C    4  
ATOM 5704  O O    . GLY A 1 30  ? -5.317  6.582   3.038   1.00 0.00 ? 30  GLY A O    4  
ATOM 5705  H H    . GLY A 1 30  ? -2.851  9.609   1.539   1.00 0.00 ? 30  GLY A H    4  
ATOM 5706  H HA2  . GLY A 1 30  ? -4.461  9.218   3.201   1.00 0.00 ? 30  GLY A HA2  4  
ATOM 5707  H HA3  . GLY A 1 30  ? -5.659  8.944   1.945   1.00 0.00 ? 30  GLY A HA3  4  
ATOM 5708  N N    . ILE A 1 31  ? -3.400  6.699   1.865   1.00 0.00 ? 31  ILE A N    4  
ATOM 5709  C CA   . ILE A 1 31  ? -3.130  5.269   1.956   1.00 0.00 ? 31  ILE A CA   4  
ATOM 5710  C C    . ILE A 1 31  ? -1.890  4.997   2.801   1.00 0.00 ? 31  ILE A C    4  
ATOM 5711  O O    . ILE A 1 31  ? -0.959  5.801   2.833   1.00 0.00 ? 31  ILE A O    4  
ATOM 5712  C CB   . ILE A 1 31  ? -2.936  4.643   0.563   1.00 0.00 ? 31  ILE A CB   4  
ATOM 5713  C CG1  . ILE A 1 31  ? -3.978  5.188   -0.415  1.00 0.00 ? 31  ILE A CG1  4  
ATOM 5714  C CG2  . ILE A 1 31  ? -3.022  3.126   0.647   1.00 0.00 ? 31  ILE A CG2  4  
ATOM 5715  C CD1  . ILE A 1 31  ? -3.721  4.796   -1.853  1.00 0.00 ? 31  ILE A CD1  4  
ATOM 5716  H H    . ILE A 1 31  ? -2.770  7.275   1.385   1.00 0.00 ? 31  ILE A H    4  
ATOM 5717  H HA   . ILE A 1 31  ? -3.982  4.799   2.425   1.00 0.00 ? 31  ILE A HA   4  
ATOM 5718  H HB   . ILE A 1 31  ? -1.950  4.904   0.210   1.00 0.00 ? 31  ILE A HB   4  
ATOM 5719  H HG12 . ILE A 1 31  ? -4.952  4.815   -0.139  1.00 0.00 ? 31  ILE A HG12 4  
ATOM 5720  H HG13 . ILE A 1 31  ? -3.983  6.267   -0.360  1.00 0.00 ? 31  ILE A HG13 4  
ATOM 5721  H HG21 . ILE A 1 31  ? -3.901  2.847   1.209   1.00 0.00 ? 31  ILE A HG21 4  
ATOM 5722  H HG22 . ILE A 1 31  ? -3.087  2.714   -0.349  1.00 0.00 ? 31  ILE A HG22 4  
ATOM 5723  H HG23 . ILE A 1 31  ? -2.142  2.742   1.139   1.00 0.00 ? 31  ILE A HG23 4  
ATOM 5724  H HD11 . ILE A 1 31  ? -2.754  4.319   -1.929  1.00 0.00 ? 31  ILE A HD11 4  
ATOM 5725  H HD12 . ILE A 1 31  ? -4.487  4.109   -2.182  1.00 0.00 ? 31  ILE A HD12 4  
ATOM 5726  H HD13 . ILE A 1 31  ? -3.736  5.678   -2.476  1.00 0.00 ? 31  ILE A HD13 4  
ATOM 5727  N N    . SER A 1 32  ? -1.884  3.856   3.484   1.00 0.00 ? 32  SER A N    4  
ATOM 5728  C CA   . SER A 1 32  ? -0.760  3.478   4.331   1.00 0.00 ? 32  SER A CA   4  
ATOM 5729  C C    . SER A 1 32  ? -0.333  2.039   4.056   1.00 0.00 ? 32  SER A C    4  
ATOM 5730  O O    . SER A 1 32  ? -1.020  1.300   3.350   1.00 0.00 ? 32  SER A O    4  
ATOM 5731  C CB   . SER A 1 32  ? -1.128  3.640   5.807   1.00 0.00 ? 32  SER A CB   4  
ATOM 5732  O OG   . SER A 1 32  ? -1.377  4.998   6.124   1.00 0.00 ? 32  SER A OG   4  
ATOM 5733  H H    . SER A 1 32  ? -2.657  3.256   3.417   1.00 0.00 ? 32  SER A H    4  
ATOM 5734  H HA   . SER A 1 32  ? 0.065   4.136   4.100   1.00 0.00 ? 32  SER A HA   4  
ATOM 5735  H HB2  . SER A 1 32  ? -2.017  3.064   6.018   1.00 0.00 ? 32  SER A HB2  4  
ATOM 5736  H HB3  . SER A 1 32  ? -0.313  3.282   6.420   1.00 0.00 ? 32  SER A HB3  4  
ATOM 5737  H HG   . SER A 1 32  ? -0.608  5.526   5.898   1.00 0.00 ? 32  SER A HG   4  
ATOM 5738  N N    . ILE A 1 33  ? 0.806   1.649   4.619   1.00 0.00 ? 33  ILE A N    4  
ATOM 5739  C CA   . ILE A 1 33  ? 1.324   0.299   4.436   1.00 0.00 ? 33  ILE A CA   4  
ATOM 5740  C C    . ILE A 1 33  ? 1.881   -0.258  5.743   1.00 0.00 ? 33  ILE A C    4  
ATOM 5741  O O    . ILE A 1 33  ? 2.297   0.495   6.624   1.00 0.00 ? 33  ILE A O    4  
ATOM 5742  C CB   . ILE A 1 33  ? 2.429   0.260   3.364   1.00 0.00 ? 33  ILE A CB   4  
ATOM 5743  C CG1  . ILE A 1 33  ? 3.298   1.516   3.450   1.00 0.00 ? 33  ILE A CG1  4  
ATOM 5744  C CG2  . ILE A 1 33  ? 1.816   0.128   1.977   1.00 0.00 ? 33  ILE A CG2  4  
ATOM 5745  C CD1  . ILE A 1 33  ? 4.702   1.316   2.924   1.00 0.00 ? 33  ILE A CD1  4  
ATOM 5746  H H    . ILE A 1 33  ? 1.309   2.283   5.171   1.00 0.00 ? 33  ILE A H    4  
ATOM 5747  H HA   . ILE A 1 33  ? 0.509   -0.330  4.108   1.00 0.00 ? 33  ILE A HA   4  
ATOM 5748  H HB   . ILE A 1 33  ? 3.044   -0.608  3.543   1.00 0.00 ? 33  ILE A HB   4  
ATOM 5749  H HG12 . ILE A 1 33  ? 2.839   2.305   2.877   1.00 0.00 ? 33  ILE A HG12 4  
ATOM 5750  H HG13 . ILE A 1 33  ? 3.371   1.823   4.484   1.00 0.00 ? 33  ILE A HG13 4  
ATOM 5751  H HG21 . ILE A 1 33  ? 2.575   0.306   1.230   1.00 0.00 ? 33  ILE A HG21 4  
ATOM 5752  H HG22 . ILE A 1 33  ? 1.416   -0.867  1.854   1.00 0.00 ? 33  ILE A HG22 4  
ATOM 5753  H HG23 . ILE A 1 33  ? 1.022   0.852   1.864   1.00 0.00 ? 33  ILE A HG23 4  
ATOM 5754  H HD11 . ILE A 1 33  ? 4.808   1.827   1.978   1.00 0.00 ? 33  ILE A HD11 4  
ATOM 5755  H HD12 . ILE A 1 33  ? 5.413   1.719   3.630   1.00 0.00 ? 33  ILE A HD12 4  
ATOM 5756  H HD13 . ILE A 1 33  ? 4.889   0.262   2.785   1.00 0.00 ? 33  ILE A HD13 4  
ATOM 5757  N N    . VAL A 1 34  ? 1.887   -1.582  5.860   1.00 0.00 ? 34  VAL A N    4  
ATOM 5758  C CA   . VAL A 1 34  ? 2.395   -2.241  7.058   1.00 0.00 ? 34  VAL A CA   4  
ATOM 5759  C C    . VAL A 1 34  ? 3.742   -2.903  6.791   1.00 0.00 ? 34  VAL A C    4  
ATOM 5760  O O    . VAL A 1 34  ? 4.143   -3.077  5.641   1.00 0.00 ? 34  VAL A O    4  
ATOM 5761  C CB   . VAL A 1 34  ? 1.407   -3.302  7.577   1.00 0.00 ? 34  VAL A CB   4  
ATOM 5762  C CG1  . VAL A 1 34  ? -0.026  -2.892  7.273   1.00 0.00 ? 34  VAL A CG1  4  
ATOM 5763  C CG2  . VAL A 1 34  ? 1.720   -4.662  6.971   1.00 0.00 ? 34  VAL A CG2  4  
ATOM 5764  H H    . VAL A 1 34  ? 1.542   -2.129  5.124   1.00 0.00 ? 34  VAL A H    4  
ATOM 5765  H HA   . VAL A 1 34  ? 2.520   -1.490  7.825   1.00 0.00 ? 34  VAL A HA   4  
ATOM 5766  H HB   . VAL A 1 34  ? 1.518   -3.374  8.649   1.00 0.00 ? 34  VAL A HB   4  
ATOM 5767  H HG11 . VAL A 1 34  ? -0.092  -2.545  6.252   1.00 0.00 ? 34  VAL A HG11 4  
ATOM 5768  H HG12 . VAL A 1 34  ? -0.681  -3.740  7.410   1.00 0.00 ? 34  VAL A HG12 4  
ATOM 5769  H HG13 . VAL A 1 34  ? -0.322  -2.096  7.942   1.00 0.00 ? 34  VAL A HG13 4  
ATOM 5770  H HG21 . VAL A 1 34  ? 0.968   -5.374  7.277   1.00 0.00 ? 34  VAL A HG21 4  
ATOM 5771  H HG22 . VAL A 1 34  ? 1.726   -4.583  5.894   1.00 0.00 ? 34  VAL A HG22 4  
ATOM 5772  H HG23 . VAL A 1 34  ? 2.690   -4.994  7.313   1.00 0.00 ? 34  VAL A HG23 4  
ATOM 5773  N N    . GLY A 1 35  ? 4.437   -3.272  7.863   1.00 0.00 ? 35  GLY A N    4  
ATOM 5774  C CA   . GLY A 1 35  ? 5.731   -3.912  7.723   1.00 0.00 ? 35  GLY A CA   4  
ATOM 5775  C C    . GLY A 1 35  ? 6.512   -3.389  6.534   1.00 0.00 ? 35  GLY A C    4  
ATOM 5776  O O    . GLY A 1 35  ? 6.449   -2.203  6.215   1.00 0.00 ? 35  GLY A O    4  
ATOM 5777  H H    . GLY A 1 35  ? 4.067   -3.108  8.756   1.00 0.00 ? 35  GLY A H    4  
ATOM 5778  H HA2  . GLY A 1 35  ? 6.305   -3.739  8.621   1.00 0.00 ? 35  GLY A HA2  4  
ATOM 5779  H HA3  . GLY A 1 35  ? 5.583   -4.976  7.602   1.00 0.00 ? 35  GLY A HA3  4  
ATOM 5780  N N    . GLY A 1 36  ? 7.251   -4.277  5.876   1.00 0.00 ? 36  GLY A N    4  
ATOM 5781  C CA   . GLY A 1 36  ? 8.038   -3.879  4.723   1.00 0.00 ? 36  GLY A CA   4  
ATOM 5782  C C    . GLY A 1 36  ? 9.524   -4.090  4.935   1.00 0.00 ? 36  GLY A C    4  
ATOM 5783  O O    . GLY A 1 36  ? 10.230  -4.528  4.027   1.00 0.00 ? 36  GLY A O    4  
ATOM 5784  H H    . GLY A 1 36  ? 7.263   -5.210  6.176   1.00 0.00 ? 36  GLY A H    4  
ATOM 5785  H HA2  . GLY A 1 36  ? 7.721   -4.456  3.868   1.00 0.00 ? 36  GLY A HA2  4  
ATOM 5786  H HA3  . GLY A 1 36  ? 7.860   -2.832  4.525   1.00 0.00 ? 36  GLY A HA3  4  
ATOM 5787  N N    . GLN A 1 37  ? 10.000  -3.777  6.136   1.00 0.00 ? 37  GLN A N    4  
ATOM 5788  C CA   . GLN A 1 37  ? 11.412  -3.934  6.462   1.00 0.00 ? 37  GLN A CA   4  
ATOM 5789  C C    . GLN A 1 37  ? 11.971  -5.218  5.858   1.00 0.00 ? 37  GLN A C    4  
ATOM 5790  O O    . GLN A 1 37  ? 11.244  -6.190  5.657   1.00 0.00 ? 37  GLN A O    4  
ATOM 5791  C CB   . GLN A 1 37  ? 11.610  -3.941  7.979   1.00 0.00 ? 37  GLN A CB   4  
ATOM 5792  C CG   . GLN A 1 37  ? 10.644  -3.032  8.722   1.00 0.00 ? 37  GLN A CG   4  
ATOM 5793  C CD   . GLN A 1 37  ? 9.355   -3.735  9.101   1.00 0.00 ? 37  GLN A CD   4  
ATOM 5794  O OE1  . GLN A 1 37  ? 8.667   -3.331  10.038  1.00 0.00 ? 37  GLN A OE1  4  
ATOM 5795  N NE2  . GLN A 1 37  ? 9.022   -4.795  8.373   1.00 0.00 ? 37  GLN A NE2  4  
ATOM 5796  H H    . GLN A 1 37  ? 9.387   -3.433  6.818   1.00 0.00 ? 37  GLN A H    4  
ATOM 5797  H HA   . GLN A 1 37  ? 11.944  -3.093  6.043   1.00 0.00 ? 37  GLN A HA   4  
ATOM 5798  H HB2  . GLN A 1 37  ? 11.475  -4.948  8.343   1.00 0.00 ? 37  GLN A HB2  4  
ATOM 5799  H HB3  . GLN A 1 37  ? 12.616  -3.618  8.200   1.00 0.00 ? 37  GLN A HB3  4  
ATOM 5800  H HG2  . GLN A 1 37  ? 11.122  -2.680  9.624   1.00 0.00 ? 37  GLN A HG2  4  
ATOM 5801  H HG3  . GLN A 1 37  ? 10.405  -2.189  8.090   1.00 0.00 ? 37  GLN A HG3  4  
ATOM 5802  H HE21 . GLN A 1 37  ? 9.620   -5.060  7.642   1.00 0.00 ? 37  GLN A HE21 4  
ATOM 5803  H HE22 . GLN A 1 37  ? 8.196   -5.269  8.596   1.00 0.00 ? 37  GLN A HE22 4  
ATOM 5804  N N    . THR A 1 38  ? 13.270  -5.215  5.571   1.00 0.00 ? 38  THR A N    4  
ATOM 5805  C CA   . THR A 1 38  ? 13.926  -6.379  4.990   1.00 0.00 ? 38  THR A CA   4  
ATOM 5806  C C    . THR A 1 38  ? 15.288  -6.620  5.632   1.00 0.00 ? 38  THR A C    4  
ATOM 5807  O O    . THR A 1 38  ? 15.698  -5.889  6.533   1.00 0.00 ? 38  THR A O    4  
ATOM 5808  C CB   . THR A 1 38  ? 14.110  -6.218  3.469   1.00 0.00 ? 38  THR A CB   4  
ATOM 5809  O OG1  . THR A 1 38  ? 13.049  -5.424  2.928   1.00 0.00 ? 38  THR A OG1  4  
ATOM 5810  C CG2  . THR A 1 38  ? 14.136  -7.575  2.781   1.00 0.00 ? 38  THR A CG2  4  
ATOM 5811  H H    . THR A 1 38  ? 13.797  -4.410  5.755   1.00 0.00 ? 38  THR A H    4  
ATOM 5812  H HA   . THR A 1 38  ? 13.298  -7.240  5.167   1.00 0.00 ? 38  THR A HA   4  
ATOM 5813  H HB   . THR A 1 38  ? 15.052  -5.720  3.286   1.00 0.00 ? 38  THR A HB   4  
ATOM 5814  H HG1  . THR A 1 38  ? 13.273  -5.156  2.034   1.00 0.00 ? 38  THR A HG1  4  
ATOM 5815  H HG21 . THR A 1 38  ? 15.160  -7.876  2.618   1.00 0.00 ? 38  THR A HG21 4  
ATOM 5816  H HG22 . THR A 1 38  ? 13.625  -7.507  1.832   1.00 0.00 ? 38  THR A HG22 4  
ATOM 5817  H HG23 . THR A 1 38  ? 13.641  -8.304  3.405   1.00 0.00 ? 38  THR A HG23 4  
ATOM 5818  N N    . VAL A 1 39  ? 15.985  -7.650  5.162   1.00 0.00 ? 39  VAL A N    4  
ATOM 5819  C CA   . VAL A 1 39  ? 17.301  -7.986  5.689   1.00 0.00 ? 39  VAL A CA   4  
ATOM 5820  C C    . VAL A 1 39  ? 18.212  -8.525  4.591   1.00 0.00 ? 39  VAL A C    4  
ATOM 5821  O O    . VAL A 1 39  ? 17.742  -9.086  3.601   1.00 0.00 ? 39  VAL A O    4  
ATOM 5822  C CB   . VAL A 1 39  ? 17.204  -9.030  6.818   1.00 0.00 ? 39  VAL A CB   4  
ATOM 5823  C CG1  . VAL A 1 39  ? 15.878  -8.901  7.552   1.00 0.00 ? 39  VAL A CG1  4  
ATOM 5824  C CG2  . VAL A 1 39  ? 17.380  -10.434 6.261   1.00 0.00 ? 39  VAL A CG2  4  
ATOM 5825  H H    . VAL A 1 39  ? 15.604  -8.196  4.442   1.00 0.00 ? 39  VAL A H    4  
ATOM 5826  H HA   . VAL A 1 39  ? 17.738  -7.086  6.096   1.00 0.00 ? 39  VAL A HA   4  
ATOM 5827  H HB   . VAL A 1 39  ? 18.000  -8.842  7.523   1.00 0.00 ? 39  VAL A HB   4  
ATOM 5828  H HG11 . VAL A 1 39  ? 15.736  -7.875  7.861   1.00 0.00 ? 39  VAL A HG11 4  
ATOM 5829  H HG12 . VAL A 1 39  ? 15.072  -9.194  6.894   1.00 0.00 ? 39  VAL A HG12 4  
ATOM 5830  H HG13 . VAL A 1 39  ? 15.884  -9.541  8.422   1.00 0.00 ? 39  VAL A HG13 4  
ATOM 5831  H HG21 . VAL A 1 39  ? 18.423  -10.607 6.040   1.00 0.00 ? 39  VAL A HG21 4  
ATOM 5832  H HG22 . VAL A 1 39  ? 17.042  -11.155 6.991   1.00 0.00 ? 39  VAL A HG22 4  
ATOM 5833  H HG23 . VAL A 1 39  ? 16.799  -10.539 5.356   1.00 0.00 ? 39  VAL A HG23 4  
ATOM 5834  N N    . ILE A 1 40  ? 19.516  -8.351  4.774   1.00 0.00 ? 40  ILE A N    4  
ATOM 5835  C CA   . ILE A 1 40  ? 20.493  -8.821  3.799   1.00 0.00 ? 40  ILE A CA   4  
ATOM 5836  C C    . ILE A 1 40  ? 20.719  -10.324 3.929   1.00 0.00 ? 40  ILE A C    4  
ATOM 5837  O O    . ILE A 1 40  ? 20.705  -11.053 2.937   1.00 0.00 ? 40  ILE A O    4  
ATOM 5838  C CB   . ILE A 1 40  ? 21.842  -8.095  3.959   1.00 0.00 ? 40  ILE A CB   4  
ATOM 5839  C CG1  . ILE A 1 40  ? 21.683  -6.605  3.650   1.00 0.00 ? 40  ILE A CG1  4  
ATOM 5840  C CG2  . ILE A 1 40  ? 22.891  -8.721  3.052   1.00 0.00 ? 40  ILE A CG2  4  
ATOM 5841  C CD1  . ILE A 1 40  ? 22.961  -5.813  3.818   1.00 0.00 ? 40  ILE A CD1  4  
ATOM 5842  H H    . ILE A 1 40  ? 19.829  -7.896  5.583   1.00 0.00 ? 40  ILE A H    4  
ATOM 5843  H HA   . ILE A 1 40  ? 20.107  -8.609  2.812   1.00 0.00 ? 40  ILE A HA   4  
ATOM 5844  H HB   . ILE A 1 40  ? 22.169  -8.210  4.981   1.00 0.00 ? 40  ILE A HB   4  
ATOM 5845  H HG12 . ILE A 1 40  ? 21.354  -6.488  2.629   1.00 0.00 ? 40  ILE A HG12 4  
ATOM 5846  H HG13 . ILE A 1 40  ? 20.942  -6.184  4.313   1.00 0.00 ? 40  ILE A HG13 4  
ATOM 5847  H HG21 . ILE A 1 40  ? 23.614  -9.254  3.652   1.00 0.00 ? 40  ILE A HG21 4  
ATOM 5848  H HG22 . ILE A 1 40  ? 22.413  -9.409  2.370   1.00 0.00 ? 40  ILE A HG22 4  
ATOM 5849  H HG23 . ILE A 1 40  ? 23.390  -7.946  2.490   1.00 0.00 ? 40  ILE A HG23 4  
ATOM 5850  H HD11 . ILE A 1 40  ? 22.728  -4.832  4.206   1.00 0.00 ? 40  ILE A HD11 4  
ATOM 5851  H HD12 . ILE A 1 40  ? 23.615  -6.326  4.508   1.00 0.00 ? 40  ILE A HD12 4  
ATOM 5852  H HD13 . ILE A 1 40  ? 23.453  -5.714  2.862   1.00 0.00 ? 40  ILE A HD13 4  
ATOM 5853  N N    . LYS A 1 41  ? 20.926  -10.781 5.159   1.00 0.00 ? 41  LYS A N    4  
ATOM 5854  C CA   . LYS A 1 41  ? 21.152  -12.198 5.420   1.00 0.00 ? 41  LYS A CA   4  
ATOM 5855  C C    . LYS A 1 41  ? 20.146  -13.058 4.663   1.00 0.00 ? 41  LYS A C    4  
ATOM 5856  O O    . LYS A 1 41  ? 19.026  -12.625 4.391   1.00 0.00 ? 41  LYS A O    4  
ATOM 5857  C CB   . LYS A 1 41  ? 21.056  -12.482 6.921   1.00 0.00 ? 41  LYS A CB   4  
ATOM 5858  C CG   . LYS A 1 41  ? 22.308  -12.104 7.693   1.00 0.00 ? 41  LYS A CG   4  
ATOM 5859  C CD   . LYS A 1 41  ? 23.418  -13.121 7.488   1.00 0.00 ? 41  LYS A CD   4  
ATOM 5860  C CE   . LYS A 1 41  ? 23.236  -14.334 8.387   1.00 0.00 ? 41  LYS A CE   4  
ATOM 5861  N NZ   . LYS A 1 41  ? 23.721  -14.077 9.771   1.00 0.00 ? 41  LYS A NZ   4  
ATOM 5862  H H    . LYS A 1 41  ? 20.926  -10.151 5.910   1.00 0.00 ? 41  LYS A H    4  
ATOM 5863  H HA   . LYS A 1 41  ? 22.146  -12.444 5.079   1.00 0.00 ? 41  LYS A HA   4  
ATOM 5864  H HB2  . LYS A 1 41  ? 20.225  -11.925 7.328   1.00 0.00 ? 41  LYS A HB2  4  
ATOM 5865  H HB3  . LYS A 1 41  ? 20.875  -13.538 7.064   1.00 0.00 ? 41  LYS A HB3  4  
ATOM 5866  H HG2  . LYS A 1 41  ? 22.651  -11.138 7.354   1.00 0.00 ? 41  LYS A HG2  4  
ATOM 5867  H HG3  . LYS A 1 41  ? 22.068  -12.053 8.746   1.00 0.00 ? 41  LYS A HG3  4  
ATOM 5868  H HD2  . LYS A 1 41  ? 23.411  -13.446 6.458   1.00 0.00 ? 41  LYS A HD2  4  
ATOM 5869  H HD3  . LYS A 1 41  ? 24.367  -12.655 7.714   1.00 0.00 ? 41  LYS A HD3  4  
ATOM 5870  H HE2  . LYS A 1 41  ? 22.187  -14.585 8.423   1.00 0.00 ? 41  LYS A HE2  4  
ATOM 5871  H HE3  . LYS A 1 41  ? 23.789  -15.162 7.969   1.00 0.00 ? 41  LYS A HE3  4  
ATOM 5872  H HZ1  . LYS A 1 41  ? 24.537  -13.434 9.750   1.00 0.00 ? 41  LYS A HZ1  4  
ATOM 5873  H HZ2  . LYS A 1 41  ? 24.007  -14.970 10.221  1.00 0.00 ? 41  LYS A HZ2  4  
ATOM 5874  H HZ3  . LYS A 1 41  ? 22.965  -13.643 10.339  1.00 0.00 ? 41  LYS A HZ3  4  
ATOM 5875  N N    . ARG A 1 42  ? 20.551  -14.279 4.328   1.00 0.00 ? 42  ARG A N    4  
ATOM 5876  C CA   . ARG A 1 42  ? 19.684  -15.200 3.603   1.00 0.00 ? 42  ARG A CA   4  
ATOM 5877  C C    . ARG A 1 42  ? 19.567  -16.531 4.341   1.00 0.00 ? 42  ARG A C    4  
ATOM 5878  O O    . ARG A 1 42  ? 20.391  -17.428 4.159   1.00 0.00 ? 42  ARG A O    4  
ATOM 5879  C CB   . ARG A 1 42  ? 20.220  -15.433 2.190   1.00 0.00 ? 42  ARG A CB   4  
ATOM 5880  C CG   . ARG A 1 42  ? 19.934  -14.287 1.233   1.00 0.00 ? 42  ARG A CG   4  
ATOM 5881  C CD   . ARG A 1 42  ? 18.515  -14.357 0.689   1.00 0.00 ? 42  ARG A CD   4  
ATOM 5882  N NE   . ARG A 1 42  ? 17.534  -13.872 1.657   1.00 0.00 ? 42  ARG A NE   4  
ATOM 5883  C CZ   . ARG A 1 42  ? 16.238  -14.155 1.594   1.00 0.00 ? 42  ARG A CZ   4  
ATOM 5884  N NH1  . ARG A 1 42  ? 15.769  -14.917 0.615   1.00 0.00 ? 42  ARG A NH1  4  
ATOM 5885  N NH2  . ARG A 1 42  ? 15.408  -13.677 2.511   1.00 0.00 ? 42  ARG A NH2  4  
ATOM 5886  H H    . ARG A 1 42  ? 21.455  -14.567 4.574   1.00 0.00 ? 42  ARG A H    4  
ATOM 5887  H HA   . ARG A 1 42  ? 18.704  -14.751 3.537   1.00 0.00 ? 42  ARG A HA   4  
ATOM 5888  H HB2  . ARG A 1 42  ? 21.290  -15.571 2.241   1.00 0.00 ? 42  ARG A HB2  4  
ATOM 5889  H HB3  . ARG A 1 42  ? 19.769  -16.329 1.790   1.00 0.00 ? 42  ARG A HB3  4  
ATOM 5890  H HG2  . ARG A 1 42  ? 20.061  -13.352 1.758   1.00 0.00 ? 42  ARG A HG2  4  
ATOM 5891  H HG3  . ARG A 1 42  ? 20.629  -14.337 0.408   1.00 0.00 ? 42  ARG A HG3  4  
ATOM 5892  H HD2  . ARG A 1 42  ? 18.456  -13.752 -0.203  1.00 0.00 ? 42  ARG A HD2  4  
ATOM 5893  H HD3  . ARG A 1 42  ? 18.288  -15.384 0.444   1.00 0.00 ? 42  ARG A HD3  4  
ATOM 5894  H HE   . ARG A 1 42  ? 17.859  -13.307 2.388   1.00 0.00 ? 42  ARG A HE   4  
ATOM 5895  H HH11 . ARG A 1 42  ? 16.393  -15.280 -0.077  1.00 0.00 ? 42  ARG A HH11 4  
ATOM 5896  H HH12 . ARG A 1 42  ? 14.793  -15.130 0.571   1.00 0.00 ? 42  ARG A HH12 4  
ATOM 5897  H HH21 . ARG A 1 42  ? 15.757  -13.102 3.251   1.00 0.00 ? 42  ARG A HH21 4  
ATOM 5898  H HH22 . ARG A 1 42  ? 14.432  -13.890 2.463   1.00 0.00 ? 42  ARG A HH22 4  
ATOM 5899  N N    . LEU A 1 43  ? 18.539  -16.652 5.173   1.00 0.00 ? 43  LEU A N    4  
ATOM 5900  C CA   . LEU A 1 43  ? 18.313  -17.873 5.938   1.00 0.00 ? 43  LEU A CA   4  
ATOM 5901  C C    . LEU A 1 43  ? 17.354  -18.806 5.206   1.00 0.00 ? 43  LEU A C    4  
ATOM 5902  O O    . LEU A 1 43  ? 16.943  -18.531 4.078   1.00 0.00 ? 43  LEU A O    4  
ATOM 5903  C CB   . LEU A 1 43  ? 17.757  -17.535 7.322   1.00 0.00 ? 43  LEU A CB   4  
ATOM 5904  C CG   . LEU A 1 43  ? 18.773  -17.041 8.352   1.00 0.00 ? 43  LEU A CG   4  
ATOM 5905  C CD1  . LEU A 1 43  ? 19.512  -18.213 8.978   1.00 0.00 ? 43  LEU A CD1  4  
ATOM 5906  C CD2  . LEU A 1 43  ? 19.754  -16.071 7.711   1.00 0.00 ? 43  LEU A CD2  4  
ATOM 5907  H H    . LEU A 1 43  ? 17.915  -15.903 5.275   1.00 0.00 ? 43  LEU A H    4  
ATOM 5908  H HA   . LEU A 1 43  ? 19.264  -18.371 6.054   1.00 0.00 ? 43  LEU A HA   4  
ATOM 5909  H HB2  . LEU A 1 43  ? 17.010  -16.766 7.200   1.00 0.00 ? 43  LEU A HB2  4  
ATOM 5910  H HB3  . LEU A 1 43  ? 17.291  -18.427 7.717   1.00 0.00 ? 43  LEU A HB3  4  
ATOM 5911  H HG   . LEU A 1 43  ? 18.251  -16.517 9.141   1.00 0.00 ? 43  LEU A HG   4  
ATOM 5912  H HD11 . LEU A 1 43  ? 19.397  -18.180 10.051  1.00 0.00 ? 43  LEU A HD11 4  
ATOM 5913  H HD12 . LEU A 1 43  ? 20.560  -18.154 8.726   1.00 0.00 ? 43  LEU A HD12 4  
ATOM 5914  H HD13 . LEU A 1 43  ? 19.103  -19.139 8.601   1.00 0.00 ? 43  LEU A HD13 4  
ATOM 5915  H HD21 . LEU A 1 43  ? 20.397  -16.608 7.029   1.00 0.00 ? 43  LEU A HD21 4  
ATOM 5916  H HD22 . LEU A 1 43  ? 20.353  -15.604 8.479   1.00 0.00 ? 43  LEU A HD22 4  
ATOM 5917  H HD23 . LEU A 1 43  ? 19.208  -15.312 7.169   1.00 0.00 ? 43  LEU A HD23 4  
ATOM 5918  N N    . LYS A 1 44  ? 17.000  -19.910 5.855   1.00 0.00 ? 44  LYS A N    4  
ATOM 5919  C CA   . LYS A 1 44  ? 16.086  -20.883 5.268   1.00 0.00 ? 44  LYS A CA   4  
ATOM 5920  C C    . LYS A 1 44  ? 14.635  -20.502 5.544   1.00 0.00 ? 44  LYS A C    4  
ATOM 5921  O O    . LYS A 1 44  ? 13.710  -21.177 5.093   1.00 0.00 ? 44  LYS A O    4  
ATOM 5922  C CB   . LYS A 1 44  ? 16.372  -22.280 5.822   1.00 0.00 ? 44  LYS A CB   4  
ATOM 5923  C CG   . LYS A 1 44  ? 16.087  -22.416 7.308   1.00 0.00 ? 44  LYS A CG   4  
ATOM 5924  C CD   . LYS A 1 44  ? 14.638  -22.795 7.565   1.00 0.00 ? 44  LYS A CD   4  
ATOM 5925  C CE   . LYS A 1 44  ? 14.452  -23.370 8.961   1.00 0.00 ? 44  LYS A CE   4  
ATOM 5926  N NZ   . LYS A 1 44  ? 14.574  -22.322 10.013  1.00 0.00 ? 44  LYS A NZ   4  
ATOM 5927  H H    . LYS A 1 44  ? 17.361  -20.073 6.752   1.00 0.00 ? 44  LYS A H    4  
ATOM 5928  H HA   . LYS A 1 44  ? 16.248  -20.888 4.201   1.00 0.00 ? 44  LYS A HA   4  
ATOM 5929  H HB2  . LYS A 1 44  ? 15.761  -22.996 5.292   1.00 0.00 ? 44  LYS A HB2  4  
ATOM 5930  H HB3  . LYS A 1 44  ? 17.414  -22.515 5.654   1.00 0.00 ? 44  LYS A HB3  4  
ATOM 5931  H HG2  . LYS A 1 44  ? 16.727  -23.182 7.720   1.00 0.00 ? 44  LYS A HG2  4  
ATOM 5932  H HG3  . LYS A 1 44  ? 16.294  -21.472 7.792   1.00 0.00 ? 44  LYS A HG3  4  
ATOM 5933  H HD2  . LYS A 1 44  ? 14.021  -21.915 7.465   1.00 0.00 ? 44  LYS A HD2  4  
ATOM 5934  H HD3  . LYS A 1 44  ? 14.334  -23.534 6.837   1.00 0.00 ? 44  LYS A HD3  4  
ATOM 5935  H HE2  . LYS A 1 44  ? 13.473  -23.818 9.024   1.00 0.00 ? 44  LYS A HE2  4  
ATOM 5936  H HE3  . LYS A 1 44  ? 15.205  -24.125 9.128   1.00 0.00 ? 44  LYS A HE3  4  
ATOM 5937  H HZ1  . LYS A 1 44  ? 14.757  -22.763 10.937  1.00 0.00 ? 44  LYS A HZ1  4  
ATOM 5938  H HZ2  . LYS A 1 44  ? 13.694  -21.771 10.071  1.00 0.00 ? 44  LYS A HZ2  4  
ATOM 5939  H HZ3  . LYS A 1 44  ? 15.359  -21.678 9.786   1.00 0.00 ? 44  LYS A HZ3  4  
ATOM 5940  N N    . ASN A 1 45  ? 14.444  -19.416 6.286   1.00 0.00 ? 45  ASN A N    4  
ATOM 5941  C CA   . ASN A 1 45  ? 13.105  -18.946 6.621   1.00 0.00 ? 45  ASN A CA   4  
ATOM 5942  C C    . ASN A 1 45  ? 12.495  -18.168 5.459   1.00 0.00 ? 45  ASN A C    4  
ATOM 5943  O O    . ASN A 1 45  ? 13.195  -17.774 4.527   1.00 0.00 ? 45  ASN A O    4  
ATOM 5944  C CB   . ASN A 1 45  ? 13.149  -18.065 7.872   1.00 0.00 ? 45  ASN A CB   4  
ATOM 5945  C CG   . ASN A 1 45  ? 11.774  -17.571 8.280   1.00 0.00 ? 45  ASN A CG   4  
ATOM 5946  O OD1  . ASN A 1 45  ? 11.455  -16.392 8.122   1.00 0.00 ? 45  ASN A OD1  4  
ATOM 5947  N ND2  . ASN A 1 45  ? 10.954  -18.472 8.807   1.00 0.00 ? 45  ASN A ND2  4  
ATOM 5948  H H    . ASN A 1 45  ? 15.221  -18.920 6.617   1.00 0.00 ? 45  ASN A H    4  
ATOM 5949  H HA   . ASN A 1 45  ? 12.490  -19.810 6.822   1.00 0.00 ? 45  ASN A HA   4  
ATOM 5950  H HB2  . ASN A 1 45  ? 13.563  -18.635 8.691   1.00 0.00 ? 45  ASN A HB2  4  
ATOM 5951  H HB3  . ASN A 1 45  ? 13.778  -17.209 7.681   1.00 0.00 ? 45  ASN A HB3  4  
ATOM 5952  H HD21 . ASN A 1 45  ? 11.277  -19.392 8.903   1.00 0.00 ? 45  ASN A HD21 4  
ATOM 5953  H HD22 . ASN A 1 45  ? 10.059  -18.179 9.079   1.00 0.00 ? 45  ASN A HD22 4  
ATOM 5954  N N    . GLY A 1 46  ? 11.185  -17.949 5.523   1.00 0.00 ? 46  GLY A N    4  
ATOM 5955  C CA   . GLY A 1 46  ? 10.503  -17.219 4.470   1.00 0.00 ? 46  GLY A CA   4  
ATOM 5956  C C    . GLY A 1 46  ? 9.234   -17.910 4.013   1.00 0.00 ? 46  GLY A C    4  
ATOM 5957  O O    . GLY A 1 46  ? 9.197   -18.504 2.936   1.00 0.00 ? 46  GLY A O    4  
ATOM 5958  H H    . GLY A 1 46  ? 10.677  -18.287 6.290   1.00 0.00 ? 46  GLY A H    4  
ATOM 5959  H HA2  . GLY A 1 46  ? 10.252  -16.234 4.835   1.00 0.00 ? 46  GLY A HA2  4  
ATOM 5960  H HA3  . GLY A 1 46  ? 11.169  -17.120 3.626   1.00 0.00 ? 46  GLY A HA3  4  
ATOM 5961  N N    . GLU A 1 47  ? 8.191   -17.834 4.835   1.00 0.00 ? 47  GLU A N    4  
ATOM 5962  C CA   . GLU A 1 47  ? 6.915   -18.461 4.509   1.00 0.00 ? 47  GLU A CA   4  
ATOM 5963  C C    . GLU A 1 47  ? 5.761   -17.485 4.719   1.00 0.00 ? 47  GLU A C    4  
ATOM 5964  O O    . GLU A 1 47  ? 4.605   -17.809 4.450   1.00 0.00 ? 47  GLU A O    4  
ATOM 5965  C CB   . GLU A 1 47  ? 6.703   -19.711 5.365   1.00 0.00 ? 47  GLU A CB   4  
ATOM 5966  C CG   . GLU A 1 47  ? 6.437   -19.408 6.830   1.00 0.00 ? 47  GLU A CG   4  
ATOM 5967  C CD   . GLU A 1 47  ? 6.035   -20.640 7.617   1.00 0.00 ? 47  GLU A CD   4  
ATOM 5968  O OE1  . GLU A 1 47  ? 6.490   -21.747 7.258   1.00 0.00 ? 47  GLU A OE1  4  
ATOM 5969  O OE2  . GLU A 1 47  ? 5.266   -20.498 8.590   1.00 0.00 ? 47  GLU A OE2  4  
ATOM 5970  H H    . GLU A 1 47  ? 8.283   -17.346 5.680   1.00 0.00 ? 47  GLU A H    4  
ATOM 5971  H HA   . GLU A 1 47  ? 6.943   -18.748 3.469   1.00 0.00 ? 47  GLU A HA   4  
ATOM 5972  H HB2  . GLU A 1 47  ? 5.860   -20.261 4.974   1.00 0.00 ? 47  GLU A HB2  4  
ATOM 5973  H HB3  . GLU A 1 47  ? 7.585   -20.330 5.301   1.00 0.00 ? 47  GLU A HB3  4  
ATOM 5974  H HG2  . GLU A 1 47  ? 7.335   -18.998 7.268   1.00 0.00 ? 47  GLU A HG2  4  
ATOM 5975  H HG3  . GLU A 1 47  ? 5.641   -18.681 6.896   1.00 0.00 ? 47  GLU A HG3  4  
ATOM 5976  N N    . GLU A 1 48  ? 6.085   -16.289 5.201   1.00 0.00 ? 48  GLU A N    4  
ATOM 5977  C CA   . GLU A 1 48  ? 5.075   -15.267 5.448   1.00 0.00 ? 48  GLU A CA   4  
ATOM 5978  C C    . GLU A 1 48  ? 5.024   -14.263 4.300   1.00 0.00 ? 48  GLU A C    4  
ATOM 5979  O O    . GLU A 1 48  ? 5.808   -14.345 3.353   1.00 0.00 ? 48  GLU A O    4  
ATOM 5980  C CB   . GLU A 1 48  ? 5.364   -14.540 6.763   1.00 0.00 ? 48  GLU A CB   4  
ATOM 5981  C CG   . GLU A 1 48  ? 5.016   -15.354 7.998   1.00 0.00 ? 48  GLU A CG   4  
ATOM 5982  C CD   . GLU A 1 48  ? 5.483   -14.694 9.281   1.00 0.00 ? 48  GLU A CD   4  
ATOM 5983  O OE1  . GLU A 1 48  ? 6.648   -14.246 9.328   1.00 0.00 ? 48  GLU A OE1  4  
ATOM 5984  O OE2  . GLU A 1 48  ? 4.684   -14.626 10.238  1.00 0.00 ? 48  GLU A OE2  4  
ATOM 5985  H H    . GLU A 1 48  ? 7.024   -16.090 5.396   1.00 0.00 ? 48  GLU A H    4  
ATOM 5986  H HA   . GLU A 1 48  ? 4.117   -15.759 5.523   1.00 0.00 ? 48  GLU A HA   4  
ATOM 5987  H HB2  . GLU A 1 48  ? 6.415   -14.295 6.801   1.00 0.00 ? 48  GLU A HB2  4  
ATOM 5988  H HB3  . GLU A 1 48  ? 4.790   -13.625 6.788   1.00 0.00 ? 48  GLU A HB3  4  
ATOM 5989  H HG2  . GLU A 1 48  ? 3.945   -15.476 8.043   1.00 0.00 ? 48  GLU A HG2  4  
ATOM 5990  H HG3  . GLU A 1 48  ? 5.485   -16.323 7.918   1.00 0.00 ? 48  GLU A HG3  4  
ATOM 5991  N N    . LEU A 1 49  ? 4.095   -13.318 4.389   1.00 0.00 ? 49  LEU A N    4  
ATOM 5992  C CA   . LEU A 1 49  ? 3.940   -12.297 3.358   1.00 0.00 ? 49  LEU A CA   4  
ATOM 5993  C C    . LEU A 1 49  ? 5.031   -11.237 3.473   1.00 0.00 ? 49  LEU A C    4  
ATOM 5994  O O    . LEU A 1 49  ? 5.030   -10.428 4.401   1.00 0.00 ? 49  LEU A O    4  
ATOM 5995  C CB   . LEU A 1 49  ? 2.562   -11.642 3.464   1.00 0.00 ? 49  LEU A CB   4  
ATOM 5996  C CG   . LEU A 1 49  ? 1.379   -12.487 2.993   1.00 0.00 ? 49  LEU A CG   4  
ATOM 5997  C CD1  . LEU A 1 49  ? 1.555   -12.886 1.536   1.00 0.00 ? 49  LEU A CD1  4  
ATOM 5998  C CD2  . LEU A 1 49  ? 1.221   -13.720 3.870   1.00 0.00 ? 49  LEU A CD2  4  
ATOM 5999  H H    . LEU A 1 49  ? 3.499   -13.304 5.167   1.00 0.00 ? 49  LEU A H    4  
ATOM 6000  H HA   . LEU A 1 49  ? 4.026   -12.782 2.397   1.00 0.00 ? 49  LEU A HA   4  
ATOM 6001  H HB2  . LEU A 1 49  ? 2.396   -11.389 4.500   1.00 0.00 ? 49  LEU A HB2  4  
ATOM 6002  H HB3  . LEU A 1 49  ? 2.581   -10.737 2.873   1.00 0.00 ? 49  LEU A HB3  4  
ATOM 6003  H HG   . LEU A 1 49  ? 0.473   -11.902 3.071   1.00 0.00 ? 49  LEU A HG   4  
ATOM 6004  H HD11 . LEU A 1 49  ? 1.661   -13.958 1.466   1.00 0.00 ? 49  LEU A HD11 4  
ATOM 6005  H HD12 . LEU A 1 49  ? 2.438   -12.410 1.136   1.00 0.00 ? 49  LEU A HD12 4  
ATOM 6006  H HD13 . LEU A 1 49  ? 0.690   -12.572 0.970   1.00 0.00 ? 49  LEU A HD13 4  
ATOM 6007  H HD21 . LEU A 1 49  ? 1.855   -14.511 3.497   1.00 0.00 ? 49  LEU A HD21 4  
ATOM 6008  H HD22 . LEU A 1 49  ? 0.191   -14.045 3.851   1.00 0.00 ? 49  LEU A HD22 4  
ATOM 6009  H HD23 . LEU A 1 49  ? 1.504   -13.479 4.884   1.00 0.00 ? 49  LEU A HD23 4  
ATOM 6010  N N    . LYS A 1 50  ? 5.959   -11.245 2.522   1.00 0.00 ? 50  LYS A N    4  
ATOM 6011  C CA   . LYS A 1 50  ? 7.054   -10.283 2.513   1.00 0.00 ? 50  LYS A CA   4  
ATOM 6012  C C    . LYS A 1 50  ? 6.682   -9.042  1.707   1.00 0.00 ? 50  LYS A C    4  
ATOM 6013  O O    . LYS A 1 50  ? 7.292   -7.985  1.860   1.00 0.00 ? 50  LYS A O    4  
ATOM 6014  C CB   . LYS A 1 50  ? 8.318   -10.922 1.932   1.00 0.00 ? 50  LYS A CB   4  
ATOM 6015  C CG   . LYS A 1 50  ? 8.339   -10.955 0.414   1.00 0.00 ? 50  LYS A CG   4  
ATOM 6016  C CD   . LYS A 1 50  ? 8.989   -9.708  -0.163  1.00 0.00 ? 50  LYS A CD   4  
ATOM 6017  C CE   . LYS A 1 50  ? 10.484  -9.901  -0.362  1.00 0.00 ? 50  LYS A CE   4  
ATOM 6018  N NZ   . LYS A 1 50  ? 10.814  -10.268 -1.767  1.00 0.00 ? 50  LYS A NZ   4  
ATOM 6019  H H    . LYS A 1 50  ? 5.906   -11.915 1.808   1.00 0.00 ? 50  LYS A H    4  
ATOM 6020  H HA   . LYS A 1 50  ? 7.247   -9.989  3.534   1.00 0.00 ? 50  LYS A HA   4  
ATOM 6021  H HB2  . LYS A 1 50  ? 9.178   -10.363 2.271   1.00 0.00 ? 50  LYS A HB2  4  
ATOM 6022  H HB3  . LYS A 1 50  ? 8.392   -11.937 2.294   1.00 0.00 ? 50  LYS A HB3  4  
ATOM 6023  H HG2  . LYS A 1 50  ? 8.896   -11.821 0.089   1.00 0.00 ? 50  LYS A HG2  4  
ATOM 6024  H HG3  . LYS A 1 50  ? 7.323   -11.021 0.050   1.00 0.00 ? 50  LYS A HG3  4  
ATOM 6025  H HD2  . LYS A 1 50  ? 8.536   -9.485  -1.117  1.00 0.00 ? 50  LYS A HD2  4  
ATOM 6026  H HD3  . LYS A 1 50  ? 8.828   -8.883  0.516   1.00 0.00 ? 50  LYS A HD3  4  
ATOM 6027  H HE2  . LYS A 1 50  ? 10.989  -8.980  -0.112  1.00 0.00 ? 50  LYS A HE2  4  
ATOM 6028  H HE3  . LYS A 1 50  ? 10.823  -10.687 0.296   1.00 0.00 ? 50  LYS A HE3  4  
ATOM 6029  H HZ1  . LYS A 1 50  ? 11.037  -11.282 -1.829  1.00 0.00 ? 50  LYS A HZ1  4  
ATOM 6030  H HZ2  . LYS A 1 50  ? 11.635  -9.721  -2.096  1.00 0.00 ? 50  LYS A HZ2  4  
ATOM 6031  H HZ3  . LYS A 1 50  ? 10.005  -10.064 -2.389  1.00 0.00 ? 50  LYS A HZ3  4  
ATOM 6032  N N    . GLY A 1 51  ? 5.676   -9.180  0.849   1.00 0.00 ? 51  GLY A N    4  
ATOM 6033  C CA   . GLY A 1 51  ? 5.239   -8.062  0.033   1.00 0.00 ? 51  GLY A CA   4  
ATOM 6034  C C    . GLY A 1 51  ? 4.641   -6.940  0.858   1.00 0.00 ? 51  GLY A C    4  
ATOM 6035  O O    . GLY A 1 51  ? 4.547   -7.043  2.081   1.00 0.00 ? 51  GLY A O    4  
ATOM 6036  H H    . GLY A 1 51  ? 5.226   -10.047 0.769   1.00 0.00 ? 51  GLY A H    4  
ATOM 6037  H HA2  . GLY A 1 51  ? 6.086   -7.679  -0.517  1.00 0.00 ? 51  GLY A HA2  4  
ATOM 6038  H HA3  . GLY A 1 51  ? 4.496   -8.412  -0.669  1.00 0.00 ? 51  GLY A HA3  4  
ATOM 6039  N N    . ILE A 1 52  ? 4.238   -5.865  0.189   1.00 0.00 ? 52  ILE A N    4  
ATOM 6040  C CA   . ILE A 1 52  ? 3.648   -4.720  0.869   1.00 0.00 ? 52  ILE A CA   4  
ATOM 6041  C C    . ILE A 1 52  ? 2.129   -4.842  0.935   1.00 0.00 ? 52  ILE A C    4  
ATOM 6042  O O    . ILE A 1 52  ? 1.489   -5.278  -0.022  1.00 0.00 ? 52  ILE A O    4  
ATOM 6043  C CB   . ILE A 1 52  ? 4.015   -3.398  0.168   1.00 0.00 ? 52  ILE A CB   4  
ATOM 6044  C CG1  . ILE A 1 52  ? 5.524   -3.326  -0.074  1.00 0.00 ? 52  ILE A CG1  4  
ATOM 6045  C CG2  . ILE A 1 52  ? 3.549   -2.211  0.999   1.00 0.00 ? 52  ILE A CG2  4  
ATOM 6046  C CD1  . ILE A 1 52  ? 6.349   -3.636  1.155   1.00 0.00 ? 52  ILE A CD1  4  
ATOM 6047  H H    . ILE A 1 52  ? 4.340   -5.843  -0.785  1.00 0.00 ? 52  ILE A H    4  
ATOM 6048  H HA   . ILE A 1 52  ? 4.040   -4.691  1.876   1.00 0.00 ? 52  ILE A HA   4  
ATOM 6049  H HB   . ILE A 1 52  ? 3.502   -3.365  -0.781  1.00 0.00 ? 52  ILE A HB   4  
ATOM 6050  H HG12 . ILE A 1 52  ? 5.793   -4.036  -0.841  1.00 0.00 ? 52  ILE A HG12 4  
ATOM 6051  H HG13 . ILE A 1 52  ? 5.780   -2.330  -0.406  1.00 0.00 ? 52  ILE A HG13 4  
ATOM 6052  H HG21 . ILE A 1 52  ? 4.305   -1.966  1.731   1.00 0.00 ? 52  ILE A HG21 4  
ATOM 6053  H HG22 . ILE A 1 52  ? 3.387   -1.362  0.353   1.00 0.00 ? 52  ILE A HG22 4  
ATOM 6054  H HG23 . ILE A 1 52  ? 2.628   -2.463  1.502   1.00 0.00 ? 52  ILE A HG23 4  
ATOM 6055  H HD11 . ILE A 1 52  ? 7.167   -2.933  1.225   1.00 0.00 ? 52  ILE A HD11 4  
ATOM 6056  H HD12 . ILE A 1 52  ? 5.729   -3.553  2.035   1.00 0.00 ? 52  ILE A HD12 4  
ATOM 6057  H HD13 . ILE A 1 52  ? 6.742   -4.638  1.083   1.00 0.00 ? 52  ILE A HD13 4  
ATOM 6058  N N    . PHE A 1 53  ? 1.558   -4.454  2.070   1.00 0.00 ? 53  PHE A N    4  
ATOM 6059  C CA   . PHE A 1 53  ? 0.114   -4.519  2.261   1.00 0.00 ? 53  PHE A CA   4  
ATOM 6060  C C    . PHE A 1 53  ? -0.425  -3.194  2.790   1.00 0.00 ? 53  PHE A C    4  
ATOM 6061  O O    . PHE A 1 53  ? 0.265   -2.475  3.514   1.00 0.00 ? 53  PHE A O    4  
ATOM 6062  C CB   . PHE A 1 53  ? -0.243  -5.650  3.228   1.00 0.00 ? 53  PHE A CB   4  
ATOM 6063  C CG   . PHE A 1 53  ? 0.086   -7.017  2.699   1.00 0.00 ? 53  PHE A CG   4  
ATOM 6064  C CD1  . PHE A 1 53  ? 1.404   -7.412  2.534   1.00 0.00 ? 53  PHE A CD1  4  
ATOM 6065  C CD2  . PHE A 1 53  ? -0.923  -7.908  2.368   1.00 0.00 ? 53  PHE A CD2  4  
ATOM 6066  C CE1  . PHE A 1 53  ? 1.709   -8.669  2.047   1.00 0.00 ? 53  PHE A CE1  4  
ATOM 6067  C CE2  . PHE A 1 53  ? -0.623  -9.166  1.881   1.00 0.00 ? 53  PHE A CE2  4  
ATOM 6068  C CZ   . PHE A 1 53  ? 0.694   -9.547  1.721   1.00 0.00 ? 53  PHE A CZ   4  
ATOM 6069  H H    . PHE A 1 53  ? 2.122   -4.116  2.798   1.00 0.00 ? 53  PHE A H    4  
ATOM 6070  H HA   . PHE A 1 53  ? -0.337  -4.721  1.302   1.00 0.00 ? 53  PHE A HA   4  
ATOM 6071  H HB2  . PHE A 1 53  ? 0.302   -5.512  4.150   1.00 0.00 ? 53  PHE A HB2  4  
ATOM 6072  H HB3  . PHE A 1 53  ? -1.303  -5.618  3.432   1.00 0.00 ? 53  PHE A HB3  4  
ATOM 6073  H HD1  . PHE A 1 53  ? 2.198   -6.726  2.789   1.00 0.00 ? 53  PHE A HD1  4  
ATOM 6074  H HD2  . PHE A 1 53  ? -1.954  -7.610  2.493   1.00 0.00 ? 53  PHE A HD2  4  
ATOM 6075  H HE1  . PHE A 1 53  ? 2.740   -8.964  1.923   1.00 0.00 ? 53  PHE A HE1  4  
ATOM 6076  H HE2  . PHE A 1 53  ? -1.420  -9.850  1.628   1.00 0.00 ? 53  PHE A HE2  4  
ATOM 6077  H HZ   . PHE A 1 53  ? 0.930   -10.530 1.340   1.00 0.00 ? 53  PHE A HZ   4  
ATOM 6078  N N    . ILE A 1 54  ? -1.662  -2.876  2.423   1.00 0.00 ? 54  ILE A N    4  
ATOM 6079  C CA   . ILE A 1 54  ? -2.294  -1.638  2.860   1.00 0.00 ? 54  ILE A CA   4  
ATOM 6080  C C    . ILE A 1 54  ? -2.510  -1.634  4.370   1.00 0.00 ? 54  ILE A C    4  
ATOM 6081  O O    . ILE A 1 54  ? -3.208  -2.491  4.911   1.00 0.00 ? 54  ILE A O    4  
ATOM 6082  C CB   . ILE A 1 54  ? -3.648  -1.419  2.159   1.00 0.00 ? 54  ILE A CB   4  
ATOM 6083  C CG1  . ILE A 1 54  ? -3.494  -1.572  0.645   1.00 0.00 ? 54  ILE A CG1  4  
ATOM 6084  C CG2  . ILE A 1 54  ? -4.207  -0.047  2.504   1.00 0.00 ? 54  ILE A CG2  4  
ATOM 6085  C CD1  . ILE A 1 54  ? -4.745  -1.219  -0.129  1.00 0.00 ? 54  ILE A CD1  4  
ATOM 6086  H H    . ILE A 1 54  ? -2.161  -3.489  1.845   1.00 0.00 ? 54  ILE A H    4  
ATOM 6087  H HA   . ILE A 1 54  ? -1.639  -0.819  2.599   1.00 0.00 ? 54  ILE A HA   4  
ATOM 6088  H HB   . ILE A 1 54  ? -4.340  -2.164  2.521   1.00 0.00 ? 54  ILE A HB   4  
ATOM 6089  H HG12 . ILE A 1 54  ? -2.700  -0.927  0.303   1.00 0.00 ? 54  ILE A HG12 4  
ATOM 6090  H HG13 . ILE A 1 54  ? -3.241  -2.598  0.418   1.00 0.00 ? 54  ILE A HG13 4  
ATOM 6091  H HG21 . ILE A 1 54  ? -3.762  0.302   3.424   1.00 0.00 ? 54  ILE A HG21 4  
ATOM 6092  H HG22 . ILE A 1 54  ? -3.976  0.646   1.709   1.00 0.00 ? 54  ILE A HG22 4  
ATOM 6093  H HG23 . ILE A 1 54  ? -5.278  -0.114  2.625   1.00 0.00 ? 54  ILE A HG23 4  
ATOM 6094  H HD11 . ILE A 1 54  ? -5.602  -1.277  0.527   1.00 0.00 ? 54  ILE A HD11 4  
ATOM 6095  H HD12 . ILE A 1 54  ? -4.657  -0.214  -0.516  1.00 0.00 ? 54  ILE A HD12 4  
ATOM 6096  H HD13 . ILE A 1 54  ? -4.870  -1.911  -0.947  1.00 0.00 ? 54  ILE A HD13 4  
ATOM 6097  N N    . LYS A 1 55  ? -1.906  -0.662  5.046   1.00 0.00 ? 55  LYS A N    4  
ATOM 6098  C CA   . LYS A 1 55  ? -2.033  -0.543  6.493   1.00 0.00 ? 55  LYS A CA   4  
ATOM 6099  C C    . LYS A 1 55  ? -3.375  0.075   6.872   1.00 0.00 ? 55  LYS A C    4  
ATOM 6100  O O    . LYS A 1 55  ? -4.092  -0.453  7.722   1.00 0.00 ? 55  LYS A O    4  
ATOM 6101  C CB   . LYS A 1 55  ? -0.891  0.306   7.058   1.00 0.00 ? 55  LYS A CB   4  
ATOM 6102  C CG   . LYS A 1 55  ? -1.185  0.885   8.431   1.00 0.00 ? 55  LYS A CG   4  
ATOM 6103  C CD   . LYS A 1 55  ? -1.625  -0.193  9.408   1.00 0.00 ? 55  LYS A CD   4  
ATOM 6104  C CE   . LYS A 1 55  ? -2.475  0.385   10.529  1.00 0.00 ? 55  LYS A CE   4  
ATOM 6105  N NZ   . LYS A 1 55  ? -3.012  -0.679  11.423  1.00 0.00 ? 55  LYS A NZ   4  
ATOM 6106  H H    . LYS A 1 55  ? -1.362  -0.008  4.558   1.00 0.00 ? 55  LYS A H    4  
ATOM 6107  H HA   . LYS A 1 55  ? -1.975  -1.535  6.914   1.00 0.00 ? 55  LYS A HA   4  
ATOM 6108  H HB2  . LYS A 1 55  ? -0.005  -0.307  7.131   1.00 0.00 ? 55  LYS A HB2  4  
ATOM 6109  H HB3  . LYS A 1 55  ? -0.697  1.124   6.379   1.00 0.00 ? 55  LYS A HB3  4  
ATOM 6110  H HG2  . LYS A 1 55  ? -0.292  1.358   8.811   1.00 0.00 ? 55  LYS A HG2  4  
ATOM 6111  H HG3  . LYS A 1 55  ? -1.973  1.619   8.340   1.00 0.00 ? 55  LYS A HG3  4  
ATOM 6112  H HD2  . LYS A 1 55  ? -2.204  -0.933  8.877   1.00 0.00 ? 55  LYS A HD2  4  
ATOM 6113  H HD3  . LYS A 1 55  ? -0.748  -0.658  9.836   1.00 0.00 ? 55  LYS A HD3  4  
ATOM 6114  H HE2  . LYS A 1 55  ? -1.868  1.061   11.112  1.00 0.00 ? 55  LYS A HE2  4  
ATOM 6115  H HE3  . LYS A 1 55  ? -3.301  0.928   10.093  1.00 0.00 ? 55  LYS A HE3  4  
ATOM 6116  H HZ1  . LYS A 1 55  ? -2.678  -0.529  12.396  1.00 0.00 ? 55  LYS A HZ1  4  
ATOM 6117  H HZ2  . LYS A 1 55  ? -2.691  -1.613  11.097  1.00 0.00 ? 55  LYS A HZ2  4  
ATOM 6118  H HZ3  . LYS A 1 55  ? -4.051  -0.660  11.416  1.00 0.00 ? 55  LYS A HZ3  4  
ATOM 6119  N N    . GLN A 1 56  ? -3.707  1.193   6.236   1.00 0.00 ? 56  GLN A N    4  
ATOM 6120  C CA   . GLN A 1 56  ? -4.964  1.881   6.508   1.00 0.00 ? 56  GLN A CA   4  
ATOM 6121  C C    . GLN A 1 56  ? -5.256  2.925   5.434   1.00 0.00 ? 56  GLN A C    4  
ATOM 6122  O O    . GLN A 1 56  ? -4.340  3.497   4.844   1.00 0.00 ? 56  GLN A O    4  
ATOM 6123  C CB   . GLN A 1 56  ? -4.919  2.547   7.884   1.00 0.00 ? 56  GLN A CB   4  
ATOM 6124  C CG   . GLN A 1 56  ? -5.520  3.943   7.905   1.00 0.00 ? 56  GLN A CG   4  
ATOM 6125  C CD   . GLN A 1 56  ? -5.860  4.412   9.306   1.00 0.00 ? 56  GLN A CD   4  
ATOM 6126  O OE1  . GLN A 1 56  ? -6.061  3.602   10.212  1.00 0.00 ? 56  GLN A OE1  4  
ATOM 6127  N NE2  . GLN A 1 56  ? -5.928  5.725   9.491   1.00 0.00 ? 56  GLN A NE2  4  
ATOM 6128  H H    . GLN A 1 56  ? -3.093  1.565   5.570   1.00 0.00 ? 56  GLN A H    4  
ATOM 6129  H HA   . GLN A 1 56  ? -5.753  1.145   6.500   1.00 0.00 ? 56  GLN A HA   4  
ATOM 6130  H HB2  . GLN A 1 56  ? -5.463  1.934   8.586   1.00 0.00 ? 56  GLN A HB2  4  
ATOM 6131  H HB3  . GLN A 1 56  ? -3.889  2.618   8.203   1.00 0.00 ? 56  GLN A HB3  4  
ATOM 6132  H HG2  . GLN A 1 56  ? -4.809  4.634   7.474   1.00 0.00 ? 56  GLN A HG2  4  
ATOM 6133  H HG3  . GLN A 1 56  ? -6.422  3.941   7.312   1.00 0.00 ? 56  GLN A HG3  4  
ATOM 6134  H HE21 . GLN A 1 56  ? -5.758  6.310   8.723   1.00 0.00 ? 56  GLN A HE21 4  
ATOM 6135  H HE22 . GLN A 1 56  ? -6.147  6.055   10.387  1.00 0.00 ? 56  GLN A HE22 4  
ATOM 6136  N N    . VAL A 1 57  ? -6.539  3.168   5.186   1.00 0.00 ? 57  VAL A N    4  
ATOM 6137  C CA   . VAL A 1 57  ? -6.953  4.143   4.184   1.00 0.00 ? 57  VAL A CA   4  
ATOM 6138  C C    . VAL A 1 57  ? -8.008  5.091   4.743   1.00 0.00 ? 57  VAL A C    4  
ATOM 6139  O O    . VAL A 1 57  ? -9.032  4.656   5.271   1.00 0.00 ? 57  VAL A O    4  
ATOM 6140  C CB   . VAL A 1 57  ? -7.513  3.452   2.926   1.00 0.00 ? 57  VAL A CB   4  
ATOM 6141  C CG1  . VAL A 1 57  ? -8.388  4.412   2.135   1.00 0.00 ? 57  VAL A CG1  4  
ATOM 6142  C CG2  . VAL A 1 57  ? -6.380  2.917   2.064   1.00 0.00 ? 57  VAL A CG2  4  
ATOM 6143  H H    . VAL A 1 57  ? -7.224  2.680   5.689   1.00 0.00 ? 57  VAL A H    4  
ATOM 6144  H HA   . VAL A 1 57  ? -6.083  4.716   3.897   1.00 0.00 ? 57  VAL A HA   4  
ATOM 6145  H HB   . VAL A 1 57  ? -8.124  2.619   3.240   1.00 0.00 ? 57  VAL A HB   4  
ATOM 6146  H HG11 . VAL A 1 57  ? -7.814  5.288   1.872   1.00 0.00 ? 57  VAL A HG11 4  
ATOM 6147  H HG12 . VAL A 1 57  ? -8.737  3.925   1.236   1.00 0.00 ? 57  VAL A HG12 4  
ATOM 6148  H HG13 . VAL A 1 57  ? -9.236  4.706   2.737   1.00 0.00 ? 57  VAL A HG13 4  
ATOM 6149  H HG21 . VAL A 1 57  ? -6.783  2.262   1.306   1.00 0.00 ? 57  VAL A HG21 4  
ATOM 6150  H HG22 . VAL A 1 57  ? -5.866  3.741   1.593   1.00 0.00 ? 57  VAL A HG22 4  
ATOM 6151  H HG23 . VAL A 1 57  ? -5.686  2.366   2.682   1.00 0.00 ? 57  VAL A HG23 4  
ATOM 6152  N N    . LEU A 1 58  ? -7.752  6.389   4.622   1.00 0.00 ? 58  LEU A N    4  
ATOM 6153  C CA   . LEU A 1 58  ? -8.680  7.401   5.115   1.00 0.00 ? 58  LEU A CA   4  
ATOM 6154  C C    . LEU A 1 58  ? -9.921  7.478   4.231   1.00 0.00 ? 58  LEU A C    4  
ATOM 6155  O O    . LEU A 1 58  ? -9.992  6.828   3.188   1.00 0.00 ? 58  LEU A O    4  
ATOM 6156  C CB   . LEU A 1 58  ? -7.994  8.767   5.170   1.00 0.00 ? 58  LEU A CB   4  
ATOM 6157  C CG   . LEU A 1 58  ? -6.785  8.873   6.100   1.00 0.00 ? 58  LEU A CG   4  
ATOM 6158  C CD1  . LEU A 1 58  ? -5.647  7.998   5.598   1.00 0.00 ? 58  LEU A CD1  4  
ATOM 6159  C CD2  . LEU A 1 58  ? -6.333  10.321  6.223   1.00 0.00 ? 58  LEU A CD2  4  
ATOM 6160  H H    . LEU A 1 58  ? -6.919  6.675   4.193   1.00 0.00 ? 58  LEU A H    4  
ATOM 6161  H HA   . LEU A 1 58  ? -8.981  7.117   6.112   1.00 0.00 ? 58  LEU A HA   4  
ATOM 6162  H HB2  . LEU A 1 58  ? -7.666  9.013   4.172   1.00 0.00 ? 58  LEU A HB2  4  
ATOM 6163  H HB3  . LEU A 1 58  ? -8.728  9.491   5.495   1.00 0.00 ? 58  LEU A HB3  4  
ATOM 6164  H HG   . LEU A 1 58  ? -7.065  8.524   7.085   1.00 0.00 ? 58  LEU A HG   4  
ATOM 6165  H HD11 . LEU A 1 58  ? -4.742  8.244   6.132   1.00 0.00 ? 58  LEU A HD11 4  
ATOM 6166  H HD12 . LEU A 1 58  ? -5.500  8.169   4.542   1.00 0.00 ? 58  LEU A HD12 4  
ATOM 6167  H HD13 . LEU A 1 58  ? -5.892  6.959   5.764   1.00 0.00 ? 58  LEU A HD13 4  
ATOM 6168  H HD21 . LEU A 1 58  ? -5.600  10.404  7.012   1.00 0.00 ? 58  LEU A HD21 4  
ATOM 6169  H HD22 . LEU A 1 58  ? -7.184  10.945  6.455   1.00 0.00 ? 58  LEU A HD22 4  
ATOM 6170  H HD23 . LEU A 1 58  ? -5.895  10.642  5.289   1.00 0.00 ? 58  LEU A HD23 4  
ATOM 6171  N N    . GLU A 1 59  ? -10.895 8.277   4.655   1.00 0.00 ? 59  GLU A N    4  
ATOM 6172  C CA   . GLU A 1 59  ? -12.132 8.439   3.900   1.00 0.00 ? 59  GLU A CA   4  
ATOM 6173  C C    . GLU A 1 59  ? -12.102 9.723   3.076   1.00 0.00 ? 59  GLU A C    4  
ATOM 6174  O O    . GLU A 1 59  ? -12.486 9.732   1.906   1.00 0.00 ? 59  GLU A O    4  
ATOM 6175  C CB   . GLU A 1 59  ? -13.335 8.455   4.846   1.00 0.00 ? 59  GLU A CB   4  
ATOM 6176  C CG   . GLU A 1 59  ? -14.673 8.492   4.129   1.00 0.00 ? 59  GLU A CG   4  
ATOM 6177  C CD   . GLU A 1 59  ? -15.797 7.905   4.960   1.00 0.00 ? 59  GLU A CD   4  
ATOM 6178  O OE1  . GLU A 1 59  ? -15.668 6.741   5.394   1.00 0.00 ? 59  GLU A OE1  4  
ATOM 6179  O OE2  . GLU A 1 59  ? -16.805 8.609   5.178   1.00 0.00 ? 59  GLU A OE2  4  
ATOM 6180  H H    . GLU A 1 59  ? -10.779 8.768   5.495   1.00 0.00 ? 59  GLU A H    4  
ATOM 6181  H HA   . GLU A 1 59  ? -12.224 7.598   3.230   1.00 0.00 ? 59  GLU A HA   4  
ATOM 6182  H HB2  . GLU A 1 59  ? -13.304 7.569   5.463   1.00 0.00 ? 59  GLU A HB2  4  
ATOM 6183  H HB3  . GLU A 1 59  ? -13.266 9.326   5.481   1.00 0.00 ? 59  GLU A HB3  4  
ATOM 6184  H HG2  . GLU A 1 59  ? -14.915 9.518   3.898   1.00 0.00 ? 59  GLU A HG2  4  
ATOM 6185  H HG3  . GLU A 1 59  ? -14.591 7.927   3.212   1.00 0.00 ? 59  GLU A HG3  4  
ATOM 6186  N N    . ASP A 1 60  ? -11.645 10.806  3.696   1.00 0.00 ? 60  ASP A N    4  
ATOM 6187  C CA   . ASP A 1 60  ? -11.565 12.096  3.021   1.00 0.00 ? 60  ASP A CA   4  
ATOM 6188  C C    . ASP A 1 60  ? -10.288 12.197  2.192   1.00 0.00 ? 60  ASP A C    4  
ATOM 6189  O O    . ASP A 1 60  ? -9.657  13.252  2.132   1.00 0.00 ? 60  ASP A O    4  
ATOM 6190  C CB   . ASP A 1 60  ? -11.616 13.234  4.042   1.00 0.00 ? 60  ASP A CB   4  
ATOM 6191  C CG   . ASP A 1 60  ? -10.285 13.450  4.735   1.00 0.00 ? 60  ASP A CG   4  
ATOM 6192  O OD1  . ASP A 1 60  ? -9.675  12.452  5.173   1.00 0.00 ? 60  ASP A OD1  4  
ATOM 6193  O OD2  . ASP A 1 60  ? -9.853  14.617  4.840   1.00 0.00 ? 60  ASP A OD2  4  
ATOM 6194  H H    . ASP A 1 60  ? -11.354 10.735  4.629   1.00 0.00 ? 60  ASP A H    4  
ATOM 6195  H HA   . ASP A 1 60  ? -12.415 12.179  2.361   1.00 0.00 ? 60  ASP A HA   4  
ATOM 6196  H HB2  . ASP A 1 60  ? -11.890 14.149  3.538   1.00 0.00 ? 60  ASP A HB2  4  
ATOM 6197  H HB3  . ASP A 1 60  ? -12.359 13.003  4.791   1.00 0.00 ? 60  ASP A HB3  4  
ATOM 6198  N N    . SER A 1 61  ? -9.913  11.092  1.555   1.00 0.00 ? 61  SER A N    4  
ATOM 6199  C CA   . SER A 1 61  ? -8.709  11.055  0.733   1.00 0.00 ? 61  SER A CA   4  
ATOM 6200  C C    . SER A 1 61  ? -9.029  10.569  -0.677  1.00 0.00 ? 61  SER A C    4  
ATOM 6201  O O    . SER A 1 61  ? -10.111 10.051  -0.952  1.00 0.00 ? 61  SER A O    4  
ATOM 6202  C CB   . SER A 1 61  ? -7.658  10.145  1.373   1.00 0.00 ? 61  SER A CB   4  
ATOM 6203  O OG   . SER A 1 61  ? -7.455  8.977   0.596   1.00 0.00 ? 61  SER A OG   4  
ATOM 6204  H H    . SER A 1 61  ? -10.459 10.282  1.642   1.00 0.00 ? 61  SER A H    4  
ATOM 6205  H HA   . SER A 1 61  ? -8.316  12.059  0.675   1.00 0.00 ? 61  SER A HA   4  
ATOM 6206  H HB2  . SER A 1 61  ? -6.723  10.678  1.450   1.00 0.00 ? 61  SER A HB2  4  
ATOM 6207  H HB3  . SER A 1 61  ? -7.990  9.854   2.359   1.00 0.00 ? 61  SER A HB3  4  
ATOM 6208  H HG   . SER A 1 61  ? -7.844  8.223   1.044   1.00 0.00 ? 61  SER A HG   4  
ATOM 6209  N N    . PRO A 1 62  ? -8.065  10.740  -1.594  1.00 0.00 ? 62  PRO A N    4  
ATOM 6210  C CA   . PRO A 1 62  ? -8.218  10.326  -2.991  1.00 0.00 ? 62  PRO A CA   4  
ATOM 6211  C C    . PRO A 1 62  ? -8.234  8.809   -3.148  1.00 0.00 ? 62  PRO A C    4  
ATOM 6212  O O    . PRO A 1 62  ? -8.703  8.285   -4.158  1.00 0.00 ? 62  PRO A O    4  
ATOM 6213  C CB   . PRO A 1 62  ? -6.986  10.922  -3.676  1.00 0.00 ? 62  PRO A CB   4  
ATOM 6214  C CG   . PRO A 1 62  ? -5.975  11.051  -2.589  1.00 0.00 ? 62  PRO A CG   4  
ATOM 6215  C CD   . PRO A 1 62  ? -6.750  11.351  -1.336  1.00 0.00 ? 62  PRO A CD   4  
ATOM 6216  H HA   . PRO A 1 62  ? -9.113  10.742  -3.432  1.00 0.00 ? 62  PRO A HA   4  
ATOM 6217  H HB2  . PRO A 1 62  ? -6.646  10.255  -4.455  1.00 0.00 ? 62  PRO A HB2  4  
ATOM 6218  H HB3  . PRO A 1 62  ? -7.234  11.883  -4.100  1.00 0.00 ? 62  PRO A HB3  4  
ATOM 6219  H HG2  . PRO A 1 62  ? -5.431  10.125  -2.481  1.00 0.00 ? 62  PRO A HG2  4  
ATOM 6220  H HG3  . PRO A 1 62  ? -5.297  11.862  -2.813  1.00 0.00 ? 62  PRO A HG3  4  
ATOM 6221  H HD2  . PRO A 1 62  ? -6.274  10.896  -0.480  1.00 0.00 ? 62  PRO A HD2  4  
ATOM 6222  H HD3  . PRO A 1 62  ? -6.842  12.418  -1.195  1.00 0.00 ? 62  PRO A HD3  4  
ATOM 6223  N N    . ALA A 1 63  ? -7.719  8.110   -2.142  1.00 0.00 ? 63  ALA A N    4  
ATOM 6224  C CA   . ALA A 1 63  ? -7.676  6.653   -2.168  1.00 0.00 ? 63  ALA A CA   4  
ATOM 6225  C C    . ALA A 1 63  ? -8.902  6.056   -1.486  1.00 0.00 ? 63  ALA A C    4  
ATOM 6226  O O    . ALA A 1 63  ? -9.320  4.943   -1.803  1.00 0.00 ? 63  ALA A O    4  
ATOM 6227  C CB   . ALA A 1 63  ? -6.402  6.151   -1.504  1.00 0.00 ? 63  ALA A CB   4  
ATOM 6228  H H    . ALA A 1 63  ? -7.360  8.585   -1.364  1.00 0.00 ? 63  ALA A H    4  
ATOM 6229  H HA   . ALA A 1 63  ? -7.662  6.338   -3.202  1.00 0.00 ? 63  ALA A HA   4  
ATOM 6230  H HB1  . ALA A 1 63  ? -6.411  6.423   -0.459  1.00 0.00 ? 63  ALA A HB1  4  
ATOM 6231  H HB2  . ALA A 1 63  ? -6.349  5.076   -1.596  1.00 0.00 ? 63  ALA A HB2  4  
ATOM 6232  H HB3  . ALA A 1 63  ? -5.545  6.597   -1.986  1.00 0.00 ? 63  ALA A HB3  4  
ATOM 6233  N N    . GLY A 1 64  ? -9.473  6.803   -0.546  1.00 0.00 ? 64  GLY A N    4  
ATOM 6234  C CA   . GLY A 1 64  ? -10.645 6.330   0.167   1.00 0.00 ? 64  GLY A CA   4  
ATOM 6235  C C    . GLY A 1 64  ? -11.908 6.425   -0.666  1.00 0.00 ? 64  GLY A C    4  
ATOM 6236  O O    . GLY A 1 64  ? -12.768 5.546   -0.607  1.00 0.00 ? 64  GLY A O    4  
ATOM 6237  H H    . GLY A 1 64  ? -9.096  7.683   -0.335  1.00 0.00 ? 64  GLY A H    4  
ATOM 6238  H HA2  . GLY A 1 64  ? -10.490 5.299   0.450   1.00 0.00 ? 64  GLY A HA2  4  
ATOM 6239  H HA3  . GLY A 1 64  ? -10.773 6.922   1.061   1.00 0.00 ? 64  GLY A HA3  4  
ATOM 6240  N N    . LYS A 1 65  ? -12.023 7.496   -1.444  1.00 0.00 ? 65  LYS A N    4  
ATOM 6241  C CA   . LYS A 1 65  ? -13.190 7.704   -2.293  1.00 0.00 ? 65  LYS A CA   4  
ATOM 6242  C C    . LYS A 1 65  ? -13.282 6.624   -3.366  1.00 0.00 ? 65  LYS A C    4  
ATOM 6243  O O    . LYS A 1 65  ? -14.371 6.154   -3.697  1.00 0.00 ? 65  LYS A O    4  
ATOM 6244  C CB   . LYS A 1 65  ? -13.129 9.085   -2.949  1.00 0.00 ? 65  LYS A CB   4  
ATOM 6245  C CG   . LYS A 1 65  ? -13.260 10.233  -1.963  1.00 0.00 ? 65  LYS A CG   4  
ATOM 6246  C CD   . LYS A 1 65  ? -13.709 11.511  -2.651  1.00 0.00 ? 65  LYS A CD   4  
ATOM 6247  C CE   . LYS A 1 65  ? -13.287 12.744  -1.867  1.00 0.00 ? 65  LYS A CE   4  
ATOM 6248  N NZ   . LYS A 1 65  ? -14.002 12.845  -0.565  1.00 0.00 ? 65  LYS A NZ   4  
ATOM 6249  H H    . LYS A 1 65  ? -11.304 8.162   -1.448  1.00 0.00 ? 65  LYS A H    4  
ATOM 6250  H HA   . LYS A 1 65  ? -14.068 7.650   -1.668  1.00 0.00 ? 65  LYS A HA   4  
ATOM 6251  H HB2  . LYS A 1 65  ? -12.184 9.185   -3.462  1.00 0.00 ? 65  LYS A HB2  4  
ATOM 6252  H HB3  . LYS A 1 65  ? -13.930 9.164   -3.669  1.00 0.00 ? 65  LYS A HB3  4  
ATOM 6253  H HG2  . LYS A 1 65  ? -13.988 9.968   -1.210  1.00 0.00 ? 65  LYS A HG2  4  
ATOM 6254  H HG3  . LYS A 1 65  ? -12.301 10.405  -1.495  1.00 0.00 ? 65  LYS A HG3  4  
ATOM 6255  H HD2  . LYS A 1 65  ? -13.265 11.555  -3.635  1.00 0.00 ? 65  LYS A HD2  4  
ATOM 6256  H HD3  . LYS A 1 65  ? -14.786 11.503  -2.740  1.00 0.00 ? 65  LYS A HD3  4  
ATOM 6257  H HE2  . LYS A 1 65  ? -12.225 12.691  -1.682  1.00 0.00 ? 65  LYS A HE2  4  
ATOM 6258  H HE3  . LYS A 1 65  ? -13.505 13.622  -2.457  1.00 0.00 ? 65  LYS A HE3  4  
ATOM 6259  H HZ1  . LYS A 1 65  ? -14.958 12.446  -0.650  1.00 0.00 ? 65  LYS A HZ1  4  
ATOM 6260  H HZ2  . LYS A 1 65  ? -14.078 13.842  -0.276  1.00 0.00 ? 65  LYS A HZ2  4  
ATOM 6261  H HZ3  . LYS A 1 65  ? -13.483 12.322  0.169   1.00 0.00 ? 65  LYS A HZ3  4  
ATOM 6262  N N    . THR A 1 66  ? -12.132 6.232   -3.905  1.00 0.00 ? 66  THR A N    4  
ATOM 6263  C CA   . THR A 1 66  ? -12.083 5.207   -4.940  1.00 0.00 ? 66  THR A CA   4  
ATOM 6264  C C    . THR A 1 66  ? -12.768 3.926   -4.478  1.00 0.00 ? 66  THR A C    4  
ATOM 6265  O O    . THR A 1 66  ? -13.175 3.100   -5.294  1.00 0.00 ? 66  THR A O    4  
ATOM 6266  C CB   . THR A 1 66  ? -10.632 4.883   -5.342  1.00 0.00 ? 66  THR A CB   4  
ATOM 6267  O OG1  . THR A 1 66  ? -10.118 3.831   -4.518  1.00 0.00 ? 66  THR A OG1  4  
ATOM 6268  C CG2  . THR A 1 66  ? -9.747  6.114   -5.212  1.00 0.00 ? 66  THR A CG2  4  
ATOM 6269  H H    . THR A 1 66  ? -11.297 6.644   -3.600  1.00 0.00 ? 66  THR A H    4  
ATOM 6270  H HA   . THR A 1 66  ? -12.599 5.587   -5.810  1.00 0.00 ? 66  THR A HA   4  
ATOM 6271  H HB   . THR A 1 66  ? -10.623 4.560   -6.373  1.00 0.00 ? 66  THR A HB   4  
ATOM 6272  H HG1  . THR A 1 66  ? -10.134 4.108   -3.599  1.00 0.00 ? 66  THR A HG1  4  
ATOM 6273  H HG21 . THR A 1 66  ? -8.904  6.023   -5.880  1.00 0.00 ? 66  THR A HG21 4  
ATOM 6274  H HG22 . THR A 1 66  ? -9.392  6.196   -4.195  1.00 0.00 ? 66  THR A HG22 4  
ATOM 6275  H HG23 . THR A 1 66  ? -10.316 6.995   -5.468  1.00 0.00 ? 66  THR A HG23 4  
ATOM 6276  N N    . ASN A 1 67  ? -12.893 3.768   -3.165  1.00 0.00 ? 67  ASN A N    4  
ATOM 6277  C CA   . ASN A 1 67  ? -13.530 2.587   -2.594  1.00 0.00 ? 67  ASN A CA   4  
ATOM 6278  C C    . ASN A 1 67  ? -13.083 1.323   -3.322  1.00 0.00 ? 67  ASN A C    4  
ATOM 6279  O O    . ASN A 1 67  ? -13.784 0.312   -3.320  1.00 0.00 ? 67  ASN A O    4  
ATOM 6280  C CB   . ASN A 1 67  ? -15.053 2.718   -2.665  1.00 0.00 ? 67  ASN A CB   4  
ATOM 6281  C CG   . ASN A 1 67  ? -15.759 1.798   -1.688  1.00 0.00 ? 67  ASN A CG   4  
ATOM 6282  O OD1  . ASN A 1 67  ? -15.393 0.631   -1.543  1.00 0.00 ? 67  ASN A OD1  4  
ATOM 6283  N ND2  . ASN A 1 67  ? -16.777 2.320   -1.014  1.00 0.00 ? 67  ASN A ND2  4  
ATOM 6284  H H    . ASN A 1 67  ? -12.549 4.462   -2.564  1.00 0.00 ? 67  ASN A H    4  
ATOM 6285  H HA   . ASN A 1 67  ? -13.232 2.517   -1.559  1.00 0.00 ? 67  ASN A HA   4  
ATOM 6286  H HB2  . ASN A 1 67  ? -15.331 3.736   -2.436  1.00 0.00 ? 67  ASN A HB2  4  
ATOM 6287  H HB3  . ASN A 1 67  ? -15.383 2.475   -3.664  1.00 0.00 ? 67  ASN A HB3  4  
ATOM 6288  H HD21 . ASN A 1 67  ? -17.012 3.256   -1.182  1.00 0.00 ? 67  ASN A HD21 4  
ATOM 6289  H HD22 . ASN A 1 67  ? -17.250 1.747   -0.375  1.00 0.00 ? 67  ASN A HD22 4  
ATOM 6290  N N    . ALA A 1 68  ? -11.910 1.388   -3.944  1.00 0.00 ? 68  ALA A N    4  
ATOM 6291  C CA   . ALA A 1 68  ? -11.368 0.249   -4.673  1.00 0.00 ? 68  ALA A CA   4  
ATOM 6292  C C    . ALA A 1 68  ? -10.191 -0.372  -3.927  1.00 0.00 ? 68  ALA A C    4  
ATOM 6293  O O    . ALA A 1 68  ? -9.640  -1.388  -4.351  1.00 0.00 ? 68  ALA A O    4  
ATOM 6294  C CB   . ALA A 1 68  ? -10.944 0.671   -6.072  1.00 0.00 ? 68  ALA A CB   4  
ATOM 6295  H H    . ALA A 1 68  ? -11.397 2.222   -3.910  1.00 0.00 ? 68  ALA A H    4  
ATOM 6296  H HA   . ALA A 1 68  ? -12.151 -0.490  -4.769  1.00 0.00 ? 68  ALA A HA   4  
ATOM 6297  H HB1  . ALA A 1 68  ? -9.936  1.057   -6.042  1.00 0.00 ? 68  ALA A HB1  4  
ATOM 6298  H HB2  . ALA A 1 68  ? -10.983 -0.183  -6.733  1.00 0.00 ? 68  ALA A HB2  4  
ATOM 6299  H HB3  . ALA A 1 68  ? -11.613 1.437   -6.435  1.00 0.00 ? 68  ALA A HB3  4  
ATOM 6300  N N    . LEU A 1 69  ? -9.811  0.246   -2.814  1.00 0.00 ? 69  LEU A N    4  
ATOM 6301  C CA   . LEU A 1 69  ? -8.699  -0.245  -2.008  1.00 0.00 ? 69  LEU A CA   4  
ATOM 6302  C C    . LEU A 1 69  ? -9.041  -0.200  -0.523  1.00 0.00 ? 69  LEU A C    4  
ATOM 6303  O O    . LEU A 1 69  ? -9.683  0.738   -0.050  1.00 0.00 ? 69  LEU A O    4  
ATOM 6304  C CB   . LEU A 1 69  ? -7.442  0.583   -2.279  1.00 0.00 ? 69  LEU A CB   4  
ATOM 6305  C CG   . LEU A 1 69  ? -7.122  0.857   -3.749  1.00 0.00 ? 69  LEU A CG   4  
ATOM 6306  C CD1  . LEU A 1 69  ? -6.209  2.066   -3.881  1.00 0.00 ? 69  LEU A CD1  4  
ATOM 6307  C CD2  . LEU A 1 69  ? -6.486  -0.366  -4.394  1.00 0.00 ? 69  LEU A CD2  4  
ATOM 6308  H H    . LEU A 1 69  ? -10.288 1.052   -2.527  1.00 0.00 ? 69  LEU A H    4  
ATOM 6309  H HA   . LEU A 1 69  ? -8.512  -1.271  -2.292  1.00 0.00 ? 69  LEU A HA   4  
ATOM 6310  H HB2  . LEU A 1 69  ? -7.560  1.535   -1.784  1.00 0.00 ? 69  LEU A HB2  4  
ATOM 6311  H HB3  . LEU A 1 69  ? -6.601  0.058   -1.849  1.00 0.00 ? 69  LEU A HB3  4  
ATOM 6312  H HG   . LEU A 1 69  ? -8.041  1.075   -4.276  1.00 0.00 ? 69  LEU A HG   4  
ATOM 6313  H HD11 . LEU A 1 69  ? -6.806  2.954   -4.025  1.00 0.00 ? 69  LEU A HD11 4  
ATOM 6314  H HD12 . LEU A 1 69  ? -5.553  1.931   -4.728  1.00 0.00 ? 69  LEU A HD12 4  
ATOM 6315  H HD13 . LEU A 1 69  ? -5.619  2.171   -2.982  1.00 0.00 ? 69  LEU A HD13 4  
ATOM 6316  H HD21 . LEU A 1 69  ? -6.817  -1.256  -3.880  1.00 0.00 ? 69  LEU A HD21 4  
ATOM 6317  H HD22 . LEU A 1 69  ? -5.411  -0.290  -4.327  1.00 0.00 ? 69  LEU A HD22 4  
ATOM 6318  H HD23 . LEU A 1 69  ? -6.779  -0.419  -5.432  1.00 0.00 ? 69  LEU A HD23 4  
ATOM 6319  N N    . LYS A 1 70  ? -8.606  -1.219  0.210   1.00 0.00 ? 70  LYS A N    4  
ATOM 6320  C CA   . LYS A 1 70  ? -8.862  -1.296  1.644   1.00 0.00 ? 70  LYS A CA   4  
ATOM 6321  C C    . LYS A 1 70  ? -7.684  -1.933  2.374   1.00 0.00 ? 70  LYS A C    4  
ATOM 6322  O O    . LYS A 1 70  ? -6.900  -2.675  1.781   1.00 0.00 ? 70  LYS A O    4  
ATOM 6323  C CB   . LYS A 1 70  ? -10.137 -2.099  1.913   1.00 0.00 ? 70  LYS A CB   4  
ATOM 6324  C CG   . LYS A 1 70  ? -11.234 -1.858  0.891   1.00 0.00 ? 70  LYS A CG   4  
ATOM 6325  C CD   . LYS A 1 70  ? -12.057 -0.628  1.236   1.00 0.00 ? 70  LYS A CD   4  
ATOM 6326  C CE   . LYS A 1 70  ? -13.132 -0.365  0.193   1.00 0.00 ? 70  LYS A CE   4  
ATOM 6327  N NZ   . LYS A 1 70  ? -14.220 0.502   0.724   1.00 0.00 ? 70  LYS A NZ   4  
ATOM 6328  H H    . LYS A 1 70  ? -8.098  -1.938  -0.223  1.00 0.00 ? 70  LYS A H    4  
ATOM 6329  H HA   . LYS A 1 70  ? -8.997  -0.290  2.011   1.00 0.00 ? 70  LYS A HA   4  
ATOM 6330  H HB2  . LYS A 1 70  ? -9.893  -3.151  1.907   1.00 0.00 ? 70  LYS A HB2  4  
ATOM 6331  H HB3  . LYS A 1 70  ? -10.517 -1.832  2.888   1.00 0.00 ? 70  LYS A HB3  4  
ATOM 6332  H HG2  . LYS A 1 70  ? -10.785 -1.716  -0.081  1.00 0.00 ? 70  LYS A HG2  4  
ATOM 6333  H HG3  . LYS A 1 70  ? -11.886 -2.720  0.866   1.00 0.00 ? 70  LYS A HG3  4  
ATOM 6334  H HD2  . LYS A 1 70  ? -12.531 -0.779  2.194   1.00 0.00 ? 70  LYS A HD2  4  
ATOM 6335  H HD3  . LYS A 1 70  ? -11.401 0.230   1.289   1.00 0.00 ? 70  LYS A HD3  4  
ATOM 6336  H HE2  . LYS A 1 70  ? -12.679 0.121   -0.658  1.00 0.00 ? 70  LYS A HE2  4  
ATOM 6337  H HE3  . LYS A 1 70  ? -13.554 -1.310  -0.116  1.00 0.00 ? 70  LYS A HE3  4  
ATOM 6338  H HZ1  . LYS A 1 70  ? -13.935 0.917   1.633   1.00 0.00 ? 70  LYS A HZ1  4  
ATOM 6339  H HZ2  . LYS A 1 70  ? -15.085 -0.058  0.865   1.00 0.00 ? 70  LYS A HZ2  4  
ATOM 6340  H HZ3  . LYS A 1 70  ? -14.425 1.270   0.053   1.00 0.00 ? 70  LYS A HZ3  4  
ATOM 6341  N N    . THR A 1 71  ? -7.565  -1.639  3.665   1.00 0.00 ? 71  THR A N    4  
ATOM 6342  C CA   . THR A 1 71  ? -6.483  -2.183  4.476   1.00 0.00 ? 71  THR A CA   4  
ATOM 6343  C C    . THR A 1 71  ? -6.441  -3.704  4.387   1.00 0.00 ? 71  THR A C    4  
ATOM 6344  O O    . THR A 1 71  ? -7.479  -4.364  4.375   1.00 0.00 ? 71  THR A O    4  
ATOM 6345  C CB   . THR A 1 71  ? -6.626  -1.770  5.953   1.00 0.00 ? 71  THR A CB   4  
ATOM 6346  O OG1  . THR A 1 71  ? -5.478  -2.197  6.695   1.00 0.00 ? 71  THR A OG1  4  
ATOM 6347  C CG2  . THR A 1 71  ? -7.883  -2.372  6.564   1.00 0.00 ? 71  THR A CG2  4  
ATOM 6348  H H    . THR A 1 71  ? -8.221  -1.041  4.081   1.00 0.00 ? 71  THR A H    4  
ATOM 6349  H HA   . THR A 1 71  ? -5.552  -1.784  4.101   1.00 0.00 ? 71  THR A HA   4  
ATOM 6350  H HB   . THR A 1 71  ? -6.699  -0.693  6.005   1.00 0.00 ? 71  THR A HB   4  
ATOM 6351  H HG1  . THR A 1 71  ? -4.763  -2.401  6.087   1.00 0.00 ? 71  THR A HG1  4  
ATOM 6352  H HG21 . THR A 1 71  ? -8.066  -1.921  7.528   1.00 0.00 ? 71  THR A HG21 4  
ATOM 6353  H HG22 . THR A 1 71  ? -7.750  -3.437  6.685   1.00 0.00 ? 71  THR A HG22 4  
ATOM 6354  H HG23 . THR A 1 71  ? -8.724  -2.186  5.914   1.00 0.00 ? 71  THR A HG23 4  
ATOM 6355  N N    . GLY A 1 72  ? -5.232  -4.255  4.326   1.00 0.00 ? 72  GLY A N    4  
ATOM 6356  C CA   . GLY A 1 72  ? -5.077  -5.696  4.240   1.00 0.00 ? 72  GLY A CA   4  
ATOM 6357  C C    . GLY A 1 72  ? -4.710  -6.156  2.843   1.00 0.00 ? 72  GLY A C    4  
ATOM 6358  O O    . GLY A 1 72  ? -4.130  -7.228  2.668   1.00 0.00 ? 72  GLY A O    4  
ATOM 6359  H H    . GLY A 1 72  ? -4.439  -3.679  4.340   1.00 0.00 ? 72  GLY A H    4  
ATOM 6360  H HA2  . GLY A 1 72  ? -4.302  -6.005  4.925   1.00 0.00 ? 72  GLY A HA2  4  
ATOM 6361  H HA3  . GLY A 1 72  ? -6.007  -6.164  4.528   1.00 0.00 ? 72  GLY A HA3  4  
ATOM 6362  N N    . ASP A 1 73  ? -5.051  -5.347  1.847   1.00 0.00 ? 73  ASP A N    4  
ATOM 6363  C CA   . ASP A 1 73  ? -4.755  -5.678  0.458   1.00 0.00 ? 73  ASP A CA   4  
ATOM 6364  C C    . ASP A 1 73  ? -3.248  -5.725  0.220   1.00 0.00 ? 73  ASP A C    4  
ATOM 6365  O O    . ASP A 1 73  ? -2.481  -5.036  0.892   1.00 0.00 ? 73  ASP A O    4  
ATOM 6366  C CB   . ASP A 1 73  ? -5.400  -4.658  -0.481  1.00 0.00 ? 73  ASP A CB   4  
ATOM 6367  C CG   . ASP A 1 73  ? -6.798  -5.065  -0.906  1.00 0.00 ? 73  ASP A CG   4  
ATOM 6368  O OD1  . ASP A 1 73  ? -7.763  -4.694  -0.205  1.00 0.00 ? 73  ASP A OD1  4  
ATOM 6369  O OD2  . ASP A 1 73  ? -6.926  -5.754  -1.939  1.00 0.00 ? 73  ASP A OD2  4  
ATOM 6370  H H    . ASP A 1 73  ? -5.513  -4.507  2.050   1.00 0.00 ? 73  ASP A H    4  
ATOM 6371  H HA   . ASP A 1 73  ? -5.169  -6.654  0.253   1.00 0.00 ? 73  ASP A HA   4  
ATOM 6372  H HB2  . ASP A 1 73  ? -5.461  -3.703  0.022   1.00 0.00 ? 73  ASP A HB2  4  
ATOM 6373  H HB3  . ASP A 1 73  ? -4.790  -4.556  -1.366  1.00 0.00 ? 73  ASP A HB3  4  
ATOM 6374  N N    . LYS A 1 74  ? -2.831  -6.543  -0.741  1.00 0.00 ? 74  LYS A N    4  
ATOM 6375  C CA   . LYS A 1 74  ? -1.417  -6.680  -1.069  1.00 0.00 ? 74  LYS A CA   4  
ATOM 6376  C C    . LYS A 1 74  ? -1.067  -5.873  -2.315  1.00 0.00 ? 74  LYS A C    4  
ATOM 6377  O O    . LYS A 1 74  ? -1.608  -6.115  -3.394  1.00 0.00 ? 74  LYS A O    4  
ATOM 6378  C CB   . LYS A 1 74  ? -1.064  -8.154  -1.286  1.00 0.00 ? 74  LYS A CB   4  
ATOM 6379  C CG   . LYS A 1 74  ? 0.428   -8.409  -1.412  1.00 0.00 ? 74  LYS A CG   4  
ATOM 6380  C CD   . LYS A 1 74  ? 0.726   -9.886  -1.604  1.00 0.00 ? 74  LYS A CD   4  
ATOM 6381  C CE   . LYS A 1 74  ? 0.758   -10.262 -3.078  1.00 0.00 ? 74  LYS A CE   4  
ATOM 6382  N NZ   . LYS A 1 74  ? 0.632   -11.732 -3.279  1.00 0.00 ? 74  LYS A NZ   4  
ATOM 6383  H H    . LYS A 1 74  ? -3.492  -7.066  -1.242  1.00 0.00 ? 74  LYS A H    4  
ATOM 6384  H HA   . LYS A 1 74  ? -0.845  -6.301  -0.236  1.00 0.00 ? 74  LYS A HA   4  
ATOM 6385  H HB2  . LYS A 1 74  ? -1.437  -8.728  -0.451  1.00 0.00 ? 74  LYS A HB2  4  
ATOM 6386  H HB3  . LYS A 1 74  ? -1.545  -8.497  -2.191  1.00 0.00 ? 74  LYS A HB3  4  
ATOM 6387  H HG2  . LYS A 1 74  ? 0.807   -7.863  -2.263  1.00 0.00 ? 74  LYS A HG2  4  
ATOM 6388  H HG3  . LYS A 1 74  ? 0.920   -8.066  -0.513  1.00 0.00 ? 74  LYS A HG3  4  
ATOM 6389  H HD2  . LYS A 1 74  ? 1.688   -10.111 -1.167  1.00 0.00 ? 74  LYS A HD2  4  
ATOM 6390  H HD3  . LYS A 1 74  ? -0.040  -10.467 -1.110  1.00 0.00 ? 74  LYS A HD3  4  
ATOM 6391  H HE2  . LYS A 1 74  ? -0.060  -9.768  -3.579  1.00 0.00 ? 74  LYS A HE2  4  
ATOM 6392  H HE3  . LYS A 1 74  ? 1.694   -9.928  -3.501  1.00 0.00 ? 74  LYS A HE3  4  
ATOM 6393  H HZ1  . LYS A 1 74  ? -0.091  -11.934 -3.998  1.00 0.00 ? 74  LYS A HZ1  4  
ATOM 6394  H HZ2  . LYS A 1 74  ? 0.358   -12.192 -2.387  1.00 0.00 ? 74  LYS A HZ2  4  
ATOM 6395  H HZ3  . LYS A 1 74  ? 1.541   -12.128 -3.594  1.00 0.00 ? 74  LYS A HZ3  4  
ATOM 6396  N N    . ILE A 1 75  ? -0.158  -4.916  -2.158  1.00 0.00 ? 75  ILE A N    4  
ATOM 6397  C CA   . ILE A 1 75  ? 0.265   -4.077  -3.271  1.00 0.00 ? 75  ILE A CA   4  
ATOM 6398  C C    . ILE A 1 75  ? 1.373   -4.748  -4.076  1.00 0.00 ? 75  ILE A C    4  
ATOM 6399  O O    . ILE A 1 75  ? 2.436   -5.069  -3.542  1.00 0.00 ? 75  ILE A O    4  
ATOM 6400  C CB   . ILE A 1 75  ? 0.761   -2.703  -2.783  1.00 0.00 ? 75  ILE A CB   4  
ATOM 6401  C CG1  . ILE A 1 75  ? -0.137  -2.182  -1.659  1.00 0.00 ? 75  ILE A CG1  4  
ATOM 6402  C CG2  . ILE A 1 75  ? 0.802   -1.713  -3.938  1.00 0.00 ? 75  ILE A CG2  4  
ATOM 6403  C CD1  . ILE A 1 75  ? 0.434   -0.981  -0.937  1.00 0.00 ? 75  ILE A CD1  4  
ATOM 6404  H H    . ILE A 1 75  ? 0.236   -4.772  -1.273  1.00 0.00 ? 75  ILE A H    4  
ATOM 6405  H HA   . ILE A 1 75  ? -0.589  -3.921  -3.915  1.00 0.00 ? 75  ILE A HA   4  
ATOM 6406  H HB   . ILE A 1 75  ? 1.766   -2.820  -2.406  1.00 0.00 ? 75  ILE A HB   4  
ATOM 6407  H HG12 . ILE A 1 75  ? -1.091  -1.896  -2.073  1.00 0.00 ? 75  ILE A HG12 4  
ATOM 6408  H HG13 . ILE A 1 75  ? -0.285  -2.968  -0.933  1.00 0.00 ? 75  ILE A HG13 4  
ATOM 6409  H HG21 . ILE A 1 75  ? 0.994   -2.243  -4.859  1.00 0.00 ? 75  ILE A HG21 4  
ATOM 6410  H HG22 . ILE A 1 75  ? -0.147  -1.204  -4.009  1.00 0.00 ? 75  ILE A HG22 4  
ATOM 6411  H HG23 . ILE A 1 75  ? 1.587   -0.992  -3.767  1.00 0.00 ? 75  ILE A HG23 4  
ATOM 6412  H HD11 . ILE A 1 75  ? 0.443   -0.131  -1.604  1.00 0.00 ? 75  ILE A HD11 4  
ATOM 6413  H HD12 . ILE A 1 75  ? -0.177  -0.755  -0.076  1.00 0.00 ? 75  ILE A HD12 4  
ATOM 6414  H HD13 . ILE A 1 75  ? 1.442   -1.198  -0.618  1.00 0.00 ? 75  ILE A HD13 4  
ATOM 6415  N N    . LEU A 1 76  ? 1.119   -4.956  -5.363  1.00 0.00 ? 76  LEU A N    4  
ATOM 6416  C CA   . LEU A 1 76  ? 2.096   -5.588  -6.243  1.00 0.00 ? 76  LEU A CA   4  
ATOM 6417  C C    . LEU A 1 76  ? 2.798   -4.549  -7.112  1.00 0.00 ? 76  LEU A C    4  
ATOM 6418  O O    . LEU A 1 76  ? 3.923   -4.762  -7.564  1.00 0.00 ? 76  LEU A O    4  
ATOM 6419  C CB   . LEU A 1 76  ? 1.414   -6.632  -7.128  1.00 0.00 ? 76  LEU A CB   4  
ATOM 6420  C CG   . LEU A 1 76  ? 0.232   -7.374  -6.502  1.00 0.00 ? 76  LEU A CG   4  
ATOM 6421  C CD1  . LEU A 1 76  ? -0.729  -7.853  -7.579  1.00 0.00 ? 76  LEU A CD1  4  
ATOM 6422  C CD2  . LEU A 1 76  ? 0.722   -8.545  -5.663  1.00 0.00 ? 76  LEU A CD2  4  
ATOM 6423  H H    . LEU A 1 76  ? 0.255   -4.678  -5.731  1.00 0.00 ? 76  LEU A H    4  
ATOM 6424  H HA   . LEU A 1 76  ? 2.832   -6.078  -5.624  1.00 0.00 ? 76  LEU A HA   4  
ATOM 6425  H HB2  . LEU A 1 76  ? 1.057   -6.132  -8.015  1.00 0.00 ? 76  LEU A HB2  4  
ATOM 6426  H HB3  . LEU A 1 76  ? 2.157   -7.366  -7.405  1.00 0.00 ? 76  LEU A HB3  4  
ATOM 6427  H HG   . LEU A 1 76  ? -0.306  -6.698  -5.852  1.00 0.00 ? 76  LEU A HG   4  
ATOM 6428  H HD11 . LEU A 1 76  ? -0.532  -7.322  -8.498  1.00 0.00 ? 76  LEU A HD11 4  
ATOM 6429  H HD12 . LEU A 1 76  ? -1.745  -7.664  -7.264  1.00 0.00 ? 76  LEU A HD12 4  
ATOM 6430  H HD13 . LEU A 1 76  ? -0.593  -8.913  -7.737  1.00 0.00 ? 76  LEU A HD13 4  
ATOM 6431  H HD21 . LEU A 1 76  ? -0.055  -9.292  -5.598  1.00 0.00 ? 76  LEU A HD21 4  
ATOM 6432  H HD22 . LEU A 1 76  ? 0.971   -8.198  -4.671  1.00 0.00 ? 76  LEU A HD22 4  
ATOM 6433  H HD23 . LEU A 1 76  ? 1.599   -8.977  -6.124  1.00 0.00 ? 76  LEU A HD23 4  
ATOM 6434  N N    . GLU A 1 77  ? 2.127   -3.424  -7.340  1.00 0.00 ? 77  GLU A N    4  
ATOM 6435  C CA   . GLU A 1 77  ? 2.688   -2.352  -8.153  1.00 0.00 ? 77  GLU A CA   4  
ATOM 6436  C C    . GLU A 1 77  ? 1.896   -1.060  -7.972  1.00 0.00 ? 77  GLU A C    4  
ATOM 6437  O O    . GLU A 1 77  ? 0.704   -1.087  -7.668  1.00 0.00 ? 77  GLU A O    4  
ATOM 6438  C CB   . GLU A 1 77  ? 2.698   -2.754  -9.630  1.00 0.00 ? 77  GLU A CB   4  
ATOM 6439  C CG   . GLU A 1 77  ? 3.856   -2.160  -10.414 1.00 0.00 ? 77  GLU A CG   4  
ATOM 6440  C CD   . GLU A 1 77  ? 3.650   -2.248  -11.914 1.00 0.00 ? 77  GLU A CD   4  
ATOM 6441  O OE1  . GLU A 1 77  ? 2.499   -2.470  -12.344 1.00 0.00 ? 77  GLU A OE1  4  
ATOM 6442  O OE2  . GLU A 1 77  ? 4.641   -2.094  -12.658 1.00 0.00 ? 77  GLU A OE2  4  
ATOM 6443  H H    . GLU A 1 77  ? 1.234   -3.313  -6.952  1.00 0.00 ? 77  GLU A H    4  
ATOM 6444  H HA   . GLU A 1 77  ? 3.704   -2.186  -7.828  1.00 0.00 ? 77  GLU A HA   4  
ATOM 6445  H HB2  . GLU A 1 77  ? 2.759   -3.830  -9.697  1.00 0.00 ? 77  GLU A HB2  4  
ATOM 6446  H HB3  . GLU A 1 77  ? 1.776   -2.426  -10.086 1.00 0.00 ? 77  GLU A HB3  4  
ATOM 6447  H HG2  . GLU A 1 77  ? 3.963   -1.121  -10.142 1.00 0.00 ? 77  GLU A HG2  4  
ATOM 6448  H HG3  . GLU A 1 77  ? 4.759   -2.693  -10.158 1.00 0.00 ? 77  GLU A HG3  4  
ATOM 6449  N N    . VAL A 1 78  ? 2.569   0.071   -8.160  1.00 0.00 ? 78  VAL A N    4  
ATOM 6450  C CA   . VAL A 1 78  ? 1.930   1.373   -8.018  1.00 0.00 ? 78  VAL A CA   4  
ATOM 6451  C C    . VAL A 1 78  ? 2.511   2.381   -9.004  1.00 0.00 ? 78  VAL A C    4  
ATOM 6452  O O    . VAL A 1 78  ? 3.723   2.591   -9.052  1.00 0.00 ? 78  VAL A O    4  
ATOM 6453  C CB   . VAL A 1 78  ? 2.087   1.923   -6.588  1.00 0.00 ? 78  VAL A CB   4  
ATOM 6454  C CG1  . VAL A 1 78  ? 3.263   2.884   -6.511  1.00 0.00 ? 78  VAL A CG1  4  
ATOM 6455  C CG2  . VAL A 1 78  ? 0.803   2.600   -6.134  1.00 0.00 ? 78  VAL A CG2  4  
ATOM 6456  H H    . VAL A 1 78  ? 3.518   0.028   -8.401  1.00 0.00 ? 78  VAL A H    4  
ATOM 6457  H HA   . VAL A 1 78  ? 0.876   1.252   -8.221  1.00 0.00 ? 78  VAL A HA   4  
ATOM 6458  H HB   . VAL A 1 78  ? 2.285   1.093   -5.925  1.00 0.00 ? 78  VAL A HB   4  
ATOM 6459  H HG11 . VAL A 1 78  ? 3.386   3.221   -5.492  1.00 0.00 ? 78  VAL A HG11 4  
ATOM 6460  H HG12 . VAL A 1 78  ? 4.162   2.381   -6.836  1.00 0.00 ? 78  VAL A HG12 4  
ATOM 6461  H HG13 . VAL A 1 78  ? 3.075   3.734   -7.150  1.00 0.00 ? 78  VAL A HG13 4  
ATOM 6462  H HG21 . VAL A 1 78  ? 0.930   2.978   -5.130  1.00 0.00 ? 78  VAL A HG21 4  
ATOM 6463  H HG22 . VAL A 1 78  ? 0.574   3.418   -6.800  1.00 0.00 ? 78  VAL A HG22 4  
ATOM 6464  H HG23 . VAL A 1 78  ? -0.007  1.885   -6.150  1.00 0.00 ? 78  VAL A HG23 4  
ATOM 6465  N N    . SER A 1 79  ? 1.637   3.002   -9.790  1.00 0.00 ? 79  SER A N    4  
ATOM 6466  C CA   . SER A 1 79  ? 2.063   3.986   -10.778 1.00 0.00 ? 79  SER A CA   4  
ATOM 6467  C C    . SER A 1 79  ? 3.017   3.361   -11.791 1.00 0.00 ? 79  SER A C    4  
ATOM 6468  O O    . SER A 1 79  ? 3.728   4.064   -12.508 1.00 0.00 ? 79  SER A O    4  
ATOM 6469  C CB   . SER A 1 79  ? 2.739   5.173   -10.089 1.00 0.00 ? 79  SER A CB   4  
ATOM 6470  O OG   . SER A 1 79  ? 2.559   6.365   -10.834 1.00 0.00 ? 79  SER A OG   4  
ATOM 6471  H H    . SER A 1 79  ? 0.684   2.792   -9.704  1.00 0.00 ? 79  SER A H    4  
ATOM 6472  H HA   . SER A 1 79  ? 1.184   4.336   -11.298 1.00 0.00 ? 79  SER A HA   4  
ATOM 6473  H HB2  . SER A 1 79  ? 2.311   5.308   -9.108  1.00 0.00 ? 79  SER A HB2  4  
ATOM 6474  H HB3  . SER A 1 79  ? 3.797   4.976   -9.996  1.00 0.00 ? 79  SER A HB3  4  
ATOM 6475  H HG   . SER A 1 79  ? 1.643   6.435   -11.111 1.00 0.00 ? 79  SER A HG   4  
ATOM 6476  N N    . GLY A 1 80  ? 3.027   2.032   -11.844 1.00 0.00 ? 80  GLY A N    4  
ATOM 6477  C CA   . GLY A 1 80  ? 3.897   1.333   -12.771 1.00 0.00 ? 80  GLY A CA   4  
ATOM 6478  C C    . GLY A 1 80  ? 5.244   0.997   -12.162 1.00 0.00 ? 80  GLY A C    4  
ATOM 6479  O O    . GLY A 1 80  ? 6.262   0.991   -12.854 1.00 0.00 ? 80  GLY A O    4  
ATOM 6480  H H    . GLY A 1 80  ? 2.439   1.523   -11.248 1.00 0.00 ? 80  GLY A H    4  
ATOM 6481  H HA2  . GLY A 1 80  ? 3.415   0.417   -13.080 1.00 0.00 ? 80  GLY A HA2  4  
ATOM 6482  H HA3  . GLY A 1 80  ? 4.053   1.956   -13.640 1.00 0.00 ? 80  GLY A HA3  4  
ATOM 6483  N N    . VAL A 1 81  ? 5.251   0.719   -10.862 1.00 0.00 ? 81  VAL A N    4  
ATOM 6484  C CA   . VAL A 1 81  ? 6.483   0.381   -10.159 1.00 0.00 ? 81  VAL A CA   4  
ATOM 6485  C C    . VAL A 1 81  ? 6.314   -0.889  -9.334  1.00 0.00 ? 81  VAL A C    4  
ATOM 6486  O O    . VAL A 1 81  ? 5.425   -0.978  -8.486  1.00 0.00 ? 81  VAL A O    4  
ATOM 6487  C CB   . VAL A 1 81  ? 6.932   1.527   -9.233  1.00 0.00 ? 81  VAL A CB   4  
ATOM 6488  C CG1  . VAL A 1 81  ? 6.207   1.450   -7.898  1.00 0.00 ? 81  VAL A CG1  4  
ATOM 6489  C CG2  . VAL A 1 81  ? 8.440   1.489   -9.033  1.00 0.00 ? 81  VAL A CG2  4  
ATOM 6490  H H    . VAL A 1 81  ? 4.407   0.740   -10.364 1.00 0.00 ? 81  VAL A H    4  
ATOM 6491  H HA   . VAL A 1 81  ? 7.255   0.219   -10.897 1.00 0.00 ? 81  VAL A HA   4  
ATOM 6492  H HB   . VAL A 1 81  ? 6.676   2.465   -9.703  1.00 0.00 ? 81  VAL A HB   4  
ATOM 6493  H HG11 . VAL A 1 81  ? 5.177   1.169   -8.064  1.00 0.00 ? 81  VAL A HG11 4  
ATOM 6494  H HG12 . VAL A 1 81  ? 6.686   0.713   -7.270  1.00 0.00 ? 81  VAL A HG12 4  
ATOM 6495  H HG13 . VAL A 1 81  ? 6.243   2.414   -7.413  1.00 0.00 ? 81  VAL A HG13 4  
ATOM 6496  H HG21 . VAL A 1 81  ? 8.705   0.618   -8.453  1.00 0.00 ? 81  VAL A HG21 4  
ATOM 6497  H HG22 . VAL A 1 81  ? 8.929   1.445   -9.995  1.00 0.00 ? 81  VAL A HG22 4  
ATOM 6498  H HG23 . VAL A 1 81  ? 8.756   2.380   -8.509  1.00 0.00 ? 81  VAL A HG23 4  
ATOM 6499  N N    . ASP A 1 82  ? 7.173   -1.871  -9.586  1.00 0.00 ? 82  ASP A N    4  
ATOM 6500  C CA   . ASP A 1 82  ? 7.121   -3.137  -8.865  1.00 0.00 ? 82  ASP A CA   4  
ATOM 6501  C C    . ASP A 1 82  ? 7.476   -2.940  -7.394  1.00 0.00 ? 82  ASP A C    4  
ATOM 6502  O O    . ASP A 1 82  ? 8.624   -2.646  -7.056  1.00 0.00 ? 82  ASP A O    4  
ATOM 6503  C CB   . ASP A 1 82  ? 8.073   -4.150  -9.501  1.00 0.00 ? 82  ASP A CB   4  
ATOM 6504  C CG   . ASP A 1 82  ? 7.722   -5.581  -9.141  1.00 0.00 ? 82  ASP A CG   4  
ATOM 6505  O OD1  . ASP A 1 82  ? 7.994   -5.988  -7.992  1.00 0.00 ? 82  ASP A OD1  4  
ATOM 6506  O OD2  . ASP A 1 82  ? 7.174   -6.292  -10.008 1.00 0.00 ? 82  ASP A OD2  4  
ATOM 6507  H H    . ASP A 1 82  ? 7.860   -1.740  -10.273 1.00 0.00 ? 82  ASP A H    4  
ATOM 6508  H HA   . ASP A 1 82  ? 6.112   -3.515  -8.930  1.00 0.00 ? 82  ASP A HA   4  
ATOM 6509  H HB2  . ASP A 1 82  ? 8.031   -4.049  -10.576 1.00 0.00 ? 82  ASP A HB2  4  
ATOM 6510  H HB3  . ASP A 1 82  ? 9.080   -3.950  -9.164  1.00 0.00 ? 82  ASP A HB3  4  
ATOM 6511  N N    . LEU A 1 83  ? 6.485   -3.102  -6.525  1.00 0.00 ? 83  LEU A N    4  
ATOM 6512  C CA   . LEU A 1 83  ? 6.693   -2.941  -5.090  1.00 0.00 ? 83  LEU A CA   4  
ATOM 6513  C C    . LEU A 1 83  ? 6.558   -4.277  -4.367  1.00 0.00 ? 83  LEU A C    4  
ATOM 6514  O O    . LEU A 1 83  ? 6.681   -4.347  -3.144  1.00 0.00 ? 83  LEU A O    4  
ATOM 6515  C CB   . LEU A 1 83  ? 5.690   -1.936  -4.519  1.00 0.00 ? 83  LEU A CB   4  
ATOM 6516  C CG   . LEU A 1 83  ? 5.826   -0.496  -5.016  1.00 0.00 ? 83  LEU A CG   4  
ATOM 6517  C CD1  . LEU A 1 83  ? 4.924   0.432   -4.217  1.00 0.00 ? 83  LEU A CD1  4  
ATOM 6518  C CD2  . LEU A 1 83  ? 7.275   -0.038  -4.931  1.00 0.00 ? 83  LEU A CD2  4  
ATOM 6519  H H    . LEU A 1 83  ? 5.593   -3.335  -6.854  1.00 0.00 ? 83  LEU A H    4  
ATOM 6520  H HA   . LEU A 1 83  ? 7.693   -2.563  -4.940  1.00 0.00 ? 83  LEU A HA   4  
ATOM 6521  H HB2  . LEU A 1 83  ? 4.699   -2.280  -4.770  1.00 0.00 ? 83  LEU A HB2  4  
ATOM 6522  H HB3  . LEU A 1 83  ? 5.806   -1.929  -3.445  1.00 0.00 ? 83  LEU A HB3  4  
ATOM 6523  H HG   . LEU A 1 83  ? 5.519   -0.449  -6.052  1.00 0.00 ? 83  LEU A HG   4  
ATOM 6524  H HD11 . LEU A 1 83  ? 4.503   -0.107  -3.382  1.00 0.00 ? 83  LEU A HD11 4  
ATOM 6525  H HD12 . LEU A 1 83  ? 4.128   0.793   -4.851  1.00 0.00 ? 83  LEU A HD12 4  
ATOM 6526  H HD13 . LEU A 1 83  ? 5.502   1.269   -3.852  1.00 0.00 ? 83  LEU A HD13 4  
ATOM 6527  H HD21 . LEU A 1 83  ? 7.871   -0.596  -5.638  1.00 0.00 ? 83  LEU A HD21 4  
ATOM 6528  H HD22 . LEU A 1 83  ? 7.648   -0.207  -3.932  1.00 0.00 ? 83  LEU A HD22 4  
ATOM 6529  H HD23 . LEU A 1 83  ? 7.333   1.016   -5.163  1.00 0.00 ? 83  LEU A HD23 4  
ATOM 6530  N N    . GLN A 1 84  ? 6.306   -5.335  -5.131  1.00 0.00 ? 84  GLN A N    4  
ATOM 6531  C CA   . GLN A 1 84  ? 6.157   -6.669  -4.563  1.00 0.00 ? 84  GLN A CA   4  
ATOM 6532  C C    . GLN A 1 84  ? 7.300   -6.984  -3.603  1.00 0.00 ? 84  GLN A C    4  
ATOM 6533  O O    . GLN A 1 84  ? 7.094   -7.106  -2.397  1.00 0.00 ? 84  GLN A O    4  
ATOM 6534  C CB   . GLN A 1 84  ? 6.106   -7.718  -5.675  1.00 0.00 ? 84  GLN A CB   4  
ATOM 6535  C CG   . GLN A 1 84  ? 4.769   -7.778  -6.394  1.00 0.00 ? 84  GLN A CG   4  
ATOM 6536  C CD   . GLN A 1 84  ? 4.730   -8.850  -7.466  1.00 0.00 ? 84  GLN A CD   4  
ATOM 6537  O OE1  . GLN A 1 84  ? 4.881   -10.038 -7.178  1.00 0.00 ? 84  GLN A OE1  4  
ATOM 6538  N NE2  . GLN A 1 84  ? 4.525   -8.436  -8.711  1.00 0.00 ? 84  GLN A NE2  4  
ATOM 6539  H H    . GLN A 1 84  ? 6.219   -5.215  -6.099  1.00 0.00 ? 84  GLN A H    4  
ATOM 6540  H HA   . GLN A 1 84  ? 5.227   -6.694  -4.015  1.00 0.00 ? 84  GLN A HA   4  
ATOM 6541  H HB2  . GLN A 1 84  ? 6.872   -7.491  -6.402  1.00 0.00 ? 84  GLN A HB2  4  
ATOM 6542  H HB3  . GLN A 1 84  ? 6.304   -8.689  -5.247  1.00 0.00 ? 84  GLN A HB3  4  
ATOM 6543  H HG2  . GLN A 1 84  ? 3.994   -7.987  -5.671  1.00 0.00 ? 84  GLN A HG2  4  
ATOM 6544  H HG3  . GLN A 1 84  ? 4.579   -6.821  -6.856  1.00 0.00 ? 84  GLN A HG3  4  
ATOM 6545  H HE21 . GLN A 1 84  ? 4.414   -7.474  -8.866  1.00 0.00 ? 84  GLN A HE21 4  
ATOM 6546  H HE22 . GLN A 1 84  ? 4.496   -9.107  -9.423  1.00 0.00 ? 84  GLN A HE22 4  
ATOM 6547  N N    . ASN A 1 85  ? 8.505   -7.113  -4.148  1.00 0.00 ? 85  ASN A N    4  
ATOM 6548  C CA   . ASN A 1 85  ? 9.681   -7.414  -3.340  1.00 0.00 ? 85  ASN A CA   4  
ATOM 6549  C C    . ASN A 1 85  ? 10.298  -6.136  -2.780  1.00 0.00 ? 85  ASN A C    4  
ATOM 6550  O O    . ASN A 1 85  ? 11.499  -6.078  -2.517  1.00 0.00 ? 85  ASN A O    4  
ATOM 6551  C CB   . ASN A 1 85  ? 10.718  -8.171  -4.173  1.00 0.00 ? 85  ASN A CB   4  
ATOM 6552  C CG   . ASN A 1 85  ? 10.150  -9.433  -4.794  1.00 0.00 ? 85  ASN A CG   4  
ATOM 6553  O OD1  . ASN A 1 85  ? 9.310   -10.107 -4.199  1.00 0.00 ? 85  ASN A OD1  4  
ATOM 6554  N ND2  . ASN A 1 85  ? 10.610  -9.758  -5.997  1.00 0.00 ? 85  ASN A ND2  4  
ATOM 6555  H H    . ASN A 1 85  ? 8.606   -7.004  -5.117  1.00 0.00 ? 85  ASN A H    4  
ATOM 6556  H HA   . ASN A 1 85  ? 9.367   -8.039  -2.518  1.00 0.00 ? 85  ASN A HA   4  
ATOM 6557  H HB2  . ASN A 1 85  ? 11.070  -7.530  -4.967  1.00 0.00 ? 85  ASN A HB2  4  
ATOM 6558  H HB3  . ASN A 1 85  ? 11.549  -8.445  -3.541  1.00 0.00 ? 85  ASN A HB3  4  
ATOM 6559  H HD21 . ASN A 1 85  ? 11.279  -9.174  -6.411  1.00 0.00 ? 85  ASN A HD21 4  
ATOM 6560  H HD22 . ASN A 1 85  ? 10.259  -10.569 -6.422  1.00 0.00 ? 85  ASN A HD22 4  
ATOM 6561  N N    . ALA A 1 86  ? 9.467   -5.115  -2.599  1.00 0.00 ? 86  ALA A N    4  
ATOM 6562  C CA   . ALA A 1 86  ? 9.929   -3.839  -2.067  1.00 0.00 ? 86  ALA A CA   4  
ATOM 6563  C C    . ALA A 1 86  ? 9.585   -3.704  -0.587  1.00 0.00 ? 86  ALA A C    4  
ATOM 6564  O O    . ALA A 1 86  ? 8.542   -4.176  -0.137  1.00 0.00 ? 86  ALA A O    4  
ATOM 6565  C CB   . ALA A 1 86  ? 9.326   -2.688  -2.858  1.00 0.00 ? 86  ALA A CB   4  
ATOM 6566  H H    . ALA A 1 86  ? 8.520   -5.223  -2.827  1.00 0.00 ? 86  ALA A H    4  
ATOM 6567  H HA   . ALA A 1 86  ? 11.003  -3.799  -2.182  1.00 0.00 ? 86  ALA A HA   4  
ATOM 6568  H HB1  . ALA A 1 86  ? 8.258   -2.826  -2.937  1.00 0.00 ? 86  ALA A HB1  4  
ATOM 6569  H HB2  . ALA A 1 86  ? 9.533   -1.756  -2.351  1.00 0.00 ? 86  ALA A HB2  4  
ATOM 6570  H HB3  . ALA A 1 86  ? 9.760   -2.664  -3.847  1.00 0.00 ? 86  ALA A HB3  4  
ATOM 6571  N N    . SER A 1 87  ? 10.470  -3.056  0.164   1.00 0.00 ? 87  SER A N    4  
ATOM 6572  C CA   . SER A 1 87  ? 10.262  -2.863  1.595   1.00 0.00 ? 87  SER A CA   4  
ATOM 6573  C C    . SER A 1 87  ? 9.282   -1.722  1.852   1.00 0.00 ? 87  SER A C    4  
ATOM 6574  O O    . SER A 1 87  ? 8.713   -1.155  0.918   1.00 0.00 ? 87  SER A O    4  
ATOM 6575  C CB   . SER A 1 87  ? 11.593  -2.573  2.291   1.00 0.00 ? 87  SER A CB   4  
ATOM 6576  O OG   . SER A 1 87  ? 11.397  -2.276  3.662   1.00 0.00 ? 87  SER A OG   4  
ATOM 6577  H H    . SER A 1 87  ? 11.283  -2.703  -0.253  1.00 0.00 ? 87  SER A H    4  
ATOM 6578  H HA   . SER A 1 87  ? 9.847   -3.776  1.995   1.00 0.00 ? 87  SER A HA   4  
ATOM 6579  H HB2  . SER A 1 87  ? 12.234  -3.438  2.210   1.00 0.00 ? 87  SER A HB2  4  
ATOM 6580  H HB3  . SER A 1 87  ? 12.068  -1.727  1.815   1.00 0.00 ? 87  SER A HB3  4  
ATOM 6581  H HG   . SER A 1 87  ? 11.894  -1.488  3.893   1.00 0.00 ? 87  SER A HG   4  
ATOM 6582  N N    . HIS A 1 88  ? 9.088   -1.392  3.125   1.00 0.00 ? 88  HIS A N    4  
ATOM 6583  C CA   . HIS A 1 88  ? 8.178   -0.319  3.506   1.00 0.00 ? 88  HIS A CA   4  
ATOM 6584  C C    . HIS A 1 88  ? 8.594   1.001   2.864   1.00 0.00 ? 88  HIS A C    4  
ATOM 6585  O O    . HIS A 1 88  ? 7.759   1.738   2.339   1.00 0.00 ? 88  HIS A O    4  
ATOM 6586  C CB   . HIS A 1 88  ? 8.140   -0.170  5.027   1.00 0.00 ? 88  HIS A CB   4  
ATOM 6587  C CG   . HIS A 1 88  ? 6.820   0.308   5.550   1.00 0.00 ? 88  HIS A CG   4  
ATOM 6588  N ND1  . HIS A 1 88  ? 6.703   1.258   6.543   1.00 0.00 ? 88  HIS A ND1  4  
ATOM 6589  C CD2  . HIS A 1 88  ? 5.556   -0.037  5.211   1.00 0.00 ? 88  HIS A CD2  4  
ATOM 6590  C CE1  . HIS A 1 88  ? 5.424   1.475   6.793   1.00 0.00 ? 88  HIS A CE1  4  
ATOM 6591  N NE2  . HIS A 1 88  ? 4.707   0.701   5.997   1.00 0.00 ? 88  HIS A NE2  4  
ATOM 6592  H H    . HIS A 1 88  ? 9.570   -1.881  3.823   1.00 0.00 ? 88  HIS A H    4  
ATOM 6593  H HA   . HIS A 1 88  ? 7.191   -0.580  3.154   1.00 0.00 ? 88  HIS A HA   4  
ATOM 6594  H HB2  . HIS A 1 88  ? 8.349   -1.127  5.481   1.00 0.00 ? 88  HIS A HB2  4  
ATOM 6595  H HB3  . HIS A 1 88  ? 8.895   0.541   5.332   1.00 0.00 ? 88  HIS A HB3  4  
ATOM 6596  H HD1  . HIS A 1 88  ? 7.447   1.705   6.997   1.00 0.00 ? 88  HIS A HD1  4  
ATOM 6597  H HD2  . HIS A 1 88  ? 5.268   -0.761  4.461   1.00 0.00 ? 88  HIS A HD2  4  
ATOM 6598  H HE1  . HIS A 1 88  ? 5.031   2.167   7.522   1.00 0.00 ? 88  HIS A HE1  4  
ATOM 6599  N N    . SER A 1 89  ? 9.890   1.294   2.910   1.00 0.00 ? 89  SER A N    4  
ATOM 6600  C CA   . SER A 1 89  ? 10.416  2.527   2.337   1.00 0.00 ? 89  SER A CA   4  
ATOM 6601  C C    . SER A 1 89  ? 10.425  2.457   0.813   1.00 0.00 ? 89  SER A C    4  
ATOM 6602  O O    . SER A 1 89  ? 10.075  3.423   0.136   1.00 0.00 ? 89  SER A O    4  
ATOM 6603  C CB   . SER A 1 89  ? 11.831  2.792   2.855   1.00 0.00 ? 89  SER A CB   4  
ATOM 6604  O OG   . SER A 1 89  ? 12.555  3.618   1.960   1.00 0.00 ? 89  SER A OG   4  
ATOM 6605  H H    . SER A 1 89  ? 10.506  0.666   3.343   1.00 0.00 ? 89  SER A H    4  
ATOM 6606  H HA   . SER A 1 89  ? 9.772   3.337   2.645   1.00 0.00 ? 89  SER A HA   4  
ATOM 6607  H HB2  . SER A 1 89  ? 11.774  3.283   3.814   1.00 0.00 ? 89  SER A HB2  4  
ATOM 6608  H HB3  . SER A 1 89  ? 12.354  1.852   2.962   1.00 0.00 ? 89  SER A HB3  4  
ATOM 6609  H HG   . SER A 1 89  ? 12.032  4.394   1.746   1.00 0.00 ? 89  SER A HG   4  
ATOM 6610  N N    . GLU A 1 90  ? 10.827  1.307   0.282   1.00 0.00 ? 90  GLU A N    4  
ATOM 6611  C CA   . GLU A 1 90  ? 10.882  1.111   -1.162  1.00 0.00 ? 90  GLU A CA   4  
ATOM 6612  C C    . GLU A 1 90  ? 9.535   1.427   -1.806  1.00 0.00 ? 90  GLU A C    4  
ATOM 6613  O O    . GLU A 1 90  ? 9.474   1.934   -2.926  1.00 0.00 ? 90  GLU A O    4  
ATOM 6614  C CB   . GLU A 1 90  ? 11.291  -0.327  -1.489  1.00 0.00 ? 90  GLU A CB   4  
ATOM 6615  C CG   . GLU A 1 90  ? 12.755  -0.622  -1.208  1.00 0.00 ? 90  GLU A CG   4  
ATOM 6616  C CD   . GLU A 1 90  ? 13.659  -0.238  -2.363  1.00 0.00 ? 90  GLU A CD   4  
ATOM 6617  O OE1  . GLU A 1 90  ? 13.265  0.640   -3.160  1.00 0.00 ? 90  GLU A OE1  4  
ATOM 6618  O OE2  . GLU A 1 90  ? 14.761  -0.816  -2.471  1.00 0.00 ? 90  GLU A OE2  4  
ATOM 6619  H H    . GLU A 1 90  ? 11.093  0.573   0.875   1.00 0.00 ? 90  GLU A H    4  
ATOM 6620  H HA   . GLU A 1 90  ? 11.624  1.786   -1.560  1.00 0.00 ? 90  GLU A HA   4  
ATOM 6621  H HB2  . GLU A 1 90  ? 10.689  -1.002  -0.899  1.00 0.00 ? 90  GLU A HB2  4  
ATOM 6622  H HB3  . GLU A 1 90  ? 11.102  -0.512  -2.536  1.00 0.00 ? 90  GLU A HB3  4  
ATOM 6623  H HG2  . GLU A 1 90  ? 13.059  -0.068  -0.333  1.00 0.00 ? 90  GLU A HG2  4  
ATOM 6624  H HG3  . GLU A 1 90  ? 12.866  -1.680  -1.019  1.00 0.00 ? 90  GLU A HG3  4  
ATOM 6625  N N    . ALA A 1 91  ? 8.457   1.124   -1.089  1.00 0.00 ? 91  ALA A N    4  
ATOM 6626  C CA   . ALA A 1 91  ? 7.112   1.376   -1.589  1.00 0.00 ? 91  ALA A CA   4  
ATOM 6627  C C    . ALA A 1 91  ? 6.663   2.797   -1.265  1.00 0.00 ? 91  ALA A C    4  
ATOM 6628  O O    . ALA A 1 91  ? 6.008   3.453   -2.075  1.00 0.00 ? 91  ALA A O    4  
ATOM 6629  C CB   . ALA A 1 91  ? 6.134   0.367   -1.006  1.00 0.00 ? 91  ALA A CB   4  
ATOM 6630  H H    . ALA A 1 91  ? 8.571   0.722   -0.203  1.00 0.00 ? 91  ALA A H    4  
ATOM 6631  H HA   . ALA A 1 91  ? 7.125   1.250   -2.662  1.00 0.00 ? 91  ALA A HA   4  
ATOM 6632  H HB1  . ALA A 1 91  ? 6.558   -0.072  -0.115  1.00 0.00 ? 91  ALA A HB1  4  
ATOM 6633  H HB2  . ALA A 1 91  ? 5.209   0.865   -0.757  1.00 0.00 ? 91  ALA A HB2  4  
ATOM 6634  H HB3  . ALA A 1 91  ? 5.941   -0.408  -1.733  1.00 0.00 ? 91  ALA A HB3  4  
ATOM 6635  N N    . VAL A 1 92  ? 7.021   3.269   -0.074  1.00 0.00 ? 92  VAL A N    4  
ATOM 6636  C CA   . VAL A 1 92  ? 6.655   4.613   0.357   1.00 0.00 ? 92  VAL A CA   4  
ATOM 6637  C C    . VAL A 1 92  ? 7.061   5.652   -0.681  1.00 0.00 ? 92  VAL A C    4  
ATOM 6638  O O    . VAL A 1 92  ? 6.284   6.547   -1.013  1.00 0.00 ? 92  VAL A O    4  
ATOM 6639  C CB   . VAL A 1 92  ? 7.311   4.967   1.705   1.00 0.00 ? 92  VAL A CB   4  
ATOM 6640  C CG1  . VAL A 1 92  ? 7.550   6.466   1.805   1.00 0.00 ? 92  VAL A CG1  4  
ATOM 6641  C CG2  . VAL A 1 92  ? 6.450   4.478   2.861   1.00 0.00 ? 92  VAL A CG2  4  
ATOM 6642  H H    . VAL A 1 92  ? 7.543   2.699   0.528   1.00 0.00 ? 92  VAL A H    4  
ATOM 6643  H HA   . VAL A 1 92  ? 5.583   4.643   0.483   1.00 0.00 ? 92  VAL A HA   4  
ATOM 6644  H HB   . VAL A 1 92  ? 8.267   4.468   1.760   1.00 0.00 ? 92  VAL A HB   4  
ATOM 6645  H HG11 . VAL A 1 92  ? 8.484   6.714   1.321   1.00 0.00 ? 92  VAL A HG11 4  
ATOM 6646  H HG12 . VAL A 1 92  ? 6.741   6.993   1.322   1.00 0.00 ? 92  VAL A HG12 4  
ATOM 6647  H HG13 . VAL A 1 92  ? 7.597   6.754   2.845   1.00 0.00 ? 92  VAL A HG13 4  
ATOM 6648  H HG21 . VAL A 1 92  ? 5.612   3.919   2.474   1.00 0.00 ? 92  VAL A HG21 4  
ATOM 6649  H HG22 . VAL A 1 92  ? 7.041   3.844   3.505   1.00 0.00 ? 92  VAL A HG22 4  
ATOM 6650  H HG23 . VAL A 1 92  ? 6.088   5.326   3.424   1.00 0.00 ? 92  VAL A HG23 4  
ATOM 6651  N N    . GLU A 1 93  ? 8.282   5.527   -1.191  1.00 0.00 ? 93  GLU A N    4  
ATOM 6652  C CA   . GLU A 1 93  ? 8.791   6.457   -2.192  1.00 0.00 ? 93  GLU A CA   4  
ATOM 6653  C C    . GLU A 1 93  ? 8.027   6.314   -3.505  1.00 0.00 ? 93  GLU A C    4  
ATOM 6654  O O    . GLU A 1 93  ? 7.824   7.289   -4.227  1.00 0.00 ? 93  GLU A O    4  
ATOM 6655  C CB   . GLU A 1 93  ? 10.283  6.220   -2.430  1.00 0.00 ? 93  GLU A CB   4  
ATOM 6656  C CG   . GLU A 1 93  ? 11.099  6.146   -1.150  1.00 0.00 ? 93  GLU A CG   4  
ATOM 6657  C CD   . GLU A 1 93  ? 12.526  6.622   -1.339  1.00 0.00 ? 93  GLU A CD   4  
ATOM 6658  O OE1  . GLU A 1 93  ? 12.919  6.876   -2.497  1.00 0.00 ? 93  GLU A OE1  4  
ATOM 6659  O OE2  . GLU A 1 93  ? 13.250  6.742   -0.329  1.00 0.00 ? 93  GLU A OE2  4  
ATOM 6660  H H    . GLU A 1 93  ? 8.855   4.793   -0.886  1.00 0.00 ? 93  GLU A H    4  
ATOM 6661  H HA   . GLU A 1 93  ? 8.651   7.459   -1.816  1.00 0.00 ? 93  GLU A HA   4  
ATOM 6662  H HB2  . GLU A 1 93  ? 10.407  5.290   -2.965  1.00 0.00 ? 93  GLU A HB2  4  
ATOM 6663  H HB3  . GLU A 1 93  ? 10.672  7.027   -3.033  1.00 0.00 ? 93  GLU A HB3  4  
ATOM 6664  H HG2  . GLU A 1 93  ? 10.627  6.764   -0.401  1.00 0.00 ? 93  GLU A HG2  4  
ATOM 6665  H HG3  . GLU A 1 93  ? 11.119  5.121   -0.809  1.00 0.00 ? 93  GLU A HG3  4  
ATOM 6666  N N    . ALA A 1 94  ? 7.606   5.090   -3.808  1.00 0.00 ? 94  ALA A N    4  
ATOM 6667  C CA   . ALA A 1 94  ? 6.863   4.818   -5.032  1.00 0.00 ? 94  ALA A CA   4  
ATOM 6668  C C    . ALA A 1 94  ? 5.520   5.540   -5.031  1.00 0.00 ? 94  ALA A C    4  
ATOM 6669  O O    . ALA A 1 94  ? 5.155   6.192   -6.010  1.00 0.00 ? 94  ALA A O    4  
ATOM 6670  C CB   . ALA A 1 94  ? 6.660   3.320   -5.205  1.00 0.00 ? 94  ALA A CB   4  
ATOM 6671  H H    . ALA A 1 94  ? 7.798   4.352   -3.192  1.00 0.00 ? 94  ALA A H    4  
ATOM 6672  H HA   . ALA A 1 94  ? 7.452   5.175   -5.866  1.00 0.00 ? 94  ALA A HA   4  
ATOM 6673  H HB1  . ALA A 1 94  ? 5.685   3.137   -5.631  1.00 0.00 ? 94  ALA A HB1  4  
ATOM 6674  H HB2  . ALA A 1 94  ? 7.421   2.928   -5.863  1.00 0.00 ? 94  ALA A HB2  4  
ATOM 6675  H HB3  . ALA A 1 94  ? 6.730   2.835   -4.243  1.00 0.00 ? 94  ALA A HB3  4  
ATOM 6676  N N    . ILE A 1 95  ? 4.789   5.418   -3.929  1.00 0.00 ? 95  ILE A N    4  
ATOM 6677  C CA   . ILE A 1 95  ? 3.486   6.060   -3.801  1.00 0.00 ? 95  ILE A CA   4  
ATOM 6678  C C    . ILE A 1 95  ? 3.623   7.578   -3.756  1.00 0.00 ? 95  ILE A C    4  
ATOM 6679  O O    . ILE A 1 95  ? 2.787   8.304   -4.294  1.00 0.00 ? 95  ILE A O    4  
ATOM 6680  C CB   . ILE A 1 95  ? 2.746   5.585   -2.537  1.00 0.00 ? 95  ILE A CB   4  
ATOM 6681  C CG1  . ILE A 1 95  ? 2.346   4.114   -2.676  1.00 0.00 ? 95  ILE A CG1  4  
ATOM 6682  C CG2  . ILE A 1 95  ? 1.521   6.451   -2.285  1.00 0.00 ? 95  ILE A CG2  4  
ATOM 6683  C CD1  . ILE A 1 95  ? 3.383   3.153   -2.138  1.00 0.00 ? 95  ILE A CD1  4  
ATOM 6684  H H    . ILE A 1 95  ? 5.134   4.885   -3.183  1.00 0.00 ? 95  ILE A H    4  
ATOM 6685  H HA   . ILE A 1 95  ? 2.896   5.788   -4.664  1.00 0.00 ? 95  ILE A HA   4  
ATOM 6686  H HB   . ILE A 1 95  ? 3.412   5.691   -1.695  1.00 0.00 ? 95  ILE A HB   4  
ATOM 6687  H HG12 . ILE A 1 95  ? 1.427   3.945   -2.138  1.00 0.00 ? 95  ILE A HG12 4  
ATOM 6688  H HG13 . ILE A 1 95  ? 2.193   3.888   -3.722  1.00 0.00 ? 95  ILE A HG13 4  
ATOM 6689  H HG21 . ILE A 1 95  ? 1.813   7.490   -2.262  1.00 0.00 ? 95  ILE A HG21 4  
ATOM 6690  H HG22 . ILE A 1 95  ? 0.802   6.297   -3.075  1.00 0.00 ? 95  ILE A HG22 4  
ATOM 6691  H HG23 . ILE A 1 95  ? 1.078   6.181   -1.337  1.00 0.00 ? 95  ILE A HG23 4  
ATOM 6692  H HD11 . ILE A 1 95  ? 4.063   2.877   -2.931  1.00 0.00 ? 95  ILE A HD11 4  
ATOM 6693  H HD12 . ILE A 1 95  ? 3.935   3.628   -1.341  1.00 0.00 ? 95  ILE A HD12 4  
ATOM 6694  H HD13 . ILE A 1 95  ? 2.893   2.268   -1.761  1.00 0.00 ? 95  ILE A HD13 4  
ATOM 6695  N N    . LYS A 1 96  ? 4.685   8.052   -3.113  1.00 0.00 ? 96  LYS A N    4  
ATOM 6696  C CA   . LYS A 1 96  ? 4.935   9.484   -3.000  1.00 0.00 ? 96  LYS A CA   4  
ATOM 6697  C C    . LYS A 1 96  ? 5.570   10.028  -4.276  1.00 0.00 ? 96  LYS A C    4  
ATOM 6698  O O    . LYS A 1 96  ? 5.421   11.205  -4.601  1.00 0.00 ? 96  LYS A O    4  
ATOM 6699  C CB   . LYS A 1 96  ? 5.845   9.770   -1.803  1.00 0.00 ? 96  LYS A CB   4  
ATOM 6700  C CG   . LYS A 1 96  ? 7.324   9.764   -2.148  1.00 0.00 ? 96  LYS A CG   4  
ATOM 6701  C CD   . LYS A 1 96  ? 8.189   9.777   -0.899  1.00 0.00 ? 96  LYS A CD   4  
ATOM 6702  C CE   . LYS A 1 96  ? 9.661   9.949   -1.241  1.00 0.00 ? 96  LYS A CE   4  
ATOM 6703  N NZ   . LYS A 1 96  ? 10.419  10.582  -0.126  1.00 0.00 ? 96  LYS A NZ   4  
ATOM 6704  H H    . LYS A 1 96  ? 5.317   7.422   -2.705  1.00 0.00 ? 96  LYS A H    4  
ATOM 6705  H HA   . LYS A 1 96  ? 3.987   9.975   -2.846  1.00 0.00 ? 96  LYS A HA   4  
ATOM 6706  H HB2  . LYS A 1 96  ? 5.595   10.740  -1.400  1.00 0.00 ? 96  LYS A HB2  4  
ATOM 6707  H HB3  . LYS A 1 96  ? 5.671   9.019   -1.046  1.00 0.00 ? 96  LYS A HB3  4  
ATOM 6708  H HG2  . LYS A 1 96  ? 7.548   8.875   -2.719  1.00 0.00 ? 96  LYS A HG2  4  
ATOM 6709  H HG3  . LYS A 1 96  ? 7.550   10.640  -2.740  1.00 0.00 ? 96  LYS A HG3  4  
ATOM 6710  H HD2  . LYS A 1 96  ? 7.880   10.596  -0.266  1.00 0.00 ? 96  LYS A HD2  4  
ATOM 6711  H HD3  . LYS A 1 96  ? 8.057   8.843   -0.371  1.00 0.00 ? 96  LYS A HD3  4  
ATOM 6712  H HE2  . LYS A 1 96  ? 10.084  8.979   -1.448  1.00 0.00 ? 96  LYS A HE2  4  
ATOM 6713  H HE3  . LYS A 1 96  ? 9.742   10.572  -2.119  1.00 0.00 ? 96  LYS A HE3  4  
ATOM 6714  H HZ1  . LYS A 1 96  ? 10.649  9.871   0.598   1.00 0.00 ? 96  LYS A HZ1  4  
ATOM 6715  H HZ2  . LYS A 1 96  ? 9.850   11.335  0.310   1.00 0.00 ? 96  LYS A HZ2  4  
ATOM 6716  H HZ3  . LYS A 1 96  ? 11.303  10.995  -0.485  1.00 0.00 ? 96  LYS A HZ3  4  
ATOM 6717  N N    . ASN A 1 97  ? 6.276   9.162   -4.996  1.00 0.00 ? 97  ASN A N    4  
ATOM 6718  C CA   . ASN A 1 97  ? 6.932   9.557   -6.237  1.00 0.00 ? 97  ASN A CA   4  
ATOM 6719  C C    . ASN A 1 97  ? 6.193   8.993   -7.446  1.00 0.00 ? 97  ASN A C    4  
ATOM 6720  O O    . ASN A 1 97  ? 6.746   8.911   -8.542  1.00 0.00 ? 97  ASN A O    4  
ATOM 6721  C CB   . ASN A 1 97  ? 8.385   9.078   -6.245  1.00 0.00 ? 97  ASN A CB   4  
ATOM 6722  C CG   . ASN A 1 97  ? 9.168   9.586   -5.049  1.00 0.00 ? 97  ASN A CG   4  
ATOM 6723  O OD1  . ASN A 1 97  ? 9.161   10.780  -4.751  1.00 0.00 ? 97  ASN A OD1  4  
ATOM 6724  N ND2  . ASN A 1 97  ? 9.849   8.679   -4.359  1.00 0.00 ? 97  ASN A ND2  4  
ATOM 6725  H H    . ASN A 1 97  ? 6.359   8.237   -4.685  1.00 0.00 ? 97  ASN A H    4  
ATOM 6726  H HA   . ASN A 1 97  ? 6.918   10.635  -6.291  1.00 0.00 ? 97  ASN A HA   4  
ATOM 6727  H HB2  . ASN A 1 97  ? 8.402   7.998   -6.229  1.00 0.00 ? 97  ASN A HB2  4  
ATOM 6728  H HB3  . ASN A 1 97  ? 8.869   9.428   -7.144  1.00 0.00 ? 97  ASN A HB3  4  
ATOM 6729  H HD21 . ASN A 1 97  ? 9.808   7.745   -4.655  1.00 0.00 ? 97  ASN A HD21 4  
ATOM 6730  H HD22 . ASN A 1 97  ? 10.363  8.980   -3.581  1.00 0.00 ? 97  ASN A HD22 4  
ATOM 6731  N N    . ALA A 1 98  ? 4.939   8.606   -7.238  1.00 0.00 ? 98  ALA A N    4  
ATOM 6732  C CA   . ALA A 1 98  ? 4.122   8.052   -8.311  1.00 0.00 ? 98  ALA A CA   4  
ATOM 6733  C C    . ALA A 1 98  ? 3.675   9.142   -9.279  1.00 0.00 ? 98  ALA A C    4  
ATOM 6734  O O    . ALA A 1 98  ? 2.868   10.002  -8.931  1.00 0.00 ? 98  ALA A O    4  
ATOM 6735  C CB   . ALA A 1 98  ? 2.915   7.327   -7.735  1.00 0.00 ? 98  ALA A CB   4  
ATOM 6736  H H    . ALA A 1 98  ? 4.553   8.696   -6.342  1.00 0.00 ? 98  ALA A H    4  
ATOM 6737  H HA   . ALA A 1 98  ? 4.721   7.331   -8.849  1.00 0.00 ? 98  ALA A HA   4  
ATOM 6738  H HB1  . ALA A 1 98  ? 2.565   7.851   -6.858  1.00 0.00 ? 98  ALA A HB1  4  
ATOM 6739  H HB2  . ALA A 1 98  ? 2.127   7.298   -8.475  1.00 0.00 ? 98  ALA A HB2  4  
ATOM 6740  H HB3  . ALA A 1 98  ? 3.194   6.320   -7.466  1.00 0.00 ? 98  ALA A HB3  4  
ATOM 6741  N N    . GLY A 1 99  ? 4.206   9.100   -10.498 1.00 0.00 ? 99  GLY A N    4  
ATOM 6742  C CA   . GLY A 1 99  ? 3.850   10.090  -11.497 1.00 0.00 ? 99  GLY A CA   4  
ATOM 6743  C C    . GLY A 1 99  ? 2.351   10.273  -11.624 1.00 0.00 ? 99  GLY A C    4  
ATOM 6744  O O    . GLY A 1 99  ? 1.689   9.534   -12.351 1.00 0.00 ? 99  GLY A O    4  
ATOM 6745  H H    . GLY A 1 99  ? 4.845   8.390   -10.719 1.00 0.00 ? 99  GLY A H    4  
ATOM 6746  H HA2  . GLY A 1 99  ? 4.296   11.035  -11.226 1.00 0.00 ? 99  GLY A HA2  4  
ATOM 6747  H HA3  . GLY A 1 99  ? 4.245   9.778   -12.453 1.00 0.00 ? 99  GLY A HA3  4  
ATOM 6748  N N    . ASN A 1 100 ? 1.814   11.259  -10.913 1.00 0.00 ? 100 ASN A N    4  
ATOM 6749  C CA   . ASN A 1 100 ? 0.383   11.535  -10.948 1.00 0.00 ? 100 ASN A CA   4  
ATOM 6750  C C    . ASN A 1 100 ? -0.186  11.284  -12.341 1.00 0.00 ? 100 ASN A C    4  
ATOM 6751  O O    . ASN A 1 100 ? 0.360   11.729  -13.351 1.00 0.00 ? 100 ASN A O    4  
ATOM 6752  C CB   . ASN A 1 100 ? 0.110   12.980  -10.526 1.00 0.00 ? 100 ASN A CB   4  
ATOM 6753  C CG   . ASN A 1 100 ? -1.335  13.202  -10.123 1.00 0.00 ? 100 ASN A CG   4  
ATOM 6754  O OD1  . ASN A 1 100 ? -2.254  12.951  -10.903 1.00 0.00 ? 100 ASN A OD1  4  
ATOM 6755  N ND2  . ASN A 1 100 ? -1.542  13.676  -8.900  1.00 0.00 ? 100 ASN A ND2  4  
ATOM 6756  H H    . ASN A 1 100 ? 2.394   11.814  -10.351 1.00 0.00 ? 100 ASN A H    4  
ATOM 6757  H HA   . ASN A 1 100 ? -0.100  10.868  -10.249 1.00 0.00 ? 100 ASN A HA   4  
ATOM 6758  H HB2  . ASN A 1 100 ? 0.740   13.228  -9.684  1.00 0.00 ? 100 ASN A HB2  4  
ATOM 6759  H HB3  . ASN A 1 100 ? 0.341   13.639  -11.350 1.00 0.00 ? 100 ASN A HB3  4  
ATOM 6760  H HD21 . ASN A 1 100 ? -0.761  13.854  -8.334  1.00 0.00 ? 100 ASN A HD21 4  
ATOM 6761  H HD22 . ASN A 1 100 ? -2.466  13.829  -8.613  1.00 0.00 ? 100 ASN A HD22 4  
ATOM 6762  N N    . PRO A 1 101 ? -1.310  10.554  -12.399 1.00 0.00 ? 101 PRO A N    4  
ATOM 6763  C CA   . PRO A 1 101 ? -1.968  10.018  -11.204 1.00 0.00 ? 101 PRO A CA   4  
ATOM 6764  C C    . PRO A 1 101 ? -1.161  8.903   -10.548 1.00 0.00 ? 101 PRO A C    4  
ATOM 6765  O O    . PRO A 1 101 ? -0.050  8.592   -10.977 1.00 0.00 ? 101 PRO A O    4  
ATOM 6766  C CB   . PRO A 1 101 ? -3.293  9.474   -11.743 1.00 0.00 ? 101 PRO A CB   4  
ATOM 6767  C CG   . PRO A 1 101 ? -3.023  9.170   -13.176 1.00 0.00 ? 101 PRO A CG   4  
ATOM 6768  C CD   . PRO A 1 101 ? -2.024  10.195  -13.636 1.00 0.00 ? 101 PRO A CD   4  
ATOM 6769  H HA   . PRO A 1 101 ? -2.165  10.794  -10.478 1.00 0.00 ? 101 PRO A HA   4  
ATOM 6770  H HB2  . PRO A 1 101 ? -3.570  8.584   -11.194 1.00 0.00 ? 101 PRO A HB2  4  
ATOM 6771  H HB3  . PRO A 1 101 ? -4.064  10.223  -11.637 1.00 0.00 ? 101 PRO A HB3  4  
ATOM 6772  H HG2  . PRO A 1 101 ? -2.611  8.176   -13.269 1.00 0.00 ? 101 PRO A HG2  4  
ATOM 6773  H HG3  . PRO A 1 101 ? -3.936  9.254   -13.747 1.00 0.00 ? 101 PRO A HG3  4  
ATOM 6774  H HD2  . PRO A 1 101 ? -1.349  9.766   -14.360 1.00 0.00 ? 101 PRO A HD2  4  
ATOM 6775  H HD3  . PRO A 1 101 ? -2.530  11.054  -14.051 1.00 0.00 ? 101 PRO A HD3  4  
ATOM 6776  N N    . VAL A 1 102 ? -1.728  8.303   -9.506  1.00 0.00 ? 102 VAL A N    4  
ATOM 6777  C CA   . VAL A 1 102 ? -1.061  7.221   -8.791  1.00 0.00 ? 102 VAL A CA   4  
ATOM 6778  C C    . VAL A 1 102 ? -1.862  5.927   -8.884  1.00 0.00 ? 102 VAL A C    4  
ATOM 6779  O O    . VAL A 1 102 ? -2.755  5.678   -8.074  1.00 0.00 ? 102 VAL A O    4  
ATOM 6780  C CB   . VAL A 1 102 ? -0.848  7.575   -7.308  1.00 0.00 ? 102 VAL A CB   4  
ATOM 6781  C CG1  . VAL A 1 102 ? 0.071   6.562   -6.643  1.00 0.00 ? 102 VAL A CG1  4  
ATOM 6782  C CG2  . VAL A 1 102 ? -0.290  8.984   -7.171  1.00 0.00 ? 102 VAL A CG2  4  
ATOM 6783  H H    . VAL A 1 102 ? -2.615  8.595   -9.210  1.00 0.00 ? 102 VAL A H    4  
ATOM 6784  H HA   . VAL A 1 102 ? -0.093  7.067   -9.246  1.00 0.00 ? 102 VAL A HA   4  
ATOM 6785  H HB   . VAL A 1 102 ? -1.806  7.540   -6.809  1.00 0.00 ? 102 VAL A HB   4  
ATOM 6786  H HG11 . VAL A 1 102 ? 0.644   7.050   -5.869  1.00 0.00 ? 102 VAL A HG11 4  
ATOM 6787  H HG12 . VAL A 1 102 ? -0.520  5.768   -6.210  1.00 0.00 ? 102 VAL A HG12 4  
ATOM 6788  H HG13 . VAL A 1 102 ? 0.744   6.149   -7.381  1.00 0.00 ? 102 VAL A HG13 4  
ATOM 6789  H HG21 . VAL A 1 102 ? -0.454  9.527   -8.090  1.00 0.00 ? 102 VAL A HG21 4  
ATOM 6790  H HG22 . VAL A 1 102 ? -0.789  9.490   -6.359  1.00 0.00 ? 102 VAL A HG22 4  
ATOM 6791  H HG23 . VAL A 1 102 ? 0.770   8.933   -6.968  1.00 0.00 ? 102 VAL A HG23 4  
ATOM 6792  N N    . VAL A 1 103 ? -1.535  5.105   -9.876  1.00 0.00 ? 103 VAL A N    4  
ATOM 6793  C CA   . VAL A 1 103 ? -2.223  3.834   -10.074 1.00 0.00 ? 103 VAL A CA   4  
ATOM 6794  C C    . VAL A 1 103 ? -1.834  2.826   -8.999  1.00 0.00 ? 103 VAL A C    4  
ATOM 6795  O O    . VAL A 1 103 ? -0.691  2.799   -8.542  1.00 0.00 ? 103 VAL A O    4  
ATOM 6796  C CB   . VAL A 1 103 ? -1.911  3.238   -11.460 1.00 0.00 ? 103 VAL A CB   4  
ATOM 6797  C CG1  . VAL A 1 103 ? -2.990  2.247   -11.869 1.00 0.00 ? 103 VAL A CG1  4  
ATOM 6798  C CG2  . VAL A 1 103 ? -1.770  4.343   -12.496 1.00 0.00 ? 103 VAL A CG2  4  
ATOM 6799  H H    . VAL A 1 103 ? -0.814  5.359   -10.489 1.00 0.00 ? 103 VAL A H    4  
ATOM 6800  H HA   . VAL A 1 103 ? -3.286  4.017   -10.015 1.00 0.00 ? 103 VAL A HA   4  
ATOM 6801  H HB   . VAL A 1 103 ? -0.972  2.708   -11.398 1.00 0.00 ? 103 VAL A HB   4  
ATOM 6802  H HG11 . VAL A 1 103 ? -3.934  2.763   -11.968 1.00 0.00 ? 103 VAL A HG11 4  
ATOM 6803  H HG12 . VAL A 1 103 ? -2.725  1.795   -12.814 1.00 0.00 ? 103 VAL A HG12 4  
ATOM 6804  H HG13 . VAL A 1 103 ? -3.078  1.479   -11.114 1.00 0.00 ? 103 VAL A HG13 4  
ATOM 6805  H HG21 . VAL A 1 103 ? -2.172  4.005   -13.439 1.00 0.00 ? 103 VAL A HG21 4  
ATOM 6806  H HG22 . VAL A 1 103 ? -2.311  5.217   -12.165 1.00 0.00 ? 103 VAL A HG22 4  
ATOM 6807  H HG23 . VAL A 1 103 ? -0.725  4.591   -12.617 1.00 0.00 ? 103 VAL A HG23 4  
ATOM 6808  N N    . PHE A 1 104 ? -2.792  1.996   -8.600  1.00 0.00 ? 104 PHE A N    4  
ATOM 6809  C CA   . PHE A 1 104 ? -2.550  0.984   -7.578  1.00 0.00 ? 104 PHE A CA   4  
ATOM 6810  C C    . PHE A 1 104 ? -2.954  -0.400  -8.076  1.00 0.00 ? 104 PHE A C    4  
ATOM 6811  O O    . PHE A 1 104 ? -4.063  -0.592  -8.576  1.00 0.00 ? 104 PHE A O    4  
ATOM 6812  C CB   . PHE A 1 104 ? -3.321  1.324   -6.301  1.00 0.00 ? 104 PHE A CB   4  
ATOM 6813  C CG   . PHE A 1 104 ? -2.534  2.153   -5.327  1.00 0.00 ? 104 PHE A CG   4  
ATOM 6814  C CD1  . PHE A 1 104 ? -2.526  3.535   -5.421  1.00 0.00 ? 104 PHE A CD1  4  
ATOM 6815  C CD2  . PHE A 1 104 ? -1.800  1.549   -4.318  1.00 0.00 ? 104 PHE A CD2  4  
ATOM 6816  C CE1  . PHE A 1 104 ? -1.802  4.300   -4.526  1.00 0.00 ? 104 PHE A CE1  4  
ATOM 6817  C CE2  . PHE A 1 104 ? -1.075  2.309   -3.420  1.00 0.00 ? 104 PHE A CE2  4  
ATOM 6818  C CZ   . PHE A 1 104 ? -1.075  3.686   -3.525  1.00 0.00 ? 104 PHE A CZ   4  
ATOM 6819  H H    . PHE A 1 104 ? -3.683  2.066   -9.002  1.00 0.00 ? 104 PHE A H    4  
ATOM 6820  H HA   . PHE A 1 104 ? -1.493  0.981   -7.360  1.00 0.00 ? 104 PHE A HA   4  
ATOM 6821  H HB2  . PHE A 1 104 ? -4.211  1.877   -6.563  1.00 0.00 ? 104 PHE A HB2  4  
ATOM 6822  H HB3  . PHE A 1 104 ? -3.605  0.408   -5.806  1.00 0.00 ? 104 PHE A HB3  4  
ATOM 6823  H HD1  . PHE A 1 104 ? -3.094  4.016   -6.204  1.00 0.00 ? 104 PHE A HD1  4  
ATOM 6824  H HD2  . PHE A 1 104 ? -1.799  0.472   -4.236  1.00 0.00 ? 104 PHE A HD2  4  
ATOM 6825  H HE1  . PHE A 1 104 ? -1.804  5.377   -4.611  1.00 0.00 ? 104 PHE A HE1  4  
ATOM 6826  H HE2  . PHE A 1 104 ? -0.507  1.827   -2.639  1.00 0.00 ? 104 PHE A HE2  4  
ATOM 6827  H HZ   . PHE A 1 104 ? -0.509  4.282   -2.824  1.00 0.00 ? 104 PHE A HZ   4  
ATOM 6828  N N    . ILE A 1 105 ? -2.046  -1.361  -7.937  1.00 0.00 ? 105 ILE A N    4  
ATOM 6829  C CA   . ILE A 1 105 ? -2.308  -2.727  -8.372  1.00 0.00 ? 105 ILE A CA   4  
ATOM 6830  C C    . ILE A 1 105 ? -2.249  -3.699  -7.199  1.00 0.00 ? 105 ILE A C    4  
ATOM 6831  O O    . ILE A 1 105 ? -1.191  -4.241  -6.879  1.00 0.00 ? 105 ILE A O    4  
ATOM 6832  C CB   . ILE A 1 105 ? -1.301  -3.178  -9.448  1.00 0.00 ? 105 ILE A CB   4  
ATOM 6833  C CG1  . ILE A 1 105 ? -1.165  -2.106  -10.531 1.00 0.00 ? 105 ILE A CG1  4  
ATOM 6834  C CG2  . ILE A 1 105 ? -1.735  -4.502  -10.057 1.00 0.00 ? 105 ILE A CG2  4  
ATOM 6835  C CD1  . ILE A 1 105 ? -0.768  -2.658  -11.882 1.00 0.00 ? 105 ILE A CD1  4  
ATOM 6836  H H    . ILE A 1 105 ? -1.181  -1.146  -7.531  1.00 0.00 ? 105 ILE A H    4  
ATOM 6837  H HA   . ILE A 1 105 ? -3.299  -2.756  -8.801  1.00 0.00 ? 105 ILE A HA   4  
ATOM 6838  H HB   . ILE A 1 105 ? -0.343  -3.324  -8.973  1.00 0.00 ? 105 ILE A HB   4  
ATOM 6839  H HG12 . ILE A 1 105 ? -2.109  -1.597  -10.646 1.00 0.00 ? 105 ILE A HG12 4  
ATOM 6840  H HG13 . ILE A 1 105 ? -0.412  -1.393  -10.228 1.00 0.00 ? 105 ILE A HG13 4  
ATOM 6841  H HG21 . ILE A 1 105 ? -2.392  -5.016  -9.371  1.00 0.00 ? 105 ILE A HG21 4  
ATOM 6842  H HG22 . ILE A 1 105 ? -2.258  -4.318  -10.984 1.00 0.00 ? 105 ILE A HG22 4  
ATOM 6843  H HG23 . ILE A 1 105 ? -0.866  -5.113  -10.249 1.00 0.00 ? 105 ILE A HG23 4  
ATOM 6844  H HD11 . ILE A 1 105 ? -0.090  -3.489  -11.745 1.00 0.00 ? 105 ILE A HD11 4  
ATOM 6845  H HD12 . ILE A 1 105 ? -1.649  -2.997  -12.406 1.00 0.00 ? 105 ILE A HD12 4  
ATOM 6846  H HD13 . ILE A 1 105 ? -0.279  -1.887  -12.457 1.00 0.00 ? 105 ILE A HD13 4  
ATOM 6847  N N    . VAL A 1 106 ? -3.394  -3.916  -6.560  1.00 0.00 ? 106 VAL A N    4  
ATOM 6848  C CA   . VAL A 1 106 ? -3.475  -4.825  -5.422  1.00 0.00 ? 106 VAL A CA   4  
ATOM 6849  C C    . VAL A 1 106 ? -4.456  -5.960  -5.695  1.00 0.00 ? 106 VAL A C    4  
ATOM 6850  O O    . VAL A 1 106 ? -5.095  -6.002  -6.746  1.00 0.00 ? 106 VAL A O    4  
ATOM 6851  C CB   . VAL A 1 106 ? -3.906  -4.085  -4.142  1.00 0.00 ? 106 VAL A CB   4  
ATOM 6852  C CG1  . VAL A 1 106 ? -3.012  -2.879  -3.896  1.00 0.00 ? 106 VAL A CG1  4  
ATOM 6853  C CG2  . VAL A 1 106 ? -5.366  -3.668  -4.234  1.00 0.00 ? 106 VAL A CG2  4  
ATOM 6854  H H    . VAL A 1 106 ? -4.205  -3.454  -6.861  1.00 0.00 ? 106 VAL A H    4  
ATOM 6855  H HA   . VAL A 1 106 ? -2.492  -5.243  -5.259  1.00 0.00 ? 106 VAL A HA   4  
ATOM 6856  H HB   . VAL A 1 106 ? -3.798  -4.761  -3.306  1.00 0.00 ? 106 VAL A HB   4  
ATOM 6857  H HG11 . VAL A 1 106 ? -3.596  -1.975  -3.988  1.00 0.00 ? 106 VAL A HG11 4  
ATOM 6858  H HG12 . VAL A 1 106 ? -2.592  -2.938  -2.903  1.00 0.00 ? 106 VAL A HG12 4  
ATOM 6859  H HG13 . VAL A 1 106 ? -2.215  -2.867  -4.625  1.00 0.00 ? 106 VAL A HG13 4  
ATOM 6860  H HG21 . VAL A 1 106 ? -5.547  -2.840  -3.565  1.00 0.00 ? 106 VAL A HG21 4  
ATOM 6861  H HG22 . VAL A 1 106 ? -5.591  -3.371  -5.247  1.00 0.00 ? 106 VAL A HG22 4  
ATOM 6862  H HG23 . VAL A 1 106 ? -5.996  -4.500  -3.954  1.00 0.00 ? 106 VAL A HG23 4  
ATOM 6863  N N    . GLN A 1 107 ? -4.569  -6.878  -4.740  1.00 0.00 ? 107 GLN A N    4  
ATOM 6864  C CA   . GLN A 1 107 ? -5.472  -8.015  -4.878  1.00 0.00 ? 107 GLN A CA   4  
ATOM 6865  C C    . GLN A 1 107 ? -6.233  -8.265  -3.580  1.00 0.00 ? 107 GLN A C    4  
ATOM 6866  O O    . GLN A 1 107 ? -5.670  -8.764  -2.606  1.00 0.00 ? 107 GLN A O    4  
ATOM 6867  C CB   . GLN A 1 107 ? -4.692  -9.268  -5.276  1.00 0.00 ? 107 GLN A CB   4  
ATOM 6868  C CG   . GLN A 1 107 ? -3.532  -8.990  -6.218  1.00 0.00 ? 107 GLN A CG   4  
ATOM 6869  C CD   . GLN A 1 107 ? -2.963  -10.253 -6.834  1.00 0.00 ? 107 GLN A CD   4  
ATOM 6870  O OE1  . GLN A 1 107 ? -1.822  -10.628 -6.566  1.00 0.00 ? 107 GLN A OE1  4  
ATOM 6871  N NE2  . GLN A 1 107 ? -3.759  -10.917 -7.664  1.00 0.00 ? 107 GLN A NE2  4  
ATOM 6872  H H    . GLN A 1 107 ? -4.033  -6.790  -3.926  1.00 0.00 ? 107 GLN A H    4  
ATOM 6873  H HA   . GLN A 1 107 ? -6.182  -7.781  -5.657  1.00 0.00 ? 107 GLN A HA   4  
ATOM 6874  H HB2  . GLN A 1 107 ? -4.299  -9.732  -4.383  1.00 0.00 ? 107 GLN A HB2  4  
ATOM 6875  H HB3  . GLN A 1 107 ? -5.365  -9.958  -5.763  1.00 0.00 ? 107 GLN A HB3  4  
ATOM 6876  H HG2  . GLN A 1 107 ? -3.877  -8.345  -7.013  1.00 0.00 ? 107 GLN A HG2  4  
ATOM 6877  H HG3  . GLN A 1 107 ? -2.749  -8.491  -5.667  1.00 0.00 ? 107 GLN A HG3  4  
ATOM 6878  H HE21 . GLN A 1 107 ? -4.656  -10.558 -7.831  1.00 0.00 ? 107 GLN A HE21 4  
ATOM 6879  H HE22 . GLN A 1 107 ? -3.417  -11.736 -8.077  1.00 0.00 ? 107 GLN A HE22 4  
ATOM 6880  N N    . SER A 1 108 ? -7.515  -7.915  -3.575  1.00 0.00 ? 108 SER A N    4  
ATOM 6881  C CA   . SER A 1 108 ? -8.353  -8.099  -2.395  1.00 0.00 ? 108 SER A CA   4  
ATOM 6882  C C    . SER A 1 108 ? -8.829  -9.544  -2.286  1.00 0.00 ? 108 SER A C    4  
ATOM 6883  O O    . SER A 1 108 ? -9.368  -10.106 -3.240  1.00 0.00 ? 108 SER A O    4  
ATOM 6884  C CB   . SER A 1 108 ? -9.556  -7.156  -2.446  1.00 0.00 ? 108 SER A CB   4  
ATOM 6885  O OG   . SER A 1 108 ? -9.976  -6.793  -1.142  1.00 0.00 ? 108 SER A OG   4  
ATOM 6886  H H    . SER A 1 108 ? -7.907  -7.522  -4.383  1.00 0.00 ? 108 SER A H    4  
ATOM 6887  H HA   . SER A 1 108 ? -7.757  -7.862  -1.526  1.00 0.00 ? 108 SER A HA   4  
ATOM 6888  H HB2  . SER A 1 108 ? -9.287  -6.261  -2.986  1.00 0.00 ? 108 SER A HB2  4  
ATOM 6889  H HB3  . SER A 1 108 ? -10.375 -7.648  -2.951  1.00 0.00 ? 108 SER A HB3  4  
ATOM 6890  H HG   . SER A 1 108 ? -10.332 -5.901  -1.156  1.00 0.00 ? 108 SER A HG   4  
ATOM 6891  N N    . LEU A 1 109 ? -8.626  -10.140 -1.116  1.00 0.00 ? 109 LEU A N    4  
ATOM 6892  C CA   . LEU A 1 109 ? -9.034  -11.521 -0.881  1.00 0.00 ? 109 LEU A CA   4  
ATOM 6893  C C    . LEU A 1 109 ? -10.551 -11.660 -0.954  1.00 0.00 ? 109 LEU A C    4  
ATOM 6894  O O    . LEU A 1 109 ? -11.282 -10.680 -0.811  1.00 0.00 ? 109 LEU A O    4  
ATOM 6895  C CB   . LEU A 1 109 ? -8.532  -11.996 0.484   1.00 0.00 ? 109 LEU A CB   4  
ATOM 6896  C CG   . LEU A 1 109 ? -7.153  -12.655 0.500   1.00 0.00 ? 109 LEU A CG   4  
ATOM 6897  C CD1  . LEU A 1 109 ? -6.891  -13.313 1.845   1.00 0.00 ? 109 LEU A CD1  4  
ATOM 6898  C CD2  . LEU A 1 109 ? -7.034  -13.672 -0.626  1.00 0.00 ? 109 LEU A CD2  4  
ATOM 6899  H H    . LEU A 1 109 ? -8.192  -9.642  -0.394  1.00 0.00 ? 109 LEU A H    4  
ATOM 6900  H HA   . LEU A 1 109 ? -8.591  -12.134 -1.651  1.00 0.00 ? 109 LEU A HA   4  
ATOM 6901  H HB2  . LEU A 1 109 ? -8.497  -11.140 1.140   1.00 0.00 ? 109 LEU A HB2  4  
ATOM 6902  H HB3  . LEU A 1 109 ? -9.246  -12.711 0.867   1.00 0.00 ? 109 LEU A HB3  4  
ATOM 6903  H HG   . LEU A 1 109 ? -6.397  -11.896 0.348   1.00 0.00 ? 109 LEU A HG   4  
ATOM 6904  H HD11 . LEU A 1 109 ? -6.565  -14.331 1.691   1.00 0.00 ? 109 LEU A HD11 4  
ATOM 6905  H HD12 . LEU A 1 109 ? -7.799  -13.311 2.430   1.00 0.00 ? 109 LEU A HD12 4  
ATOM 6906  H HD13 . LEU A 1 109 ? -6.123  -12.765 2.371   1.00 0.00 ? 109 LEU A HD13 4  
ATOM 6907  H HD21 . LEU A 1 109 ? -6.715  -13.173 -1.529  1.00 0.00 ? 109 LEU A HD21 4  
ATOM 6908  H HD22 . LEU A 1 109 ? -7.994  -14.138 -0.792  1.00 0.00 ? 109 LEU A HD22 4  
ATOM 6909  H HD23 . LEU A 1 109 ? -6.310  -14.426 -0.355  1.00 0.00 ? 109 LEU A HD23 4  
ATOM 6910  N N    . SER A 1 110 ? -11.018 -12.885 -1.175  1.00 0.00 ? 110 SER A N    4  
ATOM 6911  C CA   . SER A 1 110 ? -12.448 -13.153 -1.269  1.00 0.00 ? 110 SER A CA   4  
ATOM 6912  C C    . SER A 1 110 ? -13.208 -12.447 -0.150  1.00 0.00 ? 110 SER A C    4  
ATOM 6913  O O    . SER A 1 110 ? -13.239 -12.918 0.987   1.00 0.00 ? 110 SER A O    4  
ATOM 6914  C CB   . SER A 1 110 ? -12.712 -14.659 -1.208  1.00 0.00 ? 110 SER A CB   4  
ATOM 6915  O OG   . SER A 1 110 ? -14.032 -14.962 -1.624  1.00 0.00 ? 110 SER A OG   4  
ATOM 6916  H H    . SER A 1 110 ? -10.385 -13.626 -1.281  1.00 0.00 ? 110 SER A H    4  
ATOM 6917  H HA   . SER A 1 110 ? -12.795 -12.773 -2.219  1.00 0.00 ? 110 SER A HA   4  
ATOM 6918  H HB2  . SER A 1 110 ? -12.017 -15.170 -1.857  1.00 0.00 ? 110 SER A HB2  4  
ATOM 6919  H HB3  . SER A 1 110 ? -12.578 -15.004 -0.194  1.00 0.00 ? 110 SER A HB3  4  
ATOM 6920  H HG   . SER A 1 110 ? -14.006 -15.631 -2.312  1.00 0.00 ? 110 SER A HG   4  
ATOM 6921  N N    . SER A 1 111 ? -13.819 -11.314 -0.481  1.00 0.00 ? 111 SER A N    4  
ATOM 6922  C CA   . SER A 1 111 ? -14.575 -10.539 0.496   1.00 0.00 ? 111 SER A CA   4  
ATOM 6923  C C    . SER A 1 111 ? -15.376 -9.436  -0.188  1.00 0.00 ? 111 SER A C    4  
ATOM 6924  O O    . SER A 1 111 ? -15.283 -9.245  -1.401  1.00 0.00 ? 111 SER A O    4  
ATOM 6925  C CB   . SER A 1 111 ? -13.632 -9.931  1.536   1.00 0.00 ? 111 SER A CB   4  
ATOM 6926  O OG   . SER A 1 111 ? -12.469 -9.403  0.924   1.00 0.00 ? 111 SER A OG   4  
ATOM 6927  H H    . SER A 1 111 ? -13.757 -10.990 -1.404  1.00 0.00 ? 111 SER A H    4  
ATOM 6928  H HA   . SER A 1 111 ? -15.260 -11.210 0.992   1.00 0.00 ? 111 SER A HA   4  
ATOM 6929  H HB2  . SER A 1 111 ? -14.142 -9.136  2.059   1.00 0.00 ? 111 SER A HB2  4  
ATOM 6930  H HB3  . SER A 1 111 ? -13.338 -10.695 2.242   1.00 0.00 ? 111 SER A HB3  4  
ATOM 6931  H HG   . SER A 1 111 ? -11.948 -8.931  1.578   1.00 0.00 ? 111 SER A HG   4  
ATOM 6932  N N    . THR A 1 112 ? -16.164 -8.710  0.600   1.00 0.00 ? 112 THR A N    4  
ATOM 6933  C CA   . THR A 1 112 ? -16.983 -7.626  0.072   1.00 0.00 ? 112 THR A CA   4  
ATOM 6934  C C    . THR A 1 112 ? -16.825 -6.361  0.907   1.00 0.00 ? 112 THR A C    4  
ATOM 6935  O O    . THR A 1 112 ? -16.680 -6.409  2.129   1.00 0.00 ? 112 THR A O    4  
ATOM 6936  C CB   . THR A 1 112 ? -18.472 -8.017  0.028   1.00 0.00 ? 112 THR A CB   4  
ATOM 6937  O OG1  . THR A 1 112 ? -18.929 -8.351  1.344   1.00 0.00 ? 112 THR A OG1  4  
ATOM 6938  C CG2  . THR A 1 112 ? -18.695 -9.196  -0.907  1.00 0.00 ? 112 THR A CG2  4  
ATOM 6939  H H    . THR A 1 112 ? -16.195 -8.910  1.558   1.00 0.00 ? 112 THR A H    4  
ATOM 6940  H HA   . THR A 1 112 ? -16.656 -7.423  -0.938  1.00 0.00 ? 112 THR A HA   4  
ATOM 6941  H HB   . THR A 1 112 ? -19.040 -7.173  -0.338  1.00 0.00 ? 112 THR A HB   4  
ATOM 6942  H HG1  . THR A 1 112 ? -18.629 -7.684  1.966   1.00 0.00 ? 112 THR A HG1  4  
ATOM 6943  H HG21 . THR A 1 112 ? -18.015 -9.127  -1.741  1.00 0.00 ? 112 THR A HG21 4  
ATOM 6944  H HG22 . THR A 1 112 ? -19.713 -9.180  -1.270  1.00 0.00 ? 112 THR A HG22 4  
ATOM 6945  H HG23 . THR A 1 112 ? -18.518 -10.118 -0.372  1.00 0.00 ? 112 THR A HG23 4  
ATOM 6946  N N    . PRO A 1 113 ? -16.855 -5.200  0.236   1.00 0.00 ? 113 PRO A N    4  
ATOM 6947  C CA   . PRO A 1 113 ? -16.719 -3.899  0.898   1.00 0.00 ? 113 PRO A CA   4  
ATOM 6948  C C    . PRO A 1 113 ? -17.935 -3.551  1.749   1.00 0.00 ? 113 PRO A C    4  
ATOM 6949  O O    . PRO A 1 113 ? -18.748 -4.418  2.070   1.00 0.00 ? 113 PRO A O    4  
ATOM 6950  C CB   . PRO A 1 113 ? -16.586 -2.919  -0.271  1.00 0.00 ? 113 PRO A CB   4  
ATOM 6951  C CG   . PRO A 1 113 ? -17.264 -3.596  -1.412  1.00 0.00 ? 113 PRO A CG   4  
ATOM 6952  C CD   . PRO A 1 113 ? -17.026 -5.068  -1.221  1.00 0.00 ? 113 PRO A CD   4  
ATOM 6953  H HA   . PRO A 1 113 ? -15.829 -3.857  1.509   1.00 0.00 ? 113 PRO A HA   4  
ATOM 6954  H HB2  . PRO A 1 113 ? -17.070 -1.987  -0.018  1.00 0.00 ? 113 PRO A HB2  4  
ATOM 6955  H HB3  . PRO A 1 113 ? -15.541 -2.743  -0.480  1.00 0.00 ? 113 PRO A HB3  4  
ATOM 6956  H HG2  . PRO A 1 113 ? -18.321 -3.381  -1.390  1.00 0.00 ? 113 PRO A HG2  4  
ATOM 6957  H HG3  . PRO A 1 113 ? -16.831 -3.264  -2.344  1.00 0.00 ? 113 PRO A HG3  4  
ATOM 6958  H HD2  . PRO A 1 113 ? -17.879 -5.635  -1.562  1.00 0.00 ? 113 PRO A HD2  4  
ATOM 6959  H HD3  . PRO A 1 113 ? -16.132 -5.376  -1.742  1.00 0.00 ? 113 PRO A HD3  4  
ATOM 6960  N N    . ARG A 1 114 ? -18.053 -2.278  2.111   1.00 0.00 ? 114 ARG A N    4  
ATOM 6961  C CA   . ARG A 1 114 ? -19.170 -1.816  2.926   1.00 0.00 ? 114 ARG A CA   4  
ATOM 6962  C C    . ARG A 1 114 ? -19.769 -0.535  2.352   1.00 0.00 ? 114 ARG A C    4  
ATOM 6963  O O    . ARG A 1 114 ? -19.370 -0.076  1.282   1.00 0.00 ? 114 ARG A O    4  
ATOM 6964  C CB   . ARG A 1 114 ? -18.714 -1.578  4.367   1.00 0.00 ? 114 ARG A CB   4  
ATOM 6965  C CG   . ARG A 1 114 ? -18.054 -0.226  4.581   1.00 0.00 ? 114 ARG A CG   4  
ATOM 6966  C CD   . ARG A 1 114 ? -16.676 -0.171  3.942   1.00 0.00 ? 114 ARG A CD   4  
ATOM 6967  N NE   . ARG A 1 114 ? -15.800 0.787   4.610   1.00 0.00 ? 114 ARG A NE   4  
ATOM 6968  C CZ   . ARG A 1 114 ? -15.406 0.666   5.873   1.00 0.00 ? 114 ARG A CZ   4  
ATOM 6969  N NH1  . ARG A 1 114 ? -15.807 -0.368  6.600   1.00 0.00 ? 114 ARG A NH1  4  
ATOM 6970  N NH2  . ARG A 1 114 ? -14.608 1.580   6.411   1.00 0.00 ? 114 ARG A NH2  4  
ATOM 6971  H H    . ARG A 1 114 ? -17.373 -1.634  1.824   1.00 0.00 ? 114 ARG A H    4  
ATOM 6972  H HA   . ARG A 1 114 ? -19.927 -2.587  2.920   1.00 0.00 ? 114 ARG A HA   4  
ATOM 6973  H HB2  . ARG A 1 114 ? -19.573 -1.643  5.019   1.00 0.00 ? 114 ARG A HB2  4  
ATOM 6974  H HB3  . ARG A 1 114 ? -18.007 -2.347  4.639   1.00 0.00 ? 114 ARG A HB3  4  
ATOM 6975  H HG2  . ARG A 1 114 ? -18.674 0.541   4.140   1.00 0.00 ? 114 ARG A HG2  4  
ATOM 6976  H HG3  . ARG A 1 114 ? -17.957 -0.048  5.642   1.00 0.00 ? 114 ARG A HG3  4  
ATOM 6977  H HD2  . ARG A 1 114 ? -16.229 -1.152  3.997   1.00 0.00 ? 114 ARG A HD2  4  
ATOM 6978  H HD3  . ARG A 1 114 ? -16.786 0.116   2.907   1.00 0.00 ? 114 ARG A HD3  4  
ATOM 6979  H HE   . ARG A 1 114 ? -15.492 1.559   4.091   1.00 0.00 ? 114 ARG A HE   4  
ATOM 6980  H HH11 . ARG A 1 114 ? -16.408 -1.058  6.197   1.00 0.00 ? 114 ARG A HH11 4  
ATOM 6981  H HH12 . ARG A 1 114 ? -15.508 -0.457  7.550   1.00 0.00 ? 114 ARG A HH12 4  
ATOM 6982  H HH21 . ARG A 1 114 ? -14.303 2.360   5.866   1.00 0.00 ? 114 ARG A HH21 4  
ATOM 6983  H HH22 . ARG A 1 114 ? -14.312 1.488   7.361   1.00 0.00 ? 114 ARG A HH22 4  
ATOM 6984  N N    . VAL A 1 115 ? -20.729 0.038   3.072   1.00 0.00 ? 115 VAL A N    4  
ATOM 6985  C CA   . VAL A 1 115 ? -21.382 1.266   2.635   1.00 0.00 ? 115 VAL A CA   4  
ATOM 6986  C C    . VAL A 1 115 ? -21.001 2.439   3.531   1.00 0.00 ? 115 VAL A C    4  
ATOM 6987  O O    . VAL A 1 115 ? -20.378 2.257   4.577   1.00 0.00 ? 115 VAL A O    4  
ATOM 6988  C CB   . VAL A 1 115 ? -22.915 1.115   2.630   1.00 0.00 ? 115 VAL A CB   4  
ATOM 6989  C CG1  . VAL A 1 115 ? -23.547 2.122   1.681   1.00 0.00 ? 115 VAL A CG1  4  
ATOM 6990  C CG2  . VAL A 1 115 ? -23.309 -0.305  2.253   1.00 0.00 ? 115 VAL A CG2  4  
ATOM 6991  H H    . VAL A 1 115 ? -21.004 -0.376  3.917   1.00 0.00 ? 115 VAL A H    4  
ATOM 6992  H HA   . VAL A 1 115 ? -21.058 1.476   1.626   1.00 0.00 ? 115 VAL A HA   4  
ATOM 6993  H HB   . VAL A 1 115 ? -23.279 1.315   3.627   1.00 0.00 ? 115 VAL A HB   4  
ATOM 6994  H HG11 . VAL A 1 115 ? -22.893 2.280   0.836   1.00 0.00 ? 115 VAL A HG11 4  
ATOM 6995  H HG12 . VAL A 1 115 ? -24.498 1.744   1.336   1.00 0.00 ? 115 VAL A HG12 4  
ATOM 6996  H HG13 . VAL A 1 115 ? -23.698 3.058   2.199   1.00 0.00 ? 115 VAL A HG13 4  
ATOM 6997  H HG21 . VAL A 1 115 ? -24.376 -0.355  2.101   1.00 0.00 ? 115 VAL A HG21 4  
ATOM 6998  H HG22 . VAL A 1 115 ? -22.801 -0.589  1.343   1.00 0.00 ? 115 VAL A HG22 4  
ATOM 6999  H HG23 . VAL A 1 115 ? -23.027 -0.980  3.048   1.00 0.00 ? 115 VAL A HG23 4  
ATOM 7000  N N    . ILE A 1 116 ? -21.379 3.642   3.113   1.00 0.00 ? 116 ILE A N    4  
ATOM 7001  C CA   . ILE A 1 116 ? -21.078 4.846   3.879   1.00 0.00 ? 116 ILE A CA   4  
ATOM 7002  C C    . ILE A 1 116 ? -22.352 5.487   4.418   1.00 0.00 ? 116 ILE A C    4  
ATOM 7003  O O    . ILE A 1 116 ? -23.452 5.264   3.911   1.00 0.00 ? 116 ILE A O    4  
ATOM 7004  C CB   . ILE A 1 116 ? -20.317 5.879   3.027   1.00 0.00 ? 116 ILE A CB   4  
ATOM 7005  C CG1  . ILE A 1 116 ? -20.797 5.828   1.575   1.00 0.00 ? 116 ILE A CG1  4  
ATOM 7006  C CG2  . ILE A 1 116 ? -18.819 5.629   3.105   1.00 0.00 ? 116 ILE A CG2  4  
ATOM 7007  C CD1  . ILE A 1 116 ? -20.179 6.894   0.697   1.00 0.00 ? 116 ILE A CD1  4  
ATOM 7008  H H    . ILE A 1 116 ? -21.873 3.723   2.271   1.00 0.00 ? 116 ILE A H    4  
ATOM 7009  H HA   . ILE A 1 116 ? -20.450 4.562   4.711   1.00 0.00 ? 116 ILE A HA   4  
ATOM 7010  H HB   . ILE A 1 116 ? -20.515 6.860   3.430   1.00 0.00 ? 116 ILE A HB   4  
ATOM 7011  H HG12 . ILE A 1 116 ? -20.548 4.867   1.154   1.00 0.00 ? 116 ILE A HG12 4  
ATOM 7012  H HG13 . ILE A 1 116 ? -21.869 5.960   1.553   1.00 0.00 ? 116 ILE A HG13 4  
ATOM 7013  H HG21 . ILE A 1 116 ? -18.347 6.435   3.647   1.00 0.00 ? 116 ILE A HG21 4  
ATOM 7014  H HG22 . ILE A 1 116 ? -18.636 4.697   3.618   1.00 0.00 ? 116 ILE A HG22 4  
ATOM 7015  H HG23 . ILE A 1 116 ? -18.409 5.578   2.107   1.00 0.00 ? 116 ILE A HG23 4  
ATOM 7016  H HD11 . ILE A 1 116 ? -20.754 6.988   -0.213  1.00 0.00 ? 116 ILE A HD11 4  
ATOM 7017  H HD12 . ILE A 1 116 ? -20.179 7.838   1.222   1.00 0.00 ? 116 ILE A HD12 4  
ATOM 7018  H HD13 . ILE A 1 116 ? -19.164 6.617   0.454   1.00 0.00 ? 116 ILE A HD13 4  
ATOM 7019  N N    . PRO A 1 117 ? -22.203 6.305   5.470   1.00 0.00 ? 117 PRO A N    4  
ATOM 7020  C CA   . PRO A 1 117 ? -23.331 6.998   6.100   1.00 0.00 ? 117 PRO A CA   4  
ATOM 7021  C C    . PRO A 1 117 ? -23.911 8.091   5.209   1.00 0.00 ? 117 PRO A C    4  
ATOM 7022  O O    . PRO A 1 117 ? -24.838 7.848   4.436   1.00 0.00 ? 117 PRO A O    4  
ATOM 7023  C CB   . PRO A 1 117 ? -22.713 7.609   7.361   1.00 0.00 ? 117 PRO A CB   4  
ATOM 7024  C CG   . PRO A 1 117 ? -21.267 7.763   7.037   1.00 0.00 ? 117 PRO A CG   4  
ATOM 7025  C CD   . PRO A 1 117 ? -20.922 6.617   6.126   1.00 0.00 ? 117 PRO A CD   4  
ATOM 7026  H HA   . PRO A 1 117 ? -24.115 6.309   6.379   1.00 0.00 ? 117 PRO A HA   4  
ATOM 7027  H HB2  . PRO A 1 117 ? -23.177 8.563   7.566   1.00 0.00 ? 117 PRO A HB2  4  
ATOM 7028  H HB3  . PRO A 1 117 ? -22.862 6.943   8.197   1.00 0.00 ? 117 PRO A HB3  4  
ATOM 7029  H HG2  . PRO A 1 117 ? -21.101 8.704   6.536   1.00 0.00 ? 117 PRO A HG2  4  
ATOM 7030  H HG3  . PRO A 1 117 ? -20.681 7.710   7.943   1.00 0.00 ? 117 PRO A HG3  4  
ATOM 7031  H HD2  . PRO A 1 117 ? -20.182 6.921   5.401   1.00 0.00 ? 117 PRO A HD2  4  
ATOM 7032  H HD3  . PRO A 1 117 ? -20.568 5.773   6.699   1.00 0.00 ? 117 PRO A HD3  4  
ATOM 7033  N N    . GLY A 1 1   ? 15.129  -36.286 4.142   1.00 0.00 ? 1   GLY A N    5  
ATOM 7034  C CA   . GLY A 1 1   ? 14.211  -35.279 4.640   1.00 0.00 ? 1   GLY A CA   5  
ATOM 7035  C C    . GLY A 1 1   ? 13.630  -34.424 3.531   1.00 0.00 ? 1   GLY A C    5  
ATOM 7036  O O    . GLY A 1 1   ? 14.345  -34.012 2.617   1.00 0.00 ? 1   GLY A O    5  
ATOM 7037  H H1   . GLY A 1 1   ? 15.968  -36.013 3.715   1.00 0.00 ? 1   GLY A H1   5  
ATOM 7038  H HA2  . GLY A 1 1   ? 13.403  -35.771 5.162   1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7039  H HA3  . GLY A 1 1   ? 14.737  -34.640 5.334   1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7040  N N    . SER A 1 2   ? 12.330  -34.158 3.610   1.00 0.00 ? 2   SER A N    5  
ATOM 7041  C CA   . SER A 1 2   ? 11.653  -33.352 2.601   1.00 0.00 ? 2   SER A CA   5  
ATOM 7042  C C    . SER A 1 2   ? 10.727  -32.330 3.255   1.00 0.00 ? 2   SER A C    5  
ATOM 7043  O O    . SER A 1 2   ? 10.646  -32.244 4.480   1.00 0.00 ? 2   SER A O    5  
ATOM 7044  C CB   . SER A 1 2   ? 10.854  -34.248 1.653   1.00 0.00 ? 2   SER A CB   5  
ATOM 7045  O OG   . SER A 1 2   ? 11.539  -35.462 1.401   1.00 0.00 ? 2   SER A OG   5  
ATOM 7046  H H    . SER A 1 2   ? 11.814  -34.516 4.363   1.00 0.00 ? 2   SER A H    5  
ATOM 7047  H HA   . SER A 1 2   ? 12.408  -32.826 2.035   1.00 0.00 ? 2   SER A HA   5  
ATOM 7048  H HB2  . SER A 1 2   ? 9.896   -34.474 2.097   1.00 0.00 ? 2   SER A HB2  5  
ATOM 7049  H HB3  . SER A 1 2   ? 10.703  -33.732 0.716   1.00 0.00 ? 2   SER A HB3  5  
ATOM 7050  H HG   . SER A 1 2   ? 11.085  -35.948 0.708   1.00 0.00 ? 2   SER A HG   5  
ATOM 7051  N N    . SER A 1 3   ? 10.032  -31.557 2.427   1.00 0.00 ? 3   SER A N    5  
ATOM 7052  C CA   . SER A 1 3   ? 9.114   -30.537 2.923   1.00 0.00 ? 3   SER A CA   5  
ATOM 7053  C C    . SER A 1 3   ? 7.799   -30.568 2.151   1.00 0.00 ? 3   SER A C    5  
ATOM 7054  O O    . SER A 1 3   ? 7.784   -30.759 0.936   1.00 0.00 ? 3   SER A O    5  
ATOM 7055  C CB   . SER A 1 3   ? 9.751   -29.151 2.813   1.00 0.00 ? 3   SER A CB   5  
ATOM 7056  O OG   . SER A 1 3   ? 9.798   -28.717 1.465   1.00 0.00 ? 3   SER A OG   5  
ATOM 7057  H H    . SER A 1 3   ? 10.140  -31.673 1.460   1.00 0.00 ? 3   SER A H    5  
ATOM 7058  H HA   . SER A 1 3   ? 8.913   -30.750 3.963   1.00 0.00 ? 3   SER A HA   5  
ATOM 7059  H HB2  . SER A 1 3   ? 9.170   -28.444 3.386   1.00 0.00 ? 3   SER A HB2  5  
ATOM 7060  H HB3  . SER A 1 3   ? 10.758  -29.188 3.203   1.00 0.00 ? 3   SER A HB3  5  
ATOM 7061  H HG   . SER A 1 3   ? 9.512   -27.802 1.413   1.00 0.00 ? 3   SER A HG   5  
ATOM 7062  N N    . GLY A 1 4   ? 6.695   -30.379 2.867   1.00 0.00 ? 4   GLY A N    5  
ATOM 7063  C CA   . GLY A 1 4   ? 5.389   -30.389 2.233   1.00 0.00 ? 4   GLY A CA   5  
ATOM 7064  C C    . GLY A 1 4   ? 4.394   -29.491 2.941   1.00 0.00 ? 4   GLY A C    5  
ATOM 7065  O O    . GLY A 1 4   ? 4.236   -29.568 4.160   1.00 0.00 ? 4   GLY A O    5  
ATOM 7066  H H    . GLY A 1 4   ? 6.767   -30.232 3.833   1.00 0.00 ? 4   GLY A H    5  
ATOM 7067  H HA2  . GLY A 1 4   ? 5.494   -30.057 1.211   1.00 0.00 ? 4   GLY A HA2  5  
ATOM 7068  H HA3  . GLY A 1 4   ? 5.008   -31.400 2.235   1.00 0.00 ? 4   GLY A HA3  5  
ATOM 7069  N N    . SER A 1 5   ? 3.723   -28.635 2.177   1.00 0.00 ? 5   SER A N    5  
ATOM 7070  C CA   . SER A 1 5   ? 2.742   -27.714 2.740   1.00 0.00 ? 5   SER A CA   5  
ATOM 7071  C C    . SER A 1 5   ? 1.403   -27.841 2.020   1.00 0.00 ? 5   SER A C    5  
ATOM 7072  O O    . SER A 1 5   ? 1.345   -27.847 0.790   1.00 0.00 ? 5   SER A O    5  
ATOM 7073  C CB   . SER A 1 5   ? 3.251   -26.275 2.646   1.00 0.00 ? 5   SER A CB   5  
ATOM 7074  O OG   . SER A 1 5   ? 3.914   -26.047 1.414   1.00 0.00 ? 5   SER A OG   5  
ATOM 7075  H H    . SER A 1 5   ? 3.894   -28.621 1.212   1.00 0.00 ? 5   SER A H    5  
ATOM 7076  H HA   . SER A 1 5   ? 2.605   -27.971 3.779   1.00 0.00 ? 5   SER A HA   5  
ATOM 7077  H HB2  . SER A 1 5   ? 2.415   -25.595 2.721   1.00 0.00 ? 5   SER A HB2  5  
ATOM 7078  H HB3  . SER A 1 5   ? 3.942   -26.086 3.454   1.00 0.00 ? 5   SER A HB3  5  
ATOM 7079  H HG   . SER A 1 5   ? 3.308   -26.212 0.688   1.00 0.00 ? 5   SER A HG   5  
ATOM 7080  N N    . SER A 1 6   ? 0.328   -27.942 2.796   1.00 0.00 ? 6   SER A N    5  
ATOM 7081  C CA   . SER A 1 6   ? -1.011  -28.072 2.234   1.00 0.00 ? 6   SER A CA   5  
ATOM 7082  C C    . SER A 1 6   ? -1.998  -27.170 2.969   1.00 0.00 ? 6   SER A C    5  
ATOM 7083  O O    . SER A 1 6   ? -1.748  -26.745 4.096   1.00 0.00 ? 6   SER A O    5  
ATOM 7084  C CB   . SER A 1 6   ? -1.479  -29.527 2.308   1.00 0.00 ? 6   SER A CB   5  
ATOM 7085  O OG   . SER A 1 6   ? -2.098  -29.801 3.553   1.00 0.00 ? 6   SER A OG   5  
ATOM 7086  H H    . SER A 1 6   ? 0.440   -27.930 3.770   1.00 0.00 ? 6   SER A H    5  
ATOM 7087  H HA   . SER A 1 6   ? -0.967  -27.769 1.199   1.00 0.00 ? 6   SER A HA   5  
ATOM 7088  H HB2  . SER A 1 6   ? -2.189  -29.715 1.518   1.00 0.00 ? 6   SER A HB2  5  
ATOM 7089  H HB3  . SER A 1 6   ? -0.627  -30.182 2.191   1.00 0.00 ? 6   SER A HB3  5  
ATOM 7090  H HG   . SER A 1 6   ? -2.580  -30.629 3.496   1.00 0.00 ? 6   SER A HG   5  
ATOM 7091  N N    . GLY A 1 7   ? -3.123  -26.883 2.320   1.00 0.00 ? 7   GLY A N    5  
ATOM 7092  C CA   . GLY A 1 7   ? -4.132  -26.033 2.926   1.00 0.00 ? 7   GLY A CA   5  
ATOM 7093  C C    . GLY A 1 7   ? -4.988  -25.324 1.895   1.00 0.00 ? 7   GLY A C    5  
ATOM 7094  O O    . GLY A 1 7   ? -4.867  -24.118 1.680   1.00 0.00 ? 7   GLY A O    5  
ATOM 7095  H H    . GLY A 1 7   ? -3.268  -27.250 1.423   1.00 0.00 ? 7   GLY A H    5  
ATOM 7096  H HA2  . GLY A 1 7   ? -4.769  -26.640 3.552   1.00 0.00 ? 7   GLY A HA2  5  
ATOM 7097  H HA3  . GLY A 1 7   ? -3.641  -25.292 3.540   1.00 0.00 ? 7   GLY A HA3  5  
ATOM 7098  N N    . PRO A 1 8   ? -5.876  -26.082 1.235   1.00 0.00 ? 8   PRO A N    5  
ATOM 7099  C CA   . PRO A 1 8   ? -6.772  -25.540 0.209   1.00 0.00 ? 8   PRO A CA   5  
ATOM 7100  C C    . PRO A 1 8   ? -7.841  -24.627 0.797   1.00 0.00 ? 8   PRO A C    5  
ATOM 7101  O O    . PRO A 1 8   ? -7.933  -24.466 2.014   1.00 0.00 ? 8   PRO A O    5  
ATOM 7102  C CB   . PRO A 1 8   ? -7.412  -26.791 -0.399  1.00 0.00 ? 8   PRO A CB   5  
ATOM 7103  C CG   . PRO A 1 8   ? -7.338  -27.817 0.678   1.00 0.00 ? 8   PRO A CG   5  
ATOM 7104  C CD   . PRO A 1 8   ? -6.074  -27.527 1.440   1.00 0.00 ? 8   PRO A CD   5  
ATOM 7105  H HA   . PRO A 1 8   ? -6.224  -25.007 -0.554  1.00 0.00 ? 8   PRO A HA   5  
ATOM 7106  H HB2  . PRO A 1 8   ? -8.435  -26.577 -0.673  1.00 0.00 ? 8   PRO A HB2  5  
ATOM 7107  H HB3  . PRO A 1 8   ? -6.855  -27.096 -1.273  1.00 0.00 ? 8   PRO A HB3  5  
ATOM 7108  H HG2  . PRO A 1 8   ? -8.195  -27.729 1.328   1.00 0.00 ? 8   PRO A HG2  5  
ATOM 7109  H HG3  . PRO A 1 8   ? -7.294  -28.804 0.242   1.00 0.00 ? 8   PRO A HG3  5  
ATOM 7110  H HD2  . PRO A 1 8   ? -6.204  -27.754 2.488   1.00 0.00 ? 8   PRO A HD2  5  
ATOM 7111  H HD3  . PRO A 1 8   ? -5.249  -28.091 1.030   1.00 0.00 ? 8   PRO A HD3  5  
ATOM 7112  N N    . ASN A 1 9   ? -8.649  -24.031 -0.074  1.00 0.00 ? 9   ASN A N    5  
ATOM 7113  C CA   . ASN A 1 9   ? -9.713  -23.133 0.360   1.00 0.00 ? 9   ASN A CA   5  
ATOM 7114  C C    . ASN A 1 9   ? -9.198  -22.142 1.400   1.00 0.00 ? 9   ASN A C    5  
ATOM 7115  O O    . ASN A 1 9   ? -9.757  -22.024 2.491   1.00 0.00 ? 9   ASN A O    5  
ATOM 7116  C CB   . ASN A 1 9   ? -10.881 -23.935 0.938   1.00 0.00 ? 9   ASN A CB   5  
ATOM 7117  C CG   . ASN A 1 9   ? -12.136 -23.097 1.094   1.00 0.00 ? 9   ASN A CG   5  
ATOM 7118  O OD1  . ASN A 1 9   ? -12.496 -22.699 2.202   1.00 0.00 ? 9   ASN A OD1  5  
ATOM 7119  N ND2  . ASN A 1 9   ? -12.808 -22.826 -0.019  1.00 0.00 ? 9   ASN A ND2  5  
ATOM 7120  H H    . ASN A 1 9   ? -8.526  -24.199 -1.032  1.00 0.00 ? 9   ASN A H    5  
ATOM 7121  H HA   . ASN A 1 9   ? -10.056 -22.584 -0.504  1.00 0.00 ? 9   ASN A HA   5  
ATOM 7122  H HB2  . ASN A 1 9   ? -11.103 -24.761 0.278   1.00 0.00 ? 9   ASN A HB2  5  
ATOM 7123  H HB3  . ASN A 1 9   ? -10.603 -24.318 1.908   1.00 0.00 ? 9   ASN A HB3  5  
ATOM 7124  H HD21 . ASN A 1 9   ? -12.462 -23.176 -0.866  1.00 0.00 ? 9   ASN A HD21 5  
ATOM 7125  H HD22 . ASN A 1 9   ? -13.623 -22.286 0.053   1.00 0.00 ? 9   ASN A HD22 5  
ATOM 7126  N N    . PHE A 1 10  ? -8.129  -21.432 1.055   1.00 0.00 ? 10  PHE A N    5  
ATOM 7127  C CA   . PHE A 1 10  ? -7.538  -20.452 1.958   1.00 0.00 ? 10  PHE A CA   5  
ATOM 7128  C C    . PHE A 1 10  ? -6.634  -19.487 1.196   1.00 0.00 ? 10  PHE A C    5  
ATOM 7129  O O    . PHE A 1 10  ? -6.151  -19.799 0.108   1.00 0.00 ? 10  PHE A O    5  
ATOM 7130  C CB   . PHE A 1 10  ? -6.740  -21.156 3.057   1.00 0.00 ? 10  PHE A CB   5  
ATOM 7131  C CG   . PHE A 1 10  ? -6.045  -20.209 3.993   1.00 0.00 ? 10  PHE A CG   5  
ATOM 7132  C CD1  . PHE A 1 10  ? -6.753  -19.210 4.642   1.00 0.00 ? 10  PHE A CD1  5  
ATOM 7133  C CD2  . PHE A 1 10  ? -4.683  -20.317 4.223   1.00 0.00 ? 10  PHE A CD2  5  
ATOM 7134  C CE1  . PHE A 1 10  ? -6.116  -18.337 5.504   1.00 0.00 ? 10  PHE A CE1  5  
ATOM 7135  C CE2  . PHE A 1 10  ? -4.041  -19.447 5.084   1.00 0.00 ? 10  PHE A CE2  5  
ATOM 7136  C CZ   . PHE A 1 10  ? -4.758  -18.455 5.725   1.00 0.00 ? 10  PHE A CZ   5  
ATOM 7137  H H    . PHE A 1 10  ? -7.728  -21.572 0.171   1.00 0.00 ? 10  PHE A H    5  
ATOM 7138  H HA   . PHE A 1 10  ? -8.342  -19.892 2.410   1.00 0.00 ? 10  PHE A HA   5  
ATOM 7139  H HB2  . PHE A 1 10  ? -7.410  -21.767 3.643   1.00 0.00 ? 10  PHE A HB2  5  
ATOM 7140  H HB3  . PHE A 1 10  ? -5.991  -21.785 2.602   1.00 0.00 ? 10  PHE A HB3  5  
ATOM 7141  H HD1  . PHE A 1 10  ? -7.816  -19.117 4.470   1.00 0.00 ? 10  PHE A HD1  5  
ATOM 7142  H HD2  . PHE A 1 10  ? -4.120  -21.091 3.723   1.00 0.00 ? 10  PHE A HD2  5  
ATOM 7143  H HE1  . PHE A 1 10  ? -6.680  -17.563 6.003   1.00 0.00 ? 10  PHE A HE1  5  
ATOM 7144  H HE2  . PHE A 1 10  ? -2.979  -19.541 5.255   1.00 0.00 ? 10  PHE A HE2  5  
ATOM 7145  H HZ   . PHE A 1 10  ? -4.259  -17.775 6.398   1.00 0.00 ? 10  PHE A HZ   5  
ATOM 7146  N N    . SER A 1 11  ? -6.410  -18.312 1.777   1.00 0.00 ? 11  SER A N    5  
ATOM 7147  C CA   . SER A 1 11  ? -5.568  -17.299 1.152   1.00 0.00 ? 11  SER A CA   5  
ATOM 7148  C C    . SER A 1 11  ? -5.729  -17.318 -0.365  1.00 0.00 ? 11  SER A C    5  
ATOM 7149  O O    . SER A 1 11  ? -4.746  -17.367 -1.105  1.00 0.00 ? 11  SER A O    5  
ATOM 7150  C CB   . SER A 1 11  ? -4.101  -17.525 1.523   1.00 0.00 ? 11  SER A CB   5  
ATOM 7151  O OG   . SER A 1 11  ? -3.798  -18.908 1.586   1.00 0.00 ? 11  SER A OG   5  
ATOM 7152  H H    . SER A 1 11  ? -6.823  -18.122 2.645   1.00 0.00 ? 11  SER A H    5  
ATOM 7153  H HA   . SER A 1 11  ? -5.879  -16.334 1.524   1.00 0.00 ? 11  SER A HA   5  
ATOM 7154  H HB2  . SER A 1 11  ? -3.469  -17.064 0.780   1.00 0.00 ? 11  SER A HB2  5  
ATOM 7155  H HB3  . SER A 1 11  ? -3.904  -17.081 2.488   1.00 0.00 ? 11  SER A HB3  5  
ATOM 7156  H HG   . SER A 1 11  ? -2.846  -19.028 1.586   1.00 0.00 ? 11  SER A HG   5  
ATOM 7157  N N    . HIS A 1 12  ? -6.977  -17.279 -0.821  1.00 0.00 ? 12  HIS A N    5  
ATOM 7158  C CA   . HIS A 1 12  ? -7.269  -17.292 -2.250  1.00 0.00 ? 12  HIS A CA   5  
ATOM 7159  C C    . HIS A 1 12  ? -7.229  -15.879 -2.825  1.00 0.00 ? 12  HIS A C    5  
ATOM 7160  O O    . HIS A 1 12  ? -8.220  -15.150 -2.777  1.00 0.00 ? 12  HIS A O    5  
ATOM 7161  C CB   . HIS A 1 12  ? -8.639  -17.920 -2.507  1.00 0.00 ? 12  HIS A CB   5  
ATOM 7162  C CG   . HIS A 1 12  ? -8.588  -19.401 -2.721  1.00 0.00 ? 12  HIS A CG   5  
ATOM 7163  N ND1  . HIS A 1 12  ? -7.603  -20.021 -3.461  1.00 0.00 ? 12  HIS A ND1  5  
ATOM 7164  C CD2  . HIS A 1 12  ? -9.407  -20.388 -2.287  1.00 0.00 ? 12  HIS A CD2  5  
ATOM 7165  C CE1  . HIS A 1 12  ? -7.819  -21.324 -3.473  1.00 0.00 ? 12  HIS A CE1  5  
ATOM 7166  N NE2  . HIS A 1 12  ? -8.908  -21.573 -2.768  1.00 0.00 ? 12  HIS A NE2  5  
ATOM 7167  H H    . HIS A 1 12  ? -7.719  -17.241 -0.182  1.00 0.00 ? 12  HIS A H    5  
ATOM 7168  H HA   . HIS A 1 12  ? -6.513  -17.887 -2.738  1.00 0.00 ? 12  HIS A HA   5  
ATOM 7169  H HB2  . HIS A 1 12  ? -9.280  -17.730 -1.658  1.00 0.00 ? 12  HIS A HB2  5  
ATOM 7170  H HB3  . HIS A 1 12  ? -9.075  -17.471 -3.388  1.00 0.00 ? 12  HIS A HB3  5  
ATOM 7171  H HD1  . HIS A 1 12  ? -6.857  -19.572 -3.910  1.00 0.00 ? 12  HIS A HD1  5  
ATOM 7172  H HD2  . HIS A 1 12  ? -10.291 -20.266 -1.676  1.00 0.00 ? 12  HIS A HD2  5  
ATOM 7173  H HE1  . HIS A 1 12  ? -7.209  -22.061 -3.974  1.00 0.00 ? 12  HIS A HE1  5  
ATOM 7174  N N    . TRP A 1 13  ? -6.077  -15.499 -3.367  1.00 0.00 ? 13  TRP A N    5  
ATOM 7175  C CA   . TRP A 1 13  ? -5.908  -14.173 -3.951  1.00 0.00 ? 13  TRP A CA   5  
ATOM 7176  C C    . TRP A 1 13  ? -6.386  -14.150 -5.398  1.00 0.00 ? 13  TRP A C    5  
ATOM 7177  O O    . TRP A 1 13  ? -5.770  -14.755 -6.275  1.00 0.00 ? 13  TRP A O    5  
ATOM 7178  C CB   . TRP A 1 13  ? -4.441  -13.745 -3.878  1.00 0.00 ? 13  TRP A CB   5  
ATOM 7179  C CG   . TRP A 1 13  ? -3.925  -13.628 -2.476  1.00 0.00 ? 13  TRP A CG   5  
ATOM 7180  C CD1  . TRP A 1 13  ? -3.487  -14.645 -1.677  1.00 0.00 ? 13  TRP A CD1  5  
ATOM 7181  C CD2  . TRP A 1 13  ? -3.796  -12.427 -1.708  1.00 0.00 ? 13  TRP A CD2  5  
ATOM 7182  N NE1  . TRP A 1 13  ? -3.093  -14.148 -0.458  1.00 0.00 ? 13  TRP A NE1  5  
ATOM 7183  C CE2  . TRP A 1 13  ? -3.272  -12.790 -0.452  1.00 0.00 ? 13  TRP A CE2  5  
ATOM 7184  C CE3  . TRP A 1 13  ? -4.071  -11.080 -1.959  1.00 0.00 ? 13  TRP A CE3  5  
ATOM 7185  C CZ2  . TRP A 1 13  ? -3.019  -11.854 0.548   1.00 0.00 ? 13  TRP A CZ2  5  
ATOM 7186  C CZ3  . TRP A 1 13  ? -3.820  -10.153 -0.966  1.00 0.00 ? 13  TRP A CZ3  5  
ATOM 7187  C CH2  . TRP A 1 13  ? -3.297  -10.542 0.274   1.00 0.00 ? 13  TRP A CH2  5  
ATOM 7188  H H    . TRP A 1 13  ? -5.323  -16.125 -3.376  1.00 0.00 ? 13  TRP A H    5  
ATOM 7189  H HA   . TRP A 1 13  ? -6.505  -13.481 -3.375  1.00 0.00 ? 13  TRP A HA   5  
ATOM 7190  H HB2  . TRP A 1 13  ? -3.835  -14.472 -4.397  1.00 0.00 ? 13  TRP A HB2  5  
ATOM 7191  H HB3  . TRP A 1 13  ? -4.331  -12.783 -4.356  1.00 0.00 ? 13  TRP A HB3  5  
ATOM 7192  H HD1  . TRP A 1 13  ? -3.461  -15.683 -1.972  1.00 0.00 ? 13  TRP A HD1  5  
ATOM 7193  H HE1  . TRP A 1 13  ? -2.739  -14.680 0.286   1.00 0.00 ? 13  TRP A HE1  5  
ATOM 7194  H HE3  . TRP A 1 13  ? -4.474  -10.760 -2.909  1.00 0.00 ? 13  TRP A HE3  5  
ATOM 7195  H HZ2  . TRP A 1 13  ? -2.616  -12.139 1.509   1.00 0.00 ? 13  TRP A HZ2  5  
ATOM 7196  H HZ3  . TRP A 1 13  ? -4.026  -9.107  -1.142  1.00 0.00 ? 13  TRP A HZ3  5  
ATOM 7197  H HH2  . TRP A 1 13  ? -3.117  -9.784  1.020   1.00 0.00 ? 13  TRP A HH2  5  
ATOM 7198  N N    . GLY A 1 14  ? -7.489  -13.448 -5.642  1.00 0.00 ? 14  GLY A N    5  
ATOM 7199  C CA   . GLY A 1 14  ? -8.030  -13.360 -6.985  1.00 0.00 ? 14  GLY A CA   5  
ATOM 7200  C C    . GLY A 1 14  ? -7.156  -12.537 -7.910  1.00 0.00 ? 14  GLY A C    5  
ATOM 7201  O O    . GLY A 1 14  ? -5.986  -12.278 -7.626  1.00 0.00 ? 14  GLY A O    5  
ATOM 7202  H H    . GLY A 1 14  ? -7.938  -12.986 -4.903  1.00 0.00 ? 14  GLY A H    5  
ATOM 7203  H HA2  . GLY A 1 14  ? -8.126  -14.357 -7.389  1.00 0.00 ? 14  GLY A HA2  5  
ATOM 7204  H HA3  . GLY A 1 14  ? -9.010  -12.907 -6.937  1.00 0.00 ? 14  GLY A HA3  5  
ATOM 7205  N N    . PRO A 1 15  ? -7.726  -12.112 -9.047  1.00 0.00 ? 15  PRO A N    5  
ATOM 7206  C CA   . PRO A 1 15  ? -7.008  -11.308 -10.041 1.00 0.00 ? 15  PRO A CA   5  
ATOM 7207  C C    . PRO A 1 15  ? -6.718  -9.896  -9.544  1.00 0.00 ? 15  PRO A C    5  
ATOM 7208  O O    . PRO A 1 15  ? -7.374  -9.385  -8.636  1.00 0.00 ? 15  PRO A O    5  
ATOM 7209  C CB   . PRO A 1 15  ? -7.971  -11.269 -11.229 1.00 0.00 ? 15  PRO A CB   5  
ATOM 7210  C CG   . PRO A 1 15  ? -9.320  -11.473 -10.631 1.00 0.00 ? 15  PRO A CG   5  
ATOM 7211  C CD   . PRO A 1 15  ? -9.116  -12.383 -9.451  1.00 0.00 ? 15  PRO A CD   5  
ATOM 7212  H HA   . PRO A 1 15  ? -6.083  -11.780 -10.340 1.00 0.00 ? 15  PRO A HA   5  
ATOM 7213  H HB2  . PRO A 1 15  ? -7.899  -10.311 -11.724 1.00 0.00 ? 15  PRO A HB2  5  
ATOM 7214  H HB3  . PRO A 1 15  ? -7.724  -12.058 -11.924 1.00 0.00 ? 15  PRO A HB3  5  
ATOM 7215  H HG2  . PRO A 1 15  ? -9.726  -10.527 -10.308 1.00 0.00 ? 15  PRO A HG2  5  
ATOM 7216  H HG3  . PRO A 1 15  ? -9.975  -11.938 -11.353 1.00 0.00 ? 15  PRO A HG3  5  
ATOM 7217  H HD2  . PRO A 1 15  ? -9.804  -12.133 -8.657  1.00 0.00 ? 15  PRO A HD2  5  
ATOM 7218  H HD3  . PRO A 1 15  ? -9.237  -13.416 -9.745  1.00 0.00 ? 15  PRO A HD3  5  
ATOM 7219  N N    . PRO A 1 16  ? -5.712  -9.249  -10.151 1.00 0.00 ? 16  PRO A N    5  
ATOM 7220  C CA   . PRO A 1 16  ? -5.314  -7.886  -9.787  1.00 0.00 ? 16  PRO A CA   5  
ATOM 7221  C C    . PRO A 1 16  ? -6.356  -6.849  -10.192 1.00 0.00 ? 16  PRO A C    5  
ATOM 7222  O O    . PRO A 1 16  ? -7.216  -7.115  -11.031 1.00 0.00 ? 16  PRO A O    5  
ATOM 7223  C CB   . PRO A 1 16  ? -4.016  -7.674  -10.571 1.00 0.00 ? 16  PRO A CB   5  
ATOM 7224  C CG   . PRO A 1 16  ? -4.121  -8.601  -11.733 1.00 0.00 ? 16  PRO A CG   5  
ATOM 7225  C CD   . PRO A 1 16  ? -4.888  -9.797  -11.241 1.00 0.00 ? 16  PRO A CD   5  
ATOM 7226  H HA   . PRO A 1 16  ? -5.115  -7.800  -8.729  1.00 0.00 ? 16  PRO A HA   5  
ATOM 7227  H HB2  . PRO A 1 16  ? -3.950  -6.644  -10.892 1.00 0.00 ? 16  PRO A HB2  5  
ATOM 7228  H HB3  . PRO A 1 16  ? -3.170  -7.918  -9.947  1.00 0.00 ? 16  PRO A HB3  5  
ATOM 7229  H HG2  . PRO A 1 16  ? -4.652  -8.120  -12.540 1.00 0.00 ? 16  PRO A HG2  5  
ATOM 7230  H HG3  . PRO A 1 16  ? -3.133  -8.897  -12.056 1.00 0.00 ? 16  PRO A HG3  5  
ATOM 7231  H HD2  . PRO A 1 16  ? -5.508  -10.198 -12.029 1.00 0.00 ? 16  PRO A HD2  5  
ATOM 7232  H HD3  . PRO A 1 16  ? -4.211  -10.552 -10.869 1.00 0.00 ? 16  PRO A HD3  5  
ATOM 7233  N N    . ARG A 1 17  ? -6.273  -5.667  -9.590  1.00 0.00 ? 17  ARG A N    5  
ATOM 7234  C CA   . ARG A 1 17  ? -7.210  -4.590  -9.888  1.00 0.00 ? 17  ARG A CA   5  
ATOM 7235  C C    . ARG A 1 17  ? -6.487  -3.250  -9.978  1.00 0.00 ? 17  ARG A C    5  
ATOM 7236  O O    . ARG A 1 17  ? -5.992  -2.732  -8.976  1.00 0.00 ? 17  ARG A O    5  
ATOM 7237  C CB   . ARG A 1 17  ? -8.300  -4.523  -8.817  1.00 0.00 ? 17  ARG A CB   5  
ATOM 7238  C CG   . ARG A 1 17  ? -7.833  -3.902  -7.511  1.00 0.00 ? 17  ARG A CG   5  
ATOM 7239  C CD   . ARG A 1 17  ? -8.724  -4.312  -6.349  1.00 0.00 ? 17  ARG A CD   5  
ATOM 7240  N NE   . ARG A 1 17  ? -8.296  -3.707  -5.090  1.00 0.00 ? 17  ARG A NE   5  
ATOM 7241  C CZ   . ARG A 1 17  ? -9.013  -3.748  -3.973  1.00 0.00 ? 17  ARG A CZ   5  
ATOM 7242  N NH1  . ARG A 1 17  ? -10.188 -4.362  -3.958  1.00 0.00 ? 17  ARG A NH1  5  
ATOM 7243  N NH2  . ARG A 1 17  ? -8.556  -3.173  -2.868  1.00 0.00 ? 17  ARG A NH2  5  
ATOM 7244  H H    . ARG A 1 17  ? -5.565  -5.515  -8.930  1.00 0.00 ? 17  ARG A H    5  
ATOM 7245  H HA   . ARG A 1 17  ? -7.668  -4.804  -10.842 1.00 0.00 ? 17  ARG A HA   5  
ATOM 7246  H HB2  . ARG A 1 17  ? -9.124  -3.936  -9.194  1.00 0.00 ? 17  ARG A HB2  5  
ATOM 7247  H HB3  . ARG A 1 17  ? -8.647  -5.525  -8.610  1.00 0.00 ? 17  ARG A HB3  5  
ATOM 7248  H HG2  . ARG A 1 17  ? -6.823  -4.229  -7.308  1.00 0.00 ? 17  ARG A HG2  5  
ATOM 7249  H HG3  . ARG A 1 17  ? -7.853  -2.827  -7.607  1.00 0.00 ? 17  ARG A HG3  5  
ATOM 7250  H HD2  . ARG A 1 17  ? -9.736  -4.000  -6.561  1.00 0.00 ? 17  ARG A HD2  5  
ATOM 7251  H HD3  . ARG A 1 17  ? -8.692  -5.387  -6.250  1.00 0.00 ? 17  ARG A HD3  5  
ATOM 7252  H HE   . ARG A 1 17  ? -7.431  -3.247  -5.079  1.00 0.00 ? 17  ARG A HE   5  
ATOM 7253  H HH11 . ARG A 1 17  ? -10.535 -4.797  -4.789  1.00 0.00 ? 17  ARG A HH11 5  
ATOM 7254  H HH12 . ARG A 1 17  ? -10.726 -4.393  -3.116  1.00 0.00 ? 17  ARG A HH12 5  
ATOM 7255  H HH21 . ARG A 1 17  ? -7.671  -2.709  -2.875  1.00 0.00 ? 17  ARG A HH21 5  
ATOM 7256  H HH22 . ARG A 1 17  ? -9.097  -3.204  -2.028  1.00 0.00 ? 17  ARG A HH22 5  
ATOM 7257  N N    . ILE A 1 18  ? -6.430  -2.694  -11.183 1.00 0.00 ? 18  ILE A N    5  
ATOM 7258  C CA   . ILE A 1 18  ? -5.769  -1.414  -11.403 1.00 0.00 ? 18  ILE A CA   5  
ATOM 7259  C C    . ILE A 1 18  ? -6.690  -0.251  -11.051 1.00 0.00 ? 18  ILE A C    5  
ATOM 7260  O O    . ILE A 1 18  ? -7.845  -0.209  -11.475 1.00 0.00 ? 18  ILE A O    5  
ATOM 7261  C CB   . ILE A 1 18  ? -5.307  -1.263  -12.865 1.00 0.00 ? 18  ILE A CB   5  
ATOM 7262  C CG1  . ILE A 1 18  ? -4.040  -2.086  -13.109 1.00 0.00 ? 18  ILE A CG1  5  
ATOM 7263  C CG2  . ILE A 1 18  ? -5.064  0.203   -13.195 1.00 0.00 ? 18  ILE A CG2  5  
ATOM 7264  C CD1  . ILE A 1 18  ? -3.556  -2.038  -14.542 1.00 0.00 ? 18  ILE A CD1  5  
ATOM 7265  H H    . ILE A 1 18  ? -6.844  -3.155  -11.942 1.00 0.00 ? 18  ILE A H    5  
ATOM 7266  H HA   . ILE A 1 18  ? -4.898  -1.375  -10.765 1.00 0.00 ? 18  ILE A HA   5  
ATOM 7267  H HB   . ILE A 1 18  ? -6.094  -1.626  -13.507 1.00 0.00 ? 18  ILE A HB   5  
ATOM 7268  H HG12 . ILE A 1 18  ? -3.248  -1.712  -12.480 1.00 0.00 ? 18  ILE A HG12 5  
ATOM 7269  H HG13 . ILE A 1 18  ? -4.237  -3.118  -12.859 1.00 0.00 ? 18  ILE A HG13 5  
ATOM 7270  H HG21 . ILE A 1 18  ? -4.483  0.276   -14.102 1.00 0.00 ? 18  ILE A HG21 5  
ATOM 7271  H HG22 . ILE A 1 18  ? -6.012  0.701   -13.335 1.00 0.00 ? 18  ILE A HG22 5  
ATOM 7272  H HG23 . ILE A 1 18  ? -4.527  0.671   -12.384 1.00 0.00 ? 18  ILE A HG23 5  
ATOM 7273  H HD11 . ILE A 1 18  ? -2.774  -1.298  -14.633 1.00 0.00 ? 18  ILE A HD11 5  
ATOM 7274  H HD12 . ILE A 1 18  ? -3.169  -3.006  -14.824 1.00 0.00 ? 18  ILE A HD12 5  
ATOM 7275  H HD13 . ILE A 1 18  ? -4.377  -1.775  -15.191 1.00 0.00 ? 18  ILE A HD13 5  
ATOM 7276  N N    . VAL A 1 19  ? -6.171  0.694   -10.273 1.00 0.00 ? 19  VAL A N    5  
ATOM 7277  C CA   . VAL A 1 19  ? -6.945  1.860   -9.865  1.00 0.00 ? 19  VAL A CA   5  
ATOM 7278  C C    . VAL A 1 19  ? -6.081  3.116   -9.850  1.00 0.00 ? 19  VAL A C    5  
ATOM 7279  O O    . VAL A 1 19  ? -4.966  3.107   -9.329  1.00 0.00 ? 19  VAL A O    5  
ATOM 7280  C CB   . VAL A 1 19  ? -7.567  1.661   -8.470  1.00 0.00 ? 19  VAL A CB   5  
ATOM 7281  C CG1  . VAL A 1 19  ? -8.464  2.836   -8.112  1.00 0.00 ? 19  VAL A CG1  5  
ATOM 7282  C CG2  . VAL A 1 19  ? -8.341  0.352   -8.413  1.00 0.00 ? 19  VAL A CG2  5  
ATOM 7283  H H    . VAL A 1 19  ? -5.244  0.604   -9.966  1.00 0.00 ? 19  VAL A H    5  
ATOM 7284  H HA   . VAL A 1 19  ? -7.746  1.994   -10.577 1.00 0.00 ? 19  VAL A HA   5  
ATOM 7285  H HB   . VAL A 1 19  ? -6.767  1.613   -7.745  1.00 0.00 ? 19  VAL A HB   5  
ATOM 7286  H HG11 . VAL A 1 19  ? -8.890  2.678   -7.132  1.00 0.00 ? 19  VAL A HG11 5  
ATOM 7287  H HG12 . VAL A 1 19  ? -7.883  3.746   -8.111  1.00 0.00 ? 19  VAL A HG12 5  
ATOM 7288  H HG13 . VAL A 1 19  ? -9.258  2.916   -8.840  1.00 0.00 ? 19  VAL A HG13 5  
ATOM 7289  H HG21 . VAL A 1 19  ? -9.332  0.501   -8.815  1.00 0.00 ? 19  VAL A HG21 5  
ATOM 7290  H HG22 . VAL A 1 19  ? -7.824  -0.396  -8.996  1.00 0.00 ? 19  VAL A HG22 5  
ATOM 7291  H HG23 . VAL A 1 19  ? -8.415  0.021   -7.388  1.00 0.00 ? 19  VAL A HG23 5  
ATOM 7292  N N    . GLU A 1 20  ? -6.604  4.194   -10.424 1.00 0.00 ? 20  GLU A N    5  
ATOM 7293  C CA   . GLU A 1 20  ? -5.879  5.458   -10.476 1.00 0.00 ? 20  GLU A CA   5  
ATOM 7294  C C    . GLU A 1 20  ? -6.272  6.359   -9.309  1.00 0.00 ? 20  GLU A C    5  
ATOM 7295  O O    . GLU A 1 20  ? -7.453  6.633   -9.092  1.00 0.00 ? 20  GLU A O    5  
ATOM 7296  C CB   . GLU A 1 20  ? -6.152  6.174   -11.801 1.00 0.00 ? 20  GLU A CB   5  
ATOM 7297  C CG   . GLU A 1 20  ? -5.412  5.570   -12.983 1.00 0.00 ? 20  GLU A CG   5  
ATOM 7298  C CD   . GLU A 1 20  ? -6.226  4.512   -13.702 1.00 0.00 ? 20  GLU A CD   5  
ATOM 7299  O OE1  . GLU A 1 20  ? -7.248  4.066   -13.140 1.00 0.00 ? 20  GLU A OE1  5  
ATOM 7300  O OE2  . GLU A 1 20  ? -5.841  4.130   -14.827 1.00 0.00 ? 20  GLU A OE2  5  
ATOM 7301  H H    . GLU A 1 20  ? -7.498  4.139   -10.822 1.00 0.00 ? 20  GLU A H    5  
ATOM 7302  H HA   . GLU A 1 20  ? -4.825  5.239   -10.407 1.00 0.00 ? 20  GLU A HA   5  
ATOM 7303  H HB2  . GLU A 1 20  ? -7.212  6.133   -12.007 1.00 0.00 ? 20  GLU A HB2  5  
ATOM 7304  H HB3  . GLU A 1 20  ? -5.853  7.207   -11.706 1.00 0.00 ? 20  GLU A HB3  5  
ATOM 7305  H HG2  . GLU A 1 20  ? -5.174  6.357   -13.682 1.00 0.00 ? 20  GLU A HG2  5  
ATOM 7306  H HG3  . GLU A 1 20  ? -4.498  5.119   -12.626 1.00 0.00 ? 20  GLU A HG3  5  
ATOM 7307  N N    . ILE A 1 21  ? -5.274  6.816   -8.560  1.00 0.00 ? 21  ILE A N    5  
ATOM 7308  C CA   . ILE A 1 21  ? -5.514  7.686   -7.416  1.00 0.00 ? 21  ILE A CA   5  
ATOM 7309  C C    . ILE A 1 21  ? -4.748  8.997   -7.551  1.00 0.00 ? 21  ILE A C    5  
ATOM 7310  O O    . ILE A 1 21  ? -3.517  9.008   -7.594  1.00 0.00 ? 21  ILE A O    5  
ATOM 7311  C CB   . ILE A 1 21  ? -5.111  7.003   -6.095  1.00 0.00 ? 21  ILE A CB   5  
ATOM 7312  C CG1  . ILE A 1 21  ? -5.460  5.514   -6.139  1.00 0.00 ? 21  ILE A CG1  5  
ATOM 7313  C CG2  . ILE A 1 21  ? -5.799  7.679   -4.918  1.00 0.00 ? 21  ILE A CG2  5  
ATOM 7314  C CD1  . ILE A 1 21  ? -4.913  4.731   -4.966  1.00 0.00 ? 21  ILE A CD1  5  
ATOM 7315  H H    . ILE A 1 21  ? -4.354  6.563   -8.783  1.00 0.00 ? 21  ILE A H    5  
ATOM 7316  H HA   . ILE A 1 21  ? -6.572  7.902   -7.378  1.00 0.00 ? 21  ILE A HA   5  
ATOM 7317  H HB   . ILE A 1 21  ? -4.045  7.113   -5.970  1.00 0.00 ? 21  ILE A HB   5  
ATOM 7318  H HG12 . ILE A 1 21  ? -6.532  5.401   -6.141  1.00 0.00 ? 21  ILE A HG12 5  
ATOM 7319  H HG13 . ILE A 1 21  ? -5.055  5.084   -7.044  1.00 0.00 ? 21  ILE A HG13 5  
ATOM 7320  H HG21 . ILE A 1 21  ? -6.866  7.531   -4.991  1.00 0.00 ? 21  ILE A HG21 5  
ATOM 7321  H HG22 . ILE A 1 21  ? -5.439  7.249   -3.996  1.00 0.00 ? 21  ILE A HG22 5  
ATOM 7322  H HG23 . ILE A 1 21  ? -5.581  8.736   -4.932  1.00 0.00 ? 21  ILE A HG23 5  
ATOM 7323  H HD11 . ILE A 1 21  ? -5.567  4.854   -4.115  1.00 0.00 ? 21  ILE A HD11 5  
ATOM 7324  H HD12 . ILE A 1 21  ? -4.856  3.684   -5.226  1.00 0.00 ? 21  ILE A HD12 5  
ATOM 7325  H HD13 . ILE A 1 21  ? -3.927  5.095   -4.717  1.00 0.00 ? 21  ILE A HD13 5  
ATOM 7326  N N    . PHE A 1 22  ? -5.483  10.102  -7.617  1.00 0.00 ? 22  PHE A N    5  
ATOM 7327  C CA   . PHE A 1 22  ? -4.873  11.420  -7.746  1.00 0.00 ? 22  PHE A CA   5  
ATOM 7328  C C    . PHE A 1 22  ? -4.382  11.928  -6.394  1.00 0.00 ? 22  PHE A C    5  
ATOM 7329  O O    . PHE A 1 22  ? -5.142  11.986  -5.427  1.00 0.00 ? 22  PHE A O    5  
ATOM 7330  C CB   . PHE A 1 22  ? -5.873  12.412  -8.344  1.00 0.00 ? 22  PHE A CB   5  
ATOM 7331  C CG   . PHE A 1 22  ? -5.673  12.654  -9.812  1.00 0.00 ? 22  PHE A CG   5  
ATOM 7332  C CD1  . PHE A 1 22  ? -6.009  11.681  -10.740 1.00 0.00 ? 22  PHE A CD1  5  
ATOM 7333  C CD2  . PHE A 1 22  ? -5.150  13.854  -10.266 1.00 0.00 ? 22  PHE A CD2  5  
ATOM 7334  C CE1  . PHE A 1 22  ? -5.826  11.901  -12.092 1.00 0.00 ? 22  PHE A CE1  5  
ATOM 7335  C CE2  . PHE A 1 22  ? -4.964  14.080  -11.617 1.00 0.00 ? 22  PHE A CE2  5  
ATOM 7336  C CZ   . PHE A 1 22  ? -5.304  13.102  -12.531 1.00 0.00 ? 22  PHE A CZ   5  
ATOM 7337  H H    . PHE A 1 22  ? -6.460  10.029  -7.577  1.00 0.00 ? 22  PHE A H    5  
ATOM 7338  H HA   . PHE A 1 22  ? -4.028  11.329  -8.411  1.00 0.00 ? 22  PHE A HA   5  
ATOM 7339  H HB2  . PHE A 1 22  ? -6.874  12.032  -8.204  1.00 0.00 ? 22  PHE A HB2  5  
ATOM 7340  H HB3  . PHE A 1 22  ? -5.778  13.359  -7.834  1.00 0.00 ? 22  PHE A HB3  5  
ATOM 7341  H HD1  . PHE A 1 22  ? -6.418  10.742  -10.399 1.00 0.00 ? 22  PHE A HD1  5  
ATOM 7342  H HD2  . PHE A 1 22  ? -4.884  14.620  -9.551  1.00 0.00 ? 22  PHE A HD2  5  
ATOM 7343  H HE1  . PHE A 1 22  ? -6.092  11.135  -12.805 1.00 0.00 ? 22  PHE A HE1  5  
ATOM 7344  H HE2  . PHE A 1 22  ? -4.556  15.020  -11.956 1.00 0.00 ? 22  PHE A HE2  5  
ATOM 7345  H HZ   . PHE A 1 22  ? -5.159  13.276  -13.587 1.00 0.00 ? 22  PHE A HZ   5  
ATOM 7346  N N    . ARG A 1 23  ? -3.106  12.294  -6.333  1.00 0.00 ? 23  ARG A N    5  
ATOM 7347  C CA   . ARG A 1 23  ? -2.512  12.795  -5.100  1.00 0.00 ? 23  ARG A CA   5  
ATOM 7348  C C    . ARG A 1 23  ? -3.101  14.152  -4.725  1.00 0.00 ? 23  ARG A C    5  
ATOM 7349  O O    . ARG A 1 23  ? -3.490  14.931  -5.594  1.00 0.00 ? 23  ARG A O    5  
ATOM 7350  C CB   . ARG A 1 23  ? -0.994  12.909  -5.249  1.00 0.00 ? 23  ARG A CB   5  
ATOM 7351  C CG   . ARG A 1 23  ? -0.547  13.291  -6.650  1.00 0.00 ? 23  ARG A CG   5  
ATOM 7352  C CD   . ARG A 1 23  ? 0.912   13.721  -6.672  1.00 0.00 ? 23  ARG A CD   5  
ATOM 7353  N NE   . ARG A 1 23  ? 1.285   14.327  -7.947  1.00 0.00 ? 23  ARG A NE   5  
ATOM 7354  C CZ   . ARG A 1 23  ? 1.094   15.610  -8.235  1.00 0.00 ? 23  ARG A CZ   5  
ATOM 7355  N NH1  . ARG A 1 23  ? 0.537   16.417  -7.343  1.00 0.00 ? 23  ARG A NH1  5  
ATOM 7356  N NH2  . ARG A 1 23  ? 1.461   16.087  -9.417  1.00 0.00 ? 23  ARG A NH2  5  
ATOM 7357  H H    . ARG A 1 23  ? -2.550  12.225  -7.138  1.00 0.00 ? 23  ARG A H    5  
ATOM 7358  H HA   . ARG A 1 23  ? -2.736  12.090  -4.313  1.00 0.00 ? 23  ARG A HA   5  
ATOM 7359  H HB2  . ARG A 1 23  ? -0.632  13.660  -4.562  1.00 0.00 ? 23  ARG A HB2  5  
ATOM 7360  H HB3  . ARG A 1 23  ? -0.548  11.959  -4.999  1.00 0.00 ? 23  ARG A HB3  5  
ATOM 7361  H HG2  . ARG A 1 23  ? -0.669  12.439  -7.302  1.00 0.00 ? 23  ARG A HG2  5  
ATOM 7362  H HG3  . ARG A 1 23  ? -1.159  14.108  -7.003  1.00 0.00 ? 23  ARG A HG3  5  
ATOM 7363  H HD2  . ARG A 1 23  ? 1.073   14.440  -5.882  1.00 0.00 ? 23  ARG A HD2  5  
ATOM 7364  H HD3  . ARG A 1 23  ? 1.531   12.853  -6.501  1.00 0.00 ? 23  ARG A HD3  5  
ATOM 7365  H HE   . ARG A 1 23  ? 1.698   13.749  -8.620  1.00 0.00 ? 23  ARG A HE   5  
ATOM 7366  H HH11 . ARG A 1 23  ? 0.261   16.060  -6.451  1.00 0.00 ? 23  ARG A HH11 5  
ATOM 7367  H HH12 . ARG A 1 23  ? 0.395   17.383  -7.562  1.00 0.00 ? 23  ARG A HH12 5  
ATOM 7368  H HH21 . ARG A 1 23  ? 1.881   15.482  -10.092 1.00 0.00 ? 23  ARG A HH21 5  
ATOM 7369  H HH22 . ARG A 1 23  ? 1.316   17.052  -9.633  1.00 0.00 ? 23  ARG A HH22 5  
ATOM 7370  N N    . GLU A 1 24  ? -3.162  14.427  -3.426  1.00 0.00 ? 24  GLU A N    5  
ATOM 7371  C CA   . GLU A 1 24  ? -3.704  15.689  -2.937  1.00 0.00 ? 24  GLU A CA   5  
ATOM 7372  C C    . GLU A 1 24  ? -2.612  16.537  -2.292  1.00 0.00 ? 24  GLU A C    5  
ATOM 7373  O O    . GLU A 1 24  ? -1.591  16.030  -1.825  1.00 0.00 ? 24  GLU A O    5  
ATOM 7374  C CB   . GLU A 1 24  ? -4.827  15.432  -1.930  1.00 0.00 ? 24  GLU A CB   5  
ATOM 7375  C CG   . GLU A 1 24  ? -6.141  15.026  -2.574  1.00 0.00 ? 24  GLU A CG   5  
ATOM 7376  C CD   . GLU A 1 24  ? -7.027  16.215  -2.892  1.00 0.00 ? 24  GLU A CD   5  
ATOM 7377  O OE1  . GLU A 1 24  ? -6.886  16.782  -3.995  1.00 0.00 ? 24  GLU A OE1  5  
ATOM 7378  O OE2  . GLU A 1 24  ? -7.861  16.578  -2.036  1.00 0.00 ? 24  GLU A OE2  5  
ATOM 7379  H H    . GLU A 1 24  ? -2.835  13.765  -2.781  1.00 0.00 ? 24  GLU A H    5  
ATOM 7380  H HA   . GLU A 1 24  ? -4.108  16.226  -3.782  1.00 0.00 ? 24  GLU A HA   5  
ATOM 7381  H HB2  . GLU A 1 24  ? -4.519  14.643  -1.259  1.00 0.00 ? 24  GLU A HB2  5  
ATOM 7382  H HB3  . GLU A 1 24  ? -4.994  16.333  -1.358  1.00 0.00 ? 24  GLU A HB3  5  
ATOM 7383  H HG2  . GLU A 1 24  ? -5.930  14.499  -3.492  1.00 0.00 ? 24  GLU A HG2  5  
ATOM 7384  H HG3  . GLU A 1 24  ? -6.672  14.371  -1.898  1.00 0.00 ? 24  GLU A HG3  5  
ATOM 7385  N N    . PRO A 1 25  ? -2.829  17.861  -2.266  1.00 0.00 ? 25  PRO A N    5  
ATOM 7386  C CA   . PRO A 1 25  ? -1.875  18.808  -1.682  1.00 0.00 ? 25  PRO A CA   5  
ATOM 7387  C C    . PRO A 1 25  ? -1.798  18.691  -0.163  1.00 0.00 ? 25  PRO A C    5  
ATOM 7388  O O    . PRO A 1 25  ? -1.008  17.914  0.370   1.00 0.00 ? 25  PRO A O    5  
ATOM 7389  C CB   . PRO A 1 25  ? -2.438  20.173  -2.086  1.00 0.00 ? 25  PRO A CB   5  
ATOM 7390  C CG   . PRO A 1 25  ? -3.896  19.938  -2.282  1.00 0.00 ? 25  PRO A CG   5  
ATOM 7391  C CD   . PRO A 1 25  ? -4.022  18.534  -2.804  1.00 0.00 ? 25  PRO A CD   5  
ATOM 7392  H HA   . PRO A 1 25  ? -0.887  18.686  -2.101  1.00 0.00 ? 25  PRO A HA   5  
ATOM 7393  H HB2  . PRO A 1 25  ? -2.254  20.888  -1.296  1.00 0.00 ? 25  PRO A HB2  5  
ATOM 7394  H HB3  . PRO A 1 25  ? -1.965  20.506  -2.997  1.00 0.00 ? 25  PRO A HB3  5  
ATOM 7395  H HG2  . PRO A 1 25  ? -4.413  20.036  -1.340  1.00 0.00 ? 25  PRO A HG2  5  
ATOM 7396  H HG3  . PRO A 1 25  ? -4.286  20.642  -3.002  1.00 0.00 ? 25  PRO A HG3  5  
ATOM 7397  H HD2  . PRO A 1 25  ? -4.926  18.073  -2.433  1.00 0.00 ? 25  PRO A HD2  5  
ATOM 7398  H HD3  . PRO A 1 25  ? -4.012  18.531  -3.884  1.00 0.00 ? 25  PRO A HD3  5  
ATOM 7399  N N    . ASN A 1 26  ? -2.626  19.469  0.528   1.00 0.00 ? 26  ASN A N    5  
ATOM 7400  C CA   . ASN A 1 26  ? -2.651  19.453  1.986   1.00 0.00 ? 26  ASN A CA   5  
ATOM 7401  C C    . ASN A 1 26  ? -2.687  18.022  2.513   1.00 0.00 ? 26  ASN A C    5  
ATOM 7402  O O    . ASN A 1 26  ? -2.014  17.691  3.489   1.00 0.00 ? 26  ASN A O    5  
ATOM 7403  C CB   . ASN A 1 26  ? -3.863  20.230  2.504   1.00 0.00 ? 26  ASN A CB   5  
ATOM 7404  C CG   . ASN A 1 26  ? -4.100  21.513  1.732   1.00 0.00 ? 26  ASN A CG   5  
ATOM 7405  O OD1  . ASN A 1 26  ? -3.421  22.517  1.951   1.00 0.00 ? 26  ASN A OD1  5  
ATOM 7406  N ND2  . ASN A 1 26  ? -5.068  21.487  0.824   1.00 0.00 ? 26  ASN A ND2  5  
ATOM 7407  H H    . ASN A 1 26  ? -3.233  20.069  0.046   1.00 0.00 ? 26  ASN A H    5  
ATOM 7408  H HA   . ASN A 1 26  ? -1.750  19.932  2.339   1.00 0.00 ? 26  ASN A HA   5  
ATOM 7409  H HB2  . ASN A 1 26  ? -4.745  19.611  2.415   1.00 0.00 ? 26  ASN A HB2  5  
ATOM 7410  H HB3  . ASN A 1 26  ? -3.707  20.479  3.543   1.00 0.00 ? 26  ASN A HB3  5  
ATOM 7411  H HD21 . ASN A 1 26  ? -5.568  20.653  0.703   1.00 0.00 ? 26  ASN A HD21 5  
ATOM 7412  H HD22 . ASN A 1 26  ? -5.242  22.303  0.310   1.00 0.00 ? 26  ASN A HD22 5  
ATOM 7413  N N    . VAL A 1 27  ? -3.477  17.176  1.860   1.00 0.00 ? 27  VAL A N    5  
ATOM 7414  C CA   . VAL A 1 27  ? -3.600  15.779  2.261   1.00 0.00 ? 27  VAL A CA   5  
ATOM 7415  C C    . VAL A 1 27  ? -2.933  14.856  1.248   1.00 0.00 ? 27  VAL A C    5  
ATOM 7416  O O    . VAL A 1 27  ? -2.831  15.184  0.066   1.00 0.00 ? 27  VAL A O    5  
ATOM 7417  C CB   . VAL A 1 27  ? -5.076  15.369  2.420   1.00 0.00 ? 27  VAL A CB   5  
ATOM 7418  C CG1  . VAL A 1 27  ? -5.817  15.517  1.099   1.00 0.00 ? 27  VAL A CG1  5  
ATOM 7419  C CG2  . VAL A 1 27  ? -5.179  13.943  2.940   1.00 0.00 ? 27  VAL A CG2  5  
ATOM 7420  H H    . VAL A 1 27  ? -3.990  17.498  1.089   1.00 0.00 ? 27  VAL A H    5  
ATOM 7421  H HA   . VAL A 1 27  ? -3.111  15.662  3.217   1.00 0.00 ? 27  VAL A HA   5  
ATOM 7422  H HB   . VAL A 1 27  ? -5.537  16.027  3.141   1.00 0.00 ? 27  VAL A HB   5  
ATOM 7423  H HG11 . VAL A 1 27  ? -5.596  14.670  0.466   1.00 0.00 ? 27  VAL A HG11 5  
ATOM 7424  H HG12 . VAL A 1 27  ? -6.880  15.563  1.285   1.00 0.00 ? 27  VAL A HG12 5  
ATOM 7425  H HG13 . VAL A 1 27  ? -5.498  16.425  0.608   1.00 0.00 ? 27  VAL A HG13 5  
ATOM 7426  H HG21 . VAL A 1 27  ? -4.865  13.254  2.170   1.00 0.00 ? 27  VAL A HG21 5  
ATOM 7427  H HG22 . VAL A 1 27  ? -4.544  13.830  3.806   1.00 0.00 ? 27  VAL A HG22 5  
ATOM 7428  H HG23 . VAL A 1 27  ? -6.203  13.732  3.215   1.00 0.00 ? 27  VAL A HG23 5  
ATOM 7429  N N    . SER A 1 28  ? -2.480  13.698  1.720   1.00 0.00 ? 28  SER A N    5  
ATOM 7430  C CA   . SER A 1 28  ? -1.819  12.727  0.856   1.00 0.00 ? 28  SER A CA   5  
ATOM 7431  C C    . SER A 1 28  ? -2.839  11.804  0.196   1.00 0.00 ? 28  SER A C    5  
ATOM 7432  O O    . SER A 1 28  ? -4.038  12.088  0.189   1.00 0.00 ? 28  SER A O    5  
ATOM 7433  C CB   . SER A 1 28  ? -0.811  11.902  1.658   1.00 0.00 ? 28  SER A CB   5  
ATOM 7434  O OG   . SER A 1 28  ? 0.275   11.492  0.845   1.00 0.00 ? 28  SER A OG   5  
ATOM 7435  H H    . SER A 1 28  ? -2.591  13.494  2.672   1.00 0.00 ? 28  SER A H    5  
ATOM 7436  H HA   . SER A 1 28  ? -1.293  13.272  0.086   1.00 0.00 ? 28  SER A HA   5  
ATOM 7437  H HB2  . SER A 1 28  ? -0.430  12.497  2.473   1.00 0.00 ? 28  SER A HB2  5  
ATOM 7438  H HB3  . SER A 1 28  ? -1.302  11.024  2.052   1.00 0.00 ? 28  SER A HB3  5  
ATOM 7439  H HG   . SER A 1 28  ? 1.090   11.867  1.186   1.00 0.00 ? 28  SER A HG   5  
ATOM 7440  N N    . LEU A 1 29  ? -2.355  10.699  -0.359  1.00 0.00 ? 29  LEU A N    5  
ATOM 7441  C CA   . LEU A 1 29  ? -3.223  9.732   -1.023  1.00 0.00 ? 29  LEU A CA   5  
ATOM 7442  C C    . LEU A 1 29  ? -4.206  9.114   -0.033  1.00 0.00 ? 29  LEU A C    5  
ATOM 7443  O O    . LEU A 1 29  ? -5.290  8.675   -0.413  1.00 0.00 ? 29  LEU A O    5  
ATOM 7444  C CB   . LEU A 1 29  ? -2.386  8.634   -1.682  1.00 0.00 ? 29  LEU A CB   5  
ATOM 7445  C CG   . LEU A 1 29  ? -2.103  8.811   -3.174  1.00 0.00 ? 29  LEU A CG   5  
ATOM 7446  C CD1  . LEU A 1 29  ? -1.526  7.532   -3.763  1.00 0.00 ? 29  LEU A CD1  5  
ATOM 7447  C CD2  . LEU A 1 29  ? -3.370  9.216   -3.913  1.00 0.00 ? 29  LEU A CD2  5  
ATOM 7448  H H    . LEU A 1 29  ? -1.391  10.527  -0.322  1.00 0.00 ? 29  LEU A H    5  
ATOM 7449  H HA   . LEU A 1 29  ? -3.780  10.256  -1.785  1.00 0.00 ? 29  LEU A HA   5  
ATOM 7450  H HB2  . LEU A 1 29  ? -1.438  8.588   -1.169  1.00 0.00 ? 29  LEU A HB2  5  
ATOM 7451  H HB3  . LEU A 1 29  ? -2.910  7.698   -1.552  1.00 0.00 ? 29  LEU A HB3  5  
ATOM 7452  H HG   . LEU A 1 29  ? -1.372  9.597   -3.305  1.00 0.00 ? 29  LEU A HG   5  
ATOM 7453  H HD11 . LEU A 1 29  ? -1.557  6.749   -3.021  1.00 0.00 ? 29  LEU A HD11 5  
ATOM 7454  H HD12 . LEU A 1 29  ? -0.503  7.704   -4.062  1.00 0.00 ? 29  LEU A HD12 5  
ATOM 7455  H HD13 . LEU A 1 29  ? -2.108  7.238   -4.624  1.00 0.00 ? 29  LEU A HD13 5  
ATOM 7456  H HD21 . LEU A 1 29  ? -3.485  10.288  -3.869  1.00 0.00 ? 29  LEU A HD21 5  
ATOM 7457  H HD22 . LEU A 1 29  ? -4.223  8.742   -3.450  1.00 0.00 ? 29  LEU A HD22 5  
ATOM 7458  H HD23 . LEU A 1 29  ? -3.301  8.902   -4.945  1.00 0.00 ? 29  LEU A HD23 5  
ATOM 7459  N N    . GLY A 1 30  ? -3.818  9.085   1.238   1.00 0.00 ? 30  GLY A N    5  
ATOM 7460  C CA   . GLY A 1 30  ? -4.678  8.521   2.263   1.00 0.00 ? 30  GLY A CA   5  
ATOM 7461  C C    . GLY A 1 30  ? -4.528  7.018   2.382   1.00 0.00 ? 30  GLY A C    5  
ATOM 7462  O O    . GLY A 1 30  ? -5.346  6.354   3.019   1.00 0.00 ? 30  GLY A O    5  
ATOM 7463  H H    . GLY A 1 30  ? -2.942  9.451   1.483   1.00 0.00 ? 30  GLY A H    5  
ATOM 7464  H HA2  . GLY A 1 30  ? -4.432  8.973   3.212   1.00 0.00 ? 30  GLY A HA2  5  
ATOM 7465  H HA3  . GLY A 1 30  ? -5.705  8.751   2.021   1.00 0.00 ? 30  GLY A HA3  5  
ATOM 7466  N N    . ILE A 1 31  ? -3.482  6.478   1.765   1.00 0.00 ? 31  ILE A N    5  
ATOM 7467  C CA   . ILE A 1 31  ? -3.229  5.043   1.804   1.00 0.00 ? 31  ILE A CA   5  
ATOM 7468  C C    . ILE A 1 31  ? -1.964  4.730   2.597   1.00 0.00 ? 31  ILE A C    5  
ATOM 7469  O O    . ILE A 1 31  ? -1.024  5.524   2.626   1.00 0.00 ? 31  ILE A O    5  
ATOM 7470  C CB   . ILE A 1 31  ? -3.091  4.457   0.387   1.00 0.00 ? 31  ILE A CB   5  
ATOM 7471  C CG1  . ILE A 1 31  ? -4.167  5.036   -0.535  1.00 0.00 ? 31  ILE A CG1  5  
ATOM 7472  C CG2  . ILE A 1 31  ? -3.185  2.939   0.431   1.00 0.00 ? 31  ILE A CG2  5  
ATOM 7473  C CD1  . ILE A 1 31  ? -3.988  4.653   -1.987  1.00 0.00 ? 31  ILE A CD1  5  
ATOM 7474  H H    . ILE A 1 31  ? -2.865  7.059   1.273   1.00 0.00 ? 31  ILE A H    5  
ATOM 7475  H HA   . ILE A 1 31  ? -4.071  4.570   2.288   1.00 0.00 ? 31  ILE A HA   5  
ATOM 7476  H HB   . ILE A 1 31  ? -2.118  4.723   0.004   1.00 0.00 ? 31  ILE A HB   5  
ATOM 7477  H HG12 . ILE A 1 31  ? -5.134  4.682   -0.216  1.00 0.00 ? 31  ILE A HG12 5  
ATOM 7478  H HG13 . ILE A 1 31  ? -4.143  6.114   -0.470  1.00 0.00 ? 31  ILE A HG13 5  
ATOM 7479  H HG21 . ILE A 1 31  ? -3.863  2.643   1.218   1.00 0.00 ? 31  ILE A HG21 5  
ATOM 7480  H HG22 . ILE A 1 31  ? -3.553  2.574   -0.516  1.00 0.00 ? 31  ILE A HG22 5  
ATOM 7481  H HG23 . ILE A 1 31  ? -2.207  2.523   0.622   1.00 0.00 ? 31  ILE A HG23 5  
ATOM 7482  H HD11 . ILE A 1 31  ? -2.979  4.297   -2.144  1.00 0.00 ? 31  ILE A HD11 5  
ATOM 7483  H HD12 . ILE A 1 31  ? -4.688  3.871   -2.242  1.00 0.00 ? 31  ILE A HD12 5  
ATOM 7484  H HD13 . ILE A 1 31  ? -4.166  5.515   -2.612  1.00 0.00 ? 31  ILE A HD13 5  
ATOM 7485  N N    . SER A 1 32  ? -1.948  3.566   3.238   1.00 0.00 ? 32  SER A N    5  
ATOM 7486  C CA   . SER A 1 32  ? -0.800  3.147   4.033   1.00 0.00 ? 32  SER A CA   5  
ATOM 7487  C C    . SER A 1 32  ? -0.396  1.715   3.693   1.00 0.00 ? 32  SER A C    5  
ATOM 7488  O O    . SER A 1 32  ? -1.086  1.027   2.940   1.00 0.00 ? 32  SER A O    5  
ATOM 7489  C CB   . SER A 1 32  ? -1.118  3.258   5.526   1.00 0.00 ? 32  SER A CB   5  
ATOM 7490  O OG   . SER A 1 32  ? -1.379  4.602   5.893   1.00 0.00 ? 32  SER A OG   5  
ATOM 7491  H H    . SER A 1 32  ? -2.729  2.975   3.177   1.00 0.00 ? 32  SER A H    5  
ATOM 7492  H HA   . SER A 1 32  ? 0.023   3.805   3.800   1.00 0.00 ? 32  SER A HA   5  
ATOM 7493  H HB2  . SER A 1 32  ? -1.988  2.661   5.751   1.00 0.00 ? 32  SER A HB2  5  
ATOM 7494  H HB3  . SER A 1 32  ? -0.275  2.898   6.098   1.00 0.00 ? 32  SER A HB3  5  
ATOM 7495  H HG   . SER A 1 32  ? -2.328  4.740   5.948   1.00 0.00 ? 32  SER A HG   5  
ATOM 7496  N N    . ILE A 1 33  ? 0.725   1.274   4.254   1.00 0.00 ? 33  ILE A N    5  
ATOM 7497  C CA   . ILE A 1 33  ? 1.220   -0.075  4.012   1.00 0.00 ? 33  ILE A CA   5  
ATOM 7498  C C    . ILE A 1 33  ? 1.845   -0.666  5.271   1.00 0.00 ? 33  ILE A C    5  
ATOM 7499  O O    . ILE A 1 33  ? 2.352   0.062   6.125   1.00 0.00 ? 33  ILE A O    5  
ATOM 7500  C CB   . ILE A 1 33  ? 2.259   -0.098  2.876   1.00 0.00 ? 33  ILE A CB   5  
ATOM 7501  C CG1  . ILE A 1 33  ? 3.360   0.931   3.142   1.00 0.00 ? 33  ILE A CG1  5  
ATOM 7502  C CG2  . ILE A 1 33  ? 1.588   0.171   1.537   1.00 0.00 ? 33  ILE A CG2  5  
ATOM 7503  C CD1  . ILE A 1 33  ? 4.589   0.738   2.282   1.00 0.00 ? 33  ILE A CD1  5  
ATOM 7504  H H    . ILE A 1 33  ? 1.230   1.870   4.845   1.00 0.00 ? 33  ILE A H    5  
ATOM 7505  H HA   . ILE A 1 33  ? 0.381   -0.690  3.717   1.00 0.00 ? 33  ILE A HA   5  
ATOM 7506  H HB   . ILE A 1 33  ? 2.699   -1.083  2.840   1.00 0.00 ? 33  ILE A HB   5  
ATOM 7507  H HG12 . ILE A 1 33  ? 2.974   1.920   2.950   1.00 0.00 ? 33  ILE A HG12 5  
ATOM 7508  H HG13 . ILE A 1 33  ? 3.663   0.863   4.177   1.00 0.00 ? 33  ILE A HG13 5  
ATOM 7509  H HG21 . ILE A 1 33  ? 0.731   -0.477  1.429   1.00 0.00 ? 33  ILE A HG21 5  
ATOM 7510  H HG22 . ILE A 1 33  ? 1.267   1.201   1.497   1.00 0.00 ? 33  ILE A HG22 5  
ATOM 7511  H HG23 . ILE A 1 33  ? 2.288   -0.021  0.738   1.00 0.00 ? 33  ILE A HG23 5  
ATOM 7512  H HD11 . ILE A 1 33  ? 4.626   1.510   1.527   1.00 0.00 ? 33  ILE A HD11 5  
ATOM 7513  H HD12 . ILE A 1 33  ? 5.474   0.797   2.899   1.00 0.00 ? 33  ILE A HD12 5  
ATOM 7514  H HD13 . ILE A 1 33  ? 4.547   -0.230  1.805   1.00 0.00 ? 33  ILE A HD13 5  
ATOM 7515  N N    . VAL A 1 34  ? 1.809   -1.990  5.378   1.00 0.00 ? 34  VAL A N    5  
ATOM 7516  C CA   . VAL A 1 34  ? 2.375   -2.679  6.531   1.00 0.00 ? 34  VAL A CA   5  
ATOM 7517  C C    . VAL A 1 34  ? 3.684   -3.372  6.169   1.00 0.00 ? 34  VAL A C    5  
ATOM 7518  O O    . VAL A 1 34  ? 4.133   -3.316  5.025   1.00 0.00 ? 34  VAL A O    5  
ATOM 7519  C CB   . VAL A 1 34  ? 1.395   -3.723  7.098   1.00 0.00 ? 34  VAL A CB   5  
ATOM 7520  C CG1  . VAL A 1 34  ? -0.043  -3.270  6.897   1.00 0.00 ? 34  VAL A CG1  5  
ATOM 7521  C CG2  . VAL A 1 34  ? 1.630   -5.080  6.453   1.00 0.00 ? 34  VAL A CG2  5  
ATOM 7522  H H    . VAL A 1 34  ? 1.392   -2.516  4.664   1.00 0.00 ? 34  VAL A H    5  
ATOM 7523  H HA   . VAL A 1 34  ? 2.569   -1.944  7.298   1.00 0.00 ? 34  VAL A HA   5  
ATOM 7524  H HB   . VAL A 1 34  ? 1.574   -3.817  8.159   1.00 0.00 ? 34  VAL A HB   5  
ATOM 7525  H HG11 . VAL A 1 34  ? -0.168  -2.907  5.887   1.00 0.00 ? 34  VAL A HG11 5  
ATOM 7526  H HG12 . VAL A 1 34  ? -0.711  -4.102  7.067   1.00 0.00 ? 34  VAL A HG12 5  
ATOM 7527  H HG13 . VAL A 1 34  ? -0.271  -2.477  7.594   1.00 0.00 ? 34  VAL A HG13 5  
ATOM 7528  H HG21 . VAL A 1 34  ? 1.584   -4.982  5.379   1.00 0.00 ? 34  VAL A HG21 5  
ATOM 7529  H HG22 . VAL A 1 34  ? 2.603   -5.451  6.739   1.00 0.00 ? 34  VAL A HG22 5  
ATOM 7530  H HG23 . VAL A 1 34  ? 0.870   -5.773  6.783   1.00 0.00 ? 34  VAL A HG23 5  
ATOM 7531  N N    . GLY A 1 35  ? 4.293   -4.027  7.153   1.00 0.00 ? 35  GLY A N    5  
ATOM 7532  C CA   . GLY A 1 35  ? 5.545   -4.722  6.919   1.00 0.00 ? 35  GLY A CA   5  
ATOM 7533  C C    . GLY A 1 35  ? 6.666   -3.781  6.523   1.00 0.00 ? 35  GLY A C    5  
ATOM 7534  O O    . GLY A 1 35  ? 6.515   -2.561  6.591   1.00 0.00 ? 35  GLY A O    5  
ATOM 7535  H H    . GLY A 1 35  ? 3.889   -4.038  8.046   1.00 0.00 ? 35  GLY A H    5  
ATOM 7536  H HA2  . GLY A 1 35  ? 5.829   -5.244  7.820   1.00 0.00 ? 35  GLY A HA2  5  
ATOM 7537  H HA3  . GLY A 1 35  ? 5.401   -5.443  6.127   1.00 0.00 ? 35  GLY A HA3  5  
ATOM 7538  N N    . GLY A 1 36  ? 7.795   -4.348  6.109   1.00 0.00 ? 36  GLY A N    5  
ATOM 7539  C CA   . GLY A 1 36  ? 8.930   -3.536  5.710   1.00 0.00 ? 36  GLY A CA   5  
ATOM 7540  C C    . GLY A 1 36  ? 10.184  -4.359  5.493   1.00 0.00 ? 36  GLY A C    5  
ATOM 7541  O O    . GLY A 1 36  ? 10.157  -5.584  5.610   1.00 0.00 ? 36  GLY A O    5  
ATOM 7542  H H    . GLY A 1 36  ? 7.858   -5.325  6.076   1.00 0.00 ? 36  GLY A H    5  
ATOM 7543  H HA2  . GLY A 1 36  ? 8.685   -3.023  4.792   1.00 0.00 ? 36  GLY A HA2  5  
ATOM 7544  H HA3  . GLY A 1 36  ? 9.122   -2.803  6.479   1.00 0.00 ? 36  GLY A HA3  5  
ATOM 7545  N N    . GLN A 1 37  ? 11.284  -3.685  5.175   1.00 0.00 ? 37  GLN A N    5  
ATOM 7546  C CA   . GLN A 1 37  ? 12.553  -4.364  4.939   1.00 0.00 ? 37  GLN A CA   5  
ATOM 7547  C C    . GLN A 1 37  ? 12.331  -5.724  4.288   1.00 0.00 ? 37  GLN A C    5  
ATOM 7548  O O    . GLN A 1 37  ? 13.055  -6.682  4.561   1.00 0.00 ? 37  GLN A O    5  
ATOM 7549  C CB   . GLN A 1 37  ? 13.317  -4.533  6.254   1.00 0.00 ? 37  GLN A CB   5  
ATOM 7550  C CG   . GLN A 1 37  ? 12.519  -5.248  7.333   1.00 0.00 ? 37  GLN A CG   5  
ATOM 7551  C CD   . GLN A 1 37  ? 13.350  -5.562  8.561   1.00 0.00 ? 37  GLN A CD   5  
ATOM 7552  O OE1  . GLN A 1 37  ? 13.913  -4.666  9.191   1.00 0.00 ? 37  GLN A OE1  5  
ATOM 7553  N NE2  . GLN A 1 37  ? 13.432  -6.841  8.910   1.00 0.00 ? 37  GLN A NE2  5  
ATOM 7554  H H    . GLN A 1 37  ? 11.242  -2.710  5.097   1.00 0.00 ? 37  GLN A H    5  
ATOM 7555  H HA   . GLN A 1 37  ? 13.138  -3.750  4.271   1.00 0.00 ? 37  GLN A HA   5  
ATOM 7556  H HB2  . GLN A 1 37  ? 14.215  -5.102  6.064   1.00 0.00 ? 37  GLN A HB2  5  
ATOM 7557  H HB3  . GLN A 1 37  ? 13.590  -3.557  6.626   1.00 0.00 ? 37  GLN A HB3  5  
ATOM 7558  H HG2  . GLN A 1 37  ? 11.693  -4.619  7.628   1.00 0.00 ? 37  GLN A HG2  5  
ATOM 7559  H HG3  . GLN A 1 37  ? 12.139  -6.174  6.927   1.00 0.00 ? 37  GLN A HG3  5  
ATOM 7560  H HE21 . GLN A 1 37  ? 12.959  -7.501  8.360   1.00 0.00 ? 37  GLN A HE21 5  
ATOM 7561  H HE22 . GLN A 1 37  ? 13.963  -7.073  9.699   1.00 0.00 ? 37  GLN A HE22 5  
ATOM 7562  N N    . THR A 1 38  ? 11.323  -5.803  3.424   1.00 0.00 ? 38  THR A N    5  
ATOM 7563  C CA   . THR A 1 38  ? 11.004  -7.047  2.734   1.00 0.00 ? 38  THR A CA   5  
ATOM 7564  C C    . THR A 1 38  ? 12.264  -7.723  2.207   1.00 0.00 ? 38  THR A C    5  
ATOM 7565  O O    . THR A 1 38  ? 13.346  -7.136  2.218   1.00 0.00 ? 38  THR A O    5  
ATOM 7566  C CB   . THR A 1 38  ? 10.035  -6.806  1.561   1.00 0.00 ? 38  THR A CB   5  
ATOM 7567  O OG1  . THR A 1 38  ? 10.413  -5.623  0.849   1.00 0.00 ? 38  THR A OG1  5  
ATOM 7568  C CG2  . THR A 1 38  ? 8.604   -6.668  2.060   1.00 0.00 ? 38  THR A CG2  5  
ATOM 7569  H H    . THR A 1 38  ? 10.782  -5.006  3.248   1.00 0.00 ? 38  THR A H    5  
ATOM 7570  H HA   . THR A 1 38  ? 10.522  -7.706  3.442   1.00 0.00 ? 38  THR A HA   5  
ATOM 7571  H HB   . THR A 1 38  ? 10.087  -7.652  0.891   1.00 0.00 ? 38  THR A HB   5  
ATOM 7572  H HG1  . THR A 1 38  ? 11.340  -5.432  1.013   1.00 0.00 ? 38  THR A HG1  5  
ATOM 7573  H HG21 . THR A 1 38  ? 7.921   -6.970  1.281   1.00 0.00 ? 38  THR A HG21 5  
ATOM 7574  H HG22 . THR A 1 38  ? 8.414   -5.639  2.327   1.00 0.00 ? 38  THR A HG22 5  
ATOM 7575  H HG23 . THR A 1 38  ? 8.463   -7.297  2.927   1.00 0.00 ? 38  THR A HG23 5  
ATOM 7576  N N    . VAL A 1 39  ? 12.117  -8.960  1.744   1.00 0.00 ? 39  VAL A N    5  
ATOM 7577  C CA   . VAL A 1 39  ? 13.244  -9.716  1.210   1.00 0.00 ? 39  VAL A CA   5  
ATOM 7578  C C    . VAL A 1 39  ? 13.299  -9.619  -0.310  1.00 0.00 ? 39  VAL A C    5  
ATOM 7579  O O    . VAL A 1 39  ? 12.267  -9.524  -0.974  1.00 0.00 ? 39  VAL A O    5  
ATOM 7580  C CB   . VAL A 1 39  ? 13.169  -11.199 1.617   1.00 0.00 ? 39  VAL A CB   5  
ATOM 7581  C CG1  . VAL A 1 39  ? 14.046  -12.048 0.709   1.00 0.00 ? 39  VAL A CG1  5  
ATOM 7582  C CG2  . VAL A 1 39  ? 13.570  -11.373 3.074   1.00 0.00 ? 39  VAL A CG2  5  
ATOM 7583  H H    . VAL A 1 39  ? 11.229  -9.375  1.762   1.00 0.00 ? 39  VAL A H    5  
ATOM 7584  H HA   . VAL A 1 39  ? 14.151  -9.297  1.621   1.00 0.00 ? 39  VAL A HA   5  
ATOM 7585  H HB   . VAL A 1 39  ? 12.147  -11.531 1.505   1.00 0.00 ? 39  VAL A HB   5  
ATOM 7586  H HG11 . VAL A 1 39  ? 15.065  -11.692 0.759   1.00 0.00 ? 39  VAL A HG11 5  
ATOM 7587  H HG12 . VAL A 1 39  ? 14.007  -13.078 1.031   1.00 0.00 ? 39  VAL A HG12 5  
ATOM 7588  H HG13 . VAL A 1 39  ? 13.689  -11.973 -0.307  1.00 0.00 ? 39  VAL A HG13 5  
ATOM 7589  H HG21 . VAL A 1 39  ? 13.176  -10.553 3.657   1.00 0.00 ? 39  VAL A HG21 5  
ATOM 7590  H HG22 . VAL A 1 39  ? 13.172  -12.304 3.448   1.00 0.00 ? 39  VAL A HG22 5  
ATOM 7591  H HG23 . VAL A 1 39  ? 14.648  -11.385 3.152   1.00 0.00 ? 39  VAL A HG23 5  
ATOM 7592  N N    . ILE A 1 40  ? 14.511  -9.645  -0.855  1.00 0.00 ? 40  ILE A N    5  
ATOM 7593  C CA   . ILE A 1 40  ? 14.701  -9.562  -2.298  1.00 0.00 ? 40  ILE A CA   5  
ATOM 7594  C C    . ILE A 1 40  ? 15.642  -10.655 -2.792  1.00 0.00 ? 40  ILE A C    5  
ATOM 7595  O O    . ILE A 1 40  ? 16.857  -10.464 -2.850  1.00 0.00 ? 40  ILE A O    5  
ATOM 7596  C CB   . ILE A 1 40  ? 15.262  -8.190  -2.714  1.00 0.00 ? 40  ILE A CB   5  
ATOM 7597  C CG1  . ILE A 1 40  ? 14.795  -7.107  -1.739  1.00 0.00 ? 40  ILE A CG1  5  
ATOM 7598  C CG2  . ILE A 1 40  ? 14.834  -7.851  -4.135  1.00 0.00 ? 40  ILE A CG2  5  
ATOM 7599  C CD1  . ILE A 1 40  ? 15.587  -7.072  -0.451  1.00 0.00 ? 40  ILE A CD1  5  
ATOM 7600  H H    . ILE A 1 40  ? 15.295  -9.723  -0.274  1.00 0.00 ? 40  ILE A H    5  
ATOM 7601  H HA   . ILE A 1 40  ? 13.737  -9.693  -2.769  1.00 0.00 ? 40  ILE A HA   5  
ATOM 7602  H HB   . ILE A 1 40  ? 16.339  -8.245  -2.692  1.00 0.00 ? 40  ILE A HB   5  
ATOM 7603  H HG12 . ILE A 1 40  ? 14.888  -6.142  -2.212  1.00 0.00 ? 40  ILE A HG12 5  
ATOM 7604  H HG13 . ILE A 1 40  ? 13.759  -7.282  -1.488  1.00 0.00 ? 40  ILE A HG13 5  
ATOM 7605  H HG21 . ILE A 1 40  ? 14.397  -8.724  -4.596  1.00 0.00 ? 40  ILE A HG21 5  
ATOM 7606  H HG22 . ILE A 1 40  ? 14.106  -7.055  -4.111  1.00 0.00 ? 40  ILE A HG22 5  
ATOM 7607  H HG23 . ILE A 1 40  ? 15.695  -7.536  -4.705  1.00 0.00 ? 40  ILE A HG23 5  
ATOM 7608  H HD11 . ILE A 1 40  ? 16.556  -7.522  -0.612  1.00 0.00 ? 40  ILE A HD11 5  
ATOM 7609  H HD12 . ILE A 1 40  ? 15.716  -6.047  -0.135  1.00 0.00 ? 40  ILE A HD12 5  
ATOM 7610  H HD13 . ILE A 1 40  ? 15.058  -7.621  0.313   1.00 0.00 ? 40  ILE A HD13 5  
ATOM 7611  N N    . LYS A 1 41  ? 15.073  -11.802 -3.150  1.00 0.00 ? 41  LYS A N    5  
ATOM 7612  C CA   . LYS A 1 41  ? 15.860  -12.926 -3.643  1.00 0.00 ? 41  LYS A CA   5  
ATOM 7613  C C    . LYS A 1 41  ? 14.960  -14.100 -4.011  1.00 0.00 ? 41  LYS A C    5  
ATOM 7614  O O    . LYS A 1 41  ? 13.919  -14.316 -3.390  1.00 0.00 ? 41  LYS A O    5  
ATOM 7615  C CB   . LYS A 1 41  ? 16.880  -13.362 -2.589  1.00 0.00 ? 41  LYS A CB   5  
ATOM 7616  C CG   . LYS A 1 41  ? 17.240  -14.836 -2.665  1.00 0.00 ? 41  LYS A CG   5  
ATOM 7617  C CD   . LYS A 1 41  ? 16.316  -15.681 -1.805  1.00 0.00 ? 41  LYS A CD   5  
ATOM 7618  C CE   . LYS A 1 41  ? 16.719  -15.634 -0.339  1.00 0.00 ? 41  LYS A CE   5  
ATOM 7619  N NZ   . LYS A 1 41  ? 17.656  -16.736 0.014   1.00 0.00 ? 41  LYS A NZ   5  
ATOM 7620  H H    . LYS A 1 41  ? 14.100  -11.893 -3.081  1.00 0.00 ? 41  LYS A H    5  
ATOM 7621  H HA   . LYS A 1 41  ? 16.386  -12.600 -4.527  1.00 0.00 ? 41  LYS A HA   5  
ATOM 7622  H HB2  . LYS A 1 41  ? 17.784  -12.785 -2.719  1.00 0.00 ? 41  LYS A HB2  5  
ATOM 7623  H HB3  . LYS A 1 41  ? 16.474  -13.163 -1.608  1.00 0.00 ? 41  LYS A HB3  5  
ATOM 7624  H HG2  . LYS A 1 41  ? 17.161  -15.164 -3.690  1.00 0.00 ? 41  LYS A HG2  5  
ATOM 7625  H HG3  . LYS A 1 41  ? 18.257  -14.967 -2.321  1.00 0.00 ? 41  LYS A HG3  5  
ATOM 7626  H HD2  . LYS A 1 41  ? 15.307  -15.307 -1.901  1.00 0.00 ? 41  LYS A HD2  5  
ATOM 7627  H HD3  . LYS A 1 41  ? 16.356  -16.705 -2.147  1.00 0.00 ? 41  LYS A HD3  5  
ATOM 7628  H HE2  . LYS A 1 41  ? 17.200  -14.688 -0.142  1.00 0.00 ? 41  LYS A HE2  5  
ATOM 7629  H HE3  . LYS A 1 41  ? 15.830  -15.719 0.268   1.00 0.00 ? 41  LYS A HE3  5  
ATOM 7630  H HZ1  . LYS A 1 41  ? 18.233  -16.993 -0.811  1.00 0.00 ? 41  LYS A HZ1  5  
ATOM 7631  H HZ2  . LYS A 1 41  ? 17.122  -17.573 0.325   1.00 0.00 ? 41  LYS A HZ2  5  
ATOM 7632  H HZ3  . LYS A 1 41  ? 18.286  -16.436 0.785   1.00 0.00 ? 41  LYS A HZ3  5  
ATOM 7633  N N    . ARG A 1 42  ? 15.367  -14.857 -5.025  1.00 0.00 ? 42  ARG A N    5  
ATOM 7634  C CA   . ARG A 1 42  ? 14.597  -16.010 -5.475  1.00 0.00 ? 42  ARG A CA   5  
ATOM 7635  C C    . ARG A 1 42  ? 14.647  -17.134 -4.444  1.00 0.00 ? 42  ARG A C    5  
ATOM 7636  O O    . ARG A 1 42  ? 15.420  -18.083 -4.581  1.00 0.00 ? 42  ARG A O    5  
ATOM 7637  C CB   . ARG A 1 42  ? 15.128  -16.512 -6.819  1.00 0.00 ? 42  ARG A CB   5  
ATOM 7638  C CG   . ARG A 1 42  ? 16.628  -16.331 -6.987  1.00 0.00 ? 42  ARG A CG   5  
ATOM 7639  C CD   . ARG A 1 42  ? 16.959  -14.998 -7.639  1.00 0.00 ? 42  ARG A CD   5  
ATOM 7640  N NE   . ARG A 1 42  ? 18.272  -14.502 -7.237  1.00 0.00 ? 42  ARG A NE   5  
ATOM 7641  C CZ   . ARG A 1 42  ? 18.878  -13.472 -7.817  1.00 0.00 ? 42  ARG A CZ   5  
ATOM 7642  N NH1  . ARG A 1 42  ? 18.291  -12.832 -8.819  1.00 0.00 ? 42  ARG A NH1  5  
ATOM 7643  N NH2  . ARG A 1 42  ? 20.073  -13.080 -7.395  1.00 0.00 ? 42  ARG A NH2  5  
ATOM 7644  H H    . ARG A 1 42  ? 16.206  -14.635 -5.481  1.00 0.00 ? 42  ARG A H    5  
ATOM 7645  H HA   . ARG A 1 42  ? 13.571  -15.697 -5.598  1.00 0.00 ? 42  ARG A HA   5  
ATOM 7646  H HB2  . ARG A 1 42  ? 14.903  -17.565 -6.912  1.00 0.00 ? 42  ARG A HB2  5  
ATOM 7647  H HB3  . ARG A 1 42  ? 14.632  -15.975 -7.612  1.00 0.00 ? 42  ARG A HB3  5  
ATOM 7648  H HG2  . ARG A 1 42  ? 17.097  -16.369 -6.014  1.00 0.00 ? 42  ARG A HG2  5  
ATOM 7649  H HG3  . ARG A 1 42  ? 17.011  -17.130 -7.605  1.00 0.00 ? 42  ARG A HG3  5  
ATOM 7650  H HD2  . ARG A 1 42  ? 16.945  -15.124 -8.712  1.00 0.00 ? 42  ARG A HD2  5  
ATOM 7651  H HD3  . ARG A 1 42  ? 16.208  -14.277 -7.353  1.00 0.00 ? 42  ARG A HD3  5  
ATOM 7652  H HE   . ARG A 1 42  ? 18.724  -14.961 -6.499  1.00 0.00 ? 42  ARG A HE   5  
ATOM 7653  H HH11 . ARG A 1 42  ? 17.390  -13.124 -9.138  1.00 0.00 ? 42  ARG A HH11 5  
ATOM 7654  H HH12 . ARG A 1 42  ? 18.749  -12.055 -9.253  1.00 0.00 ? 42  ARG A HH12 5  
ATOM 7655  H HH21 . ARG A 1 42  ? 20.519  -13.561 -6.640  1.00 0.00 ? 42  ARG A HH21 5  
ATOM 7656  H HH22 . ARG A 1 42  ? 20.528  -12.305 -7.832  1.00 0.00 ? 42  ARG A HH22 5  
ATOM 7657  N N    . LEU A 1 43  ? 13.819  -17.020 -3.412  1.00 0.00 ? 43  LEU A N    5  
ATOM 7658  C CA   . LEU A 1 43  ? 13.769  -18.026 -2.356  1.00 0.00 ? 43  LEU A CA   5  
ATOM 7659  C C    . LEU A 1 43  ? 12.596  -18.978 -2.567  1.00 0.00 ? 43  LEU A C    5  
ATOM 7660  O O    . LEU A 1 43  ? 11.514  -18.566 -2.985  1.00 0.00 ? 43  LEU A O    5  
ATOM 7661  C CB   . LEU A 1 43  ? 13.654  -17.353 -0.988  1.00 0.00 ? 43  LEU A CB   5  
ATOM 7662  C CG   . LEU A 1 43  ? 13.014  -18.190 0.121   1.00 0.00 ? 43  LEU A CG   5  
ATOM 7663  C CD1  . LEU A 1 43  ? 13.955  -18.308 1.310   1.00 0.00 ? 43  LEU A CD1  5  
ATOM 7664  C CD2  . LEU A 1 43  ? 11.685  -17.584 0.548   1.00 0.00 ? 43  LEU A CD2  5  
ATOM 7665  H H    . LEU A 1 43  ? 13.227  -16.242 -3.357  1.00 0.00 ? 43  LEU A H    5  
ATOM 7666  H HA   . LEU A 1 43  ? 14.687  -18.592 -2.394  1.00 0.00 ? 43  LEU A HA   5  
ATOM 7667  H HB2  . LEU A 1 43  ? 14.648  -17.084 -0.667  1.00 0.00 ? 43  LEU A HB2  5  
ATOM 7668  H HB3  . LEU A 1 43  ? 13.062  -16.456 -1.110  1.00 0.00 ? 43  LEU A HB3  5  
ATOM 7669  H HG   . LEU A 1 43  ? 12.824  -19.186 -0.254  1.00 0.00 ? 43  LEU A HG   5  
ATOM 7670  H HD11 . LEU A 1 43  ? 13.659  -19.147 1.921   1.00 0.00 ? 43  LEU A HD11 5  
ATOM 7671  H HD12 . LEU A 1 43  ? 13.909  -17.402 1.896   1.00 0.00 ? 43  LEU A HD12 5  
ATOM 7672  H HD13 . LEU A 1 43  ? 14.965  -18.457 0.957   1.00 0.00 ? 43  LEU A HD13 5  
ATOM 7673  H HD21 . LEU A 1 43  ? 11.120  -17.304 -0.328  1.00 0.00 ? 43  LEU A HD21 5  
ATOM 7674  H HD22 . LEU A 1 43  ? 11.867  -16.710 1.155   1.00 0.00 ? 43  LEU A HD22 5  
ATOM 7675  H HD23 . LEU A 1 43  ? 11.127  -18.310 1.120   1.00 0.00 ? 43  LEU A HD23 5  
ATOM 7676  N N    . LYS A 1 44  ? 12.817  -20.255 -2.274  1.00 0.00 ? 44  LYS A N    5  
ATOM 7677  C CA   . LYS A 1 44  ? 11.779  -21.267 -2.427  1.00 0.00 ? 44  LYS A CA   5  
ATOM 7678  C C    . LYS A 1 44  ? 11.422  -21.890 -1.081  1.00 0.00 ? 44  LYS A C    5  
ATOM 7679  O O    . LYS A 1 44  ? 10.248  -22.080 -0.767  1.00 0.00 ? 44  LYS A O    5  
ATOM 7680  C CB   . LYS A 1 44  ? 12.239  -22.356 -3.399  1.00 0.00 ? 44  LYS A CB   5  
ATOM 7681  C CG   . LYS A 1 44  ? 12.273  -21.904 -4.849  1.00 0.00 ? 44  LYS A CG   5  
ATOM 7682  C CD   . LYS A 1 44  ? 12.282  -23.087 -5.802  1.00 0.00 ? 44  LYS A CD   5  
ATOM 7683  C CE   . LYS A 1 44  ? 10.931  -23.784 -5.838  1.00 0.00 ? 44  LYS A CE   5  
ATOM 7684  N NZ   . LYS A 1 44  ? 10.876  -24.833 -6.894  1.00 0.00 ? 44  LYS A NZ   5  
ATOM 7685  H H    . LYS A 1 44  ? 13.701  -20.524 -1.945  1.00 0.00 ? 44  LYS A H    5  
ATOM 7686  H HA   . LYS A 1 44  ? 10.902  -20.784 -2.831  1.00 0.00 ? 44  LYS A HA   5  
ATOM 7687  H HB2  . LYS A 1 44  ? 13.233  -22.675 -3.120  1.00 0.00 ? 44  LYS A HB2  5  
ATOM 7688  H HB3  . LYS A 1 44  ? 11.566  -23.198 -3.322  1.00 0.00 ? 44  LYS A HB3  5  
ATOM 7689  H HG2  . LYS A 1 44  ? 11.399  -21.301 -5.048  1.00 0.00 ? 44  LYS A HG2  5  
ATOM 7690  H HG3  . LYS A 1 44  ? 13.164  -21.315 -5.012  1.00 0.00 ? 44  LYS A HG3  5  
ATOM 7691  H HD2  . LYS A 1 44  ? 12.520  -22.736 -6.795  1.00 0.00 ? 44  LYS A HD2  5  
ATOM 7692  H HD3  . LYS A 1 44  ? 13.033  -23.793 -5.478  1.00 0.00 ? 44  LYS A HD3  5  
ATOM 7693  H HE2  . LYS A 1 44  ? 10.751  -24.243 -4.878  1.00 0.00 ? 44  LYS A HE2  5  
ATOM 7694  H HE3  . LYS A 1 44  ? 10.166  -23.048 -6.034  1.00 0.00 ? 44  LYS A HE3  5  
ATOM 7695  H HZ1  . LYS A 1 44  ? 9.974   -24.775 -7.409  1.00 0.00 ? 44  LYS A HZ1  5  
ATOM 7696  H HZ2  . LYS A 1 44  ? 10.958  -25.777 -6.464  1.00 0.00 ? 44  LYS A HZ2  5  
ATOM 7697  H HZ3  . LYS A 1 44  ? 11.657  -24.703 -7.568  1.00 0.00 ? 44  LYS A HZ3  5  
ATOM 7698  N N    . ASN A 1 45  ? 12.444  -22.203 -0.290  1.00 0.00 ? 45  ASN A N    5  
ATOM 7699  C CA   . ASN A 1 45  ? 12.237  -22.803 1.023   1.00 0.00 ? 45  ASN A CA   5  
ATOM 7700  C C    . ASN A 1 45  ? 11.895  -21.738 2.060   1.00 0.00 ? 45  ASN A C    5  
ATOM 7701  O O    . ASN A 1 45  ? 12.782  -21.137 2.664   1.00 0.00 ? 45  ASN A O    5  
ATOM 7702  C CB   . ASN A 1 45  ? 13.487  -23.571 1.458   1.00 0.00 ? 45  ASN A CB   5  
ATOM 7703  C CG   . ASN A 1 45  ? 13.740  -24.797 0.600   1.00 0.00 ? 45  ASN A CG   5  
ATOM 7704  O OD1  . ASN A 1 45  ? 14.467  -24.735 -0.391  1.00 0.00 ? 45  ASN A OD1  5  
ATOM 7705  N ND2  . ASN A 1 45  ? 13.139  -25.918 0.980   1.00 0.00 ? 45  ASN A ND2  5  
ATOM 7706  H H    . ASN A 1 45  ? 13.358  -22.027 -0.597  1.00 0.00 ? 45  ASN A H    5  
ATOM 7707  H HA   . ASN A 1 45  ? 11.410  -23.493 0.945   1.00 0.00 ? 45  ASN A HA   5  
ATOM 7708  H HB2  . ASN A 1 45  ? 14.346  -22.921 1.383   1.00 0.00 ? 45  ASN A HB2  5  
ATOM 7709  H HB3  . ASN A 1 45  ? 13.369  -23.889 2.482   1.00 0.00 ? 45  ASN A HB3  5  
ATOM 7710  H HD21 . ASN A 1 45  ? 12.573  -25.893 1.780   1.00 0.00 ? 45  ASN A HD21 5  
ATOM 7711  H HD22 . ASN A 1 45  ? 13.285  -26.726 0.444   1.00 0.00 ? 45  ASN A HD22 5  
ATOM 7712  N N    . GLY A 1 46  ? 10.600  -21.510 2.261   1.00 0.00 ? 46  GLY A N    5  
ATOM 7713  C CA   . GLY A 1 46  ? 10.163  -20.518 3.225   1.00 0.00 ? 46  GLY A CA   5  
ATOM 7714  C C    . GLY A 1 46  ? 8.920   -19.778 2.773   1.00 0.00 ? 46  GLY A C    5  
ATOM 7715  O O    . GLY A 1 46  ? 9.006   -18.661 2.264   1.00 0.00 ? 46  GLY A O    5  
ATOM 7716  H H    . GLY A 1 46  ? 9.937   -22.019 1.750   1.00 0.00 ? 46  GLY A H    5  
ATOM 7717  H HA2  . GLY A 1 46  ? 9.955   -21.011 4.163   1.00 0.00 ? 46  GLY A HA2  5  
ATOM 7718  H HA3  . GLY A 1 46  ? 10.959  -19.803 3.375   1.00 0.00 ? 46  GLY A HA3  5  
ATOM 7719  N N    . GLU A 1 47  ? 7.761   -20.402 2.958   1.00 0.00 ? 47  GLU A N    5  
ATOM 7720  C CA   . GLU A 1 47  ? 6.495   -19.795 2.563   1.00 0.00 ? 47  GLU A CA   5  
ATOM 7721  C C    . GLU A 1 47  ? 5.952   -18.898 3.671   1.00 0.00 ? 47  GLU A C    5  
ATOM 7722  O O    . GLU A 1 47  ? 5.606   -19.372 4.752   1.00 0.00 ? 47  GLU A O    5  
ATOM 7723  C CB   . GLU A 1 47  ? 5.471   -20.878 2.219   1.00 0.00 ? 47  GLU A CB   5  
ATOM 7724  C CG   . GLU A 1 47  ? 4.500   -20.471 1.123   1.00 0.00 ? 47  GLU A CG   5  
ATOM 7725  C CD   . GLU A 1 47  ? 3.230   -19.848 1.670   1.00 0.00 ? 47  GLU A CD   5  
ATOM 7726  O OE1  . GLU A 1 47  ? 2.431   -20.579 2.292   1.00 0.00 ? 47  GLU A OE1  5  
ATOM 7727  O OE2  . GLU A 1 47  ? 3.036   -18.630 1.477   1.00 0.00 ? 47  GLU A OE2  5  
ATOM 7728  H H    . GLU A 1 47  ? 7.757   -21.291 3.370   1.00 0.00 ? 47  GLU A H    5  
ATOM 7729  H HA   . GLU A 1 47  ? 6.677   -19.193 1.685   1.00 0.00 ? 47  GLU A HA   5  
ATOM 7730  H HB2  . GLU A 1 47  ? 5.996   -21.765 1.896   1.00 0.00 ? 47  GLU A HB2  5  
ATOM 7731  H HB3  . GLU A 1 47  ? 4.901   -21.112 3.106   1.00 0.00 ? 47  GLU A HB3  5  
ATOM 7732  H HG2  . GLU A 1 47  ? 4.985   -19.755 0.478   1.00 0.00 ? 47  GLU A HG2  5  
ATOM 7733  H HG3  . GLU A 1 47  ? 4.235   -21.348 0.551   1.00 0.00 ? 47  GLU A HG3  5  
ATOM 7734  N N    . GLU A 1 48  ? 5.881   -17.600 3.393   1.00 0.00 ? 48  GLU A N    5  
ATOM 7735  C CA   . GLU A 1 48  ? 5.382   -16.637 4.367   1.00 0.00 ? 48  GLU A CA   5  
ATOM 7736  C C    . GLU A 1 48  ? 4.849   -15.387 3.672   1.00 0.00 ? 48  GLU A C    5  
ATOM 7737  O O    . GLU A 1 48  ? 4.948   -15.251 2.452   1.00 0.00 ? 48  GLU A O    5  
ATOM 7738  C CB   . GLU A 1 48  ? 6.488   -16.254 5.352   1.00 0.00 ? 48  GLU A CB   5  
ATOM 7739  C CG   . GLU A 1 48  ? 7.137   -14.914 5.048   1.00 0.00 ? 48  GLU A CG   5  
ATOM 7740  C CD   . GLU A 1 48  ? 8.356   -14.647 5.910   1.00 0.00 ? 48  GLU A CD   5  
ATOM 7741  O OE1  . GLU A 1 48  ? 9.098   -15.608 6.202   1.00 0.00 ? 48  GLU A OE1  5  
ATOM 7742  O OE2  . GLU A 1 48  ? 8.566   -13.477 6.292   1.00 0.00 ? 48  GLU A OE2  5  
ATOM 7743  H H    . GLU A 1 48  ? 6.173   -17.283 2.513   1.00 0.00 ? 48  GLU A H    5  
ATOM 7744  H HA   . GLU A 1 48  ? 4.574   -17.104 4.911   1.00 0.00 ? 48  GLU A HA   5  
ATOM 7745  H HB2  . GLU A 1 48  ? 6.068   -16.210 6.347   1.00 0.00 ? 48  GLU A HB2  5  
ATOM 7746  H HB3  . GLU A 1 48  ? 7.254   -17.015 5.328   1.00 0.00 ? 48  GLU A HB3  5  
ATOM 7747  H HG2  . GLU A 1 48  ? 7.439   -14.902 4.011   1.00 0.00 ? 48  GLU A HG2  5  
ATOM 7748  H HG3  . GLU A 1 48  ? 6.414   -14.131 5.220   1.00 0.00 ? 48  GLU A HG3  5  
ATOM 7749  N N    . LEU A 1 49  ? 4.283   -14.477 4.458   1.00 0.00 ? 49  LEU A N    5  
ATOM 7750  C CA   . LEU A 1 49  ? 3.734   -13.237 3.919   1.00 0.00 ? 49  LEU A CA   5  
ATOM 7751  C C    . LEU A 1 49  ? 4.817   -12.418 3.225   1.00 0.00 ? 49  LEU A C    5  
ATOM 7752  O O    . LEU A 1 49  ? 5.513   -11.624 3.859   1.00 0.00 ? 49  LEU A O    5  
ATOM 7753  C CB   . LEU A 1 49  ? 3.092   -12.413 5.037   1.00 0.00 ? 49  LEU A CB   5  
ATOM 7754  C CG   . LEU A 1 49  ? 1.592   -12.150 4.900   1.00 0.00 ? 49  LEU A CG   5  
ATOM 7755  C CD1  . LEU A 1 49  ? 1.330   -11.087 3.845   1.00 0.00 ? 49  LEU A CD1  5  
ATOM 7756  C CD2  . LEU A 1 49  ? 0.854   -13.437 4.559   1.00 0.00 ? 49  LEU A CD2  5  
ATOM 7757  H H    . LEU A 1 49  ? 4.234   -14.641 5.422   1.00 0.00 ? 49  LEU A H    5  
ATOM 7758  H HA   . LEU A 1 49  ? 2.977   -13.498 3.195   1.00 0.00 ? 49  LEU A HA   5  
ATOM 7759  H HB2  . LEU A 1 49  ? 3.252   -12.936 5.967   1.00 0.00 ? 49  LEU A HB2  5  
ATOM 7760  H HB3  . LEU A 1 49  ? 3.595   -11.457 5.072   1.00 0.00 ? 49  LEU A HB3  5  
ATOM 7761  H HG   . LEU A 1 49  ? 1.210   -11.785 5.843   1.00 0.00 ? 49  LEU A HG   5  
ATOM 7762  H HD11 . LEU A 1 49  ? 2.263   -10.803 3.382   1.00 0.00 ? 49  LEU A HD11 5  
ATOM 7763  H HD12 . LEU A 1 49  ? 0.880   -10.222 4.309   1.00 0.00 ? 49  LEU A HD12 5  
ATOM 7764  H HD13 . LEU A 1 49  ? 0.661   -11.482 3.094   1.00 0.00 ? 49  LEU A HD13 5  
ATOM 7765  H HD21 . LEU A 1 49  ? 0.739   -13.512 3.488   1.00 0.00 ? 49  LEU A HD21 5  
ATOM 7766  H HD22 . LEU A 1 49  ? -0.120  -13.427 5.026   1.00 0.00 ? 49  LEU A HD22 5  
ATOM 7767  H HD23 . LEU A 1 49  ? 1.419   -14.283 4.922   1.00 0.00 ? 49  LEU A HD23 5  
ATOM 7768  N N    . LYS A 1 50  ? 4.953   -12.613 1.918   1.00 0.00 ? 50  LYS A N    5  
ATOM 7769  C CA   . LYS A 1 50  ? 5.948   -11.890 1.135   1.00 0.00 ? 50  LYS A CA   5  
ATOM 7770  C C    . LYS A 1 50  ? 5.290   -10.814 0.279   1.00 0.00 ? 50  LYS A C    5  
ATOM 7771  O O    . LYS A 1 50  ? 4.273   -11.058 -0.369  1.00 0.00 ? 50  LYS A O    5  
ATOM 7772  C CB   . LYS A 1 50  ? 6.728   -12.860 0.244   1.00 0.00 ? 50  LYS A CB   5  
ATOM 7773  C CG   . LYS A 1 50  ? 8.224   -12.596 0.223   1.00 0.00 ? 50  LYS A CG   5  
ATOM 7774  C CD   . LYS A 1 50  ? 8.817   -12.861 -1.151  1.00 0.00 ? 50  LYS A CD   5  
ATOM 7775  C CE   . LYS A 1 50  ? 9.442   -14.246 -1.231  1.00 0.00 ? 50  LYS A CE   5  
ATOM 7776  N NZ   . LYS A 1 50  ? 8.448   -15.319 -0.950  1.00 0.00 ? 50  LYS A NZ   5  
ATOM 7777  H H    . LYS A 1 50  ? 4.368   -13.260 1.468   1.00 0.00 ? 50  LYS A H    5  
ATOM 7778  H HA   . LYS A 1 50  ? 6.632   -11.418 1.824   1.00 0.00 ? 50  LYS A HA   5  
ATOM 7779  H HB2  . LYS A 1 50  ? 6.566   -13.867 0.599   1.00 0.00 ? 50  LYS A HB2  5  
ATOM 7780  H HB3  . LYS A 1 50  ? 6.356   -12.779 -0.767  1.00 0.00 ? 50  LYS A HB3  5  
ATOM 7781  H HG2  . LYS A 1 50  ? 8.403   -11.565 0.487   1.00 0.00 ? 50  LYS A HG2  5  
ATOM 7782  H HG3  . LYS A 1 50  ? 8.705   -13.243 0.943   1.00 0.00 ? 50  LYS A HG3  5  
ATOM 7783  H HD2  . LYS A 1 50  ? 8.035   -12.788 -1.892  1.00 0.00 ? 50  LYS A HD2  5  
ATOM 7784  H HD3  . LYS A 1 50  ? 9.578   -12.121 -1.354  1.00 0.00 ? 50  LYS A HD3  5  
ATOM 7785  H HE2  . LYS A 1 50  ? 9.843   -14.389 -2.222  1.00 0.00 ? 50  LYS A HE2  5  
ATOM 7786  H HE3  . LYS A 1 50  ? 10.240  -14.309 -0.507  1.00 0.00 ? 50  LYS A HE3  5  
ATOM 7787  H HZ1  . LYS A 1 50  ? 8.367   -15.955 -1.770  1.00 0.00 ? 50  LYS A HZ1  5  
ATOM 7788  H HZ2  . LYS A 1 50  ? 7.516   -14.901 -0.756  1.00 0.00 ? 50  LYS A HZ2  5  
ATOM 7789  H HZ3  . LYS A 1 50  ? 8.745   -15.874 -0.123  1.00 0.00 ? 50  LYS A HZ3  5  
ATOM 7790  N N    . GLY A 1 51  ? 5.878   -9.621  0.280   1.00 0.00 ? 51  GLY A N    5  
ATOM 7791  C CA   . GLY A 1 51  ? 5.335   -8.525  -0.502  1.00 0.00 ? 51  GLY A CA   5  
ATOM 7792  C C    . GLY A 1 51  ? 4.747   -7.430  0.365   1.00 0.00 ? 51  GLY A C    5  
ATOM 7793  O O    . GLY A 1 51  ? 4.697   -7.558  1.589   1.00 0.00 ? 51  GLY A O    5  
ATOM 7794  H H    . GLY A 1 51  ? 6.687   -9.484  0.816   1.00 0.00 ? 51  GLY A H    5  
ATOM 7795  H HA2  . GLY A 1 51  ? 6.123   -8.106  -1.109  1.00 0.00 ? 51  GLY A HA2  5  
ATOM 7796  H HA3  . GLY A 1 51  ? 4.561   -8.910  -1.150  1.00 0.00 ? 51  GLY A HA3  5  
ATOM 7797  N N    . ILE A 1 52  ? 4.303   -6.350  -0.268  1.00 0.00 ? 52  ILE A N    5  
ATOM 7798  C CA   . ILE A 1 52  ? 3.716   -5.228  0.454   1.00 0.00 ? 52  ILE A CA   5  
ATOM 7799  C C    . ILE A 1 52  ? 2.199   -5.362  0.539   1.00 0.00 ? 52  ILE A C    5  
ATOM 7800  O O    . ILE A 1 52  ? 1.577   -6.029  -0.288  1.00 0.00 ? 52  ILE A O    5  
ATOM 7801  C CB   . ILE A 1 52  ? 4.065   -3.885  -0.213  1.00 0.00 ? 52  ILE A CB   5  
ATOM 7802  C CG1  . ILE A 1 52  ? 5.573   -3.789  -0.457  1.00 0.00 ? 52  ILE A CG1  5  
ATOM 7803  C CG2  . ILE A 1 52  ? 3.588   -2.726  0.649   1.00 0.00 ? 52  ILE A CG2  5  
ATOM 7804  C CD1  . ILE A 1 52  ? 6.395   -3.833  0.812   1.00 0.00 ? 52  ILE A CD1  5  
ATOM 7805  H H    . ILE A 1 52  ? 4.370   -6.308  -1.245  1.00 0.00 ? 52  ILE A H    5  
ATOM 7806  H HA   . ILE A 1 52  ? 4.123   -5.227  1.455   1.00 0.00 ? 52  ILE A HA   5  
ATOM 7807  H HB   . ILE A 1 52  ? 3.550   -3.834  -1.160  1.00 0.00 ? 52  ILE A HB   5  
ATOM 7808  H HG12 . ILE A 1 52  ? 5.883   -4.612  -1.081  1.00 0.00 ? 52  ILE A HG12 5  
ATOM 7809  H HG13 . ILE A 1 52  ? 5.789   -2.858  -0.962  1.00 0.00 ? 52  ILE A HG13 5  
ATOM 7810  H HG21 . ILE A 1 52  ? 3.986   -1.800  0.260   1.00 0.00 ? 52  ILE A HG21 5  
ATOM 7811  H HG22 . ILE A 1 52  ? 2.509   -2.687  0.634   1.00 0.00 ? 52  ILE A HG22 5  
ATOM 7812  H HG23 . ILE A 1 52  ? 3.929   -2.866  1.663   1.00 0.00 ? 52  ILE A HG23 5  
ATOM 7813  H HD11 . ILE A 1 52  ? 6.999   -4.729  0.818   1.00 0.00 ? 52  ILE A HD11 5  
ATOM 7814  H HD12 . ILE A 1 52  ? 7.038   -2.966  0.855   1.00 0.00 ? 52  ILE A HD12 5  
ATOM 7815  H HD13 . ILE A 1 52  ? 5.737   -3.836  1.667   1.00 0.00 ? 52  ILE A HD13 5  
ATOM 7816  N N    . PHE A 1 53  ? 1.610   -4.721  1.543   1.00 0.00 ? 53  PHE A N    5  
ATOM 7817  C CA   . PHE A 1 53  ? 0.165   -4.767  1.736   1.00 0.00 ? 53  PHE A CA   5  
ATOM 7818  C C    . PHE A 1 53  ? -0.341  -3.474  2.368   1.00 0.00 ? 53  PHE A C    5  
ATOM 7819  O O    . PHE A 1 53  ? 0.387   -2.803  3.101   1.00 0.00 ? 53  PHE A O    5  
ATOM 7820  C CB   . PHE A 1 53  ? -0.216  -5.961  2.614   1.00 0.00 ? 53  PHE A CB   5  
ATOM 7821  C CG   . PHE A 1 53  ? 0.439   -7.246  2.196   1.00 0.00 ? 53  PHE A CG   5  
ATOM 7822  C CD1  . PHE A 1 53  ? 1.719   -7.558  2.623   1.00 0.00 ? 53  PHE A CD1  5  
ATOM 7823  C CD2  . PHE A 1 53  ? -0.227  -8.142  1.375   1.00 0.00 ? 53  PHE A CD2  5  
ATOM 7824  C CE1  . PHE A 1 53  ? 2.324   -8.740  2.239   1.00 0.00 ? 53  PHE A CE1  5  
ATOM 7825  C CE2  . PHE A 1 53  ? 0.373   -9.326  0.989   1.00 0.00 ? 53  PHE A CE2  5  
ATOM 7826  C CZ   . PHE A 1 53  ? 1.650   -9.625  1.421   1.00 0.00 ? 53  PHE A CZ   5  
ATOM 7827  H H    . PHE A 1 53  ? 2.160   -4.205  2.169   1.00 0.00 ? 53  PHE A H    5  
ATOM 7828  H HA   . PHE A 1 53  ? -0.294  -4.883  0.766   1.00 0.00 ? 53  PHE A HA   5  
ATOM 7829  H HB2  . PHE A 1 53  ? 0.077   -5.756  3.633   1.00 0.00 ? 53  PHE A HB2  5  
ATOM 7830  H HB3  . PHE A 1 53  ? -1.285  -6.102  2.573   1.00 0.00 ? 53  PHE A HB3  5  
ATOM 7831  H HD1  . PHE A 1 53  ? 2.248   -6.866  3.263   1.00 0.00 ? 53  PHE A HD1  5  
ATOM 7832  H HD2  . PHE A 1 53  ? -1.225  -7.909  1.035   1.00 0.00 ? 53  PHE A HD2  5  
ATOM 7833  H HE1  . PHE A 1 53  ? 3.323   -8.971  2.579   1.00 0.00 ? 53  PHE A HE1  5  
ATOM 7834  H HE2  . PHE A 1 53  ? -0.156  -10.016 0.348   1.00 0.00 ? 53  PHE A HE2  5  
ATOM 7835  H HZ   . PHE A 1 53  ? 2.121   -10.549 1.121   1.00 0.00 ? 53  PHE A HZ   5  
ATOM 7836  N N    . ILE A 1 54  ? -1.591  -3.130  2.079   1.00 0.00 ? 54  ILE A N    5  
ATOM 7837  C CA   . ILE A 1 54  ? -2.194  -1.918  2.619   1.00 0.00 ? 54  ILE A CA   5  
ATOM 7838  C C    . ILE A 1 54  ? -2.294  -1.985  4.139   1.00 0.00 ? 54  ILE A C    5  
ATOM 7839  O O    . ILE A 1 54  ? -2.689  -3.006  4.703   1.00 0.00 ? 54  ILE A O    5  
ATOM 7840  C CB   . ILE A 1 54  ? -3.599  -1.679  2.033   1.00 0.00 ? 54  ILE A CB   5  
ATOM 7841  C CG1  . ILE A 1 54  ? -3.543  -1.674  0.504   1.00 0.00 ? 54  ILE A CG1  5  
ATOM 7842  C CG2  . ILE A 1 54  ? -4.173  -0.370  2.553   1.00 0.00 ? 54  ILE A CG2  5  
ATOM 7843  C CD1  . ILE A 1 54  ? -4.818  -1.181  -0.145  1.00 0.00 ? 54  ILE A CD1  5  
ATOM 7844  H H    . ILE A 1 54  ? -2.121  -3.706  1.489   1.00 0.00 ? 54  ILE A H    5  
ATOM 7845  H HA   . ILE A 1 54  ? -1.565  -1.083  2.346   1.00 0.00 ? 54  ILE A HA   5  
ATOM 7846  H HB   . ILE A 1 54  ? -4.242  -2.481  2.361   1.00 0.00 ? 54  ILE A HB   5  
ATOM 7847  H HG12 . ILE A 1 54  ? -2.738  -1.033  0.182   1.00 0.00 ? 54  ILE A HG12 5  
ATOM 7848  H HG13 . ILE A 1 54  ? -3.359  -2.680  0.155   1.00 0.00 ? 54  ILE A HG13 5  
ATOM 7849  H HG21 . ILE A 1 54  ? -3.861  0.440   1.910   1.00 0.00 ? 54  ILE A HG21 5  
ATOM 7850  H HG22 . ILE A 1 54  ? -5.251  -0.427  2.559   1.00 0.00 ? 54  ILE A HG22 5  
ATOM 7851  H HG23 . ILE A 1 54  ? -3.815  -0.192  3.556   1.00 0.00 ? 54  ILE A HG23 5  
ATOM 7852  H HD11 . ILE A 1 54  ? -5.598  -1.115  0.600   1.00 0.00 ? 54  ILE A HD11 5  
ATOM 7853  H HD12 . ILE A 1 54  ? -4.649  -0.205  -0.575  1.00 0.00 ? 54  ILE A HD12 5  
ATOM 7854  H HD13 . ILE A 1 54  ? -5.117  -1.870  -0.919  1.00 0.00 ? 54  ILE A HD13 5  
ATOM 7855  N N    . LYS A 1 55  ? -1.936  -0.888  4.799   1.00 0.00 ? 55  LYS A N    5  
ATOM 7856  C CA   . LYS A 1 55  ? -1.987  -0.819  6.254   1.00 0.00 ? 55  LYS A CA   5  
ATOM 7857  C C    . LYS A 1 55  ? -3.286  -0.170  6.722   1.00 0.00 ? 55  LYS A C    5  
ATOM 7858  O O    . LYS A 1 55  ? -3.912  -0.633  7.676   1.00 0.00 ? 55  LYS A O    5  
ATOM 7859  C CB   . LYS A 1 55  ? -0.790  -0.031  6.790   1.00 0.00 ? 55  LYS A CB   5  
ATOM 7860  C CG   . LYS A 1 55  ? -1.001  0.518   8.191   1.00 0.00 ? 55  LYS A CG   5  
ATOM 7861  C CD   . LYS A 1 55  ? -1.298  -0.592  9.185   1.00 0.00 ? 55  LYS A CD   5  
ATOM 7862  C CE   . LYS A 1 55  ? -1.873  -0.040  10.481  1.00 0.00 ? 55  LYS A CE   5  
ATOM 7863  N NZ   . LYS A 1 55  ? -0.805  0.315   11.455  1.00 0.00 ? 55  LYS A NZ   5  
ATOM 7864  H H    . LYS A 1 55  ? -1.630  -0.105  4.293   1.00 0.00 ? 55  LYS A H    5  
ATOM 7865  H HA   . LYS A 1 55  ? -1.944  -1.827  6.636   1.00 0.00 ? 55  LYS A HA   5  
ATOM 7866  H HB2  . LYS A 1 55  ? 0.074   -0.679  6.806   1.00 0.00 ? 55  LYS A HB2  5  
ATOM 7867  H HB3  . LYS A 1 55  ? -0.594  0.799   6.127   1.00 0.00 ? 55  LYS A HB3  5  
ATOM 7868  H HG2  . LYS A 1 55  ? -0.106  1.036   8.503   1.00 0.00 ? 55  LYS A HG2  5  
ATOM 7869  H HG3  . LYS A 1 55  ? -1.833  1.208   8.176   1.00 0.00 ? 55  LYS A HG3  5  
ATOM 7870  H HD2  . LYS A 1 55  ? -2.013  -1.273  8.749   1.00 0.00 ? 55  LYS A HD2  5  
ATOM 7871  H HD3  . LYS A 1 55  ? -0.381  -1.121  9.405   1.00 0.00 ? 55  LYS A HD3  5  
ATOM 7872  H HE2  . LYS A 1 55  ? -2.451  0.843   10.255  1.00 0.00 ? 55  LYS A HE2  5  
ATOM 7873  H HE3  . LYS A 1 55  ? -2.516  -0.788  10.921  1.00 0.00 ? 55  LYS A HE3  5  
ATOM 7874  H HZ1  . LYS A 1 55  ? -0.562  -0.512  12.037  1.00 0.00 ? 55  LYS A HZ1  5  
ATOM 7875  H HZ2  . LYS A 1 55  ? -1.131  1.081   12.079  1.00 0.00 ? 55  LYS A HZ2  5  
ATOM 7876  H HZ3  . LYS A 1 55  ? 0.047   0.633   10.951  1.00 0.00 ? 55  LYS A HZ3  5  
ATOM 7877  N N    . GLN A 1 56  ? -3.686  0.901   6.044   1.00 0.00 ? 56  GLN A N    5  
ATOM 7878  C CA   . GLN A 1 56  ? -4.911  1.611   6.391   1.00 0.00 ? 56  GLN A CA   5  
ATOM 7879  C C    . GLN A 1 56  ? -5.242  2.670   5.344   1.00 0.00 ? 56  GLN A C    5  
ATOM 7880  O O    . GLN A 1 56  ? -4.348  3.242   4.721   1.00 0.00 ? 56  GLN A O    5  
ATOM 7881  C CB   . GLN A 1 56  ? -4.775  2.263   7.768   1.00 0.00 ? 56  GLN A CB   5  
ATOM 7882  C CG   . GLN A 1 56  ? -5.396  3.648   7.849   1.00 0.00 ? 56  GLN A CG   5  
ATOM 7883  C CD   . GLN A 1 56  ? -5.685  4.075   9.275   1.00 0.00 ? 56  GLN A CD   5  
ATOM 7884  O OE1  . GLN A 1 56  ? -6.034  3.254   10.123  1.00 0.00 ? 56  GLN A OE1  5  
ATOM 7885  N NE2  . GLN A 1 56  ? -5.540  5.367   9.547   1.00 0.00 ? 56  GLN A NE2  5  
ATOM 7886  H H    . GLN A 1 56  ? -3.144  1.221   5.294   1.00 0.00 ? 56  GLN A H    5  
ATOM 7887  H HA   . GLN A 1 56  ? -5.714  0.890   6.422   1.00 0.00 ? 56  GLN A HA   5  
ATOM 7888  H HB2  . GLN A 1 56  ? -5.257  1.632   8.501   1.00 0.00 ? 56  GLN A HB2  5  
ATOM 7889  H HB3  . GLN A 1 56  ? -3.726  2.347   8.011   1.00 0.00 ? 56  GLN A HB3  5  
ATOM 7890  H HG2  . GLN A 1 56  ? -4.715  4.360   7.408   1.00 0.00 ? 56  GLN A HG2  5  
ATOM 7891  H HG3  . GLN A 1 56  ? -6.322  3.646   7.295   1.00 0.00 ? 56  GLN A HG3  5  
ATOM 7892  H HE21 . GLN A 1 56  ? -5.259  5.964   8.821   1.00 0.00 ? 56  GLN A HE21 5  
ATOM 7893  H HE22 . GLN A 1 56  ? -5.720  5.671   10.460  1.00 0.00 ? 56  GLN A HE22 5  
ATOM 7894  N N    . VAL A 1 57  ? -6.532  2.926   5.156   1.00 0.00 ? 57  VAL A N    5  
ATOM 7895  C CA   . VAL A 1 57  ? -6.981  3.917   4.185   1.00 0.00 ? 57  VAL A CA   5  
ATOM 7896  C C    . VAL A 1 57  ? -7.996  4.872   4.804   1.00 0.00 ? 57  VAL A C    5  
ATOM 7897  O O    . VAL A 1 57  ? -9.009  4.445   5.360   1.00 0.00 ? 57  VAL A O    5  
ATOM 7898  C CB   . VAL A 1 57  ? -7.611  3.247   2.950   1.00 0.00 ? 57  VAL A CB   5  
ATOM 7899  C CG1  . VAL A 1 57  ? -8.524  4.221   2.221   1.00 0.00 ? 57  VAL A CG1  5  
ATOM 7900  C CG2  . VAL A 1 57  ? -6.528  2.721   2.019   1.00 0.00 ? 57  VAL A CG2  5  
ATOM 7901  H H    . VAL A 1 57  ? -7.199  2.437   5.683   1.00 0.00 ? 57  VAL A H    5  
ATOM 7902  H HA   . VAL A 1 57  ? -6.119  4.482   3.862   1.00 0.00 ? 57  VAL A HA   5  
ATOM 7903  H HB   . VAL A 1 57  ? -8.207  2.410   3.283   1.00 0.00 ? 57  VAL A HB   5  
ATOM 7904  H HG11 . VAL A 1 57  ? -7.967  5.108   1.957   1.00 0.00 ? 57  VAL A HG11 5  
ATOM 7905  H HG12 . VAL A 1 57  ? -8.907  3.754   1.325   1.00 0.00 ? 57  VAL A HG12 5  
ATOM 7906  H HG13 . VAL A 1 57  ? -9.347  4.493   2.865   1.00 0.00 ? 57  VAL A HG13 5  
ATOM 7907  H HG21 . VAL A 1 57  ? -5.802  2.162   2.591   1.00 0.00 ? 57  VAL A HG21 5  
ATOM 7908  H HG22 . VAL A 1 57  ? -6.975  2.077   1.276   1.00 0.00 ? 57  VAL A HG22 5  
ATOM 7909  H HG23 . VAL A 1 57  ? -6.039  3.551   1.530   1.00 0.00 ? 57  VAL A HG23 5  
ATOM 7910  N N    . LEU A 1 58  ? -7.718  6.167   4.704   1.00 0.00 ? 58  LEU A N    5  
ATOM 7911  C CA   . LEU A 1 58  ? -8.607  7.185   5.253   1.00 0.00 ? 58  LEU A CA   5  
ATOM 7912  C C    . LEU A 1 58  ? -9.879  7.304   4.420   1.00 0.00 ? 58  LEU A C    5  
ATOM 7913  O O    . LEU A 1 58  ? -10.030 6.632   3.401   1.00 0.00 ? 58  LEU A O    5  
ATOM 7914  C CB   . LEU A 1 58  ? -7.893  8.536   5.311   1.00 0.00 ? 58  LEU A CB   5  
ATOM 7915  C CG   . LEU A 1 58  ? -6.645  8.599   6.193   1.00 0.00 ? 58  LEU A CG   5  
ATOM 7916  C CD1  . LEU A 1 58  ? -5.543  7.721   5.621   1.00 0.00 ? 58  LEU A CD1  5  
ATOM 7917  C CD2  . LEU A 1 58  ? -6.165  10.036  6.336   1.00 0.00 ? 58  LEU A CD2  5  
ATOM 7918  H H    . LEU A 1 58  ? -6.896  6.447   4.250   1.00 0.00 ? 58  LEU A H    5  
ATOM 7919  H HA   . LEU A 1 58  ? -8.874  6.885   6.255   1.00 0.00 ? 58  LEU A HA   5  
ATOM 7920  H HB2  . LEU A 1 58  ? -7.601  8.799   4.306   1.00 0.00 ? 58  LEU A HB2  5  
ATOM 7921  H HB3  . LEU A 1 58  ? -8.598  9.267   5.682   1.00 0.00 ? 58  LEU A HB3  5  
ATOM 7922  H HG   . LEU A 1 58  ? -6.889  8.227   7.178   1.00 0.00 ? 58  LEU A HG   5  
ATOM 7923  H HD11 . LEU A 1 58  ? -4.610  7.947   6.114   1.00 0.00 ? 58  LEU A HD11 5  
ATOM 7924  H HD12 . LEU A 1 58  ? -5.445  7.910   4.562   1.00 0.00 ? 58  LEU A HD12 5  
ATOM 7925  H HD13 . LEU A 1 58  ? -5.792  6.682   5.779   1.00 0.00 ? 58  LEU A HD13 5  
ATOM 7926  H HD21 . LEU A 1 58  ? -5.398  10.085  7.094   1.00 0.00 ? 58  LEU A HD21 5  
ATOM 7927  H HD22 . LEU A 1 58  ? -6.994  10.666  6.621   1.00 0.00 ? 58  LEU A HD22 5  
ATOM 7928  H HD23 . LEU A 1 58  ? -5.762  10.376  5.392   1.00 0.00 ? 58  LEU A HD23 5  
ATOM 7929  N N    . GLU A 1 59  ? -10.790 8.167   4.860   1.00 0.00 ? 59  GLU A N    5  
ATOM 7930  C CA   . GLU A 1 59  ? -12.048 8.375   4.153   1.00 0.00 ? 59  GLU A CA   5  
ATOM 7931  C C    . GLU A 1 59  ? -12.027 9.691   3.381   1.00 0.00 ? 59  GLU A C    5  
ATOM 7932  O O    . GLU A 1 59  ? -12.495 9.763   2.244   1.00 0.00 ? 59  GLU A O    5  
ATOM 7933  C CB   . GLU A 1 59  ? -13.219 8.367   5.138   1.00 0.00 ? 59  GLU A CB   5  
ATOM 7934  C CG   . GLU A 1 59  ? -14.579 8.472   4.468   1.00 0.00 ? 59  GLU A CG   5  
ATOM 7935  C CD   . GLU A 1 59  ? -15.686 7.847   5.294   1.00 0.00 ? 59  GLU A CD   5  
ATOM 7936  O OE1  . GLU A 1 59  ? -15.945 8.343   6.410   1.00 0.00 ? 59  GLU A OE1  5  
ATOM 7937  O OE2  . GLU A 1 59  ? -16.293 6.862   4.824   1.00 0.00 ? 59  GLU A OE2  5  
ATOM 7938  H H    . GLU A 1 59  ? -10.612 8.674   5.679   1.00 0.00 ? 59  GLU A H    5  
ATOM 7939  H HA   . GLU A 1 59  ? -12.174 7.563   3.453   1.00 0.00 ? 59  GLU A HA   5  
ATOM 7940  H HB2  . GLU A 1 59  ? -13.190 7.450   5.706   1.00 0.00 ? 59  GLU A HB2  5  
ATOM 7941  H HB3  . GLU A 1 59  ? -13.110 9.202   5.814   1.00 0.00 ? 59  GLU A HB3  5  
ATOM 7942  H HG2  . GLU A 1 59  ? -14.811 9.515   4.314   1.00 0.00 ? 59  GLU A HG2  5  
ATOM 7943  H HG3  . GLU A 1 59  ? -14.535 7.970   3.512   1.00 0.00 ? 59  GLU A HG3  5  
ATOM 7944  N N    . ASP A 1 60  ? -11.482 10.728  4.006   1.00 0.00 ? 60  ASP A N    5  
ATOM 7945  C CA   . ASP A 1 60  ? -11.399 12.042  3.379   1.00 0.00 ? 60  ASP A CA   5  
ATOM 7946  C C    . ASP A 1 60  ? -10.177 12.134  2.471   1.00 0.00 ? 60  ASP A C    5  
ATOM 7947  O O    . ASP A 1 60  ? -9.532  13.180  2.386   1.00 0.00 ? 60  ASP A O    5  
ATOM 7948  C CB   . ASP A 1 60  ? -11.343 13.137  4.445   1.00 0.00 ? 60  ASP A CB   5  
ATOM 7949  C CG   . ASP A 1 60  ? -11.341 14.530  3.845   1.00 0.00 ? 60  ASP A CG   5  
ATOM 7950  O OD1  . ASP A 1 60  ? -12.237 14.823  3.026   1.00 0.00 ? 60  ASP A OD1  5  
ATOM 7951  O OD2  . ASP A 1 60  ? -10.444 15.325  4.193   1.00 0.00 ? 60  ASP A OD2  5  
ATOM 7952  H H    . ASP A 1 60  ? -11.126 10.607  4.912   1.00 0.00 ? 60  ASP A H    5  
ATOM 7953  H HA   . ASP A 1 60  ? -12.287 12.180  2.781   1.00 0.00 ? 60  ASP A HA   5  
ATOM 7954  H HB2  . ASP A 1 60  ? -12.203 13.046  5.092   1.00 0.00 ? 60  ASP A HB2  5  
ATOM 7955  H HB3  . ASP A 1 60  ? -10.443 13.015  5.029   1.00 0.00 ? 60  ASP A HB3  5  
ATOM 7956  N N    . SER A 1 61  ? -9.863  11.033  1.796   1.00 0.00 ? 61  SER A N    5  
ATOM 7957  C CA   . SER A 1 61  ? -8.714  10.989  0.898   1.00 0.00 ? 61  SER A CA   5  
ATOM 7958  C C    . SER A 1 61  ? -9.129  10.516  -0.492  1.00 0.00 ? 61  SER A C    5  
ATOM 7959  O O    . SER A 1 61  ? -10.235 10.016  -0.701  1.00 0.00 ? 61  SER A O    5  
ATOM 7960  C CB   . SER A 1 61  ? -7.635  10.063  1.463   1.00 0.00 ? 61  SER A CB   5  
ATOM 7961  O OG   . SER A 1 61  ? -7.485  8.905   0.660   1.00 0.00 ? 61  SER A OG   5  
ATOM 7962  H H    . SER A 1 61  ? -10.415 10.231  1.906   1.00 0.00 ? 61  SER A H    5  
ATOM 7963  H HA   . SER A 1 61  ? -8.315  11.989  0.821   1.00 0.00 ? 61  SER A HA   5  
ATOM 7964  H HB2  . SER A 1 61  ? -6.693  10.590  1.493   1.00 0.00 ? 61  SER A HB2  5  
ATOM 7965  H HB3  . SER A 1 61  ? -7.911  9.761   2.463   1.00 0.00 ? 61  SER A HB3  5  
ATOM 7966  H HG   . SER A 1 61  ? -7.887  8.154   1.103   1.00 0.00 ? 61  SER A HG   5  
ATOM 7967  N N    . PRO A 1 62  ? -8.222  10.678  -1.466  1.00 0.00 ? 62  PRO A N    5  
ATOM 7968  C CA   . PRO A 1 62  ? -8.469  10.274  -2.853  1.00 0.00 ? 62  PRO A CA   5  
ATOM 7969  C C    . PRO A 1 62  ? -8.518  8.759   -3.016  1.00 0.00 ? 62  PRO A C    5  
ATOM 7970  O O    . PRO A 1 62  ? -9.073  8.247   -3.988  1.00 0.00 ? 62  PRO A O    5  
ATOM 7971  C CB   . PRO A 1 62  ? -7.273  10.855  -3.611  1.00 0.00 ? 62  PRO A CB   5  
ATOM 7972  C CG   . PRO A 1 62  ? -6.194  10.963  -2.589  1.00 0.00 ? 62  PRO A CG   5  
ATOM 7973  C CD   . PRO A 1 62  ? -6.884  11.267  -1.288  1.00 0.00 ? 62  PRO A CD   5  
ATOM 7974  H HA   . PRO A 1 62  ? -9.383  10.706  -3.235  1.00 0.00 ? 62  PRO A HA   5  
ATOM 7975  H HB2  . PRO A 1 62  ? -6.993  10.187  -4.414  1.00 0.00 ? 62  PRO A HB2  5  
ATOM 7976  H HB3  . PRO A 1 62  ? -7.532  11.823  -4.014  1.00 0.00 ? 62  PRO A HB3  5  
ATOM 7977  H HG2  . PRO A 1 62  ? -5.659  10.028  -2.520  1.00 0.00 ? 62  PRO A HG2  5  
ATOM 7978  H HG3  . PRO A 1 62  ? -5.519  11.764  -2.852  1.00 0.00 ? 62  PRO A HG3  5  
ATOM 7979  H HD2  . PRO A 1 62  ? -6.363  10.799  -0.466  1.00 0.00 ? 62  PRO A HD2  5  
ATOM 7980  H HD3  . PRO A 1 62  ? -6.950  12.334  -1.137  1.00 0.00 ? 62  PRO A HD3  5  
ATOM 7981  N N    . ALA A 1 63  ? -7.934  8.046   -2.059  1.00 0.00 ? 63  ALA A N    5  
ATOM 7982  C CA   . ALA A 1 63  ? -7.913  6.589   -2.095  1.00 0.00 ? 63  ALA A CA   5  
ATOM 7983  C C    . ALA A 1 63  ? -9.112  6.005   -1.356  1.00 0.00 ? 63  ALA A C    5  
ATOM 7984  O O    . ALA A 1 63  ? -9.566  4.903   -1.662  1.00 0.00 ? 63  ALA A O    5  
ATOM 7985  C CB   . ALA A 1 63  ? -6.616  6.065   -1.499  1.00 0.00 ? 63  ALA A CB   5  
ATOM 7986  H H    . ALA A 1 63  ? -7.508  8.512   -1.309  1.00 0.00 ? 63  ALA A H    5  
ATOM 7987  H HA   . ALA A 1 63  ? -7.956  6.281   -3.130  1.00 0.00 ? 63  ALA A HA   5  
ATOM 7988  H HB1  . ALA A 1 63  ? -5.778  6.531   -1.995  1.00 0.00 ? 63  ALA A HB1  5  
ATOM 7989  H HB2  . ALA A 1 63  ? -6.585  6.297   -0.444  1.00 0.00 ? 63  ALA A HB2  5  
ATOM 7990  H HB3  . ALA A 1 63  ? -6.565  4.995   -1.634  1.00 0.00 ? 63  ALA A HB3  5  
ATOM 7991  N N    . GLY A 1 64  ? -9.620  6.750   -0.379  1.00 0.00 ? 64  GLY A N    5  
ATOM 7992  C CA   . GLY A 1 64  ? -10.761 6.288   0.390   1.00 0.00 ? 64  GLY A CA   5  
ATOM 7993  C C    . GLY A 1 64  ? -12.071 6.468   -0.351  1.00 0.00 ? 64  GLY A C    5  
ATOM 7994  O O    . GLY A 1 64  ? -13.060 5.800   -0.051  1.00 0.00 ? 64  GLY A O    5  
ATOM 7995  H H    . GLY A 1 64  ? -9.217  7.621   -0.178  1.00 0.00 ? 64  GLY A H    5  
ATOM 7996  H HA2  . GLY A 1 64  ? -10.629 5.241   0.617   1.00 0.00 ? 64  GLY A HA2  5  
ATOM 7997  H HA3  . GLY A 1 64  ? -10.806 6.844   1.315   1.00 0.00 ? 64  GLY A HA3  5  
ATOM 7998  N N    . LYS A 1 65  ? -12.080 7.375   -1.322  1.00 0.00 ? 65  LYS A N    5  
ATOM 7999  C CA   . LYS A 1 65  ? -13.277 7.643   -2.109  1.00 0.00 ? 65  LYS A CA   5  
ATOM 8000  C C    . LYS A 1 65  ? -13.426 6.627   -3.237  1.00 0.00 ? 65  LYS A C    5  
ATOM 8001  O O    . LYS A 1 65  ? -14.539 6.262   -3.617  1.00 0.00 ? 65  LYS A O    5  
ATOM 8002  C CB   . LYS A 1 65  ? -13.227 9.059   -2.688  1.00 0.00 ? 65  LYS A CB   5  
ATOM 8003  C CG   . LYS A 1 65  ? -13.334 10.150  -1.636  1.00 0.00 ? 65  LYS A CG   5  
ATOM 8004  C CD   . LYS A 1 65  ? -13.910 11.430  -2.217  1.00 0.00 ? 65  LYS A CD   5  
ATOM 8005  C CE   . LYS A 1 65  ? -13.451 12.652  -1.437  1.00 0.00 ? 65  LYS A CE   5  
ATOM 8006  N NZ   . LYS A 1 65  ? -14.280 13.850  -1.745  1.00 0.00 ? 65  LYS A NZ   5  
ATOM 8007  H H    . LYS A 1 65  ? -11.259 7.877   -1.515  1.00 0.00 ? 65  LYS A H    5  
ATOM 8008  H HA   . LYS A 1 65  ? -14.131 7.562   -1.453  1.00 0.00 ? 65  LYS A HA   5  
ATOM 8009  H HB2  . LYS A 1 65  ? -12.293 9.186   -3.215  1.00 0.00 ? 65  LYS A HB2  5  
ATOM 8010  H HB3  . LYS A 1 65  ? -14.043 9.179   -3.385  1.00 0.00 ? 65  LYS A HB3  5  
ATOM 8011  H HG2  . LYS A 1 65  ? -13.977 9.807   -0.839  1.00 0.00 ? 65  LYS A HG2  5  
ATOM 8012  H HG3  . LYS A 1 65  ? -12.348 10.355  -1.243  1.00 0.00 ? 65  LYS A HG3  5  
ATOM 8013  H HD2  . LYS A 1 65  ? -13.584 11.529  -3.242  1.00 0.00 ? 65  LYS A HD2  5  
ATOM 8014  H HD3  . LYS A 1 65  ? -14.989 11.376  -2.184  1.00 0.00 ? 65  LYS A HD3  5  
ATOM 8015  H HE2  . LYS A 1 65  ? -13.523 12.437  -0.382  1.00 0.00 ? 65  LYS A HE2  5  
ATOM 8016  H HE3  . LYS A 1 65  ? -12.423 12.861  -1.692  1.00 0.00 ? 65  LYS A HE3  5  
ATOM 8017  H HZ1  . LYS A 1 65  ? -14.413 13.939  -2.772  1.00 0.00 ? 65  LYS A HZ1  5  
ATOM 8018  H HZ2  . LYS A 1 65  ? -13.812 14.709  -1.391  1.00 0.00 ? 65  LYS A HZ2  5  
ATOM 8019  H HZ3  . LYS A 1 65  ? -15.213 13.766  -1.292  1.00 0.00 ? 65  LYS A HZ3  5  
ATOM 8020  N N    . THR A 1 66  ? -12.296 6.171   -3.769  1.00 0.00 ? 66  THR A N    5  
ATOM 8021  C CA   . THR A 1 66  ? -12.300 5.196   -4.853  1.00 0.00 ? 66  THR A CA   5  
ATOM 8022  C C    . THR A 1 66  ? -12.933 3.883   -4.409  1.00 0.00 ? 66  THR A C    5  
ATOM 8023  O O    . THR A 1 66  ? -13.311 3.054   -5.236  1.00 0.00 ? 66  THR A O    5  
ATOM 8024  C CB   . THR A 1 66  ? -10.874 4.919   -5.365  1.00 0.00 ? 66  THR A CB   5  
ATOM 8025  O OG1  . THR A 1 66  ? -10.224 3.969   -4.513  1.00 0.00 ? 66  THR A OG1  5  
ATOM 8026  C CG2  . THR A 1 66  ? -10.059 6.202   -5.417  1.00 0.00 ? 66  THR A CG2  5  
ATOM 8027  H H    . THR A 1 66  ? -11.440 6.499   -3.424  1.00 0.00 ? 66  THR A H    5  
ATOM 8028  H HA   . THR A 1 66  ? -12.879 5.607   -5.668  1.00 0.00 ? 66  THR A HA   5  
ATOM 8029  H HB   . THR A 1 66  ? -10.939 4.510   -6.363  1.00 0.00 ? 66  THR A HB   5  
ATOM 8030  H HG1  . THR A 1 66  ? -9.964  4.399   -3.694  1.00 0.00 ? 66  THR A HG1  5  
ATOM 8031  H HG21 . THR A 1 66  ? -9.195  6.106   -4.777  1.00 0.00 ? 66  THR A HG21 5  
ATOM 8032  H HG22 . THR A 1 66  ? -10.666 7.029   -5.079  1.00 0.00 ? 66  THR A HG22 5  
ATOM 8033  H HG23 . THR A 1 66  ? -9.737  6.383   -6.432  1.00 0.00 ? 66  THR A HG23 5  
ATOM 8034  N N    . ASN A 1 67  ? -13.045 3.699   -3.098  1.00 0.00 ? 67  ASN A N    5  
ATOM 8035  C CA   . ASN A 1 67  ? -13.633 2.485   -2.543  1.00 0.00 ? 67  ASN A CA   5  
ATOM 8036  C C    . ASN A 1 67  ? -13.085 1.246   -3.245  1.00 0.00 ? 67  ASN A C    5  
ATOM 8037  O O    . ASN A 1 67  ? -13.705 0.183   -3.225  1.00 0.00 ? 67  ASN A O    5  
ATOM 8038  C CB   . ASN A 1 67  ? -15.157 2.526   -2.673  1.00 0.00 ? 67  ASN A CB   5  
ATOM 8039  C CG   . ASN A 1 67  ? -15.843 2.778   -1.344  1.00 0.00 ? 67  ASN A CG   5  
ATOM 8040  O OD1  . ASN A 1 67  ? -15.493 2.178   -0.328  1.00 0.00 ? 67  ASN A OD1  5  
ATOM 8041  N ND2  . ASN A 1 67  ? -16.828 3.670   -1.347  1.00 0.00 ? 67  ASN A ND2  5  
ATOM 8042  H H    . ASN A 1 67  ? -12.725 4.396   -2.488  1.00 0.00 ? 67  ASN A H    5  
ATOM 8043  H HA   . ASN A 1 67  ? -13.371 2.437   -1.497  1.00 0.00 ? 67  ASN A HA   5  
ATOM 8044  H HB2  . ASN A 1 67  ? -15.433 3.318   -3.354  1.00 0.00 ? 67  ASN A HB2  5  
ATOM 8045  H HB3  . ASN A 1 67  ? -15.505 1.582   -3.064  1.00 0.00 ? 67  ASN A HB3  5  
ATOM 8046  H HD21 . ASN A 1 67  ? -17.053 4.109   -2.194  1.00 0.00 ? 67  ASN A HD21 5  
ATOM 8047  H HD22 . ASN A 1 67  ? -17.288 3.853   -0.501  1.00 0.00 ? 67  ASN A HD22 5  
ATOM 8048  N N    . ALA A 1 68  ? -11.919 1.391   -3.865  1.00 0.00 ? 68  ALA A N    5  
ATOM 8049  C CA   . ALA A 1 68  ? -11.286 0.284   -4.571  1.00 0.00 ? 68  ALA A CA   5  
ATOM 8050  C C    . ALA A 1 68  ? -10.020 -0.173  -3.853  1.00 0.00 ? 68  ALA A C    5  
ATOM 8051  O O    . ALA A 1 68  ? -9.248  -0.974  -4.383  1.00 0.00 ? 68  ALA A O    5  
ATOM 8052  C CB   . ALA A 1 68  ? -10.967 0.685   -6.004  1.00 0.00 ? 68  ALA A CB   5  
ATOM 8053  H H    . ALA A 1 68  ? -11.473 2.263   -3.846  1.00 0.00 ? 68  ALA A H    5  
ATOM 8054  H HA   . ALA A 1 68  ? -11.987 -0.538  -4.601  1.00 0.00 ? 68  ALA A HA   5  
ATOM 8055  H HB1  . ALA A 1 68  ? -10.625 1.709   -6.023  1.00 0.00 ? 68  ALA A HB1  5  
ATOM 8056  H HB2  . ALA A 1 68  ? -10.193 0.039   -6.394  1.00 0.00 ? 68  ALA A HB2  5  
ATOM 8057  H HB3  . ALA A 1 68  ? -11.855 0.590   -6.610  1.00 0.00 ? 68  ALA A HB3  5  
ATOM 8058  N N    . LEU A 1 69  ? -9.812  0.341   -2.646  1.00 0.00 ? 69  LEU A N    5  
ATOM 8059  C CA   . LEU A 1 69  ? -8.638  -0.013  -1.856  1.00 0.00 ? 69  LEU A CA   5  
ATOM 8060  C C    . LEU A 1 69  ? -8.987  -0.100  -0.373  1.00 0.00 ? 69  LEU A C    5  
ATOM 8061  O O    . LEU A 1 69  ? -9.673  0.768   0.167   1.00 0.00 ? 69  LEU A O    5  
ATOM 8062  C CB   . LEU A 1 69  ? -7.525  1.013   -2.070  1.00 0.00 ? 69  LEU A CB   5  
ATOM 8063  C CG   . LEU A 1 69  ? -7.197  1.354   -3.525  1.00 0.00 ? 69  LEU A CG   5  
ATOM 8064  C CD1  . LEU A 1 69  ? -6.476  2.690   -3.610  1.00 0.00 ? 69  LEU A CD1  5  
ATOM 8065  C CD2  . LEU A 1 69  ? -6.358  0.251   -4.154  1.00 0.00 ? 69  LEU A CD2  5  
ATOM 8066  H H    . LEU A 1 69  ? -10.462 0.974   -2.277  1.00 0.00 ? 69  LEU A H    5  
ATOM 8067  H HA   . LEU A 1 69  ? -8.294  -0.981  -2.190  1.00 0.00 ? 69  LEU A HA   5  
ATOM 8068  H HB2  . LEU A 1 69  ? -7.817  1.926   -1.575  1.00 0.00 ? 69  LEU A HB2  5  
ATOM 8069  H HB3  . LEU A 1 69  ? -6.627  0.627   -1.609  1.00 0.00 ? 69  LEU A HB3  5  
ATOM 8070  H HG   . LEU A 1 69  ? -8.118  1.436   -4.085  1.00 0.00 ? 69  LEU A HG   5  
ATOM 8071  H HD11 . LEU A 1 69  ? -6.826  3.233   -4.475  1.00 0.00 ? 69  LEU A HD11 5  
ATOM 8072  H HD12 . LEU A 1 69  ? -5.413  2.520   -3.699  1.00 0.00 ? 69  LEU A HD12 5  
ATOM 8073  H HD13 . LEU A 1 69  ? -6.675  3.264   -2.718  1.00 0.00 ? 69  LEU A HD13 5  
ATOM 8074  H HD21 . LEU A 1 69  ? -6.728  0.040   -5.147  1.00 0.00 ? 69  LEU A HD21 5  
ATOM 8075  H HD22 . LEU A 1 69  ? -6.423  -0.641  -3.548  1.00 0.00 ? 69  LEU A HD22 5  
ATOM 8076  H HD23 . LEU A 1 69  ? -5.328  0.572   -4.213  1.00 0.00 ? 69  LEU A HD23 5  
ATOM 8077  N N    . LYS A 1 70  ? -8.507  -1.153  0.281   1.00 0.00 ? 70  LYS A N    5  
ATOM 8078  C CA   . LYS A 1 70  ? -8.764  -1.353  1.702   1.00 0.00 ? 70  LYS A CA   5  
ATOM 8079  C C    . LYS A 1 70  ? -7.558  -1.985  2.389   1.00 0.00 ? 70  LYS A C    5  
ATOM 8080  O O    . LYS A 1 70  ? -6.726  -2.624  1.744   1.00 0.00 ? 70  LYS A O    5  
ATOM 8081  C CB   . LYS A 1 70  ? -9.998  -2.236  1.899   1.00 0.00 ? 70  LYS A CB   5  
ATOM 8082  C CG   . LYS A 1 70  ? -11.119 -1.943  0.917   1.00 0.00 ? 70  LYS A CG   5  
ATOM 8083  C CD   . LYS A 1 70  ? -11.983 -0.784  1.386   1.00 0.00 ? 70  LYS A CD   5  
ATOM 8084  C CE   . LYS A 1 70  ? -13.159 -0.551  0.451   1.00 0.00 ? 70  LYS A CE   5  
ATOM 8085  N NZ   . LYS A 1 70  ? -14.136 0.419   1.019   1.00 0.00 ? 70  LYS A NZ   5  
ATOM 8086  H H    . LYS A 1 70  ? -7.966  -1.811  -0.204  1.00 0.00 ? 70  LYS A H    5  
ATOM 8087  H HA   . LYS A 1 70  ? -8.949  -0.386  2.145   1.00 0.00 ? 70  LYS A HA   5  
ATOM 8088  H HB2  . LYS A 1 70  ? -9.708  -3.270  1.784   1.00 0.00 ? 70  LYS A HB2  5  
ATOM 8089  H HB3  . LYS A 1 70  ? -10.377 -2.086  2.900   1.00 0.00 ? 70  LYS A HB3  5  
ATOM 8090  H HG2  . LYS A 1 70  ? -10.690 -1.692  -0.041  1.00 0.00 ? 70  LYS A HG2  5  
ATOM 8091  H HG3  . LYS A 1 70  ? -11.738 -2.823  0.818   1.00 0.00 ? 70  LYS A HG3  5  
ATOM 8092  H HD2  . LYS A 1 70  ? -12.361 -1.004  2.374   1.00 0.00 ? 70  LYS A HD2  5  
ATOM 8093  H HD3  . LYS A 1 70  ? -11.379 0.112   1.422   1.00 0.00 ? 70  LYS A HD3  5  
ATOM 8094  H HE2  . LYS A 1 70  ? -12.787 -0.166  -0.486  1.00 0.00 ? 70  LYS A HE2  5  
ATOM 8095  H HE3  . LYS A 1 70  ? -13.658 -1.493  0.280   1.00 0.00 ? 70  LYS A HE3  5  
ATOM 8096  H HZ1  . LYS A 1 70  ? -14.377 0.153   1.995   1.00 0.00 ? 70  LYS A HZ1  5  
ATOM 8097  H HZ2  . LYS A 1 70  ? -15.005 0.426   0.448   1.00 0.00 ? 70  LYS A HZ2  5  
ATOM 8098  H HZ3  . LYS A 1 70  ? -13.729 1.376   1.022   1.00 0.00 ? 70  LYS A HZ3  5  
ATOM 8099  N N    . THR A 1 71  ? -7.470  -1.806  3.704   1.00 0.00 ? 71  THR A N    5  
ATOM 8100  C CA   . THR A 1 71  ? -6.366  -2.359  4.478   1.00 0.00 ? 71  THR A CA   5  
ATOM 8101  C C    . THR A 1 71  ? -6.297  -3.875  4.332   1.00 0.00 ? 71  THR A C    5  
ATOM 8102  O O    . THR A 1 71  ? -7.319  -4.559  4.364   1.00 0.00 ? 71  THR A O    5  
ATOM 8103  C CB   . THR A 1 71  ? -6.494  -2.005  5.972   1.00 0.00 ? 71  THR A CB   5  
ATOM 8104  O OG1  . THR A 1 71  ? -5.324  -2.429  6.678   1.00 0.00 ? 71  THR A OG1  5  
ATOM 8105  C CG2  . THR A 1 71  ? -7.725  -2.660  6.580   1.00 0.00 ? 71  THR A CG2  5  
ATOM 8106  H H    . THR A 1 71  ? -8.164  -1.288  4.162   1.00 0.00 ? 71  THR A H    5  
ATOM 8107  H HA   . THR A 1 71  ? -5.448  -1.929  4.105   1.00 0.00 ? 71  THR A HA   5  
ATOM 8108  H HB   . THR A 1 71  ? -6.593  -0.932  6.064   1.00 0.00 ? 71  THR A HB   5  
ATOM 8109  H HG1  . THR A 1 71  ? -5.581  -2.982  7.420   1.00 0.00 ? 71  THR A HG1  5  
ATOM 8110  H HG21 . THR A 1 71  ? -7.847  -2.321  7.597   1.00 0.00 ? 71  THR A HG21 5  
ATOM 8111  H HG22 . THR A 1 71  ? -7.604  -3.733  6.570   1.00 0.00 ? 71  THR A HG22 5  
ATOM 8112  H HG23 . THR A 1 71  ? -8.598  -2.390  6.003   1.00 0.00 ? 71  THR A HG23 5  
ATOM 8113  N N    . GLY A 1 72  ? -5.084  -4.395  4.170   1.00 0.00 ? 72  GLY A N    5  
ATOM 8114  C CA   . GLY A 1 72  ? -4.904  -5.827  4.021   1.00 0.00 ? 72  GLY A CA   5  
ATOM 8115  C C    . GLY A 1 72  ? -4.516  -6.219  2.610   1.00 0.00 ? 72  GLY A C    5  
ATOM 8116  O O    . GLY A 1 72  ? -3.759  -7.169  2.408   1.00 0.00 ? 72  GLY A O    5  
ATOM 8117  H H    . GLY A 1 72  ? -4.304  -3.801  4.152   1.00 0.00 ? 72  GLY A H    5  
ATOM 8118  H HA2  . GLY A 1 72  ? -4.131  -6.154  4.700   1.00 0.00 ? 72  GLY A HA2  5  
ATOM 8119  H HA3  . GLY A 1 72  ? -5.829  -6.323  4.279   1.00 0.00 ? 72  GLY A HA3  5  
ATOM 8120  N N    . ASP A 1 73  ? -5.037  -5.488  1.630   1.00 0.00 ? 73  ASP A N    5  
ATOM 8121  C CA   . ASP A 1 73  ? -4.741  -5.765  0.229   1.00 0.00 ? 73  ASP A CA   5  
ATOM 8122  C C    . ASP A 1 73  ? -3.238  -5.904  0.008   1.00 0.00 ? 73  ASP A C    5  
ATOM 8123  O O    . ASP A 1 73  ? -2.435  -5.425  0.809   1.00 0.00 ? 73  ASP A O    5  
ATOM 8124  C CB   . ASP A 1 73  ? -5.300  -4.655  -0.661  1.00 0.00 ? 73  ASP A CB   5  
ATOM 8125  C CG   . ASP A 1 73  ? -6.706  -4.953  -1.146  1.00 0.00 ? 73  ASP A CG   5  
ATOM 8126  O OD1  . ASP A 1 73  ? -6.843  -5.582  -2.216  1.00 0.00 ? 73  ASP A OD1  5  
ATOM 8127  O OD2  . ASP A 1 73  ? -7.668  -4.557  -0.455  1.00 0.00 ? 73  ASP A OD2  5  
ATOM 8128  H H    . ASP A 1 73  ? -5.634  -4.744  1.855   1.00 0.00 ? 73  ASP A H    5  
ATOM 8129  H HA   . ASP A 1 73  ? -5.218  -6.698  -0.032  1.00 0.00 ? 73  ASP A HA   5  
ATOM 8130  H HB2  . ASP A 1 73  ? -5.321  -3.730  -0.103  1.00 0.00 ? 73  ASP A HB2  5  
ATOM 8131  H HB3  . ASP A 1 73  ? -4.659  -4.536  -1.523  1.00 0.00 ? 73  ASP A HB3  5  
ATOM 8132  N N    . LYS A 1 74  ? -2.864  -6.563  -1.083  1.00 0.00 ? 74  LYS A N    5  
ATOM 8133  C CA   . LYS A 1 74  ? -1.458  -6.765  -1.411  1.00 0.00 ? 74  LYS A CA   5  
ATOM 8134  C C    . LYS A 1 74  ? -1.048  -5.905  -2.602  1.00 0.00 ? 74  LYS A C    5  
ATOM 8135  O O    . LYS A 1 74  ? -1.520  -6.112  -3.720  1.00 0.00 ? 74  LYS A O    5  
ATOM 8136  C CB   . LYS A 1 74  ? -1.192  -8.241  -1.718  1.00 0.00 ? 74  LYS A CB   5  
ATOM 8137  C CG   . LYS A 1 74  ? 0.267   -8.548  -2.008  1.00 0.00 ? 74  LYS A CG   5  
ATOM 8138  C CD   . LYS A 1 74  ? 0.463   -10.002 -2.404  1.00 0.00 ? 74  LYS A CD   5  
ATOM 8139  C CE   . LYS A 1 74  ? 1.855   -10.244 -2.967  1.00 0.00 ? 74  LYS A CE   5  
ATOM 8140  N NZ   . LYS A 1 74  ? 2.209   -11.690 -2.969  1.00 0.00 ? 74  LYS A NZ   5  
ATOM 8141  H H    . LYS A 1 74  ? -3.551  -6.922  -1.684  1.00 0.00 ? 74  LYS A H    5  
ATOM 8142  H HA   . LYS A 1 74  ? -0.872  -6.474  -0.553  1.00 0.00 ? 74  LYS A HA   5  
ATOM 8143  H HB2  . LYS A 1 74  ? -1.502  -8.834  -0.871  1.00 0.00 ? 74  LYS A HB2  5  
ATOM 8144  H HB3  . LYS A 1 74  ? -1.776  -8.528  -2.581  1.00 0.00 ? 74  LYS A HB3  5  
ATOM 8145  H HG2  . LYS A 1 74  ? 0.605   -7.917  -2.817  1.00 0.00 ? 74  LYS A HG2  5  
ATOM 8146  H HG3  . LYS A 1 74  ? 0.851   -8.344  -1.122  1.00 0.00 ? 74  LYS A HG3  5  
ATOM 8147  H HD2  . LYS A 1 74  ? 0.326   -10.625 -1.533  1.00 0.00 ? 74  LYS A HD2  5  
ATOM 8148  H HD3  . LYS A 1 74  ? -0.270  -10.263 -3.155  1.00 0.00 ? 74  LYS A HD3  5  
ATOM 8149  H HE2  . LYS A 1 74  ? 1.889   -9.872  -3.980  1.00 0.00 ? 74  LYS A HE2  5  
ATOM 8150  H HE3  . LYS A 1 74  ? 2.571   -9.707  -2.363  1.00 0.00 ? 74  LYS A HE3  5  
ATOM 8151  H HZ1  . LYS A 1 74  ? 2.096   -12.087 -2.015  1.00 0.00 ? 74  LYS A HZ1  5  
ATOM 8152  H HZ2  . LYS A 1 74  ? 3.197   -11.815 -3.271  1.00 0.00 ? 74  LYS A HZ2  5  
ATOM 8153  H HZ3  . LYS A 1 74  ? 1.590   -12.208 -3.625  1.00 0.00 ? 74  LYS A HZ3  5  
ATOM 8154  N N    . ILE A 1 75  ? -0.167  -4.942  -2.355  1.00 0.00 ? 75  ILE A N    5  
ATOM 8155  C CA   . ILE A 1 75  ? 0.308   -4.053  -3.408  1.00 0.00 ? 75  ILE A CA   5  
ATOM 8156  C C    . ILE A 1 75  ? 1.447   -4.692  -4.195  1.00 0.00 ? 75  ILE A C    5  
ATOM 8157  O O    . ILE A 1 75  ? 2.498   -5.012  -3.638  1.00 0.00 ? 75  ILE A O    5  
ATOM 8158  C CB   . ILE A 1 75  ? 0.788   -2.706  -2.834  1.00 0.00 ? 75  ILE A CB   5  
ATOM 8159  C CG1  . ILE A 1 75  ? -0.155  -2.235  -1.725  1.00 0.00 ? 75  ILE A CG1  5  
ATOM 8160  C CG2  . ILE A 1 75  ? 0.880   -1.663  -3.937  1.00 0.00 ? 75  ILE A CG2  5  
ATOM 8161  C CD1  . ILE A 1 75  ? 0.337   -1.003  -0.997  1.00 0.00 ? 75  ILE A CD1  5  
ATOM 8162  H H    . ILE A 1 75  ? 0.172   -4.826  -1.443  1.00 0.00 ? 75  ILE A H    5  
ATOM 8163  H HA   . ILE A 1 75  ? -0.517  -3.862  -4.079  1.00 0.00 ? 75  ILE A HA   5  
ATOM 8164  H HB   . ILE A 1 75  ? 1.775   -2.847  -2.422  1.00 0.00 ? 75  ILE A HB   5  
ATOM 8165  H HG12 . ILE A 1 75  ? -1.118  -2.005  -2.153  1.00 0.00 ? 75  ILE A HG12 5  
ATOM 8166  H HG13 . ILE A 1 75  ? -0.268  -3.027  -0.998  1.00 0.00 ? 75  ILE A HG13 5  
ATOM 8167  H HG21 . ILE A 1 75  ? 1.638   -0.937  -3.684  1.00 0.00 ? 75  ILE A HG21 5  
ATOM 8168  H HG22 . ILE A 1 75  ? 1.141   -2.145  -4.867  1.00 0.00 ? 75  ILE A HG22 5  
ATOM 8169  H HG23 . ILE A 1 75  ? -0.073  -1.166  -4.044  1.00 0.00 ? 75  ILE A HG23 5  
ATOM 8170  H HD11 . ILE A 1 75  ? 1.273   -1.225  -0.505  1.00 0.00 ? 75  ILE A HD11 5  
ATOM 8171  H HD12 . ILE A 1 75  ? 0.486   -0.201  -1.706  1.00 0.00 ? 75  ILE A HD12 5  
ATOM 8172  H HD13 . ILE A 1 75  ? -0.394  -0.703  -0.262  1.00 0.00 ? 75  ILE A HD13 5  
ATOM 8173  N N    . LEU A 1 76  ? 1.232   -4.874  -5.493  1.00 0.00 ? 76  LEU A N    5  
ATOM 8174  C CA   . LEU A 1 76  ? 2.241   -5.474  -6.359  1.00 0.00 ? 76  LEU A CA   5  
ATOM 8175  C C    . LEU A 1 76  ? 2.952   -4.407  -7.186  1.00 0.00 ? 76  LEU A C    5  
ATOM 8176  O O    . LEU A 1 76  ? 4.093   -4.594  -7.607  1.00 0.00 ? 76  LEU A O    5  
ATOM 8177  C CB   . LEU A 1 76  ? 1.598   -6.508  -7.284  1.00 0.00 ? 76  LEU A CB   5  
ATOM 8178  C CG   . LEU A 1 76  ? 0.404   -7.272  -6.710  1.00 0.00 ? 76  LEU A CG   5  
ATOM 8179  C CD1  . LEU A 1 76  ? -0.529  -7.718  -7.825  1.00 0.00 ? 76  LEU A CD1  5  
ATOM 8180  C CD2  . LEU A 1 76  ? 0.878   -8.468  -5.897  1.00 0.00 ? 76  LEU A CD2  5  
ATOM 8181  H H    . LEU A 1 76  ? 0.375   -4.599  -5.879  1.00 0.00 ? 76  LEU A H    5  
ATOM 8182  H HA   . LEU A 1 76  ? 2.967   -5.967  -5.729  1.00 0.00 ? 76  LEU A HA   5  
ATOM 8183  H HB2  . LEU A 1 76  ? 1.266   -5.995  -8.173  1.00 0.00 ? 76  LEU A HB2  5  
ATOM 8184  H HB3  . LEU A 1 76  ? 2.358   -7.230  -7.550  1.00 0.00 ? 76  LEU A HB3  5  
ATOM 8185  H HG   . LEU A 1 76  ? -0.151  -6.618  -6.052  1.00 0.00 ? 76  LEU A HG   5  
ATOM 8186  H HD11 . LEU A 1 76  ? -0.318  -8.745  -8.081  1.00 0.00 ? 76  LEU A HD11 5  
ATOM 8187  H HD12 . LEU A 1 76  ? -0.380  -7.092  -8.692  1.00 0.00 ? 76  LEU A HD12 5  
ATOM 8188  H HD13 . LEU A 1 76  ? -1.554  -7.633  -7.491  1.00 0.00 ? 76  LEU A HD13 5  
ATOM 8189  H HD21 . LEU A 1 76  ? 0.106   -8.757  -5.199  1.00 0.00 ? 76  LEU A HD21 5  
ATOM 8190  H HD22 . LEU A 1 76  ? 1.773   -8.203  -5.355  1.00 0.00 ? 76  LEU A HD22 5  
ATOM 8191  H HD23 . LEU A 1 76  ? 1.090   -9.294  -6.561  1.00 0.00 ? 76  LEU A HD23 5  
ATOM 8192  N N    . GLU A 1 77  ? 2.270   -3.289  -7.412  1.00 0.00 ? 77  GLU A N    5  
ATOM 8193  C CA   . GLU A 1 77  ? 2.838   -2.192  -8.188  1.00 0.00 ? 77  GLU A CA   5  
ATOM 8194  C C    . GLU A 1 77  ? 2.018   -0.918  -8.009  1.00 0.00 ? 77  GLU A C    5  
ATOM 8195  O O    . GLU A 1 77  ? 0.813   -0.971  -7.762  1.00 0.00 ? 77  GLU A O    5  
ATOM 8196  C CB   . GLU A 1 77  ? 2.904   -2.567  -9.670  1.00 0.00 ? 77  GLU A CB   5  
ATOM 8197  C CG   . GLU A 1 77  ? 4.065   -1.923  -10.410 1.00 0.00 ? 77  GLU A CG   5  
ATOM 8198  C CD   . GLU A 1 77  ? 3.950   -2.068  -11.915 1.00 0.00 ? 77  GLU A CD   5  
ATOM 8199  O OE1  . GLU A 1 77  ? 2.822   -2.280  -12.406 1.00 0.00 ? 77  GLU A OE1  5  
ATOM 8200  O OE2  . GLU A 1 77  ? 4.989   -1.970  -12.601 1.00 0.00 ? 77  GLU A OE2  5  
ATOM 8201  H H    . GLU A 1 77  ? 1.364   -3.199  -7.050  1.00 0.00 ? 77  GLU A H    5  
ATOM 8202  H HA   . GLU A 1 77  ? 3.840   -2.015  -7.827  1.00 0.00 ? 77  GLU A HA   5  
ATOM 8203  H HB2  . GLU A 1 77  ? 2.999   -3.639  -9.754  1.00 0.00 ? 77  GLU A HB2  5  
ATOM 8204  H HB3  . GLU A 1 77  ? 1.985   -2.258  -10.147 1.00 0.00 ? 77  GLU A HB3  5  
ATOM 8205  H HG2  . GLU A 1 77  ? 4.092   -0.872  -10.166 1.00 0.00 ? 77  GLU A HG2  5  
ATOM 8206  H HG3  . GLU A 1 77  ? 4.984   -2.390  -10.087 1.00 0.00 ? 77  GLU A HG3  5  
ATOM 8207  N N    . VAL A 1 78  ? 2.680   0.228   -8.136  1.00 0.00 ? 78  VAL A N    5  
ATOM 8208  C CA   . VAL A 1 78  ? 2.014   1.516   -7.990  1.00 0.00 ? 78  VAL A CA   5  
ATOM 8209  C C    . VAL A 1 78  ? 2.577   2.541   -8.969  1.00 0.00 ? 78  VAL A C    5  
ATOM 8210  O O    . VAL A 1 78  ? 3.785   2.775   -9.011  1.00 0.00 ? 78  VAL A O    5  
ATOM 8211  C CB   . VAL A 1 78  ? 2.154   2.061   -6.556  1.00 0.00 ? 78  VAL A CB   5  
ATOM 8212  C CG1  . VAL A 1 78  ? 3.296   3.062   -6.475  1.00 0.00 ? 78  VAL A CG1  5  
ATOM 8213  C CG2  . VAL A 1 78  ? 0.848   2.691   -6.096  1.00 0.00 ? 78  VAL A CG2  5  
ATOM 8214  H H    . VAL A 1 78  ? 3.640   0.206   -8.334  1.00 0.00 ? 78  VAL A H    5  
ATOM 8215  H HA   . VAL A 1 78  ? 0.963   1.374   -8.198  1.00 0.00 ? 78  VAL A HA   5  
ATOM 8216  H HB   . VAL A 1 78  ? 2.382   1.234   -5.899  1.00 0.00 ? 78  VAL A HB   5  
ATOM 8217  H HG11 . VAL A 1 78  ? 3.397   3.411   -5.457  1.00 0.00 ? 78  VAL A HG11 5  
ATOM 8218  H HG12 . VAL A 1 78  ? 4.215   2.587   -6.787  1.00 0.00 ? 78  VAL A HG12 5  
ATOM 8219  H HG13 . VAL A 1 78  ? 3.086   3.901   -7.122  1.00 0.00 ? 78  VAL A HG13 5  
ATOM 8220  H HG21 . VAL A 1 78  ? 0.605   3.525   -6.737  1.00 0.00 ? 78  VAL A HG21 5  
ATOM 8221  H HG22 . VAL A 1 78  ? 0.059   1.956   -6.145  1.00 0.00 ? 78  VAL A HG22 5  
ATOM 8222  H HG23 . VAL A 1 78  ? 0.954   3.038   -5.078  1.00 0.00 ? 78  VAL A HG23 5  
ATOM 8223  N N    . SER A 1 79  ? 1.694   3.149   -9.753  1.00 0.00 ? 79  SER A N    5  
ATOM 8224  C CA   . SER A 1 79  ? 2.103   4.147   -10.735 1.00 0.00 ? 79  SER A CA   5  
ATOM 8225  C C    . SER A 1 79  ? 3.080   3.549   -11.743 1.00 0.00 ? 79  SER A C    5  
ATOM 8226  O O    . SER A 1 79  ? 3.764   4.272   -12.466 1.00 0.00 ? 79  SER A O    5  
ATOM 8227  C CB   . SER A 1 79  ? 2.746   5.347   -10.036 1.00 0.00 ? 79  SER A CB   5  
ATOM 8228  O OG   . SER A 1 79  ? 2.547   6.537   -10.780 1.00 0.00 ? 79  SER A OG   5  
ATOM 8229  H H    . SER A 1 79  ? 0.745   2.920   -9.672  1.00 0.00 ? 79  SER A H    5  
ATOM 8230  H HA   . SER A 1 79  ? 1.220   4.478   -11.260 1.00 0.00 ? 79  SER A HA   5  
ATOM 8231  H HB2  . SER A 1 79  ? 2.304   5.470   -9.059  1.00 0.00 ? 79  SER A HB2  5  
ATOM 8232  H HB3  . SER A 1 79  ? 3.807   5.174   -9.933  1.00 0.00 ? 79  SER A HB3  5  
ATOM 8233  H HG   . SER A 1 79  ? 2.385   6.316   -11.700 1.00 0.00 ? 79  SER A HG   5  
ATOM 8234  N N    . GLY A 1 80  ? 3.138   2.221   -11.785 1.00 0.00 ? 80  GLY A N    5  
ATOM 8235  C CA   . GLY A 1 80  ? 4.033   1.547   -12.707 1.00 0.00 ? 80  GLY A CA   5  
ATOM 8236  C C    . GLY A 1 80  ? 5.379   1.234   -12.085 1.00 0.00 ? 80  GLY A C    5  
ATOM 8237  O O    . GLY A 1 80  ? 6.403   1.235   -12.768 1.00 0.00 ? 80  GLY A O    5  
ATOM 8238  H H    . GLY A 1 80  ? 2.568   1.695   -11.185 1.00 0.00 ? 80  GLY A H    5  
ATOM 8239  H HA2  . GLY A 1 80  ? 3.573   0.624   -13.028 1.00 0.00 ? 80  GLY A HA2  5  
ATOM 8240  H HA3  . GLY A 1 80  ? 4.186   2.179   -13.569 1.00 0.00 ? 80  GLY A HA3  5  
ATOM 8241  N N    . VAL A 1 81  ? 5.379   0.967   -10.782 1.00 0.00 ? 81  VAL A N    5  
ATOM 8242  C CA   . VAL A 1 81  ? 6.610   0.652   -10.067 1.00 0.00 ? 81  VAL A CA   5  
ATOM 8243  C C    . VAL A 1 81  ? 6.458   -0.624  -9.247  1.00 0.00 ? 81  VAL A C    5  
ATOM 8244  O O    . VAL A 1 81  ? 5.538   -0.748  -8.438  1.00 0.00 ? 81  VAL A O    5  
ATOM 8245  C CB   . VAL A 1 81  ? 7.026   1.803   -9.132  1.00 0.00 ? 81  VAL A CB   5  
ATOM 8246  C CG1  . VAL A 1 81  ? 6.259   1.730   -7.820  1.00 0.00 ? 81  VAL A CG1  5  
ATOM 8247  C CG2  . VAL A 1 81  ? 8.527   1.772   -8.884  1.00 0.00 ? 81  VAL A CG2  5  
ATOM 8248  H H    . VAL A 1 81  ? 4.532   0.982   -10.291 1.00 0.00 ? 81  VAL A H    5  
ATOM 8249  H HA   . VAL A 1 81  ? 7.393   0.509   -10.797 1.00 0.00 ? 81  VAL A HA   5  
ATOM 8250  H HB   . VAL A 1 81  ? 6.782   2.738   -9.614  1.00 0.00 ? 81  VAL A HB   5  
ATOM 8251  H HG11 . VAL A 1 81  ? 6.750   1.035   -7.155  1.00 0.00 ? 81  VAL A HG11 5  
ATOM 8252  H HG12 . VAL A 1 81  ? 6.231   2.709   -7.364  1.00 0.00 ? 81  VAL A HG12 5  
ATOM 8253  H HG13 . VAL A 1 81  ? 5.251   1.393   -8.012  1.00 0.00 ? 81  VAL A HG13 5  
ATOM 8254  H HG21 . VAL A 1 81  ? 8.806   2.604   -8.255  1.00 0.00 ? 81  VAL A HG21 5  
ATOM 8255  H HG22 . VAL A 1 81  ? 8.791   0.846   -8.395  1.00 0.00 ? 81  VAL A HG22 5  
ATOM 8256  H HG23 . VAL A 1 81  ? 9.049   1.843   -9.827  1.00 0.00 ? 81  VAL A HG23 5  
ATOM 8257  N N    . ASP A 1 82  ? 7.366   -1.570  -9.461  1.00 0.00 ? 82  ASP A N    5  
ATOM 8258  C CA   . ASP A 1 82  ? 7.334   -2.837  -8.740  1.00 0.00 ? 82  ASP A CA   5  
ATOM 8259  C C    . ASP A 1 82  ? 7.670   -2.633  -7.266  1.00 0.00 ? 82  ASP A C    5  
ATOM 8260  O O    . ASP A 1 82  ? 8.789   -2.252  -6.921  1.00 0.00 ? 82  ASP A O    5  
ATOM 8261  C CB   . ASP A 1 82  ? 8.315   -3.829  -9.367  1.00 0.00 ? 82  ASP A CB   5  
ATOM 8262  C CG   . ASP A 1 82  ? 9.719   -3.682  -8.816  1.00 0.00 ? 82  ASP A CG   5  
ATOM 8263  O OD1  . ASP A 1 82  ? 10.475  -2.834  -9.336  1.00 0.00 ? 82  ASP A OD1  5  
ATOM 8264  O OD2  . ASP A 1 82  ? 10.063  -4.413  -7.864  1.00 0.00 ? 82  ASP A OD2  5  
ATOM 8265  H H    . ASP A 1 82  ? 8.075   -1.411  -10.119 1.00 0.00 ? 82  ASP A H    5  
ATOM 8266  H HA   . ASP A 1 82  ? 6.334   -3.237  -8.816  1.00 0.00 ? 82  ASP A HA   5  
ATOM 8267  H HB2  . ASP A 1 82  ? 7.975   -4.836  -9.170  1.00 0.00 ? 82  ASP A HB2  5  
ATOM 8268  H HB3  . ASP A 1 82  ? 8.347   -3.668  -10.435 1.00 0.00 ? 82  ASP A HB3  5  
ATOM 8269  N N    . LEU A 1 83  ? 6.695   -2.888  -6.402  1.00 0.00 ? 83  LEU A N    5  
ATOM 8270  C CA   . LEU A 1 83  ? 6.886   -2.731  -4.964  1.00 0.00 ? 83  LEU A CA   5  
ATOM 8271  C C    . LEU A 1 83  ? 6.796   -4.077  -4.253  1.00 0.00 ? 83  LEU A C    5  
ATOM 8272  O O    . LEU A 1 83  ? 6.844   -4.145  -3.025  1.00 0.00 ? 83  LEU A O    5  
ATOM 8273  C CB   . LEU A 1 83  ? 5.843   -1.769  -4.393  1.00 0.00 ? 83  LEU A CB   5  
ATOM 8274  C CG   . LEU A 1 83  ? 5.910   -0.328  -4.901  1.00 0.00 ? 83  LEU A CG   5  
ATOM 8275  C CD1  . LEU A 1 83  ? 4.984   0.566   -4.092  1.00 0.00 ? 83  LEU A CD1  5  
ATOM 8276  C CD2  . LEU A 1 83  ? 7.339   0.192   -4.846  1.00 0.00 ? 83  LEU A CD2  5  
ATOM 8277  H H    . LEU A 1 83  ? 5.825   -3.189  -6.737  1.00 0.00 ? 83  LEU A H    5  
ATOM 8278  H HA   . LEU A 1 83  ? 7.871   -2.318  -4.804  1.00 0.00 ? 83  LEU A HA   5  
ATOM 8279  H HB2  . LEU A 1 83  ? 4.867   -2.159  -4.633  1.00 0.00 ? 83  LEU A HB2  5  
ATOM 8280  H HB3  . LEU A 1 83  ? 5.967   -1.748  -3.319  1.00 0.00 ? 83  LEU A HB3  5  
ATOM 8281  H HG   . LEU A 1 83  ? 5.583   -0.301  -5.931  1.00 0.00 ? 83  LEU A HG   5  
ATOM 8282  H HD11 . LEU A 1 83  ? 4.601   0.016   -3.246  1.00 0.00 ? 83  LEU A HD11 5  
ATOM 8283  H HD12 . LEU A 1 83  ? 4.162   0.890   -4.713  1.00 0.00 ? 83  LEU A HD12 5  
ATOM 8284  H HD13 . LEU A 1 83  ? 5.531   1.430   -3.743  1.00 0.00 ? 83  LEU A HD13 5  
ATOM 8285  H HD21 . LEU A 1 83  ? 7.327   1.267   -4.751  1.00 0.00 ? 83  LEU A HD21 5  
ATOM 8286  H HD22 . LEU A 1 83  ? 7.857   -0.085  -5.752  1.00 0.00 ? 83  LEU A HD22 5  
ATOM 8287  H HD23 . LEU A 1 83  ? 7.846   -0.240  -3.995  1.00 0.00 ? 83  LEU A HD23 5  
ATOM 8288  N N    . GLN A 1 84  ? 6.668   -5.146  -5.033  1.00 0.00 ? 84  GLN A N    5  
ATOM 8289  C CA   . GLN A 1 84  ? 6.573   -6.490  -4.477  1.00 0.00 ? 84  GLN A CA   5  
ATOM 8290  C C    . GLN A 1 84  ? 7.727   -6.766  -3.518  1.00 0.00 ? 84  GLN A C    5  
ATOM 8291  O O    . GLN A 1 84  ? 7.525   -6.901  -2.312  1.00 0.00 ? 84  GLN A O    5  
ATOM 8292  C CB   . GLN A 1 84  ? 6.567   -7.530  -5.599  1.00 0.00 ? 84  GLN A CB   5  
ATOM 8293  C CG   . GLN A 1 84  ? 5.228   -7.652  -6.309  1.00 0.00 ? 84  GLN A CG   5  
ATOM 8294  C CD   . GLN A 1 84  ? 5.309   -8.495  -7.566  1.00 0.00 ? 84  GLN A CD   5  
ATOM 8295  O OE1  . GLN A 1 84  ? 5.742   -9.647  -7.528  1.00 0.00 ? 84  GLN A OE1  5  
ATOM 8296  N NE2  . GLN A 1 84  ? 4.891   -7.924  -8.690  1.00 0.00 ? 84  GLN A NE2  5  
ATOM 8297  H H    . GLN A 1 84  ? 6.635   -5.027  -6.005  1.00 0.00 ? 84  GLN A H    5  
ATOM 8298  H HA   . GLN A 1 84  ? 5.644   -6.558  -3.931  1.00 0.00 ? 84  GLN A HA   5  
ATOM 8299  H HB2  . GLN A 1 84  ? 7.314   -7.258  -6.330  1.00 0.00 ? 84  GLN A HB2  5  
ATOM 8300  H HB3  . GLN A 1 84  ? 6.818   -8.494  -5.182  1.00 0.00 ? 84  GLN A HB3  5  
ATOM 8301  H HG2  . GLN A 1 84  ? 4.518   -8.107  -5.635  1.00 0.00 ? 84  GLN A HG2  5  
ATOM 8302  H HG3  . GLN A 1 84  ? 4.887   -6.663  -6.577  1.00 0.00 ? 84  GLN A HG3  5  
ATOM 8303  H HE21 . GLN A 1 84  ? 4.560   -7.002  -8.645  1.00 0.00 ? 84  GLN A HE21 5  
ATOM 8304  H HE22 . GLN A 1 84  ? 4.933   -8.446  -9.517  1.00 0.00 ? 84  GLN A HE22 5  
ATOM 8305  N N    . ASN A 1 85  ? 8.936   -6.848  -4.064  1.00 0.00 ? 85  ASN A N    5  
ATOM 8306  C CA   . ASN A 1 85  ? 10.122  -7.108  -3.257  1.00 0.00 ? 85  ASN A CA   5  
ATOM 8307  C C    . ASN A 1 85  ? 10.732  -5.805  -2.750  1.00 0.00 ? 85  ASN A C    5  
ATOM 8308  O O    . ASN A 1 85  ? 11.944  -5.706  -2.564  1.00 0.00 ? 85  ASN A O    5  
ATOM 8309  C CB   . ASN A 1 85  ? 11.158  -7.886  -4.071  1.00 0.00 ? 85  ASN A CB   5  
ATOM 8310  C CG   . ASN A 1 85  ? 10.554  -9.081  -4.784  1.00 0.00 ? 85  ASN A CG   5  
ATOM 8311  O OD1  . ASN A 1 85  ? 10.621  -10.209 -4.294  1.00 0.00 ? 85  ASN A OD1  5  
ATOM 8312  N ND2  . ASN A 1 85  ? 9.961   -8.838  -5.947  1.00 0.00 ? 85  ASN A ND2  5  
ATOM 8313  H H    . ASN A 1 85  ? 9.033   -6.732  -5.032  1.00 0.00 ? 85  ASN A H    5  
ATOM 8314  H HA   . ASN A 1 85  ? 9.822   -7.705  -2.409  1.00 0.00 ? 85  ASN A HA   5  
ATOM 8315  H HB2  . ASN A 1 85  ? 11.590  -7.230  -4.813  1.00 0.00 ? 85  ASN A HB2  5  
ATOM 8316  H HB3  . ASN A 1 85  ? 11.936  -8.239  -3.411  1.00 0.00 ? 85  ASN A HB3  5  
ATOM 8317  H HD21 . ASN A 1 85  ? 9.946   -7.915  -6.275  1.00 0.00 ? 85  ASN A HD21 5  
ATOM 8318  H HD22 . ASN A 1 85  ? 9.561   -9.593  -6.428  1.00 0.00 ? 85  ASN A HD22 5  
ATOM 8319  N N    . ALA A 1 86  ? 9.882   -4.807  -2.528  1.00 0.00 ? 86  ALA A N    5  
ATOM 8320  C CA   . ALA A 1 86  ? 10.337  -3.511  -2.040  1.00 0.00 ? 86  ALA A CA   5  
ATOM 8321  C C    . ALA A 1 86  ? 10.019  -3.340  -0.559  1.00 0.00 ? 86  ALA A C    5  
ATOM 8322  O O    . ALA A 1 86  ? 8.928   -3.686  -0.104  1.00 0.00 ? 86  ALA A O    5  
ATOM 8323  C CB   . ALA A 1 86  ? 9.703   -2.391  -2.851  1.00 0.00 ? 86  ALA A CB   5  
ATOM 8324  H H    . ALA A 1 86  ? 8.927   -4.947  -2.695  1.00 0.00 ? 86  ALA A H    5  
ATOM 8325  H HA   . ALA A 1 86  ? 11.407  -3.460  -2.177  1.00 0.00 ? 86  ALA A HA   5  
ATOM 8326  H HB1  . ALA A 1 86  ? 9.832   -1.453  -2.331  1.00 0.00 ? 86  ALA A HB1  5  
ATOM 8327  H HB2  . ALA A 1 86  ? 10.179  -2.334  -3.819  1.00 0.00 ? 86  ALA A HB2  5  
ATOM 8328  H HB3  . ALA A 1 86  ? 8.649   -2.590  -2.979  1.00 0.00 ? 86  ALA A HB3  5  
ATOM 8329  N N    . SER A 1 87  ? 10.978  -2.804  0.189   1.00 0.00 ? 87  SER A N    5  
ATOM 8330  C CA   . SER A 1 87  ? 10.801  -2.591  1.621   1.00 0.00 ? 87  SER A CA   5  
ATOM 8331  C C    . SER A 1 87  ? 9.678   -1.593  1.887   1.00 0.00 ? 87  SER A C    5  
ATOM 8332  O O    . SER A 1 87  ? 8.990   -1.155  0.965   1.00 0.00 ? 87  SER A O    5  
ATOM 8333  C CB   . SER A 1 87  ? 12.104  -2.090  2.248   1.00 0.00 ? 87  SER A CB   5  
ATOM 8334  O OG   . SER A 1 87  ? 12.614  -0.974  1.540   1.00 0.00 ? 87  SER A OG   5  
ATOM 8335  H H    . SER A 1 87  ? 11.825  -2.548  -0.232  1.00 0.00 ? 87  SER A H    5  
ATOM 8336  H HA   . SER A 1 87  ? 10.538  -3.539  2.067   1.00 0.00 ? 87  SER A HA   5  
ATOM 8337  H HB2  . SER A 1 87  ? 11.919  -1.799  3.271   1.00 0.00 ? 87  SER A HB2  5  
ATOM 8338  H HB3  . SER A 1 87  ? 12.838  -2.882  2.226   1.00 0.00 ? 87  SER A HB3  5  
ATOM 8339  H HG   . SER A 1 87  ? 13.512  -1.158  1.256   1.00 0.00 ? 87  SER A HG   5  
ATOM 8340  N N    . HIS A 1 88  ? 9.499   -1.238  3.156   1.00 0.00 ? 88  HIS A N    5  
ATOM 8341  C CA   . HIS A 1 88  ? 8.460   -0.291  3.545   1.00 0.00 ? 88  HIS A CA   5  
ATOM 8342  C C    . HIS A 1 88  ? 8.711   1.078   2.920   1.00 0.00 ? 88  HIS A C    5  
ATOM 8343  O O    . HIS A 1 88  ? 7.778   1.754   2.488   1.00 0.00 ? 88  HIS A O    5  
ATOM 8344  C CB   . HIS A 1 88  ? 8.400   -0.166  5.068   1.00 0.00 ? 88  HIS A CB   5  
ATOM 8345  C CG   . HIS A 1 88  ? 7.011   0.021   5.598   1.00 0.00 ? 88  HIS A CG   5  
ATOM 8346  N ND1  . HIS A 1 88  ? 6.717   0.848   6.662   1.00 0.00 ? 88  HIS A ND1  5  
ATOM 8347  C CD2  . HIS A 1 88  ? 5.833   -0.518  5.205   1.00 0.00 ? 88  HIS A CD2  5  
ATOM 8348  C CE1  . HIS A 1 88  ? 5.419   0.809   6.900   1.00 0.00 ? 88  HIS A CE1  5  
ATOM 8349  N NE2  . HIS A 1 88  ? 4.859   -0.012  6.030   1.00 0.00 ? 88  HIS A NE2  5  
ATOM 8350  H H    . HIS A 1 88  ? 10.080  -1.621  3.846   1.00 0.00 ? 88  HIS A H    5  
ATOM 8351  H HA   . HIS A 1 88  ? 7.516   -0.669  3.186   1.00 0.00 ? 88  HIS A HA   5  
ATOM 8352  H HB2  . HIS A 1 88  ? 8.806   -1.063  5.513   1.00 0.00 ? 88  HIS A HB2  5  
ATOM 8353  H HB3  . HIS A 1 88  ? 8.991   0.684   5.377   1.00 0.00 ? 88  HIS A HB3  5  
ATOM 8354  H HD1  . HIS A 1 88  ? 7.364   1.383   7.167   1.00 0.00 ? 88  HIS A HD1  5  
ATOM 8355  H HD2  . HIS A 1 88  ? 5.686   -1.216  4.393   1.00 0.00 ? 88  HIS A HD2  5  
ATOM 8356  H HE1  . HIS A 1 88  ? 4.901   1.356   7.675   1.00 0.00 ? 88  HIS A HE1  5  
ATOM 8357  N N    . SER A 1 89  ? 9.977   1.480   2.877   1.00 0.00 ? 89  SER A N    5  
ATOM 8358  C CA   . SER A 1 89  ? 10.350  2.771   2.309   1.00 0.00 ? 89  SER A CA   5  
ATOM 8359  C C    . SER A 1 89  ? 10.314  2.725   0.785   1.00 0.00 ? 89  SER A C    5  
ATOM 8360  O O    . SER A 1 89  ? 9.765   3.618   0.140   1.00 0.00 ? 89  SER A O    5  
ATOM 8361  C CB   . SER A 1 89  ? 11.747  3.176   2.785   1.00 0.00 ? 89  SER A CB   5  
ATOM 8362  O OG   . SER A 1 89  ? 12.233  4.286   2.050   1.00 0.00 ? 89  SER A OG   5  
ATOM 8363  H H    . SER A 1 89  ? 10.677  0.896   3.238   1.00 0.00 ? 89  SER A H    5  
ATOM 8364  H HA   . SER A 1 89  ? 9.635   3.503   2.653   1.00 0.00 ? 89  SER A HA   5  
ATOM 8365  H HB2  . SER A 1 89  ? 11.705  3.443   3.830   1.00 0.00 ? 89  SER A HB2  5  
ATOM 8366  H HB3  . SER A 1 89  ? 12.425  2.346   2.652   1.00 0.00 ? 89  SER A HB3  5  
ATOM 8367  H HG   . SER A 1 89  ? 12.078  5.092   2.547   1.00 0.00 ? 89  SER A HG   5  
ATOM 8368  N N    . GLU A 1 90  ? 10.901  1.676   0.216   1.00 0.00 ? 90  GLU A N    5  
ATOM 8369  C CA   . GLU A 1 90  ? 10.936  1.514   -1.232  1.00 0.00 ? 90  GLU A CA   5  
ATOM 8370  C C    . GLU A 1 90  ? 9.536   1.630   -1.827  1.00 0.00 ? 90  GLU A C    5  
ATOM 8371  O O    . GLU A 1 90  ? 9.361   2.127   -2.939  1.00 0.00 ? 90  GLU A O    5  
ATOM 8372  C CB   . GLU A 1 90  ? 11.549  0.161   -1.602  1.00 0.00 ? 90  GLU A CB   5  
ATOM 8373  C CG   . GLU A 1 90  ? 13.051  0.093   -1.382  1.00 0.00 ? 90  GLU A CG   5  
ATOM 8374  C CD   . GLU A 1 90  ? 13.839  0.521   -2.605  1.00 0.00 ? 90  GLU A CD   5  
ATOM 8375  O OE1  . GLU A 1 90  ? 13.403  0.204   -3.731  1.00 0.00 ? 90  GLU A OE1  5  
ATOM 8376  O OE2  . GLU A 1 90  ? 14.891  1.171   -2.435  1.00 0.00 ? 90  GLU A OE2  5  
ATOM 8377  H H    . GLU A 1 90  ? 11.321  0.997   0.784   1.00 0.00 ? 90  GLU A H    5  
ATOM 8378  H HA   . GLU A 1 90  ? 11.553  2.301   -1.640  1.00 0.00 ? 90  GLU A HA   5  
ATOM 8379  H HB2  . GLU A 1 90  ? 11.083  -0.607  -1.002  1.00 0.00 ? 90  GLU A HB2  5  
ATOM 8380  H HB3  . GLU A 1 90  ? 11.350  -0.038  -2.644  1.00 0.00 ? 90  GLU A HB3  5  
ATOM 8381  H HG2  . GLU A 1 90  ? 13.312  0.742   -0.560  1.00 0.00 ? 90  GLU A HG2  5  
ATOM 8382  H HG3  . GLU A 1 90  ? 13.320  -0.924  -1.136  1.00 0.00 ? 90  GLU A HG3  5  
ATOM 8383  N N    . ALA A 1 91  ? 8.541   1.166   -1.078  1.00 0.00 ? 91  ALA A N    5  
ATOM 8384  C CA   . ALA A 1 91  ? 7.156   1.218   -1.529  1.00 0.00 ? 91  ALA A CA   5  
ATOM 8385  C C    . ALA A 1 91  ? 6.550   2.595   -1.283  1.00 0.00 ? 91  ALA A C    5  
ATOM 8386  O O    . ALA A 1 91  ? 5.818   3.122   -2.121  1.00 0.00 ? 91  ALA A O    5  
ATOM 8387  C CB   . ALA A 1 91  ? 6.333   0.145   -0.832  1.00 0.00 ? 91  ALA A CB   5  
ATOM 8388  H H    . ALA A 1 91  ? 8.744   0.780   -0.200  1.00 0.00 ? 91  ALA A H    5  
ATOM 8389  H HA   . ALA A 1 91  ? 7.143   1.015   -2.591  1.00 0.00 ? 91  ALA A HA   5  
ATOM 8390  H HB1  . ALA A 1 91  ? 5.299   0.452   -0.795  1.00 0.00 ? 91  ALA A HB1  5  
ATOM 8391  H HB2  . ALA A 1 91  ? 6.414   -0.783  -1.382  1.00 0.00 ? 91  ALA A HB2  5  
ATOM 8392  H HB3  . ALA A 1 91  ? 6.704   0.002   0.171   1.00 0.00 ? 91  ALA A HB3  5  
ATOM 8393  N N    . VAL A 1 92  ? 6.859   3.174   -0.127  1.00 0.00 ? 92  VAL A N    5  
ATOM 8394  C CA   . VAL A 1 92  ? 6.345   4.491   0.230   1.00 0.00 ? 92  VAL A CA   5  
ATOM 8395  C C    . VAL A 1 92  ? 6.765   5.541   -0.793  1.00 0.00 ? 92  VAL A C    5  
ATOM 8396  O O    . VAL A 1 92  ? 5.922   6.210   -1.390  1.00 0.00 ? 92  VAL A O    5  
ATOM 8397  C CB   . VAL A 1 92  ? 6.834   4.926   1.625   1.00 0.00 ? 92  VAL A CB   5  
ATOM 8398  C CG1  . VAL A 1 92  ? 6.766   6.438   1.767   1.00 0.00 ? 92  VAL A CG1  5  
ATOM 8399  C CG2  . VAL A 1 92  ? 6.018   4.242   2.712   1.00 0.00 ? 92  VAL A CG2  5  
ATOM 8400  H H    . VAL A 1 92  ? 7.448   2.705   0.501   1.00 0.00 ? 92  VAL A H    5  
ATOM 8401  H HA   . VAL A 1 92  ? 5.266   4.434   0.251   1.00 0.00 ? 92  VAL A HA   5  
ATOM 8402  H HB   . VAL A 1 92  ? 7.865   4.622   1.733   1.00 0.00 ? 92  VAL A HB   5  
ATOM 8403  H HG11 . VAL A 1 92  ? 6.853   6.706   2.810   1.00 0.00 ? 92  VAL A HG11 5  
ATOM 8404  H HG12 . VAL A 1 92  ? 7.573   6.890   1.210   1.00 0.00 ? 92  VAL A HG12 5  
ATOM 8405  H HG13 . VAL A 1 92  ? 5.820   6.794   1.384   1.00 0.00 ? 92  VAL A HG13 5  
ATOM 8406  H HG21 . VAL A 1 92  ? 5.225   3.666   2.258   1.00 0.00 ? 92  VAL A HG21 5  
ATOM 8407  H HG22 . VAL A 1 92  ? 6.658   3.587   3.283   1.00 0.00 ? 92  VAL A HG22 5  
ATOM 8408  H HG23 . VAL A 1 92  ? 5.591   4.989   3.366   1.00 0.00 ? 92  VAL A HG23 5  
ATOM 8409  N N    . GLU A 1 93  ? 8.072   5.678   -0.990  1.00 0.00 ? 93  GLU A N    5  
ATOM 8410  C CA   . GLU A 1 93  ? 8.603   6.647   -1.941  1.00 0.00 ? 93  GLU A CA   5  
ATOM 8411  C C    . GLU A 1 93  ? 7.897   6.529   -3.289  1.00 0.00 ? 93  GLU A C    5  
ATOM 8412  O O    . GLU A 1 93  ? 7.700   7.523   -3.987  1.00 0.00 ? 93  GLU A O    5  
ATOM 8413  C CB   . GLU A 1 93  ? 10.109  6.444   -2.123  1.00 0.00 ? 93  GLU A CB   5  
ATOM 8414  C CG   . GLU A 1 93  ? 10.878  6.395   -0.814  1.00 0.00 ? 93  GLU A CG   5  
ATOM 8415  C CD   . GLU A 1 93  ? 12.280  6.959   -0.939  1.00 0.00 ? 93  GLU A CD   5  
ATOM 8416  O OE1  . GLU A 1 93  ? 12.466  7.921   -1.713  1.00 0.00 ? 93  GLU A OE1  5  
ATOM 8417  O OE2  . GLU A 1 93  ? 13.191  6.439   -0.262  1.00 0.00 ? 93  GLU A OE2  5  
ATOM 8418  H H    . GLU A 1 93  ? 8.694   5.115   -0.483  1.00 0.00 ? 93  GLU A H    5  
ATOM 8419  H HA   . GLU A 1 93  ? 8.428   7.634   -1.542  1.00 0.00 ? 93  GLU A HA   5  
ATOM 8420  H HB2  . GLU A 1 93  ? 10.274  5.516   -2.650  1.00 0.00 ? 93  GLU A HB2  5  
ATOM 8421  H HB3  . GLU A 1 93  ? 10.500  7.259   -2.715  1.00 0.00 ? 93  GLU A HB3  5  
ATOM 8422  H HG2  . GLU A 1 93  ? 10.341  6.968   -0.073  1.00 0.00 ? 93  GLU A HG2  5  
ATOM 8423  H HG3  . GLU A 1 93  ? 10.948  5.367   -0.490  1.00 0.00 ? 93  GLU A HG3  5  
ATOM 8424  N N    . ALA A 1 94  ? 7.520   5.306   -3.648  1.00 0.00 ? 94  ALA A N    5  
ATOM 8425  C CA   . ALA A 1 94  ? 6.835   5.058   -4.910  1.00 0.00 ? 94  ALA A CA   5  
ATOM 8426  C C    . ALA A 1 94  ? 5.500   5.793   -4.965  1.00 0.00 ? 94  ALA A C    5  
ATOM 8427  O O    . ALA A 1 94  ? 5.198   6.478   -5.942  1.00 0.00 ? 94  ALA A O    5  
ATOM 8428  C CB   . ALA A 1 94  ? 6.625   3.564   -5.112  1.00 0.00 ? 94  ALA A CB   5  
ATOM 8429  H H    . ALA A 1 94  ? 7.705   4.554   -3.049  1.00 0.00 ? 94  ALA A H    5  
ATOM 8430  H HA   . ALA A 1 94  ? 7.466   5.419   -5.709  1.00 0.00 ? 94  ALA A HA   5  
ATOM 8431  H HB1  . ALA A 1 94  ? 6.663   3.064   -4.156  1.00 0.00 ? 94  ALA A HB1  5  
ATOM 8432  H HB2  . ALA A 1 94  ? 5.661   3.396   -5.570  1.00 0.00 ? 94  ALA A HB2  5  
ATOM 8433  H HB3  . ALA A 1 94  ? 7.402   3.176   -5.754  1.00 0.00 ? 94  ALA A HB3  5  
ATOM 8434  N N    . ILE A 1 95  ? 4.705   5.646   -3.910  1.00 0.00 ? 95  ILE A N    5  
ATOM 8435  C CA   . ILE A 1 95  ? 3.403   6.297   -3.839  1.00 0.00 ? 95  ILE A CA   5  
ATOM 8436  C C    . ILE A 1 95  ? 3.547   7.815   -3.820  1.00 0.00 ? 95  ILE A C    5  
ATOM 8437  O O    . ILE A 1 95  ? 2.790   8.530   -4.476  1.00 0.00 ? 95  ILE A O    5  
ATOM 8438  C CB   . ILE A 1 95  ? 2.619   5.851   -2.590  1.00 0.00 ? 95  ILE A CB   5  
ATOM 8439  C CG1  . ILE A 1 95  ? 2.192   4.388   -2.724  1.00 0.00 ? 95  ILE A CG1  5  
ATOM 8440  C CG2  . ILE A 1 95  ? 1.406   6.745   -2.379  1.00 0.00 ? 95  ILE A CG2  5  
ATOM 8441  C CD1  . ILE A 1 95  ? 3.217   3.409   -2.197  1.00 0.00 ? 95  ILE A CD1  5  
ATOM 8442  H H    . ILE A 1 95  ? 5.002   5.087   -3.162  1.00 0.00 ? 95  ILE A H    5  
ATOM 8443  H HA   . ILE A 1 95  ? 2.839   6.010   -4.714  1.00 0.00 ? 95  ILE A HA   5  
ATOM 8444  H HB   . ILE A 1 95  ? 3.265   5.953   -1.731  1.00 0.00 ? 95  ILE A HB   5  
ATOM 8445  H HG12 . ILE A 1 95  ? 1.275   4.235   -2.176  1.00 0.00 ? 95  ILE A HG12 5  
ATOM 8446  H HG13 . ILE A 1 95  ? 2.024   4.164   -3.768  1.00 0.00 ? 95  ILE A HG13 5  
ATOM 8447  H HG21 . ILE A 1 95  ? 0.519   6.135   -2.298  1.00 0.00 ? 95  ILE A HG21 5  
ATOM 8448  H HG22 . ILE A 1 95  ? 1.534   7.316   -1.472  1.00 0.00 ? 95  ILE A HG22 5  
ATOM 8449  H HG23 . ILE A 1 95  ? 1.304   7.418   -3.218  1.00 0.00 ? 95  ILE A HG23 5  
ATOM 8450  H HD11 . ILE A 1 95  ? 3.862   3.910   -1.489  1.00 0.00 ? 95  ILE A HD11 5  
ATOM 8451  H HD12 . ILE A 1 95  ? 2.713   2.590   -1.705  1.00 0.00 ? 95  ILE A HD12 5  
ATOM 8452  H HD13 . ILE A 1 95  ? 3.808   3.030   -3.016  1.00 0.00 ? 95  ILE A HD13 5  
ATOM 8453  N N    . LYS A 1 96  ? 4.526   8.301   -3.064  1.00 0.00 ? 96  LYS A N    5  
ATOM 8454  C CA   . LYS A 1 96  ? 4.773   9.734   -2.961  1.00 0.00 ? 96  LYS A CA   5  
ATOM 8455  C C    . LYS A 1 96  ? 5.471   10.257  -4.213  1.00 0.00 ? 96  LYS A C    5  
ATOM 8456  O O    . LYS A 1 96  ? 5.345   11.430  -4.561  1.00 0.00 ? 96  LYS A O    5  
ATOM 8457  C CB   . LYS A 1 96  ? 5.624   10.038  -1.726  1.00 0.00 ? 96  LYS A CB   5  
ATOM 8458  C CG   . LYS A 1 96  ? 7.118   10.032  -1.999  1.00 0.00 ? 96  LYS A CG   5  
ATOM 8459  C CD   . LYS A 1 96  ? 7.920   10.154  -0.714  1.00 0.00 ? 96  LYS A CD   5  
ATOM 8460  C CE   . LYS A 1 96  ? 8.128   11.609  -0.323  1.00 0.00 ? 96  LYS A CE   5  
ATOM 8461  N NZ   . LYS A 1 96  ? 8.614   11.742  1.078   1.00 0.00 ? 96  LYS A NZ   5  
ATOM 8462  H H    . LYS A 1 96  ? 5.097   7.680   -2.564  1.00 0.00 ? 96  LYS A H    5  
ATOM 8463  H HA   . LYS A 1 96  ? 3.819   10.229  -2.862  1.00 0.00 ? 96  LYS A HA   5  
ATOM 8464  H HB2  . LYS A 1 96  ? 5.352   11.013  -1.348  1.00 0.00 ? 96  LYS A HB2  5  
ATOM 8465  H HB3  . LYS A 1 96  ? 5.414   9.297   -0.968  1.00 0.00 ? 96  LYS A HB3  5  
ATOM 8466  H HG2  . LYS A 1 96  ? 7.381   9.106   -2.488  1.00 0.00 ? 96  LYS A HG2  5  
ATOM 8467  H HG3  . LYS A 1 96  ? 7.360   10.864  -2.644  1.00 0.00 ? 96  LYS A HG3  5  
ATOM 8468  H HD2  . LYS A 1 96  ? 7.389   9.652   0.081   1.00 0.00 ? 96  LYS A HD2  5  
ATOM 8469  H HD3  . LYS A 1 96  ? 8.884   9.686   -0.856  1.00 0.00 ? 96  LYS A HD3  5  
ATOM 8470  H HE2  . LYS A 1 96  ? 8.855   12.046  -0.990  1.00 0.00 ? 96  LYS A HE2  5  
ATOM 8471  H HE3  . LYS A 1 96  ? 7.189   12.132  -0.421  1.00 0.00 ? 96  LYS A HE3  5  
ATOM 8472  H HZ1  . LYS A 1 96  ? 8.327   12.662  1.470   1.00 0.00 ? 96  LYS A HZ1  5  
ATOM 8473  H HZ2  . LYS A 1 96  ? 9.651   11.675  1.105   1.00 0.00 ? 96  LYS A HZ2  5  
ATOM 8474  H HZ3  . LYS A 1 96  ? 8.213   10.986  1.669   1.00 0.00 ? 96  LYS A HZ3  5  
ATOM 8475  N N    . ASN A 1 97  ? 6.206   9.378   -4.886  1.00 0.00 ? 97  ASN A N    5  
ATOM 8476  C CA   . ASN A 1 97  ? 6.924   9.751   -6.100  1.00 0.00 ? 97  ASN A CA   5  
ATOM 8477  C C    . ASN A 1 97  ? 6.246   9.164   -7.334  1.00 0.00 ? 97  ASN A C    5  
ATOM 8478  O O    . ASN A 1 97  ? 6.844   9.091   -8.407  1.00 0.00 ? 97  ASN A O    5  
ATOM 8479  C CB   . ASN A 1 97  ? 8.376   9.275   -6.026  1.00 0.00 ? 97  ASN A CB   5  
ATOM 8480  C CG   . ASN A 1 97  ? 9.105   9.828   -4.817  1.00 0.00 ? 97  ASN A CG   5  
ATOM 8481  O OD1  . ASN A 1 97  ? 9.135   11.039  -4.597  1.00 0.00 ? 97  ASN A OD1  5  
ATOM 8482  N ND2  . ASN A 1 97  ? 9.699   8.941   -4.027  1.00 0.00 ? 97  ASN A ND2  5  
ATOM 8483  H H    . ASN A 1 97  ? 6.269   8.456   -4.559  1.00 0.00 ? 97  ASN A H    5  
ATOM 8484  H HA   . ASN A 1 97  ? 6.911   10.828  -6.174  1.00 0.00 ? 97  ASN A HA   5  
ATOM 8485  H HB2  . ASN A 1 97  ? 8.392   8.196   -5.969  1.00 0.00 ? 97  ASN A HB2  5  
ATOM 8486  H HB3  . ASN A 1 97  ? 8.898   9.592   -6.916  1.00 0.00 ? 97  ASN A HB3  5  
ATOM 8487  H HD21 . ASN A 1 97  ? 9.634   7.993   -4.265  1.00 0.00 ? 97  ASN A HD21 5  
ATOM 8488  H HD22 . ASN A 1 97  ? 10.177  9.272   -3.238  1.00 0.00 ? 97  ASN A HD22 5  
ATOM 8489  N N    . ALA A 1 98  ? 4.994   8.749   -7.174  1.00 0.00 ? 98  ALA A N    5  
ATOM 8490  C CA   . ALA A 1 98  ? 4.234   8.171   -8.275  1.00 0.00 ? 98  ALA A CA   5  
ATOM 8491  C C    . ALA A 1 98  ? 3.750   9.253   -9.235  1.00 0.00 ? 98  ALA A C    5  
ATOM 8492  O O    . ALA A 1 98  ? 2.935   10.100  -8.872  1.00 0.00 ? 98  ALA A O    5  
ATOM 8493  C CB   . ALA A 1 98  ? 3.055   7.371   -7.741  1.00 0.00 ? 98  ALA A CB   5  
ATOM 8494  H H    . ALA A 1 98  ? 4.571   8.834   -6.294  1.00 0.00 ? 98  ALA A H    5  
ATOM 8495  H HA   . ALA A 1 98  ? 4.884   7.494   -8.810  1.00 0.00 ? 98  ALA A HA   5  
ATOM 8496  H HB1  . ALA A 1 98  ? 3.364   6.353   -7.559  1.00 0.00 ? 98  ALA A HB1  5  
ATOM 8497  H HB2  . ALA A 1 98  ? 2.710   7.814   -6.817  1.00 0.00 ? 98  ALA A HB2  5  
ATOM 8498  H HB3  . ALA A 1 98  ? 2.255   7.381   -8.466  1.00 0.00 ? 98  ALA A HB3  5  
ATOM 8499  N N    . GLY A 1 99  ? 4.258   9.218   -10.463 1.00 0.00 ? 99  GLY A N    5  
ATOM 8500  C CA   . GLY A 1 99  ? 3.866   10.202  -11.456 1.00 0.00 ? 99  GLY A CA   5  
ATOM 8501  C C    . GLY A 1 99  ? 2.362   10.348  -11.565 1.00 0.00 ? 99  GLY A C    5  
ATOM 8502  O O    . GLY A 1 99  ? 1.705   9.575   -12.260 1.00 0.00 ? 99  GLY A O    5  
ATOM 8503  H H    . GLY A 1 99  ? 4.905   8.520   -10.697 1.00 0.00 ? 99  GLY A H    5  
ATOM 8504  H HA2  . GLY A 1 99  ? 4.293   11.157  -11.188 1.00 0.00 ? 99  GLY A HA2  5  
ATOM 8505  H HA3  . GLY A 1 99  ? 4.257   9.901   -12.417 1.00 0.00 ? 99  GLY A HA3  5  
ATOM 8506  N N    . ASN A 1 100 ? 1.814   11.343  -10.874 1.00 0.00 ? 100 ASN A N    5  
ATOM 8507  C CA   . ASN A 1 100 ? 0.377   11.587  -10.894 1.00 0.00 ? 100 ASN A CA   5  
ATOM 8508  C C    . ASN A 1 100 ? -0.187  11.403  -12.300 1.00 0.00 ? 100 ASN A C    5  
ATOM 8509  O O    . ASN A 1 100 ? 0.373   11.879  -13.287 1.00 0.00 ? 100 ASN A O    5  
ATOM 8510  C CB   . ASN A 1 100 ? 0.071   13.000  -10.391 1.00 0.00 ? 100 ASN A CB   5  
ATOM 8511  C CG   . ASN A 1 100 ? -1.174  13.584  -11.030 1.00 0.00 ? 100 ASN A CG   5  
ATOM 8512  O OD1  . ASN A 1 100 ? -1.253  13.719  -12.251 1.00 0.00 ? 100 ASN A OD1  5  
ATOM 8513  N ND2  . ASN A 1 100 ? -2.153  13.935  -10.205 1.00 0.00 ? 100 ASN A ND2  5  
ATOM 8514  H H    . ASN A 1 100 ? 2.391   11.927  -10.338 1.00 0.00 ? 100 ASN A H    5  
ATOM 8515  H HA   . ASN A 1 100 ? -0.090  10.871  -10.235 1.00 0.00 ? 100 ASN A HA   5  
ATOM 8516  H HB2  . ASN A 1 100 ? -0.077  12.970  -9.321  1.00 0.00 ? 100 ASN A HB2  5  
ATOM 8517  H HB3  . ASN A 1 100 ? 0.907   13.645  -10.617 1.00 0.00 ? 100 ASN A HB3  5  
ATOM 8518  H HD21 . ASN A 1 100 ? -2.020  13.798  -9.244  1.00 0.00 ? 100 ASN A HD21 5  
ATOM 8519  H HD22 . ASN A 1 100 ? -2.970  14.315  -10.592 1.00 0.00 ? 100 ASN A HD22 5  
ATOM 8520  N N    . PRO A 1 101 ? -1.323  10.695  -12.394 1.00 0.00 ? 101 PRO A N    5  
ATOM 8521  C CA   . PRO A 1 101 ? -1.998  10.123  -11.225 1.00 0.00 ? 101 PRO A CA   5  
ATOM 8522  C C    . PRO A 1 101 ? -1.214  8.969   -10.610 1.00 0.00 ? 101 PRO A C    5  
ATOM 8523  O O    . PRO A 1 101 ? -0.220  8.511   -11.173 1.00 0.00 ? 101 PRO A O    5  
ATOM 8524  C CB   . PRO A 1 101 ? -3.328  9.624   -11.794 1.00 0.00 ? 101 PRO A CB   5  
ATOM 8525  C CG   . PRO A 1 101 ? -3.054  9.373   -13.236 1.00 0.00 ? 101 PRO A CG   5  
ATOM 8526  C CD   . PRO A 1 101 ? -2.035  10.399  -13.648 1.00 0.00 ? 101 PRO A CD   5  
ATOM 8527  H HA   . PRO A 1 101 ? -2.186  10.872  -10.469 1.00 0.00 ? 101 PRO A HA   5  
ATOM 8528  H HB2  . PRO A 1 101 ? -3.623  8.718   -11.283 1.00 0.00 ? 101 PRO A HB2  5  
ATOM 8529  H HB3  . PRO A 1 101 ? -4.087  10.381  -11.662 1.00 0.00 ? 101 PRO A HB3  5  
ATOM 8530  H HG2  . PRO A 1 101 ? -2.658  8.378   -13.367 1.00 0.00 ? 101 PRO A HG2  5  
ATOM 8531  H HG3  . PRO A 1 101 ? -3.961  9.496   -13.809 1.00 0.00 ? 101 PRO A HG3  5  
ATOM 8532  H HD2  . PRO A 1 101 ? -1.362  9.988   -14.386 1.00 0.00 ? 101 PRO A HD2  5  
ATOM 8533  H HD3  . PRO A 1 101 ? -2.523  11.283  -14.032 1.00 0.00 ? 101 PRO A HD3  5  
ATOM 8534  N N    . VAL A 1 102 ? -1.669  8.501   -9.452  1.00 0.00 ? 102 VAL A N    5  
ATOM 8535  C CA   . VAL A 1 102 ? -1.011  7.398   -8.762  1.00 0.00 ? 102 VAL A CA   5  
ATOM 8536  C C    . VAL A 1 102 ? -1.808  6.106   -8.906  1.00 0.00 ? 102 VAL A C    5  
ATOM 8537  O O    . VAL A 1 102 ? -2.756  5.863   -8.159  1.00 0.00 ? 102 VAL A O    5  
ATOM 8538  C CB   . VAL A 1 102 ? -0.821  7.707   -7.265  1.00 0.00 ? 102 VAL A CB   5  
ATOM 8539  C CG1  . VAL A 1 102 ? 0.052   6.648   -6.608  1.00 0.00 ? 102 VAL A CG1  5  
ATOM 8540  C CG2  . VAL A 1 102 ? -0.223  9.093   -7.079  1.00 0.00 ? 102 VAL A CG2  5  
ATOM 8541  H H    . VAL A 1 102 ? -2.467  8.907   -9.053  1.00 0.00 ? 102 VAL A H    5  
ATOM 8542  H HA   . VAL A 1 102 ? -0.036  7.260   -9.206  1.00 0.00 ? 102 VAL A HA   5  
ATOM 8543  H HB   . VAL A 1 102 ? -1.790  7.689   -6.788  1.00 0.00 ? 102 VAL A HB   5  
ATOM 8544  H HG11 . VAL A 1 102 ? 0.485   7.050   -5.704  1.00 0.00 ? 102 VAL A HG11 5  
ATOM 8545  H HG12 . VAL A 1 102 ? -0.550  5.784   -6.367  1.00 0.00 ? 102 VAL A HG12 5  
ATOM 8546  H HG13 . VAL A 1 102 ? 0.841   6.361   -7.287  1.00 0.00 ? 102 VAL A HG13 5  
ATOM 8547  H HG21 . VAL A 1 102 ? 0.206   9.429   -8.011  1.00 0.00 ? 102 VAL A HG21 5  
ATOM 8548  H HG22 . VAL A 1 102 ? -0.997  9.780   -6.771  1.00 0.00 ? 102 VAL A HG22 5  
ATOM 8549  H HG23 . VAL A 1 102 ? 0.547   9.055   -6.322  1.00 0.00 ? 102 VAL A HG23 5  
ATOM 8550  N N    . VAL A 1 103 ? -1.416  5.280   -9.871  1.00 0.00 ? 103 VAL A N    5  
ATOM 8551  C CA   . VAL A 1 103 ? -2.093  4.011   -10.112 1.00 0.00 ? 103 VAL A CA   5  
ATOM 8552  C C    . VAL A 1 103 ? -1.719  2.979   -9.054  1.00 0.00 ? 103 VAL A C    5  
ATOM 8553  O O    . VAL A 1 103 ? -0.623  3.017   -8.494  1.00 0.00 ? 103 VAL A O    5  
ATOM 8554  C CB   . VAL A 1 103 ? -1.752  3.450   -11.505 1.00 0.00 ? 103 VAL A CB   5  
ATOM 8555  C CG1  . VAL A 1 103 ? -2.811  2.454   -11.954 1.00 0.00 ? 103 VAL A CG1  5  
ATOM 8556  C CG2  . VAL A 1 103 ? -1.609  4.579   -12.514 1.00 0.00 ? 103 VAL A CG2  5  
ATOM 8557  H H    . VAL A 1 103 ? -0.654  5.530   -10.433 1.00 0.00 ? 103 VAL A H    5  
ATOM 8558  H HA   . VAL A 1 103 ? -3.158  4.187   -10.069 1.00 0.00 ? 103 VAL A HA   5  
ATOM 8559  H HB   . VAL A 1 103 ? -0.806  2.931   -11.440 1.00 0.00 ? 103 VAL A HB   5  
ATOM 8560  H HG11 . VAL A 1 103 ? -3.616  2.438   -11.234 1.00 0.00 ? 103 VAL A HG11 5  
ATOM 8561  H HG12 . VAL A 1 103 ? -3.195  2.747   -12.920 1.00 0.00 ? 103 VAL A HG12 5  
ATOM 8562  H HG13 . VAL A 1 103 ? -2.372  1.470   -12.024 1.00 0.00 ? 103 VAL A HG13 5  
ATOM 8563  H HG21 . VAL A 1 103 ? -1.911  4.231   -13.490 1.00 0.00 ? 103 VAL A HG21 5  
ATOM 8564  H HG22 . VAL A 1 103 ? -2.234  5.408   -12.217 1.00 0.00 ? 103 VAL A HG22 5  
ATOM 8565  H HG23 . VAL A 1 103 ? -0.578  4.902   -12.550 1.00 0.00 ? 103 VAL A HG23 5  
ATOM 8566  N N    . PHE A 1 104 ? -2.636  2.056   -8.786  1.00 0.00 ? 104 PHE A N    5  
ATOM 8567  C CA   . PHE A 1 104 ? -2.403  1.013   -7.794  1.00 0.00 ? 104 PHE A CA   5  
ATOM 8568  C C    . PHE A 1 104 ? -2.753  -0.361  -8.358  1.00 0.00 ? 104 PHE A C    5  
ATOM 8569  O O    . PHE A 1 104 ? -3.800  -0.540  -8.981  1.00 0.00 ? 104 PHE A O    5  
ATOM 8570  C CB   . PHE A 1 104 ? -3.228  1.283   -6.534  1.00 0.00 ? 104 PHE A CB   5  
ATOM 8571  C CG   . PHE A 1 104 ? -2.495  2.088   -5.499  1.00 0.00 ? 104 PHE A CG   5  
ATOM 8572  C CD1  . PHE A 1 104 ? -2.419  3.468   -5.601  1.00 0.00 ? 104 PHE A CD1  5  
ATOM 8573  C CD2  . PHE A 1 104 ? -1.882  1.465   -4.424  1.00 0.00 ? 104 PHE A CD2  5  
ATOM 8574  C CE1  . PHE A 1 104 ? -1.744  4.211   -4.651  1.00 0.00 ? 104 PHE A CE1  5  
ATOM 8575  C CE2  . PHE A 1 104 ? -1.206  2.203   -3.471  1.00 0.00 ? 104 PHE A CE2  5  
ATOM 8576  C CZ   . PHE A 1 104 ? -1.138  3.578   -3.584  1.00 0.00 ? 104 PHE A CZ   5  
ATOM 8577  H H    . PHE A 1 104 ? -3.491  2.078   -9.265  1.00 0.00 ? 104 PHE A H    5  
ATOM 8578  H HA   . PHE A 1 104 ? -1.355  1.028   -7.538  1.00 0.00 ? 104 PHE A HA   5  
ATOM 8579  H HB2  . PHE A 1 104 ? -4.120  1.828   -6.806  1.00 0.00 ? 104 PHE A HB2  5  
ATOM 8580  H HB3  . PHE A 1 104 ? -3.508  0.342   -6.087  1.00 0.00 ? 104 PHE A HB3  5  
ATOM 8581  H HD1  . PHE A 1 104 ? -2.894  3.965   -6.435  1.00 0.00 ? 104 PHE A HD1  5  
ATOM 8582  H HD2  . PHE A 1 104 ? -1.934  0.389   -4.335  1.00 0.00 ? 104 PHE A HD2  5  
ATOM 8583  H HE1  . PHE A 1 104 ? -1.693  5.286   -4.741  1.00 0.00 ? 104 PHE A HE1  5  
ATOM 8584  H HE2  . PHE A 1 104 ? -0.733  1.704   -2.637  1.00 0.00 ? 104 PHE A HE2  5  
ATOM 8585  H HZ   . PHE A 1 104 ? -0.610  4.156   -2.840  1.00 0.00 ? 104 PHE A HZ   5  
ATOM 8586  N N    . ILE A 1 105 ? -1.868  -1.328  -8.136  1.00 0.00 ? 105 ILE A N    5  
ATOM 8587  C CA   . ILE A 1 105 ? -2.083  -2.685  -8.622  1.00 0.00 ? 105 ILE A CA   5  
ATOM 8588  C C    . ILE A 1 105 ? -2.036  -3.692  -7.477  1.00 0.00 ? 105 ILE A C    5  
ATOM 8589  O O    . ILE A 1 105 ? -0.976  -4.220  -7.143  1.00 0.00 ? 105 ILE A O    5  
ATOM 8590  C CB   . ILE A 1 105 ? -1.033  -3.078  -9.678  1.00 0.00 ? 105 ILE A CB   5  
ATOM 8591  C CG1  . ILE A 1 105 ? -0.896  -1.973  -10.728 1.00 0.00 ? 105 ILE A CG1  5  
ATOM 8592  C CG2  . ILE A 1 105 ? -1.411  -4.396  -10.336 1.00 0.00 ? 105 ILE A CG2  5  
ATOM 8593  C CD1  . ILE A 1 105 ? -0.439  -2.476  -12.079 1.00 0.00 ? 105 ILE A CD1  5  
ATOM 8594  H H    . ILE A 1 105 ? -1.053  -1.123  -7.634  1.00 0.00 ? 105 ILE A H    5  
ATOM 8595  H HA   . ILE A 1 105 ? -3.059  -2.724  -9.082  1.00 0.00 ? 105 ILE A HA   5  
ATOM 8596  H HB   . ILE A 1 105 ? -0.085  -3.210  -9.180  1.00 0.00 ? 105 ILE A HB   5  
ATOM 8597  H HG12 . ILE A 1 105 ? -1.852  -1.490  -10.860 1.00 0.00 ? 105 ILE A HG12 5  
ATOM 8598  H HG13 . ILE A 1 105 ? -0.175  -1.246  -10.382 1.00 0.00 ? 105 ILE A HG13 5  
ATOM 8599  H HG21 . ILE A 1 105 ? -1.911  -4.201  -11.273 1.00 0.00 ? 105 ILE A HG21 5  
ATOM 8600  H HG22 . ILE A 1 105 ? -0.518  -4.975  -10.520 1.00 0.00 ? 105 ILE A HG22 5  
ATOM 8601  H HG23 . ILE A 1 105 ? -2.071  -4.948  -9.684  1.00 0.00 ? 105 ILE A HG23 5  
ATOM 8602  H HD11 . ILE A 1 105 ? -1.292  -2.839  -12.635 1.00 0.00 ? 105 ILE A HD11 5  
ATOM 8603  H HD12 . ILE A 1 105 ? 0.028   -1.670  -12.625 1.00 0.00 ? 105 ILE A HD12 5  
ATOM 8604  H HD13 . ILE A 1 105 ? 0.269   -3.279  -11.944 1.00 0.00 ? 105 ILE A HD13 5  
ATOM 8605  N N    . VAL A 1 106 ? -3.195  -3.955  -6.881  1.00 0.00 ? 106 VAL A N    5  
ATOM 8606  C CA   . VAL A 1 106 ? -3.288  -4.901  -5.775  1.00 0.00 ? 106 VAL A CA   5  
ATOM 8607  C C    . VAL A 1 106 ? -4.278  -6.017  -6.089  1.00 0.00 ? 106 VAL A C    5  
ATOM 8608  O O    . VAL A 1 106 ? -4.862  -6.055  -7.172  1.00 0.00 ? 106 VAL A O    5  
ATOM 8609  C CB   . VAL A 1 106 ? -3.717  -4.201  -4.472  1.00 0.00 ? 106 VAL A CB   5  
ATOM 8610  C CG1  . VAL A 1 106 ? -2.775  -3.051  -4.148  1.00 0.00 ? 106 VAL A CG1  5  
ATOM 8611  C CG2  . VAL A 1 106 ? -5.153  -3.711  -4.579  1.00 0.00 ? 106 VAL A CG2  5  
ATOM 8612  H H    . VAL A 1 106 ? -4.006  -3.502  -7.192  1.00 0.00 ? 106 VAL A H    5  
ATOM 8613  H HA   . VAL A 1 106 ? -2.310  -5.333  -5.622  1.00 0.00 ? 106 VAL A HA   5  
ATOM 8614  H HB   . VAL A 1 106 ? -3.663  -4.919  -3.667  1.00 0.00 ? 106 VAL A HB   5  
ATOM 8615  H HG11 . VAL A 1 106 ? -3.345  -2.141  -4.037  1.00 0.00 ? 106 VAL A HG11 5  
ATOM 8616  H HG12 . VAL A 1 106 ? -2.250  -3.264  -3.229  1.00 0.00 ? 106 VAL A HG12 5  
ATOM 8617  H HG13 . VAL A 1 106 ? -2.063  -2.933  -4.952  1.00 0.00 ? 106 VAL A HG13 5  
ATOM 8618  H HG21 . VAL A 1 106 ? -5.716  -4.380  -5.212  1.00 0.00 ? 106 VAL A HG21 5  
ATOM 8619  H HG22 . VAL A 1 106 ? -5.598  -3.685  -3.596  1.00 0.00 ? 106 VAL A HG22 5  
ATOM 8620  H HG23 . VAL A 1 106 ? -5.164  -2.718  -5.005  1.00 0.00 ? 106 VAL A HG23 5  
ATOM 8621  N N    . GLN A 1 107 ? -4.461  -6.924  -5.135  1.00 0.00 ? 107 GLN A N    5  
ATOM 8622  C CA   . GLN A 1 107 ? -5.381  -8.042  -5.310  1.00 0.00 ? 107 GLN A CA   5  
ATOM 8623  C C    . GLN A 1 107 ? -6.133  -8.336  -4.017  1.00 0.00 ? 107 GLN A C    5  
ATOM 8624  O O    . GLN A 1 107 ? -5.560  -8.852  -3.057  1.00 0.00 ? 107 GLN A O    5  
ATOM 8625  C CB   . GLN A 1 107 ? -4.620  -9.288  -5.766  1.00 0.00 ? 107 GLN A CB   5  
ATOM 8626  C CG   . GLN A 1 107 ? -3.406  -8.979  -6.627  1.00 0.00 ? 107 GLN A CG   5  
ATOM 8627  C CD   . GLN A 1 107 ? -2.843  -10.212 -7.306  1.00 0.00 ? 107 GLN A CD   5  
ATOM 8628  O OE1  . GLN A 1 107 ? -1.639  -10.466 -7.259  1.00 0.00 ? 107 GLN A OE1  5  
ATOM 8629  N NE2  . GLN A 1 107 ? -3.713  -10.987 -7.943  1.00 0.00 ? 107 GLN A NE2  5  
ATOM 8630  H H    . GLN A 1 107 ? -3.967  -6.839  -4.294  1.00 0.00 ? 107 GLN A H    5  
ATOM 8631  H HA   . GLN A 1 107 ? -6.094  -7.768  -6.072  1.00 0.00 ? 107 GLN A HA   5  
ATOM 8632  H HB2  . GLN A 1 107 ? -4.288  -9.832  -4.895  1.00 0.00 ? 107 GLN A HB2  5  
ATOM 8633  H HB3  . GLN A 1 107 ? -5.290  -9.914  -6.338  1.00 0.00 ? 107 GLN A HB3  5  
ATOM 8634  H HG2  . GLN A 1 107 ? -3.692  -8.268  -7.388  1.00 0.00 ? 107 GLN A HG2  5  
ATOM 8635  H HG3  . GLN A 1 107 ? -2.639  -8.548  -6.002  1.00 0.00 ? 107 GLN A HG3  5  
ATOM 8636  H HE21 . GLN A 1 107 ? -4.657  -10.722 -7.940  1.00 0.00 ? 107 GLN A HE21 5  
ATOM 8637  H HE22 . GLN A 1 107 ? -3.376  -11.790 -8.391  1.00 0.00 ? 107 GLN A HE22 5  
ATOM 8638  N N    . SER A 1 108 ? -7.420  -8.004  -3.998  1.00 0.00 ? 108 SER A N    5  
ATOM 8639  C CA   . SER A 1 108 ? -8.251  -8.228  -2.820  1.00 0.00 ? 108 SER A CA   5  
ATOM 8640  C C    . SER A 1 108 ? -8.527  -9.716  -2.627  1.00 0.00 ? 108 SER A C    5  
ATOM 8641  O O    . SER A 1 108 ? -9.019  -10.392 -3.532  1.00 0.00 ? 108 SER A O    5  
ATOM 8642  C CB   . SER A 1 108 ? -9.570  -7.465  -2.948  1.00 0.00 ? 108 SER A CB   5  
ATOM 8643  O OG   . SER A 1 108 ? -10.080 -7.113  -1.674  1.00 0.00 ? 108 SER A OG   5  
ATOM 8644  H H    . SER A 1 108 ? -7.820  -7.596  -4.795  1.00 0.00 ? 108 SER A H    5  
ATOM 8645  H HA   . SER A 1 108 ? -7.713  -7.859  -1.960  1.00 0.00 ? 108 SER A HA   5  
ATOM 8646  H HB2  . SER A 1 108 ? -9.408  -6.564  -3.519  1.00 0.00 ? 108 SER A HB2  5  
ATOM 8647  H HB3  . SER A 1 108 ? -10.295 -8.087  -3.454  1.00 0.00 ? 108 SER A HB3  5  
ATOM 8648  H HG   . SER A 1 108 ? -9.390  -6.690  -1.158  1.00 0.00 ? 108 SER A HG   5  
ATOM 8649  N N    . LEU A 1 109 ? -8.208  -10.221 -1.440  1.00 0.00 ? 109 LEU A N    5  
ATOM 8650  C CA   . LEU A 1 109 ? -8.421  -11.630 -1.125  1.00 0.00 ? 109 LEU A CA   5  
ATOM 8651  C C    . LEU A 1 109 ? -9.906  -11.976 -1.159  1.00 0.00 ? 109 LEU A C    5  
ATOM 8652  O O    . LEU A 1 109 ? -10.753 -11.103 -1.348  1.00 0.00 ? 109 LEU A O    5  
ATOM 8653  C CB   . LEU A 1 109 ? -7.840  -11.959 0.251   1.00 0.00 ? 109 LEU A CB   5  
ATOM 8654  C CG   . LEU A 1 109 ? -6.386  -12.430 0.270   1.00 0.00 ? 109 LEU A CG   5  
ATOM 8655  C CD1  . LEU A 1 109 ? -5.844  -12.432 1.691   1.00 0.00 ? 109 LEU A CD1  5  
ATOM 8656  C CD2  . LEU A 1 109 ? -6.266  -13.815 -0.349  1.00 0.00 ? 109 LEU A CD2  5  
ATOM 8657  H H    . LEU A 1 109 ? -7.819  -9.634  -0.759  1.00 0.00 ? 109 LEU A H    5  
ATOM 8658  H HA   . LEU A 1 109 ? -7.910  -12.217 -1.873  1.00 0.00 ? 109 LEU A HA   5  
ATOM 8659  H HB2  . LEU A 1 109 ? -7.907  -11.070 0.859   1.00 0.00 ? 109 LEU A HB2  5  
ATOM 8660  H HB3  . LEU A 1 109 ? -8.448  -12.738 0.688   1.00 0.00 ? 109 LEU A HB3  5  
ATOM 8661  H HG   . LEU A 1 109 ? -5.785  -11.748 -0.315  1.00 0.00 ? 109 LEU A HG   5  
ATOM 8662  H HD11 . LEU A 1 109 ? -4.982  -13.079 1.747   1.00 0.00 ? 109 LEU A HD11 5  
ATOM 8663  H HD12 . LEU A 1 109 ? -6.607  -12.788 2.367   1.00 0.00 ? 109 LEU A HD12 5  
ATOM 8664  H HD13 . LEU A 1 109 ? -5.559  -11.427 1.968   1.00 0.00 ? 109 LEU A HD13 5  
ATOM 8665  H HD21 . LEU A 1 109 ? -7.153  -14.388 -0.124  1.00 0.00 ? 109 LEU A HD21 5  
ATOM 8666  H HD22 . LEU A 1 109 ? -5.400  -14.317 0.057   1.00 0.00 ? 109 LEU A HD22 5  
ATOM 8667  H HD23 . LEU A 1 109 ? -6.159  -13.722 -1.421  1.00 0.00 ? 109 LEU A HD23 5  
ATOM 8668  N N    . SER A 1 110 ? -10.215 -13.255 -0.972  1.00 0.00 ? 110 SER A N    5  
ATOM 8669  C CA   . SER A 1 110 ? -11.598 -13.718 -0.983  1.00 0.00 ? 110 SER A CA   5  
ATOM 8670  C C    . SER A 1 110 ? -12.505 -12.735 -0.249  1.00 0.00 ? 110 SER A C    5  
ATOM 8671  O O    . SER A 1 110 ? -13.267 -11.994 -0.870  1.00 0.00 ? 110 SER A O    5  
ATOM 8672  C CB   . SER A 1 110 ? -11.700 -15.102 -0.339  1.00 0.00 ? 110 SER A CB   5  
ATOM 8673  O OG   . SER A 1 110 ? -13.052 -15.459 -0.110  1.00 0.00 ? 110 SER A OG   5  
ATOM 8674  H H    . SER A 1 110 ? -9.494  -13.904 -0.826  1.00 0.00 ? 110 SER A H    5  
ATOM 8675  H HA   . SER A 1 110 ? -11.917 -13.785 -2.012  1.00 0.00 ? 110 SER A HA   5  
ATOM 8676  H HB2  . SER A 1 110 ? -11.252 -15.834 -0.993  1.00 0.00 ? 110 SER A HB2  5  
ATOM 8677  H HB3  . SER A 1 110 ? -11.176 -15.095 0.606   1.00 0.00 ? 110 SER A HB3  5  
ATOM 8678  H HG   . SER A 1 110 ? -13.109 -16.010 0.674   1.00 0.00 ? 110 SER A HG   5  
ATOM 8679  N N    . SER A 1 111 ? -12.416 -12.734 1.077   1.00 0.00 ? 111 SER A N    5  
ATOM 8680  C CA   . SER A 1 111 ? -13.231 -11.846 1.897   1.00 0.00 ? 111 SER A CA   5  
ATOM 8681  C C    . SER A 1 111 ? -13.087 -10.398 1.437   1.00 0.00 ? 111 SER A C    5  
ATOM 8682  O O    . SER A 1 111 ? -12.227 -10.076 0.616   1.00 0.00 ? 111 SER A O    5  
ATOM 8683  C CB   . SER A 1 111 ? -12.832 -11.967 3.369   1.00 0.00 ? 111 SER A CB   5  
ATOM 8684  O OG   . SER A 1 111 ? -11.567 -11.373 3.605   1.00 0.00 ? 111 SER A OG   5  
ATOM 8685  H H    . SER A 1 111 ? -11.789 -13.348 1.514   1.00 0.00 ? 111 SER A H    5  
ATOM 8686  H HA   . SER A 1 111 ? -14.262 -12.145 1.787   1.00 0.00 ? 111 SER A HA   5  
ATOM 8687  H HB2  . SER A 1 111 ? -13.569 -11.470 3.982   1.00 0.00 ? 111 SER A HB2  5  
ATOM 8688  H HB3  . SER A 1 111 ? -12.782 -13.011 3.641   1.00 0.00 ? 111 SER A HB3  5  
ATOM 8689  H HG   . SER A 1 111 ? -11.680 -10.434 3.771   1.00 0.00 ? 111 SER A HG   5  
ATOM 8690  N N    . THR A 1 112 ? -13.937 -9.526  1.973   1.00 0.00 ? 112 THR A N    5  
ATOM 8691  C CA   . THR A 1 112 ? -13.907 -8.113  1.618   1.00 0.00 ? 112 THR A CA   5  
ATOM 8692  C C    . THR A 1 112 ? -14.594 -7.265  2.681   1.00 0.00 ? 112 THR A C    5  
ATOM 8693  O O    . THR A 1 112 ? -15.569 -7.681  3.308   1.00 0.00 ? 112 THR A O    5  
ATOM 8694  C CB   . THR A 1 112 ? -14.586 -7.861  0.258   1.00 0.00 ? 112 THR A CB   5  
ATOM 8695  O OG1  . THR A 1 112 ? -15.923 -8.373  0.276   1.00 0.00 ? 112 THR A OG1  5  
ATOM 8696  C CG2  . THR A 1 112 ? -13.802 -8.516  -0.868  1.00 0.00 ? 112 THR A CG2  5  
ATOM 8697  H H    . THR A 1 112 ? -14.599 -9.843  2.621   1.00 0.00 ? 112 THR A H    5  
ATOM 8698  H HA   . THR A 1 112 ? -12.873 -7.810  1.542   1.00 0.00 ? 112 THR A HA   5  
ATOM 8699  H HB   . THR A 1 112 ? -14.619 -6.795  0.082   1.00 0.00 ? 112 THR A HB   5  
ATOM 8700  H HG1  . THR A 1 112 ? -15.949 -9.182  0.794   1.00 0.00 ? 112 THR A HG1  5  
ATOM 8701  H HG21 . THR A 1 112 ? -14.071 -8.058  -1.808  1.00 0.00 ? 112 THR A HG21 5  
ATOM 8702  H HG22 . THR A 1 112 ? -14.034 -9.571  -0.903  1.00 0.00 ? 112 THR A HG22 5  
ATOM 8703  H HG23 . THR A 1 112 ? -12.744 -8.386  -0.693  1.00 0.00 ? 112 THR A HG23 5  
ATOM 8704  N N    . PRO A 1 113 ? -14.077 -6.045  2.891   1.00 0.00 ? 113 PRO A N    5  
ATOM 8705  C CA   . PRO A 1 113 ? -14.627 -5.111  3.879   1.00 0.00 ? 113 PRO A CA   5  
ATOM 8706  C C    . PRO A 1 113 ? -15.991 -4.569  3.467   1.00 0.00 ? 113 PRO A C    5  
ATOM 8707  O O    . PRO A 1 113 ? -16.627 -5.093  2.552   1.00 0.00 ? 113 PRO A O    5  
ATOM 8708  C CB   . PRO A 1 113 ? -13.592 -3.984  3.916   1.00 0.00 ? 113 PRO A CB   5  
ATOM 8709  C CG   . PRO A 1 113 ? -12.930 -4.034  2.582   1.00 0.00 ? 113 PRO A CG   5  
ATOM 8710  C CD   . PRO A 1 113 ? -12.916 -5.483  2.181   1.00 0.00 ? 113 PRO A CD   5  
ATOM 8711  H HA   . PRO A 1 113 ? -14.701 -5.566  4.856   1.00 0.00 ? 113 PRO A HA   5  
ATOM 8712  H HB2  . PRO A 1 113 ? -14.092 -3.038  4.074   1.00 0.00 ? 113 PRO A HB2  5  
ATOM 8713  H HB3  . PRO A 1 113 ? -12.887 -4.163  4.713   1.00 0.00 ? 113 PRO A HB3  5  
ATOM 8714  H HG2  . PRO A 1 113 ? -13.495 -3.453  1.869   1.00 0.00 ? 113 PRO A HG2  5  
ATOM 8715  H HG3  . PRO A 1 113 ? -11.920 -3.657  2.659   1.00 0.00 ? 113 PRO A HG3  5  
ATOM 8716  H HD2  . PRO A 1 113 ? -13.034 -5.580  1.112   1.00 0.00 ? 113 PRO A HD2  5  
ATOM 8717  H HD3  . PRO A 1 113 ? -12.001 -5.956  2.505   1.00 0.00 ? 113 PRO A HD3  5  
ATOM 8718  N N    . ARG A 1 114 ? -16.435 -3.518  4.148   1.00 0.00 ? 114 ARG A N    5  
ATOM 8719  C CA   . ARG A 1 114 ? -17.725 -2.905  3.854   1.00 0.00 ? 114 ARG A CA   5  
ATOM 8720  C C    . ARG A 1 114 ? -17.546 -1.473  3.359   1.00 0.00 ? 114 ARG A C    5  
ATOM 8721  O O    . ARG A 1 114 ? -16.469 -0.891  3.486   1.00 0.00 ? 114 ARG A O    5  
ATOM 8722  C CB   . ARG A 1 114 ? -18.616 -2.920  5.097   1.00 0.00 ? 114 ARG A CB   5  
ATOM 8723  C CG   . ARG A 1 114 ? -19.626 -1.784  5.135   1.00 0.00 ? 114 ARG A CG   5  
ATOM 8724  C CD   . ARG A 1 114 ? -20.376 -1.750  6.457   1.00 0.00 ? 114 ARG A CD   5  
ATOM 8725  N NE   . ARG A 1 114 ? -20.650 -3.091  6.966   1.00 0.00 ? 114 ARG A NE   5  
ATOM 8726  C CZ   . ARG A 1 114 ? -21.505 -3.933  6.395   1.00 0.00 ? 114 ARG A CZ   5  
ATOM 8727  N NH1  . ARG A 1 114 ? -22.164 -3.574  5.302   1.00 0.00 ? 114 ARG A NH1  5  
ATOM 8728  N NH2  . ARG A 1 114 ? -21.701 -5.137  6.917   1.00 0.00 ? 114 ARG A NH2  5  
ATOM 8729  H H    . ARG A 1 114 ? -15.882 -3.145  4.867   1.00 0.00 ? 114 ARG A H    5  
ATOM 8730  H HA   . ARG A 1 114 ? -18.198 -3.486  3.076   1.00 0.00 ? 114 ARG A HA   5  
ATOM 8731  H HB2  . ARG A 1 114 ? -19.157 -3.854  5.127   1.00 0.00 ? 114 ARG A HB2  5  
ATOM 8732  H HB3  . ARG A 1 114 ? -17.991 -2.846  5.974   1.00 0.00 ? 114 ARG A HB3  5  
ATOM 8733  H HG2  . ARG A 1 114 ? -19.105 -0.847  5.005   1.00 0.00 ? 114 ARG A HG2  5  
ATOM 8734  H HG3  . ARG A 1 114 ? -20.335 -1.919  4.332   1.00 0.00 ? 114 ARG A HG3  5  
ATOM 8735  H HD2  . ARG A 1 114 ? -19.778 -1.217  7.181   1.00 0.00 ? 114 ARG A HD2  5  
ATOM 8736  H HD3  . ARG A 1 114 ? -21.312 -1.231  6.312   1.00 0.00 ? 114 ARG A HD3  5  
ATOM 8737  H HE   . ARG A 1 114 ? -20.174 -3.377  7.773   1.00 0.00 ? 114 ARG A HE   5  
ATOM 8738  H HH11 . ARG A 1 114 ? -22.018 -2.667  4.906   1.00 0.00 ? 114 ARG A HH11 5  
ATOM 8739  H HH12 . ARG A 1 114 ? -22.807 -4.210  4.874   1.00 0.00 ? 114 ARG A HH12 5  
ATOM 8740  H HH21 . ARG A 1 114 ? -21.206 -5.411  7.741   1.00 0.00 ? 114 ARG A HH21 5  
ATOM 8741  H HH22 . ARG A 1 114 ? -22.345 -5.769  6.487   1.00 0.00 ? 114 ARG A HH22 5  
ATOM 8742  N N    . VAL A 1 115 ? -18.609 -0.911  2.793   1.00 0.00 ? 115 VAL A N    5  
ATOM 8743  C CA   . VAL A 1 115 ? -18.571 0.453   2.280   1.00 0.00 ? 115 VAL A CA   5  
ATOM 8744  C C    . VAL A 1 115 ? -19.700 1.293   2.865   1.00 0.00 ? 115 VAL A C    5  
ATOM 8745  O O    . VAL A 1 115 ? -20.715 0.760   3.314   1.00 0.00 ? 115 VAL A O    5  
ATOM 8746  C CB   . VAL A 1 115 ? -18.671 0.478   0.743   1.00 0.00 ? 115 VAL A CB   5  
ATOM 8747  C CG1  . VAL A 1 115 ? -20.040 -0.005  0.289   1.00 0.00 ? 115 VAL A CG1  5  
ATOM 8748  C CG2  . VAL A 1 115 ? -18.387 1.875   0.213   1.00 0.00 ? 115 VAL A CG2  5  
ATOM 8749  H H    . VAL A 1 115 ? -19.440 -1.426  2.720   1.00 0.00 ? 115 VAL A H    5  
ATOM 8750  H HA   . VAL A 1 115 ? -17.625 0.891   2.565   1.00 0.00 ? 115 VAL A HA   5  
ATOM 8751  H HB   . VAL A 1 115 ? -17.926 -0.195  0.343   1.00 0.00 ? 115 VAL A HB   5  
ATOM 8752  H HG11 . VAL A 1 115 ? -20.764 0.179   1.070   1.00 0.00 ? 115 VAL A HG11 5  
ATOM 8753  H HG12 . VAL A 1 115 ? -20.331 0.525   -0.605  1.00 0.00 ? 115 VAL A HG12 5  
ATOM 8754  H HG13 . VAL A 1 115 ? -19.998 -1.065  0.082   1.00 0.00 ? 115 VAL A HG13 5  
ATOM 8755  H HG21 . VAL A 1 115 ? -18.213 1.828   -0.852  1.00 0.00 ? 115 VAL A HG21 5  
ATOM 8756  H HG22 . VAL A 1 115 ? -19.234 2.514   0.412   1.00 0.00 ? 115 VAL A HG22 5  
ATOM 8757  H HG23 . VAL A 1 115 ? -17.511 2.275   0.703   1.00 0.00 ? 115 VAL A HG23 5  
ATOM 8758  N N    . ILE A 1 116 ? -19.517 2.609   2.857   1.00 0.00 ? 116 ILE A N    5  
ATOM 8759  C CA   . ILE A 1 116 ? -20.522 3.523   3.386   1.00 0.00 ? 116 ILE A CA   5  
ATOM 8760  C C    . ILE A 1 116 ? -21.651 3.738   2.384   1.00 0.00 ? 116 ILE A C    5  
ATOM 8761  O O    . ILE A 1 116 ? -21.485 3.563   1.177   1.00 0.00 ? 116 ILE A O    5  
ATOM 8762  C CB   . ILE A 1 116 ? -19.906 4.887   3.749   1.00 0.00 ? 116 ILE A CB   5  
ATOM 8763  C CG1  . ILE A 1 116 ? -18.900 5.318   2.680   1.00 0.00 ? 116 ILE A CG1  5  
ATOM 8764  C CG2  . ILE A 1 116 ? -19.240 4.822   5.115   1.00 0.00 ? 116 ILE A CG2  5  
ATOM 8765  C CD1  . ILE A 1 116 ? -18.797 6.818   2.516   1.00 0.00 ? 116 ILE A CD1  5  
ATOM 8766  H H    . ILE A 1 116 ? -18.687 2.974   2.486   1.00 0.00 ? 116 ILE A H    5  
ATOM 8767  H HA   . ILE A 1 116 ? -20.931 3.085   4.285   1.00 0.00 ? 116 ILE A HA   5  
ATOM 8768  H HB   . ILE A 1 116 ? -20.702 5.615   3.797   1.00 0.00 ? 116 ILE A HB   5  
ATOM 8769  H HG12 . ILE A 1 116 ? -17.923 4.946   2.943   1.00 0.00 ? 116 ILE A HG12 5  
ATOM 8770  H HG13 . ILE A 1 116 ? -19.195 4.899   1.728   1.00 0.00 ? 116 ILE A HG13 5  
ATOM 8771  H HG21 . ILE A 1 116 ? -19.691 4.032   5.697   1.00 0.00 ? 116 ILE A HG21 5  
ATOM 8772  H HG22 . ILE A 1 116 ? -18.187 4.620   4.992   1.00 0.00 ? 116 ILE A HG22 5  
ATOM 8773  H HG23 . ILE A 1 116 ? -19.370 5.764   5.625   1.00 0.00 ? 116 ILE A HG23 5  
ATOM 8774  H HD11 . ILE A 1 116 ? -17.839 7.068   2.083   1.00 0.00 ? 116 ILE A HD11 5  
ATOM 8775  H HD12 . ILE A 1 116 ? -19.586 7.164   1.864   1.00 0.00 ? 116 ILE A HD12 5  
ATOM 8776  H HD13 . ILE A 1 116 ? -18.891 7.294   3.480   1.00 0.00 ? 116 ILE A HD13 5  
ATOM 8777  N N    . PRO A 1 117 ? -22.829 4.127   2.895   1.00 0.00 ? 117 PRO A N    5  
ATOM 8778  C CA   . PRO A 1 117 ? -24.009 4.377   2.062   1.00 0.00 ? 117 PRO A CA   5  
ATOM 8779  C C    . PRO A 1 117 ? -23.858 5.626   1.202   1.00 0.00 ? 117 PRO A C    5  
ATOM 8780  O O    . PRO A 1 117 ? -22.764 5.939   0.731   1.00 0.00 ? 117 PRO A O    5  
ATOM 8781  C CB   . PRO A 1 117 ? -25.132 4.565   3.085   1.00 0.00 ? 117 PRO A CB   5  
ATOM 8782  C CG   . PRO A 1 117 ? -24.443 5.027   4.323   1.00 0.00 ? 117 PRO A CG   5  
ATOM 8783  C CD   . PRO A 1 117 ? -23.099 4.354   4.325   1.00 0.00 ? 117 PRO A CD   5  
ATOM 8784  H HA   . PRO A 1 117 ? -24.234 3.531   1.429   1.00 0.00 ? 117 PRO A HA   5  
ATOM 8785  H HB2  . PRO A 1 117 ? -25.833 5.303   2.723   1.00 0.00 ? 117 PRO A HB2  5  
ATOM 8786  H HB3  . PRO A 1 117 ? -25.640 3.625   3.244   1.00 0.00 ? 117 PRO A HB3  5  
ATOM 8787  H HG2  . PRO A 1 117 ? -24.326 6.100   4.298   1.00 0.00 ? 117 PRO A HG2  5  
ATOM 8788  H HG3  . PRO A 1 117 ? -25.012 4.730   5.192   1.00 0.00 ? 117 PRO A HG3  5  
ATOM 8789  H HD2  . PRO A 1 117 ? -22.353 5.003   4.759   1.00 0.00 ? 117 PRO A HD2  5  
ATOM 8790  H HD3  . PRO A 1 117 ? -23.146 3.418   4.861   1.00 0.00 ? 117 PRO A HD3  5  
ATOM 8791  N N    . GLY A 1 1   ? 17.002  -32.622 12.243  1.00 0.00 ? 1   GLY A N    6  
ATOM 8792  C CA   . GLY A 1 1   ? 17.986  -31.564 12.372  1.00 0.00 ? 1   GLY A CA   6  
ATOM 8793  C C    . GLY A 1 1   ? 17.831  -30.495 11.308  1.00 0.00 ? 1   GLY A C    6  
ATOM 8794  O O    . GLY A 1 1   ? 17.827  -29.302 11.612  1.00 0.00 ? 1   GLY A O    6  
ATOM 8795  H H1   . GLY A 1 1   ? 16.104  -32.416 11.907  1.00 0.00 ? 1   GLY A H1   6  
ATOM 8796  H HA2  . GLY A 1 1   ? 17.881  -31.106 13.345  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 8797  H HA3  . GLY A 1 1   ? 18.974  -31.994 12.292  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 8798  N N    . SER A 1 2   ? 17.705  -30.923 10.056  1.00 0.00 ? 2   SER A N    6  
ATOM 8799  C CA   . SER A 1 2   ? 17.555  -29.994 8.942   1.00 0.00 ? 2   SER A CA   6  
ATOM 8800  C C    . SER A 1 2   ? 16.341  -30.357 8.092   1.00 0.00 ? 2   SER A C    6  
ATOM 8801  O O    . SER A 1 2   ? 16.457  -30.573 6.886   1.00 0.00 ? 2   SER A O    6  
ATOM 8802  C CB   . SER A 1 2   ? 18.817  -29.994 8.076   1.00 0.00 ? 2   SER A CB   6  
ATOM 8803  O OG   . SER A 1 2   ? 19.983  -29.890 8.875   1.00 0.00 ? 2   SER A OG   6  
ATOM 8804  H H    . SER A 1 2   ? 17.716  -31.887 9.877   1.00 0.00 ? 2   SER A H    6  
ATOM 8805  H HA   . SER A 1 2   ? 17.411  -29.006 9.352   1.00 0.00 ? 2   SER A HA   6  
ATOM 8806  H HB2  . SER A 1 2   ? 18.863  -30.913 7.512   1.00 0.00 ? 2   SER A HB2  6  
ATOM 8807  H HB3  . SER A 1 2   ? 18.783  -29.155 7.396   1.00 0.00 ? 2   SER A HB3  6  
ATOM 8808  H HG   . SER A 1 2   ? 19.870  -30.405 9.677   1.00 0.00 ? 2   SER A HG   6  
ATOM 8809  N N    . SER A 1 3   ? 15.177  -30.421 8.731   1.00 0.00 ? 3   SER A N    6  
ATOM 8810  C CA   . SER A 1 3   ? 13.942  -30.761 8.035   1.00 0.00 ? 3   SER A CA   6  
ATOM 8811  C C    . SER A 1 3   ? 13.215  -29.502 7.572   1.00 0.00 ? 3   SER A C    6  
ATOM 8812  O O    . SER A 1 3   ? 13.246  -28.471 8.243   1.00 0.00 ? 3   SER A O    6  
ATOM 8813  C CB   . SER A 1 3   ? 13.029  -31.585 8.946   1.00 0.00 ? 3   SER A CB   6  
ATOM 8814  O OG   . SER A 1 3   ? 11.989  -32.199 8.205   1.00 0.00 ? 3   SER A OG   6  
ATOM 8815  H H    . SER A 1 3   ? 15.150  -30.237 9.693   1.00 0.00 ? 3   SER A H    6  
ATOM 8816  H HA   . SER A 1 3   ? 14.200  -31.352 7.169   1.00 0.00 ? 3   SER A HA   6  
ATOM 8817  H HB2  . SER A 1 3   ? 13.610  -32.353 9.433   1.00 0.00 ? 3   SER A HB2  6  
ATOM 8818  H HB3  . SER A 1 3   ? 12.590  -30.938 9.691   1.00 0.00 ? 3   SER A HB3  6  
ATOM 8819  H HG   . SER A 1 3   ? 11.289  -32.473 8.802   1.00 0.00 ? 3   SER A HG   6  
ATOM 8820  N N    . GLY A 1 4   ? 12.559  -29.594 6.419   1.00 0.00 ? 4   GLY A N    6  
ATOM 8821  C CA   . GLY A 1 4   ? 11.833  -28.457 5.885   1.00 0.00 ? 4   GLY A CA   6  
ATOM 8822  C C    . GLY A 1 4   ? 10.749  -28.868 4.909   1.00 0.00 ? 4   GLY A C    6  
ATOM 8823  O O    . GLY A 1 4   ? 10.802  -29.954 4.333   1.00 0.00 ? 4   GLY A O    6  
ATOM 8824  H H    . GLY A 1 4   ? 12.569  -30.442 5.927   1.00 0.00 ? 4   GLY A H    6  
ATOM 8825  H HA2  . GLY A 1 4   ? 11.381  -27.916 6.703   1.00 0.00 ? 4   GLY A HA2  6  
ATOM 8826  H HA3  . GLY A 1 4   ? 12.530  -27.806 5.378   1.00 0.00 ? 4   GLY A HA3  6  
ATOM 8827  N N    . SER A 1 5   ? 9.761   -27.998 4.724   1.00 0.00 ? 5   SER A N    6  
ATOM 8828  C CA   . SER A 1 5   ? 8.656   -28.278 3.815   1.00 0.00 ? 5   SER A CA   6  
ATOM 8829  C C    . SER A 1 5   ? 8.505   -27.164 2.783   1.00 0.00 ? 5   SER A C    6  
ATOM 8830  O O    . SER A 1 5   ? 8.303   -27.425 1.597   1.00 0.00 ? 5   SER A O    6  
ATOM 8831  C CB   . SER A 1 5   ? 7.352   -28.443 4.599   1.00 0.00 ? 5   SER A CB   6  
ATOM 8832  O OG   . SER A 1 5   ? 6.445   -29.284 3.908   1.00 0.00 ? 5   SER A OG   6  
ATOM 8833  H H    . SER A 1 5   ? 9.775   -27.148 5.213   1.00 0.00 ? 5   SER A H    6  
ATOM 8834  H HA   . SER A 1 5   ? 8.876   -29.202 3.301   1.00 0.00 ? 5   SER A HA   6  
ATOM 8835  H HB2  . SER A 1 5   ? 7.567   -28.880 5.562   1.00 0.00 ? 5   SER A HB2  6  
ATOM 8836  H HB3  . SER A 1 5   ? 6.894   -27.475 4.737   1.00 0.00 ? 5   SER A HB3  6  
ATOM 8837  H HG   . SER A 1 5   ? 5.545   -29.039 4.134   1.00 0.00 ? 5   SER A HG   6  
ATOM 8838  N N    . SER A 1 6   ? 8.604   -25.922 3.245   1.00 0.00 ? 6   SER A N    6  
ATOM 8839  C CA   . SER A 1 6   ? 8.474   -24.767 2.364   1.00 0.00 ? 6   SER A CA   6  
ATOM 8840  C C    . SER A 1 6   ? 7.331   -24.964 1.373   1.00 0.00 ? 6   SER A C    6  
ATOM 8841  O O    . SER A 1 6   ? 7.363   -24.442 0.260   1.00 0.00 ? 6   SER A O    6  
ATOM 8842  C CB   . SER A 1 6   ? 9.783   -24.526 1.609   1.00 0.00 ? 6   SER A CB   6  
ATOM 8843  O OG   . SER A 1 6   ? 10.358  -25.748 1.183   1.00 0.00 ? 6   SER A OG   6  
ATOM 8844  H H    . SER A 1 6   ? 8.765   -25.779 4.201   1.00 0.00 ? 6   SER A H    6  
ATOM 8845  H HA   . SER A 1 6   ? 8.259   -23.905 2.978   1.00 0.00 ? 6   SER A HA   6  
ATOM 8846  H HB2  . SER A 1 6   ? 9.588   -23.912 0.743   1.00 0.00 ? 6   SER A HB2  6  
ATOM 8847  H HB3  . SER A 1 6   ? 10.482  -24.019 2.259   1.00 0.00 ? 6   SER A HB3  6  
ATOM 8848  H HG   . SER A 1 6   ? 11.184  -25.572 0.725   1.00 0.00 ? 6   SER A HG   6  
ATOM 8849  N N    . GLY A 1 7   ? 6.321   -25.724 1.788   1.00 0.00 ? 7   GLY A N    6  
ATOM 8850  C CA   . GLY A 1 7   ? 5.182   -25.978 0.926   1.00 0.00 ? 7   GLY A CA   6  
ATOM 8851  C C    . GLY A 1 7   ? 4.492   -24.702 0.485   1.00 0.00 ? 7   GLY A C    6  
ATOM 8852  O O    . GLY A 1 7   ? 4.855   -23.600 0.899   1.00 0.00 ? 7   GLY A O    6  
ATOM 8853  H H    . GLY A 1 7   ? 6.350   -26.114 2.687   1.00 0.00 ? 7   GLY A H    6  
ATOM 8854  H HA2  . GLY A 1 7   ? 5.519   -26.514 0.051   1.00 0.00 ? 7   GLY A HA2  6  
ATOM 8855  H HA3  . GLY A 1 7   ? 4.471   -26.591 1.460   1.00 0.00 ? 7   GLY A HA3  6  
ATOM 8856  N N    . PRO A 1 8   ? 3.474   -24.843 -0.376  1.00 0.00 ? 8   PRO A N    6  
ATOM 8857  C CA   . PRO A 1 8   ? 2.712   -23.702 -0.894  1.00 0.00 ? 8   PRO A CA   6  
ATOM 8858  C C    . PRO A 1 8   ? 1.844   -23.051 0.178   1.00 0.00 ? 8   PRO A C    6  
ATOM 8859  O O    . PRO A 1 8   ? 2.032   -23.287 1.371   1.00 0.00 ? 8   PRO A O    6  
ATOM 8860  C CB   . PRO A 1 8   ? 1.837   -24.326 -1.984  1.00 0.00 ? 8   PRO A CB   6  
ATOM 8861  C CG   . PRO A 1 8   ? 1.696   -25.755 -1.586  1.00 0.00 ? 8   PRO A CG   6  
ATOM 8862  C CD   . PRO A 1 8   ? 2.988   -26.125 -0.911  1.00 0.00 ? 8   PRO A CD   6  
ATOM 8863  H HA   . PRO A 1 8   ? 3.360   -22.958 -1.332  1.00 0.00 ? 8   PRO A HA   6  
ATOM 8864  H HB2  . PRO A 1 8   ? 0.879   -23.826 -2.010  1.00 0.00 ? 8   PRO A HB2  6  
ATOM 8865  H HB3  . PRO A 1 8   ? 2.325   -24.229 -2.942  1.00 0.00 ? 8   PRO A HB3  6  
ATOM 8866  H HG2  . PRO A 1 8   ? 0.870   -25.865 -0.901  1.00 0.00 ? 8   PRO A HG2  6  
ATOM 8867  H HG3  . PRO A 1 8   ? 1.543   -26.366 -2.463  1.00 0.00 ? 8   PRO A HG3  6  
ATOM 8868  H HD2  . PRO A 1 8   ? 2.808   -26.832 -0.115  1.00 0.00 ? 8   PRO A HD2  6  
ATOM 8869  H HD3  . PRO A 1 8   ? 3.685   -26.532 -1.629  1.00 0.00 ? 8   PRO A HD3  6  
ATOM 8870  N N    . ASN A 1 9   ? 0.893   -22.230 -0.255  1.00 0.00 ? 9   ASN A N    6  
ATOM 8871  C CA   . ASN A 1 9   ? -0.004  -21.545 0.668   1.00 0.00 ? 9   ASN A CA   6  
ATOM 8872  C C    . ASN A 1 9   ? -1.439  -22.036 0.499   1.00 0.00 ? 9   ASN A C    6  
ATOM 8873  O O    . ASN A 1 9   ? -1.701  -22.968 -0.262  1.00 0.00 ? 9   ASN A O    6  
ATOM 8874  C CB   . ASN A 1 9   ? 0.058   -20.032 0.444   1.00 0.00 ? 9   ASN A CB   6  
ATOM 8875  C CG   . ASN A 1 9   ? 1.234   -19.391 1.155   1.00 0.00 ? 9   ASN A CG   6  
ATOM 8876  O OD1  . ASN A 1 9   ? 1.097   -18.880 2.267   1.00 0.00 ? 9   ASN A OD1  6  
ATOM 8877  N ND2  . ASN A 1 9   ? 2.397   -19.414 0.515   1.00 0.00 ? 9   ASN A ND2  6  
ATOM 8878  H H    . ASN A 1 9   ? 0.791   -22.082 -1.219  1.00 0.00 ? 9   ASN A H    6  
ATOM 8879  H HA   . ASN A 1 9   ? 0.323   -21.765 1.673   1.00 0.00 ? 9   ASN A HA   6  
ATOM 8880  H HB2  . ASN A 1 9   ? 0.152   -19.835 -0.614  1.00 0.00 ? 9   ASN A HB2  6  
ATOM 8881  H HB3  . ASN A 1 9   ? -0.852  -19.582 0.811   1.00 0.00 ? 9   ASN A HB3  6  
ATOM 8882  H HD21 . ASN A 1 9   ? 2.431   -19.838 -0.368  1.00 0.00 ? 9   ASN A HD21 6  
ATOM 8883  H HD22 . ASN A 1 9   ? 3.174   -19.007 0.952   1.00 0.00 ? 9   ASN A HD22 6  
ATOM 8884  N N    . PHE A 1 10  ? -2.363  -21.403 1.212   1.00 0.00 ? 10  PHE A N    6  
ATOM 8885  C CA   . PHE A 1 10  ? -3.772  -21.775 1.142   1.00 0.00 ? 10  PHE A CA   6  
ATOM 8886  C C    . PHE A 1 10  ? -4.620  -20.606 0.650   1.00 0.00 ? 10  PHE A C    6  
ATOM 8887  O O    . PHE A 1 10  ? -5.556  -20.789 -0.128  1.00 0.00 ? 10  PHE A O    6  
ATOM 8888  C CB   . PHE A 1 10  ? -4.268  -22.238 2.513   1.00 0.00 ? 10  PHE A CB   6  
ATOM 8889  C CG   . PHE A 1 10  ? -5.702  -22.685 2.513   1.00 0.00 ? 10  PHE A CG   6  
ATOM 8890  C CD1  . PHE A 1 10  ? -6.097  -23.788 1.774   1.00 0.00 ? 10  PHE A CD1  6  
ATOM 8891  C CD2  . PHE A 1 10  ? -6.654  -22.001 3.251   1.00 0.00 ? 10  PHE A CD2  6  
ATOM 8892  C CE1  . PHE A 1 10  ? -7.416  -24.200 1.771   1.00 0.00 ? 10  PHE A CE1  6  
ATOM 8893  C CE2  . PHE A 1 10  ? -7.975  -22.409 3.253   1.00 0.00 ? 10  PHE A CE2  6  
ATOM 8894  C CZ   . PHE A 1 10  ? -8.356  -23.511 2.512   1.00 0.00 ? 10  PHE A CZ   6  
ATOM 8895  H H    . PHE A 1 10  ? -2.092  -20.668 1.801   1.00 0.00 ? 10  PHE A H    6  
ATOM 8896  H HA   . PHE A 1 10  ? -3.863  -22.591 0.441   1.00 0.00 ? 10  PHE A HA   6  
ATOM 8897  H HB2  . PHE A 1 10  ? -3.663  -23.068 2.846   1.00 0.00 ? 10  PHE A HB2  6  
ATOM 8898  H HB3  . PHE A 1 10  ? -4.172  -21.424 3.216   1.00 0.00 ? 10  PHE A HB3  6  
ATOM 8899  H HD1  . PHE A 1 10  ? -5.364  -24.329 1.195   1.00 0.00 ? 10  PHE A HD1  6  
ATOM 8900  H HD2  . PHE A 1 10  ? -6.357  -21.139 3.832   1.00 0.00 ? 10  PHE A HD2  6  
ATOM 8901  H HE1  . PHE A 1 10  ? -7.712  -25.062 1.191   1.00 0.00 ? 10  PHE A HE1  6  
ATOM 8902  H HE2  . PHE A 1 10  ? -8.707  -21.868 3.833   1.00 0.00 ? 10  PHE A HE2  6  
ATOM 8903  H HZ   . PHE A 1 10  ? -9.387  -23.831 2.511   1.00 0.00 ? 10  PHE A HZ   6  
ATOM 8904  N N    . SER A 1 11  ? -4.284  -19.405 1.109   1.00 0.00 ? 11  SER A N    6  
ATOM 8905  C CA   . SER A 1 11  ? -5.016  -18.206 0.720   1.00 0.00 ? 11  SER A CA   6  
ATOM 8906  C C    . SER A 1 11  ? -5.502  -18.310 -0.723  1.00 0.00 ? 11  SER A C    6  
ATOM 8907  O O    . SER A 1 11  ? -4.851  -18.928 -1.566  1.00 0.00 ? 11  SER A O    6  
ATOM 8908  C CB   . SER A 1 11  ? -4.134  -16.967 0.885   1.00 0.00 ? 11  SER A CB   6  
ATOM 8909  O OG   . SER A 1 11  ? -2.896  -17.130 0.213   1.00 0.00 ? 11  SER A OG   6  
ATOM 8910  H H    . SER A 1 11  ? -3.527  -19.324 1.727   1.00 0.00 ? 11  SER A H    6  
ATOM 8911  H HA   . SER A 1 11  ? -5.874  -18.115 1.370   1.00 0.00 ? 11  SER A HA   6  
ATOM 8912  H HB2  . SER A 1 11  ? -4.642  -16.108 0.474   1.00 0.00 ? 11  SER A HB2  6  
ATOM 8913  H HB3  . SER A 1 11  ? -3.941  -16.803 1.935   1.00 0.00 ? 11  SER A HB3  6  
ATOM 8914  H HG   . SER A 1 11  ? -2.251  -16.520 0.579   1.00 0.00 ? 11  SER A HG   6  
ATOM 8915  N N    . HIS A 1 12  ? -6.650  -17.701 -1.000  1.00 0.00 ? 12  HIS A N    6  
ATOM 8916  C CA   . HIS A 1 12  ? -7.224  -17.724 -2.341  1.00 0.00 ? 12  HIS A CA   6  
ATOM 8917  C C    . HIS A 1 12  ? -7.349  -16.311 -2.902  1.00 0.00 ? 12  HIS A C    6  
ATOM 8918  O O    . HIS A 1 12  ? -8.453  -15.788 -3.054  1.00 0.00 ? 12  HIS A O    6  
ATOM 8919  C CB   . HIS A 1 12  ? -8.595  -18.400 -2.320  1.00 0.00 ? 12  HIS A CB   6  
ATOM 8920  C CG   . HIS A 1 12  ? -8.978  -19.018 -3.629  1.00 0.00 ? 12  HIS A CG   6  
ATOM 8921  N ND1  . HIS A 1 12  ? -9.105  -18.293 -4.795  1.00 0.00 ? 12  HIS A ND1  6  
ATOM 8922  C CD2  . HIS A 1 12  ? -9.260  -20.301 -3.953  1.00 0.00 ? 12  HIS A CD2  6  
ATOM 8923  C CE1  . HIS A 1 12  ? -9.451  -19.104 -5.779  1.00 0.00 ? 12  HIS A CE1  6  
ATOM 8924  N NE2  . HIS A 1 12  ? -9.551  -20.328 -5.295  1.00 0.00 ? 12  HIS A NE2  6  
ATOM 8925  H H    . HIS A 1 12  ? -7.123  -17.224 -0.286  1.00 0.00 ? 12  HIS A H    6  
ATOM 8926  H HA   . HIS A 1 12  ? -6.562  -18.293 -2.975  1.00 0.00 ? 12  HIS A HA   6  
ATOM 8927  H HB2  . HIS A 1 12  ? -8.594  -19.180 -1.573  1.00 0.00 ? 12  HIS A HB2  6  
ATOM 8928  H HB3  . HIS A 1 12  ? -9.347  -17.666 -2.066  1.00 0.00 ? 12  HIS A HB3  6  
ATOM 8929  H HD1  . HIS A 1 12  ? -8.965  -17.328 -4.887  1.00 0.00 ? 12  HIS A HD1  6  
ATOM 8930  H HD2  . HIS A 1 12  ? -9.258  -21.148 -3.281  1.00 0.00 ? 12  HIS A HD2  6  
ATOM 8931  H HE1  . HIS A 1 12  ? -9.622  -18.815 -6.806  1.00 0.00 ? 12  HIS A HE1  6  
ATOM 8932  N N    . TRP A 1 13  ? -6.210  -15.699 -3.208  1.00 0.00 ? 13  TRP A N    6  
ATOM 8933  C CA   . TRP A 1 13  ? -6.193  -14.346 -3.752  1.00 0.00 ? 13  TRP A CA   6  
ATOM 8934  C C    . TRP A 1 13  ? -6.644  -14.339 -5.209  1.00 0.00 ? 13  TRP A C    6  
ATOM 8935  O O    . TRP A 1 13  ? -6.099  -15.064 -6.040  1.00 0.00 ? 13  TRP A O    6  
ATOM 8936  C CB   . TRP A 1 13  ? -4.791  -13.746 -3.637  1.00 0.00 ? 13  TRP A CB   6  
ATOM 8937  C CG   . TRP A 1 13  ? -4.289  -13.676 -2.226  1.00 0.00 ? 13  TRP A CG   6  
ATOM 8938  C CD1  . TRP A 1 13  ? -3.948  -14.727 -1.425  1.00 0.00 ? 13  TRP A CD1  6  
ATOM 8939  C CD2  . TRP A 1 13  ? -4.074  -12.491 -1.451  1.00 0.00 ? 13  TRP A CD2  6  
ATOM 8940  N NE1  . TRP A 1 13  ? -3.534  -14.268 -0.197  1.00 0.00 ? 13  TRP A NE1  6  
ATOM 8941  C CE2  . TRP A 1 13  ? -3.601  -12.900 -0.189  1.00 0.00 ? 13  TRP A CE2  6  
ATOM 8942  C CE3  . TRP A 1 13  ? -4.232  -11.126 -1.701  1.00 0.00 ? 13  TRP A CE3  6  
ATOM 8943  C CZ2  . TRP A 1 13  ? -3.287  -11.991 0.818   1.00 0.00 ? 13  TRP A CZ2  6  
ATOM 8944  C CZ3  . TRP A 1 13  ? -3.921  -10.225 -0.700  1.00 0.00 ? 13  TRP A CZ3  6  
ATOM 8945  C CH2  . TRP A 1 13  ? -3.452  -10.660 0.546   1.00 0.00 ? 13  TRP A CH2  6  
ATOM 8946  H H    . TRP A 1 13  ? -5.361  -16.167 -3.065  1.00 0.00 ? 13  TRP A H    6  
ATOM 8947  H HA   . TRP A 1 13  ? -6.880  -13.747 -3.172  1.00 0.00 ? 13  TRP A HA   6  
ATOM 8948  H HB2  . TRP A 1 13  ? -4.100  -14.348 -4.207  1.00 0.00 ? 13  TRP A HB2  6  
ATOM 8949  H HB3  . TRP A 1 13  ? -4.802  -12.742 -4.037  1.00 0.00 ? 13  TRP A HB3  6  
ATOM 8950  H HD1  . TRP A 1 13  ? -4.003  -15.763 -1.724  1.00 0.00 ? 13  TRP A HD1  6  
ATOM 8951  H HE1  . TRP A 1 13  ? -3.237  -14.830 0.549   1.00 0.00 ? 13  TRP A HE1  6  
ATOM 8952  H HE3  . TRP A 1 13  ? -4.592  -10.771 -2.656  1.00 0.00 ? 13  TRP A HE3  6  
ATOM 8953  H HZ2  . TRP A 1 13  ? -2.925  -12.311 1.784   1.00 0.00 ? 13  TRP A HZ2  6  
ATOM 8954  H HZ3  . TRP A 1 13  ? -4.037  -9.165  -0.875  1.00 0.00 ? 13  TRP A HZ3  6  
ATOM 8955  H HH2  . TRP A 1 13  ? -3.222  -9.922  1.298   1.00 0.00 ? 13  TRP A HH2  6  
ATOM 8956  N N    . GLY A 1 14  ? -7.642  -13.514 -5.511  1.00 0.00 ? 14  GLY A N    6  
ATOM 8957  C CA   . GLY A 1 14  ? -8.148  -13.429 -6.869  1.00 0.00 ? 14  GLY A CA   6  
ATOM 8958  C C    . GLY A 1 14  ? -7.296  -12.539 -7.751  1.00 0.00 ? 14  GLY A C    6  
ATOM 8959  O O    . GLY A 1 14  ? -6.151  -12.220 -7.427  1.00 0.00 ? 14  GLY A O    6  
ATOM 8960  H H    . GLY A 1 14  ? -8.038  -12.959 -4.807  1.00 0.00 ? 14  GLY A H    6  
ATOM 8961  H HA2  . GLY A 1 14  ? -8.175  -14.421 -7.294  1.00 0.00 ? 14  GLY A HA2  6  
ATOM 8962  H HA3  . GLY A 1 14  ? -9.153  -13.033 -6.842  1.00 0.00 ? 14  GLY A HA3  6  
ATOM 8963  N N    . PRO A 1 15  ? -7.856  -12.124 -8.897  1.00 0.00 ? 15  PRO A N    6  
ATOM 8964  C CA   . PRO A 1 15  ? -7.156  -11.260 -9.853  1.00 0.00 ? 15  PRO A CA   6  
ATOM 8965  C C    . PRO A 1 15  ? -6.961  -9.845  -9.321  1.00 0.00 ? 15  PRO A C    6  
ATOM 8966  O O    . PRO A 1 15  ? -7.774  -9.327  -8.554  1.00 0.00 ? 15  PRO A O    6  
ATOM 8967  C CB   . PRO A 1 15  ? -8.085  -11.251 -11.069 1.00 0.00 ? 15  PRO A CB   6  
ATOM 8968  C CG   . PRO A 1 15  ? -9.437  -11.544 -10.515 1.00 0.00 ? 15  PRO A CG   6  
ATOM 8969  C CD   . PRO A 1 15  ? -9.216  -12.465 -9.347  1.00 0.00 ? 15  PRO A CD   6  
ATOM 8970  H HA   . PRO A 1 15  ? -6.198  -11.673 -10.133 1.00 0.00 ? 15  PRO A HA   6  
ATOM 8971  H HB2  . PRO A 1 15  ? -8.053  -10.280 -11.543 1.00 0.00 ? 15  PRO A HB2  6  
ATOM 8972  H HB3  . PRO A 1 15  ? -7.774  -12.011 -11.770 1.00 0.00 ? 15  PRO A HB3  6  
ATOM 8973  H HG2  . PRO A 1 15  ? -9.905  -10.628 -10.187 1.00 0.00 ? 15  PRO A HG2  6  
ATOM 8974  H HG3  . PRO A 1 15  ? -10.044 -12.029 -11.265 1.00 0.00 ? 15  PRO A HG3  6  
ATOM 8975  H HD2  . PRO A 1 15  ? -9.940  -12.269 -8.570  1.00 0.00 ? 15  PRO A HD2  6  
ATOM 8976  H HD3  . PRO A 1 15  ? -9.269  -13.496 -9.664  1.00 0.00 ? 15  PRO A HD3  6  
ATOM 8977  N N    . PRO A 1 16  ? -5.860  -9.202  -9.736  1.00 0.00 ? 16  PRO A N    6  
ATOM 8978  C CA   . PRO A 1 16  ? -5.534  -7.837  -9.314  1.00 0.00 ? 16  PRO A CA   6  
ATOM 8979  C C    . PRO A 1 16  ? -6.481  -6.803  -9.912  1.00 0.00 ? 16  PRO A C    6  
ATOM 8980  O O    . PRO A 1 16  ? -7.188  -7.082  -10.881 1.00 0.00 ? 16  PRO A O    6  
ATOM 8981  C CB   . PRO A 1 16  ? -4.113  -7.631  -9.845  1.00 0.00 ? 16  PRO A CB   6  
ATOM 8982  C CG   . PRO A 1 16  ? -4.001  -8.566  -11.000 1.00 0.00 ? 16  PRO A CG   6  
ATOM 8983  C CD   . PRO A 1 16  ? -4.848  -9.758  -10.650 1.00 0.00 ? 16  PRO A CD   6  
ATOM 8984  H HA   . PRO A 1 16  ? -5.534  -7.743  -8.238  1.00 0.00 ? 16  PRO A HA   6  
ATOM 8985  H HB2  . PRO A 1 16  ? -3.987  -6.603  -10.155 1.00 0.00 ? 16  PRO A HB2  6  
ATOM 8986  H HB3  . PRO A 1 16  ? -3.398  -7.870  -9.073  1.00 0.00 ? 16  PRO A HB3  6  
ATOM 8987  H HG2  . PRO A 1 16  ? -4.374  -8.091  -11.894 1.00 0.00 ? 16  PRO A HG2  6  
ATOM 8988  H HG3  . PRO A 1 16  ? -2.972  -8.864  -11.132 1.00 0.00 ? 16  PRO A HG3  6  
ATOM 8989  H HD2  . PRO A 1 16  ? -5.311  -10.165 -11.536 1.00 0.00 ? 16  PRO A HD2  6  
ATOM 8990  H HD3  . PRO A 1 16  ? -4.253  -10.511 -10.153 1.00 0.00 ? 16  PRO A HD3  6  
ATOM 8991  N N    . ARG A 1 17  ? -6.491  -5.608  -9.330  1.00 0.00 ? 17  ARG A N    6  
ATOM 8992  C CA   . ARG A 1 17  ? -7.353  -4.533  -9.806  1.00 0.00 ? 17  ARG A CA   6  
ATOM 8993  C C    . ARG A 1 17  ? -6.583  -3.219  -9.896  1.00 0.00 ? 17  ARG A C    6  
ATOM 8994  O O    . ARG A 1 17  ? -5.946  -2.794  -8.932  1.00 0.00 ? 17  ARG A O    6  
ATOM 8995  C CB   . ARG A 1 17  ? -8.558  -4.368  -8.878  1.00 0.00 ? 17  ARG A CB   6  
ATOM 8996  C CG   . ARG A 1 17  ? -8.327  -3.374  -7.751  1.00 0.00 ? 17  ARG A CG   6  
ATOM 8997  C CD   . ARG A 1 17  ? -9.502  -3.344  -6.785  1.00 0.00 ? 17  ARG A CD   6  
ATOM 8998  N NE   . ARG A 1 17  ? -9.750  -4.651  -6.184  1.00 0.00 ? 17  ARG A NE   6  
ATOM 8999  C CZ   . ARG A 1 17  ? -10.487 -5.596  -6.758  1.00 0.00 ? 17  ARG A CZ   6  
ATOM 9000  N NH1  . ARG A 1 17  ? -11.045 -5.380  -7.941  1.00 0.00 ? 17  ARG A NH1  6  
ATOM 9001  N NH2  . ARG A 1 17  ? -10.666 -6.761  -6.148  1.00 0.00 ? 17  ARG A NH2  6  
ATOM 9002  H H    . ARG A 1 17  ? -5.906  -5.446  -8.561  1.00 0.00 ? 17  ARG A H    6  
ATOM 9003  H HA   . ARG A 1 17  ? -7.703  -4.800  -10.791 1.00 0.00 ? 17  ARG A HA   6  
ATOM 9004  H HB2  . ARG A 1 17  ? -9.403  -4.029  -9.460  1.00 0.00 ? 17  ARG A HB2  6  
ATOM 9005  H HB3  . ARG A 1 17  ? -8.794  -5.326  -8.440  1.00 0.00 ? 17  ARG A HB3  6  
ATOM 9006  H HG2  . ARG A 1 17  ? -7.437  -3.659  -7.209  1.00 0.00 ? 17  ARG A HG2  6  
ATOM 9007  H HG3  . ARG A 1 17  ? -8.194  -2.389  -8.174  1.00 0.00 ? 17  ARG A HG3  6  
ATOM 9008  H HD2  . ARG A 1 17  ? -9.288  -2.633  -6.002  1.00 0.00 ? 17  ARG A HD2  6  
ATOM 9009  H HD3  . ARG A 1 17  ? -10.384 -3.032  -7.323  1.00 0.00 ? 17  ARG A HD3  6  
ATOM 9010  H HE   . ARG A 1 17  ? -9.347  -4.833  -5.310  1.00 0.00 ? 17  ARG A HE   6  
ATOM 9011  H HH11 . ARG A 1 17  ? -10.910 -4.503  -8.403  1.00 0.00 ? 17  ARG A HH11 6  
ATOM 9012  H HH12 . ARG A 1 17  ? -11.598 -6.093  -8.371  1.00 0.00 ? 17  ARG A HH12 6  
ATOM 9013  H HH21 . ARG A 1 17  ? -10.247 -6.928  -5.256  1.00 0.00 ? 17  ARG A HH21 6  
ATOM 9014  H HH22 . ARG A 1 17  ? -11.221 -7.471  -6.580  1.00 0.00 ? 17  ARG A HH22 6  
ATOM 9015  N N    . ILE A 1 18  ? -6.647  -2.581  -11.060 1.00 0.00 ? 18  ILE A N    6  
ATOM 9016  C CA   . ILE A 1 18  ? -5.957  -1.315  -11.276 1.00 0.00 ? 18  ILE A CA   6  
ATOM 9017  C C    . ILE A 1 18  ? -6.854  -0.133  -10.925 1.00 0.00 ? 18  ILE A C    6  
ATOM 9018  O O    . ILE A 1 18  ? -8.001  -0.059  -11.364 1.00 0.00 ? 18  ILE A O    6  
ATOM 9019  C CB   . ILE A 1 18  ? -5.485  -1.173  -12.735 1.00 0.00 ? 18  ILE A CB   6  
ATOM 9020  C CG1  . ILE A 1 18  ? -4.253  -2.045  -12.983 1.00 0.00 ? 18  ILE A CG1  6  
ATOM 9021  C CG2  . ILE A 1 18  ? -5.182  0.283   -13.054 1.00 0.00 ? 18  ILE A CG2  6  
ATOM 9022  C CD1  . ILE A 1 18  ? -3.790  -2.042  -14.423 1.00 0.00 ? 18  ILE A CD1  6  
ATOM 9023  H H    . ILE A 1 18  ? -7.171  -2.970  -11.790 1.00 0.00 ? 18  ILE A H    6  
ATOM 9024  H HA   . ILE A 1 18  ? -5.087  -1.297  -10.634 1.00 0.00 ? 18  ILE A HA   6  
ATOM 9025  H HB   . ILE A 1 18  ? -6.285  -1.499  -13.382 1.00 0.00 ? 18  ILE A HB   6  
ATOM 9026  H HG12 . ILE A 1 18  ? -3.438  -1.689  -12.373 1.00 0.00 ? 18  ILE A HG12 6  
ATOM 9027  H HG13 . ILE A 1 18  ? -4.482  -3.065  -12.710 1.00 0.00 ? 18  ILE A HG13 6  
ATOM 9028  H HG21 . ILE A 1 18  ? -4.822  0.779   -12.164 1.00 0.00 ? 18  ILE A HG21 6  
ATOM 9029  H HG22 . ILE A 1 18  ? -4.427  0.333   -13.824 1.00 0.00 ? 18  ILE A HG22 6  
ATOM 9030  H HG23 . ILE A 1 18  ? -6.082  0.771   -13.398 1.00 0.00 ? 18  ILE A HG23 6  
ATOM 9031  H HD11 . ILE A 1 18  ? -3.252  -1.127  -14.626 1.00 0.00 ? 18  ILE A HD11 6  
ATOM 9032  H HD12 . ILE A 1 18  ? -3.139  -2.886  -14.594 1.00 0.00 ? 18  ILE A HD12 6  
ATOM 9033  H HD13 . ILE A 1 18  ? -4.646  -2.108  -15.077 1.00 0.00 ? 18  ILE A HD13 6  
ATOM 9034  N N    . VAL A 1 19  ? -6.322  0.792   -10.133 1.00 0.00 ? 19  VAL A N    6  
ATOM 9035  C CA   . VAL A 1 19  ? -7.073  1.973   -9.725  1.00 0.00 ? 19  VAL A CA   6  
ATOM 9036  C C    . VAL A 1 19  ? -6.193  3.218   -9.746  1.00 0.00 ? 19  VAL A C    6  
ATOM 9037  O O    . VAL A 1 19  ? -5.097  3.224   -9.187  1.00 0.00 ? 19  VAL A O    6  
ATOM 9038  C CB   . VAL A 1 19  ? -7.668  1.802   -8.315  1.00 0.00 ? 19  VAL A CB   6  
ATOM 9039  C CG1  . VAL A 1 19  ? -8.526  3.002   -7.947  1.00 0.00 ? 19  VAL A CG1  6  
ATOM 9040  C CG2  . VAL A 1 19  ? -8.473  0.514   -8.230  1.00 0.00 ? 19  VAL A CG2  6  
ATOM 9041  H H    . VAL A 1 19  ? -5.402  0.677   -9.815  1.00 0.00 ? 19  VAL A H    6  
ATOM 9042  H HA   . VAL A 1 19  ? -7.887  2.108   -10.422 1.00 0.00 ? 19  VAL A HA   6  
ATOM 9043  H HB   . VAL A 1 19  ? -6.853  1.739   -7.608  1.00 0.00 ? 19  VAL A HB   6  
ATOM 9044  H HG11 . VAL A 1 19  ? -9.225  3.203   -8.746  1.00 0.00 ? 19  VAL A HG11 6  
ATOM 9045  H HG12 . VAL A 1 19  ? -9.068  2.793   -7.037  1.00 0.00 ? 19  VAL A HG12 6  
ATOM 9046  H HG13 . VAL A 1 19  ? -7.893  3.865   -7.800  1.00 0.00 ? 19  VAL A HG13 6  
ATOM 9047  H HG21 . VAL A 1 19  ? -9.465  0.683   -8.623  1.00 0.00 ? 19  VAL A HG21 6  
ATOM 9048  H HG22 . VAL A 1 19  ? -7.982  -0.255  -8.807  1.00 0.00 ? 19  VAL A HG22 6  
ATOM 9049  H HG23 . VAL A 1 19  ? -8.544  0.200   -7.199  1.00 0.00 ? 19  VAL A HG23 6  
ATOM 9050  N N    . GLU A 1 20  ? -6.681  4.271   -10.394 1.00 0.00 ? 20  GLU A N    6  
ATOM 9051  C CA   . GLU A 1 20  ? -5.938  5.522   -10.487 1.00 0.00 ? 20  GLU A CA   6  
ATOM 9052  C C    . GLU A 1 20  ? -6.298  6.456   -9.335  1.00 0.00 ? 20  GLU A C    6  
ATOM 9053  O O    . GLU A 1 20  ? -7.467  6.784   -9.130  1.00 0.00 ? 20  GLU A O    6  
ATOM 9054  C CB   . GLU A 1 20  ? -6.221  6.211   -11.823 1.00 0.00 ? 20  GLU A CB   6  
ATOM 9055  C CG   . GLU A 1 20  ? -5.456  5.611   -12.991 1.00 0.00 ? 20  GLU A CG   6  
ATOM 9056  C CD   . GLU A 1 20  ? -6.246  4.540   -13.718 1.00 0.00 ? 20  GLU A CD   6  
ATOM 9057  O OE1  . GLU A 1 20  ? -7.465  4.430   -13.467 1.00 0.00 ? 20  GLU A OE1  6  
ATOM 9058  O OE2  . GLU A 1 20  ? -5.647  3.811   -14.535 1.00 0.00 ? 20  GLU A OE2  6  
ATOM 9059  H H    . GLU A 1 20  ? -7.561  4.205   -10.819 1.00 0.00 ? 20  GLU A H    6  
ATOM 9060  H HA   . GLU A 1 20  ? -4.886  5.288   -10.429 1.00 0.00 ? 20  GLU A HA   6  
ATOM 9061  H HB2  . GLU A 1 20  ? -7.277  6.138   -12.036 1.00 0.00 ? 20  GLU A HB2  6  
ATOM 9062  H HB3  . GLU A 1 20  ? -5.951  7.253   -11.741 1.00 0.00 ? 20  GLU A HB3  6  
ATOM 9063  H HG2  . GLU A 1 20  ? -5.218  6.398   -13.691 1.00 0.00 ? 20  GLU A HG2  6  
ATOM 9064  H HG3  . GLU A 1 20  ? -4.542  5.173   -12.619 1.00 0.00 ? 20  GLU A HG3  6  
ATOM 9065  N N    . ILE A 1 21  ? -5.285  6.880   -8.586  1.00 0.00 ? 21  ILE A N    6  
ATOM 9066  C CA   . ILE A 1 21  ? -5.494  7.775   -7.455  1.00 0.00 ? 21  ILE A CA   6  
ATOM 9067  C C    . ILE A 1 21  ? -4.652  9.039   -7.592  1.00 0.00 ? 21  ILE A C    6  
ATOM 9068  O O    . ILE A 1 21  ? -3.422  8.982   -7.586  1.00 0.00 ? 21  ILE A O    6  
ATOM 9069  C CB   . ILE A 1 21  ? -5.154  7.087   -6.121  1.00 0.00 ? 21  ILE A CB   6  
ATOM 9070  C CG1  . ILE A 1 21  ? -5.798  5.700   -6.059  1.00 0.00 ? 21  ILE A CG1  6  
ATOM 9071  C CG2  . ILE A 1 21  ? -5.613  7.943   -4.950  1.00 0.00 ? 21  ILE A CG2  6  
ATOM 9072  C CD1  . ILE A 1 21  ? -5.399  4.903   -4.836  1.00 0.00 ? 21  ILE A CD1  6  
ATOM 9073  H H    . ILE A 1 21  ? -4.376  6.583   -8.800  1.00 0.00 ? 21  ILE A H    6  
ATOM 9074  H HA   . ILE A 1 21  ? -6.539  8.052   -7.439  1.00 0.00 ? 21  ILE A HA   6  
ATOM 9075  H HB   . ILE A 1 21  ? -4.081  6.981   -6.059  1.00 0.00 ? 21  ILE A HB   6  
ATOM 9076  H HG12 . ILE A 1 21  ? -6.871  5.808   -6.048  1.00 0.00 ? 21  ILE A HG12 6  
ATOM 9077  H HG13 . ILE A 1 21  ? -5.505  5.136   -6.933  1.00 0.00 ? 21  ILE A HG13 6  
ATOM 9078  H HG21 . ILE A 1 21  ? -5.187  8.931   -5.038  1.00 0.00 ? 21  ILE A HG21 6  
ATOM 9079  H HG22 . ILE A 1 21  ? -6.691  8.015   -4.958  1.00 0.00 ? 21  ILE A HG22 6  
ATOM 9080  H HG23 . ILE A 1 21  ? -5.289  7.492   -4.025  1.00 0.00 ? 21  ILE A HG23 6  
ATOM 9081  H HD11 . ILE A 1 21  ? -4.479  5.300   -4.432  1.00 0.00 ? 21  ILE A HD11 6  
ATOM 9082  H HD12 . ILE A 1 21  ? -6.178  4.973   -4.091  1.00 0.00 ? 21  ILE A HD12 6  
ATOM 9083  H HD13 . ILE A 1 21  ? -5.254  3.869   -5.111  1.00 0.00 ? 21  ILE A HD13 6  
ATOM 9084  N N    . PHE A 1 22  ? -5.322  10.180  -7.714  1.00 0.00 ? 22  PHE A N    6  
ATOM 9085  C CA   . PHE A 1 22  ? -4.635  11.459  -7.851  1.00 0.00 ? 22  PHE A CA   6  
ATOM 9086  C C    . PHE A 1 22  ? -4.139  11.958  -6.497  1.00 0.00 ? 22  PHE A C    6  
ATOM 9087  O O    . PHE A 1 22  ? -4.875  11.945  -5.510  1.00 0.00 ? 22  PHE A O    6  
ATOM 9088  C CB   . PHE A 1 22  ? -5.566  12.498  -8.479  1.00 0.00 ? 22  PHE A CB   6  
ATOM 9089  C CG   . PHE A 1 22  ? -5.314  12.721  -9.943  1.00 0.00 ? 22  PHE A CG   6  
ATOM 9090  C CD1  . PHE A 1 22  ? -5.756  11.806  -10.884 1.00 0.00 ? 22  PHE A CD1  6  
ATOM 9091  C CD2  . PHE A 1 22  ? -4.633  13.847  -10.378 1.00 0.00 ? 22  PHE A CD2  6  
ATOM 9092  C CE1  . PHE A 1 22  ? -5.526  12.009  -12.232 1.00 0.00 ? 22  PHE A CE1  6  
ATOM 9093  C CE2  . PHE A 1 22  ? -4.400  14.056  -11.724 1.00 0.00 ? 22  PHE A CE2  6  
ATOM 9094  C CZ   . PHE A 1 22  ? -4.846  13.135  -12.652 1.00 0.00 ? 22  PHE A CZ   6  
ATOM 9095  H H    . PHE A 1 22  ? -6.302  10.162  -7.712  1.00 0.00 ? 22  PHE A H    6  
ATOM 9096  H HA   . PHE A 1 22  ? -3.786  11.310  -8.499  1.00 0.00 ? 22  PHE A HA   6  
ATOM 9097  H HB2  . PHE A 1 22  ? -6.588  12.169  -8.366  1.00 0.00 ? 22  PHE A HB2  6  
ATOM 9098  H HB3  . PHE A 1 22  ? -5.437  13.441  -7.971  1.00 0.00 ? 22  PHE A HB3  6  
ATOM 9099  H HD1  . PHE A 1 22  ? -6.289  10.924  -10.556 1.00 0.00 ? 22  PHE A HD1  6  
ATOM 9100  H HD2  . PHE A 1 22  ? -4.283  14.568  -9.654  1.00 0.00 ? 22  PHE A HD2  6  
ATOM 9101  H HE1  . PHE A 1 22  ? -5.876  11.286  -12.954 1.00 0.00 ? 22  PHE A HE1  6  
ATOM 9102  H HE2  . PHE A 1 22  ? -3.868  14.937  -12.050 1.00 0.00 ? 22  PHE A HE2  6  
ATOM 9103  H HZ   . PHE A 1 22  ? -4.666  13.296  -13.704 1.00 0.00 ? 22  PHE A HZ   6  
ATOM 9104  N N    . ARG A 1 23  ? -2.885  12.397  -6.458  1.00 0.00 ? 23  ARG A N    6  
ATOM 9105  C CA   . ARG A 1 23  ? -2.289  12.898  -5.225  1.00 0.00 ? 23  ARG A CA   6  
ATOM 9106  C C    . ARG A 1 23  ? -2.934  14.216  -4.806  1.00 0.00 ? 23  ARG A C    6  
ATOM 9107  O O    . ARG A 1 23  ? -3.512  14.924  -5.630  1.00 0.00 ? 23  ARG A O    6  
ATOM 9108  C CB   . ARG A 1 23  ? -0.781  13.090  -5.404  1.00 0.00 ? 23  ARG A CB   6  
ATOM 9109  C CG   . ARG A 1 23  ? -0.081  11.882  -6.005  1.00 0.00 ? 23  ARG A CG   6  
ATOM 9110  C CD   . ARG A 1 23  ? 1.379   12.181  -6.311  1.00 0.00 ? 23  ARG A CD   6  
ATOM 9111  N NE   . ARG A 1 23  ? 2.121   12.569  -5.115  1.00 0.00 ? 23  ARG A NE   6  
ATOM 9112  C CZ   . ARG A 1 23  ? 3.233   13.295  -5.143  1.00 0.00 ? 23  ARG A CZ   6  
ATOM 9113  N NH1  . ARG A 1 23  ? 3.729   13.708  -6.301  1.00 0.00 ? 23  ARG A NH1  6  
ATOM 9114  N NH2  . ARG A 1 23  ? 3.851   13.608  -4.012  1.00 0.00 ? 23  ARG A NH2  6  
ATOM 9115  H H    . ARG A 1 23  ? -2.347  12.382  -7.277  1.00 0.00 ? 23  ARG A H    6  
ATOM 9116  H HA   . ARG A 1 23  ? -2.460  12.165  -4.452  1.00 0.00 ? 23  ARG A HA   6  
ATOM 9117  H HB2  . ARG A 1 23  ? -0.612  13.936  -6.053  1.00 0.00 ? 23  ARG A HB2  6  
ATOM 9118  H HB3  . ARG A 1 23  ? -0.340  13.292  -4.440  1.00 0.00 ? 23  ARG A HB3  6  
ATOM 9119  H HG2  . ARG A 1 23  ? -0.130  11.063  -5.303  1.00 0.00 ? 23  ARG A HG2  6  
ATOM 9120  H HG3  . ARG A 1 23  ? -0.583  11.605  -6.920  1.00 0.00 ? 23  ARG A HG3  6  
ATOM 9121  H HD2  . ARG A 1 23  ? 1.832   11.296  -6.732  1.00 0.00 ? 23  ARG A HD2  6  
ATOM 9122  H HD3  . ARG A 1 23  ? 1.424   12.985  -7.030  1.00 0.00 ? 23  ARG A HD3  6  
ATOM 9123  H HE   . ARG A 1 23  ? 1.771   12.275  -4.248  1.00 0.00 ? 23  ARG A HE   6  
ATOM 9124  H HH11 . ARG A 1 23  ? 3.265   13.474  -7.155  1.00 0.00 ? 23  ARG A HH11 6  
ATOM 9125  H HH12 . ARG A 1 23  ? 4.567   14.255  -6.320  1.00 0.00 ? 23  ARG A HH12 6  
ATOM 9126  H HH21 . ARG A 1 23  ? 3.480   13.299  -3.137  1.00 0.00 ? 23  ARG A HH21 6  
ATOM 9127  H HH22 . ARG A 1 23  ? 4.689   14.154  -4.034  1.00 0.00 ? 23  ARG A HH22 6  
ATOM 9128  N N    . GLU A 1 24  ? -2.831  14.537  -3.520  1.00 0.00 ? 24  GLU A N    6  
ATOM 9129  C CA   . GLU A 1 24  ? -3.405  15.769  -2.993  1.00 0.00 ? 24  GLU A CA   6  
ATOM 9130  C C    . GLU A 1 24  ? -2.337  16.620  -2.313  1.00 0.00 ? 24  GLU A C    6  
ATOM 9131  O O    . GLU A 1 24  ? -1.351  16.114  -1.778  1.00 0.00 ? 24  GLU A O    6  
ATOM 9132  C CB   . GLU A 1 24  ? -4.527  15.451  -2.001  1.00 0.00 ? 24  GLU A CB   6  
ATOM 9133  C CG   . GLU A 1 24  ? -5.899  15.353  -2.646  1.00 0.00 ? 24  GLU A CG   6  
ATOM 9134  C CD   . GLU A 1 24  ? -5.827  15.053  -4.130  1.00 0.00 ? 24  GLU A CD   6  
ATOM 9135  O OE1  . GLU A 1 24  ? -5.694  16.009  -4.923  1.00 0.00 ? 24  GLU A OE1  6  
ATOM 9136  O OE2  . GLU A 1 24  ? -5.903  13.863  -4.499  1.00 0.00 ? 24  GLU A OE2  6  
ATOM 9137  H H    . GLU A 1 24  ? -2.357  13.931  -2.913  1.00 0.00 ? 24  GLU A H    6  
ATOM 9138  H HA   . GLU A 1 24  ? -3.818  16.324  -3.822  1.00 0.00 ? 24  GLU A HA   6  
ATOM 9139  H HB2  . GLU A 1 24  ? -4.309  14.509  -1.520  1.00 0.00 ? 24  GLU A HB2  6  
ATOM 9140  H HB3  . GLU A 1 24  ? -4.559  16.228  -1.252  1.00 0.00 ? 24  GLU A HB3  6  
ATOM 9141  H HG2  . GLU A 1 24  ? -6.455  14.564  -2.162  1.00 0.00 ? 24  GLU A HG2  6  
ATOM 9142  H HG3  . GLU A 1 24  ? -6.416  16.292  -2.507  1.00 0.00 ? 24  GLU A HG3  6  
ATOM 9143  N N    . PRO A 1 25  ? -2.536  17.947  -2.335  1.00 0.00 ? 25  PRO A N    6  
ATOM 9144  C CA   . PRO A 1 25  ? -1.601  18.898  -1.726  1.00 0.00 ? 25  PRO A CA   6  
ATOM 9145  C C    . PRO A 1 25  ? -1.608  18.822  -0.203  1.00 0.00 ? 25  PRO A C    6  
ATOM 9146  O O    . PRO A 1 25  ? -0.860  18.049  0.393   1.00 0.00 ? 25  PRO A O    6  
ATOM 9147  C CB   . PRO A 1 25  ? -2.122  20.258  -2.197  1.00 0.00 ? 25  PRO A CB   6  
ATOM 9148  C CG   . PRO A 1 25  ? -3.570  20.037  -2.465  1.00 0.00 ? 25  PRO A CG   6  
ATOM 9149  C CD   . PRO A 1 25  ? -3.689  18.620  -2.955  1.00 0.00 ? 25  PRO A CD   6  
ATOM 9150  H HA   . PRO A 1 25  ? -0.594  18.751  -2.088  1.00 0.00 ? 25  PRO A HA   6  
ATOM 9151  H HB2  . PRO A 1 25  ? -1.971  20.993  -1.418  1.00 0.00 ? 25  PRO A HB2  6  
ATOM 9152  H HB3  . PRO A 1 25  ? -1.596  20.559  -3.090  1.00 0.00 ? 25  PRO A HB3  6  
ATOM 9153  H HG2  . PRO A 1 25  ? -4.136  20.168  -1.555  1.00 0.00 ? 25  PRO A HG2  6  
ATOM 9154  H HG3  . PRO A 1 25  ? -3.912  20.725  -3.224  1.00 0.00 ? 25  PRO A HG3  6  
ATOM 9155  H HD2  . PRO A 1 25  ? -4.618  18.182  -2.620  1.00 0.00 ? 25  PRO A HD2  6  
ATOM 9156  H HD3  . PRO A 1 25  ? -3.621  18.587  -4.032  1.00 0.00 ? 25  PRO A HD3  6  
ATOM 9157  N N    . ASN A 1 26  ? -2.459  19.631  0.421   1.00 0.00 ? 26  ASN A N    6  
ATOM 9158  C CA   . ASN A 1 26  ? -2.563  19.656  1.876   1.00 0.00 ? 26  ASN A CA   6  
ATOM 9159  C C    . ASN A 1 26  ? -2.638  18.240  2.440   1.00 0.00 ? 26  ASN A C    6  
ATOM 9160  O O    . ASN A 1 26  ? -2.079  17.951  3.498   1.00 0.00 ? 26  ASN A O    6  
ATOM 9161  C CB   . ASN A 1 26  ? -3.795  20.454  2.306   1.00 0.00 ? 26  ASN A CB   6  
ATOM 9162  C CG   . ASN A 1 26  ? -3.528  21.946  2.356   1.00 0.00 ? 26  ASN A CG   6  
ATOM 9163  O OD1  . ASN A 1 26  ? -2.953  22.454  3.319   1.00 0.00 ? 26  ASN A OD1  6  
ATOM 9164  N ND2  . ASN A 1 26  ? -3.946  22.657  1.315   1.00 0.00 ? 26  ASN A ND2  6  
ATOM 9165  H H    . ASN A 1 26  ? -3.030  20.225  -0.109  1.00 0.00 ? 26  ASN A H    6  
ATOM 9166  H HA   . ASN A 1 26  ? -1.679  20.139  2.263   1.00 0.00 ? 26  ASN A HA   6  
ATOM 9167  H HB2  . ASN A 1 26  ? -4.596  20.275  1.604   1.00 0.00 ? 26  ASN A HB2  6  
ATOM 9168  H HB3  . ASN A 1 26  ? -4.103  20.129  3.288   1.00 0.00 ? 26  ASN A HB3  6  
ATOM 9169  H HD21 . ASN A 1 26  ? -4.397  22.186  0.583   1.00 0.00 ? 26  ASN A HD21 6  
ATOM 9170  H HD22 . ASN A 1 26  ? -3.786  23.624  1.321   1.00 0.00 ? 26  ASN A HD22 6  
ATOM 9171  N N    . VAL A 1 27  ? -3.333  17.360  1.725   1.00 0.00 ? 27  VAL A N    6  
ATOM 9172  C CA   . VAL A 1 27  ? -3.480  15.974  2.153   1.00 0.00 ? 27  VAL A CA   6  
ATOM 9173  C C    . VAL A 1 27  ? -2.817  15.021  1.165   1.00 0.00 ? 27  VAL A C    6  
ATOM 9174  O O    . VAL A 1 27  ? -2.807  15.268  -0.040  1.00 0.00 ? 27  VAL A O    6  
ATOM 9175  C CB   . VAL A 1 27  ? -4.964  15.589  2.305   1.00 0.00 ? 27  VAL A CB   6  
ATOM 9176  C CG1  . VAL A 1 27  ? -5.663  15.613  0.955   1.00 0.00 ? 27  VAL A CG1  6  
ATOM 9177  C CG2  . VAL A 1 27  ? -5.094  14.221  2.958   1.00 0.00 ? 27  VAL A CG2  6  
ATOM 9178  H H    . VAL A 1 27  ? -3.756  17.650  0.890   1.00 0.00 ? 27  VAL A H    6  
ATOM 9179  H HA   . VAL A 1 27  ? -3.002  15.869  3.116   1.00 0.00 ? 27  VAL A HA   6  
ATOM 9180  H HB   . VAL A 1 27  ? -5.440  16.316  2.945   1.00 0.00 ? 27  VAL A HB   6  
ATOM 9181  H HG11 . VAL A 1 27  ? -6.686  15.287  1.074   1.00 0.00 ? 27  VAL A HG11 6  
ATOM 9182  H HG12 . VAL A 1 27  ? -5.647  16.617  0.558   1.00 0.00 ? 27  VAL A HG12 6  
ATOM 9183  H HG13 . VAL A 1 27  ? -5.152  14.949  0.273   1.00 0.00 ? 27  VAL A HG13 6  
ATOM 9184  H HG21 . VAL A 1 27  ? -5.797  14.277  3.775   1.00 0.00 ? 27  VAL A HG21 6  
ATOM 9185  H HG22 . VAL A 1 27  ? -5.445  13.506  2.228   1.00 0.00 ? 27  VAL A HG22 6  
ATOM 9186  H HG23 . VAL A 1 27  ? -4.130  13.907  3.334   1.00 0.00 ? 27  VAL A HG23 6  
ATOM 9187  N N    . SER A 1 28  ? -2.264  13.930  1.685   1.00 0.00 ? 28  SER A N    6  
ATOM 9188  C CA   . SER A 1 28  ? -1.595  12.940  0.849   1.00 0.00 ? 28  SER A CA   6  
ATOM 9189  C C    . SER A 1 28  ? -2.612  12.034  0.161   1.00 0.00 ? 28  SER A C    6  
ATOM 9190  O O    . SER A 1 28  ? -3.789  12.378  0.045   1.00 0.00 ? 28  SER A O    6  
ATOM 9191  C CB   . SER A 1 28  ? -0.633  12.098  1.690   1.00 0.00 ? 28  SER A CB   6  
ATOM 9192  O OG   . SER A 1 28  ? 0.490   11.693  0.926   1.00 0.00 ? 28  SER A OG   6  
ATOM 9193  H H    . SER A 1 28  ? -2.305  13.789  2.654   1.00 0.00 ? 28  SER A H    6  
ATOM 9194  H HA   . SER A 1 28  ? -1.033  13.469  0.095   1.00 0.00 ? 28  SER A HA   6  
ATOM 9195  H HB2  . SER A 1 28  ? -0.290  12.681  2.531   1.00 0.00 ? 28  SER A HB2  6  
ATOM 9196  H HB3  . SER A 1 28  ? -1.147  11.218  2.047   1.00 0.00 ? 28  SER A HB3  6  
ATOM 9197  H HG   . SER A 1 28  ? 1.066   11.148  1.468   1.00 0.00 ? 28  SER A HG   6  
ATOM 9198  N N    . LEU A 1 29  ? -2.149  10.875  -0.295  1.00 0.00 ? 29  LEU A N    6  
ATOM 9199  C CA   . LEU A 1 29  ? -3.017  9.918   -0.973  1.00 0.00 ? 29  LEU A CA   6  
ATOM 9200  C C    . LEU A 1 29  ? -4.043  9.334   -0.007  1.00 0.00 ? 29  LEU A C    6  
ATOM 9201  O O    . LEU A 1 29  ? -5.160  8.999   -0.399  1.00 0.00 ? 29  LEU A O    6  
ATOM 9202  C CB   . LEU A 1 29  ? -2.185  8.794   -1.591  1.00 0.00 ? 29  LEU A CB   6  
ATOM 9203  C CG   . LEU A 1 29  ? -1.881  8.927   -3.084  1.00 0.00 ? 29  LEU A CG   6  
ATOM 9204  C CD1  . LEU A 1 29  ? -1.322  7.624   -3.633  1.00 0.00 ? 29  LEU A CD1  6  
ATOM 9205  C CD2  . LEU A 1 29  ? -3.131  9.338   -3.848  1.00 0.00 ? 29  LEU A CD2  6  
ATOM 9206  H H    . LEU A 1 29  ? -1.202  10.657  -0.173  1.00 0.00 ? 29  LEU A H    6  
ATOM 9207  H HA   . LEU A 1 29  ? -3.539  10.443  -1.759  1.00 0.00 ? 29  LEU A HA   6  
ATOM 9208  H HB2  . LEU A 1 29  ? -1.243  8.752   -1.065  1.00 0.00 ? 29  LEU A HB2  6  
ATOM 9209  H HB3  . LEU A 1 29  ? -2.720  7.867   -1.443  1.00 0.00 ? 29  LEU A HB3  6  
ATOM 9210  H HG   . LEU A 1 29  ? -1.133  9.696   -3.225  1.00 0.00 ? 29  LEU A HG   6  
ATOM 9211  H HD11 . LEU A 1 29  ? -1.935  7.287   -4.455  1.00 0.00 ? 29  LEU A HD11 6  
ATOM 9212  H HD12 . LEU A 1 29  ? -1.321  6.876   -2.854  1.00 0.00 ? 29  LEU A HD12 6  
ATOM 9213  H HD13 . LEU A 1 29  ? -0.311  7.783   -3.979  1.00 0.00 ? 29  LEU A HD13 6  
ATOM 9214  H HD21 . LEU A 1 29  ? -3.222  10.414  -3.837  1.00 0.00 ? 29  LEU A HD21 6  
ATOM 9215  H HD22 . LEU A 1 29  ? -3.999  8.897   -3.381  1.00 0.00 ? 29  LEU A HD22 6  
ATOM 9216  H HD23 . LEU A 1 29  ? -3.058  8.992   -4.869  1.00 0.00 ? 29  LEU A HD23 6  
ATOM 9217  N N    . GLY A 1 30  ? -3.656  9.217   1.260   1.00 0.00 ? 30  GLY A N    6  
ATOM 9218  C CA   . GLY A 1 30  ? -4.555  8.676   2.263   1.00 0.00 ? 30  GLY A CA   6  
ATOM 9219  C C    . GLY A 1 30  ? -4.458  7.167   2.374   1.00 0.00 ? 30  GLY A C    6  
ATOM 9220  O O    . GLY A 1 30  ? -5.312  6.528   2.990   1.00 0.00 ? 30  GLY A O    6  
ATOM 9221  H H    . GLY A 1 30  ? -2.753  9.501   1.516   1.00 0.00 ? 30  GLY A H    6  
ATOM 9222  H HA2  . GLY A 1 30  ? -4.313  9.113   3.220   1.00 0.00 ? 30  GLY A HA2  6  
ATOM 9223  H HA3  . GLY A 1 30  ? -5.569  8.942   2.002   1.00 0.00 ? 30  GLY A HA3  6  
ATOM 9224  N N    . ILE A 1 31  ? -3.418  6.597   1.775   1.00 0.00 ? 31  ILE A N    6  
ATOM 9225  C CA   . ILE A 1 31  ? -3.215  5.154   1.809   1.00 0.00 ? 31  ILE A CA   6  
ATOM 9226  C C    . ILE A 1 31  ? -1.975  4.792   2.620   1.00 0.00 ? 31  ILE A C    6  
ATOM 9227  O O    . ILE A 1 31  ? -1.012  5.558   2.675   1.00 0.00 ? 31  ILE A O    6  
ATOM 9228  C CB   . ILE A 1 31  ? -3.074  4.571   0.390   1.00 0.00 ? 31  ILE A CB   6  
ATOM 9229  C CG1  . ILE A 1 31  ? -4.123  5.182   -0.542  1.00 0.00 ? 31  ILE A CG1  6  
ATOM 9230  C CG2  . ILE A 1 31  ? -3.205  3.056   0.424   1.00 0.00 ? 31  ILE A CG2  6  
ATOM 9231  C CD1  . ILE A 1 31  ? -3.927  4.814   -1.996  1.00 0.00 ? 31  ILE A CD1  6  
ATOM 9232  H H    . ILE A 1 31  ? -2.773  7.159   1.299   1.00 0.00 ? 31  ILE A H    6  
ATOM 9233  H HA   . ILE A 1 31  ? -4.080  4.706   2.276   1.00 0.00 ? 31  ILE A HA   6  
ATOM 9234  H HB   . ILE A 1 31  ? -2.090  4.815   0.021   1.00 0.00 ? 31  ILE A HB   6  
ATOM 9235  H HG12 . ILE A 1 31  ? -5.102  4.841   -0.244  1.00 0.00 ? 31  ILE A HG12 6  
ATOM 9236  H HG13 . ILE A 1 31  ? -4.082  6.258   -0.462  1.00 0.00 ? 31  ILE A HG13 6  
ATOM 9237  H HG21 . ILE A 1 31  ? -2.244  2.617   0.644   1.00 0.00 ? 31  ILE A HG21 6  
ATOM 9238  H HG22 . ILE A 1 31  ? -3.913  2.773   1.189   1.00 0.00 ? 31  ILE A HG22 6  
ATOM 9239  H HG23 . ILE A 1 31  ? -3.551  2.703   -0.536  1.00 0.00 ? 31  ILE A HG23 6  
ATOM 9240  H HD11 . ILE A 1 31  ? -3.784  5.714   -2.578  1.00 0.00 ? 31  ILE A HD11 6  
ATOM 9241  H HD12 . ILE A 1 31  ? -3.057  4.182   -2.094  1.00 0.00 ? 31  ILE A HD12 6  
ATOM 9242  H HD13 . ILE A 1 31  ? -4.798  4.289   -2.356  1.00 0.00 ? 31  ILE A HD13 6  
ATOM 9243  N N    . SER A 1 32  ? -2.005  3.620   3.246   1.00 0.00 ? 32  SER A N    6  
ATOM 9244  C CA   . SER A 1 32  ? -0.884  3.158   4.056   1.00 0.00 ? 32  SER A CA   6  
ATOM 9245  C C    . SER A 1 32  ? -0.515  1.721   3.701   1.00 0.00 ? 32  SER A C    6  
ATOM 9246  O O    . SER A 1 32  ? -1.189  1.075   2.898   1.00 0.00 ? 32  SER A O    6  
ATOM 9247  C CB   . SER A 1 32  ? -1.228  3.256   5.544   1.00 0.00 ? 32  SER A CB   6  
ATOM 9248  O OG   . SER A 1 32  ? -1.406  4.605   5.938   1.00 0.00 ? 32  SER A OG   6  
ATOM 9249  H H    . SER A 1 32  ? -2.801  3.055   3.163   1.00 0.00 ? 32  SER A H    6  
ATOM 9250  H HA   . SER A 1 32  ? -0.039  3.796   3.848   1.00 0.00 ? 32  SER A HA   6  
ATOM 9251  H HB2  . SER A 1 32  ? -2.141  2.713   5.736   1.00 0.00 ? 32  SER A HB2  6  
ATOM 9252  H HB3  . SER A 1 32  ? -0.425  2.826   6.125   1.00 0.00 ? 32  SER A HB3  6  
ATOM 9253  H HG   . SER A 1 32  ? -2.031  4.646   6.666   1.00 0.00 ? 32  SER A HG   6  
ATOM 9254  N N    . ILE A 1 33  ? 0.561   1.227   4.306   1.00 0.00 ? 33  ILE A N    6  
ATOM 9255  C CA   . ILE A 1 33  ? 1.020   -0.134  4.055   1.00 0.00 ? 33  ILE A CA   6  
ATOM 9256  C C    . ILE A 1 33  ? 1.631   -0.748  5.310   1.00 0.00 ? 33  ILE A C    6  
ATOM 9257  O O    . ILE A 1 33  ? 2.164   -0.040  6.164   1.00 0.00 ? 33  ILE A O    6  
ATOM 9258  C CB   . ILE A 1 33  ? 2.059   -0.177  2.919   1.00 0.00 ? 33  ILE A CB   6  
ATOM 9259  C CG1  . ILE A 1 33  ? 3.125   0.901   3.131   1.00 0.00 ? 33  ILE A CG1  6  
ATOM 9260  C CG2  . ILE A 1 33  ? 1.377   0.004   1.571   1.00 0.00 ? 33  ILE A CG2  6  
ATOM 9261  C CD1  . ILE A 1 33  ? 4.336   0.736   2.241   1.00 0.00 ? 33  ILE A CD1  6  
ATOM 9262  H H    . ILE A 1 33  ? 1.057   1.790   4.935   1.00 0.00 ? 33  ILE A H    6  
ATOM 9263  H HA   . ILE A 1 33  ? 0.166   -0.724  3.757   1.00 0.00 ? 33  ILE A HA   6  
ATOM 9264  H HB   . ILE A 1 33  ? 2.531   -1.147  2.929   1.00 0.00 ? 33  ILE A HB   6  
ATOM 9265  H HG12 . ILE A 1 33  ? 2.694   1.869   2.929   1.00 0.00 ? 33  ILE A HG12 6  
ATOM 9266  H HG13 . ILE A 1 33  ? 3.459   0.868   4.158   1.00 0.00 ? 33  ILE A HG13 6  
ATOM 9267  H HG21 . ILE A 1 33  ? 0.887   -0.916  1.289   1.00 0.00 ? 33  ILE A HG21 6  
ATOM 9268  H HG22 . ILE A 1 33  ? 0.645   0.794   1.641   1.00 0.00 ? 33  ILE A HG22 6  
ATOM 9269  H HG23 . ILE A 1 33  ? 2.115   0.261   0.825   1.00 0.00 ? 33  ILE A HG23 6  
ATOM 9270  H HD11 . ILE A 1 33  ? 4.262   1.414   1.403   1.00 0.00 ? 33  ILE A HD11 6  
ATOM 9271  H HD12 . ILE A 1 33  ? 5.231   0.958   2.805   1.00 0.00 ? 33  ILE A HD12 6  
ATOM 9272  H HD13 . ILE A 1 33  ? 4.382   -0.280  1.878   1.00 0.00 ? 33  ILE A HD13 6  
ATOM 9273  N N    . VAL A 1 34  ? 1.550   -2.070  5.415   1.00 0.00 ? 34  VAL A N    6  
ATOM 9274  C CA   . VAL A 1 34  ? 2.097   -2.781  6.564   1.00 0.00 ? 34  VAL A CA   6  
ATOM 9275  C C    . VAL A 1 34  ? 3.371   -3.530  6.192   1.00 0.00 ? 34  VAL A C    6  
ATOM 9276  O O    . VAL A 1 34  ? 3.811   -3.495  5.043   1.00 0.00 ? 34  VAL A O    6  
ATOM 9277  C CB   . VAL A 1 34  ? 1.078   -3.781  7.142   1.00 0.00 ? 34  VAL A CB   6  
ATOM 9278  C CG1  . VAL A 1 34  ? -0.342  -3.277  6.935   1.00 0.00 ? 34  VAL A CG1  6  
ATOM 9279  C CG2  . VAL A 1 34  ? 1.262   -5.154  6.513   1.00 0.00 ? 34  VAL A CG2  6  
ATOM 9280  H H    . VAL A 1 34  ? 1.112   -2.580  4.701   1.00 0.00 ? 34  VAL A H    6  
ATOM 9281  H HA   . VAL A 1 34  ? 2.328   -2.053  7.328   1.00 0.00 ? 34  VAL A HA   6  
ATOM 9282  H HB   . VAL A 1 34  ? 1.253   -3.869  8.205   1.00 0.00 ? 34  VAL A HB   6  
ATOM 9283  H HG11 . VAL A 1 34  ? -0.545  -2.477  7.632   1.00 0.00 ? 34  VAL A HG11 6  
ATOM 9284  H HG12 . VAL A 1 34  ? -0.451  -2.912  5.924   1.00 0.00 ? 34  VAL A HG12 6  
ATOM 9285  H HG13 . VAL A 1 34  ? -1.039  -4.085  7.103   1.00 0.00 ? 34  VAL A HG13 6  
ATOM 9286  H HG21 . VAL A 1 34  ? 0.458   -5.804  6.823   1.00 0.00 ? 34  VAL A HG21 6  
ATOM 9287  H HG22 . VAL A 1 34  ? 1.255   -5.059  5.437   1.00 0.00 ? 34  VAL A HG22 6  
ATOM 9288  H HG23 . VAL A 1 34  ? 2.206   -5.572  6.831   1.00 0.00 ? 34  VAL A HG23 6  
ATOM 9289  N N    . GLY A 1 35  ? 3.961   -4.208  7.172   1.00 0.00 ? 35  GLY A N    6  
ATOM 9290  C CA   . GLY A 1 35  ? 5.180   -4.956  6.927   1.00 0.00 ? 35  GLY A CA   6  
ATOM 9291  C C    . GLY A 1 35  ? 6.366   -4.056  6.640   1.00 0.00 ? 35  GLY A C    6  
ATOM 9292  O O    . GLY A 1 35  ? 6.354   -2.875  6.985   1.00 0.00 ? 35  GLY A O    6  
ATOM 9293  H H    . GLY A 1 35  ? 3.565   -4.200  8.068   1.00 0.00 ? 35  GLY A H    6  
ATOM 9294  H HA2  . GLY A 1 35  ? 5.400   -5.559  7.795   1.00 0.00 ? 35  GLY A HA2  6  
ATOM 9295  H HA3  . GLY A 1 35  ? 5.025   -5.608  6.079   1.00 0.00 ? 35  GLY A HA3  6  
ATOM 9296  N N    . GLY A 1 36  ? 7.393   -4.616  6.009   1.00 0.00 ? 36  GLY A N    6  
ATOM 9297  C CA   . GLY A 1 36  ? 8.578   -3.841  5.689   1.00 0.00 ? 36  GLY A CA   6  
ATOM 9298  C C    . GLY A 1 36  ? 9.841   -4.680  5.708   1.00 0.00 ? 36  GLY A C    6  
ATOM 9299  O O    . GLY A 1 36  ? 10.905  -4.218  5.297   1.00 0.00 ? 36  GLY A O    6  
ATOM 9300  H H    . GLY A 1 36  ? 7.347   -5.562  5.759   1.00 0.00 ? 36  GLY A H    6  
ATOM 9301  H HA2  . GLY A 1 36  ? 8.459   -3.411  4.706   1.00 0.00 ? 36  GLY A HA2  6  
ATOM 9302  H HA3  . GLY A 1 36  ? 8.679   -3.044  6.411   1.00 0.00 ? 36  GLY A HA3  6  
ATOM 9303  N N    . GLN A 1 37  ? 9.723   -5.914  6.188   1.00 0.00 ? 37  GLN A N    6  
ATOM 9304  C CA   . GLN A 1 37  ? 10.866  -6.816  6.260   1.00 0.00 ? 37  GLN A CA   6  
ATOM 9305  C C    . GLN A 1 37  ? 11.805  -6.603  5.077   1.00 0.00 ? 37  GLN A C    6  
ATOM 9306  O O    . GLN A 1 37  ? 11.361  -6.444  3.940   1.00 0.00 ? 37  GLN A O    6  
ATOM 9307  C CB   . GLN A 1 37  ? 10.392  -8.270  6.295   1.00 0.00 ? 37  GLN A CB   6  
ATOM 9308  C CG   . GLN A 1 37  ? 11.320  -9.194  7.067   1.00 0.00 ? 37  GLN A CG   6  
ATOM 9309  C CD   . GLN A 1 37  ? 12.777  -8.789  6.952   1.00 0.00 ? 37  GLN A CD   6  
ATOM 9310  O OE1  . GLN A 1 37  ? 13.278  -7.998  7.751   1.00 0.00 ? 37  GLN A OE1  6  
ATOM 9311  N NE2  . GLN A 1 37  ? 13.464  -9.330  5.953   1.00 0.00 ? 37  GLN A NE2  6  
ATOM 9312  H H    . GLN A 1 37  ? 8.848   -6.224  6.500   1.00 0.00 ? 37  GLN A H    6  
ATOM 9313  H HA   . GLN A 1 37  ? 11.402  -6.600  7.172   1.00 0.00 ? 37  GLN A HA   6  
ATOM 9314  H HB2  . GLN A 1 37  ? 9.417   -8.308  6.756   1.00 0.00 ? 37  GLN A HB2  6  
ATOM 9315  H HB3  . GLN A 1 37  ? 10.317  -8.636  5.282   1.00 0.00 ? 37  GLN A HB3  6  
ATOM 9316  H HG2  . GLN A 1 37  ? 11.040  -9.176  8.110   1.00 0.00 ? 37  GLN A HG2  6  
ATOM 9317  H HG3  . GLN A 1 37  ? 11.209  -10.198 6.683   1.00 0.00 ? 37  GLN A HG3  6  
ATOM 9318  H HE21 . GLN A 1 37  ? 12.999  -9.951  5.354   1.00 0.00 ? 37  GLN A HE21 6  
ATOM 9319  H HE22 . GLN A 1 37  ? 14.407  -9.085  5.854   1.00 0.00 ? 37  GLN A HE22 6  
ATOM 9320  N N    . THR A 1 38  ? 13.105  -6.600  5.353   1.00 0.00 ? 38  THR A N    6  
ATOM 9321  C CA   . THR A 1 38  ? 14.107  -6.405  4.313   1.00 0.00 ? 38  THR A CA   6  
ATOM 9322  C C    . THR A 1 38  ? 13.950  -7.434  3.199   1.00 0.00 ? 38  THR A C    6  
ATOM 9323  O O    . THR A 1 38  ? 13.328  -8.479  3.389   1.00 0.00 ? 38  THR A O    6  
ATOM 9324  C CB   . THR A 1 38  ? 15.535  -6.495  4.883   1.00 0.00 ? 38  THR A CB   6  
ATOM 9325  O OG1  . THR A 1 38  ? 15.884  -5.265  5.527   1.00 0.00 ? 38  THR A OG1  6  
ATOM 9326  C CG2  . THR A 1 38  ? 16.539  -6.801  3.782   1.00 0.00 ? 38  THR A CG2  6  
ATOM 9327  H H    . THR A 1 38  ? 13.397  -6.732  6.280   1.00 0.00 ? 38  THR A H    6  
ATOM 9328  H HA   . THR A 1 38  ? 13.969  -5.416  3.899   1.00 0.00 ? 38  THR A HA   6  
ATOM 9329  H HB   . THR A 1 38  ? 15.566  -7.294  5.610   1.00 0.00 ? 38  THR A HB   6  
ATOM 9330  H HG1  . THR A 1 38  ? 15.217  -4.602  5.333   1.00 0.00 ? 38  THR A HG1  6  
ATOM 9331  H HG21 . THR A 1 38  ? 16.278  -7.734  3.306   1.00 0.00 ? 38  THR A HG21 6  
ATOM 9332  H HG22 . THR A 1 38  ? 17.528  -6.879  4.208   1.00 0.00 ? 38  THR A HG22 6  
ATOM 9333  H HG23 . THR A 1 38  ? 16.524  -6.006  3.051   1.00 0.00 ? 38  THR A HG23 6  
ATOM 9334  N N    . VAL A 1 39  ? 14.520  -7.132  2.036   1.00 0.00 ? 39  VAL A N    6  
ATOM 9335  C CA   . VAL A 1 39  ? 14.445  -8.032  0.892   1.00 0.00 ? 39  VAL A CA   6  
ATOM 9336  C C    . VAL A 1 39  ? 15.821  -8.249  0.272   1.00 0.00 ? 39  VAL A C    6  
ATOM 9337  O O    . VAL A 1 39  ? 16.725  -7.430  0.441   1.00 0.00 ? 39  VAL A O    6  
ATOM 9338  C CB   . VAL A 1 39  ? 13.488  -7.490  -0.186  1.00 0.00 ? 39  VAL A CB   6  
ATOM 9339  C CG1  . VAL A 1 39  ? 13.457  -5.970  -0.159  1.00 0.00 ? 39  VAL A CG1  6  
ATOM 9340  C CG2  . VAL A 1 39  ? 13.894  -7.998  -1.562  1.00 0.00 ? 39  VAL A CG2  6  
ATOM 9341  H H    . VAL A 1 39  ? 15.003  -6.284  1.947   1.00 0.00 ? 39  VAL A H    6  
ATOM 9342  H HA   . VAL A 1 39  ? 14.063  -8.981  1.238   1.00 0.00 ? 39  VAL A HA   6  
ATOM 9343  H HB   . VAL A 1 39  ? 12.494  -7.852  0.029   1.00 0.00 ? 39  VAL A HB   6  
ATOM 9344  H HG11 . VAL A 1 39  ? 14.388  -5.584  -0.548  1.00 0.00 ? 39  VAL A HG11 6  
ATOM 9345  H HG12 . VAL A 1 39  ? 12.637  -5.615  -0.765  1.00 0.00 ? 39  VAL A HG12 6  
ATOM 9346  H HG13 . VAL A 1 39  ? 13.327  -5.632  0.859   1.00 0.00 ? 39  VAL A HG13 6  
ATOM 9347  H HG21 . VAL A 1 39  ? 13.885  -9.078  -1.564  1.00 0.00 ? 39  VAL A HG21 6  
ATOM 9348  H HG22 . VAL A 1 39  ? 13.198  -7.630  -2.301  1.00 0.00 ? 39  VAL A HG22 6  
ATOM 9349  H HG23 . VAL A 1 39  ? 14.888  -7.647  -1.797  1.00 0.00 ? 39  VAL A HG23 6  
ATOM 9350  N N    . ILE A 1 40  ? 15.973  -9.356  -0.445  1.00 0.00 ? 40  ILE A N    6  
ATOM 9351  C CA   . ILE A 1 40  ? 17.239  -9.680  -1.092  1.00 0.00 ? 40  ILE A CA   6  
ATOM 9352  C C    . ILE A 1 40  ? 17.015  -10.481 -2.370  1.00 0.00 ? 40  ILE A C    6  
ATOM 9353  O O    . ILE A 1 40  ? 16.072  -11.268 -2.465  1.00 0.00 ? 40  ILE A O    6  
ATOM 9354  C CB   . ILE A 1 40  ? 18.162  -10.479 -0.153  1.00 0.00 ? 40  ILE A CB   6  
ATOM 9355  C CG1  . ILE A 1 40  ? 18.342  -9.738  1.173   1.00 0.00 ? 40  ILE A CG1  6  
ATOM 9356  C CG2  . ILE A 1 40  ? 19.509  -10.723 -0.817  1.00 0.00 ? 40  ILE A CG2  6  
ATOM 9357  C CD1  . ILE A 1 40  ? 19.152  -8.466  1.050   1.00 0.00 ? 40  ILE A CD1  6  
ATOM 9358  H H    . ILE A 1 40  ? 15.216  -9.970  -0.543  1.00 0.00 ? 40  ILE A H    6  
ATOM 9359  H HA   . ILE A 1 40  ? 17.731  -8.751  -1.344  1.00 0.00 ? 40  ILE A HA   6  
ATOM 9360  H HB   . ILE A 1 40  ? 17.703  -11.437 0.037   1.00 0.00 ? 40  ILE A HB   6  
ATOM 9361  H HG12 . ILE A 1 40  ? 17.372  -9.476  1.567   1.00 0.00 ? 40  ILE A HG12 6  
ATOM 9362  H HG13 . ILE A 1 40  ? 18.847  -10.387 1.874   1.00 0.00 ? 40  ILE A HG13 6  
ATOM 9363  H HG21 . ILE A 1 40  ? 19.812  -9.835  -1.353  1.00 0.00 ? 40  ILE A HG21 6  
ATOM 9364  H HG22 . ILE A 1 40  ? 20.245  -10.955 -0.062  1.00 0.00 ? 40  ILE A HG22 6  
ATOM 9365  H HG23 . ILE A 1 40  ? 19.427  -11.549 -1.507  1.00 0.00 ? 40  ILE A HG23 6  
ATOM 9366  H HD11 . ILE A 1 40  ? 20.203  -8.699  1.141   1.00 0.00 ? 40  ILE A HD11 6  
ATOM 9367  H HD12 . ILE A 1 40  ? 18.967  -8.013  0.087   1.00 0.00 ? 40  ILE A HD12 6  
ATOM 9368  H HD13 . ILE A 1 40  ? 18.866  -7.780  1.832   1.00 0.00 ? 40  ILE A HD13 6  
ATOM 9369  N N    . LYS A 1 41  ? 17.888  -10.278 -3.350  1.00 0.00 ? 41  LYS A N    6  
ATOM 9370  C CA   . LYS A 1 41  ? 17.789  -10.983 -4.623  1.00 0.00 ? 41  LYS A CA   6  
ATOM 9371  C C    . LYS A 1 41  ? 17.257  -12.398 -4.420  1.00 0.00 ? 41  LYS A C    6  
ATOM 9372  O O    . LYS A 1 41  ? 16.393  -12.859 -5.167  1.00 0.00 ? 41  LYS A O    6  
ATOM 9373  C CB   . LYS A 1 41  ? 19.156  -11.034 -5.309  1.00 0.00 ? 41  LYS A CB   6  
ATOM 9374  C CG   . LYS A 1 41  ? 20.307  -11.288 -4.352  1.00 0.00 ? 41  LYS A CG   6  
ATOM 9375  C CD   . LYS A 1 41  ? 20.736  -12.745 -4.369  1.00 0.00 ? 41  LYS A CD   6  
ATOM 9376  C CE   . LYS A 1 41  ? 21.773  -13.008 -5.450  1.00 0.00 ? 41  LYS A CE   6  
ATOM 9377  N NZ   . LYS A 1 41  ? 22.861  -11.992 -5.434  1.00 0.00 ? 41  LYS A NZ   6  
ATOM 9378  H H    . LYS A 1 41  ? 18.618  -9.637  -3.214  1.00 0.00 ? 41  LYS A H    6  
ATOM 9379  H HA   . LYS A 1 41  ? 17.100  -10.438 -5.251  1.00 0.00 ? 41  LYS A HA   6  
ATOM 9380  H HB2  . LYS A 1 41  ? 19.146  -11.824 -6.045  1.00 0.00 ? 41  LYS A HB2  6  
ATOM 9381  H HB3  . LYS A 1 41  ? 19.330  -10.091 -5.807  1.00 0.00 ? 41  LYS A HB3  6  
ATOM 9382  H HG2  . LYS A 1 41  ? 21.147  -10.673 -4.642  1.00 0.00 ? 41  LYS A HG2  6  
ATOM 9383  H HG3  . LYS A 1 41  ? 19.996  -11.025 -3.351  1.00 0.00 ? 41  LYS A HG3  6  
ATOM 9384  H HD2  . LYS A 1 41  ? 21.161  -12.998 -3.409  1.00 0.00 ? 41  LYS A HD2  6  
ATOM 9385  H HD3  . LYS A 1 41  ? 19.870  -13.364 -4.556  1.00 0.00 ? 41  LYS A HD3  6  
ATOM 9386  H HE2  . LYS A 1 41  ? 22.203  -13.985 -5.288  1.00 0.00 ? 41  LYS A HE2  6  
ATOM 9387  H HE3  . LYS A 1 41  ? 21.285  -12.985 -6.413  1.00 0.00 ? 41  LYS A HE3  6  
ATOM 9388  H HZ1  . LYS A 1 41  ? 22.866  -11.487 -4.525  1.00 0.00 ? 41  LYS A HZ1  6  
ATOM 9389  H HZ2  . LYS A 1 41  ? 22.718  -11.303 -6.200  1.00 0.00 ? 41  LYS A HZ2  6  
ATOM 9390  H HZ3  . LYS A 1 41  ? 23.784  -12.453 -5.567  1.00 0.00 ? 41  LYS A HZ3  6  
ATOM 9391  N N    . ARG A 1 42  ? 17.776  -13.081 -3.406  1.00 0.00 ? 42  ARG A N    6  
ATOM 9392  C CA   . ARG A 1 42  ? 17.353  -14.444 -3.106  1.00 0.00 ? 42  ARG A CA   6  
ATOM 9393  C C    . ARG A 1 42  ? 17.848  -14.876 -1.728  1.00 0.00 ? 42  ARG A C    6  
ATOM 9394  O O    . ARG A 1 42  ? 18.440  -14.085 -0.993  1.00 0.00 ? 42  ARG A O    6  
ATOM 9395  C CB   . ARG A 1 42  ? 17.873  -15.409 -4.172  1.00 0.00 ? 42  ARG A CB   6  
ATOM 9396  C CG   . ARG A 1 42  ? 17.047  -15.409 -5.448  1.00 0.00 ? 42  ARG A CG   6  
ATOM 9397  C CD   . ARG A 1 42  ? 17.141  -16.743 -6.173  1.00 0.00 ? 42  ARG A CD   6  
ATOM 9398  N NE   . ARG A 1 42  ? 18.525  -17.181 -6.335  1.00 0.00 ? 42  ARG A NE   6  
ATOM 9399  C CZ   . ARG A 1 42  ? 18.867  -18.406 -6.719  1.00 0.00 ? 42  ARG A CZ   6  
ATOM 9400  N NH1  . ARG A 1 42  ? 17.932  -19.309 -6.979  1.00 0.00 ? 42  ARG A NH1  6  
ATOM 9401  N NH2  . ARG A 1 42  ? 20.148  -18.730 -6.843  1.00 0.00 ? 42  ARG A NH2  6  
ATOM 9402  H H    . ARG A 1 42  ? 18.462  -12.660 -2.846  1.00 0.00 ? 42  ARG A H    6  
ATOM 9403  H HA   . ARG A 1 42  ? 16.273  -14.464 -3.110  1.00 0.00 ? 42  ARG A HA   6  
ATOM 9404  H HB2  . ARG A 1 42  ? 18.887  -15.135 -4.426  1.00 0.00 ? 42  ARG A HB2  6  
ATOM 9405  H HB3  . ARG A 1 42  ? 17.870  -16.409 -3.767  1.00 0.00 ? 42  ARG A HB3  6  
ATOM 9406  H HG2  . ARG A 1 42  ? 16.014  -15.220 -5.198  1.00 0.00 ? 42  ARG A HG2  6  
ATOM 9407  H HG3  . ARG A 1 42  ? 17.410  -14.628 -6.101  1.00 0.00 ? 42  ARG A HG3  6  
ATOM 9408  H HD2  . ARG A 1 42  ? 16.603  -17.485 -5.603  1.00 0.00 ? 42  ARG A HD2  6  
ATOM 9409  H HD3  . ARG A 1 42  ? 16.689  -16.640 -7.148  1.00 0.00 ? 42  ARG A HD3  6  
ATOM 9410  H HE   . ARG A 1 42  ? 19.232  -16.530 -6.147  1.00 0.00 ? 42  ARG A HE   6  
ATOM 9411  H HH11 . ARG A 1 42  ? 16.966  -19.067 -6.887  1.00 0.00 ? 42  ARG A HH11 6  
ATOM 9412  H HH12 . ARG A 1 42  ? 18.192  -20.230 -7.269  1.00 0.00 ? 42  ARG A HH12 6  
ATOM 9413  H HH21 . ARG A 1 42  ? 20.856  -18.052 -6.648  1.00 0.00 ? 42  ARG A HH21 6  
ATOM 9414  H HH22 . ARG A 1 42  ? 20.405  -19.652 -7.132  1.00 0.00 ? 42  ARG A HH22 6  
ATOM 9415  N N    . LEU A 1 43  ? 17.600  -16.135 -1.385  1.00 0.00 ? 43  LEU A N    6  
ATOM 9416  C CA   . LEU A 1 43  ? 18.020  -16.673 -0.096  1.00 0.00 ? 43  LEU A CA   6  
ATOM 9417  C C    . LEU A 1 43  ? 17.385  -15.895 1.052   1.00 0.00 ? 43  LEU A C    6  
ATOM 9418  O O    . LEU A 1 43  ? 18.055  -15.542 2.023   1.00 0.00 ? 43  LEU A O    6  
ATOM 9419  C CB   . LEU A 1 43  ? 19.545  -16.630 0.025   1.00 0.00 ? 43  LEU A CB   6  
ATOM 9420  C CG   . LEU A 1 43  ? 20.322  -17.501 -0.963  1.00 0.00 ? 43  LEU A CG   6  
ATOM 9421  C CD1  . LEU A 1 43  ? 19.718  -17.397 -2.355  1.00 0.00 ? 43  LEU A CD1  6  
ATOM 9422  C CD2  . LEU A 1 43  ? 21.790  -17.102 -0.986  1.00 0.00 ? 43  LEU A CD2  6  
ATOM 9423  H H    . LEU A 1 43  ? 17.125  -16.718 -2.013  1.00 0.00 ? 43  LEU A H    6  
ATOM 9424  H HA   . LEU A 1 43  ? 17.692  -17.701 -0.043  1.00 0.00 ? 43  LEU A HA   6  
ATOM 9425  H HB2  . LEU A 1 43  ? 19.859  -15.607 -0.118  1.00 0.00 ? 43  LEU A HB2  6  
ATOM 9426  H HB3  . LEU A 1 43  ? 19.806  -16.948 1.024   1.00 0.00 ? 43  LEU A HB3  6  
ATOM 9427  H HG   . LEU A 1 43  ? 20.259  -18.534 -0.649  1.00 0.00 ? 43  LEU A HG   6  
ATOM 9428  H HD11 . LEU A 1 43  ? 18.744  -17.862 -2.361  1.00 0.00 ? 43  LEU A HD11 6  
ATOM 9429  H HD12 . LEU A 1 43  ? 20.360  -17.898 -3.064  1.00 0.00 ? 43  LEU A HD12 6  
ATOM 9430  H HD13 . LEU A 1 43  ? 19.623  -16.356 -2.629  1.00 0.00 ? 43  LEU A HD13 6  
ATOM 9431  H HD21 . LEU A 1 43  ? 21.969  -16.433 -1.814  1.00 0.00 ? 43  LEU A HD21 6  
ATOM 9432  H HD22 . LEU A 1 43  ? 22.401  -17.986 -1.097  1.00 0.00 ? 43  LEU A HD22 6  
ATOM 9433  H HD23 . LEU A 1 43  ? 22.042  -16.604 -0.060  1.00 0.00 ? 43  LEU A HD23 6  
ATOM 9434  N N    . LYS A 1 44  ? 16.088  -15.631 0.935   1.00 0.00 ? 44  LYS A N    6  
ATOM 9435  C CA   . LYS A 1 44  ? 15.360  -14.898 1.964   1.00 0.00 ? 44  LYS A CA   6  
ATOM 9436  C C    . LYS A 1 44  ? 14.292  -15.777 2.606   1.00 0.00 ? 44  LYS A C    6  
ATOM 9437  O O    . LYS A 1 44  ? 13.515  -16.432 1.912   1.00 0.00 ? 44  LYS A O    6  
ATOM 9438  C CB   . LYS A 1 44  ? 14.714  -13.646 1.366   1.00 0.00 ? 44  LYS A CB   6  
ATOM 9439  C CG   . LYS A 1 44  ? 14.387  -12.580 2.396   1.00 0.00 ? 44  LYS A CG   6  
ATOM 9440  C CD   . LYS A 1 44  ? 15.563  -11.645 2.624   1.00 0.00 ? 44  LYS A CD   6  
ATOM 9441  C CE   . LYS A 1 44  ? 15.511  -11.012 4.007   1.00 0.00 ? 44  LYS A CE   6  
ATOM 9442  N NZ   . LYS A 1 44  ? 15.662  -12.026 5.087   1.00 0.00 ? 44  LYS A NZ   6  
ATOM 9443  H H    . LYS A 1 44  ? 15.608  -15.939 0.137   1.00 0.00 ? 44  LYS A H    6  
ATOM 9444  H HA   . LYS A 1 44  ? 16.068  -14.600 2.722   1.00 0.00 ? 44  LYS A HA   6  
ATOM 9445  H HB2  . LYS A 1 44  ? 15.389  -13.220 0.638   1.00 0.00 ? 44  LYS A HB2  6  
ATOM 9446  H HB3  . LYS A 1 44  ? 13.797  -13.931 0.870   1.00 0.00 ? 44  LYS A HB3  6  
ATOM 9447  H HG2  . LYS A 1 44  ? 13.544  -12.002 2.047   1.00 0.00 ? 44  LYS A HG2  6  
ATOM 9448  H HG3  . LYS A 1 44  ? 14.134  -13.060 3.331   1.00 0.00 ? 44  LYS A HG3  6  
ATOM 9449  H HD2  . LYS A 1 44  ? 16.481  -12.206 2.532   1.00 0.00 ? 44  LYS A HD2  6  
ATOM 9450  H HD3  . LYS A 1 44  ? 15.540  -10.863 1.879   1.00 0.00 ? 44  LYS A HD3  6  
ATOM 9451  H HE2  . LYS A 1 44  ? 16.310  -10.291 4.088   1.00 0.00 ? 44  LYS A HE2  6  
ATOM 9452  H HE3  . LYS A 1 44  ? 14.562  -10.512 4.124   1.00 0.00 ? 44  LYS A HE3  6  
ATOM 9453  H HZ1  . LYS A 1 44  ? 14.738  -12.230 5.518   1.00 0.00 ? 44  LYS A HZ1  6  
ATOM 9454  H HZ2  . LYS A 1 44  ? 16.306  -11.671 5.823   1.00 0.00 ? 44  LYS A HZ2  6  
ATOM 9455  H HZ3  . LYS A 1 44  ? 16.053  -12.908 4.697   1.00 0.00 ? 44  LYS A HZ3  6  
ATOM 9456  N N    . ASN A 1 45  ? 14.260  -15.786 3.934   1.00 0.00 ? 45  ASN A N    6  
ATOM 9457  C CA   . ASN A 1 45  ? 13.286  -16.585 4.670   1.00 0.00 ? 45  ASN A CA   6  
ATOM 9458  C C    . ASN A 1 45  ? 12.019  -15.780 4.945   1.00 0.00 ? 45  ASN A C    6  
ATOM 9459  O O    . ASN A 1 45  ? 11.970  -14.576 4.697   1.00 0.00 ? 45  ASN A O    6  
ATOM 9460  C CB   . ASN A 1 45  ? 13.888  -17.075 5.988   1.00 0.00 ? 45  ASN A CB   6  
ATOM 9461  C CG   . ASN A 1 45  ? 13.235  -18.351 6.483   1.00 0.00 ? 45  ASN A CG   6  
ATOM 9462  O OD1  . ASN A 1 45  ? 12.661  -19.111 5.703   1.00 0.00 ? 45  ASN A OD1  6  
ATOM 9463  N ND2  . ASN A 1 45  ? 13.319  -18.591 7.786   1.00 0.00 ? 45  ASN A ND2  6  
ATOM 9464  H H    . ASN A 1 45  ? 14.906  -15.243 4.432   1.00 0.00 ? 45  ASN A H    6  
ATOM 9465  H HA   . ASN A 1 45  ? 13.030  -17.439 4.061   1.00 0.00 ? 45  ASN A HA   6  
ATOM 9466  H HB2  . ASN A 1 45  ? 14.942  -17.265 5.846   1.00 0.00 ? 45  ASN A HB2  6  
ATOM 9467  H HB3  . ASN A 1 45  ? 13.762  -16.312 6.741   1.00 0.00 ? 45  ASN A HB3  6  
ATOM 9468  H HD21 . ASN A 1 45  ? 13.791  -17.941 8.348   1.00 0.00 ? 45  ASN A HD21 6  
ATOM 9469  H HD22 . ASN A 1 45  ? 12.906  -19.409 8.133   1.00 0.00 ? 45  ASN A HD22 6  
ATOM 9470  N N    . GLY A 1 46  ? 10.996  -16.455 5.460   1.00 0.00 ? 46  GLY A N    6  
ATOM 9471  C CA   . GLY A 1 46  ? 9.743   -15.787 5.761   1.00 0.00 ? 46  GLY A CA   6  
ATOM 9472  C C    . GLY A 1 46  ? 8.633   -16.762 6.102   1.00 0.00 ? 46  GLY A C    6  
ATOM 9473  O O    . GLY A 1 46  ? 8.260   -17.598 5.280   1.00 0.00 ? 46  GLY A O    6  
ATOM 9474  H H    . GLY A 1 46  ? 11.092  -17.414 5.637   1.00 0.00 ? 46  GLY A H    6  
ATOM 9475  H HA2  . GLY A 1 46  ? 9.894   -15.122 6.599   1.00 0.00 ? 46  GLY A HA2  6  
ATOM 9476  H HA3  . GLY A 1 46  ? 9.443   -15.204 4.902   1.00 0.00 ? 46  GLY A HA3  6  
ATOM 9477  N N    . GLU A 1 47  ? 8.106   -16.655 7.317   1.00 0.00 ? 47  GLU A N    6  
ATOM 9478  C CA   . GLU A 1 47  ? 7.034   -17.536 7.765   1.00 0.00 ? 47  GLU A CA   6  
ATOM 9479  C C    . GLU A 1 47  ? 5.716   -17.178 7.086   1.00 0.00 ? 47  GLU A C    6  
ATOM 9480  O O    . GLU A 1 47  ? 4.746   -17.932 7.154   1.00 0.00 ? 47  GLU A O    6  
ATOM 9481  C CB   . GLU A 1 47  ? 6.877   -17.454 9.284   1.00 0.00 ? 47  GLU A CB   6  
ATOM 9482  C CG   . GLU A 1 47  ? 5.437   -17.574 9.755   1.00 0.00 ? 47  GLU A CG   6  
ATOM 9483  C CD   . GLU A 1 47  ? 4.851   -18.949 9.497   1.00 0.00 ? 47  GLU A CD   6  
ATOM 9484  O OE1  . GLU A 1 47  ? 5.555   -19.950 9.745   1.00 0.00 ? 47  GLU A OE1  6  
ATOM 9485  O OE2  . GLU A 1 47  ? 3.689   -19.023 9.048   1.00 0.00 ? 47  GLU A OE2  6  
ATOM 9486  H H    . GLU A 1 47  ? 8.446   -15.967 7.927   1.00 0.00 ? 47  GLU A H    6  
ATOM 9487  H HA   . GLU A 1 47  ? 7.301   -18.547 7.494   1.00 0.00 ? 47  GLU A HA   6  
ATOM 9488  H HB2  . GLU A 1 47  ? 7.449   -18.250 9.737   1.00 0.00 ? 47  GLU A HB2  6  
ATOM 9489  H HB3  . GLU A 1 47  ? 7.266   -16.505 9.623   1.00 0.00 ? 47  GLU A HB3  6  
ATOM 9490  H HG2  . GLU A 1 47  ? 5.400   -17.377 10.816  1.00 0.00 ? 47  GLU A HG2  6  
ATOM 9491  H HG3  . GLU A 1 47  ? 4.839   -16.841 9.233   1.00 0.00 ? 47  GLU A HG3  6  
ATOM 9492  N N    . GLU A 1 48  ? 5.689   -16.021 6.431   1.00 0.00 ? 48  GLU A N    6  
ATOM 9493  C CA   . GLU A 1 48  ? 4.489   -15.561 5.741   1.00 0.00 ? 48  GLU A CA   6  
ATOM 9494  C C    . GLU A 1 48  ? 4.796   -15.218 4.287   1.00 0.00 ? 48  GLU A C    6  
ATOM 9495  O O    . GLU A 1 48  ? 5.915   -15.420 3.812   1.00 0.00 ? 48  GLU A O    6  
ATOM 9496  C CB   . GLU A 1 48  ? 3.901   -14.340 6.452   1.00 0.00 ? 48  GLU A CB   6  
ATOM 9497  C CG   . GLU A 1 48  ? 3.103   -14.687 7.697   1.00 0.00 ? 48  GLU A CG   6  
ATOM 9498  C CD   . GLU A 1 48  ? 1.666   -15.057 7.385   1.00 0.00 ? 48  GLU A CD   6  
ATOM 9499  O OE1  . GLU A 1 48  ? 0.835   -14.135 7.242   1.00 0.00 ? 48  GLU A OE1  6  
ATOM 9500  O OE2  . GLU A 1 48  ? 1.372   -16.266 7.283   1.00 0.00 ? 48  GLU A OE2  6  
ATOM 9501  H H    . GLU A 1 48  ? 6.495   -15.463 6.413   1.00 0.00 ? 48  GLU A H    6  
ATOM 9502  H HA   . GLU A 1 48  ? 3.766   -16.362 5.765   1.00 0.00 ? 48  GLU A HA   6  
ATOM 9503  H HB2  . GLU A 1 48  ? 4.708   -13.682 6.738   1.00 0.00 ? 48  GLU A HB2  6  
ATOM 9504  H HB3  . GLU A 1 48  ? 3.250   -13.819 5.766   1.00 0.00 ? 48  GLU A HB3  6  
ATOM 9505  H HG2  . GLU A 1 48  ? 3.574   -15.524 8.190   1.00 0.00 ? 48  GLU A HG2  6  
ATOM 9506  H HG3  . GLU A 1 48  ? 3.104   -13.834 8.359   1.00 0.00 ? 48  GLU A HG3  6  
ATOM 9507  N N    . LEU A 1 49  ? 3.796   -14.698 3.584   1.00 0.00 ? 49  LEU A N    6  
ATOM 9508  C CA   . LEU A 1 49  ? 3.957   -14.326 2.183   1.00 0.00 ? 49  LEU A CA   6  
ATOM 9509  C C    . LEU A 1 49  ? 4.827   -13.080 2.047   1.00 0.00 ? 49  LEU A C    6  
ATOM 9510  O O    . LEU A 1 49  ? 5.112   -12.398 3.031   1.00 0.00 ? 49  LEU A O    6  
ATOM 9511  C CB   . LEU A 1 49  ? 2.591   -14.082 1.539   1.00 0.00 ? 49  LEU A CB   6  
ATOM 9512  C CG   . LEU A 1 49  ? 1.648   -13.150 2.300   1.00 0.00 ? 49  LEU A CG   6  
ATOM 9513  C CD1  . LEU A 1 49  ? 0.786   -13.941 3.272   1.00 0.00 ? 49  LEU A CD1  6  
ATOM 9514  C CD2  . LEU A 1 49  ? 2.436   -12.077 3.036   1.00 0.00 ? 49  LEU A CD2  6  
ATOM 9515  H H    . LEU A 1 49  ? 2.928   -14.560 4.017   1.00 0.00 ? 49  LEU A H    6  
ATOM 9516  H HA   . LEU A 1 49  ? 4.443   -15.146 1.676   1.00 0.00 ? 49  LEU A HA   6  
ATOM 9517  H HB2  . LEU A 1 49  ? 2.758   -13.656 0.561   1.00 0.00 ? 49  LEU A HB2  6  
ATOM 9518  H HB3  . LEU A 1 49  ? 2.100   -15.039 1.434   1.00 0.00 ? 49  LEU A HB3  6  
ATOM 9519  H HG   . LEU A 1 49  ? 0.990   -12.659 1.595   1.00 0.00 ? 49  LEU A HG   6  
ATOM 9520  H HD11 . LEU A 1 49  ? 1.134   -13.775 4.280   1.00 0.00 ? 49  LEU A HD11 6  
ATOM 9521  H HD12 . LEU A 1 49  ? 0.851   -14.993 3.037   1.00 0.00 ? 49  LEU A HD12 6  
ATOM 9522  H HD13 . LEU A 1 49  ? -0.241  -13.617 3.188   1.00 0.00 ? 49  LEU A HD13 6  
ATOM 9523  H HD21 . LEU A 1 49  ? 3.066   -11.549 2.336   1.00 0.00 ? 49  LEU A HD21 6  
ATOM 9524  H HD22 . LEU A 1 49  ? 3.050   -12.539 3.795   1.00 0.00 ? 49  LEU A HD22 6  
ATOM 9525  H HD23 . LEU A 1 49  ? 1.752   -11.382 3.500   1.00 0.00 ? 49  LEU A HD23 6  
ATOM 9526  N N    . LYS A 1 50  ? 5.243   -12.787 0.820   1.00 0.00 ? 50  LYS A N    6  
ATOM 9527  C CA   . LYS A 1 50  ? 6.077   -11.621 0.552   1.00 0.00 ? 50  LYS A CA   6  
ATOM 9528  C C    . LYS A 1 50  ? 5.333   -10.606 -0.311  1.00 0.00 ? 50  LYS A C    6  
ATOM 9529  O O    . LYS A 1 50  ? 4.651   -10.972 -1.267  1.00 0.00 ? 50  LYS A O    6  
ATOM 9530  C CB   . LYS A 1 50  ? 7.373   -12.043 -0.142  1.00 0.00 ? 50  LYS A CB   6  
ATOM 9531  C CG   . LYS A 1 50  ? 8.007   -10.940 -0.971  1.00 0.00 ? 50  LYS A CG   6  
ATOM 9532  C CD   . LYS A 1 50  ? 8.501   -9.800  -0.097  1.00 0.00 ? 50  LYS A CD   6  
ATOM 9533  C CE   . LYS A 1 50  ? 9.938   -10.022 0.350   1.00 0.00 ? 50  LYS A CE   6  
ATOM 9534  N NZ   . LYS A 1 50  ? 10.031  -11.041 1.433   1.00 0.00 ? 50  LYS A NZ   6  
ATOM 9535  H H    . LYS A 1 50  ? 4.982   -13.368 0.074   1.00 0.00 ? 50  LYS A H    6  
ATOM 9536  H HA   . LYS A 1 50  ? 6.318   -11.161 1.499   1.00 0.00 ? 50  LYS A HA   6  
ATOM 9537  H HB2  . LYS A 1 50  ? 8.084   -12.355 0.609   1.00 0.00 ? 50  LYS A HB2  6  
ATOM 9538  H HB3  . LYS A 1 50  ? 7.162   -12.879 -0.795  1.00 0.00 ? 50  LYS A HB3  6  
ATOM 9539  H HG2  . LYS A 1 50  ? 8.844   -11.348 -1.518  1.00 0.00 ? 50  LYS A HG2  6  
ATOM 9540  H HG3  . LYS A 1 50  ? 7.273   -10.557 -1.666  1.00 0.00 ? 50  LYS A HG3  6  
ATOM 9541  H HD2  . LYS A 1 50  ? 8.449   -8.878  -0.658  1.00 0.00 ? 50  LYS A HD2  6  
ATOM 9542  H HD3  . LYS A 1 50  ? 7.869   -9.727  0.777   1.00 0.00 ? 50  LYS A HD3  6  
ATOM 9543  H HE2  . LYS A 1 50  ? 10.517  -10.356 -0.497  1.00 0.00 ? 50  LYS A HE2  6  
ATOM 9544  H HE3  . LYS A 1 50  ? 10.337  -9.086  0.713   1.00 0.00 ? 50  LYS A HE3  6  
ATOM 9545  H HZ1  . LYS A 1 50  ? 10.194  -11.983 1.024   1.00 0.00 ? 50  LYS A HZ1  6  
ATOM 9546  H HZ2  . LYS A 1 50  ? 9.147   -11.061 1.981   1.00 0.00 ? 50  LYS A HZ2  6  
ATOM 9547  H HZ3  . LYS A 1 50  ? 10.817  -10.811 2.073   1.00 0.00 ? 50  LYS A HZ3  6  
ATOM 9548  N N    . GLY A 1 51  ? 5.470   -9.329  0.034   1.00 0.00 ? 51  GLY A N    6  
ATOM 9549  C CA   . GLY A 1 51  ? 4.807   -8.282  -0.721  1.00 0.00 ? 51  GLY A CA   6  
ATOM 9550  C C    . GLY A 1 51  ? 4.195   -7.222  0.174   1.00 0.00 ? 51  GLY A C    6  
ATOM 9551  O O    . GLY A 1 51  ? 3.945   -7.465  1.354   1.00 0.00 ? 51  GLY A O    6  
ATOM 9552  H H    . GLY A 1 51  ? 6.026   -9.096  0.806   1.00 0.00 ? 51  GLY A H    6  
ATOM 9553  H HA2  . GLY A 1 51  ? 5.526   -7.814  -1.376  1.00 0.00 ? 51  GLY A HA2  6  
ATOM 9554  H HA3  . GLY A 1 51  ? 4.025   -8.726  -1.319  1.00 0.00 ? 51  GLY A HA3  6  
ATOM 9555  N N    . ILE A 1 52  ? 3.955   -6.042  -0.389  1.00 0.00 ? 52  ILE A N    6  
ATOM 9556  C CA   . ILE A 1 52  ? 3.370   -4.941  0.366   1.00 0.00 ? 52  ILE A CA   6  
ATOM 9557  C C    . ILE A 1 52  ? 1.855   -5.086  0.464   1.00 0.00 ? 52  ILE A C    6  
ATOM 9558  O O    . ILE A 1 52  ? 1.191   -5.451  -0.506  1.00 0.00 ? 52  ILE A O    6  
ATOM 9559  C CB   . ILE A 1 52  ? 3.703   -3.580  -0.273  1.00 0.00 ? 52  ILE A CB   6  
ATOM 9560  C CG1  . ILE A 1 52  ? 5.199   -3.490  -0.581  1.00 0.00 ? 52  ILE A CG1  6  
ATOM 9561  C CG2  . ILE A 1 52  ? 3.277   -2.445  0.646   1.00 0.00 ? 52  ILE A CG2  6  
ATOM 9562  C CD1  . ILE A 1 52  ? 6.080   -3.711  0.629   1.00 0.00 ? 52  ILE A CD1  6  
ATOM 9563  H H    . ILE A 1 52  ? 4.176   -5.910  -1.334  1.00 0.00 ? 52  ILE A H    6  
ATOM 9564  H HA   . ILE A 1 52  ? 3.788   -4.961  1.362   1.00 0.00 ? 52  ILE A HA   6  
ATOM 9565  H HB   . ILE A 1 52  ? 3.148   -3.494  -1.194  1.00 0.00 ? 52  ILE A HB   6  
ATOM 9566  H HG12 . ILE A 1 52  ? 5.455   -4.236  -1.316  1.00 0.00 ? 52  ILE A HG12 6  
ATOM 9567  H HG13 . ILE A 1 52  ? 5.419   -2.509  -0.977  1.00 0.00 ? 52  ILE A HG13 6  
ATOM 9568  H HG21 . ILE A 1 52  ? 3.038   -1.574  0.054   1.00 0.00 ? 52  ILE A HG21 6  
ATOM 9569  H HG22 . ILE A 1 52  ? 2.406   -2.746  1.209   1.00 0.00 ? 52  ILE A HG22 6  
ATOM 9570  H HG23 . ILE A 1 52  ? 4.082   -2.210  1.326   1.00 0.00 ? 52  ILE A HG23 6  
ATOM 9571  H HD11 . ILE A 1 52  ? 6.518   -4.697  0.580   1.00 0.00 ? 52  ILE A HD11 6  
ATOM 9572  H HD12 . ILE A 1 52  ? 6.865   -2.969  0.644   1.00 0.00 ? 52  ILE A HD12 6  
ATOM 9573  H HD13 . ILE A 1 52  ? 5.487   -3.626  1.527   1.00 0.00 ? 52  ILE A HD13 6  
ATOM 9574  N N    . PHE A 1 53  ? 1.313   -4.796  1.643   1.00 0.00 ? 53  PHE A N    6  
ATOM 9575  C CA   . PHE A 1 53  ? -0.124  -4.893  1.869   1.00 0.00 ? 53  PHE A CA   6  
ATOM 9576  C C    . PHE A 1 53  ? -0.662  -3.614  2.503   1.00 0.00 ? 53  PHE A C    6  
ATOM 9577  O O    . PHE A 1 53  ? -0.056  -3.061  3.420   1.00 0.00 ? 53  PHE A O    6  
ATOM 9578  C CB   . PHE A 1 53  ? -0.441  -6.093  2.764   1.00 0.00 ? 53  PHE A CB   6  
ATOM 9579  C CG   . PHE A 1 53  ? 0.143   -7.384  2.267   1.00 0.00 ? 53  PHE A CG   6  
ATOM 9580  C CD1  . PHE A 1 53  ? 1.448   -7.733  2.574   1.00 0.00 ? 53  PHE A CD1  6  
ATOM 9581  C CD2  . PHE A 1 53  ? -0.613  -8.249  1.492   1.00 0.00 ? 53  PHE A CD2  6  
ATOM 9582  C CE1  . PHE A 1 53  ? 1.989   -8.919  2.117   1.00 0.00 ? 53  PHE A CE1  6  
ATOM 9583  C CE2  . PHE A 1 53  ? -0.078  -9.437  1.032   1.00 0.00 ? 53  PHE A CE2  6  
ATOM 9584  C CZ   . PHE A 1 53  ? 1.224   -9.773  1.346   1.00 0.00 ? 53  PHE A CZ   6  
ATOM 9585  H H    . PHE A 1 53  ? 1.895   -4.511  2.379   1.00 0.00 ? 53  PHE A H    6  
ATOM 9586  H HA   . PHE A 1 53  ? -0.600  -5.034  0.911   1.00 0.00 ? 53  PHE A HA   6  
ATOM 9587  H HB2  . PHE A 1 53  ? -0.046  -5.909  3.752   1.00 0.00 ? 53  PHE A HB2  6  
ATOM 9588  H HB3  . PHE A 1 53  ? -1.512  -6.213  2.826   1.00 0.00 ? 53  PHE A HB3  6  
ATOM 9589  H HD1  . PHE A 1 53  ? 2.047   -7.066  3.178   1.00 0.00 ? 53  PHE A HD1  6  
ATOM 9590  H HD2  . PHE A 1 53  ? -1.632  -7.986  1.246   1.00 0.00 ? 53  PHE A HD2  6  
ATOM 9591  H HE1  . PHE A 1 53  ? 3.007   -9.180  2.364   1.00 0.00 ? 53  PHE A HE1  6  
ATOM 9592  H HE2  . PHE A 1 53  ? -0.679  -10.102 0.430   1.00 0.00 ? 53  PHE A HE2  6  
ATOM 9593  H HZ   . PHE A 1 53  ? 1.644   -10.701 0.987   1.00 0.00 ? 53  PHE A HZ   6  
ATOM 9594  N N    . ILE A 1 54  ? -1.805  -3.150  2.007   1.00 0.00 ? 54  ILE A N    6  
ATOM 9595  C CA   . ILE A 1 54  ? -2.425  -1.937  2.524   1.00 0.00 ? 54  ILE A CA   6  
ATOM 9596  C C    . ILE A 1 54  ? -2.556  -1.992  4.043   1.00 0.00 ? 54  ILE A C    6  
ATOM 9597  O O    . ILE A 1 54  ? -2.999  -2.994  4.604   1.00 0.00 ? 54  ILE A O    6  
ATOM 9598  C CB   . ILE A 1 54  ? -3.818  -1.711  1.909   1.00 0.00 ? 54  ILE A CB   6  
ATOM 9599  C CG1  . ILE A 1 54  ? -3.731  -1.708  0.381   1.00 0.00 ? 54  ILE A CG1  6  
ATOM 9600  C CG2  . ILE A 1 54  ? -4.414  -0.405  2.412   1.00 0.00 ? 54  ILE A CG2  6  
ATOM 9601  C CD1  . ILE A 1 54  ? -4.988  -1.208  -0.296  1.00 0.00 ? 54  ILE A CD1  6  
ATOM 9602  H H    . ILE A 1 54  ? -2.240  -3.636  1.276   1.00 0.00 ? 54  ILE A H    6  
ATOM 9603  H HA   . ILE A 1 54  ? -1.795  -1.101  2.257   1.00 0.00 ? 54  ILE A HA   6  
ATOM 9604  H HB   . ILE A 1 54  ? -4.462  -2.518  2.224   1.00 0.00 ? 54  ILE A HB   6  
ATOM 9605  H HG12 . ILE A 1 54  ? -2.915  -1.074  0.074   1.00 0.00 ? 54  ILE A HG12 6  
ATOM 9606  H HG13 . ILE A 1 54  ? -3.546  -2.716  0.037   1.00 0.00 ? 54  ILE A HG13 6  
ATOM 9607  H HG21 . ILE A 1 54  ? -4.040  -0.197  3.404   1.00 0.00 ? 54  ILE A HG21 6  
ATOM 9608  H HG22 . ILE A 1 54  ? -4.134  0.398   1.748   1.00 0.00 ? 54  ILE A HG22 6  
ATOM 9609  H HG23 . ILE A 1 54  ? -5.490  -0.488  2.444   1.00 0.00 ? 54  ILE A HG23 6  
ATOM 9610  H HD11 . ILE A 1 54  ? -5.738  -0.995  0.452   1.00 0.00 ? 54  ILE A HD11 6  
ATOM 9611  H HD12 . ILE A 1 54  ? -4.765  -0.307  -0.848  1.00 0.00 ? 54  ILE A HD12 6  
ATOM 9612  H HD13 . ILE A 1 54  ? -5.359  -1.964  -0.972  1.00 0.00 ? 54  ILE A HD13 6  
ATOM 9613  N N    . LYS A 1 55  ? -2.167  -0.906  4.703   1.00 0.00 ? 55  LYS A N    6  
ATOM 9614  C CA   . LYS A 1 55  ? -2.243  -0.827  6.157   1.00 0.00 ? 55  LYS A CA   6  
ATOM 9615  C C    . LYS A 1 55  ? -3.542  -0.161  6.599   1.00 0.00 ? 55  LYS A C    6  
ATOM 9616  O O    . LYS A 1 55  ? -4.222  -0.647  7.503   1.00 0.00 ? 55  LYS A O    6  
ATOM 9617  C CB   . LYS A 1 55  ? -1.046  -0.049  6.709   1.00 0.00 ? 55  LYS A CB   6  
ATOM 9618  C CG   . LYS A 1 55  ? -1.291  0.549   8.084   1.00 0.00 ? 55  LYS A CG   6  
ATOM 9619  C CD   . LYS A 1 55  ? -1.753  -0.505  9.076   1.00 0.00 ? 55  LYS A CD   6  
ATOM 9620  C CE   . LYS A 1 55  ? -2.555  0.113   10.211  1.00 0.00 ? 55  LYS A CE   6  
ATOM 9621  N NZ   . LYS A 1 55  ? -1.675  0.749   11.230  1.00 0.00 ? 55  LYS A NZ   6  
ATOM 9622  H H    . LYS A 1 55  ? -1.822  -0.139  4.200   1.00 0.00 ? 55  LYS A H    6  
ATOM 9623  H HA   . LYS A 1 55  ? -2.218  -1.834  6.546   1.00 0.00 ? 55  LYS A HA   6  
ATOM 9624  H HB2  . LYS A 1 55  ? -0.198  -0.716  6.775   1.00 0.00 ? 55  LYS A HB2  6  
ATOM 9625  H HB3  . LYS A 1 55  ? -0.808  0.754   6.027   1.00 0.00 ? 55  LYS A HB3  6  
ATOM 9626  H HG2  . LYS A 1 55  ? -0.372  0.989   8.444   1.00 0.00 ? 55  LYS A HG2  6  
ATOM 9627  H HG3  . LYS A 1 55  ? -2.051  1.313   8.003   1.00 0.00 ? 55  LYS A HG3  6  
ATOM 9628  H HD2  . LYS A 1 55  ? -2.373  -1.224  8.562   1.00 0.00 ? 55  LYS A HD2  6  
ATOM 9629  H HD3  . LYS A 1 55  ? -0.887  -1.003  9.489   1.00 0.00 ? 55  LYS A HD3  6  
ATOM 9630  H HE2  . LYS A 1 55  ? -3.216  0.861   9.802   1.00 0.00 ? 55  LYS A HE2  6  
ATOM 9631  H HE3  . LYS A 1 55  ? -3.139  -0.662  10.686  1.00 0.00 ? 55  LYS A HE3  6  
ATOM 9632  H HZ1  . LYS A 1 55  ? -0.749  0.971   10.814  1.00 0.00 ? 55  LYS A HZ1  6  
ATOM 9633  H HZ2  . LYS A 1 55  ? -1.537  0.104   12.035  1.00 0.00 ? 55  LYS A HZ2  6  
ATOM 9634  H HZ3  . LYS A 1 55  ? -2.108  1.629   11.577  1.00 0.00 ? 55  LYS A HZ3  6  
ATOM 9635  N N    . GLN A 1 56  ? -3.881  0.951   5.955   1.00 0.00 ? 56  GLN A N    6  
ATOM 9636  C CA   . GLN A 1 56  ? -5.100  1.681   6.282   1.00 0.00 ? 56  GLN A CA   6  
ATOM 9637  C C    . GLN A 1 56  ? -5.366  2.782   5.260   1.00 0.00 ? 56  GLN A C    6  
ATOM 9638  O O    . GLN A 1 56  ? -4.437  3.332   4.669   1.00 0.00 ? 56  GLN A O    6  
ATOM 9639  C CB   . GLN A 1 56  ? -4.997  2.285   7.684   1.00 0.00 ? 56  GLN A CB   6  
ATOM 9640  C CG   . GLN A 1 56  ? -5.510  3.713   7.770   1.00 0.00 ? 56  GLN A CG   6  
ATOM 9641  C CD   . GLN A 1 56  ? -5.786  4.149   9.196   1.00 0.00 ? 56  GLN A CD   6  
ATOM 9642  O OE1  . GLN A 1 56  ? -6.073  3.325   10.064  1.00 0.00 ? 56  GLN A OE1  6  
ATOM 9643  N NE2  . GLN A 1 56  ? -5.700  5.451   9.444   1.00 0.00 ? 56  GLN A NE2  6  
ATOM 9644  H H    . GLN A 1 56  ? -3.298  1.288   5.244   1.00 0.00 ? 56  GLN A H    6  
ATOM 9645  H HA   . GLN A 1 56  ? -5.921  0.982   6.261   1.00 0.00 ? 56  GLN A HA   6  
ATOM 9646  H HB2  . GLN A 1 56  ? -5.570  1.677   8.368   1.00 0.00 ? 56  GLN A HB2  6  
ATOM 9647  H HB3  . GLN A 1 56  ? -3.961  2.279   7.990   1.00 0.00 ? 56  GLN A HB3  6  
ATOM 9648  H HG2  . GLN A 1 56  ? -4.770  4.375   7.345   1.00 0.00 ? 56  GLN A HG2  6  
ATOM 9649  H HG3  . GLN A 1 56  ? -6.426  3.788   7.202   1.00 0.00 ? 56  GLN A HG3  6  
ATOM 9650  H HE21 . GLN A 1 56  ? -5.468  6.049   8.702   1.00 0.00 ? 56  GLN A HE21 6  
ATOM 9651  H HE22 . GLN A 1 56  ? -5.874  5.760   10.356  1.00 0.00 ? 56  GLN A HE22 6  
ATOM 9652  N N    . VAL A 1 57  ? -6.641  3.097   5.056   1.00 0.00 ? 57  VAL A N    6  
ATOM 9653  C CA   . VAL A 1 57  ? -7.029  4.132   4.105   1.00 0.00 ? 57  VAL A CA   6  
ATOM 9654  C C    . VAL A 1 57  ? -8.019  5.109   4.731   1.00 0.00 ? 57  VAL A C    6  
ATOM 9655  O O    . VAL A 1 57  ? -9.052  4.706   5.267   1.00 0.00 ? 57  VAL A O    6  
ATOM 9656  C CB   . VAL A 1 57  ? -7.658  3.523   2.838   1.00 0.00 ? 57  VAL A CB   6  
ATOM 9657  C CG1  . VAL A 1 57  ? -8.511  4.555   2.116   1.00 0.00 ? 57  VAL A CG1  6  
ATOM 9658  C CG2  . VAL A 1 57  ? -6.577  2.975   1.919   1.00 0.00 ? 57  VAL A CG2  6  
ATOM 9659  H H    . VAL A 1 57  ? -7.337  2.623   5.557   1.00 0.00 ? 57  VAL A H    6  
ATOM 9660  H HA   . VAL A 1 57  ? -6.139  4.672   3.817   1.00 0.00 ? 57  VAL A HA   6  
ATOM 9661  H HB   . VAL A 1 57  ? -8.297  2.705   3.135   1.00 0.00 ? 57  VAL A HB   6  
ATOM 9662  H HG11 . VAL A 1 57  ? -8.895  4.127   1.201   1.00 0.00 ? 57  VAL A HG11 6  
ATOM 9663  H HG12 . VAL A 1 57  ? -9.333  4.851   2.750   1.00 0.00 ? 57  VAL A HG12 6  
ATOM 9664  H HG13 . VAL A 1 57  ? -7.907  5.420   1.881   1.00 0.00 ? 57  VAL A HG13 6  
ATOM 9665  H HG21 . VAL A 1 57  ? -6.048  3.794   1.455   1.00 0.00 ? 57  VAL A HG21 6  
ATOM 9666  H HG22 . VAL A 1 57  ? -5.885  2.378   2.494   1.00 0.00 ? 57  VAL A HG22 6  
ATOM 9667  H HG23 . VAL A 1 57  ? -7.031  2.361   1.154   1.00 0.00 ? 57  VAL A HG23 6  
ATOM 9668  N N    . LEU A 1 58  ? -7.697  6.396   4.658   1.00 0.00 ? 58  LEU A N    6  
ATOM 9669  C CA   . LEU A 1 58  ? -8.558  7.433   5.217   1.00 0.00 ? 58  LEU A CA   6  
ATOM 9670  C C    . LEU A 1 58  ? -9.824  7.598   4.382   1.00 0.00 ? 58  LEU A C    6  
ATOM 9671  O O    . LEU A 1 58  ? -9.992  6.939   3.356   1.00 0.00 ? 58  LEU A O    6  
ATOM 9672  C CB   . LEU A 1 58  ? -7.806  8.762   5.292   1.00 0.00 ? 58  LEU A CB   6  
ATOM 9673  C CG   . LEU A 1 58  ? -6.562  8.781   6.180   1.00 0.00 ? 58  LEU A CG   6  
ATOM 9674  C CD1  . LEU A 1 58  ? -5.482  7.876   5.606   1.00 0.00 ? 58  LEU A CD1  6  
ATOM 9675  C CD2  . LEU A 1 58  ? -6.041  10.202  6.339   1.00 0.00 ? 58  LEU A CD2  6  
ATOM 9676  H H    . LEU A 1 58  ? -6.861  6.656   4.219   1.00 0.00 ? 58  LEU A H    6  
ATOM 9677  H HA   . LEU A 1 58  ? -8.837  7.129   6.215   1.00 0.00 ? 58  LEU A HA   6  
ATOM 9678  H HB2  . LEU A 1 58  ? -7.501  9.027   4.291   1.00 0.00 ? 58  LEU A HB2  6  
ATOM 9679  H HB3  . LEU A 1 58  ? -8.492  9.509   5.666   1.00 0.00 ? 58  LEU A HB3  6  
ATOM 9680  H HG   . LEU A 1 58  ? -6.822  8.407   7.161   1.00 0.00 ? 58  LEU A HG   6  
ATOM 9681  H HD11 . LEU A 1 58  ? -4.545  8.073   6.104   1.00 0.00 ? 58  LEU A HD11 6  
ATOM 9682  H HD12 . LEU A 1 58  ? -5.376  8.070   4.549   1.00 0.00 ? 58  LEU A HD12 6  
ATOM 9683  H HD13 . LEU A 1 58  ? -5.761  6.843   5.756   1.00 0.00 ? 58  LEU A HD13 6  
ATOM 9684  H HD21 . LEU A 1 58  ? -5.547  10.508  5.429   1.00 0.00 ? 58  LEU A HD21 6  
ATOM 9685  H HD22 . LEU A 1 58  ? -5.339  10.238  7.160   1.00 0.00 ? 58  LEU A HD22 6  
ATOM 9686  H HD23 . LEU A 1 58  ? -6.867  10.867  6.542   1.00 0.00 ? 58  LEU A HD23 6  
ATOM 9687  N N    . GLU A 1 59  ? -10.710 8.482   4.828   1.00 0.00 ? 59  GLU A N    6  
ATOM 9688  C CA   . GLU A 1 59  ? -11.960 8.734   4.120   1.00 0.00 ? 59  GLU A CA   6  
ATOM 9689  C C    . GLU A 1 59  ? -11.888 10.043  3.338   1.00 0.00 ? 59  GLU A C    6  
ATOM 9690  O O    . GLU A 1 59  ? -12.318 10.115  2.187   1.00 0.00 ? 59  GLU A O    6  
ATOM 9691  C CB   . GLU A 1 59  ? -13.130 8.780   5.105   1.00 0.00 ? 59  GLU A CB   6  
ATOM 9692  C CG   . GLU A 1 59  ? -14.492 8.796   4.433   1.00 0.00 ? 59  GLU A CG   6  
ATOM 9693  C CD   . GLU A 1 59  ? -15.579 8.198   5.304   1.00 0.00 ? 59  GLU A CD   6  
ATOM 9694  O OE1  . GLU A 1 59  ? -15.278 7.826   6.457   1.00 0.00 ? 59  GLU A OE1  6  
ATOM 9695  O OE2  . GLU A 1 59  ? -16.732 8.100   4.832   1.00 0.00 ? 59  GLU A OE2  6  
ATOM 9696  H H    . GLU A 1 59  ? -10.519 8.977   5.652   1.00 0.00 ? 59  GLU A H    6  
ATOM 9697  H HA   . GLU A 1 59  ? -12.118 7.923   3.426   1.00 0.00 ? 59  GLU A HA   6  
ATOM 9698  H HB2  . GLU A 1 59  ? -13.078 7.913   5.748   1.00 0.00 ? 59  GLU A HB2  6  
ATOM 9699  H HB3  . GLU A 1 59  ? -13.040 9.671   5.710   1.00 0.00 ? 59  GLU A HB3  6  
ATOM 9700  H HG2  . GLU A 1 59  ? -14.756 9.818   4.206   1.00 0.00 ? 59  GLU A HG2  6  
ATOM 9701  H HG3  . GLU A 1 59  ? -14.433 8.229   3.515   1.00 0.00 ? 59  GLU A HG3  6  
ATOM 9702  N N    . ASP A 1 60  ? -11.342 11.075  3.972   1.00 0.00 ? 60  ASP A N    6  
ATOM 9703  C CA   . ASP A 1 60  ? -11.213 12.381  3.336   1.00 0.00 ? 60  ASP A CA   6  
ATOM 9704  C C    . ASP A 1 60  ? -9.968  12.436  2.455   1.00 0.00 ? 60  ASP A C    6  
ATOM 9705  O O    . ASP A 1 60  ? -9.281  13.455  2.398   1.00 0.00 ? 60  ASP A O    6  
ATOM 9706  C CB   . ASP A 1 60  ? -11.152 13.483  4.395   1.00 0.00 ? 60  ASP A CB   6  
ATOM 9707  C CG   . ASP A 1 60  ? -10.897 14.851  3.793   1.00 0.00 ? 60  ASP A CG   6  
ATOM 9708  O OD1  . ASP A 1 60  ? -11.617 15.225  2.844   1.00 0.00 ? 60  ASP A OD1  6  
ATOM 9709  O OD2  . ASP A 1 60  ? -9.976  15.547  4.270   1.00 0.00 ? 60  ASP A OD2  6  
ATOM 9710  H H    . ASP A 1 60  ? -11.017 10.955  4.889   1.00 0.00 ? 60  ASP A H    6  
ATOM 9711  H HA   . ASP A 1 60  ? -12.083 12.536  2.718   1.00 0.00 ? 60  ASP A HA   6  
ATOM 9712  H HB2  . ASP A 1 60  ? -12.092 13.514  4.927   1.00 0.00 ? 60  ASP A HB2  6  
ATOM 9713  H HB3  . ASP A 1 60  ? -10.357 13.261  5.091   1.00 0.00 ? 60  ASP A HB3  6  
ATOM 9714  N N    . SER A 1 61  ? -9.685  11.332  1.771   1.00 0.00 ? 61  SER A N    6  
ATOM 9715  C CA   . SER A 1 61  ? -8.520  11.253  0.897   1.00 0.00 ? 61  SER A CA   6  
ATOM 9716  C C    . SER A 1 61  ? -8.924  10.809  -0.506  1.00 0.00 ? 61  SER A C    6  
ATOM 9717  O O    . SER A 1 61  ? -10.042 10.351  -0.742  1.00 0.00 ? 61  SER A O    6  
ATOM 9718  C CB   . SER A 1 61  ? -7.488  10.283  1.474   1.00 0.00 ? 61  SER A CB   6  
ATOM 9719  O OG   . SER A 1 61  ? -7.366  9.126   0.665   1.00 0.00 ? 61  SER A OG   6  
ATOM 9720  H H    . SER A 1 61  ? -10.271 10.552  1.859   1.00 0.00 ? 61  SER A H    6  
ATOM 9721  H HA   . SER A 1 61  ? -8.083  12.238  0.838   1.00 0.00 ? 61  SER A HA   6  
ATOM 9722  H HB2  . SER A 1 61  ? -6.527  10.773  1.527   1.00 0.00 ? 61  SER A HB2  6  
ATOM 9723  H HB3  . SER A 1 61  ? -7.794  9.984   2.466   1.00 0.00 ? 61  SER A HB3  6  
ATOM 9724  H HG   . SER A 1 61  ? -7.795  8.385   1.099   1.00 0.00 ? 61  SER A HG   6  
ATOM 9725  N N    . PRO A 1 62  ? -7.991  10.946  -1.460  1.00 0.00 ? 62  PRO A N    6  
ATOM 9726  C CA   . PRO A 1 62  ? -8.225  10.565  -2.856  1.00 0.00 ? 62  PRO A CA   6  
ATOM 9727  C C    . PRO A 1 62  ? -8.325  9.054   -3.035  1.00 0.00 ? 62  PRO A C    6  
ATOM 9728  O O    . PRO A 1 62  ? -8.883  8.572   -4.020  1.00 0.00 ? 62  PRO A O    6  
ATOM 9729  C CB   . PRO A 1 62  ? -6.993  11.108  -3.583  1.00 0.00 ? 62  PRO A CB   6  
ATOM 9730  C CG   . PRO A 1 62  ? -5.932  11.167  -2.539  1.00 0.00 ? 62  PRO A CG   6  
ATOM 9731  C CD   . PRO A 1 62  ? -6.637  11.484  -1.250  1.00 0.00 ? 62  PRO A CD   6  
ATOM 9732  H HA   . PRO A 1 62  ? -9.114  11.033  -3.252  1.00 0.00 ? 62  PRO A HA   6  
ATOM 9733  H HB2  . PRO A 1 62  ? -6.721  10.438  -4.387  1.00 0.00 ? 62  PRO A HB2  6  
ATOM 9734  H HB3  . PRO A 1 62  ? -7.209  12.088  -3.982  1.00 0.00 ? 62  PRO A HB3  6  
ATOM 9735  H HG2  . PRO A 1 62  ? -5.432  10.213  -2.469  1.00 0.00 ? 62  PRO A HG2  6  
ATOM 9736  H HG3  . PRO A 1 62  ? -5.223  11.946  -2.780  1.00 0.00 ? 62  PRO A HG3  6  
ATOM 9737  H HD2  . PRO A 1 62  ? -6.150  10.991  -0.422  1.00 0.00 ? 62  PRO A HD2  6  
ATOM 9738  H HD3  . PRO A 1 62  ? -6.668  12.552  -1.089  1.00 0.00 ? 62  PRO A HD3  6  
ATOM 9739  N N    . ALA A 1 63  ? -7.782  8.311   -2.076  1.00 0.00 ? 63  ALA A N    6  
ATOM 9740  C CA   . ALA A 1 63  ? -7.813  6.855   -2.127  1.00 0.00 ? 63  ALA A CA   6  
ATOM 9741  C C    . ALA A 1 63  ? -9.049  6.307   -1.420  1.00 0.00 ? 63  ALA A C    6  
ATOM 9742  O O    . ALA A 1 63  ? -9.550  5.238   -1.766  1.00 0.00 ? 63  ALA A O    6  
ATOM 9743  C CB   . ALA A 1 63  ? -6.549  6.278   -1.506  1.00 0.00 ? 63  ALA A CB   6  
ATOM 9744  H H    . ALA A 1 63  ? -7.352  8.754   -1.315  1.00 0.00 ? 63  ALA A H    6  
ATOM 9745  H HA   . ALA A 1 63  ? -7.843  6.558   -3.165  1.00 0.00 ? 63  ALA A HA   6  
ATOM 9746  H HB1  . ALA A 1 63  ? -6.493  6.569   -0.468  1.00 0.00 ? 63  ALA A HB1  6  
ATOM 9747  H HB2  . ALA A 1 63  ? -6.574  5.200   -1.578  1.00 0.00 ? 63  ALA A HB2  6  
ATOM 9748  H HB3  . ALA A 1 63  ? -5.686  6.655   -2.033  1.00 0.00 ? 63  ALA A HB3  6  
ATOM 9749  N N    . GLY A 1 64  ? -9.535  7.047   -0.429  1.00 0.00 ? 64  GLY A N    6  
ATOM 9750  C CA   . GLY A 1 64  ? -10.708 6.619   0.311   1.00 0.00 ? 64  GLY A CA   6  
ATOM 9751  C C    . GLY A 1 64  ? -11.989 6.794   -0.481  1.00 0.00 ? 64  GLY A C    6  
ATOM 9752  O O    . GLY A 1 64  ? -12.937 6.025   -0.320  1.00 0.00 ? 64  GLY A O    6  
ATOM 9753  H H    . GLY A 1 64  ? -9.094  7.892   -0.197  1.00 0.00 ? 64  GLY A H    6  
ATOM 9754  H HA2  . GLY A 1 64  ? -10.596 5.576   0.569   1.00 0.00 ? 64  GLY A HA2  6  
ATOM 9755  H HA3  . GLY A 1 64  ? -10.778 7.199   1.219   1.00 0.00 ? 64  GLY A HA3  6  
ATOM 9756  N N    . LYS A 1 65  ? -12.018 7.809   -1.338  1.00 0.00 ? 65  LYS A N    6  
ATOM 9757  C CA   . LYS A 1 65  ? -13.192 8.084   -2.158  1.00 0.00 ? 65  LYS A CA   6  
ATOM 9758  C C    . LYS A 1 65  ? -13.377 7.007   -3.223  1.00 0.00 ? 65  LYS A C    6  
ATOM 9759  O O    . LYS A 1 65  ? -14.500 6.605   -3.527  1.00 0.00 ? 65  LYS A O    6  
ATOM 9760  C CB   . LYS A 1 65  ? -13.065 9.456   -2.822  1.00 0.00 ? 65  LYS A CB   6  
ATOM 9761  C CG   . LYS A 1 65  ? -13.113 10.614  -1.841  1.00 0.00 ? 65  LYS A CG   6  
ATOM 9762  C CD   . LYS A 1 65  ? -13.621 11.885  -2.501  1.00 0.00 ? 65  LYS A CD   6  
ATOM 9763  C CE   . LYS A 1 65  ? -13.261 13.118  -1.687  1.00 0.00 ? 65  LYS A CE   6  
ATOM 9764  N NZ   . LYS A 1 65  ? -14.079 13.222  -0.446  1.00 0.00 ? 65  LYS A NZ   6  
ATOM 9765  H H    . LYS A 1 65  ? -11.231 8.387   -1.422  1.00 0.00 ? 65  LYS A H    6  
ATOM 9766  H HA   . LYS A 1 65  ? -14.056 8.085   -1.511  1.00 0.00 ? 65  LYS A HA   6  
ATOM 9767  H HB2  . LYS A 1 65  ? -12.126 9.501   -3.353  1.00 0.00 ? 65  LYS A HB2  6  
ATOM 9768  H HB3  . LYS A 1 65  ? -13.874 9.577   -3.529  1.00 0.00 ? 65  LYS A HB3  6  
ATOM 9769  H HG2  . LYS A 1 65  ? -13.773 10.356  -1.025  1.00 0.00 ? 65  LYS A HG2  6  
ATOM 9770  H HG3  . LYS A 1 65  ? -12.117 10.791  -1.458  1.00 0.00 ? 65  LYS A HG3  6  
ATOM 9771  H HD2  . LYS A 1 65  ? -13.178 11.973  -3.481  1.00 0.00 ? 65  LYS A HD2  6  
ATOM 9772  H HD3  . LYS A 1 65  ? -14.696 11.827  -2.594  1.00 0.00 ? 65  LYS A HD3  6  
ATOM 9773  H HE2  . LYS A 1 65  ? -12.218 13.063  -1.416  1.00 0.00 ? 65  LYS A HE2  6  
ATOM 9774  H HE3  . LYS A 1 65  ? -13.430 13.996  -2.294  1.00 0.00 ? 65  LYS A HE3  6  
ATOM 9775  H HZ1  . LYS A 1 65  ? -13.702 12.585  0.284   1.00 0.00 ? 65  LYS A HZ1  6  
ATOM 9776  H HZ2  . LYS A 1 65  ? -15.065 12.959  -0.646  1.00 0.00 ? 65  LYS A HZ2  6  
ATOM 9777  H HZ3  . LYS A 1 65  ? -14.058 14.197  -0.086  1.00 0.00 ? 65  LYS A HZ3  6  
ATOM 9778  N N    . THR A 1 66  ? -12.266 6.542   -3.787  1.00 0.00 ? 66  THR A N    6  
ATOM 9779  C CA   . THR A 1 66  ? -12.305 5.512   -4.817  1.00 0.00 ? 66  THR A CA   6  
ATOM 9780  C C    . THR A 1 66  ? -12.957 4.237   -4.294  1.00 0.00 ? 66  THR A C    6  
ATOM 9781  O O    . THR A 1 66  ? -13.443 3.415   -5.070  1.00 0.00 ? 66  THR A O    6  
ATOM 9782  C CB   . THR A 1 66  ? -10.892 5.179   -5.332  1.00 0.00 ? 66  THR A CB   6  
ATOM 9783  O OG1  . THR A 1 66  ? -10.320 4.126   -4.548  1.00 0.00 ? 66  THR A OG1  6  
ATOM 9784  C CG2  . THR A 1 66  ? -9.993  6.405   -5.278  1.00 0.00 ? 66  THR A CG2  6  
ATOM 9785  H H    . THR A 1 66  ? -11.400 6.902   -3.502  1.00 0.00 ? 66  THR A H    6  
ATOM 9786  H HA   . THR A 1 66  ? -12.888 5.890   -5.644  1.00 0.00 ? 66  THR A HA   6  
ATOM 9787  H HB   . THR A 1 66  ? -10.968 4.852   -6.359  1.00 0.00 ? 66  THR A HB   6  
ATOM 9788  H HG1  . THR A 1 66  ? -10.311 4.385   -3.623  1.00 0.00 ? 66  THR A HG1  6  
ATOM 9789  H HG21 . THR A 1 66  ? -10.575 7.287   -5.500  1.00 0.00 ? 66  THR A HG21 6  
ATOM 9790  H HG22 . THR A 1 66  ? -9.201  6.303   -6.005  1.00 0.00 ? 66  THR A HG22 6  
ATOM 9791  H HG23 . THR A 1 66  ? -9.566  6.494   -4.290  1.00 0.00 ? 66  THR A HG23 6  
ATOM 9792  N N    . ASN A 1 67  ? -12.963 4.079   -2.975  1.00 0.00 ? 67  ASN A N    6  
ATOM 9793  C CA   . ASN A 1 67  ? -13.556 2.902   -2.349  1.00 0.00 ? 67  ASN A CA   6  
ATOM 9794  C C    . ASN A 1 67  ? -13.219 1.639   -3.135  1.00 0.00 ? 67  ASN A C    6  
ATOM 9795  O O    . ASN A 1 67  ? -13.945 0.648   -3.078  1.00 0.00 ? 67  ASN A O    6  
ATOM 9796  C CB   . ASN A 1 67  ? -15.075 3.063   -2.248  1.00 0.00 ? 67  ASN A CB   6  
ATOM 9797  C CG   . ASN A 1 67  ? -15.685 2.147   -1.205  1.00 0.00 ? 67  ASN A CG   6  
ATOM 9798  O OD1  . ASN A 1 67  ? -16.465 1.252   -1.529  1.00 0.00 ? 67  ASN A OD1  6  
ATOM 9799  N ND2  . ASN A 1 67  ? -15.332 2.368   0.056   1.00 0.00 ? 67  ASN A ND2  6  
ATOM 9800  H H    . ASN A 1 67  ? -12.560 4.769   -2.408  1.00 0.00 ? 67  ASN A H    6  
ATOM 9801  H HA   . ASN A 1 67  ? -13.146 2.814   -1.355  1.00 0.00 ? 67  ASN A HA   6  
ATOM 9802  H HB2  . ASN A 1 67  ? -15.305 4.084   -1.981  1.00 0.00 ? 67  ASN A HB2  6  
ATOM 9803  H HB3  . ASN A 1 67  ? -15.519 2.836   -3.205  1.00 0.00 ? 67  ASN A HB3  6  
ATOM 9804  H HD21 . ASN A 1 67  ? -14.706 3.100   0.240   1.00 0.00 ? 67  ASN A HD21 6  
ATOM 9805  H HD22 . ASN A 1 67  ? -15.711 1.790   0.751   1.00 0.00 ? 67  ASN A HD22 6  
ATOM 9806  N N    . ALA A 1 68  ? -12.111 1.684   -3.869  1.00 0.00 ? 68  ALA A N    6  
ATOM 9807  C CA   . ALA A 1 68  ? -11.676 0.543   -4.665  1.00 0.00 ? 68  ALA A CA   6  
ATOM 9808  C C    . ALA A 1 68  ? -10.502 -0.171  -4.004  1.00 0.00 ? 68  ALA A C    6  
ATOM 9809  O O    . ALA A 1 68  ? -10.027 -1.195  -4.497  1.00 0.00 ? 68  ALA A O    6  
ATOM 9810  C CB   . ALA A 1 68  ? -11.300 0.992   -6.069  1.00 0.00 ? 68  ALA A CB   6  
ATOM 9811  H H    . ALA A 1 68  ? -11.574 2.503   -3.874  1.00 0.00 ? 68  ALA A H    6  
ATOM 9812  H HA   . ALA A 1 68  ? -12.505 -0.145  -4.743  1.00 0.00 ? 68  ALA A HA   6  
ATOM 9813  H HB1  . ALA A 1 68  ? -11.752 0.329   -6.792  1.00 0.00 ? 68  ALA A HB1  6  
ATOM 9814  H HB2  . ALA A 1 68  ? -11.656 1.999   -6.232  1.00 0.00 ? 68  ALA A HB2  6  
ATOM 9815  H HB3  . ALA A 1 68  ? -10.226 0.967   -6.179  1.00 0.00 ? 68  ALA A HB3  6  
ATOM 9816  N N    . LEU A 1 69  ? -10.037 0.374   -2.885  1.00 0.00 ? 69  LEU A N    6  
ATOM 9817  C CA   . LEU A 1 69  ? -8.917  -0.211  -2.156  1.00 0.00 ? 69  LEU A CA   6  
ATOM 9818  C C    . LEU A 1 69  ? -9.192  -0.223  -0.656  1.00 0.00 ? 69  LEU A C    6  
ATOM 9819  O O    . LEU A 1 69  ? -9.672  0.760   -0.093  1.00 0.00 ? 69  LEU A O    6  
ATOM 9820  C CB   . LEU A 1 69  ? -7.633  0.568   -2.445  1.00 0.00 ? 69  LEU A CB   6  
ATOM 9821  C CG   . LEU A 1 69  ? -7.314  0.813   -3.920  1.00 0.00 ? 69  LEU A CG   6  
ATOM 9822  C CD1  . LEU A 1 69  ? -6.512  2.094   -4.087  1.00 0.00 ? 69  LEU A CD1  6  
ATOM 9823  C CD2  . LEU A 1 69  ? -6.560  -0.371  -4.508  1.00 0.00 ? 69  LEU A CD2  6  
ATOM 9824  H H    . LEU A 1 69  ? -10.456 1.190   -2.541  1.00 0.00 ? 69  LEU A H    6  
ATOM 9825  H HA   . LEU A 1 69  ? -8.796  -1.229  -2.496  1.00 0.00 ? 69  LEU A HA   6  
ATOM 9826  H HB2  . LEU A 1 69  ? -7.712  1.528   -1.960  1.00 0.00 ? 69  LEU A HB2  6  
ATOM 9827  H HB3  . LEU A 1 69  ? -6.809  0.016   -2.015  1.00 0.00 ? 69  LEU A HB3  6  
ATOM 9828  H HG   . LEU A 1 69  ? -8.240  0.927   -4.468  1.00 0.00 ? 69  LEU A HG   6  
ATOM 9829  H HD11 . LEU A 1 69  ? -7.160  2.882   -4.438  1.00 0.00 ? 69  LEU A HD11 6  
ATOM 9830  H HD12 . LEU A 1 69  ? -5.721  1.933   -4.804  1.00 0.00 ? 69  LEU A HD12 6  
ATOM 9831  H HD13 . LEU A 1 69  ? -6.083  2.376   -3.136  1.00 0.00 ? 69  LEU A HD13 6  
ATOM 9832  H HD21 . LEU A 1 69  ? -6.699  -1.235  -3.876  1.00 0.00 ? 69  LEU A HD21 6  
ATOM 9833  H HD22 . LEU A 1 69  ? -5.508  -0.133  -4.567  1.00 0.00 ? 69  LEU A HD22 6  
ATOM 9834  H HD23 . LEU A 1 69  ? -6.937  -0.583  -5.498  1.00 0.00 ? 69  LEU A HD23 6  
ATOM 9835  N N    . LYS A 1 70  ? -8.880  -1.343  -0.012  1.00 0.00 ? 70  LYS A N    6  
ATOM 9836  C CA   . LYS A 1 70  ? -9.089  -1.484  1.424   1.00 0.00 ? 70  LYS A CA   6  
ATOM 9837  C C    . LYS A 1 70  ? -7.853  -2.069  2.099   1.00 0.00 ? 70  LYS A C    6  
ATOM 9838  O O    . LYS A 1 70  ? -7.002  -2.674  1.444   1.00 0.00 ? 70  LYS A O    6  
ATOM 9839  C CB   . LYS A 1 70  ? -10.303 -2.375  1.699   1.00 0.00 ? 70  LYS A CB   6  
ATOM 9840  C CG   . LYS A 1 70  ? -11.502 -2.056  0.823   1.00 0.00 ? 70  LYS A CG   6  
ATOM 9841  C CD   . LYS A 1 70  ? -12.416 -1.036  1.480   1.00 0.00 ? 70  LYS A CD   6  
ATOM 9842  C CE   . LYS A 1 70  ? -11.977 0.387   1.171   1.00 0.00 ? 70  LYS A CE   6  
ATOM 9843  N NZ   . LYS A 1 70  ? -12.967 1.390   1.651   1.00 0.00 ? 70  LYS A NZ   6  
ATOM 9844  H H    . LYS A 1 70  ? -8.500  -2.094  -0.516  1.00 0.00 ? 70  LYS A H    6  
ATOM 9845  H HA   . LYS A 1 70  ? -9.276  -0.502  1.830   1.00 0.00 ? 70  LYS A HA   6  
ATOM 9846  H HB2  . LYS A 1 70  ? -10.024 -3.405  1.530   1.00 0.00 ? 70  LYS A HB2  6  
ATOM 9847  H HB3  . LYS A 1 70  ? -10.596 -2.256  2.732   1.00 0.00 ? 70  LYS A HB3  6  
ATOM 9848  H HG2  . LYS A 1 70  ? -11.154 -1.658  -0.118  1.00 0.00 ? 70  LYS A HG2  6  
ATOM 9849  H HG3  . LYS A 1 70  ? -12.060 -2.965  0.647   1.00 0.00 ? 70  LYS A HG3  6  
ATOM 9850  H HD2  . LYS A 1 70  ? -13.422 -1.177  1.114   1.00 0.00 ? 70  LYS A HD2  6  
ATOM 9851  H HD3  . LYS A 1 70  ? -12.397 -1.184  2.551   1.00 0.00 ? 70  LYS A HD3  6  
ATOM 9852  H HE2  . LYS A 1 70  ? -11.029 0.570   1.653   1.00 0.00 ? 70  LYS A HE2  6  
ATOM 9853  H HE3  . LYS A 1 70  ? -11.863 0.490   0.102   1.00 0.00 ? 70  LYS A HE3  6  
ATOM 9854  H HZ1  . LYS A 1 70  ? -12.838 1.561   2.669   1.00 0.00 ? 70  LYS A HZ1  6  
ATOM 9855  H HZ2  . LYS A 1 70  ? -13.934 1.044   1.488   1.00 0.00 ? 70  LYS A HZ2  6  
ATOM 9856  H HZ3  . LYS A 1 70  ? -12.843 2.288   1.141   1.00 0.00 ? 70  LYS A HZ3  6  
ATOM 9857  N N    . THR A 1 71  ? -7.759  -1.888  3.412   1.00 0.00 ? 71  THR A N    6  
ATOM 9858  C CA   . THR A 1 71  ? -6.627  -2.398  4.176   1.00 0.00 ? 71  THR A CA   6  
ATOM 9859  C C    . THR A 1 71  ? -6.563  -3.919  4.115   1.00 0.00 ? 71  THR A C    6  
ATOM 9860  O O    . THR A 1 71  ? -7.589  -4.596  4.175   1.00 0.00 ? 71  THR A O    6  
ATOM 9861  C CB   . THR A 1 71  ? -6.699  -1.957  5.650   1.00 0.00 ? 71  THR A CB   6  
ATOM 9862  O OG1  . THR A 1 71  ? -5.524  -2.384  6.347   1.00 0.00 ? 71  THR A OG1  6  
ATOM 9863  C CG2  . THR A 1 71  ? -7.934  -2.533  6.327   1.00 0.00 ? 71  THR A CG2  6  
ATOM 9864  H H    . THR A 1 71  ? -8.469  -1.398  3.878   1.00 0.00 ? 71  THR A H    6  
ATOM 9865  H HA   . THR A 1 71  ? -5.724  -1.991  3.744   1.00 0.00 ? 71  THR A HA   6  
ATOM 9866  H HB   . THR A 1 71  ? -6.758  -0.879  5.685   1.00 0.00 ? 71  THR A HB   6  
ATOM 9867  H HG1  . THR A 1 71  ? -5.281  -3.266  6.056   1.00 0.00 ? 71  THR A HG1  6  
ATOM 9868  H HG21 . THR A 1 71  ? -8.111  -2.011  7.255   1.00 0.00 ? 71  THR A HG21 6  
ATOM 9869  H HG22 . THR A 1 71  ? -7.777  -3.583  6.529   1.00 0.00 ? 71  THR A HG22 6  
ATOM 9870  H HG23 . THR A 1 71  ? -8.789  -2.415  5.678   1.00 0.00 ? 71  THR A HG23 6  
ATOM 9871  N N    . GLY A 1 72  ? -5.351  -4.452  3.994   1.00 0.00 ? 72  GLY A N    6  
ATOM 9872  C CA   . GLY A 1 72  ? -5.176  -5.891  3.928   1.00 0.00 ? 72  GLY A CA   6  
ATOM 9873  C C    . GLY A 1 72  ? -4.764  -6.362  2.547   1.00 0.00 ? 72  GLY A C    6  
ATOM 9874  O O    . GLY A 1 72  ? -4.071  -7.370  2.409   1.00 0.00 ? 72  GLY A O    6  
ATOM 9875  H H    . GLY A 1 72  ? -4.569  -3.863  3.951   1.00 0.00 ? 72  GLY A H    6  
ATOM 9876  H HA2  . GLY A 1 72  ? -4.418  -6.184  4.638   1.00 0.00 ? 72  GLY A HA2  6  
ATOM 9877  H HA3  . GLY A 1 72  ? -6.108  -6.368  4.194   1.00 0.00 ? 72  GLY A HA3  6  
ATOM 9878  N N    . ASP A 1 73  ? -5.193  -5.633  1.523   1.00 0.00 ? 73  ASP A N    6  
ATOM 9879  C CA   . ASP A 1 73  ? -4.865  -5.981  0.145   1.00 0.00 ? 73  ASP A CA   6  
ATOM 9880  C C    . ASP A 1 73  ? -3.362  -6.185  -0.020  1.00 0.00 ? 73  ASP A C    6  
ATOM 9881  O O    . ASP A 1 73  ? -2.590  -5.989  0.919   1.00 0.00 ? 73  ASP A O    6  
ATOM 9882  C CB   . ASP A 1 73  ? -5.352  -4.891  -0.810  1.00 0.00 ? 73  ASP A CB   6  
ATOM 9883  C CG   . ASP A 1 73  ? -6.764  -5.142  -1.303  1.00 0.00 ? 73  ASP A CG   6  
ATOM 9884  O OD1  . ASP A 1 73  ? -7.702  -5.064  -0.482  1.00 0.00 ? 73  ASP A OD1  6  
ATOM 9885  O OD2  . ASP A 1 73  ? -6.930  -5.415  -2.509  1.00 0.00 ? 73  ASP A OD2  6  
ATOM 9886  H H    . ASP A 1 73  ? -5.743  -4.840  1.697   1.00 0.00 ? 73  ASP A H    6  
ATOM 9887  H HA   . ASP A 1 73  ? -5.368  -6.906  -0.092  1.00 0.00 ? 73  ASP A HA   6  
ATOM 9888  H HB2  . ASP A 1 73  ? -5.334  -3.939  -0.299  1.00 0.00 ? 73  ASP A HB2  6  
ATOM 9889  H HB3  . ASP A 1 73  ? -4.694  -4.849  -1.664  1.00 0.00 ? 73  ASP A HB3  6  
ATOM 9890  N N    . LYS A 1 74  ? -2.952  -6.580  -1.221  1.00 0.00 ? 74  LYS A N    6  
ATOM 9891  C CA   . LYS A 1 74  ? -1.542  -6.811  -1.511  1.00 0.00 ? 74  LYS A CA   6  
ATOM 9892  C C    . LYS A 1 74  ? -1.085  -5.964  -2.694  1.00 0.00 ? 74  LYS A C    6  
ATOM 9893  O O    . LYS A 1 74  ? -1.393  -6.272  -3.846  1.00 0.00 ? 74  LYS A O    6  
ATOM 9894  C CB   . LYS A 1 74  ? -1.297  -8.293  -1.806  1.00 0.00 ? 74  LYS A CB   6  
ATOM 9895  C CG   . LYS A 1 74  ? 0.154   -8.619  -2.115  1.00 0.00 ? 74  LYS A CG   6  
ATOM 9896  C CD   . LYS A 1 74  ? 0.326   -10.075 -2.515  1.00 0.00 ? 74  LYS A CD   6  
ATOM 9897  C CE   . LYS A 1 74  ? 1.715   -10.339 -3.075  1.00 0.00 ? 74  LYS A CE   6  
ATOM 9898  N NZ   . LYS A 1 74  ? 1.962   -11.793 -3.281  1.00 0.00 ? 74  LYS A NZ   6  
ATOM 9899  H H    . LYS A 1 74  ? -3.615  -6.720  -1.930  1.00 0.00 ? 74  LYS A H    6  
ATOM 9900  H HA   . LYS A 1 74  ? -0.973  -6.527  -0.639  1.00 0.00 ? 74  LYS A HA   6  
ATOM 9901  H HB2  . LYS A 1 74  ? -1.599  -8.873  -0.947  1.00 0.00 ? 74  LYS A HB2  6  
ATOM 9902  H HB3  . LYS A 1 74  ? -1.898  -8.583  -2.656  1.00 0.00 ? 74  LYS A HB3  6  
ATOM 9903  H HG2  . LYS A 1 74  ? 0.490   -7.992  -2.928  1.00 0.00 ? 74  LYS A HG2  6  
ATOM 9904  H HG3  . LYS A 1 74  ? 0.753   -8.423  -1.237  1.00 0.00 ? 74  LYS A HG3  6  
ATOM 9905  H HD2  . LYS A 1 74  ? 0.176   -10.698 -1.645  1.00 0.00 ? 74  LYS A HD2  6  
ATOM 9906  H HD3  . LYS A 1 74  ? -0.410  -10.321 -3.267  1.00 0.00 ? 74  LYS A HD3  6  
ATOM 9907  H HE2  . LYS A 1 74  ? 1.810   -9.829  -4.021  1.00 0.00 ? 74  LYS A HE2  6  
ATOM 9908  H HE3  . LYS A 1 74  ? 2.447   -9.953  -2.382  1.00 0.00 ? 74  LYS A HE3  6  
ATOM 9909  H HZ1  . LYS A 1 74  ? 1.361   -12.153 -4.050  1.00 0.00 ? 74  LYS A HZ1  6  
ATOM 9910  H HZ2  . LYS A 1 74  ? 1.744   -12.320 -2.411  1.00 0.00 ? 74  LYS A HZ2  6  
ATOM 9911  H HZ3  . LYS A 1 74  ? 2.958   -11.955 -3.530  1.00 0.00 ? 74  LYS A HZ3  6  
ATOM 9912  N N    . ILE A 1 75  ? -0.348  -4.897  -2.402  1.00 0.00 ? 75  ILE A N    6  
ATOM 9913  C CA   . ILE A 1 75  ? 0.154   -4.008  -3.443  1.00 0.00 ? 75  ILE A CA   6  
ATOM 9914  C C    . ILE A 1 75  ? 1.295   -4.658  -4.218  1.00 0.00 ? 75  ILE A C    6  
ATOM 9915  O O    . ILE A 1 75  ? 2.365   -4.920  -3.666  1.00 0.00 ? 75  ILE A O    6  
ATOM 9916  C CB   . ILE A 1 75  ? 0.643   -2.672  -2.854  1.00 0.00 ? 75  ILE A CB   6  
ATOM 9917  C CG1  . ILE A 1 75  ? -0.382  -2.122  -1.860  1.00 0.00 ? 75  ILE A CG1  6  
ATOM 9918  C CG2  . ILE A 1 75  ? 0.904   -1.667  -3.965  1.00 0.00 ? 75  ILE A CG2  6  
ATOM 9919  C CD1  . ILE A 1 75  ? 0.121   -0.934  -1.069  1.00 0.00 ? 75  ILE A CD1  6  
ATOM 9920  H H    . ILE A 1 75  ? -0.136  -4.704  -1.466  1.00 0.00 ? 75  ILE A H    6  
ATOM 9921  H HA   . ILE A 1 75  ? -0.659  -3.802  -4.125  1.00 0.00 ? 75  ILE A HA   6  
ATOM 9922  H HB   . ILE A 1 75  ? 1.574   -2.851  -2.338  1.00 0.00 ? 75  ILE A HB   6  
ATOM 9923  H HG12 . ILE A 1 75  ? -1.265  -1.813  -2.396  1.00 0.00 ? 75  ILE A HG12 6  
ATOM 9924  H HG13 . ILE A 1 75  ? -0.646  -2.901  -1.159  1.00 0.00 ? 75  ILE A HG13 6  
ATOM 9925  H HG21 . ILE A 1 75  ? 1.745   -1.045  -3.698  1.00 0.00 ? 75  ILE A HG21 6  
ATOM 9926  H HG22 . ILE A 1 75  ? 1.123   -2.193  -4.882  1.00 0.00 ? 75  ILE A HG22 6  
ATOM 9927  H HG23 . ILE A 1 75  ? 0.029   -1.049  -4.104  1.00 0.00 ? 75  ILE A HG23 6  
ATOM 9928  H HD11 . ILE A 1 75  ? 1.122   -1.135  -0.716  1.00 0.00 ? 75  ILE A HD11 6  
ATOM 9929  H HD12 . ILE A 1 75  ? 0.132   -0.059  -1.702  1.00 0.00 ? 75  ILE A HD12 6  
ATOM 9930  H HD13 . ILE A 1 75  ? -0.530  -0.761  -0.225  1.00 0.00 ? 75  ILE A HD13 6  
ATOM 9931  N N    . LEU A 1 76  ? 1.062   -4.913  -5.500  1.00 0.00 ? 76  LEU A N    6  
ATOM 9932  C CA   . LEU A 1 76  ? 2.071   -5.531  -6.354  1.00 0.00 ? 76  LEU A CA   6  
ATOM 9933  C C    . LEU A 1 76  ? 2.813   -4.477  -7.170  1.00 0.00 ? 76  LEU A C    6  
ATOM 9934  O O    . LEU A 1 76  ? 3.959   -4.680  -7.567  1.00 0.00 ? 76  LEU A O    6  
ATOM 9935  C CB   . LEU A 1 76  ? 1.422   -6.552  -7.289  1.00 0.00 ? 76  LEU A CB   6  
ATOM 9936  C CG   . LEU A 1 76  ? 0.229   -7.320  -6.719  1.00 0.00 ? 76  LEU A CG   6  
ATOM 9937  C CD1  . LEU A 1 76  ? -0.722  -7.732  -7.832  1.00 0.00 ? 76  LEU A CD1  6  
ATOM 9938  C CD2  . LEU A 1 76  ? 0.702   -8.539  -5.941  1.00 0.00 ? 76  LEU A CD2  6  
ATOM 9939  H H    . LEU A 1 76  ? 0.191   -4.682  -5.884  1.00 0.00 ? 76  LEU A H    6  
ATOM 9940  H HA   . LEU A 1 76  ? 2.779   -6.038  -5.715  1.00 0.00 ? 76  LEU A HA   6  
ATOM 9941  H HB2  . LEU A 1 76  ? 1.086   -6.027  -8.170  1.00 0.00 ? 76  LEU A HB2  6  
ATOM 9942  H HB3  . LEU A 1 76  ? 2.178   -7.272  -7.567  1.00 0.00 ? 76  LEU A HB3  6  
ATOM 9943  H HG   . LEU A 1 76  ? -0.313  -6.678  -6.038  1.00 0.00 ? 76  LEU A HG   6  
ATOM 9944  H HD11 . LEU A 1 76  ? -0.538  -7.126  -8.706  1.00 0.00 ? 76  LEU A HD11 6  
ATOM 9945  H HD12 . LEU A 1 76  ? -1.742  -7.591  -7.505  1.00 0.00 ? 76  LEU A HD12 6  
ATOM 9946  H HD13 . LEU A 1 76  ? -0.563  -8.772  -8.075  1.00 0.00 ? 76  LEU A HD13 6  
ATOM 9947  H HD21 . LEU A 1 76  ? 0.983   -9.320  -6.632  1.00 0.00 ? 76  LEU A HD21 6  
ATOM 9948  H HD22 . LEU A 1 76  ? -0.096  -8.891  -5.304  1.00 0.00 ? 76  LEU A HD22 6  
ATOM 9949  H HD23 . LEU A 1 76  ? 1.554   -8.271  -5.334  1.00 0.00 ? 76  LEU A HD23 6  
ATOM 9950  N N    . GLU A 1 77  ? 2.151   -3.350  -7.413  1.00 0.00 ? 77  GLU A N    6  
ATOM 9951  C CA   . GLU A 1 77  ? 2.749   -2.264  -8.181  1.00 0.00 ? 77  GLU A CA   6  
ATOM 9952  C C    . GLU A 1 77  ? 1.960   -0.970  -7.999  1.00 0.00 ? 77  GLU A C    6  
ATOM 9953  O O    . GLU A 1 77  ? 0.755   -0.995  -7.750  1.00 0.00 ? 77  GLU A O    6  
ATOM 9954  C CB   . GLU A 1 77  ? 2.811   -2.632  -9.664  1.00 0.00 ? 77  GLU A CB   6  
ATOM 9955  C CG   . GLU A 1 77  ? 4.008   -2.039  -10.389 1.00 0.00 ? 77  GLU A CG   6  
ATOM 9956  C CD   . GLU A 1 77  ? 3.912   -2.193  -11.895 1.00 0.00 ? 77  GLU A CD   6  
ATOM 9957  O OE1  . GLU A 1 77  ? 2.780   -2.183  -12.421 1.00 0.00 ? 77  GLU A OE1  6  
ATOM 9958  O OE2  . GLU A 1 77  ? 4.970   -2.323  -12.546 1.00 0.00 ? 77  GLU A OE2  6  
ATOM 9959  H H    . GLU A 1 77  ? 1.239   -3.247  -7.069  1.00 0.00 ? 77  GLU A H    6  
ATOM 9960  H HA   . GLU A 1 77  ? 3.753   -2.113  -7.814  1.00 0.00 ? 77  GLU A HA   6  
ATOM 9961  H HB2  . GLU A 1 77  ? 2.858   -3.707  -9.755  1.00 0.00 ? 77  GLU A HB2  6  
ATOM 9962  H HB3  . GLU A 1 77  ? 1.912   -2.278  -10.148 1.00 0.00 ? 77  GLU A HB3  6  
ATOM 9963  H HG2  . GLU A 1 77  ? 4.070   -0.987  -10.154 1.00 0.00 ? 77  GLU A HG2  6  
ATOM 9964  H HG3  . GLU A 1 77  ? 4.903   -2.537  -10.047 1.00 0.00 ? 77  GLU A HG3  6  
ATOM 9965  N N    . VAL A 1 78  ? 2.649   0.159   -8.125  1.00 0.00 ? 78  VAL A N    6  
ATOM 9966  C CA   . VAL A 1 78  ? 2.014   1.463   -7.975  1.00 0.00 ? 78  VAL A CA   6  
ATOM 9967  C C    . VAL A 1 78  ? 2.610   2.479   -8.944  1.00 0.00 ? 78  VAL A C    6  
ATOM 9968  O O    . VAL A 1 78  ? 3.823   2.685   -8.975  1.00 0.00 ? 78  VAL A O    6  
ATOM 9969  C CB   . VAL A 1 78  ? 2.159   1.996   -6.537  1.00 0.00 ? 78  VAL A CB   6  
ATOM 9970  C CG1  . VAL A 1 78  ? 3.316   2.978   -6.445  1.00 0.00 ? 78  VAL A CG1  6  
ATOM 9971  C CG2  . VAL A 1 78  ? 0.861   2.643   -6.077  1.00 0.00 ? 78  VAL A CG2  6  
ATOM 9972  H H    . VAL A 1 78  ? 3.608   0.114   -8.324  1.00 0.00 ? 78  VAL A H    6  
ATOM 9973  H HA   . VAL A 1 78  ? 0.962   1.349   -8.190  1.00 0.00 ? 78  VAL A HA   6  
ATOM 9974  H HB   . VAL A 1 78  ? 2.371   1.161   -5.885  1.00 0.00 ? 78  VAL A HB   6  
ATOM 9975  H HG11 . VAL A 1 78  ? 3.117   3.829   -7.080  1.00 0.00 ? 78  VAL A HG11 6  
ATOM 9976  H HG12 . VAL A 1 78  ? 3.428   3.309   -5.423  1.00 0.00 ? 78  VAL A HG12 6  
ATOM 9977  H HG13 . VAL A 1 78  ? 4.226   2.494   -6.769  1.00 0.00 ? 78  VAL A HG13 6  
ATOM 9978  H HG21 . VAL A 1 78  ? 0.981   3.013   -5.069  1.00 0.00 ? 78  VAL A HG21 6  
ATOM 9979  H HG22 . VAL A 1 78  ? 0.615   3.462   -6.735  1.00 0.00 ? 78  VAL A HG22 6  
ATOM 9980  H HG23 . VAL A 1 78  ? 0.066   1.912   -6.099  1.00 0.00 ? 78  VAL A HG23 6  
ATOM 9981  N N    . SER A 1 79  ? 1.748   3.111   -9.734  1.00 0.00 ? 79  SER A N    6  
ATOM 9982  C CA   . SER A 1 79  ? 2.188   4.103   -10.707 1.00 0.00 ? 79  SER A CA   6  
ATOM 9983  C C    . SER A 1 79  ? 3.149   3.484   -11.717 1.00 0.00 ? 79  SER A C    6  
ATOM 9984  O O    . SER A 1 79  ? 3.847   4.192   -12.442 1.00 0.00 ? 79  SER A O    6  
ATOM 9985  C CB   . SER A 1 79  ? 2.864   5.279   -9.998  1.00 0.00 ? 79  SER A CB   6  
ATOM 9986  O OG   . SER A 1 79  ? 2.693   6.481   -10.728 1.00 0.00 ? 79  SER A OG   6  
ATOM 9987  H H    . SER A 1 79  ? 0.792   2.902   -9.662  1.00 0.00 ? 79  SER A H    6  
ATOM 9988  H HA   . SER A 1 79  ? 1.316   4.464   -11.231 1.00 0.00 ? 79  SER A HA   6  
ATOM 9989  H HB2  . SER A 1 79  ? 2.430   5.402   -9.017  1.00 0.00 ? 79  SER A HB2  6  
ATOM 9990  H HB3  . SER A 1 79  ? 3.921   5.077   -9.901  1.00 0.00 ? 79  SER A HB3  6  
ATOM 9991  H HG   . SER A 1 79  ? 1.851   6.460   -11.188 1.00 0.00 ? 79  SER A HG   6  
ATOM 9992  N N    . GLY A 1 80  ? 3.178   2.155   -11.759 1.00 0.00 ? 80  GLY A N    6  
ATOM 9993  C CA   . GLY A 1 80  ? 4.056   1.462   -12.684 1.00 0.00 ? 80  GLY A CA   6  
ATOM 9994  C C    . GLY A 1 80  ? 5.394   1.114   -12.062 1.00 0.00 ? 80  GLY A C    6  
ATOM 9995  O O    . GLY A 1 80  ? 6.417   1.087   -12.748 1.00 0.00 ? 80  GLY A O    6  
ATOM 9996  H H    . GLY A 1 80  ? 2.599   1.642   -11.158 1.00 0.00 ? 80  GLY A H    6  
ATOM 9997  H HA2  . GLY A 1 80  ? 3.574   0.551   -13.007 1.00 0.00 ? 80  GLY A HA2  6  
ATOM 9998  H HA3  . GLY A 1 80  ? 4.225   2.093   -13.544 1.00 0.00 ? 80  GLY A HA3  6  
ATOM 9999  N N    . VAL A 1 81  ? 5.389   0.849   -10.760 1.00 0.00 ? 81  VAL A N    6  
ATOM 10000 C CA   . VAL A 1 81  ? 6.612   0.503   -10.045 1.00 0.00 ? 81  VAL A CA   6  
ATOM 10001 C C    . VAL A 1 81  ? 6.426   -0.766  -9.221  1.00 0.00 ? 81  VAL A C    6  
ATOM 10002 O O    . VAL A 1 81  ? 5.504   -0.864  -8.412  1.00 0.00 ? 81  VAL A O    6  
ATOM 10003 C CB   . VAL A 1 81  ? 7.062   1.645   -9.115  1.00 0.00 ? 81  VAL A CB   6  
ATOM 10004 C CG1  . VAL A 1 81  ? 6.296   1.596   -7.801  1.00 0.00 ? 81  VAL A CG1  6  
ATOM 10005 C CG2  . VAL A 1 81  ? 8.561   1.573   -8.870  1.00 0.00 ? 81  VAL A CG2  6  
ATOM 10006 H H    . VAL A 1 81  ? 4.543   0.887   -10.268 1.00 0.00 ? 81  VAL A H    6  
ATOM 10007 H HA   . VAL A 1 81  ? 7.390   0.335   -10.776 1.00 0.00 ? 81  VAL A HA   6  
ATOM 10008 H HB   . VAL A 1 81  ? 6.842   2.585   -9.599  1.00 0.00 ? 81  VAL A HB   6  
ATOM 10009 H HG11 . VAL A 1 81  ? 6.764   0.883   -7.139  1.00 0.00 ? 81  VAL A HG11 6  
ATOM 10010 H HG12 . VAL A 1 81  ? 6.304   2.574   -7.343  1.00 0.00 ? 81  VAL A HG12 6  
ATOM 10011 H HG13 . VAL A 1 81  ? 5.276   1.295   -7.991  1.00 0.00 ? 81  VAL A HG13 6  
ATOM 10012 H HG21 . VAL A 1 81  ? 9.086   1.712   -9.803  1.00 0.00 ? 81  VAL A HG21 6  
ATOM 10013 H HG22 . VAL A 1 81  ? 8.849   2.348   -8.175  1.00 0.00 ? 81  VAL A HG22 6  
ATOM 10014 H HG23 . VAL A 1 81  ? 8.813   0.607   -8.456  1.00 0.00 ? 81  VAL A HG23 6  
ATOM 10015 N N    . ASP A 1 82  ? 7.309   -1.737  -9.433  1.00 0.00 ? 82  ASP A N    6  
ATOM 10016 C CA   . ASP A 1 82  ? 7.243   -3.001  -8.708  1.00 0.00 ? 82  ASP A CA   6  
ATOM 10017 C C    . ASP A 1 82  ? 7.583   -2.800  -7.235  1.00 0.00 ? 82  ASP A C    6  
ATOM 10018 O O    . ASP A 1 82  ? 8.712   -2.449  -6.889  1.00 0.00 ? 82  ASP A O    6  
ATOM 10019 C CB   . ASP A 1 82  ? 8.199   -4.020  -9.331  1.00 0.00 ? 82  ASP A CB   6  
ATOM 10020 C CG   . ASP A 1 82  ? 9.607   -3.904  -8.781  1.00 0.00 ? 82  ASP A CG   6  
ATOM 10021 O OD1  . ASP A 1 82  ? 9.878   -4.494  -7.714  1.00 0.00 ? 82  ASP A OD1  6  
ATOM 10022 O OD2  . ASP A 1 82  ? 10.438  -3.225  -9.419  1.00 0.00 ? 82  ASP A OD2  6  
ATOM 10023 H H    . ASP A 1 82  ? 8.021   -1.600  -10.092 1.00 0.00 ? 82  ASP A H    6  
ATOM 10024 H HA   . ASP A 1 82  ? 6.234   -3.375  -8.784  1.00 0.00 ? 82  ASP A HA   6  
ATOM 10025 H HB2  . ASP A 1 82  ? 7.834   -5.016  -9.128  1.00 0.00 ? 82  ASP A HB2  6  
ATOM 10026 H HB3  . ASP A 1 82  ? 8.234   -3.865  -10.399 1.00 0.00 ? 82  ASP A HB3  6  
ATOM 10027 N N    . LEU A 1 83  ? 6.599   -3.025  -6.371  1.00 0.00 ? 83  LEU A N    6  
ATOM 10028 C CA   . LEU A 1 83  ? 6.793   -2.868  -4.933  1.00 0.00 ? 83  LEU A CA   6  
ATOM 10029 C C    . LEU A 1 83  ? 6.746   -4.220  -4.227  1.00 0.00 ? 83  LEU A C    6  
ATOM 10030 O O    . LEU A 1 83  ? 7.013   -4.314  -3.029  1.00 0.00 ? 83  LEU A O    6  
ATOM 10031 C CB   . LEU A 1 83  ? 5.726   -1.939  -4.353  1.00 0.00 ? 83  LEU A CB   6  
ATOM 10032 C CG   . LEU A 1 83  ? 5.763   -0.489  -4.837  1.00 0.00 ? 83  LEU A CG   6  
ATOM 10033 C CD1  . LEU A 1 83  ? 4.829   0.376   -4.005  1.00 0.00 ? 83  LEU A CD1  6  
ATOM 10034 C CD2  . LEU A 1 83  ? 7.184   0.054   -4.785  1.00 0.00 ? 83  LEU A CD2  6  
ATOM 10035 H H    . LEU A 1 83  ? 5.722   -3.303  -6.706  1.00 0.00 ? 83  LEU A H    6  
ATOM 10036 H HA   . LEU A 1 83  ? 7.766   -2.428  -4.776  1.00 0.00 ? 83  LEU A HA   6  
ATOM 10037 H HB2  . LEU A 1 83  ? 4.759   -2.347  -4.606  1.00 0.00 ? 83  LEU A HB2  6  
ATOM 10038 H HB3  . LEU A 1 83  ? 5.842   -1.933  -3.278  1.00 0.00 ? 83  LEU A HB3  6  
ATOM 10039 H HG   . LEU A 1 83  ? 5.427   -0.450  -5.864  1.00 0.00 ? 83  LEU A HG   6  
ATOM 10040 H HD11 . LEU A 1 83  ? 3.989   0.682   -4.609  1.00 0.00 ? 83  LEU A HD11 6  
ATOM 10041 H HD12 . LEU A 1 83  ? 5.361   1.249   -3.658  1.00 0.00 ? 83  LEU A HD12 6  
ATOM 10042 H HD13 . LEU A 1 83  ? 4.475   -0.191  -3.156  1.00 0.00 ? 83  LEU A HD13 6  
ATOM 10043 H HD21 . LEU A 1 83  ? 7.729   -0.281  -5.654  1.00 0.00 ? 83  LEU A HD21 6  
ATOM 10044 H HD22 . LEU A 1 83  ? 7.673   -0.305  -3.892  1.00 0.00 ? 83  LEU A HD22 6  
ATOM 10045 H HD23 . LEU A 1 83  ? 7.156   1.134   -4.771  1.00 0.00 ? 83  LEU A HD23 6  
ATOM 10046 N N    . GLN A 1 84  ? 6.406   -5.262  -4.978  1.00 0.00 ? 84  GLN A N    6  
ATOM 10047 C CA   . GLN A 1 84  ? 6.325   -6.608  -4.423  1.00 0.00 ? 84  GLN A CA   6  
ATOM 10048 C C    . GLN A 1 84  ? 7.526   -6.902  -3.529  1.00 0.00 ? 84  GLN A C    6  
ATOM 10049 O O    . GLN A 1 84  ? 7.380   -7.104  -2.325  1.00 0.00 ? 84  GLN A O    6  
ATOM 10050 C CB   . GLN A 1 84  ? 6.246   -7.642  -5.548  1.00 0.00 ? 84  GLN A CB   6  
ATOM 10051 C CG   . GLN A 1 84  ? 4.883   -7.711  -6.217  1.00 0.00 ? 84  GLN A CG   6  
ATOM 10052 C CD   . GLN A 1 84  ? 4.850   -8.689  -7.374  1.00 0.00 ? 84  GLN A CD   6  
ATOM 10053 O OE1  . GLN A 1 84  ? 4.863   -9.904  -7.176  1.00 0.00 ? 84  GLN A OE1  6  
ATOM 10054 N NE2  . GLN A 1 84  ? 4.807   -8.163  -8.593  1.00 0.00 ? 84  GLN A NE2  6  
ATOM 10055 H H    . GLN A 1 84  ? 6.204   -5.123  -5.926  1.00 0.00 ? 84  GLN A H    6  
ATOM 10056 H HA   . GLN A 1 84  ? 5.426   -6.668  -3.828  1.00 0.00 ? 84  GLN A HA   6  
ATOM 10057 H HB2  . GLN A 1 84  ? 6.981   -7.395  -6.300  1.00 0.00 ? 84  GLN A HB2  6  
ATOM 10058 H HB3  . GLN A 1 84  ? 6.473   -8.617  -5.141  1.00 0.00 ? 84  GLN A HB3  6  
ATOM 10059 H HG2  . GLN A 1 84  ? 4.152   -8.020  -5.484  1.00 0.00 ? 84  GLN A HG2  6  
ATOM 10060 H HG3  . GLN A 1 84  ? 4.628   -6.729  -6.586  1.00 0.00 ? 84  GLN A HG3  6  
ATOM 10061 H HE21 . GLN A 1 84  ? 4.801   -7.186  -8.675  1.00 0.00 ? 84  GLN A HE21 6  
ATOM 10062 H HE22 . GLN A 1 84  ? 4.786   -8.772  -9.359  1.00 0.00 ? 84  GLN A HE22 6  
ATOM 10063 N N    . ASN A 1 85  ? 8.712   -6.923  -4.129  1.00 0.00 ? 85  ASN A N    6  
ATOM 10064 C CA   . ASN A 1 85  ? 9.938   -7.193  -3.387  1.00 0.00 ? 85  ASN A CA   6  
ATOM 10065 C C    . ASN A 1 85  ? 10.559  -5.898  -2.872  1.00 0.00 ? 85  ASN A C    6  
ATOM 10066 O O    . ASN A 1 85  ? 11.780  -5.775  -2.783  1.00 0.00 ? 85  ASN A O    6  
ATOM 10067 C CB   . ASN A 1 85  ? 10.941  -7.936  -4.271  1.00 0.00 ? 85  ASN A CB   6  
ATOM 10068 C CG   . ASN A 1 85  ? 10.640  -9.420  -4.366  1.00 0.00 ? 85  ASN A CG   6  
ATOM 10069 O OD1  . ASN A 1 85  ? 11.260  -10.235 -3.683  1.00 0.00 ? 85  ASN A OD1  6  
ATOM 10070 N ND2  . ASN A 1 85  ? 9.685   -9.776  -5.217  1.00 0.00 ? 85  ASN A ND2  6  
ATOM 10071 H H    . ASN A 1 85  ? 8.764   -6.754  -5.092  1.00 0.00 ? 85  ASN A H    6  
ATOM 10072 H HA   . ASN A 1 85  ? 9.684   -7.817  -2.543  1.00 0.00 ? 85  ASN A HA   6  
ATOM 10073 H HB2  . ASN A 1 85  ? 10.912  -7.518  -5.267  1.00 0.00 ? 85  ASN A HB2  6  
ATOM 10074 H HB3  . ASN A 1 85  ? 11.933  -7.814  -3.863  1.00 0.00 ? 85  ASN A HB3  6  
ATOM 10075 H HD21 . ASN A 1 85  ? 9.234   -9.072  -5.728  1.00 0.00 ? 85  ASN A HD21 6  
ATOM 10076 H HD22 . ASN A 1 85  ? 9.470   -10.729 -5.298  1.00 0.00 ? 85  ASN A HD22 6  
ATOM 10077 N N    . ALA A 1 86  ? 9.708   -4.934  -2.534  1.00 0.00 ? 86  ALA A N    6  
ATOM 10078 C CA   . ALA A 1 86  ? 10.172  -3.649  -2.026  1.00 0.00 ? 86  ALA A CA   6  
ATOM 10079 C C    . ALA A 1 86  ? 9.852   -3.497  -0.543  1.00 0.00 ? 86  ALA A C    6  
ATOM 10080 O O    . ALA A 1 86  ? 8.772   -3.877  -0.090  1.00 0.00 ? 86  ALA A O    6  
ATOM 10081 C CB   . ALA A 1 86  ? 9.551   -2.511  -2.822  1.00 0.00 ? 86  ALA A CB   6  
ATOM 10082 H H    . ALA A 1 86  ? 8.746   -5.092  -2.627  1.00 0.00 ? 86  ALA A H    6  
ATOM 10083 H HA   . ALA A 1 86  ? 11.244  -3.605  -2.159  1.00 0.00 ? 86  ALA A HA   6  
ATOM 10084 H HB1  . ALA A 1 86  ? 9.754   -1.573  -2.327  1.00 0.00 ? 86  ALA A HB1  6  
ATOM 10085 H HB2  . ALA A 1 86  ? 9.976   -2.494  -3.815  1.00 0.00 ? 86  ALA A HB2  6  
ATOM 10086 H HB3  . ALA A 1 86  ? 8.484   -2.660  -2.889  1.00 0.00 ? 86  ALA A HB3  6  
ATOM 10087 N N    . SER A 1 87  ? 10.796  -2.939  0.208   1.00 0.00 ? 87  SER A N    6  
ATOM 10088 C CA   . SER A 1 87  ? 10.615  -2.741  1.641   1.00 0.00 ? 87  SER A CA   6  
ATOM 10089 C C    . SER A 1 87  ? 9.493   -1.744  1.914   1.00 0.00 ? 87  SER A C    6  
ATOM 10090 O O    . SER A 1 87  ? 8.778   -1.330  1.001   1.00 0.00 ? 87  SER A O    6  
ATOM 10091 C CB   . SER A 1 87  ? 11.916  -2.248  2.277   1.00 0.00 ? 87  SER A CB   6  
ATOM 10092 O OG   . SER A 1 87  ? 12.955  -3.199  2.117   1.00 0.00 ? 87  SER A OG   6  
ATOM 10093 H H    . SER A 1 87  ? 11.635  -2.657  -0.212  1.00 0.00 ? 87  SER A H    6  
ATOM 10094 H HA   . SER A 1 87  ? 10.350  -3.693  2.076   1.00 0.00 ? 87  SER A HA   6  
ATOM 10095 H HB2  . SER A 1 87  ? 12.216  -1.323  1.808   1.00 0.00 ? 87  SER A HB2  6  
ATOM 10096 H HB3  . SER A 1 87  ? 11.757  -2.081  3.333   1.00 0.00 ? 87  SER A HB3  6  
ATOM 10097 H HG   . SER A 1 87  ? 12.728  -3.804  1.406   1.00 0.00 ? 87  SER A HG   6  
ATOM 10098 N N    . HIS A 1 88  ? 9.344   -1.362  3.179   1.00 0.00 ? 88  HIS A N    6  
ATOM 10099 C CA   . HIS A 1 88  ? 8.309   -0.413  3.574   1.00 0.00 ? 88  HIS A CA   6  
ATOM 10100 C C    . HIS A 1 88  ? 8.595   0.972   3.002   1.00 0.00 ? 88  HIS A C    6  
ATOM 10101 O O    . HIS A 1 88  ? 7.677   1.697   2.619   1.00 0.00 ? 88  HIS A O    6  
ATOM 10102 C CB   . HIS A 1 88  ? 8.212   -0.338  5.098   1.00 0.00 ? 88  HIS A CB   6  
ATOM 10103 C CG   . HIS A 1 88  ? 6.812   -0.158  5.600   1.00 0.00 ? 88  HIS A CG   6  
ATOM 10104 N ND1  . HIS A 1 88  ? 6.492   0.673   6.653   1.00 0.00 ? 88  HIS A ND1  6  
ATOM 10105 C CD2  . HIS A 1 88  ? 5.646   -0.706  5.187   1.00 0.00 ? 88  HIS A CD2  6  
ATOM 10106 C CE1  . HIS A 1 88  ? 5.189   0.626   6.867   1.00 0.00 ? 88  HIS A CE1  6  
ATOM 10107 N NE2  . HIS A 1 88  ? 4.652   -0.203  5.990   1.00 0.00 ? 88  HIS A NE2  6  
ATOM 10108 H H    . HIS A 1 88  ? 9.944   -1.727  3.862   1.00 0.00 ? 88  HIS A H    6  
ATOM 10109 H HA   . HIS A 1 88  ? 7.368   -0.765  3.179   1.00 0.00 ? 88  HIS A HA   6  
ATOM 10110 H HB2  . HIS A 1 88  ? 8.601   -1.252  5.523   1.00 0.00 ? 88  HIS A HB2  6  
ATOM 10111 H HB3  . HIS A 1 88  ? 8.801   0.496   5.450   1.00 0.00 ? 88  HIS A HB3  6  
ATOM 10112 H HD1  . HIS A 1 88  ? 7.125   1.214   7.168   1.00 0.00 ? 88  HIS A HD1  6  
ATOM 10113 H HD2  . HIS A 1 88  ? 5.519   -1.410  4.376   1.00 0.00 ? 88  HIS A HD2  6  
ATOM 10114 H HE1  . HIS A 1 88  ? 4.653   1.174   7.628   1.00 0.00 ? 88  HIS A HE1  6  
ATOM 10115 N N    . SER A 1 89  ? 9.873   1.332   2.948   1.00 0.00 ? 89  SER A N    6  
ATOM 10116 C CA   . SER A 1 89  ? 10.280  2.632   2.427   1.00 0.00 ? 89  SER A CA   6  
ATOM 10117 C C    . SER A 1 89  ? 10.303  2.623   0.901   1.00 0.00 ? 89  SER A C    6  
ATOM 10118 O O    . SER A 1 89  ? 9.879   3.582   0.258   1.00 0.00 ? 89  SER A O    6  
ATOM 10119 C CB   . SER A 1 89  ? 11.659  3.013   2.967   1.00 0.00 ? 89  SER A CB   6  
ATOM 10120 O OG   . SER A 1 89  ? 12.242  4.047   2.193   1.00 0.00 ? 89  SER A OG   6  
ATOM 10121 H H    . SER A 1 89  ? 10.559  0.709   3.268   1.00 0.00 ? 89  SER A H    6  
ATOM 10122 H HA   . SER A 1 89  ? 9.558   3.363   2.759   1.00 0.00 ? 89  SER A HA   6  
ATOM 10123 H HB2  . SER A 1 89  ? 11.562  3.354   3.987   1.00 0.00 ? 89  SER A HB2  6  
ATOM 10124 H HB3  . SER A 1 89  ? 12.306  2.148   2.937   1.00 0.00 ? 89  SER A HB3  6  
ATOM 10125 H HG   . SER A 1 89  ? 12.143  4.885   2.651   1.00 0.00 ? 89  SER A HG   6  
ATOM 10126 N N    . GLU A 1 90  ? 10.803  1.531   0.330   1.00 0.00 ? 90  GLU A N    6  
ATOM 10127 C CA   . GLU A 1 90  ? 10.883  1.397   -1.120  1.00 0.00 ? 90  GLU A CA   6  
ATOM 10128 C C    . GLU A 1 90  ? 9.523   1.645   -1.765  1.00 0.00 ? 90  GLU A C    6  
ATOM 10129 O O    . GLU A 1 90  ? 9.431   2.255   -2.830  1.00 0.00 ? 90  GLU A O    6  
ATOM 10130 C CB   . GLU A 1 90  ? 11.393  0.005   -1.498  1.00 0.00 ? 90  GLU A CB   6  
ATOM 10131 C CG   . GLU A 1 90  ? 12.887  -0.175  -1.285  1.00 0.00 ? 90  GLU A CG   6  
ATOM 10132 C CD   . GLU A 1 90  ? 13.701  0.224   -2.501  1.00 0.00 ? 90  GLU A CD   6  
ATOM 10133 O OE1  . GLU A 1 90  ? 13.144  0.891   -3.397  1.00 0.00 ? 90  GLU A OE1  6  
ATOM 10134 O OE2  . GLU A 1 90  ? 14.897  -0.132  -2.555  1.00 0.00 ? 90  GLU A OE2  6  
ATOM 10135 H H    . GLU A 1 90  ? 11.126  0.800   0.897   1.00 0.00 ? 90  GLU A H    6  
ATOM 10136 H HA   . GLU A 1 90  ? 11.581  2.136   -1.483  1.00 0.00 ? 90  GLU A HA   6  
ATOM 10137 H HB2  . GLU A 1 90  ? 10.874  -0.730  -0.901  1.00 0.00 ? 90  GLU A HB2  6  
ATOM 10138 H HB3  . GLU A 1 90  ? 11.176  -0.174  -2.541  1.00 0.00 ? 90  GLU A HB3  6  
ATOM 10139 H HG2  . GLU A 1 90  ? 13.195  0.435   -0.449  1.00 0.00 ? 90  GLU A HG2  6  
ATOM 10140 H HG3  . GLU A 1 90  ? 13.084  -1.213  -1.063  1.00 0.00 ? 90  GLU A HG3  6  
ATOM 10141 N N    . ALA A 1 91  ? 8.469   1.167   -1.112  1.00 0.00 ? 91  ALA A N    6  
ATOM 10142 C CA   . ALA A 1 91  ? 7.114   1.338   -1.620  1.00 0.00 ? 91  ALA A CA   6  
ATOM 10143 C C    . ALA A 1 91  ? 6.568   2.720   -1.276  1.00 0.00 ? 91  ALA A C    6  
ATOM 10144 O O    . ALA A 1 91  ? 5.890   3.351   -2.087  1.00 0.00 ? 91  ALA A O    6  
ATOM 10145 C CB   . ALA A 1 91  ? 6.201   0.255   -1.064  1.00 0.00 ? 91  ALA A CB   6  
ATOM 10146 H H    . ALA A 1 91  ? 8.606   0.690   -0.267  1.00 0.00 ? 91  ALA A H    6  
ATOM 10147 H HA   . ALA A 1 91  ? 7.144   1.232   -2.695  1.00 0.00 ? 91  ALA A HA   6  
ATOM 10148 H HB1  . ALA A 1 91  ? 5.210   0.659   -0.919  1.00 0.00 ? 91  ALA A HB1  6  
ATOM 10149 H HB2  . ALA A 1 91  ? 6.156   -0.569  -1.761  1.00 0.00 ? 91  ALA A HB2  6  
ATOM 10150 H HB3  . ALA A 1 91  ? 6.590   -0.093  -0.119  1.00 0.00 ? 91  ALA A HB3  6  
ATOM 10151 N N    . VAL A 1 92  ? 6.868   3.185   -0.067  1.00 0.00 ? 92  VAL A N    6  
ATOM 10152 C CA   . VAL A 1 92  ? 6.408   4.493   0.384   1.00 0.00 ? 92  VAL A CA   6  
ATOM 10153 C C    . VAL A 1 92  ? 6.798   5.585   -0.606  1.00 0.00 ? 92  VAL A C    6  
ATOM 10154 O O    . VAL A 1 92  ? 5.966   6.395   -1.012  1.00 0.00 ? 92  VAL A O    6  
ATOM 10155 C CB   . VAL A 1 92  ? 6.982   4.843   1.770   1.00 0.00 ? 92  VAL A CB   6  
ATOM 10156 C CG1  . VAL A 1 92  ? 6.953   6.346   1.996   1.00 0.00 ? 92  VAL A CG1  6  
ATOM 10157 C CG2  . VAL A 1 92  ? 6.213   4.116   2.863   1.00 0.00 ? 92  VAL A CG2  6  
ATOM 10158 H H    . VAL A 1 92  ? 7.412   2.636   0.535   1.00 0.00 ? 92  VAL A H    6  
ATOM 10159 H HA   . VAL A 1 92  ? 5.331   4.460   0.462   1.00 0.00 ? 92  VAL A HA   6  
ATOM 10160 H HB   . VAL A 1 92  ? 8.010   4.515   1.804   1.00 0.00 ? 92  VAL A HB   6  
ATOM 10161 H HG11 . VAL A 1 92  ? 5.989   6.736   1.704   1.00 0.00 ? 92  VAL A HG11 6  
ATOM 10162 H HG12 . VAL A 1 92  ? 7.126   6.557   3.041   1.00 0.00 ? 92  VAL A HG12 6  
ATOM 10163 H HG13 . VAL A 1 92  ? 7.725   6.814   1.402   1.00 0.00 ? 92  VAL A HG13 6  
ATOM 10164 H HG21 . VAL A 1 92  ? 5.660   4.832   3.452   1.00 0.00 ? 92  VAL A HG21 6  
ATOM 10165 H HG22 . VAL A 1 92  ? 5.528   3.413   2.414   1.00 0.00 ? 92  VAL A HG22 6  
ATOM 10166 H HG23 . VAL A 1 92  ? 6.906   3.586   3.500   1.00 0.00 ? 92  VAL A HG23 6  
ATOM 10167 N N    . GLU A 1 93  ? 8.071   5.600   -0.991  1.00 0.00 ? 93  GLU A N    6  
ATOM 10168 C CA   . GLU A 1 93  ? 8.572   6.593   -1.933  1.00 0.00 ? 93  GLU A CA   6  
ATOM 10169 C C    . GLU A 1 93  ? 7.854   6.480   -3.275  1.00 0.00 ? 93  GLU A C    6  
ATOM 10170 O O    . GLU A 1 93  ? 7.654   7.476   -3.970  1.00 0.00 ? 93  GLU A O    6  
ATOM 10171 C CB   . GLU A 1 93  ? 10.079  6.424   -2.133  1.00 0.00 ? 93  GLU A CB   6  
ATOM 10172 C CG   . GLU A 1 93  ? 10.862  6.354   -0.832  1.00 0.00 ? 93  GLU A CG   6  
ATOM 10173 C CD   . GLU A 1 93  ? 12.244  6.965   -0.949  1.00 0.00 ? 93  GLU A CD   6  
ATOM 10174 O OE1  . GLU A 1 93  ? 12.778  7.012   -2.078  1.00 0.00 ? 93  GLU A OE1  6  
ATOM 10175 O OE2  . GLU A 1 93  ? 12.793  7.395   0.086   1.00 0.00 ? 93  GLU A OE2  6  
ATOM 10176 H H    . GLU A 1 93  ? 8.687   4.927   -0.632  1.00 0.00 ? 93  GLU A H    6  
ATOM 10177 H HA   . GLU A 1 93  ? 8.380   7.571   -1.518  1.00 0.00 ? 93  GLU A HA   6  
ATOM 10178 H HB2  . GLU A 1 93  ? 10.258  5.514   -2.686  1.00 0.00 ? 93  GLU A HB2  6  
ATOM 10179 H HB3  . GLU A 1 93  ? 10.450  7.261   -2.706  1.00 0.00 ? 93  GLU A HB3  6  
ATOM 10180 H HG2  . GLU A 1 93  ? 10.314  6.886   -0.068  1.00 0.00 ? 93  GLU A HG2  6  
ATOM 10181 H HG3  . GLU A 1 93  ? 10.965  5.318   -0.544  1.00 0.00 ? 93  GLU A HG3  6  
ATOM 10182 N N    . ALA A 1 94  ? 7.470   5.259   -3.633  1.00 0.00 ? 94  ALA A N    6  
ATOM 10183 C CA   . ALA A 1 94  ? 6.773   5.015   -4.890  1.00 0.00 ? 94  ALA A CA   6  
ATOM 10184 C C    . ALA A 1 94  ? 5.410   5.698   -4.904  1.00 0.00 ? 94  ALA A C    6  
ATOM 10185 O O    . ALA A 1 94  ? 5.040   6.346   -5.884  1.00 0.00 ? 94  ALA A O    6  
ATOM 10186 C CB   . ALA A 1 94  ? 6.619   3.520   -5.126  1.00 0.00 ? 94  ALA A CB   6  
ATOM 10187 H H    . ALA A 1 94  ? 7.658   4.505   -3.036  1.00 0.00 ? 94  ALA A H    6  
ATOM 10188 H HA   . ALA A 1 94  ? 7.376   5.421   -5.690  1.00 0.00 ? 94  ALA A HA   6  
ATOM 10189 H HB1  . ALA A 1 94  ? 6.667   3.000   -4.181  1.00 0.00 ? 94  ALA A HB1  6  
ATOM 10190 H HB2  . ALA A 1 94  ? 5.665   3.327   -5.596  1.00 0.00 ? 94  ALA A HB2  6  
ATOM 10191 H HB3  . ALA A 1 94  ? 7.414   3.173   -5.770  1.00 0.00 ? 94  ALA A HB3  6  
ATOM 10192 N N    . ILE A 1 95  ? 4.668   5.549   -3.812  1.00 0.00 ? 95  ILE A N    6  
ATOM 10193 C CA   . ILE A 1 95  ? 3.346   6.153   -3.700  1.00 0.00 ? 95  ILE A CA   6  
ATOM 10194 C C    . ILE A 1 95  ? 3.441   7.672   -3.605  1.00 0.00 ? 95  ILE A C    6  
ATOM 10195 O O    . ILE A 1 95  ? 2.579   8.392   -4.111  1.00 0.00 ? 95  ILE A O    6  
ATOM 10196 C CB   . ILE A 1 95  ? 2.586   5.620   -2.471  1.00 0.00 ? 95  ILE A CB   6  
ATOM 10197 C CG1  . ILE A 1 95  ? 2.227   4.145   -2.666  1.00 0.00 ? 95  ILE A CG1  6  
ATOM 10198 C CG2  . ILE A 1 95  ? 1.333   6.447   -2.223  1.00 0.00 ? 95  ILE A CG2  6  
ATOM 10199 C CD1  . ILE A 1 95  ? 3.257   3.193   -2.101  1.00 0.00 ? 95  ILE A CD1  6  
ATOM 10200 H H    . ILE A 1 95  ? 5.017   5.022   -3.064  1.00 0.00 ? 95  ILE A H    6  
ATOM 10201 H HA   . ILE A 1 95  ? 2.784   5.892   -4.586  1.00 0.00 ? 95  ILE A HA   6  
ATOM 10202 H HB   . ILE A 1 95  ? 3.228   5.715   -1.609  1.00 0.00 ? 95  ILE A HB   6  
ATOM 10203 H HG12 . ILE A 1 95  ? 1.286   3.942   -2.179  1.00 0.00 ? 95  ILE A HG12 6  
ATOM 10204 H HG13 . ILE A 1 95  ? 2.131   3.943   -3.723  1.00 0.00 ? 95  ILE A HG13 6  
ATOM 10205 H HG21 . ILE A 1 95  ? 0.876   6.137   -1.294  1.00 0.00 ? 95  ILE A HG21 6  
ATOM 10206 H HG22 . ILE A 1 95  ? 1.599   7.491   -2.161  1.00 0.00 ? 95  ILE A HG22 6  
ATOM 10207 H HG23 . ILE A 1 95  ? 0.637   6.299   -3.034  1.00 0.00 ? 95  ILE A HG23 6  
ATOM 10208 H HD11 . ILE A 1 95  ? 2.756   2.347   -1.652  1.00 0.00 ? 95  ILE A HD11 6  
ATOM 10209 H HD12 . ILE A 1 95  ? 3.903   2.847   -2.895  1.00 0.00 ? 95  ILE A HD12 6  
ATOM 10210 H HD13 . ILE A 1 95  ? 3.846   3.701   -1.352  1.00 0.00 ? 95  ILE A HD13 6  
ATOM 10211 N N    . LYS A 1 96  ? 4.495   8.153   -2.956  1.00 0.00 ? 96  LYS A N    6  
ATOM 10212 C CA   . LYS A 1 96  ? 4.707   9.587   -2.797  1.00 0.00 ? 96  LYS A CA   6  
ATOM 10213 C C    . LYS A 1 96  ? 5.378   10.179  -4.032  1.00 0.00 ? 96  LYS A C    6  
ATOM 10214 O O    . LYS A 1 96  ? 5.230   11.365  -4.322  1.00 0.00 ? 96  LYS A O    6  
ATOM 10215 C CB   . LYS A 1 96  ? 5.561   9.863   -1.558  1.00 0.00 ? 96  LYS A CB   6  
ATOM 10216 C CG   . LYS A 1 96  ? 7.052   9.910   -1.845  1.00 0.00 ? 96  LYS A CG   6  
ATOM 10217 C CD   . LYS A 1 96  ? 7.866   9.940   -0.563  1.00 0.00 ? 96  LYS A CD   6  
ATOM 10218 C CE   . LYS A 1 96  ? 9.333   10.235  -0.840  1.00 0.00 ? 96  LYS A CE   6  
ATOM 10219 N NZ   . LYS A 1 96  ? 9.502   11.409  -1.739  1.00 0.00 ? 96  LYS A NZ   6  
ATOM 10220 H H    . LYS A 1 96  ? 5.148   7.529   -2.575  1.00 0.00 ? 96  LYS A H    6  
ATOM 10221 H HA   . LYS A 1 96  ? 3.741   10.053  -2.669  1.00 0.00 ? 96  LYS A HA   6  
ATOM 10222 H HB2  . LYS A 1 96  ? 5.267   10.813  -1.136  1.00 0.00 ? 96  LYS A HB2  6  
ATOM 10223 H HB3  . LYS A 1 96  ? 5.381   9.085   -0.830  1.00 0.00 ? 96  LYS A HB3  6  
ATOM 10224 H HG2  . LYS A 1 96  ? 7.328   9.034   -2.413  1.00 0.00 ? 96  LYS A HG2  6  
ATOM 10225 H HG3  . LYS A 1 96  ? 7.270   10.798  -2.420  1.00 0.00 ? 96  LYS A HG3  6  
ATOM 10226 H HD2  . LYS A 1 96  ? 7.473   10.709  0.086   1.00 0.00 ? 96  LYS A HD2  6  
ATOM 10227 H HD3  . LYS A 1 96  ? 7.787   8.979   -0.074  1.00 0.00 ? 96  LYS A HD3  6  
ATOM 10228 H HE2  . LYS A 1 96  ? 9.830   10.434  0.096   1.00 0.00 ? 96  LYS A HE2  6  
ATOM 10229 H HE3  . LYS A 1 96  ? 9.778   9.368   -1.306  1.00 0.00 ? 96  LYS A HE3  6  
ATOM 10230 H HZ1  . LYS A 1 96  ? 10.309  11.985  -1.427  1.00 0.00 ? 96  LYS A HZ1  6  
ATOM 10231 H HZ2  . LYS A 1 96  ? 8.644   11.997  -1.724  1.00 0.00 ? 96  LYS A HZ2  6  
ATOM 10232 H HZ3  . LYS A 1 96  ? 9.673   11.091  -2.715  1.00 0.00 ? 96  LYS A HZ3  6  
ATOM 10233 N N    . ASN A 1 97  ? 6.114   9.343   -4.757  1.00 0.00 ? 97  ASN A N    6  
ATOM 10234 C CA   . ASN A 1 97  ? 6.808   9.784   -5.962  1.00 0.00 ? 97  ASN A CA   6  
ATOM 10235 C C    . ASN A 1 97  ? 6.129   9.232   -7.213  1.00 0.00 ? 97  ASN A C    6  
ATOM 10236 O O    . ASN A 1 97  ? 6.654   9.350   -8.319  1.00 0.00 ? 97  ASN A O    6  
ATOM 10237 C CB   . ASN A 1 97  ? 8.271   9.340   -5.925  1.00 0.00 ? 97  ASN A CB   6  
ATOM 10238 C CG   . ASN A 1 97  ? 8.998   9.846   -4.694  1.00 0.00 ? 97  ASN A CG   6  
ATOM 10239 O OD1  . ASN A 1 97  ? 8.977   11.040  -4.395  1.00 0.00 ? 97  ASN A OD1  6  
ATOM 10240 N ND2  . ASN A 1 97  ? 9.646   8.938   -3.974  1.00 0.00 ? 97  ASN A ND2  6  
ATOM 10241 H H    . ASN A 1 97  ? 6.194   8.408   -4.475  1.00 0.00 ? 97  ASN A H    6  
ATOM 10242 H HA   . ASN A 1 97  ? 6.768   10.862  -5.991  1.00 0.00 ? 97  ASN A HA   6  
ATOM 10243 H HB2  . ASN A 1 97  ? 8.314   8.260   -5.926  1.00 0.00 ? 97  ASN A HB2  6  
ATOM 10244 H HB3  . ASN A 1 97  ? 8.778   9.716   -6.801  1.00 0.00 ? 97  ASN A HB3  6  
ATOM 10245 H HD21 . ASN A 1 97  ? 9.619   8.004   -4.273  1.00 0.00 ? 97  ASN A HD21 6  
ATOM 10246 H HD22 . ASN A 1 97  ? 10.123  9.237   -3.173  1.00 0.00 ? 97  ASN A HD22 6  
ATOM 10247 N N    . ALA A 1 98  ? 4.958   8.631   -7.027  1.00 0.00 ? 98  ALA A N    6  
ATOM 10248 C CA   . ALA A 1 98  ? 4.206   8.064   -8.140  1.00 0.00 ? 98  ALA A CA   6  
ATOM 10249 C C    . ALA A 1 98  ? 3.741   9.153   -9.100  1.00 0.00 ? 98  ALA A C    6  
ATOM 10250 O O    . ALA A 1 98  ? 2.884   9.968   -8.761  1.00 0.00 ? 98  ALA A O    6  
ATOM 10251 C CB   . ALA A 1 98  ? 3.016   7.270   -7.622  1.00 0.00 ? 98  ALA A CB   6  
ATOM 10252 H H    . ALA A 1 98  ? 4.591   8.568   -6.121  1.00 0.00 ? 98  ALA A H    6  
ATOM 10253 H HA   . ALA A 1 98  ? 4.857   7.384   -8.671  1.00 0.00 ? 98  ALA A HA   6  
ATOM 10254 H HB1  . ALA A 1 98  ? 3.318   6.251   -7.433  1.00 0.00 ? 98  ALA A HB1  6  
ATOM 10255 H HB2  . ALA A 1 98  ? 2.659   7.716   -6.705  1.00 0.00 ? 98  ALA A HB2  6  
ATOM 10256 H HB3  . ALA A 1 98  ? 2.227   7.282   -8.360  1.00 0.00 ? 98  ALA A HB3  6  
ATOM 10257 N N    . GLY A 1 99  ? 4.314   9.162   -10.300 1.00 0.00 ? 99  GLY A N    6  
ATOM 10258 C CA   . GLY A 1 99  ? 3.945   10.157  -11.290 1.00 0.00 ? 99  GLY A CA   6  
ATOM 10259 C C    . GLY A 1 99  ? 2.444   10.273  -11.465 1.00 0.00 ? 99  GLY A C    6  
ATOM 10260 O O    . GLY A 1 99  ? 1.837   9.501   -12.206 1.00 0.00 ? 99  GLY A O    6  
ATOM 10261 H H    . GLY A 1 99  ? 4.992   8.488   -10.515 1.00 0.00 ? 99  GLY A H    6  
ATOM 10262 H HA2  . GLY A 1 99  ? 4.337   11.116  -10.985 1.00 0.00 ? 99  GLY A HA2  6  
ATOM 10263 H HA3  . GLY A 1 99  ? 4.386   9.885   -12.238 1.00 0.00 ? 99  GLY A HA3  6  
ATOM 10264 N N    . ASN A 1 100 ? 1.843   11.240  -10.779 1.00 0.00 ? 100 ASN A N    6  
ATOM 10265 C CA   . ASN A 1 100 ? 0.403   11.453  -10.860 1.00 0.00 ? 100 ASN A CA   6  
ATOM 10266 C C    . ASN A 1 100 ? -0.096  11.261  -12.289 1.00 0.00 ? 100 ASN A C    6  
ATOM 10267 O O    . ASN A 1 100 ? 0.509   11.731  -13.253 1.00 0.00 ? 100 ASN A O    6  
ATOM 10268 C CB   . ASN A 1 100 ? 0.045   12.857  -10.367 1.00 0.00 ? 100 ASN A CB   6  
ATOM 10269 C CG   . ASN A 1 100 ? -1.448  13.040  -10.178 1.00 0.00 ? 100 ASN A CG   6  
ATOM 10270 O OD1  . ASN A 1 100 ? -2.230  12.865  -11.113 1.00 0.00 ? 100 ASN A OD1  6  
ATOM 10271 N ND2  . ASN A 1 100 ? -1.851  13.393  -8.963  1.00 0.00 ? 100 ASN A ND2  6  
ATOM 10272 H H    . ASN A 1 100 ? 2.381   11.824  -10.205 1.00 0.00 ? 100 ASN A H    6  
ATOM 10273 H HA   . ASN A 1 100 ? -0.076  10.725  -10.223 1.00 0.00 ? 100 ASN A HA   6  
ATOM 10274 H HB2  . ASN A 1 100 ? 0.533   13.034  -9.420  1.00 0.00 ? 100 ASN A HB2  6  
ATOM 10275 H HB3  . ASN A 1 100 ? 0.390   13.584  -11.087 1.00 0.00 ? 100 ASN A HB3  6  
ATOM 10276 H HD21 . ASN A 1 100 ? -1.172  13.515  -8.266  1.00 0.00 ? 100 ASN A HD21 6  
ATOM 10277 H HD22 . ASN A 1 100 ? -2.812  13.518  -8.812  1.00 0.00 ? 100 ASN A HD22 6  
ATOM 10278 N N    . PRO A 1 101 ? -1.227  10.555  -12.431 1.00 0.00 ? 101 PRO A N    6  
ATOM 10279 C CA   . PRO A 1 101 ? -1.956  9.990   -11.292 1.00 0.00 ? 101 PRO A CA   6  
ATOM 10280 C C    . PRO A 1 101 ? -1.204  8.838   -10.635 1.00 0.00 ? 101 PRO A C    6  
ATOM 10281 O O    . PRO A 1 101 ? -0.187  8.373   -11.151 1.00 0.00 ? 101 PRO A O    6  
ATOM 10282 C CB   . PRO A 1 101 ? -3.260  9.489   -11.918 1.00 0.00 ? 101 PRO A CB   6  
ATOM 10283 C CG   . PRO A 1 101 ? -2.920  9.230   -13.345 1.00 0.00 ? 101 PRO A CG   6  
ATOM 10284 C CD   . PRO A 1 101 ? -1.881  10.252  -13.716 1.00 0.00 ? 101 PRO A CD   6  
ATOM 10285 H HA   . PRO A 1 101 ? -2.178  10.743  -10.550 1.00 0.00 ? 101 PRO A HA   6  
ATOM 10286 H HB2  . PRO A 1 101 ? -3.579  8.586   -11.417 1.00 0.00 ? 101 PRO A HB2  6  
ATOM 10287 H HB3  . PRO A 1 101 ? -4.023  10.247  -11.826 1.00 0.00 ? 101 PRO A HB3  6  
ATOM 10288 H HG2  . PRO A 1 101 ? -2.520  8.233   -13.452 1.00 0.00 ? 101 PRO A HG2  6  
ATOM 10289 H HG3  . PRO A 1 101 ? -3.800  9.351   -13.960 1.00 0.00 ? 101 PRO A HG3  6  
ATOM 10290 H HD2  . PRO A 1 101 ? -1.176  9.836   -14.419 1.00 0.00 ? 101 PRO A HD2  6  
ATOM 10291 H HD3  . PRO A 1 101 ? -2.350  11.135  -14.126 1.00 0.00 ? 101 PRO A HD3  6  
ATOM 10292 N N    . VAL A 1 102 ? -1.709  8.380   -9.495  1.00 0.00 ? 102 VAL A N    6  
ATOM 10293 C CA   . VAL A 1 102 ? -1.085  7.281   -8.768  1.00 0.00 ? 102 VAL A CA   6  
ATOM 10294 C C    . VAL A 1 102 ? -1.897  5.998   -8.909  1.00 0.00 ? 102 VAL A C    6  
ATOM 10295 O O    . VAL A 1 102 ? -2.875  5.787   -8.192  1.00 0.00 ? 102 VAL A O    6  
ATOM 10296 C CB   . VAL A 1 102 ? -0.928  7.614   -7.273  1.00 0.00 ? 102 VAL A CB   6  
ATOM 10297 C CG1  . VAL A 1 102 ? -0.028  6.595   -6.590  1.00 0.00 ? 102 VAL A CG1  6  
ATOM 10298 C CG2  . VAL A 1 102 ? -0.382  9.023   -7.096  1.00 0.00 ? 102 VAL A CG2  6  
ATOM 10299 H H    . VAL A 1 102 ? -2.522  8.791   -9.133  1.00 0.00 ? 102 VAL A H    6  
ATOM 10300 H HA   . VAL A 1 102 ? -0.102  7.121   -9.185  1.00 0.00 ? 102 VAL A HA   6  
ATOM 10301 H HB   . VAL A 1 102 ? -1.903  7.567   -6.810  1.00 0.00 ? 102 VAL A HB   6  
ATOM 10302 H HG11 . VAL A 1 102 ? 0.654   6.175   -7.315  1.00 0.00 ? 102 VAL A HG11 6  
ATOM 10303 H HG12 . VAL A 1 102 ? 0.534   7.079   -5.805  1.00 0.00 ? 102 VAL A HG12 6  
ATOM 10304 H HG13 . VAL A 1 102 ? -0.633  5.806   -6.168  1.00 0.00 ? 102 VAL A HG13 6  
ATOM 10305 H HG21 . VAL A 1 102 ? 0.487   9.154   -7.723  1.00 0.00 ? 102 VAL A HG21 6  
ATOM 10306 H HG22 . VAL A 1 102 ? -1.140  9.739   -7.375  1.00 0.00 ? 102 VAL A HG22 6  
ATOM 10307 H HG23 . VAL A 1 102 ? -0.106  9.175   -6.062  1.00 0.00 ? 102 VAL A HG23 6  
ATOM 10308 N N    . VAL A 1 103 ? -1.485  5.142   -9.839  1.00 0.00 ? 103 VAL A N    6  
ATOM 10309 C CA   . VAL A 1 103 ? -2.172  3.878   -10.074 1.00 0.00 ? 103 VAL A CA   6  
ATOM 10310 C C    . VAL A 1 103 ? -1.811  2.850   -9.009  1.00 0.00 ? 103 VAL A C    6  
ATOM 10311 O O    . VAL A 1 103 ? -0.671  2.793   -8.547  1.00 0.00 ? 103 VAL A O    6  
ATOM 10312 C CB   . VAL A 1 103 ? -1.833  3.304   -11.463 1.00 0.00 ? 103 VAL A CB   6  
ATOM 10313 C CG1  . VAL A 1 103 ? -2.857  2.256   -11.872 1.00 0.00 ? 103 VAL A CG1  6  
ATOM 10314 C CG2  . VAL A 1 103 ? -1.757  4.419   -12.495 1.00 0.00 ? 103 VAL A CG2  6  
ATOM 10315 H H    . VAL A 1 103 ? -0.699  5.366   -10.380 1.00 0.00 ? 103 VAL A H    6  
ATOM 10316 H HA   . VAL A 1 103 ? -3.236  4.064   -10.035 1.00 0.00 ? 103 VAL A HA   6  
ATOM 10317 H HB   . VAL A 1 103 ? -0.866  2.828   -11.406 1.00 0.00 ? 103 VAL A HB   6  
ATOM 10318 H HG11 . VAL A 1 103 ? -2.687  1.349   -11.310 1.00 0.00 ? 103 VAL A HG11 6  
ATOM 10319 H HG12 . VAL A 1 103 ? -3.851  2.626   -11.669 1.00 0.00 ? 103 VAL A HG12 6  
ATOM 10320 H HG13 . VAL A 1 103 ? -2.757  2.049   -12.927 1.00 0.00 ? 103 VAL A HG13 6  
ATOM 10321 H HG21 . VAL A 1 103 ? -2.348  4.151   -13.358 1.00 0.00 ? 103 VAL A HG21 6  
ATOM 10322 H HG22 . VAL A 1 103 ? -2.138  5.333   -12.066 1.00 0.00 ? 103 VAL A HG22 6  
ATOM 10323 H HG23 . VAL A 1 103 ? -0.729  4.563   -12.794 1.00 0.00 ? 103 VAL A HG23 6  
ATOM 10324 N N    . PHE A 1 104 ? -2.789  2.037   -8.622  1.00 0.00 ? 104 PHE A N    6  
ATOM 10325 C CA   . PHE A 1 104 ? -2.574  1.009   -7.610  1.00 0.00 ? 104 PHE A CA   6  
ATOM 10326 C C    . PHE A 1 104 ? -2.960  -0.367  -8.142  1.00 0.00 ? 104 PHE A C    6  
ATOM 10327 O O    . PHE A 1 104 ? -4.079  -0.570  -8.617  1.00 0.00 ? 104 PHE A O    6  
ATOM 10328 C CB   . PHE A 1 104 ? -3.382  1.327   -6.351  1.00 0.00 ? 104 PHE A CB   6  
ATOM 10329 C CG   . PHE A 1 104 ? -2.615  2.117   -5.329  1.00 0.00 ? 104 PHE A CG   6  
ATOM 10330 C CD1  . PHE A 1 104 ? -1.751  1.484   -4.451  1.00 0.00 ? 104 PHE A CD1  6  
ATOM 10331 C CD2  . PHE A 1 104 ? -2.759  3.493   -5.247  1.00 0.00 ? 104 PHE A CD2  6  
ATOM 10332 C CE1  . PHE A 1 104 ? -1.043  2.209   -3.510  1.00 0.00 ? 104 PHE A CE1  6  
ATOM 10333 C CE2  . PHE A 1 104 ? -2.054  4.222   -4.309  1.00 0.00 ? 104 PHE A CE2  6  
ATOM 10334 C CZ   . PHE A 1 104 ? -1.196  3.579   -3.439  1.00 0.00 ? 104 PHE A CZ   6  
ATOM 10335 H H    . PHE A 1 104 ? -3.676  2.131   -9.028  1.00 0.00 ? 104 PHE A H    6  
ATOM 10336 H HA   . PHE A 1 104 ? -1.524  1.004   -7.362  1.00 0.00 ? 104 PHE A HA   6  
ATOM 10337 H HB2  . PHE A 1 104 ? -4.254  1.901   -6.627  1.00 0.00 ? 104 PHE A HB2  6  
ATOM 10338 H HB3  . PHE A 1 104 ? -3.696  0.403   -5.890  1.00 0.00 ? 104 PHE A HB3  6  
ATOM 10339 H HD1  . PHE A 1 104 ? -1.631  0.411   -4.506  1.00 0.00 ? 104 PHE A HD1  6  
ATOM 10340 H HD2  . PHE A 1 104 ? -3.431  3.997   -5.927  1.00 0.00 ? 104 PHE A HD2  6  
ATOM 10341 H HE1  . PHE A 1 104 ? -0.373  1.702   -2.831  1.00 0.00 ? 104 PHE A HE1  6  
ATOM 10342 H HE2  . PHE A 1 104 ? -2.175  5.294   -4.255  1.00 0.00 ? 104 PHE A HE2  6  
ATOM 10343 H HZ   . PHE A 1 104 ? -0.643  4.147   -2.705  1.00 0.00 ? 104 PHE A HZ   6  
ATOM 10344 N N    . ILE A 1 105 ? -2.027  -1.310  -8.061  1.00 0.00 ? 105 ILE A N    6  
ATOM 10345 C CA   . ILE A 1 105 ? -2.270  -2.667  -8.533  1.00 0.00 ? 105 ILE A CA   6  
ATOM 10346 C C    . ILE A 1 105 ? -2.234  -3.665  -7.381  1.00 0.00 ? 105 ILE A C    6  
ATOM 10347 O O    . ILE A 1 105 ? -1.182  -4.216  -7.055  1.00 0.00 ? 105 ILE A O    6  
ATOM 10348 C CB   . ILE A 1 105 ? -1.236  -3.087  -9.594  1.00 0.00 ? 105 ILE A CB   6  
ATOM 10349 C CG1  . ILE A 1 105 ? -1.077  -1.989  -10.647 1.00 0.00 ? 105 ILE A CG1  6  
ATOM 10350 C CG2  . ILE A 1 105 ? -1.649  -4.398  -10.247 1.00 0.00 ? 105 ILE A CG2  6  
ATOM 10351 C CD1  . ILE A 1 105 ? -0.573  -2.497  -11.980 1.00 0.00 ? 105 ILE A CD1  6  
ATOM 10352 H H    . ILE A 1 105 ? -1.156  -1.087  -7.673  1.00 0.00 ? 105 ILE A H    6  
ATOM 10353 H HA   . ILE A 1 105 ? -3.251  -2.692  -8.986  1.00 0.00 ? 105 ILE A HA   6  
ATOM 10354 H HB   . ILE A 1 105 ? -0.289  -3.242  -9.100  1.00 0.00 ? 105 ILE A HB   6  
ATOM 10355 H HG12 . ILE A 1 105 ? -2.033  -1.517  -10.812 1.00 0.00 ? 105 ILE A HG12 6  
ATOM 10356 H HG13 . ILE A 1 105 ? -0.375  -1.252  -10.284 1.00 0.00 ? 105 ILE A HG13 6  
ATOM 10357 H HG21 . ILE A 1 105 ? -2.095  -4.196  -11.209 1.00 0.00 ? 105 ILE A HG21 6  
ATOM 10358 H HG22 . ILE A 1 105 ? -0.779  -5.024  -10.379 1.00 0.00 ? 105 ILE A HG22 6  
ATOM 10359 H HG23 . ILE A 1 105 ? -2.364  -4.905  -9.617  1.00 0.00 ? 105 ILE A HG23 6  
ATOM 10360 H HD11 . ILE A 1 105 ? 0.025   -1.732  -12.453 1.00 0.00 ? 105 ILE A HD11 6  
ATOM 10361 H HD12 . ILE A 1 105 ? 0.030   -3.379  -11.824 1.00 0.00 ? 105 ILE A HD12 6  
ATOM 10362 H HD13 . ILE A 1 105 ? -1.412  -2.740  -12.613 1.00 0.00 ? 105 ILE A HD13 6  
ATOM 10363 N N    . VAL A 1 106 ? -3.391  -3.895  -6.768  1.00 0.00 ? 106 VAL A N    6  
ATOM 10364 C CA   . VAL A 1 106 ? -3.493  -4.830  -5.654  1.00 0.00 ? 106 VAL A CA   6  
ATOM 10365 C C    . VAL A 1 106 ? -4.488  -5.944  -5.960  1.00 0.00 ? 106 VAL A C    6  
ATOM 10366 O O    . VAL A 1 106 ? -5.120  -5.951  -7.016  1.00 0.00 ? 106 VAL A O    6  
ATOM 10367 C CB   . VAL A 1 106 ? -3.923  -4.114  -4.359  1.00 0.00 ? 106 VAL A CB   6  
ATOM 10368 C CG1  . VAL A 1 106 ? -2.926  -3.026  -3.994  1.00 0.00 ? 106 VAL A CG1  6  
ATOM 10369 C CG2  . VAL A 1 106 ? -5.323  -3.537  -4.510  1.00 0.00 ? 106 VAL A CG2  6  
ATOM 10370 H H    . VAL A 1 106 ? -4.195  -3.426  -7.074  1.00 0.00 ? 106 VAL A H    6  
ATOM 10371 H HA   . VAL A 1 106 ? -2.518  -5.265  -5.492  1.00 0.00 ? 106 VAL A HA   6  
ATOM 10372 H HB   . VAL A 1 106 ? -3.940  -4.840  -3.559  1.00 0.00 ? 106 VAL A HB   6  
ATOM 10373 H HG11 . VAL A 1 106 ? -3.457  -2.119  -3.747  1.00 0.00 ? 106 VAL A HG11 6  
ATOM 10374 H HG12 . VAL A 1 106 ? -2.341  -3.344  -3.143  1.00 0.00 ? 106 VAL A HG12 6  
ATOM 10375 H HG13 . VAL A 1 106 ? -2.271  -2.842  -4.833  1.00 0.00 ? 106 VAL A HG13 6  
ATOM 10376 H HG21 . VAL A 1 106 ? -5.256  -2.488  -4.755  1.00 0.00 ? 106 VAL A HG21 6  
ATOM 10377 H HG22 . VAL A 1 106 ? -5.844  -4.059  -5.299  1.00 0.00 ? 106 VAL A HG22 6  
ATOM 10378 H HG23 . VAL A 1 106 ? -5.864  -3.656  -3.582  1.00 0.00 ? 106 VAL A HG23 6  
ATOM 10379 N N    . GLN A 1 107 ? -4.621  -6.883  -5.029  1.00 0.00 ? 107 GLN A N    6  
ATOM 10380 C CA   . GLN A 1 107 ? -5.539  -8.003  -5.200  1.00 0.00 ? 107 GLN A CA   6  
ATOM 10381 C C    . GLN A 1 107 ? -6.249  -8.329  -3.891  1.00 0.00 ? 107 GLN A C    6  
ATOM 10382 O O    . GLN A 1 107 ? -5.644  -8.864  -2.961  1.00 0.00 ? 107 GLN A O    6  
ATOM 10383 C CB   . GLN A 1 107 ? -4.786  -9.234  -5.707  1.00 0.00 ? 107 GLN A CB   6  
ATOM 10384 C CG   . GLN A 1 107 ? -3.550  -8.897  -6.525  1.00 0.00 ? 107 GLN A CG   6  
ATOM 10385 C CD   . GLN A 1 107 ? -3.159  -10.011 -7.477  1.00 0.00 ? 107 GLN A CD   6  
ATOM 10386 O OE1  . GLN A 1 107 ? -2.478  -9.779  -8.476  1.00 0.00 ? 107 GLN A OE1  6  
ATOM 10387 N NE2  . GLN A 1 107 ? -3.590  -11.230 -7.171  1.00 0.00 ? 107 GLN A NE2  6  
ATOM 10388 H H    . GLN A 1 107 ? -4.090  -6.822  -4.209  1.00 0.00 ? 107 GLN A H    6  
ATOM 10389 H HA   . GLN A 1 107 ? -6.278  -7.717  -5.934  1.00 0.00 ? 107 GLN A HA   6  
ATOM 10390 H HB2  . GLN A 1 107 ? -4.480  -9.828  -4.859  1.00 0.00 ? 107 GLN A HB2  6  
ATOM 10391 H HB3  . GLN A 1 107 ? -5.452  -9.819  -6.324  1.00 0.00 ? 107 GLN A HB3  6  
ATOM 10392 H HG2  . GLN A 1 107 ? -3.748  -8.006  -7.102  1.00 0.00 ? 107 GLN A HG2  6  
ATOM 10393 H HG3  . GLN A 1 107 ? -2.727  -8.714  -5.851  1.00 0.00 ? 107 GLN A HG3  6  
ATOM 10394 H HE21 . GLN A 1 107 ? -4.130  -11.339 -6.360  1.00 0.00 ? 107 GLN A HE21 6  
ATOM 10395 H HE22 . GLN A 1 107 ? -3.352  -11.968 -7.769  1.00 0.00 ? 107 GLN A HE22 6  
ATOM 10396 N N    . SER A 1 108 ? -7.537  -8.004  -3.824  1.00 0.00 ? 108 SER A N    6  
ATOM 10397 C CA   . SER A 1 108 ? -8.329  -8.259  -2.627  1.00 0.00 ? 108 SER A CA   6  
ATOM 10398 C C    . SER A 1 108 ? -8.690  -9.738  -2.519  1.00 0.00 ? 108 SER A C    6  
ATOM 10399 O O    . SER A 1 108 ? -9.258  -10.319 -3.445  1.00 0.00 ? 108 SER A O    6  
ATOM 10400 C CB   . SER A 1 108 ? -9.602  -7.411  -2.641  1.00 0.00 ? 108 SER A CB   6  
ATOM 10401 O OG   . SER A 1 108 ? -10.598 -8.001  -3.458  1.00 0.00 ? 108 SER A OG   6  
ATOM 10402 H H    . SER A 1 108 ? -7.963  -7.580  -4.598  1.00 0.00 ? 108 SER A H    6  
ATOM 10403 H HA   . SER A 1 108 ? -7.732  -7.984  -1.770  1.00 0.00 ? 108 SER A HA   6  
ATOM 10404 H HB2  . SER A 1 108 ? -9.984  -7.323  -1.636  1.00 0.00 ? 108 SER A HB2  6  
ATOM 10405 H HB3  . SER A 1 108 ? -9.372  -6.428  -3.027  1.00 0.00 ? 108 SER A HB3  6  
ATOM 10406 H HG   . SER A 1 108 ? -11.462 -7.851  -3.069  1.00 0.00 ? 108 SER A HG   6  
ATOM 10407 N N    . LEU A 1 109 ? -8.357  -10.340 -1.383  1.00 0.00 ? 109 LEU A N    6  
ATOM 10408 C CA   . LEU A 1 109 ? -8.646  -11.752 -1.152  1.00 0.00 ? 109 LEU A CA   6  
ATOM 10409 C C    . LEU A 1 109 ? -10.114 -12.059 -1.429  1.00 0.00 ? 109 LEU A C    6  
ATOM 10410 O O    . LEU A 1 109 ? -10.873 -11.187 -1.852  1.00 0.00 ? 109 LEU A O    6  
ATOM 10411 C CB   . LEU A 1 109 ? -8.295  -12.136 0.286   1.00 0.00 ? 109 LEU A CB   6  
ATOM 10412 C CG   . LEU A 1 109 ? -6.868  -12.634 0.518   1.00 0.00 ? 109 LEU A CG   6  
ATOM 10413 C CD1  . LEU A 1 109 ? -6.575  -12.740 2.007   1.00 0.00 ? 109 LEU A CD1  6  
ATOM 10414 C CD2  . LEU A 1 109 ? -6.653  -13.976 -0.167  1.00 0.00 ? 109 LEU A CD2  6  
ATOM 10415 H H    . LEU A 1 109 ? -7.907  -9.825  -0.682  1.00 0.00 ? 109 LEU A H    6  
ATOM 10416 H HA   . LEU A 1 109 ? -8.036  -12.330 -1.830  1.00 0.00 ? 109 LEU A HA   6  
ATOM 10417 H HB2  . LEU A 1 109 ? -8.447  -11.267 0.907   1.00 0.00 ? 109 LEU A HB2  6  
ATOM 10418 H HB3  . LEU A 1 109 ? -8.974  -12.919 0.593   1.00 0.00 ? 109 LEU A HB3  6  
ATOM 10419 H HG   . LEU A 1 109 ? -6.172  -11.924 0.092   1.00 0.00 ? 109 LEU A HG   6  
ATOM 10420 H HD11 . LEU A 1 109 ? -7.418  -12.364 2.567   1.00 0.00 ? 109 LEU A HD11 6  
ATOM 10421 H HD12 . LEU A 1 109 ? -5.697  -12.159 2.243   1.00 0.00 ? 109 LEU A HD12 6  
ATOM 10422 H HD13 . LEU A 1 109 ? -6.402  -13.775 2.266   1.00 0.00 ? 109 LEU A HD13 6  
ATOM 10423 H HD21 . LEU A 1 109 ? -6.461  -13.817 -1.217  1.00 0.00 ? 109 LEU A HD21 6  
ATOM 10424 H HD22 . LEU A 1 109 ? -7.537  -14.585 -0.049  1.00 0.00 ? 109 LEU A HD22 6  
ATOM 10425 H HD23 . LEU A 1 109 ? -5.808  -14.477 0.282   1.00 0.00 ? 109 LEU A HD23 6  
ATOM 10426 N N    . SER A 1 110 ? -10.509 -13.305 -1.185  1.00 0.00 ? 110 SER A N    6  
ATOM 10427 C CA   . SER A 1 110 ? -11.886 -13.728 -1.409  1.00 0.00 ? 110 SER A CA   6  
ATOM 10428 C C    . SER A 1 110 ? -12.806 -13.184 -0.320  1.00 0.00 ? 110 SER A C    6  
ATOM 10429 O O    . SER A 1 110 ? -13.432 -13.946 0.417   1.00 0.00 ? 110 SER A O    6  
ATOM 10430 C CB   . SER A 1 110 ? -11.972 -15.255 -1.449  1.00 0.00 ? 110 SER A CB   6  
ATOM 10431 O OG   . SER A 1 110 ? -13.153 -15.682 -2.106  1.00 0.00 ? 110 SER A OG   6  
ATOM 10432 H H    . SER A 1 110 ? -9.857  -13.955 -0.849  1.00 0.00 ? 110 SER A H    6  
ATOM 10433 H HA   . SER A 1 110 ? -12.203 -13.333 -2.363  1.00 0.00 ? 110 SER A HA   6  
ATOM 10434 H HB2  . SER A 1 110 ? -11.118 -15.648 -1.979  1.00 0.00 ? 110 SER A HB2  6  
ATOM 10435 H HB3  . SER A 1 110 ? -11.977 -15.639 -0.439  1.00 0.00 ? 110 SER A HB3  6  
ATOM 10436 H HG   . SER A 1 110 ? -13.778 -16.014 -1.458  1.00 0.00 ? 110 SER A HG   6  
ATOM 10437 N N    . SER A 1 111 ? -12.881 -11.860 -0.225  1.00 0.00 ? 111 SER A N    6  
ATOM 10438 C CA   . SER A 1 111 ? -13.721 -11.213 0.775   1.00 0.00 ? 111 SER A CA   6  
ATOM 10439 C C    . SER A 1 111 ? -13.685 -9.696  0.615   1.00 0.00 ? 111 SER A C    6  
ATOM 10440 O O    . SER A 1 111 ? -12.764 -9.144  0.012   1.00 0.00 ? 111 SER A O    6  
ATOM 10441 C CB   . SER A 1 111 ? -13.263 -11.599 2.183   1.00 0.00 ? 111 SER A CB   6  
ATOM 10442 O OG   . SER A 1 111 ? -11.857 -11.479 2.314   1.00 0.00 ? 111 SER A OG   6  
ATOM 10443 H H    . SER A 1 111 ? -12.358 -11.307 -0.842  1.00 0.00 ? 111 SER A H    6  
ATOM 10444 H HA   . SER A 1 111 ? -14.735 -11.554 0.629   1.00 0.00 ? 111 SER A HA   6  
ATOM 10445 H HB2  . SER A 1 111 ? -13.736 -10.949 2.904   1.00 0.00 ? 111 SER A HB2  6  
ATOM 10446 H HB3  . SER A 1 111 ? -13.545 -12.623 2.382   1.00 0.00 ? 111 SER A HB3  6  
ATOM 10447 H HG   . SER A 1 111 ? -11.623 -10.554 2.420   1.00 0.00 ? 111 SER A HG   6  
ATOM 10448 N N    . THR A 1 112 ? -14.695 -9.025  1.160   1.00 0.00 ? 112 THR A N    6  
ATOM 10449 C CA   . THR A 1 112 ? -14.781 -7.573  1.078   1.00 0.00 ? 112 THR A CA   6  
ATOM 10450 C C    . THR A 1 112 ? -15.920 -7.040  1.940   1.00 0.00 ? 112 THR A C    6  
ATOM 10451 O O    . THR A 1 112 ? -16.976 -7.659  2.068   1.00 0.00 ? 112 THR A O    6  
ATOM 10452 C CB   . THR A 1 112 ? -14.989 -7.104  -0.375  1.00 0.00 ? 112 THR A CB   6  
ATOM 10453 O OG1  . THR A 1 112 ? -15.725 -8.090  -1.107  1.00 0.00 ? 112 THR A OG1  6  
ATOM 10454 C CG2  . THR A 1 112 ? -13.654 -6.849  -1.057  1.00 0.00 ? 112 THR A CG2  6  
ATOM 10455 H H    . THR A 1 112 ? -15.399 -9.521  1.628   1.00 0.00 ? 112 THR A H    6  
ATOM 10456 H HA   . THR A 1 112 ? -13.848 -7.162  1.437   1.00 0.00 ? 112 THR A HA   6  
ATOM 10457 H HB   . THR A 1 112 ? -15.552 -6.182  -0.362  1.00 0.00 ? 112 THR A HB   6  
ATOM 10458 H HG1  . THR A 1 112 ? -15.457 -8.069  -2.029  1.00 0.00 ? 112 THR A HG1  6  
ATOM 10459 H HG21 . THR A 1 112 ? -13.722 -5.954  -1.658  1.00 0.00 ? 112 THR A HG21 6  
ATOM 10460 H HG22 . THR A 1 112 ? -13.406 -7.689  -1.690  1.00 0.00 ? 112 THR A HG22 6  
ATOM 10461 H HG23 . THR A 1 112 ? -12.886 -6.722  -0.309  1.00 0.00 ? 112 THR A HG23 6  
ATOM 10462 N N    . PRO A 1 113 ? -15.703 -5.863  2.546   1.00 0.00 ? 113 PRO A N    6  
ATOM 10463 C CA   . PRO A 1 113 ? -16.702 -5.220  3.406   1.00 0.00 ? 113 PRO A CA   6  
ATOM 10464 C C    . PRO A 1 113 ? -17.901 -4.704  2.617   1.00 0.00 ? 113 PRO A C    6  
ATOM 10465 O O    . PRO A 1 113 ? -18.112 -5.091  1.467   1.00 0.00 ? 113 PRO A O    6  
ATOM 10466 C CB   . PRO A 1 113 ? -15.932 -4.054  4.032   1.00 0.00 ? 113 PRO A CB   6  
ATOM 10467 C CG   . PRO A 1 113 ? -14.844 -3.752  3.059   1.00 0.00 ? 113 PRO A CG   6  
ATOM 10468 C CD   . PRO A 1 113 ? -14.468 -5.069  2.438   1.00 0.00 ? 113 PRO A CD   6  
ATOM 10469 H HA   . PRO A 1 113 ? -17.044 -5.886  4.183   1.00 0.00 ? 113 PRO A HA   6  
ATOM 10470 H HB2  . PRO A 1 113 ? -16.595 -3.209  4.159   1.00 0.00 ? 113 PRO A HB2  6  
ATOM 10471 H HB3  . PRO A 1 113 ? -15.534 -4.353  4.989   1.00 0.00 ? 113 PRO A HB3  6  
ATOM 10472 H HG2  . PRO A 1 113 ? -15.205 -3.071  2.304   1.00 0.00 ? 113 PRO A HG2  6  
ATOM 10473 H HG3  . PRO A 1 113 ? -13.997 -3.327  3.577   1.00 0.00 ? 113 PRO A HG3  6  
ATOM 10474 H HD2  . PRO A 1 113 ? -14.187 -4.931  1.404   1.00 0.00 ? 113 PRO A HD2  6  
ATOM 10475 H HD3  . PRO A 1 113 ? -13.664 -5.531  2.991   1.00 0.00 ? 113 PRO A HD3  6  
ATOM 10476 N N    . ARG A 1 114 ? -18.682 -3.830  3.241   1.00 0.00 ? 114 ARG A N    6  
ATOM 10477 C CA   . ARG A 1 114 ? -19.860 -3.262  2.597   1.00 0.00 ? 114 ARG A CA   6  
ATOM 10478 C C    . ARG A 1 114 ? -19.696 -1.759  2.389   1.00 0.00 ? 114 ARG A C    6  
ATOM 10479 O O    . ARG A 1 114 ? -19.019 -1.085  3.166   1.00 0.00 ? 114 ARG A O    6  
ATOM 10480 C CB   . ARG A 1 114 ? -21.109 -3.537  3.437   1.00 0.00 ? 114 ARG A CB   6  
ATOM 10481 C CG   . ARG A 1 114 ? -22.394 -3.032  2.801   1.00 0.00 ? 114 ARG A CG   6  
ATOM 10482 C CD   . ARG A 1 114 ? -23.006 -4.074  1.878   1.00 0.00 ? 114 ARG A CD   6  
ATOM 10483 N NE   . ARG A 1 114 ? -22.239 -4.231  0.645   1.00 0.00 ? 114 ARG A NE   6  
ATOM 10484 C CZ   . ARG A 1 114 ? -22.415 -5.234  -0.207  1.00 0.00 ? 114 ARG A CZ   6  
ATOM 10485 N NH1  . ARG A 1 114 ? -23.327 -6.165  0.038   1.00 0.00 ? 114 ARG A NH1  6  
ATOM 10486 N NH2  . ARG A 1 114 ? -21.678 -5.308  -1.308  1.00 0.00 ? 114 ARG A NH2  6  
ATOM 10487 H H    . ARG A 1 114 ? -18.462 -3.560  4.157   1.00 0.00 ? 114 ARG A H    6  
ATOM 10488 H HA   . ARG A 1 114 ? -19.973 -3.736  1.634   1.00 0.00 ? 114 ARG A HA   6  
ATOM 10489 H HB2  . ARG A 1 114 ? -21.202 -4.603  3.584   1.00 0.00 ? 114 ARG A HB2  6  
ATOM 10490 H HB3  . ARG A 1 114 ? -20.996 -3.058  4.397   1.00 0.00 ? 114 ARG A HB3  6  
ATOM 10491 H HG2  . ARG A 1 114 ? -23.103 -2.798  3.581   1.00 0.00 ? 114 ARG A HG2  6  
ATOM 10492 H HG3  . ARG A 1 114 ? -22.176 -2.141  2.231   1.00 0.00 ? 114 ARG A HG3  6  
ATOM 10493 H HD2  . ARG A 1 114 ? -23.035 -5.021  2.395   1.00 0.00 ? 114 ARG A HD2  6  
ATOM 10494 H HD3  . ARG A 1 114 ? -24.012 -3.769  1.629   1.00 0.00 ? 114 ARG A HD3  6  
ATOM 10495 H HE   . ARG A 1 114 ? -21.560 -3.554  0.444   1.00 0.00 ? 114 ARG A HE   6  
ATOM 10496 H HH11 . ARG A 1 114 ? -23.884 -6.111  0.867   1.00 0.00 ? 114 ARG A HH11 6  
ATOM 10497 H HH12 . ARG A 1 114 ? -23.458 -6.919  -0.606  1.00 0.00 ? 114 ARG A HH12 6  
ATOM 10498 H HH21 . ARG A 1 114 ? -20.990 -4.608  -1.497  1.00 0.00 ? 114 ARG A HH21 6  
ATOM 10499 H HH22 . ARG A 1 114 ? -21.811 -6.064  -1.949  1.00 0.00 ? 114 ARG A HH22 6  
ATOM 10500 N N    . VAL A 1 115 ? -20.319 -1.241  1.336   1.00 0.00 ? 115 VAL A N    6  
ATOM 10501 C CA   . VAL A 1 115 ? -20.242 0.182   1.026   1.00 0.00 ? 115 VAL A CA   6  
ATOM 10502 C C    . VAL A 1 115 ? -21.553 0.887   1.353   1.00 0.00 ? 115 VAL A C    6  
ATOM 10503 O O    . VAL A 1 115 ? -22.584 0.243   1.551   1.00 0.00 ? 115 VAL A O    6  
ATOM 10504 C CB   . VAL A 1 115 ? -19.903 0.415   -0.459  1.00 0.00 ? 115 VAL A CB   6  
ATOM 10505 C CG1  . VAL A 1 115 ? -19.823 1.904   -0.760  1.00 0.00 ? 115 VAL A CG1  6  
ATOM 10506 C CG2  . VAL A 1 115 ? -18.601 -0.282  -0.823  1.00 0.00 ? 115 VAL A CG2  6  
ATOM 10507 H H    . VAL A 1 115 ? -20.844 -1.829  0.754   1.00 0.00 ? 115 VAL A H    6  
ATOM 10508 H HA   . VAL A 1 115 ? -19.453 0.612   1.625   1.00 0.00 ? 115 VAL A HA   6  
ATOM 10509 H HB   . VAL A 1 115 ? -20.695 -0.009  -1.059  1.00 0.00 ? 115 VAL A HB   6  
ATOM 10510 H HG11 . VAL A 1 115 ? -19.382 2.050   -1.736  1.00 0.00 ? 115 VAL A HG11 6  
ATOM 10511 H HG12 . VAL A 1 115 ? -20.816 2.328   -0.746  1.00 0.00 ? 115 VAL A HG12 6  
ATOM 10512 H HG13 . VAL A 1 115 ? -19.212 2.390   -0.014  1.00 0.00 ? 115 VAL A HG13 6  
ATOM 10513 H HG21 . VAL A 1 115 ? -18.713 -1.348  -0.690  1.00 0.00 ? 115 VAL A HG21 6  
ATOM 10514 H HG22 . VAL A 1 115 ? -18.358 -0.071  -1.854  1.00 0.00 ? 115 VAL A HG22 6  
ATOM 10515 H HG23 . VAL A 1 115 ? -17.808 0.079   -0.185  1.00 0.00 ? 115 VAL A HG23 6  
ATOM 10516 N N    . ILE A 1 116 ? -21.507 2.214   1.409   1.00 0.00 ? 116 ILE A N    6  
ATOM 10517 C CA   . ILE A 1 116 ? -22.692 3.007   1.711   1.00 0.00 ? 116 ILE A CA   6  
ATOM 10518 C C    . ILE A 1 116 ? -23.765 2.822   0.643   1.00 0.00 ? 116 ILE A C    6  
ATOM 10519 O O    . ILE A 1 116 ? -23.482 2.463   -0.500  1.00 0.00 ? 116 ILE A O    6  
ATOM 10520 C CB   . ILE A 1 116 ? -22.352 4.505   1.827   1.00 0.00 ? 116 ILE A CB   6  
ATOM 10521 C CG1  . ILE A 1 116 ? -21.369 4.914   0.729   1.00 0.00 ? 116 ILE A CG1  6  
ATOM 10522 C CG2  . ILE A 1 116 ? -21.777 4.813   3.202   1.00 0.00 ? 116 ILE A CG2  6  
ATOM 10523 C CD1  . ILE A 1 116 ? -21.365 6.399   0.443   1.00 0.00 ? 116 ILE A CD1  6  
ATOM 10524 H H    . ILE A 1 116 ? -20.656 2.670   1.242   1.00 0.00 ? 116 ILE A H    6  
ATOM 10525 H HA   . ILE A 1 116 ? -23.083 2.673   2.661   1.00 0.00 ? 116 ILE A HA   6  
ATOM 10526 H HB   . ILE A 1 116 ? -23.265 5.068   1.711   1.00 0.00 ? 116 ILE A HB   6  
ATOM 10527 H HG12 . ILE A 1 116 ? -20.371 4.631   1.024   1.00 0.00 ? 116 ILE A HG12 6  
ATOM 10528 H HG13 . ILE A 1 116 ? -21.628 4.400   -0.186  1.00 0.00 ? 116 ILE A HG13 6  
ATOM 10529 H HG21 . ILE A 1 116 ? -21.316 3.924   3.606   1.00 0.00 ? 116 ILE A HG21 6  
ATOM 10530 H HG22 . ILE A 1 116 ? -21.037 5.594   3.115   1.00 0.00 ? 116 ILE A HG22 6  
ATOM 10531 H HG23 . ILE A 1 116 ? -22.570 5.138   3.859   1.00 0.00 ? 116 ILE A HG23 6  
ATOM 10532 H HD11 . ILE A 1 116 ? -21.942 6.596   -0.450  1.00 0.00 ? 116 ILE A HD11 6  
ATOM 10533 H HD12 . ILE A 1 116 ? -21.804 6.928   1.277   1.00 0.00 ? 116 ILE A HD12 6  
ATOM 10534 H HD13 . ILE A 1 116 ? -20.350 6.736   0.296   1.00 0.00 ? 116 ILE A HD13 6  
ATOM 10535 N N    . PRO A 1 117 ? -25.026 3.074   1.022   1.00 0.00 ? 117 PRO A N    6  
ATOM 10536 C CA   . PRO A 1 117 ? -26.167 2.944   0.110   1.00 0.00 ? 117 PRO A CA   6  
ATOM 10537 C C    . PRO A 1 117 ? -26.172 4.021   -0.969  1.00 0.00 ? 117 PRO A C    6  
ATOM 10538 O O    . PRO A 1 117 ? -27.149 4.173   -1.703  1.00 0.00 ? 117 PRO A O    6  
ATOM 10539 C CB   . PRO A 1 117 ? -27.378 3.106   1.033   1.00 0.00 ? 117 PRO A CB   6  
ATOM 10540 C CG   . PRO A 1 117 ? -26.874 3.906   2.183   1.00 0.00 ? 117 PRO A CG   6  
ATOM 10541 C CD   . PRO A 1 117 ? -25.436 3.506   2.368   1.00 0.00 ? 117 PRO A CD   6  
ATOM 10542 H HA   . PRO A 1 117 ? -26.194 1.970   -0.355  1.00 0.00 ? 117 PRO A HA   6  
ATOM 10543 H HB2  . PRO A 1 117 ? -28.168 3.623   0.506   1.00 0.00 ? 117 PRO A HB2  6  
ATOM 10544 H HB3  . PRO A 1 117 ? -27.725 2.134   1.350   1.00 0.00 ? 117 PRO A HB3  6  
ATOM 10545 H HG2  . PRO A 1 117 ? -26.943 4.959   1.956   1.00 0.00 ? 117 PRO A HG2  6  
ATOM 10546 H HG3  . PRO A 1 117 ? -27.445 3.674   3.070   1.00 0.00 ? 117 PRO A HG3  6  
ATOM 10547 H HD2  . PRO A 1 117 ? -24.849 4.349   2.699   1.00 0.00 ? 117 PRO A HD2  6  
ATOM 10548 H HD3  . PRO A 1 117 ? -25.360 2.691   3.073   1.00 0.00 ? 117 PRO A HD3  6  
ATOM 10549 N N    . GLY A 1 1   ? 13.839  -1.107  -15.020 1.00 0.00 ? 1   GLY A N    7  
ATOM 10550 C CA   . GLY A 1 1   ? 14.263  -2.295  -15.738 1.00 0.00 ? 1   GLY A CA   7  
ATOM 10551 C C    . GLY A 1 1   ? 13.149  -3.311  -15.888 1.00 0.00 ? 1   GLY A C    7  
ATOM 10552 O O    . GLY A 1 1   ? 11.982  -2.946  -16.036 1.00 0.00 ? 1   GLY A O    7  
ATOM 10553 H H1   . GLY A 1 1   ? 12.947  -1.074  -14.617 1.00 0.00 ? 1   GLY A H1   7  
ATOM 10554 H HA2  . GLY A 1 1   ? 14.607  -2.005  -16.720 1.00 0.00 ? 1   GLY A HA2  7  
ATOM 10555 H HA3  . GLY A 1 1   ? 15.082  -2.753  -15.202 1.00 0.00 ? 1   GLY A HA3  7  
ATOM 10556 N N    . SER A 1 2   ? 13.507  -4.590  -15.850 1.00 0.00 ? 2   SER A N    7  
ATOM 10557 C CA   . SER A 1 2   ? 12.529  -5.663  -15.989 1.00 0.00 ? 2   SER A CA   7  
ATOM 10558 C C    . SER A 1 2   ? 12.899  -6.853  -15.109 1.00 0.00 ? 2   SER A C    7  
ATOM 10559 O O    . SER A 1 2   ? 14.074  -7.095  -14.835 1.00 0.00 ? 2   SER A O    7  
ATOM 10560 C CB   . SER A 1 2   ? 12.429  -6.106  -17.450 1.00 0.00 ? 2   SER A CB   7  
ATOM 10561 O OG   . SER A 1 2   ? 11.733  -5.147  -18.227 1.00 0.00 ? 2   SER A OG   7  
ATOM 10562 H H    . SER A 1 2   ? 14.453  -4.818  -15.730 1.00 0.00 ? 2   SER A H    7  
ATOM 10563 H HA   . SER A 1 2   ? 11.570  -5.280  -15.672 1.00 0.00 ? 2   SER A HA   7  
ATOM 10564 H HB2  . SER A 1 2   ? 13.422  -6.227  -17.855 1.00 0.00 ? 2   SER A HB2  7  
ATOM 10565 H HB3  . SER A 1 2   ? 11.901  -7.047  -17.502 1.00 0.00 ? 2   SER A HB3  7  
ATOM 10566 H HG   . SER A 1 2   ? 11.219  -5.595  -18.903 1.00 0.00 ? 2   SER A HG   7  
ATOM 10567 N N    . SER A 1 3   ? 11.886  -7.593  -14.668 1.00 0.00 ? 3   SER A N    7  
ATOM 10568 C CA   . SER A 1 3   ? 12.103  -8.756  -13.816 1.00 0.00 ? 3   SER A CA   7  
ATOM 10569 C C    . SER A 1 3   ? 10.843  -9.612  -13.733 1.00 0.00 ? 3   SER A C    7  
ATOM 10570 O O    . SER A 1 3   ? 9.796   -9.248  -14.268 1.00 0.00 ? 3   SER A O    7  
ATOM 10571 C CB   . SER A 1 3   ? 12.526  -8.314  -12.413 1.00 0.00 ? 3   SER A CB   7  
ATOM 10572 O OG   . SER A 1 3   ? 13.437  -7.231  -12.473 1.00 0.00 ? 3   SER A OG   7  
ATOM 10573 H H    . SER A 1 3   ? 10.971  -7.349  -14.921 1.00 0.00 ? 3   SER A H    7  
ATOM 10574 H HA   . SER A 1 3   ? 12.896  -9.344  -14.253 1.00 0.00 ? 3   SER A HA   7  
ATOM 10575 H HB2  . SER A 1 3   ? 11.654  -8.005  -11.858 1.00 0.00 ? 3   SER A HB2  7  
ATOM 10576 H HB3  . SER A 1 3   ? 13.001  -9.142  -11.907 1.00 0.00 ? 3   SER A HB3  7  
ATOM 10577 H HG   . SER A 1 3   ? 14.329  -7.554  -12.325 1.00 0.00 ? 3   SER A HG   7  
ATOM 10578 N N    . GLY A 1 4   ? 10.952  -10.752 -13.058 1.00 0.00 ? 4   GLY A N    7  
ATOM 10579 C CA   . GLY A 1 4   ? 9.815   -11.643 -12.918 1.00 0.00 ? 4   GLY A CA   7  
ATOM 10580 C C    . GLY A 1 4   ? 10.094  -12.794 -11.971 1.00 0.00 ? 4   GLY A C    7  
ATOM 10581 O O    . GLY A 1 4   ? 11.251  -13.127 -11.712 1.00 0.00 ? 4   GLY A O    7  
ATOM 10582 H H    . GLY A 1 4   ? 11.812  -10.990 -12.653 1.00 0.00 ? 4   GLY A H    7  
ATOM 10583 H HA2  . GLY A 1 4   ? 8.974   -11.079 -12.544 1.00 0.00 ? 4   GLY A HA2  7  
ATOM 10584 H HA3  . GLY A 1 4   ? 9.565   -12.044 -13.889 1.00 0.00 ? 4   GLY A HA3  7  
ATOM 10585 N N    . SER A 1 5   ? 9.032   -13.402 -11.452 1.00 0.00 ? 5   SER A N    7  
ATOM 10586 C CA   . SER A 1 5   ? 9.168   -14.518 -10.525 1.00 0.00 ? 5   SER A CA   7  
ATOM 10587 C C    . SER A 1 5   ? 7.980   -15.468 -10.640 1.00 0.00 ? 5   SER A C    7  
ATOM 10588 O O    . SER A 1 5   ? 6.983   -15.156 -11.290 1.00 0.00 ? 5   SER A O    7  
ATOM 10589 C CB   . SER A 1 5   ? 9.288   -14.004 -9.089  1.00 0.00 ? 5   SER A CB   7  
ATOM 10590 O OG   . SER A 1 5   ? 8.057   -13.470 -8.634  1.00 0.00 ? 5   SER A OG   7  
ATOM 10591 H H    . SER A 1 5   ? 8.136   -13.090 -11.698 1.00 0.00 ? 5   SER A H    7  
ATOM 10592 H HA   . SER A 1 5   ? 10.069  -15.055 -10.782 1.00 0.00 ? 5   SER A HA   7  
ATOM 10593 H HB2  . SER A 1 5   ? 9.574   -14.818 -8.440  1.00 0.00 ? 5   SER A HB2  7  
ATOM 10594 H HB3  . SER A 1 5   ? 10.040  -13.230 -9.048  1.00 0.00 ? 5   SER A HB3  7  
ATOM 10595 H HG   . SER A 1 5   ? 7.556   -14.154 -8.184  1.00 0.00 ? 5   SER A HG   7  
ATOM 10596 N N    . SER A 1 6   ? 8.095   -16.630 -10.003 1.00 0.00 ? 6   SER A N    7  
ATOM 10597 C CA   . SER A 1 6   ? 7.032   -17.628 -10.037 1.00 0.00 ? 6   SER A CA   7  
ATOM 10598 C C    . SER A 1 6   ? 7.052   -18.484 -8.774  1.00 0.00 ? 6   SER A C    7  
ATOM 10599 O O    . SER A 1 6   ? 7.995   -18.427 -7.986  1.00 0.00 ? 6   SER A O    7  
ATOM 10600 C CB   . SER A 1 6   ? 7.179   -18.518 -11.272 1.00 0.00 ? 6   SER A CB   7  
ATOM 10601 O OG   . SER A 1 6   ? 6.197   -19.540 -11.284 1.00 0.00 ? 6   SER A OG   7  
ATOM 10602 H H    . SER A 1 6   ? 8.915   -16.820 -9.501  1.00 0.00 ? 6   SER A H    7  
ATOM 10603 H HA   . SER A 1 6   ? 6.089   -17.106 -10.089 1.00 0.00 ? 6   SER A HA   7  
ATOM 10604 H HB2  . SER A 1 6   ? 7.065   -17.917 -12.161 1.00 0.00 ? 6   SER A HB2  7  
ATOM 10605 H HB3  . SER A 1 6   ? 8.158   -18.975 -11.269 1.00 0.00 ? 6   SER A HB3  7  
ATOM 10606 H HG   . SER A 1 6   ? 5.880   -19.670 -12.181 1.00 0.00 ? 6   SER A HG   7  
ATOM 10607 N N    . GLY A 1 7   ? 6.002   -19.279 -8.589  1.00 0.00 ? 7   GLY A N    7  
ATOM 10608 C CA   . GLY A 1 7   ? 5.917   -20.136 -7.421  1.00 0.00 ? 7   GLY A CA   7  
ATOM 10609 C C    . GLY A 1 7   ? 4.504   -20.616 -7.156  1.00 0.00 ? 7   GLY A C    7  
ATOM 10610 O O    . GLY A 1 7   ? 3.550   -20.200 -7.815  1.00 0.00 ? 7   GLY A O    7  
ATOM 10611 H H    . GLY A 1 7   ? 5.279   -19.283 -9.251  1.00 0.00 ? 7   GLY A H    7  
ATOM 10612 H HA2  . GLY A 1 7   ? 6.556   -20.994 -7.570  1.00 0.00 ? 7   GLY A HA2  7  
ATOM 10613 H HA3  . GLY A 1 7   ? 6.265   -19.586 -6.559  1.00 0.00 ? 7   GLY A HA3  7  
ATOM 10614 N N    . PRO A 1 8   ? 4.355   -21.514 -6.171  1.00 0.00 ? 8   PRO A N    7  
ATOM 10615 C CA   . PRO A 1 8   ? 3.051   -22.072 -5.799  1.00 0.00 ? 8   PRO A CA   7  
ATOM 10616 C C    . PRO A 1 8   ? 2.150   -21.042 -5.128  1.00 0.00 ? 8   PRO A C    7  
ATOM 10617 O O    . PRO A 1 8   ? 2.399   -19.840 -5.209  1.00 0.00 ? 8   PRO A O    7  
ATOM 10618 C CB   . PRO A 1 8   ? 3.411   -23.189 -4.816  1.00 0.00 ? 8   PRO A CB   7  
ATOM 10619 C CG   . PRO A 1 8   ? 4.725   -22.782 -4.245  1.00 0.00 ? 8   PRO A CG   7  
ATOM 10620 C CD   . PRO A 1 8   ? 5.448   -22.054 -5.345  1.00 0.00 ? 8   PRO A CD   7  
ATOM 10621 H HA   . PRO A 1 8   ? 2.541   -22.493 -6.653  1.00 0.00 ? 8   PRO A HA   7  
ATOM 10622 H HB2  . PRO A 1 8   ? 2.651   -23.257 -4.050  1.00 0.00 ? 8   PRO A HB2  7  
ATOM 10623 H HB3  . PRO A 1 8   ? 3.484   -24.128 -5.343  1.00 0.00 ? 8   PRO A HB3  7  
ATOM 10624 H HG2  . PRO A 1 8   ? 4.572   -22.127 -3.400  1.00 0.00 ? 8   PRO A HG2  7  
ATOM 10625 H HG3  . PRO A 1 8   ? 5.283   -23.658 -3.946  1.00 0.00 ? 8   PRO A HG3  7  
ATOM 10626 H HD2  . PRO A 1 8   ? 6.052   -21.258 -4.937  1.00 0.00 ? 8   PRO A HD2  7  
ATOM 10627 H HD3  . PRO A 1 8   ? 6.058   -22.741 -5.914  1.00 0.00 ? 8   PRO A HD3  7  
ATOM 10628 N N    . ASN A 1 9   ? 1.102   -21.521 -4.466  1.00 0.00 ? 9   ASN A N    7  
ATOM 10629 C CA   . ASN A 1 9   ? 0.163   -20.640 -3.780  1.00 0.00 ? 9   ASN A CA   7  
ATOM 10630 C C    . ASN A 1 9   ? -0.858  -21.447 -2.985  1.00 0.00 ? 9   ASN A C    7  
ATOM 10631 O O    . ASN A 1 9   ? -1.171  -22.586 -3.331  1.00 0.00 ? 9   ASN A O    7  
ATOM 10632 C CB   . ASN A 1 9   ? -0.554  -19.741 -4.789  1.00 0.00 ? 9   ASN A CB   7  
ATOM 10633 C CG   . ASN A 1 9   ? -1.348  -18.637 -4.118  1.00 0.00 ? 9   ASN A CG   7  
ATOM 10634 O OD1  . ASN A 1 9   ? -1.111  -18.304 -2.957  1.00 0.00 ? 9   ASN A OD1  7  
ATOM 10635 N ND2  . ASN A 1 9   ? -2.298  -18.063 -4.848  1.00 0.00 ? 9   ASN A ND2  7  
ATOM 10636 H H    . ASN A 1 9   ? 0.956   -22.489 -4.437  1.00 0.00 ? 9   ASN A H    7  
ATOM 10637 H HA   . ASN A 1 9   ? 0.727   -20.022 -3.098  1.00 0.00 ? 9   ASN A HA   7  
ATOM 10638 H HB2  . ASN A 1 9   ? 0.178   -19.286 -5.441  1.00 0.00 ? 9   ASN A HB2  7  
ATOM 10639 H HB3  . ASN A 1 9   ? -1.232  -20.340 -5.379  1.00 0.00 ? 9   ASN A HB3  7  
ATOM 10640 H HD21 . ASN A 1 9   ? -2.431  -18.380 -5.766  1.00 0.00 ? 9   ASN A HD21 7  
ATOM 10641 H HD22 . ASN A 1 9   ? -2.826  -17.346 -4.439  1.00 0.00 ? 9   ASN A HD22 7  
ATOM 10642 N N    . PHE A 1 10  ? -1.376  -20.847 -1.918  1.00 0.00 ? 10  PHE A N    7  
ATOM 10643 C CA   . PHE A 1 10  ? -2.363  -21.510 -1.072  1.00 0.00 ? 10  PHE A CA   7  
ATOM 10644 C C    . PHE A 1 10  ? -3.627  -20.665 -0.948  1.00 0.00 ? 10  PHE A C    7  
ATOM 10645 O O    . PHE A 1 10  ? -4.730  -21.134 -1.231  1.00 0.00 ? 10  PHE A O    7  
ATOM 10646 C CB   . PHE A 1 10  ? -1.777  -21.780 0.315   1.00 0.00 ? 10  PHE A CB   7  
ATOM 10647 C CG   . PHE A 1 10  ? -2.810  -21.808 1.406   1.00 0.00 ? 10  PHE A CG   7  
ATOM 10648 C CD1  . PHE A 1 10  ? -3.946  -22.591 1.282   1.00 0.00 ? 10  PHE A CD1  7  
ATOM 10649 C CD2  . PHE A 1 10  ? -2.644  -21.052 2.555   1.00 0.00 ? 10  PHE A CD2  7  
ATOM 10650 C CE1  . PHE A 1 10  ? -4.898  -22.620 2.283   1.00 0.00 ? 10  PHE A CE1  7  
ATOM 10651 C CE2  . PHE A 1 10  ? -3.592  -21.078 3.561   1.00 0.00 ? 10  PHE A CE2  7  
ATOM 10652 C CZ   . PHE A 1 10  ? -4.721  -21.862 3.424   1.00 0.00 ? 10  PHE A CZ   7  
ATOM 10653 H H    . PHE A 1 10  ? -1.087  -19.938 -1.693  1.00 0.00 ? 10  PHE A H    7  
ATOM 10654 H HA   . PHE A 1 10  ? -2.616  -22.451 -1.536  1.00 0.00 ? 10  PHE A HA   7  
ATOM 10655 H HB2  . PHE A 1 10  ? -1.277  -22.736 0.308   1.00 0.00 ? 10  PHE A HB2  7  
ATOM 10656 H HB3  . PHE A 1 10  ? -1.063  -21.006 0.553   1.00 0.00 ? 10  PHE A HB3  7  
ATOM 10657 H HD1  . PHE A 1 10  ? -4.086  -23.185 0.389   1.00 0.00 ? 10  PHE A HD1  7  
ATOM 10658 H HD2  . PHE A 1 10  ? -1.762  -20.438 2.663   1.00 0.00 ? 10  PHE A HD2  7  
ATOM 10659 H HE1  . PHE A 1 10  ? -5.780  -23.234 2.173   1.00 0.00 ? 10  PHE A HE1  7  
ATOM 10660 H HE2  . PHE A 1 10  ? -3.451  -20.484 4.451   1.00 0.00 ? 10  PHE A HE2  7  
ATOM 10661 H HZ   . PHE A 1 10  ? -5.463  -21.884 4.208   1.00 0.00 ? 10  PHE A HZ   7  
ATOM 10662 N N    . SER A 1 11  ? -3.459  -19.418 -0.522  1.00 0.00 ? 11  SER A N    7  
ATOM 10663 C CA   . SER A 1 11  ? -4.587  -18.508 -0.356  1.00 0.00 ? 11  SER A CA   7  
ATOM 10664 C C    . SER A 1 11  ? -5.453  -18.482 -1.611  1.00 0.00 ? 11  SER A C    7  
ATOM 10665 O O    . SER A 1 11  ? -5.189  -19.198 -2.577  1.00 0.00 ? 11  SER A O    7  
ATOM 10666 C CB   . SER A 1 11  ? -4.088  -17.097 -0.036  1.00 0.00 ? 11  SER A CB   7  
ATOM 10667 O OG   . SER A 1 11  ? -3.865  -16.938 1.354   1.00 0.00 ? 11  SER A OG   7  
ATOM 10668 H H    . SER A 1 11  ? -2.555  -19.102 -0.313  1.00 0.00 ? 11  SER A H    7  
ATOM 10669 H HA   . SER A 1 11  ? -5.182  -18.866 0.471   1.00 0.00 ? 11  SER A HA   7  
ATOM 10670 H HB2  . SER A 1 11  ? -3.162  -16.918 -0.561  1.00 0.00 ? 11  SER A HB2  7  
ATOM 10671 H HB3  . SER A 1 11  ? -4.828  -16.377 -0.355  1.00 0.00 ? 11  SER A HB3  7  
ATOM 10672 H HG   . SER A 1 11  ? -4.275  -17.664 1.830   1.00 0.00 ? 11  SER A HG   7  
ATOM 10673 N N    . HIS A 1 12  ? -6.490  -17.650 -1.590  1.00 0.00 ? 12  HIS A N    7  
ATOM 10674 C CA   . HIS A 1 12  ? -7.396  -17.528 -2.726  1.00 0.00 ? 12  HIS A CA   7  
ATOM 10675 C C    . HIS A 1 12  ? -7.392  -16.104 -3.274  1.00 0.00 ? 12  HIS A C    7  
ATOM 10676 O O    . HIS A 1 12  ? -8.447  -15.491 -3.442  1.00 0.00 ? 12  HIS A O    7  
ATOM 10677 C CB   . HIS A 1 12  ? -8.815  -17.927 -2.319  1.00 0.00 ? 12  HIS A CB   7  
ATOM 10678 C CG   . HIS A 1 12  ? -8.913  -19.319 -1.775  1.00 0.00 ? 12  HIS A CG   7  
ATOM 10679 N ND1  . HIS A 1 12  ? -8.089  -20.346 -2.184  1.00 0.00 ? 12  HIS A ND1  7  
ATOM 10680 C CD2  . HIS A 1 12  ? -9.744  -19.851 -0.849  1.00 0.00 ? 12  HIS A CD2  7  
ATOM 10681 C CE1  . HIS A 1 12  ? -8.410  -21.450 -1.534  1.00 0.00 ? 12  HIS A CE1  7  
ATOM 10682 N NE2  . HIS A 1 12  ? -9.411  -21.177 -0.717  1.00 0.00 ? 12  HIS A NE2  7  
ATOM 10683 H H    . HIS A 1 12  ? -6.648  -17.104 -0.792  1.00 0.00 ? 12  HIS A H    7  
ATOM 10684 H HA   . HIS A 1 12  ? -7.051  -18.198 -3.499  1.00 0.00 ? 12  HIS A HA   7  
ATOM 10685 H HB2  . HIS A 1 12  ? -9.167  -17.248 -1.556  1.00 0.00 ? 12  HIS A HB2  7  
ATOM 10686 H HB3  . HIS A 1 12  ? -9.462  -17.860 -3.181  1.00 0.00 ? 12  HIS A HB3  7  
ATOM 10687 H HD1  . HIS A 1 12  ? -7.377  -20.277 -2.853  1.00 0.00 ? 12  HIS A HD1  7  
ATOM 10688 H HD2  . HIS A 1 12  ? -10.524 -19.330 -0.312  1.00 0.00 ? 12  HIS A HD2  7  
ATOM 10689 H HE1  . HIS A 1 12  ? -7.935  -22.413 -1.650  1.00 0.00 ? 12  HIS A HE1  7  
ATOM 10690 N N    . TRP A 1 13  ? -6.202  -15.585 -3.550  1.00 0.00 ? 13  TRP A N    7  
ATOM 10691 C CA   . TRP A 1 13  ? -6.062  -14.233 -4.078  1.00 0.00 ? 13  TRP A CA   7  
ATOM 10692 C C    . TRP A 1 13  ? -6.481  -14.174 -5.543  1.00 0.00 ? 13  TRP A C    7  
ATOM 10693 O O    . TRP A 1 13  ? -5.860  -14.799 -6.402  1.00 0.00 ? 13  TRP A O    7  
ATOM 10694 C CB   . TRP A 1 13  ? -4.617  -13.752 -3.929  1.00 0.00 ? 13  TRP A CB   7  
ATOM 10695 C CG   . TRP A 1 13  ? -4.133  -13.758 -2.511  1.00 0.00 ? 13  TRP A CG   7  
ATOM 10696 C CD1  . TRP A 1 13  ? -3.750  -14.847 -1.781  1.00 0.00 ? 13  TRP A CD1  7  
ATOM 10697 C CD2  . TRP A 1 13  ? -3.981  -12.623 -1.652  1.00 0.00 ? 13  TRP A CD2  7  
ATOM 10698 N NE1  . TRP A 1 13  ? -3.370  -14.457 -0.519  1.00 0.00 ? 13  TRP A NE1  7  
ATOM 10699 C CE2  . TRP A 1 13  ? -3.501  -13.098 -0.415  1.00 0.00 ? 13  TRP A CE2  7  
ATOM 10700 C CE3  . TRP A 1 13  ? -4.201  -11.252 -1.807  1.00 0.00 ? 13  TRP A CE3  7  
ATOM 10701 C CZ2  . TRP A 1 13  ? -3.240  -12.249 0.657   1.00 0.00 ? 13  TRP A CZ2  7  
ATOM 10702 C CZ3  . TRP A 1 13  ? -3.942  -10.411 -0.742  1.00 0.00 ? 13  TRP A CZ3  7  
ATOM 10703 C CH2  . TRP A 1 13  ? -3.465  -10.911 0.477   1.00 0.00 ? 13  TRP A CH2  7  
ATOM 10704 H H    . TRP A 1 13  ? -5.397  -16.123 -3.395  1.00 0.00 ? 13  TRP A H    7  
ATOM 10705 H HA   . TRP A 1 13  ? -6.708  -13.585 -3.505  1.00 0.00 ? 13  TRP A HA   7  
ATOM 10706 H HB2  . TRP A 1 13  ? -3.969  -14.394 -4.506  1.00 0.00 ? 13  TRP A HB2  7  
ATOM 10707 H HB3  . TRP A 1 13  ? -4.542  -12.741 -4.303  1.00 0.00 ? 13  TRP A HB3  7  
ATOM 10708 H HD1  . TRP A 1 13  ? -3.754  -15.860 -2.153  1.00 0.00 ? 13  TRP A HD1  7  
ATOM 10709 H HE1  . TRP A 1 13  ? -3.054  -15.056 0.190   1.00 0.00 ? 13  TRP A HE1  7  
ATOM 10710 H HE3  . TRP A 1 13  ? -4.568  -10.848 -2.739  1.00 0.00 ? 13  TRP A HE3  7  
ATOM 10711 H HZ2  . TRP A 1 13  ? -2.872  -12.619 1.603   1.00 0.00 ? 13  TRP A HZ2  7  
ATOM 10712 H HZ3  . TRP A 1 13  ? -4.107  -9.348  -0.844  1.00 0.00 ? 13  TRP A HZ3  7  
ATOM 10713 H HH2  . TRP A 1 13  ? -3.277  -10.217 1.282   1.00 0.00 ? 13  TRP A HH2  7  
ATOM 10714 N N    . GLY A 1 14  ? -7.540  -13.419 -5.822  1.00 0.00 ? 14  GLY A N    7  
ATOM 10715 C CA   . GLY A 1 14  ? -8.023  -13.294 -7.184  1.00 0.00 ? 14  GLY A CA   7  
ATOM 10716 C C    . GLY A 1 14  ? -7.133  -12.411 -8.036  1.00 0.00 ? 14  GLY A C    7  
ATOM 10717 O O    . GLY A 1 14  ? -5.982  -12.139 -7.694  1.00 0.00 ? 14  GLY A O    7  
ATOM 10718 H H    . GLY A 1 14  ? -7.996  -12.944 -5.096  1.00 0.00 ? 14  GLY A H    7  
ATOM 10719 H HA2  . GLY A 1 14  ? -8.071  -14.276 -7.630  1.00 0.00 ? 14  GLY A HA2  7  
ATOM 10720 H HA3  . GLY A 1 14  ? -9.017  -12.870 -7.164  1.00 0.00 ? 14  GLY A HA3  7  
ATOM 10721 N N    . PRO A 1 15  ? -7.669  -11.949 -9.176  1.00 0.00 ? 15  PRO A N    7  
ATOM 10722 C CA   . PRO A 1 15  ? -6.932  -11.085 -10.104 1.00 0.00 ? 15  PRO A CA   7  
ATOM 10723 C C    . PRO A 1 15  ? -6.695  -9.691  -9.534  1.00 0.00 ? 15  PRO A C    7  
ATOM 10724 O O    . PRO A 1 15  ? -7.416  -9.224  -8.652  1.00 0.00 ? 15  PRO A O    7  
ATOM 10725 C CB   . PRO A 1 15  ? -7.849  -11.015 -11.327 1.00 0.00 ? 15  PRO A CB   7  
ATOM 10726 C CG   . PRO A 1 15  ? -9.214  -11.276 -10.793 1.00 0.00 ? 15  PRO A CG   7  
ATOM 10727 C CD   . PRO A 1 15  ? -9.035  -12.233 -9.647  1.00 0.00 ? 15  PRO A CD   7  
ATOM 10728 H HA   . PRO A 1 15  ? -5.985  -11.523 -10.386 1.00 0.00 ? 15  PRO A HA   7  
ATOM 10729 H HB2  . PRO A 1 15  ? -7.780  -10.034 -11.776 1.00 0.00 ? 15  PRO A HB2  7  
ATOM 10730 H HB3  . PRO A 1 15  ? -7.556  -11.767 -12.045 1.00 0.00 ? 15  PRO A HB3  7  
ATOM 10731 H HG2  . PRO A 1 15  ? -9.655  -10.354 -10.446 1.00 0.00 ? 15  PRO A HG2  7  
ATOM 10732 H HG3  . PRO A 1 15  ? -9.830  -11.722 -11.560 1.00 0.00 ? 15  PRO A HG3  7  
ATOM 10733 H HD2  . PRO A 1 15  ? -9.759  -12.033 -8.871  1.00 0.00 ? 15  PRO A HD2  7  
ATOM 10734 H HD3  . PRO A 1 15  ? -9.119  -13.253 -9.990  1.00 0.00 ? 15  PRO A HD3  7  
ATOM 10735 N N    . PRO A 1 16  ? -5.662  -9.008  -10.049 1.00 0.00 ? 16  PRO A N    7  
ATOM 10736 C CA   . PRO A 1 16  ? -5.308  -7.656  -9.607  1.00 0.00 ? 16  PRO A CA   7  
ATOM 10737 C C    . PRO A 1 16  ? -6.336  -6.616  -10.039 1.00 0.00 ? 16  PRO A C    7  
ATOM 10738 O O    . PRO A 1 16  ? -7.082  -6.828  -10.995 1.00 0.00 ? 16  PRO A O    7  
ATOM 10739 C CB   . PRO A 1 16  ? -3.965  -7.398  -10.295 1.00 0.00 ? 16  PRO A CB   7  
ATOM 10740 C CG   . PRO A 1 16  ? -3.980  -8.279  -11.496 1.00 0.00 ? 16  PRO A CG   7  
ATOM 10741 C CD   . PRO A 1 16  ? -4.760  -9.503  -11.102 1.00 0.00 ? 16  PRO A CD   7  
ATOM 10742 H HA   . PRO A 1 16  ? -5.179  -7.610  -8.535  1.00 0.00 ? 16  PRO A HA   7  
ATOM 10743 H HB2  . PRO A 1 16  ? -3.893  -6.355  -10.570 1.00 0.00 ? 16  PRO A HB2  7  
ATOM 10744 H HB3  . PRO A 1 16  ? -3.158  -7.656  -9.626  1.00 0.00 ? 16  PRO A HB3  7  
ATOM 10745 H HG2  . PRO A 1 16  ? -4.464  -7.773  -12.317 1.00 0.00 ? 16  PRO A HG2  7  
ATOM 10746 H HG3  . PRO A 1 16  ? -2.969  -8.550  -11.765 1.00 0.00 ? 16  PRO A HG3  7  
ATOM 10747 H HD2  . PRO A 1 16  ? -5.321  -9.880  -11.945 1.00 0.00 ? 16  PRO A HD2  7  
ATOM 10748 H HD3  . PRO A 1 16  ? -4.098  -10.264 -10.716 1.00 0.00 ? 16  PRO A HD3  7  
ATOM 10749 N N    . ARG A 1 17  ? -6.370  -5.494  -9.329  1.00 0.00 ? 17  ARG A N    7  
ATOM 10750 C CA   . ARG A 1 17  ? -7.308  -4.421  -9.639  1.00 0.00 ? 17  ARG A CA   7  
ATOM 10751 C C    . ARG A 1 17  ? -6.583  -3.086  -9.771  1.00 0.00 ? 17  ARG A C    7  
ATOM 10752 O O    . ARG A 1 17  ? -5.974  -2.602  -8.817  1.00 0.00 ? 17  ARG A O    7  
ATOM 10753 C CB   . ARG A 1 17  ? -8.383  -4.325  -8.554  1.00 0.00 ? 17  ARG A CB   7  
ATOM 10754 C CG   . ARG A 1 17  ? -7.859  -4.594  -7.153  1.00 0.00 ? 17  ARG A CG   7  
ATOM 10755 C CD   . ARG A 1 17  ? -8.833  -4.108  -6.091  1.00 0.00 ? 17  ARG A CD   7  
ATOM 10756 N NE   . ARG A 1 17  ? -10.128 -4.777  -6.189  1.00 0.00 ? 17  ARG A NE   7  
ATOM 10757 C CZ   . ARG A 1 17  ? -11.037 -4.765  -5.220  1.00 0.00 ? 17  ARG A CZ   7  
ATOM 10758 N NH1  . ARG A 1 17  ? -10.794 -4.121  -4.087  1.00 0.00 ? 17  ARG A NH1  7  
ATOM 10759 N NH2  . ARG A 1 17  ? -12.192 -5.397  -5.385  1.00 0.00 ? 17  ARG A NH2  7  
ATOM 10760 H H    . ARG A 1 17  ? -5.750  -5.383  -8.578  1.00 0.00 ? 17  ARG A H    7  
ATOM 10761 H HA   . ARG A 1 17  ? -7.781  -4.656  -10.581 1.00 0.00 ? 17  ARG A HA   7  
ATOM 10762 H HB2  . ARG A 1 17  ? -8.807  -3.332  -8.571  1.00 0.00 ? 17  ARG A HB2  7  
ATOM 10763 H HB3  . ARG A 1 17  ? -9.159  -5.043  -8.769  1.00 0.00 ? 17  ARG A HB3  7  
ATOM 10764 H HG2  . ARG A 1 17  ? -7.712  -5.657  -7.031  1.00 0.00 ? 17  ARG A HG2  7  
ATOM 10765 H HG3  . ARG A 1 17  ? -6.917  -4.082  -7.026  1.00 0.00 ? 17  ARG A HG3  7  
ATOM 10766 H HD2  . ARG A 1 17  ? -8.411  -4.304  -5.117  1.00 0.00 ? 17  ARG A HD2  7  
ATOM 10767 H HD3  . ARG A 1 17  ? -8.977  -3.045  -6.214  1.00 0.00 ? 17  ARG A HD3  7  
ATOM 10768 H HE   . ARG A 1 17  ? -10.328 -5.259  -7.018  1.00 0.00 ? 17  ARG A HE   7  
ATOM 10769 H HH11 . ARG A 1 17  ? -9.924  -3.643  -3.961  1.00 0.00 ? 17  ARG A HH11 7  
ATOM 10770 H HH12 . ARG A 1 17  ? -11.480 -4.112  -3.360  1.00 0.00 ? 17  ARG A HH12 7  
ATOM 10771 H HH21 . ARG A 1 17  ? -12.379 -5.883  -6.238  1.00 0.00 ? 17  ARG A HH21 7  
ATOM 10772 H HH22 . ARG A 1 17  ? -12.875 -5.387  -4.655  1.00 0.00 ? 17  ARG A HH22 7  
ATOM 10773 N N    . ILE A 1 18  ? -6.652  -2.496  -10.960 1.00 0.00 ? 18  ILE A N    7  
ATOM 10774 C CA   . ILE A 1 18  ? -6.002  -1.217  -11.217 1.00 0.00 ? 18  ILE A CA   7  
ATOM 10775 C C    . ILE A 1 18  ? -6.891  -0.054  -10.789 1.00 0.00 ? 18  ILE A C    7  
ATOM 10776 O O    . ILE A 1 18  ? -8.069  0.003   -11.140 1.00 0.00 ? 18  ILE A O    7  
ATOM 10777 C CB   . ILE A 1 18  ? -5.646  -1.055  -12.707 1.00 0.00 ? 18  ILE A CB   7  
ATOM 10778 C CG1  . ILE A 1 18  ? -4.418  -1.900  -13.054 1.00 0.00 ? 18  ILE A CG1  7  
ATOM 10779 C CG2  . ILE A 1 18  ? -5.398  0.409   -13.036 1.00 0.00 ? 18  ILE A CG2  7  
ATOM 10780 C CD1  . ILE A 1 18  ? -4.063  -1.873  -14.524 1.00 0.00 ? 18  ILE A CD1  7  
ATOM 10781 H H    . ILE A 1 18  ? -7.152  -2.932  -11.682 1.00 0.00 ? 18  ILE A H    7  
ATOM 10782 H HA   . ILE A 1 18  ? -5.087  -1.187  -10.643 1.00 0.00 ? 18  ILE A HA   7  
ATOM 10783 H HB   . ILE A 1 18  ? -6.485  -1.395  -13.294 1.00 0.00 ? 18  ILE A HB   7  
ATOM 10784 H HG12 . ILE A 1 18  ? -3.568  -1.533  -12.501 1.00 0.00 ? 18  ILE A HG12 7  
ATOM 10785 H HG13 . ILE A 1 18  ? -4.607  -2.927  -12.776 1.00 0.00 ? 18  ILE A HG13 7  
ATOM 10786 H HG21 . ILE A 1 18  ? -4.654  0.482   -13.815 1.00 0.00 ? 18  ILE A HG21 7  
ATOM 10787 H HG22 . ILE A 1 18  ? -6.318  0.862   -13.375 1.00 0.00 ? 18  ILE A HG22 7  
ATOM 10788 H HG23 . ILE A 1 18  ? -5.048  0.923   -12.154 1.00 0.00 ? 18  ILE A HG23 7  
ATOM 10789 H HD11 . ILE A 1 18  ? -4.968  -1.817  -15.112 1.00 0.00 ? 18  ILE A HD11 7  
ATOM 10790 H HD12 . ILE A 1 18  ? -3.448  -1.009  -14.731 1.00 0.00 ? 18  ILE A HD12 7  
ATOM 10791 H HD13 . ILE A 1 18  ? -3.522  -2.771  -14.781 1.00 0.00 ? 18  ILE A HD13 7  
ATOM 10792 N N    . VAL A 1 19  ? -6.317  0.874   -10.030 1.00 0.00 ? 19  VAL A N    7  
ATOM 10793 C CA   . VAL A 1 19  ? -7.055  2.039   -9.557  1.00 0.00 ? 19  VAL A CA   7  
ATOM 10794 C C    . VAL A 1 19  ? -6.186  3.291   -9.587  1.00 0.00 ? 19  VAL A C    7  
ATOM 10795 O O    . VAL A 1 19  ? -5.129  3.339   -8.959  1.00 0.00 ? 19  VAL A O    7  
ATOM 10796 C CB   . VAL A 1 19  ? -7.580  1.826   -8.124  1.00 0.00 ? 19  VAL A CB   7  
ATOM 10797 C CG1  . VAL A 1 19  ? -8.397  3.027   -7.671  1.00 0.00 ? 19  VAL A CG1  7  
ATOM 10798 C CG2  . VAL A 1 19  ? -8.403  0.550   -8.043  1.00 0.00 ? 19  VAL A CG2  7  
ATOM 10799 H H    . VAL A 1 19  ? -5.374  0.774   -9.784  1.00 0.00 ? 19  VAL A H    7  
ATOM 10800 H HA   . VAL A 1 19  ? -7.903  2.185   -10.210 1.00 0.00 ? 19  VAL A HA   7  
ATOM 10801 H HB   . VAL A 1 19  ? -6.732  1.726   -7.463  1.00 0.00 ? 19  VAL A HB   7  
ATOM 10802 H HG11 . VAL A 1 19  ? -8.824  2.825   -6.699  1.00 0.00 ? 19  VAL A HG11 7  
ATOM 10803 H HG12 . VAL A 1 19  ? -7.758  3.896   -7.612  1.00 0.00 ? 19  VAL A HG12 7  
ATOM 10804 H HG13 . VAL A 1 19  ? -9.191  3.210   -8.380  1.00 0.00 ? 19  VAL A HG13 7  
ATOM 10805 H HG21 . VAL A 1 19  ? -7.977  -0.196  -8.697  1.00 0.00 ? 19  VAL A HG21 7  
ATOM 10806 H HG22 . VAL A 1 19  ? -8.399  0.184   -7.027  1.00 0.00 ? 19  VAL A HG22 7  
ATOM 10807 H HG23 . VAL A 1 19  ? -9.419  0.756   -8.347  1.00 0.00 ? 19  VAL A HG23 7  
ATOM 10808 N N    . GLU A 1 20  ? -6.639  4.302   -10.321 1.00 0.00 ? 20  GLU A N    7  
ATOM 10809 C CA   . GLU A 1 20  ? -5.902  5.555   -10.433 1.00 0.00 ? 20  GLU A CA   7  
ATOM 10810 C C    . GLU A 1 20  ? -6.220  6.480   -9.263  1.00 0.00 ? 20  GLU A C    7  
ATOM 10811 O O    . GLU A 1 20  ? -7.379  6.826   -9.029  1.00 0.00 ? 20  GLU A O    7  
ATOM 10812 C CB   . GLU A 1 20  ? -6.234  6.252   -11.754 1.00 0.00 ? 20  GLU A CB   7  
ATOM 10813 C CG   . GLU A 1 20  ? -5.338  5.832   -12.907 1.00 0.00 ? 20  GLU A CG   7  
ATOM 10814 C CD   . GLU A 1 20  ? -6.050  5.875   -14.245 1.00 0.00 ? 20  GLU A CD   7  
ATOM 10815 O OE1  . GLU A 1 20  ? -7.284  5.681   -14.267 1.00 0.00 ? 20  GLU A OE1  7  
ATOM 10816 O OE2  . GLU A 1 20  ? -5.374  6.102   -15.270 1.00 0.00 ? 20  GLU A OE2  7  
ATOM 10817 H H    . GLU A 1 20  ? -7.489  4.203   -10.799 1.00 0.00 ? 20  GLU A H    7  
ATOM 10818 H HA   . GLU A 1 20  ? -4.848  5.322   -10.416 1.00 0.00 ? 20  GLU A HA   7  
ATOM 10819 H HB2  . GLU A 1 20  ? -7.257  6.026   -12.019 1.00 0.00 ? 20  GLU A HB2  7  
ATOM 10820 H HB3  . GLU A 1 20  ? -6.134  7.319   -11.619 1.00 0.00 ? 20  GLU A HB3  7  
ATOM 10821 H HG2  . GLU A 1 20  ? -4.489  6.497   -12.947 1.00 0.00 ? 20  GLU A HG2  7  
ATOM 10822 H HG3  . GLU A 1 20  ? -4.995  4.823   -12.730 1.00 0.00 ? 20  GLU A HG3  7  
ATOM 10823 N N    . ILE A 1 21  ? -5.184  6.877   -8.531  1.00 0.00 ? 21  ILE A N    7  
ATOM 10824 C CA   . ILE A 1 21  ? -5.353  7.762   -7.385  1.00 0.00 ? 21  ILE A CA   7  
ATOM 10825 C C    . ILE A 1 21  ? -4.547  9.045   -7.558  1.00 0.00 ? 21  ILE A C    7  
ATOM 10826 O O    . ILE A 1 21  ? -3.317  9.015   -7.610  1.00 0.00 ? 21  ILE A O    7  
ATOM 10827 C CB   . ILE A 1 21  ? -4.928  7.074   -6.074  1.00 0.00 ? 21  ILE A CB   7  
ATOM 10828 C CG1  . ILE A 1 21  ? -5.325  5.596   -6.096  1.00 0.00 ? 21  ILE A CG1  7  
ATOM 10829 C CG2  . ILE A 1 21  ? -5.552  7.778   -4.879  1.00 0.00 ? 21  ILE A CG2  7  
ATOM 10830 C CD1  . ILE A 1 21  ? -4.997  4.864   -4.814  1.00 0.00 ? 21  ILE A CD1  7  
ATOM 10831 H H    . ILE A 1 21  ? -4.286  6.567   -8.767  1.00 0.00 ? 21  ILE A H    7  
ATOM 10832 H HA   . ILE A 1 21  ? -6.401  8.015   -7.311  1.00 0.00 ? 21  ILE A HA   7  
ATOM 10833 H HB   . ILE A 1 21  ? -3.855  7.150   -5.986  1.00 0.00 ? 21  ILE A HB   7  
ATOM 10834 H HG12 . ILE A 1 21  ? -6.388  5.518   -6.259  1.00 0.00 ? 21  ILE A HG12 7  
ATOM 10835 H HG13 . ILE A 1 21  ? -4.803  5.103   -6.904  1.00 0.00 ? 21  ILE A HG13 7  
ATOM 10836 H HG21 . ILE A 1 21  ? -6.621  7.623   -4.888  1.00 0.00 ? 21  ILE A HG21 7  
ATOM 10837 H HG22 . ILE A 1 21  ? -5.139  7.375   -3.968  1.00 0.00 ? 21  ILE A HG22 7  
ATOM 10838 H HG23 . ILE A 1 21  ? -5.342  8.836   -4.934  1.00 0.00 ? 21  ILE A HG23 7  
ATOM 10839 H HD11 . ILE A 1 21  ? -4.053  5.220   -4.427  1.00 0.00 ? 21  ILE A HD11 7  
ATOM 10840 H HD12 . ILE A 1 21  ? -5.774  5.045   -4.086  1.00 0.00 ? 21  ILE A HD12 7  
ATOM 10841 H HD13 . ILE A 1 21  ? -4.928  3.805   -5.011  1.00 0.00 ? 21  ILE A HD13 7  
ATOM 10842 N N    . PHE A 1 22  ? -5.248  10.170  -7.644  1.00 0.00 ? 22  PHE A N    7  
ATOM 10843 C CA   . PHE A 1 22  ? -4.598  11.465  -7.810  1.00 0.00 ? 22  PHE A CA   7  
ATOM 10844 C C    . PHE A 1 22  ? -4.107  12.003  -6.469  1.00 0.00 ? 22  PHE A C    7  
ATOM 10845 O O    . PHE A 1 22  ? -4.859  12.054  -5.496  1.00 0.00 ? 22  PHE A O    7  
ATOM 10846 C CB   . PHE A 1 22  ? -5.562  12.465  -8.451  1.00 0.00 ? 22  PHE A CB   7  
ATOM 10847 C CG   . PHE A 1 22  ? -5.338  12.653  -9.925  1.00 0.00 ? 22  PHE A CG   7  
ATOM 10848 C CD1  . PHE A 1 22  ? -5.797  11.715  -10.834 1.00 0.00 ? 22  PHE A CD1  7  
ATOM 10849 C CD2  . PHE A 1 22  ? -4.668  13.769  -10.400 1.00 0.00 ? 22  PHE A CD2  7  
ATOM 10850 C CE1  . PHE A 1 22  ? -5.592  11.885  -12.190 1.00 0.00 ? 22  PHE A CE1  7  
ATOM 10851 C CE2  . PHE A 1 22  ? -4.460  13.945  -11.755 1.00 0.00 ? 22  PHE A CE2  7  
ATOM 10852 C CZ   . PHE A 1 22  ? -4.923  13.002  -12.651 1.00 0.00 ? 22  PHE A CZ   7  
ATOM 10853 H H    . PHE A 1 22  ? -6.226  10.129  -7.596  1.00 0.00 ? 22  PHE A H    7  
ATOM 10854 H HA   . PHE A 1 22  ? -3.749  11.327  -8.462  1.00 0.00 ? 22  PHE A HA   7  
ATOM 10855 H HB2  . PHE A 1 22  ? -6.574  12.118  -8.312  1.00 0.00 ? 22  PHE A HB2  7  
ATOM 10856 H HB3  . PHE A 1 22  ? -5.445  13.425  -7.971  1.00 0.00 ? 22  PHE A HB3  7  
ATOM 10857 H HD1  . PHE A 1 22  ? -6.321  10.841  -10.475 1.00 0.00 ? 22  PHE A HD1  7  
ATOM 10858 H HD2  . PHE A 1 22  ? -4.305  14.508  -9.699  1.00 0.00 ? 22  PHE A HD2  7  
ATOM 10859 H HE1  . PHE A 1 22  ? -5.956  11.147  -12.889 1.00 0.00 ? 22  PHE A HE1  7  
ATOM 10860 H HE2  . PHE A 1 22  ? -3.936  14.820  -12.112 1.00 0.00 ? 22  PHE A HE2  7  
ATOM 10861 H HZ   . PHE A 1 22  ? -4.761  13.138  -13.710 1.00 0.00 ? 22  PHE A HZ   7  
ATOM 10862 N N    . ARG A 1 23  ? -2.840  12.402  -6.427  1.00 0.00 ? 23  ARG A N    7  
ATOM 10863 C CA   . ARG A 1 23  ? -2.247  12.934  -5.206  1.00 0.00 ? 23  ARG A CA   7  
ATOM 10864 C C    . ARG A 1 23  ? -2.916  14.245  -4.803  1.00 0.00 ? 23  ARG A C    7  
ATOM 10865 O O    . ARG A 1 23  ? -3.465  14.956  -5.644  1.00 0.00 ? 23  ARG A O    7  
ATOM 10866 C CB   . ARG A 1 23  ? -0.745  13.153  -5.396  1.00 0.00 ? 23  ARG A CB   7  
ATOM 10867 C CG   . ARG A 1 23  ? -0.023  11.950  -5.979  1.00 0.00 ? 23  ARG A CG   7  
ATOM 10868 C CD   . ARG A 1 23  ? 1.346   12.330  -6.521  1.00 0.00 ? 23  ARG A CD   7  
ATOM 10869 N NE   . ARG A 1 23  ? 2.329   12.500  -5.454  1.00 0.00 ? 23  ARG A NE   7  
ATOM 10870 C CZ   . ARG A 1 23  ? 3.424   13.243  -5.575  1.00 0.00 ? 23  ARG A CZ   7  
ATOM 10871 N NH1  . ARG A 1 23  ? 3.674   13.881  -6.710  1.00 0.00 ? 23  ARG A NH1  7  
ATOM 10872 N NH2  . ARG A 1 23  ? 4.270   13.350  -4.559  1.00 0.00 ? 23  ARG A NH2  7  
ATOM 10873 H H    . ARG A 1 23  ? -2.290  12.336  -7.235  1.00 0.00 ? 23  ARG A H    7  
ATOM 10874 H HA   . ARG A 1 23  ? -2.399  12.210  -4.420  1.00 0.00 ? 23  ARG A HA   7  
ATOM 10875 H HB2  . ARG A 1 23  ? -0.597  13.991  -6.061  1.00 0.00 ? 23  ARG A HB2  7  
ATOM 10876 H HB3  . ARG A 1 23  ? -0.303  13.382  -4.438  1.00 0.00 ? 23  ARG A HB3  7  
ATOM 10877 H HG2  . ARG A 1 23  ? 0.102   11.207  -5.205  1.00 0.00 ? 23  ARG A HG2  7  
ATOM 10878 H HG3  . ARG A 1 23  ? -0.617  11.539  -6.782  1.00 0.00 ? 23  ARG A HG3  7  
ATOM 10879 H HD2  . ARG A 1 23  ? 1.684   11.550  -7.187  1.00 0.00 ? 23  ARG A HD2  7  
ATOM 10880 H HD3  . ARG A 1 23  ? 1.257   13.257  -7.067  1.00 0.00 ? 23  ARG A HD3  7  
ATOM 10881 H HE   . ARG A 1 23  ? 2.164   12.038  -4.606  1.00 0.00 ? 23  ARG A HE   7  
ATOM 10882 H HH11 . ARG A 1 23  ? 3.037   13.804  -7.477  1.00 0.00 ? 23  ARG A HH11 7  
ATOM 10883 H HH12 . ARG A 1 23  ? 4.498   14.441  -6.798  1.00 0.00 ? 23  ARG A HH12 7  
ATOM 10884 H HH21 . ARG A 1 23  ? 4.085   12.870  -3.701  1.00 0.00 ? 23  ARG A HH21 7  
ATOM 10885 H HH22 . ARG A 1 23  ? 5.094   13.909  -4.651  1.00 0.00 ? 23  ARG A HH22 7  
ATOM 10886 N N    . GLU A 1 24  ? -2.866  14.556  -3.511  1.00 0.00 ? 24  GLU A N    7  
ATOM 10887 C CA   . GLU A 1 24  ? -3.469  15.781  -2.998  1.00 0.00 ? 24  GLU A CA   7  
ATOM 10888 C C    . GLU A 1 24  ? -2.418  16.672  -2.344  1.00 0.00 ? 24  GLU A C    7  
ATOM 10889 O O    . GLU A 1 24  ? -1.411  16.201  -1.813  1.00 0.00 ? 24  GLU A O    7  
ATOM 10890 C CB   . GLU A 1 24  ? -4.571  15.449  -1.990  1.00 0.00 ? 24  GLU A CB   7  
ATOM 10891 C CG   . GLU A 1 24  ? -5.938  15.256  -2.624  1.00 0.00 ? 24  GLU A CG   7  
ATOM 10892 C CD   . GLU A 1 24  ? -6.250  16.308  -3.672  1.00 0.00 ? 24  GLU A CD   7  
ATOM 10893 O OE1  . GLU A 1 24  ? -5.852  16.116  -4.840  1.00 0.00 ? 24  GLU A OE1  7  
ATOM 10894 O OE2  . GLU A 1 24  ? -6.891  17.321  -3.323  1.00 0.00 ? 24  GLU A OE2  7  
ATOM 10895 H H    . GLU A 1 24  ? -2.414  13.949  -2.890  1.00 0.00 ? 24  GLU A H    7  
ATOM 10896 H HA   . GLU A 1 24  ? -3.904  16.311  -3.832  1.00 0.00 ? 24  GLU A HA   7  
ATOM 10897 H HB2  . GLU A 1 24  ? -4.306  14.540  -1.470  1.00 0.00 ? 24  GLU A HB2  7  
ATOM 10898 H HB3  . GLU A 1 24  ? -4.641  16.255  -1.274  1.00 0.00 ? 24  GLU A HB3  7  
ATOM 10899 H HG2  . GLU A 1 24  ? -5.970  14.284  -3.093  1.00 0.00 ? 24  GLU A HG2  7  
ATOM 10900 H HG3  . GLU A 1 24  ? -6.691  15.305  -1.851  1.00 0.00 ? 24  GLU A HG3  7  
ATOM 10901 N N    . PRO A 1 25  ? -2.654  17.992  -2.382  1.00 0.00 ? 25  PRO A N    7  
ATOM 10902 C CA   . PRO A 1 25  ? -1.740  18.977  -1.798  1.00 0.00 ? 25  PRO A CA   7  
ATOM 10903 C C    . PRO A 1 25  ? -1.727  18.925  -0.274  1.00 0.00 ? 25  PRO A C    7  
ATOM 10904 O O    . PRO A 1 25  ? -0.950  18.182  0.324   1.00 0.00 ? 25  PRO A O    7  
ATOM 10905 C CB   . PRO A 1 25  ? -2.304  20.316  -2.282  1.00 0.00 ? 25  PRO A CB   7  
ATOM 10906 C CG   . PRO A 1 25  ? -3.749  20.050  -2.530  1.00 0.00 ? 25  PRO A CG   7  
ATOM 10907 C CD   . PRO A 1 25  ? -3.833  18.624  -2.998  1.00 0.00 ? 25  PRO A CD   7  
ATOM 10908 H HA   . PRO A 1 25  ? -0.733  18.854  -2.169  1.00 0.00 ? 25  PRO A HA   7  
ATOM 10909 H HB2  . PRO A 1 25  ? -2.165  21.066  -1.516  1.00 0.00 ? 25  PRO A HB2  7  
ATOM 10910 H HB3  . PRO A 1 25  ? -1.797  20.618  -3.186  1.00 0.00 ? 25  PRO A HB3  7  
ATOM 10911 H HG2  . PRO A 1 25  ? -4.308  20.178  -1.616  1.00 0.00 ? 25  PRO A HG2  7  
ATOM 10912 H HG3  . PRO A 1 25  ? -4.118  20.717  -3.294  1.00 0.00 ? 25  PRO A HG3  7  
ATOM 10913 H HD2  . PRO A 1 25  ? -4.745  18.164  -2.646  1.00 0.00 ? 25  PRO A HD2  7  
ATOM 10914 H HD3  . PRO A 1 25  ? -3.776  18.576  -4.076  1.00 0.00 ? 25  PRO A HD3  7  
ATOM 10915 N N    . ASN A 1 26  ? -2.594  19.718  0.348   1.00 0.00 ? 26  ASN A N    7  
ATOM 10916 C CA   . ASN A 1 26  ? -2.682  19.761  1.803   1.00 0.00 ? 26  ASN A CA   7  
ATOM 10917 C C    . ASN A 1 26  ? -2.743  18.353  2.387   1.00 0.00 ? 26  ASN A C    7  
ATOM 10918 O O    . ASN A 1 26  ? -2.186  18.085  3.451   1.00 0.00 ? 26  ASN A O    7  
ATOM 10919 C CB   . ASN A 1 26  ? -3.913  20.559  2.237   1.00 0.00 ? 26  ASN A CB   7  
ATOM 10920 C CG   . ASN A 1 26  ? -3.784  22.037  1.923   1.00 0.00 ? 26  ASN A CG   7  
ATOM 10921 O OD1  . ASN A 1 26  ? -3.173  22.793  2.678   1.00 0.00 ? 26  ASN A OD1  7  
ATOM 10922 N ND2  . ASN A 1 26  ? -4.361  22.456  0.802   1.00 0.00 ? 26  ASN A ND2  7  
ATOM 10923 H H    . ASN A 1 26  ? -3.188  20.287  -0.184  1.00 0.00 ? 26  ASN A H    7  
ATOM 10924 H HA   . ASN A 1 26  ? -1.796  20.253  2.174   1.00 0.00 ? 26  ASN A HA   7  
ATOM 10925 H HB2  . ASN A 1 26  ? -4.782  20.176  1.722   1.00 0.00 ? 26  ASN A HB2  7  
ATOM 10926 H HB3  . ASN A 1 26  ? -4.051  20.447  3.302   1.00 0.00 ? 26  ASN A HB3  7  
ATOM 10927 H HD21 . ASN A 1 26  ? -4.831  21.797  0.249   1.00 0.00 ? 26  ASN A HD21 7  
ATOM 10928 H HD22 . ASN A 1 26  ? -4.293  23.406  0.574   1.00 0.00 ? 26  ASN A HD22 7  
ATOM 10929 N N    . VAL A 1 27  ? -3.425  17.455  1.681   1.00 0.00 ? 27  VAL A N    7  
ATOM 10930 C CA   . VAL A 1 27  ? -3.558  16.074  2.128   1.00 0.00 ? 27  VAL A CA   7  
ATOM 10931 C C    . VAL A 1 27  ? -2.880  15.114  1.156   1.00 0.00 ? 27  VAL A C    7  
ATOM 10932 O O    . VAL A 1 27  ? -2.834  15.363  -0.048  1.00 0.00 ? 27  VAL A O    7  
ATOM 10933 C CB   . VAL A 1 27  ? -5.038  15.673  2.278   1.00 0.00 ? 27  VAL A CB   7  
ATOM 10934 C CG1  . VAL A 1 27  ? -5.733  15.680  0.925   1.00 0.00 ? 27  VAL A CG1  7  
ATOM 10935 C CG2  . VAL A 1 27  ? -5.155  14.308  2.940   1.00 0.00 ? 27  VAL A CG2  7  
ATOM 10936 H H    . VAL A 1 27  ? -3.847  17.729  0.841   1.00 0.00 ? 27  VAL A H    7  
ATOM 10937 H HA   . VAL A 1 27  ? -3.084  15.987  3.094   1.00 0.00 ? 27  VAL A HA   7  
ATOM 10938 H HB   . VAL A 1 27  ? -5.524  16.400  2.912   1.00 0.00 ? 27  VAL A HB   7  
ATOM 10939 H HG11 . VAL A 1 27  ? -5.635  16.657  0.475   1.00 0.00 ? 27  VAL A HG11 7  
ATOM 10940 H HG12 . VAL A 1 27  ? -5.280  14.939  0.283   1.00 0.00 ? 27  VAL A HG12 7  
ATOM 10941 H HG13 . VAL A 1 27  ? -6.780  15.450  1.058   1.00 0.00 ? 27  VAL A HG13 7  
ATOM 10942 H HG21 . VAL A 1 27  ? -6.056  14.272  3.535   1.00 0.00 ? 27  VAL A HG21 7  
ATOM 10943 H HG22 . VAL A 1 27  ? -5.194  13.542  2.180   1.00 0.00 ? 27  VAL A HG22 7  
ATOM 10944 H HG23 . VAL A 1 27  ? -4.298  14.141  3.576   1.00 0.00 ? 27  VAL A HG23 7  
ATOM 10945 N N    . SER A 1 28  ? -2.353  14.016  1.689   1.00 0.00 ? 28  SER A N    7  
ATOM 10946 C CA   . SER A 1 28  ? -1.673  13.020  0.869   1.00 0.00 ? 28  SER A CA   7  
ATOM 10947 C C    . SER A 1 28  ? -2.679  12.084  0.206   1.00 0.00 ? 28  SER A C    7  
ATOM 10948 O O    . SER A 1 28  ? -3.880  12.359  0.183   1.00 0.00 ? 28  SER A O    7  
ATOM 10949 C CB   . SER A 1 28  ? -0.692  12.211  1.721   1.00 0.00 ? 28  SER A CB   7  
ATOM 10950 O OG   . SER A 1 28  ? 0.420   11.787  0.953   1.00 0.00 ? 28  SER A OG   7  
ATOM 10951 H H    . SER A 1 28  ? -2.421  13.874  2.656   1.00 0.00 ? 28  SER A H    7  
ATOM 10952 H HA   . SER A 1 28  ? -1.124  13.542  0.100   1.00 0.00 ? 28  SER A HA   7  
ATOM 10953 H HB2  . SER A 1 28  ? -0.339  12.823  2.537   1.00 0.00 ? 28  SER A HB2  7  
ATOM 10954 H HB3  . SER A 1 28  ? -1.195  11.341  2.115   1.00 0.00 ? 28  SER A HB3  7  
ATOM 10955 H HG   . SER A 1 28  ? 1.072   12.492  0.917   1.00 0.00 ? 28  SER A HG   7  
ATOM 10956 N N    . LEU A 1 29  ? -2.181  10.977  -0.334  1.00 0.00 ? 29  LEU A N    7  
ATOM 10957 C CA   . LEU A 1 29  ? -3.035  9.999   -0.999  1.00 0.00 ? 29  LEU A CA   7  
ATOM 10958 C C    . LEU A 1 29  ? -4.057  9.418   -0.027  1.00 0.00 ? 29  LEU A C    7  
ATOM 10959 O O    . LEU A 1 29  ? -5.160  9.043   -0.422  1.00 0.00 ? 29  LEU A O    7  
ATOM 10960 C CB   . LEU A 1 29  ? -2.186  8.875   -1.597  1.00 0.00 ? 29  LEU A CB   7  
ATOM 10961 C CG   . LEU A 1 29  ? -1.840  9.011   -3.080  1.00 0.00 ? 29  LEU A CG   7  
ATOM 10962 C CD1  . LEU A 1 29  ? -1.265  7.709   -3.615  1.00 0.00 ? 29  LEU A CD1  7  
ATOM 10963 C CD2  . LEU A 1 29  ? -3.069  9.421   -3.879  1.00 0.00 ? 29  LEU A CD2  7  
ATOM 10964 H H    . LEU A 1 29  ? -1.216  10.813  -0.285  1.00 0.00 ? 29  LEU A H    7  
ATOM 10965 H HA   . LEU A 1 29  ? -3.560  10.505  -1.796  1.00 0.00 ? 29  LEU A HA   7  
ATOM 10966 H HB2  . LEU A 1 29  ? -1.260  8.830   -1.044  1.00 0.00 ? 29  LEU A HB2  7  
ATOM 10967 H HB3  . LEU A 1 29  ? -2.727  7.948   -1.465  1.00 0.00 ? 29  LEU A HB3  7  
ATOM 10968 H HG   . LEU A 1 29  ? -1.090  9.781   -3.199  1.00 0.00 ? 29  LEU A HG   7  
ATOM 10969 H HD11 . LEU A 1 29  ? -1.797  7.421   -4.509  1.00 0.00 ? 29  LEU A HD11 7  
ATOM 10970 H HD12 . LEU A 1 29  ? -1.368  6.936   -2.869  1.00 0.00 ? 29  LEU A HD12 7  
ATOM 10971 H HD13 . LEU A 1 29  ? -0.219  7.847   -3.848  1.00 0.00 ? 29  LEU A HD13 7  
ATOM 10972 H HD21 . LEU A 1 29  ? -2.929  9.156   -4.916  1.00 0.00 ? 29  LEU A HD21 7  
ATOM 10973 H HD22 . LEU A 1 29  ? -3.211  10.489  -3.796  1.00 0.00 ? 29  LEU A HD22 7  
ATOM 10974 H HD23 . LEU A 1 29  ? -3.938  8.911   -3.489  1.00 0.00 ? 29  LEU A HD23 7  
ATOM 10975 N N    . GLY A 1 30  ? -3.682  9.350   1.247   1.00 0.00 ? 30  GLY A N    7  
ATOM 10976 C CA   . GLY A 1 30  ? -4.578  8.816   2.256   1.00 0.00 ? 30  GLY A CA   7  
ATOM 10977 C C    . GLY A 1 30  ? -4.436  7.316   2.422   1.00 0.00 ? 30  GLY A C    7  
ATOM 10978 O O    . GLY A 1 30  ? -5.282  6.671   3.042   1.00 0.00 ? 30  GLY A O    7  
ATOM 10979 H H    . GLY A 1 30  ? -2.790  9.665   1.504   1.00 0.00 ? 30  GLY A H    7  
ATOM 10980 H HA2  . GLY A 1 30  ? -4.365  9.295   3.200   1.00 0.00 ? 30  GLY A HA2  7  
ATOM 10981 H HA3  . GLY A 1 30  ? -5.596  9.040   1.971   1.00 0.00 ? 30  GLY A HA3  7  
ATOM 10982 N N    . ILE A 1 31  ? -3.366  6.760   1.866   1.00 0.00 ? 31  ILE A N    7  
ATOM 10983 C CA   . ILE A 1 31  ? -3.117  5.326   1.956   1.00 0.00 ? 31  ILE A CA   7  
ATOM 10984 C C    . ILE A 1 31  ? -1.885  5.034   2.807   1.00 0.00 ? 31  ILE A C    7  
ATOM 10985 O O    . ILE A 1 31  ? -0.947  5.830   2.853   1.00 0.00 ? 31  ILE A O    7  
ATOM 10986 C CB   . ILE A 1 31  ? -2.924  4.700   0.562   1.00 0.00 ? 31  ILE A CB   7  
ATOM 10987 C CG1  . ILE A 1 31  ? -3.972  5.241   -0.413  1.00 0.00 ? 31  ILE A CG1  7  
ATOM 10988 C CG2  . ILE A 1 31  ? -3.006  3.183   0.647   1.00 0.00 ? 31  ILE A CG2  7  
ATOM 10989 C CD1  . ILE A 1 31  ? -3.721  4.844   -1.851  1.00 0.00 ? 31  ILE A CD1  7  
ATOM 10990 H H    . ILE A 1 31  ? -2.728  7.326   1.385   1.00 0.00 ? 31  ILE A H    7  
ATOM 10991 H HA   . ILE A 1 31  ? -3.978  4.867   2.419   1.00 0.00 ? 31  ILE A HA   7  
ATOM 10992 H HB   . ILE A 1 31  ? -1.940  4.964   0.206   1.00 0.00 ? 31  ILE A HB   7  
ATOM 10993 H HG12 . ILE A 1 31  ? -4.944  4.869   -0.131  1.00 0.00 ? 31  ILE A HG12 7  
ATOM 10994 H HG13 . ILE A 1 31  ? -3.975  6.321   -0.362  1.00 0.00 ? 31  ILE A HG13 7  
ATOM 10995 H HG21 . ILE A 1 31  ? -3.643  2.903   1.474   1.00 0.00 ? 31  ILE A HG21 7  
ATOM 10996 H HG22 . ILE A 1 31  ? -3.418  2.793   -0.271  1.00 0.00 ? 31  ILE A HG22 7  
ATOM 10997 H HG23 . ILE A 1 31  ? -2.018  2.777   0.800   1.00 0.00 ? 31  ILE A HG23 7  
ATOM 10998 H HD11 . ILE A 1 31  ? -3.770  5.721   -2.481  1.00 0.00 ? 31  ILE A HD11 7  
ATOM 10999 H HD12 . ILE A 1 31  ? -2.742  4.396   -1.936  1.00 0.00 ? 31  ILE A HD12 7  
ATOM 11000 H HD13 . ILE A 1 31  ? -4.471  4.134   -2.165  1.00 0.00 ? 31  ILE A HD13 7  
ATOM 11001 N N    . SER A 1 32  ? -1.895  3.887   3.478   1.00 0.00 ? 32  SER A N    7  
ATOM 11002 C CA   . SER A 1 32  ? -0.779  3.490   4.329   1.00 0.00 ? 32  SER A CA   7  
ATOM 11003 C C    . SER A 1 32  ? -0.374  2.045   4.054   1.00 0.00 ? 32  SER A C    7  
ATOM 11004 O O    . SER A 1 32  ? -1.068  1.319   3.341   1.00 0.00 ? 32  SER A O    7  
ATOM 11005 C CB   . SER A 1 32  ? -1.151  3.656   5.803   1.00 0.00 ? 32  SER A CB   7  
ATOM 11006 O OG   . SER A 1 32  ? -1.372  5.019   6.123   1.00 0.00 ? 32  SER A OG   7  
ATOM 11007 H H    . SER A 1 32  ? -2.672  3.294   3.400   1.00 0.00 ? 32  SER A H    7  
ATOM 11008 H HA   . SER A 1 32  ? 0.056   4.135   4.102   1.00 0.00 ? 32  SER A HA   7  
ATOM 11009 H HB2  . SER A 1 32  ? -2.053  3.099   6.010   1.00 0.00 ? 32  SER A HB2  7  
ATOM 11010 H HB3  . SER A 1 32  ? -0.347  3.280   6.419   1.00 0.00 ? 32  SER A HB3  7  
ATOM 11011 H HG   . SER A 1 32  ? -2.290  5.144   6.376   1.00 0.00 ? 32  SER A HG   7  
ATOM 11012 N N    . ILE A 1 33  ? 0.753   1.634   4.626   1.00 0.00 ? 33  ILE A N    7  
ATOM 11013 C CA   . ILE A 1 33  ? 1.250   0.276   4.445   1.00 0.00 ? 33  ILE A CA   7  
ATOM 11014 C C    . ILE A 1 33  ? 1.857   -0.264  5.735   1.00 0.00 ? 33  ILE A C    7  
ATOM 11015 O O    . ILE A 1 33  ? 2.414   0.488   6.535   1.00 0.00 ? 33  ILE A O    7  
ATOM 11016 C CB   . ILE A 1 33  ? 2.306   0.208   3.326   1.00 0.00 ? 33  ILE A CB   7  
ATOM 11017 C CG1  . ILE A 1 33  ? 3.388   1.266   3.552   1.00 0.00 ? 33  ILE A CG1  7  
ATOM 11018 C CG2  . ILE A 1 33  ? 1.651   0.395   1.966   1.00 0.00 ? 33  ILE A CG2  7  
ATOM 11019 C CD1  . ILE A 1 33  ? 4.579   1.118   2.631   1.00 0.00 ? 33  ILE A CD1  7  
ATOM 11020 H H    . ILE A 1 33  ? 1.261   2.259   5.184   1.00 0.00 ? 33  ILE A H    7  
ATOM 11021 H HA   . ILE A 1 33  ? 0.415   -0.350  4.163   1.00 0.00 ? 33  ILE A HA   7  
ATOM 11022 H HB   . ILE A 1 33  ? 2.760   -0.771  3.349   1.00 0.00 ? 33  ILE A HB   7  
ATOM 11023 H HG12 . ILE A 1 33  ? 2.965   2.245   3.391   1.00 0.00 ? 33  ILE A HG12 7  
ATOM 11024 H HG13 . ILE A 1 33  ? 3.744   1.195   4.570   1.00 0.00 ? 33  ILE A HG13 7  
ATOM 11025 H HG21 . ILE A 1 33  ? 2.414   0.481   1.207   1.00 0.00 ? 33  ILE A HG21 7  
ATOM 11026 H HG22 . ILE A 1 33  ? 1.024   -0.457  1.749   1.00 0.00 ? 33  ILE A HG22 7  
ATOM 11027 H HG23 . ILE A 1 33  ? 1.049   1.291   1.976   1.00 0.00 ? 33  ILE A HG23 7  
ATOM 11028 H HD11 . ILE A 1 33  ? 5.490   1.252   3.197   1.00 0.00 ? 33  ILE A HD11 7  
ATOM 11029 H HD12 . ILE A 1 33  ? 4.573   0.133   2.190   1.00 0.00 ? 33  ILE A HD12 7  
ATOM 11030 H HD13 . ILE A 1 33  ? 4.528   1.864   1.852   1.00 0.00 ? 33  ILE A HD13 7  
ATOM 11031 N N    . VAL A 1 34  ? 1.746   -1.574  5.932   1.00 0.00 ? 34  VAL A N    7  
ATOM 11032 C CA   . VAL A 1 34  ? 2.287   -2.217  7.124   1.00 0.00 ? 34  VAL A CA   7  
ATOM 11033 C C    . VAL A 1 34  ? 3.619   -2.895  6.826   1.00 0.00 ? 34  VAL A C    7  
ATOM 11034 O O    . VAL A 1 34  ? 4.115   -2.847  5.702   1.00 0.00 ? 34  VAL A O    7  
ATOM 11035 C CB   . VAL A 1 34  ? 1.307   -3.261  7.691   1.00 0.00 ? 34  VAL A CB   7  
ATOM 11036 C CG1  . VAL A 1 34  ? -0.129  -2.880  7.365   1.00 0.00 ? 34  VAL A CG1  7  
ATOM 11037 C CG2  . VAL A 1 34  ? 1.635   -4.646  7.153   1.00 0.00 ? 34  VAL A CG2  7  
ATOM 11038 H H    . VAL A 1 34  ? 1.291   -2.122  5.258   1.00 0.00 ? 34  VAL A H    7  
ATOM 11039 H HA   . VAL A 1 34  ? 2.441   -1.454  7.873   1.00 0.00 ? 34  VAL A HA   7  
ATOM 11040 H HB   . VAL A 1 34  ? 1.416   -3.281  8.766   1.00 0.00 ? 34  VAL A HB   7  
ATOM 11041 H HG11 . VAL A 1 34  ? -0.425  -2.039  7.975   1.00 0.00 ? 34  VAL A HG11 7  
ATOM 11042 H HG12 . VAL A 1 34  ? -0.202  -2.612  6.321   1.00 0.00 ? 34  VAL A HG12 7  
ATOM 11043 H HG13 . VAL A 1 34  ? -0.779  -3.718  7.569   1.00 0.00 ? 34  VAL A HG13 7  
ATOM 11044 H HG21 . VAL A 1 34  ? 0.800   -5.308  7.328   1.00 0.00 ? 34  VAL A HG21 7  
ATOM 11045 H HG22 . VAL A 1 34  ? 1.830   -4.583  6.093   1.00 0.00 ? 34  VAL A HG22 7  
ATOM 11046 H HG23 . VAL A 1 34  ? 2.510   -5.031  7.658   1.00 0.00 ? 34  VAL A HG23 7  
ATOM 11047 N N    . GLY A 1 35  ? 4.195   -3.528  7.844   1.00 0.00 ? 35  GLY A N    7  
ATOM 11048 C CA   . GLY A 1 35  ? 5.466   -4.208  7.671   1.00 0.00 ? 35  GLY A CA   7  
ATOM 11049 C C    . GLY A 1 35  ? 6.388   -3.479  6.715   1.00 0.00 ? 35  GLY A C    7  
ATOM 11050 O O    . GLY A 1 35  ? 6.650   -2.288  6.881   1.00 0.00 ? 35  GLY A O    7  
ATOM 11051 H H    . GLY A 1 35  ? 3.754   -3.534  8.719   1.00 0.00 ? 35  GLY A H    7  
ATOM 11052 H HA2  . GLY A 1 35  ? 5.951   -4.289  8.632   1.00 0.00 ? 35  GLY A HA2  7  
ATOM 11053 H HA3  . GLY A 1 35  ? 5.281   -5.200  7.288   1.00 0.00 ? 35  GLY A HA3  7  
ATOM 11054 N N    . GLY A 1 36  ? 6.885   -4.195  5.711   1.00 0.00 ? 36  GLY A N    7  
ATOM 11055 C CA   . GLY A 1 36  ? 7.780   -3.593  4.741   1.00 0.00 ? 36  GLY A CA   7  
ATOM 11056 C C    . GLY A 1 36  ? 9.237   -3.718  5.139   1.00 0.00 ? 36  GLY A C    7  
ATOM 11057 O O    . GLY A 1 36  ? 9.671   -3.119  6.122   1.00 0.00 ? 36  GLY A O    7  
ATOM 11058 H H    . GLY A 1 36  ? 6.641   -5.141  5.629   1.00 0.00 ? 36  GLY A H    7  
ATOM 11059 H HA2  . GLY A 1 36  ? 7.635   -4.075  3.786   1.00 0.00 ? 36  GLY A HA2  7  
ATOM 11060 H HA3  . GLY A 1 36  ? 7.534   -2.545  4.644   1.00 0.00 ? 36  GLY A HA3  7  
ATOM 11061 N N    . GLN A 1 37  ? 9.992   -4.501  4.376   1.00 0.00 ? 37  GLN A N    7  
ATOM 11062 C CA   . GLN A 1 37  ? 11.408  -4.706  4.657   1.00 0.00 ? 37  GLN A CA   7  
ATOM 11063 C C    . GLN A 1 37  ? 12.124  -5.296  3.446   1.00 0.00 ? 37  GLN A C    7  
ATOM 11064 O O    . GLN A 1 37  ? 11.496  -5.888  2.567   1.00 0.00 ? 37  GLN A O    7  
ATOM 11065 C CB   . GLN A 1 37  ? 11.582  -5.626  5.866   1.00 0.00 ? 37  GLN A CB   7  
ATOM 11066 C CG   . GLN A 1 37  ? 13.017  -5.719  6.358   1.00 0.00 ? 37  GLN A CG   7  
ATOM 11067 C CD   . GLN A 1 37  ? 13.204  -6.789  7.415   1.00 0.00 ? 37  GLN A CD   7  
ATOM 11068 O OE1  . GLN A 1 37  ? 14.304  -7.310  7.601   1.00 0.00 ? 37  GLN A OE1  7  
ATOM 11069 N NE2  . GLN A 1 37  ? 12.126  -7.124  8.115   1.00 0.00 ? 37  GLN A NE2  7  
ATOM 11070 H H    . GLN A 1 37  ? 9.587   -4.952  3.606   1.00 0.00 ? 37  GLN A H    7  
ATOM 11071 H HA   . GLN A 1 37  ? 11.843  -3.744  4.883   1.00 0.00 ? 37  GLN A HA   7  
ATOM 11072 H HB2  . GLN A 1 37  ? 10.969  -5.258  6.675   1.00 0.00 ? 37  GLN A HB2  7  
ATOM 11073 H HB3  . GLN A 1 37  ? 11.252  -6.619  5.598   1.00 0.00 ? 37  GLN A HB3  7  
ATOM 11074 H HG2  . GLN A 1 37  ? 13.658  -5.948  5.520   1.00 0.00 ? 37  GLN A HG2  7  
ATOM 11075 H HG3  . GLN A 1 37  ? 13.303  -4.765  6.777   1.00 0.00 ? 37  GLN A HG3  7  
ATOM 11076 H HE21 . GLN A 1 37  ? 11.282  -6.668  7.911   1.00 0.00 ? 37  GLN A HE21 7  
ATOM 11077 H HE22 . GLN A 1 37  ? 12.217  -7.814  8.804   1.00 0.00 ? 37  GLN A HE22 7  
ATOM 11078 N N    . THR A 1 38  ? 13.442  -5.130  3.406   1.00 0.00 ? 38  THR A N    7  
ATOM 11079 C CA   . THR A 1 38  ? 14.243  -5.645  2.302   1.00 0.00 ? 38  THR A CA   7  
ATOM 11080 C C    . THR A 1 38  ? 14.237  -7.169  2.282   1.00 0.00 ? 38  THR A C    7  
ATOM 11081 O O    . THR A 1 38  ? 13.921  -7.812  3.284   1.00 0.00 ? 38  THR A O    7  
ATOM 11082 C CB   . THR A 1 38  ? 15.700  -5.150  2.387   1.00 0.00 ? 38  THR A CB   7  
ATOM 11083 O OG1  . THR A 1 38  ? 16.520  -5.881  1.468   1.00 0.00 ? 38  THR A OG1  7  
ATOM 11084 C CG2  . THR A 1 38  ? 16.244  -5.310  3.798   1.00 0.00 ? 38  THR A CG2  7  
ATOM 11085 H H    . THR A 1 38  ? 13.885  -4.650  4.136   1.00 0.00 ? 38  THR A H    7  
ATOM 11086 H HA   . THR A 1 38  ? 13.814  -5.281  1.380   1.00 0.00 ? 38  THR A HA   7  
ATOM 11087 H HB   . THR A 1 38  ? 15.724  -4.102  2.124   1.00 0.00 ? 38  THR A HB   7  
ATOM 11088 H HG1  . THR A 1 38  ? 17.371  -5.445  1.383   1.00 0.00 ? 38  THR A HG1  7  
ATOM 11089 H HG21 . THR A 1 38  ? 15.737  -6.127  4.289   1.00 0.00 ? 38  THR A HG21 7  
ATOM 11090 H HG22 . THR A 1 38  ? 16.078  -4.398  4.353   1.00 0.00 ? 38  THR A HG22 7  
ATOM 11091 H HG23 . THR A 1 38  ? 17.303  -5.517  3.754   1.00 0.00 ? 38  THR A HG23 7  
ATOM 11092 N N    . VAL A 1 39  ? 14.589  -7.743  1.136   1.00 0.00 ? 39  VAL A N    7  
ATOM 11093 C CA   . VAL A 1 39  ? 14.625  -9.193  0.986   1.00 0.00 ? 39  VAL A CA   7  
ATOM 11094 C C    . VAL A 1 39  ? 15.614  -9.821  1.962   1.00 0.00 ? 39  VAL A C    7  
ATOM 11095 O O    . VAL A 1 39  ? 16.184  -9.136  2.812   1.00 0.00 ? 39  VAL A O    7  
ATOM 11096 C CB   . VAL A 1 39  ? 15.009  -9.599  -0.449  1.00 0.00 ? 39  VAL A CB   7  
ATOM 11097 C CG1  . VAL A 1 39  ? 16.520  -9.700  -0.589  1.00 0.00 ? 39  VAL A CG1  7  
ATOM 11098 C CG2  . VAL A 1 39  ? 14.342  -10.913 -0.826  1.00 0.00 ? 39  VAL A CG2  7  
ATOM 11099 H H    . VAL A 1 39  ? 14.830  -7.178  0.373   1.00 0.00 ? 39  VAL A H    7  
ATOM 11100 H HA   . VAL A 1 39  ? 13.636  -9.575  1.194   1.00 0.00 ? 39  VAL A HA   7  
ATOM 11101 H HB   . VAL A 1 39  ? 14.657  -8.834  -1.125  1.00 0.00 ? 39  VAL A HB   7  
ATOM 11102 H HG11 . VAL A 1 39  ? 16.986  -8.876  -0.069  1.00 0.00 ? 39  VAL A HG11 7  
ATOM 11103 H HG12 . VAL A 1 39  ? 16.860  -10.633 -0.165  1.00 0.00 ? 39  VAL A HG12 7  
ATOM 11104 H HG13 . VAL A 1 39  ? 16.788  -9.661  -1.635  1.00 0.00 ? 39  VAL A HG13 7  
ATOM 11105 H HG21 . VAL A 1 39  ? 13.603  -11.169 -0.082  1.00 0.00 ? 39  VAL A HG21 7  
ATOM 11106 H HG22 . VAL A 1 39  ? 13.863  -10.809 -1.789  1.00 0.00 ? 39  VAL A HG22 7  
ATOM 11107 H HG23 . VAL A 1 39  ? 15.086  -11.694 -0.878  1.00 0.00 ? 39  VAL A HG23 7  
ATOM 11108 N N    . ILE A 1 40  ? 15.812  -11.129 1.835   1.00 0.00 ? 40  ILE A N    7  
ATOM 11109 C CA   . ILE A 1 40  ? 16.733  -11.850 2.705   1.00 0.00 ? 40  ILE A CA   7  
ATOM 11110 C C    . ILE A 1 40  ? 17.169  -13.167 2.073   1.00 0.00 ? 40  ILE A C    7  
ATOM 11111 O O    . ILE A 1 40  ? 16.412  -13.793 1.331   1.00 0.00 ? 40  ILE A O    7  
ATOM 11112 C CB   . ILE A 1 40  ? 16.101  -12.137 4.079   1.00 0.00 ? 40  ILE A CB   7  
ATOM 11113 C CG1  . ILE A 1 40  ? 15.658  -10.832 4.745   1.00 0.00 ? 40  ILE A CG1  7  
ATOM 11114 C CG2  . ILE A 1 40  ? 17.083  -12.885 4.969   1.00 0.00 ? 40  ILE A CG2  7  
ATOM 11115 C CD1  . ILE A 1 40  ? 15.152  -11.016 6.158   1.00 0.00 ? 40  ILE A CD1  7  
ATOM 11116 H H    . ILE A 1 40  ? 15.328  -11.620 1.139   1.00 0.00 ? 40  ILE A H    7  
ATOM 11117 H HA   . ILE A 1 40  ? 17.604  -11.229 2.855   1.00 0.00 ? 40  ILE A HA   7  
ATOM 11118 H HB   . ILE A 1 40  ? 15.237  -12.767 3.929   1.00 0.00 ? 40  ILE A HB   7  
ATOM 11119 H HG12 . ILE A 1 40  ? 16.494  -10.151 4.778   1.00 0.00 ? 40  ILE A HG12 7  
ATOM 11120 H HG13 . ILE A 1 40  ? 14.863  -10.391 4.161   1.00 0.00 ? 40  ILE A HG13 7  
ATOM 11121 H HG21 . ILE A 1 40  ? 18.028  -12.363 4.979   1.00 0.00 ? 40  ILE A HG21 7  
ATOM 11122 H HG22 . ILE A 1 40  ? 16.691  -12.937 5.973   1.00 0.00 ? 40  ILE A HG22 7  
ATOM 11123 H HG23 . ILE A 1 40  ? 17.227  -13.884 4.586   1.00 0.00 ? 40  ILE A HG23 7  
ATOM 11124 H HD11 . ILE A 1 40  ? 14.750  -12.013 6.270   1.00 0.00 ? 40  ILE A HD11 7  
ATOM 11125 H HD12 . ILE A 1 40  ? 15.966  -10.878 6.854   1.00 0.00 ? 40  ILE A HD12 7  
ATOM 11126 H HD13 . ILE A 1 40  ? 14.377  -10.292 6.361   1.00 0.00 ? 40  ILE A HD13 7  
ATOM 11127 N N    . LYS A 1 41  ? 18.395  -13.584 2.373   1.00 0.00 ? 41  LYS A N    7  
ATOM 11128 C CA   . LYS A 1 41  ? 18.933  -14.828 1.838   1.00 0.00 ? 41  LYS A CA   7  
ATOM 11129 C C    . LYS A 1 41  ? 18.749  -15.972 2.830   1.00 0.00 ? 41  LYS A C    7  
ATOM 11130 O O    . LYS A 1 41  ? 17.943  -16.876 2.607   1.00 0.00 ? 41  LYS A O    7  
ATOM 11131 C CB   . LYS A 1 41  ? 20.417  -14.664 1.502   1.00 0.00 ? 41  LYS A CB   7  
ATOM 11132 C CG   . LYS A 1 41  ? 20.940  -15.708 0.531   1.00 0.00 ? 41  LYS A CG   7  
ATOM 11133 C CD   . LYS A 1 41  ? 22.407  -16.017 0.781   1.00 0.00 ? 41  LYS A CD   7  
ATOM 11134 C CE   . LYS A 1 41  ? 23.221  -14.746 0.962   1.00 0.00 ? 41  LYS A CE   7  
ATOM 11135 N NZ   . LYS A 1 41  ? 22.938  -13.748 -0.106  1.00 0.00 ? 41  LYS A NZ   7  
ATOM 11136 H H    . LYS A 1 41  ? 18.951  -13.040 2.971   1.00 0.00 ? 41  LYS A H    7  
ATOM 11137 H HA   . LYS A 1 41  ? 18.392  -15.062 0.933   1.00 0.00 ? 41  LYS A HA   7  
ATOM 11138 H HB2  . LYS A 1 41  ? 20.569  -13.688 1.066   1.00 0.00 ? 41  LYS A HB2  7  
ATOM 11139 H HB3  . LYS A 1 41  ? 20.990  -14.734 2.416   1.00 0.00 ? 41  LYS A HB3  7  
ATOM 11140 H HG2  . LYS A 1 41  ? 20.367  -16.616 0.648   1.00 0.00 ? 41  LYS A HG2  7  
ATOM 11141 H HG3  . LYS A 1 41  ? 20.827  -15.336 -0.478  1.00 0.00 ? 41  LYS A HG3  7  
ATOM 11142 H HD2  . LYS A 1 41  ? 22.492  -16.616 1.675   1.00 0.00 ? 41  LYS A HD2  7  
ATOM 11143 H HD3  . LYS A 1 41  ? 22.798  -16.568 -0.063  1.00 0.00 ? 41  LYS A HD3  7  
ATOM 11144 H HE2  . LYS A 1 41  ? 22.980  -14.312 1.920   1.00 0.00 ? 41  LYS A HE2  7  
ATOM 11145 H HE3  . LYS A 1 41  ? 24.271  -14.999 0.936   1.00 0.00 ? 41  LYS A HE3  7  
ATOM 11146 H HZ1  . LYS A 1 41  ? 23.828  -13.392 -0.509  1.00 0.00 ? 41  LYS A HZ1  7  
ATOM 11147 H HZ2  . LYS A 1 41  ? 22.402  -12.947 0.286   1.00 0.00 ? 41  LYS A HZ2  7  
ATOM 11148 H HZ3  . LYS A 1 41  ? 22.377  -14.186 -0.865  1.00 0.00 ? 41  LYS A HZ3  7  
ATOM 11149 N N    . ARG A 1 42  ? 19.499  -15.926 3.926   1.00 0.00 ? 42  ARG A N    7  
ATOM 11150 C CA   . ARG A 1 42  ? 19.418  -16.958 4.952   1.00 0.00 ? 42  ARG A CA   7  
ATOM 11151 C C    . ARG A 1 42  ? 19.374  -16.337 6.345   1.00 0.00 ? 42  ARG A C    7  
ATOM 11152 O O    . ARG A 1 42  ? 19.328  -17.046 7.351   1.00 0.00 ? 42  ARG A O    7  
ATOM 11153 C CB   . ARG A 1 42  ? 20.610  -17.910 4.843   1.00 0.00 ? 42  ARG A CB   7  
ATOM 11154 C CG   . ARG A 1 42  ? 20.345  -19.287 5.430   1.00 0.00 ? 42  ARG A CG   7  
ATOM 11155 C CD   . ARG A 1 42  ? 19.623  -20.186 4.438   1.00 0.00 ? 42  ARG A CD   7  
ATOM 11156 N NE   . ARG A 1 42  ? 20.474  -20.546 3.307   1.00 0.00 ? 42  ARG A NE   7  
ATOM 11157 C CZ   . ARG A 1 42  ? 20.066  -21.298 2.291   1.00 0.00 ? 42  ARG A CZ   7  
ATOM 11158 N NH1  . ARG A 1 42  ? 18.825  -21.766 2.264   1.00 0.00 ? 42  ARG A NH1  7  
ATOM 11159 N NH2  . ARG A 1 42  ? 20.899  -21.583 1.298   1.00 0.00 ? 42  ARG A NH2  7  
ATOM 11160 H H    . ARG A 1 42  ? 20.123  -15.180 4.047   1.00 0.00 ? 42  ARG A H    7  
ATOM 11161 H HA   . ARG A 1 42  ? 18.507  -17.515 4.791   1.00 0.00 ? 42  ARG A HA   7  
ATOM 11162 H HB2  . ARG A 1 42  ? 20.866  -18.031 3.801   1.00 0.00 ? 42  ARG A HB2  7  
ATOM 11163 H HB3  . ARG A 1 42  ? 21.450  -17.476 5.364   1.00 0.00 ? 42  ARG A HB3  7  
ATOM 11164 H HG2  . ARG A 1 42  ? 21.288  -19.744 5.692   1.00 0.00 ? 42  ARG A HG2  7  
ATOM 11165 H HG3  . ARG A 1 42  ? 19.736  -19.180 6.315   1.00 0.00 ? 42  ARG A HG3  7  
ATOM 11166 H HD2  . ARG A 1 42  ? 19.316  -21.087 4.947   1.00 0.00 ? 42  ARG A HD2  7  
ATOM 11167 H HD3  . ARG A 1 42  ? 18.752  -19.666 4.070   1.00 0.00 ? 42  ARG A HD3  7  
ATOM 11168 H HE   . ARG A 1 42  ? 21.394  -20.211 3.306   1.00 0.00 ? 42  ARG A HE   7  
ATOM 11169 H HH11 . ARG A 1 42  ? 18.195  -21.553 3.010   1.00 0.00 ? 42  ARG A HH11 7  
ATOM 11170 H HH12 . ARG A 1 42  ? 18.520  -22.332 1.497   1.00 0.00 ? 42  ARG A HH12 7  
ATOM 11171 H HH21 . ARG A 1 42  ? 21.834  -21.232 1.314   1.00 0.00 ? 42  ARG A HH21 7  
ATOM 11172 H HH22 . ARG A 1 42  ? 20.591  -22.149 0.534   1.00 0.00 ? 42  ARG A HH22 7  
ATOM 11173 N N    . LEU A 1 43  ? 19.389  -15.010 6.397   1.00 0.00 ? 43  LEU A N    7  
ATOM 11174 C CA   . LEU A 1 43  ? 19.352  -14.293 7.666   1.00 0.00 ? 43  LEU A CA   7  
ATOM 11175 C C    . LEU A 1 43  ? 17.921  -13.917 8.038   1.00 0.00 ? 43  LEU A C    7  
ATOM 11176 O O    . LEU A 1 43  ? 17.662  -12.813 8.518   1.00 0.00 ? 43  LEU A O    7  
ATOM 11177 C CB   . LEU A 1 43  ? 20.218  -13.034 7.590   1.00 0.00 ? 43  LEU A CB   7  
ATOM 11178 C CG   . LEU A 1 43  ? 21.721  -13.263 7.426   1.00 0.00 ? 43  LEU A CG   7  
ATOM 11179 C CD1  . LEU A 1 43  ? 21.986  -14.557 6.673   1.00 0.00 ? 43  LEU A CD1  7  
ATOM 11180 C CD2  . LEU A 1 43  ? 22.365  -12.085 6.710   1.00 0.00 ? 43  LEU A CD2  7  
ATOM 11181 H H    . LEU A 1 43  ? 19.426  -14.499 5.561   1.00 0.00 ? 43  LEU A H    7  
ATOM 11182 H HA   . LEU A 1 43  ? 19.749  -14.947 8.428   1.00 0.00 ? 43  LEU A HA   7  
ATOM 11183 H HB2  . LEU A 1 43  ? 19.879  -12.451 6.747   1.00 0.00 ? 43  LEU A HB2  7  
ATOM 11184 H HB3  . LEU A 1 43  ? 20.065  -12.472 8.500   1.00 0.00 ? 43  LEU A HB3  7  
ATOM 11185 H HG   . LEU A 1 43  ? 22.174  -13.348 8.405   1.00 0.00 ? 43  LEU A HG   7  
ATOM 11186 H HD11 . LEU A 1 43  ? 21.485  -15.373 7.172   1.00 0.00 ? 43  LEU A HD11 7  
ATOM 11187 H HD12 . LEU A 1 43  ? 23.048  -14.748 6.647   1.00 0.00 ? 43  LEU A HD12 7  
ATOM 11188 H HD13 . LEU A 1 43  ? 21.612  -14.468 5.663   1.00 0.00 ? 43  LEU A HD13 7  
ATOM 11189 H HD21 . LEU A 1 43  ? 22.590  -12.363 5.691   1.00 0.00 ? 43  LEU A HD21 7  
ATOM 11190 H HD22 . LEU A 1 43  ? 23.278  -11.810 7.218   1.00 0.00 ? 43  LEU A HD22 7  
ATOM 11191 H HD23 . LEU A 1 43  ? 21.684  -11.246 6.714   1.00 0.00 ? 43  LEU A HD23 7  
ATOM 11192 N N    . LYS A 1 44  ? 16.995  -14.843 7.814   1.00 0.00 ? 44  LYS A N    7  
ATOM 11193 C CA   . LYS A 1 44  ? 15.590  -14.612 8.128   1.00 0.00 ? 44  LYS A CA   7  
ATOM 11194 C C    . LYS A 1 44  ? 15.230  -15.212 9.484   1.00 0.00 ? 44  LYS A C    7  
ATOM 11195 O O    . LYS A 1 44  ? 15.957  -16.049 10.016  1.00 0.00 ? 44  LYS A O    7  
ATOM 11196 C CB   . LYS A 1 44  ? 14.697  -15.213 7.040   1.00 0.00 ? 44  LYS A CB   7  
ATOM 11197 C CG   . LYS A 1 44  ? 14.655  -16.731 7.057   1.00 0.00 ? 44  LYS A CG   7  
ATOM 11198 C CD   . LYS A 1 44  ? 13.856  -17.280 5.887   1.00 0.00 ? 44  LYS A CD   7  
ATOM 11199 C CE   . LYS A 1 44  ? 14.154  -18.753 5.651   1.00 0.00 ? 44  LYS A CE   7  
ATOM 11200 N NZ   . LYS A 1 44  ? 15.512  -18.958 5.075   1.00 0.00 ? 44  LYS A NZ   7  
ATOM 11201 H H    . LYS A 1 44  ? 17.263  -15.704 7.429   1.00 0.00 ? 44  LYS A H    7  
ATOM 11202 H HA   . LYS A 1 44  ? 15.429  -13.546 8.166   1.00 0.00 ? 44  LYS A HA   7  
ATOM 11203 H HB2  . LYS A 1 44  ? 13.691  -14.844 7.172   1.00 0.00 ? 44  LYS A HB2  7  
ATOM 11204 H HB3  . LYS A 1 44  ? 15.064  -14.895 6.074   1.00 0.00 ? 44  LYS A HB3  7  
ATOM 11205 H HG2  . LYS A 1 44  ? 15.664  -17.111 7.000   1.00 0.00 ? 44  LYS A HG2  7  
ATOM 11206 H HG3  . LYS A 1 44  ? 14.197  -17.059 7.980   1.00 0.00 ? 44  LYS A HG3  7  
ATOM 11207 H HD2  . LYS A 1 44  ? 12.803  -17.167 6.097   1.00 0.00 ? 44  LYS A HD2  7  
ATOM 11208 H HD3  . LYS A 1 44  ? 14.109  -16.723 4.996   1.00 0.00 ? 44  LYS A HD3  7  
ATOM 11209 H HE2  . LYS A 1 44  ? 14.089  -19.275 6.592   1.00 0.00 ? 44  LYS A HE2  7  
ATOM 11210 H HE3  . LYS A 1 44  ? 13.419  -19.150 4.966   1.00 0.00 ? 44  LYS A HE3  7  
ATOM 11211 H HZ1  . LYS A 1 44  ? 16.123  -18.148 5.303   1.00 0.00 ? 44  LYS A HZ1  7  
ATOM 11212 H HZ2  . LYS A 1 44  ? 15.451  -19.053 4.041   1.00 0.00 ? 44  LYS A HZ2  7  
ATOM 11213 H HZ3  . LYS A 1 44  ? 15.939  -19.822 5.466   1.00 0.00 ? 44  LYS A HZ3  7  
ATOM 11214 N N    . ASN A 1 45  ? 14.102  -14.777 10.037  1.00 0.00 ? 45  ASN A N    7  
ATOM 11215 C CA   . ASN A 1 45  ? 13.645  -15.272 11.331  1.00 0.00 ? 45  ASN A CA   7  
ATOM 11216 C C    . ASN A 1 45  ? 12.273  -15.928 11.208  1.00 0.00 ? 45  ASN A C    7  
ATOM 11217 O O    . ASN A 1 45  ? 11.548  -16.064 12.193  1.00 0.00 ? 45  ASN A O    7  
ATOM 11218 C CB   . ASN A 1 45  ? 13.587  -14.129 12.346  1.00 0.00 ? 45  ASN A CB   7  
ATOM 11219 C CG   . ASN A 1 45  ? 14.966  -13.690 12.801  1.00 0.00 ? 45  ASN A CG   7  
ATOM 11220 O OD1  . ASN A 1 45  ? 15.337  -12.525 12.659  1.00 0.00 ? 45  ASN A OD1  7  
ATOM 11221 N ND2  . ASN A 1 45  ? 15.733  -14.625 13.351  1.00 0.00 ? 45  ASN A ND2  7  
ATOM 11222 H H    . ASN A 1 45  ? 13.564  -14.108 9.564   1.00 0.00 ? 45  ASN A H    7  
ATOM 11223 H HA   . ASN A 1 45  ? 14.354  -16.010 11.672  1.00 0.00 ? 45  ASN A HA   7  
ATOM 11224 H HB2  . ASN A 1 45  ? 13.091  -13.281 11.897  1.00 0.00 ? 45  ASN A HB2  7  
ATOM 11225 H HB3  . ASN A 1 45  ? 13.028  -14.452 13.211  1.00 0.00 ? 45  ASN A HB3  7  
ATOM 11226 H HD21 . ASN A 1 45  ? 15.371  -15.532 13.432  1.00 0.00 ? 45  ASN A HD21 7  
ATOM 11227 H HD22 . ASN A 1 45  ? 16.628  -14.368 13.654  1.00 0.00 ? 45  ASN A HD22 7  
ATOM 11228 N N    . GLY A 1 46  ? 11.923  -16.334 9.991   1.00 0.00 ? 46  GLY A N    7  
ATOM 11229 C CA   . GLY A 1 46  ? 10.639  -16.971 9.762   1.00 0.00 ? 46  GLY A CA   7  
ATOM 11230 C C    . GLY A 1 46  ? 10.140  -16.775 8.345   1.00 0.00 ? 46  GLY A C    7  
ATOM 11231 O O    . GLY A 1 46  ? 10.791  -16.115 7.536   1.00 0.00 ? 46  GLY A O    7  
ATOM 11232 H H    . GLY A 1 46  ? 12.541  -16.200 9.243   1.00 0.00 ? 46  GLY A H    7  
ATOM 11233 H HA2  . GLY A 1 46  ? 10.735  -18.029 9.956   1.00 0.00 ? 46  GLY A HA2  7  
ATOM 11234 H HA3  . GLY A 1 46  ? 9.916   -16.553 10.447  1.00 0.00 ? 46  GLY A HA3  7  
ATOM 11235 N N    . GLU A 1 47  ? 8.981   -17.352 8.042   1.00 0.00 ? 47  GLU A N    7  
ATOM 11236 C CA   . GLU A 1 47  ? 8.396   -17.239 6.711   1.00 0.00 ? 47  GLU A CA   7  
ATOM 11237 C C    . GLU A 1 47  ? 6.987   -16.658 6.783   1.00 0.00 ? 47  GLU A C    7  
ATOM 11238 O O    . GLU A 1 47  ? 6.129   -17.172 7.500   1.00 0.00 ? 47  GLU A O    7  
ATOM 11239 C CB   . GLU A 1 47  ? 8.361   -18.608 6.027   1.00 0.00 ? 47  GLU A CB   7  
ATOM 11240 C CG   . GLU A 1 47  ? 9.727   -19.098 5.576   1.00 0.00 ? 47  GLU A CG   7  
ATOM 11241 C CD   . GLU A 1 47  ? 9.740   -20.581 5.261   1.00 0.00 ? 47  GLU A CD   7  
ATOM 11242 O OE1  . GLU A 1 47  ? 9.049   -21.344 5.967   1.00 0.00 ? 47  GLU A OE1  7  
ATOM 11243 O OE2  . GLU A 1 47  ? 10.442  -20.978 4.307   1.00 0.00 ? 47  GLU A OE2  7  
ATOM 11244 H H    . GLU A 1 47  ? 8.508   -17.866 8.730   1.00 0.00 ? 47  GLU A H    7  
ATOM 11245 H HA   . GLU A 1 47  ? 9.018   -16.574 6.131   1.00 0.00 ? 47  GLU A HA   7  
ATOM 11246 H HB2  . GLU A 1 47  ? 7.952   -19.331 6.717   1.00 0.00 ? 47  GLU A HB2  7  
ATOM 11247 H HB3  . GLU A 1 47  ? 7.720   -18.547 5.160   1.00 0.00 ? 47  GLU A HB3  7  
ATOM 11248 H HG2  . GLU A 1 47  ? 10.016  -18.554 4.689   1.00 0.00 ? 47  GLU A HG2  7  
ATOM 11249 H HG3  . GLU A 1 47  ? 10.442  -18.906 6.363   1.00 0.00 ? 47  GLU A HG3  7  
ATOM 11250 N N    . GLU A 1 48  ? 6.757   -15.584 6.035   1.00 0.00 ? 48  GLU A N    7  
ATOM 11251 C CA   . GLU A 1 48  ? 5.453   -14.932 6.015   1.00 0.00 ? 48  GLU A CA   7  
ATOM 11252 C C    . GLU A 1 48  ? 5.378   -13.898 4.895   1.00 0.00 ? 48  GLU A C    7  
ATOM 11253 O O    . GLU A 1 48  ? 6.402   -13.466 4.364   1.00 0.00 ? 48  GLU A O    7  
ATOM 11254 C CB   . GLU A 1 48  ? 5.172   -14.263 7.362   1.00 0.00 ? 48  GLU A CB   7  
ATOM 11255 C CG   . GLU A 1 48  ? 5.812   -12.892 7.505   1.00 0.00 ? 48  GLU A CG   7  
ATOM 11256 C CD   . GLU A 1 48  ? 5.593   -12.287 8.878   1.00 0.00 ? 48  GLU A CD   7  
ATOM 11257 O OE1  . GLU A 1 48  ? 4.630   -12.696 9.561   1.00 0.00 ? 48  GLU A OE1  7  
ATOM 11258 O OE2  . GLU A 1 48  ? 6.385   -11.405 9.270   1.00 0.00 ? 48  GLU A OE2  7  
ATOM 11259 H H    . GLU A 1 48  ? 7.482   -15.221 5.484   1.00 0.00 ? 48  GLU A H    7  
ATOM 11260 H HA   . GLU A 1 48  ? 4.706   -15.691 5.838   1.00 0.00 ? 48  GLU A HA   7  
ATOM 11261 H HB2  . GLU A 1 48  ? 4.104   -14.153 7.480   1.00 0.00 ? 48  GLU A HB2  7  
ATOM 11262 H HB3  . GLU A 1 48  ? 5.549   -14.897 8.150   1.00 0.00 ? 48  GLU A HB3  7  
ATOM 11263 H HG2  . GLU A 1 48  ? 6.874   -12.986 7.336   1.00 0.00 ? 48  GLU A HG2  7  
ATOM 11264 H HG3  . GLU A 1 48  ? 5.387   -12.231 6.765   1.00 0.00 ? 48  GLU A HG3  7  
ATOM 11265 N N    . LEU A 1 49  ? 4.160   -13.506 4.540   1.00 0.00 ? 49  LEU A N    7  
ATOM 11266 C CA   . LEU A 1 49  ? 3.949   -12.523 3.483   1.00 0.00 ? 49  LEU A CA   7  
ATOM 11267 C C    . LEU A 1 49  ? 4.962   -11.387 3.587   1.00 0.00 ? 49  LEU A C    7  
ATOM 11268 O O    . LEU A 1 49  ? 5.190   -10.841 4.667   1.00 0.00 ? 49  LEU A O    7  
ATOM 11269 C CB   . LEU A 1 49  ? 2.528   -11.963 3.556   1.00 0.00 ? 49  LEU A CB   7  
ATOM 11270 C CG   . LEU A 1 49  ? 1.436   -12.816 2.909   1.00 0.00 ? 49  LEU A CG   7  
ATOM 11271 C CD1  . LEU A 1 49  ? 1.768   -13.091 1.450   1.00 0.00 ? 49  LEU A CD1  7  
ATOM 11272 C CD2  . LEU A 1 49  ? 1.257   -14.120 3.671   1.00 0.00 ? 49  LEU A CD2  7  
ATOM 11273 H H    . LEU A 1 49  ? 3.382   -13.886 5.000   1.00 0.00 ? 49  LEU A H    7  
ATOM 11274 H HA   . LEU A 1 49  ? 4.083   -13.023 2.535   1.00 0.00 ? 49  LEU A HA   7  
ATOM 11275 H HB2  . LEU A 1 49  ? 2.275   -11.837 4.597   1.00 0.00 ? 49  LEU A HB2  7  
ATOM 11276 H HB3  . LEU A 1 49  ? 2.528   -10.998 3.068   1.00 0.00 ? 49  LEU A HB3  7  
ATOM 11277 H HG   . LEU A 1 49  ? 0.500   -12.277 2.941   1.00 0.00 ? 49  LEU A HG   7  
ATOM 11278 H HD11 . LEU A 1 49  ? 0.905   -12.877 0.838   1.00 0.00 ? 49  LEU A HD11 7  
ATOM 11279 H HD12 . LEU A 1 49  ? 2.044   -14.128 1.333   1.00 0.00 ? 49  LEU A HD12 7  
ATOM 11280 H HD13 . LEU A 1 49  ? 2.592   -12.463 1.144   1.00 0.00 ? 49  LEU A HD13 7  
ATOM 11281 H HD21 . LEU A 1 49  ? 1.133   -13.908 4.723   1.00 0.00 ? 49  LEU A HD21 7  
ATOM 11282 H HD22 . LEU A 1 49  ? 2.127   -14.743 3.529   1.00 0.00 ? 49  LEU A HD22 7  
ATOM 11283 H HD23 . LEU A 1 49  ? 0.381   -14.636 3.302   1.00 0.00 ? 49  LEU A HD23 7  
ATOM 11284 N N    . LYS A 1 50  ? 5.565   -11.034 2.457   1.00 0.00 ? 50  LYS A N    7  
ATOM 11285 C CA   . LYS A 1 50  ? 6.551   -9.960  2.419   1.00 0.00 ? 50  LYS A CA   7  
ATOM 11286 C C    . LYS A 1 50  ? 6.026   -8.768  1.625   1.00 0.00 ? 50  LYS A C    7  
ATOM 11287 O O    . LYS A 1 50  ? 6.472   -7.638  1.817   1.00 0.00 ? 50  LYS A O    7  
ATOM 11288 C CB   . LYS A 1 50  ? 7.858   -10.462 1.801   1.00 0.00 ? 50  LYS A CB   7  
ATOM 11289 C CG   . LYS A 1 50  ? 7.657   -11.500 0.710   1.00 0.00 ? 50  LYS A CG   7  
ATOM 11290 C CD   . LYS A 1 50  ? 8.910   -11.677 -0.129  1.00 0.00 ? 50  LYS A CD   7  
ATOM 11291 C CE   . LYS A 1 50  ? 9.859   -12.691 0.493   1.00 0.00 ? 50  LYS A CE   7  
ATOM 11292 N NZ   . LYS A 1 50  ? 10.696  -13.370 -0.535  1.00 0.00 ? 50  LYS A NZ   7  
ATOM 11293 H H    . LYS A 1 50  ? 5.341   -11.507 1.628   1.00 0.00 ? 50  LYS A H    7  
ATOM 11294 H HA   . LYS A 1 50  ? 6.740   -9.647  3.434   1.00 0.00 ? 50  LYS A HA   7  
ATOM 11295 H HB2  . LYS A 1 50  ? 8.388   -9.622  1.376   1.00 0.00 ? 50  LYS A HB2  7  
ATOM 11296 H HB3  . LYS A 1 50  ? 8.465   -10.902 2.580   1.00 0.00 ? 50  LYS A HB3  7  
ATOM 11297 H HG2  . LYS A 1 50  ? 7.406   -12.446 1.167   1.00 0.00 ? 50  LYS A HG2  7  
ATOM 11298 H HG3  . LYS A 1 50  ? 6.847   -11.182 0.069   1.00 0.00 ? 50  LYS A HG3  7  
ATOM 11299 H HD2  . LYS A 1 50  ? 8.629   -12.022 -1.113  1.00 0.00 ? 50  LYS A HD2  7  
ATOM 11300 H HD3  . LYS A 1 50  ? 9.416   -10.726 -0.210  1.00 0.00 ? 50  LYS A HD3  7  
ATOM 11301 H HE2  . LYS A 1 50  ? 10.505  -12.179 1.190   1.00 0.00 ? 50  LYS A HE2  7  
ATOM 11302 H HE3  . LYS A 1 50  ? 9.277   -13.433 1.019   1.00 0.00 ? 50  LYS A HE3  7  
ATOM 11303 H HZ1  . LYS A 1 50  ? 11.699  -13.331 -0.262  1.00 0.00 ? 50  LYS A HZ1  7  
ATOM 11304 H HZ2  . LYS A 1 50  ? 10.579  -12.903 -1.456  1.00 0.00 ? 50  LYS A HZ2  7  
ATOM 11305 H HZ3  . LYS A 1 50  ? 10.411  -14.366 -0.626  1.00 0.00 ? 50  LYS A HZ3  7  
ATOM 11306 N N    . GLY A 1 51  ? 5.075   -9.029  0.734   1.00 0.00 ? 51  GLY A N    7  
ATOM 11307 C CA   . GLY A 1 51  ? 4.504   -7.967  -0.074  1.00 0.00 ? 51  GLY A CA   7  
ATOM 11308 C C    . GLY A 1 51  ? 4.017   -6.800  0.762   1.00 0.00 ? 51  GLY A C    7  
ATOM 11309 O O    . GLY A 1 51  ? 3.866   -6.920  1.978   1.00 0.00 ? 51  GLY A O    7  
ATOM 11310 H H    . GLY A 1 51  ? 4.758   -9.950  0.624   1.00 0.00 ? 51  GLY A H    7  
ATOM 11311 H HA2  . GLY A 1 51  ? 5.254   -7.612  -0.765  1.00 0.00 ? 51  GLY A HA2  7  
ATOM 11312 H HA3  . GLY A 1 51  ? 3.671   -8.365  -0.635  1.00 0.00 ? 51  GLY A HA3  7  
ATOM 11313 N N    . ILE A 1 52  ? 3.773   -5.668  0.111   1.00 0.00 ? 52  ILE A N    7  
ATOM 11314 C CA   . ILE A 1 52  ? 3.301   -4.475  0.803   1.00 0.00 ? 52  ILE A CA   7  
ATOM 11315 C C    . ILE A 1 52  ? 1.779   -4.463  0.902   1.00 0.00 ? 52  ILE A C    7  
ATOM 11316 O O    . ILE A 1 52  ? 1.083   -4.259  -0.093  1.00 0.00 ? 52  ILE A O    7  
ATOM 11317 C CB   . ILE A 1 52  ? 3.768   -3.191  0.093   1.00 0.00 ? 52  ILE A CB   7  
ATOM 11318 C CG1  . ILE A 1 52  ? 5.296   -3.119  0.077   1.00 0.00 ? 52  ILE A CG1  7  
ATOM 11319 C CG2  . ILE A 1 52  ? 3.182   -1.965  0.777   1.00 0.00 ? 52  ILE A CG2  7  
ATOM 11320 C CD1  . ILE A 1 52  ? 5.937   -3.579  1.368   1.00 0.00 ? 52  ILE A CD1  7  
ATOM 11321 H H    . ILE A 1 52  ? 3.912   -5.635  -0.859  1.00 0.00 ? 52  ILE A H    7  
ATOM 11322 H HA   . ILE A 1 52  ? 3.716   -4.483  1.800   1.00 0.00 ? 52  ILE A HA   7  
ATOM 11323 H HB   . ILE A 1 52  ? 3.405   -3.215  -0.923  1.00 0.00 ? 52  ILE A HB   7  
ATOM 11324 H HG12 . ILE A 1 52  ? 5.672   -3.742  -0.719  1.00 0.00 ? 52  ILE A HG12 7  
ATOM 11325 H HG13 . ILE A 1 52  ? 5.599   -2.096  -0.098  1.00 0.00 ? 52  ILE A HG13 7  
ATOM 11326 H HG21 . ILE A 1 52  ? 3.311   -1.102  0.141   1.00 0.00 ? 52  ILE A HG21 7  
ATOM 11327 H HG22 . ILE A 1 52  ? 2.129   -2.123  0.958   1.00 0.00 ? 52  ILE A HG22 7  
ATOM 11328 H HG23 . ILE A 1 52  ? 3.688   -1.799  1.716   1.00 0.00 ? 52  ILE A HG23 7  
ATOM 11329 H HD11 . ILE A 1 52  ? 5.300   -3.314  2.200   1.00 0.00 ? 52  ILE A HD11 7  
ATOM 11330 H HD12 . ILE A 1 52  ? 6.068   -4.651  1.343   1.00 0.00 ? 52  ILE A HD12 7  
ATOM 11331 H HD13 . ILE A 1 52  ? 6.897   -3.101  1.484   1.00 0.00 ? 52  ILE A HD13 7  
ATOM 11332 N N    . PHE A 1 53  ? 1.268   -4.681  2.109   1.00 0.00 ? 53  PHE A N    7  
ATOM 11333 C CA   . PHE A 1 53  ? -0.172  -4.695  2.339   1.00 0.00 ? 53  PHE A CA   7  
ATOM 11334 C C    . PHE A 1 53  ? -0.648  -3.351  2.883   1.00 0.00 ? 53  PHE A C    7  
ATOM 11335 O O    . PHE A 1 53  ? 0.027   -2.727  3.702   1.00 0.00 ? 53  PHE A O    7  
ATOM 11336 C CB   . PHE A 1 53  ? -0.544  -5.813  3.314   1.00 0.00 ? 53  PHE A CB   7  
ATOM 11337 C CG   . PHE A 1 53  ? -0.199  -7.186  2.811   1.00 0.00 ? 53  PHE A CG   7  
ATOM 11338 C CD1  . PHE A 1 53  ? 0.384   -7.356  1.566   1.00 0.00 ? 53  PHE A CD1  7  
ATOM 11339 C CD2  . PHE A 1 53  ? -0.458  -8.307  3.584   1.00 0.00 ? 53  PHE A CD2  7  
ATOM 11340 C CE1  . PHE A 1 53  ? 0.702   -8.618  1.100   1.00 0.00 ? 53  PHE A CE1  7  
ATOM 11341 C CE2  . PHE A 1 53  ? -0.142  -9.571  3.124   1.00 0.00 ? 53  PHE A CE2  7  
ATOM 11342 C CZ   . PHE A 1 53  ? 0.440   -9.727  1.881   1.00 0.00 ? 53  PHE A CZ   7  
ATOM 11343 H H    . PHE A 1 53  ? 1.874   -4.838  2.863   1.00 0.00 ? 53  PHE A H    7  
ATOM 11344 H HA   . PHE A 1 53  ? -0.656  -4.878  1.392   1.00 0.00 ? 53  PHE A HA   7  
ATOM 11345 H HB2  . PHE A 1 53  ? -0.018  -5.660  4.244   1.00 0.00 ? 53  PHE A HB2  7  
ATOM 11346 H HB3  . PHE A 1 53  ? -1.607  -5.783  3.497   1.00 0.00 ? 53  PHE A HB3  7  
ATOM 11347 H HD1  . PHE A 1 53  ? 0.591   -6.490  0.955   1.00 0.00 ? 53  PHE A HD1  7  
ATOM 11348 H HD2  . PHE A 1 53  ? -0.912  -8.186  4.557   1.00 0.00 ? 53  PHE A HD2  7  
ATOM 11349 H HE1  . PHE A 1 53  ? 1.157   -8.737  0.128   1.00 0.00 ? 53  PHE A HE1  7  
ATOM 11350 H HE2  . PHE A 1 53  ? -0.348  -10.436 3.737   1.00 0.00 ? 53  PHE A HE2  7  
ATOM 11351 H HZ   . PHE A 1 53  ? 0.686   -10.714 1.519   1.00 0.00 ? 53  PHE A HZ   7  
ATOM 11352 N N    . ILE A 1 54  ? -1.814  -2.912  2.421   1.00 0.00 ? 54  ILE A N    7  
ATOM 11353 C CA   . ILE A 1 54  ? -2.381  -1.644  2.861   1.00 0.00 ? 54  ILE A CA   7  
ATOM 11354 C C    . ILE A 1 54  ? -2.578  -1.625  4.373   1.00 0.00 ? 54  ILE A C    7  
ATOM 11355 O O    . ILE A 1 54  ? -3.261  -2.483  4.932   1.00 0.00 ? 54  ILE A O    7  
ATOM 11356 C CB   . ILE A 1 54  ? -3.731  -1.362  2.175   1.00 0.00 ? 54  ILE A CB   7  
ATOM 11357 C CG1  . ILE A 1 54  ? -3.585  -1.458  0.655   1.00 0.00 ? 54  ILE A CG1  7  
ATOM 11358 C CG2  . ILE A 1 54  ? -4.253  0.009   2.577   1.00 0.00 ? 54  ILE A CG2  7  
ATOM 11359 C CD1  . ILE A 1 54  ? -4.755  -0.871  -0.102  1.00 0.00 ? 54  ILE A CD1  7  
ATOM 11360 H H    . ILE A 1 54  ? -2.305  -3.454  1.769   1.00 0.00 ? 54  ILE A H    7  
ATOM 11361 H HA   . ILE A 1 54  ? -1.691  -0.858  2.589   1.00 0.00 ? 54  ILE A HA   7  
ATOM 11362 H HB   . ILE A 1 54  ? -4.441  -2.103  2.509   1.00 0.00 ? 54  ILE A HB   7  
ATOM 11363 H HG12 . ILE A 1 54  ? -2.695  -0.929  0.351   1.00 0.00 ? 54  ILE A HG12 7  
ATOM 11364 H HG13 . ILE A 1 54  ? -3.495  -2.497  0.375   1.00 0.00 ? 54  ILE A HG13 7  
ATOM 11365 H HG21 . ILE A 1 54  ? -4.301  0.075   3.654   1.00 0.00 ? 54  ILE A HG21 7  
ATOM 11366 H HG22 . ILE A 1 54  ? -3.589  0.772   2.200   1.00 0.00 ? 54  ILE A HG22 7  
ATOM 11367 H HG23 . ILE A 1 54  ? -5.240  0.154   2.164   1.00 0.00 ? 54  ILE A HG23 7  
ATOM 11368 H HD11 . ILE A 1 54  ? -4.817  -1.328  -1.079  1.00 0.00 ? 54  ILE A HD11 7  
ATOM 11369 H HD12 . ILE A 1 54  ? -5.669  -1.062  0.441   1.00 0.00 ? 54  ILE A HD12 7  
ATOM 11370 H HD13 . ILE A 1 54  ? -4.616  0.194   -0.212  1.00 0.00 ? 54  ILE A HD13 7  
ATOM 11371 N N    . LYS A 1 55  ? -1.977  -0.639  5.031   1.00 0.00 ? 55  LYS A N    7  
ATOM 11372 C CA   . LYS A 1 55  ? -2.088  -0.505  6.478   1.00 0.00 ? 55  LYS A CA   7  
ATOM 11373 C C    . LYS A 1 55  ? -3.419  0.131   6.865   1.00 0.00 ? 55  LYS A C    7  
ATOM 11374 O O    . LYS A 1 55  ? -4.133  -0.380  7.727   1.00 0.00 ? 55  LYS A O    7  
ATOM 11375 C CB   . LYS A 1 55  ? -0.931  0.336   7.023   1.00 0.00 ? 55  LYS A CB   7  
ATOM 11376 C CG   . LYS A 1 55  ? -1.207  0.936   8.391   1.00 0.00 ? 55  LYS A CG   7  
ATOM 11377 C CD   . LYS A 1 55  ? -1.669  -0.120  9.381   1.00 0.00 ? 55  LYS A CD   7  
ATOM 11378 C CE   . LYS A 1 55  ? -2.456  0.496   10.527  1.00 0.00 ? 55  LYS A CE   7  
ATOM 11379 N NZ   . LYS A 1 55  ? -1.566  0.946   11.633  1.00 0.00 ? 55  LYS A NZ   7  
ATOM 11380 H H    . LYS A 1 55  ? -1.446  0.015   4.529   1.00 0.00 ? 55  LYS A H    7  
ATOM 11381 H HA   . LYS A 1 55  ? -2.036  -1.494  6.908   1.00 0.00 ? 55  LYS A HA   7  
ATOM 11382 H HB2  . LYS A 1 55  ? -0.052  -0.287  7.097   1.00 0.00 ? 55  LYS A HB2  7  
ATOM 11383 H HB3  . LYS A 1 55  ? -0.732  1.143   6.333   1.00 0.00 ? 55  LYS A HB3  7  
ATOM 11384 H HG2  . LYS A 1 55  ? -0.302  1.392   8.764   1.00 0.00 ? 55  LYS A HG2  7  
ATOM 11385 H HG3  . LYS A 1 55  ? -1.978  1.688   8.295   1.00 0.00 ? 55  LYS A HG3  7  
ATOM 11386 H HD2  . LYS A 1 55  ? -2.299  -0.831  8.867   1.00 0.00 ? 55  LYS A HD2  7  
ATOM 11387 H HD3  . LYS A 1 55  ? -0.803  -0.628  9.782   1.00 0.00 ? 55  LYS A HD3  7  
ATOM 11388 H HE2  . LYS A 1 55  ? -3.007  1.345   10.153  1.00 0.00 ? 55  LYS A HE2  7  
ATOM 11389 H HE3  . LYS A 1 55  ? -3.147  -0.241  10.909  1.00 0.00 ? 55  LYS A HE3  7  
ATOM 11390 H HZ1  . LYS A 1 55  ? -2.095  0.978   12.527  1.00 0.00 ? 55  LYS A HZ1  7  
ATOM 11391 H HZ2  . LYS A 1 55  ? -1.194  1.895   11.428  1.00 0.00 ? 55  LYS A HZ2  7  
ATOM 11392 H HZ3  . LYS A 1 55  ? -0.767  0.288   11.738  1.00 0.00 ? 55  LYS A HZ3  7  
ATOM 11393 N N    . GLN A 1 56  ? -3.746  1.247   6.221   1.00 0.00 ? 56  GLN A N    7  
ATOM 11394 C CA   . GLN A 1 56  ? -4.992  1.951   6.499   1.00 0.00 ? 56  GLN A CA   7  
ATOM 11395 C C    . GLN A 1 56  ? -5.270  3.006   5.433   1.00 0.00 ? 56  GLN A C    7  
ATOM 11396 O O    . GLN A 1 56  ? -4.346  3.569   4.846   1.00 0.00 ? 56  GLN A O    7  
ATOM 11397 C CB   . GLN A 1 56  ? -4.936  2.606   7.880   1.00 0.00 ? 56  GLN A CB   7  
ATOM 11398 C CG   . GLN A 1 56  ? -5.512  4.013   7.910   1.00 0.00 ? 56  GLN A CG   7  
ATOM 11399 C CD   . GLN A 1 56  ? -5.840  4.480   9.314   1.00 0.00 ? 56  GLN A CD   7  
ATOM 11400 O OE1  . GLN A 1 56  ? -5.591  3.771   10.290  1.00 0.00 ? 56  GLN A OE1  7  
ATOM 11401 N NE2  . GLN A 1 56  ? -6.402  5.677   9.424   1.00 0.00 ? 56  GLN A NE2  7  
ATOM 11402 H H    . GLN A 1 56  ? -3.135  1.605   5.545   1.00 0.00 ? 56  GLN A H    7  
ATOM 11403 H HA   . GLN A 1 56  ? -5.792  1.226   6.487   1.00 0.00 ? 56  GLN A HA   7  
ATOM 11404 H HB2  . GLN A 1 56  ? -5.492  1.998   8.577   1.00 0.00 ? 56  GLN A HB2  7  
ATOM 11405 H HB3  . GLN A 1 56  ? -3.906  2.656   8.200   1.00 0.00 ? 56  GLN A HB3  7  
ATOM 11406 H HG2  . GLN A 1 56  ? -4.791  4.693   7.481   1.00 0.00 ? 56  GLN A HG2  7  
ATOM 11407 H HG3  . GLN A 1 56  ? -6.416  4.030   7.320   1.00 0.00 ? 56  GLN A HG3  7  
ATOM 11408 H HE21 . GLN A 1 56  ? -6.573  6.185   8.603   1.00 0.00 ? 56  GLN A HE21 7  
ATOM 11409 H HE22 . GLN A 1 56  ? -6.626  6.003   10.320  1.00 0.00 ? 56  GLN A HE22 7  
ATOM 11410 N N    . VAL A 1 57  ? -6.550  3.270   5.188   1.00 0.00 ? 57  VAL A N    7  
ATOM 11411 C CA   . VAL A 1 57  ? -6.950  4.258   4.193   1.00 0.00 ? 57  VAL A CA   7  
ATOM 11412 C C    . VAL A 1 57  ? -7.978  5.228   4.765   1.00 0.00 ? 57  VAL A C    7  
ATOM 11413 O O    . VAL A 1 57  ? -9.006  4.814   5.303   1.00 0.00 ? 57  VAL A O    7  
ATOM 11414 C CB   . VAL A 1 57  ? -7.536  3.586   2.938   1.00 0.00 ? 57  VAL A CB   7  
ATOM 11415 C CG1  . VAL A 1 57  ? -8.414  4.562   2.170   1.00 0.00 ? 57  VAL A CG1  7  
ATOM 11416 C CG2  . VAL A 1 57  ? -6.423  3.047   2.053   1.00 0.00 ? 57  VAL A CG2  7  
ATOM 11417 H H    . VAL A 1 57  ? -7.241  2.789   5.688   1.00 0.00 ? 57  VAL A H    7  
ATOM 11418 H HA   . VAL A 1 57  ? -6.070  4.813   3.901   1.00 0.00 ? 57  VAL A HA   7  
ATOM 11419 H HB   . VAL A 1 57  ? -8.151  2.755   3.253   1.00 0.00 ? 57  VAL A HB   7  
ATOM 11420 H HG11 . VAL A 1 57  ? -7.837  5.439   1.913   1.00 0.00 ? 57  VAL A HG11 7  
ATOM 11421 H HG12 . VAL A 1 57  ? -8.774  4.090   1.267   1.00 0.00 ? 57  VAL A HG12 7  
ATOM 11422 H HG13 . VAL A 1 57  ? -9.254  4.852   2.785   1.00 0.00 ? 57  VAL A HG13 7  
ATOM 11423 H HG21 . VAL A 1 57  ? -5.722  2.488   2.655   1.00 0.00 ? 57  VAL A HG21 7  
ATOM 11424 H HG22 . VAL A 1 57  ? -6.845  2.401   1.298   1.00 0.00 ? 57  VAL A HG22 7  
ATOM 11425 H HG23 . VAL A 1 57  ? -5.910  3.870   1.577   1.00 0.00 ? 57  VAL A HG23 7  
ATOM 11426 N N    . LEU A 1 58  ? -7.695  6.520   4.644   1.00 0.00 ? 58  LEU A N    7  
ATOM 11427 C CA   . LEU A 1 58  ? -8.596  7.551   5.148   1.00 0.00 ? 58  LEU A CA   7  
ATOM 11428 C C    . LEU A 1 58  ? -9.843  7.659   4.276   1.00 0.00 ? 58  LEU A C    7  
ATOM 11429 O O    . LEU A 1 58  ? -9.934  7.022   3.227   1.00 0.00 ? 58  LEU A O    7  
ATOM 11430 C CB   . LEU A 1 58  ? -7.879  8.901   5.203   1.00 0.00 ? 58  LEU A CB   7  
ATOM 11431 C CG   . LEU A 1 58  ? -6.661  8.978   6.124   1.00 0.00 ? 58  LEU A CG   7  
ATOM 11432 C CD1  . LEU A 1 58  ? -5.545  8.083   5.609   1.00 0.00 ? 58  LEU A CD1  7  
ATOM 11433 C CD2  . LEU A 1 58  ? -6.180  10.415  6.253   1.00 0.00 ? 58  LEU A CD2  7  
ATOM 11434 H H    . LEU A 1 58  ? -6.861  6.789   4.206   1.00 0.00 ? 58  LEU A H    7  
ATOM 11435 H HA   . LEU A 1 58  ? -8.894  7.270   6.148   1.00 0.00 ? 58  LEU A HA   7  
ATOM 11436 H HB2  . LEU A 1 58  ? -7.552  9.142   4.203   1.00 0.00 ? 58  LEU A HB2  7  
ATOM 11437 H HB3  . LEU A 1 58  ? -8.594  9.641   5.534   1.00 0.00 ? 58  LEU A HB3  7  
ATOM 11438 H HG   . LEU A 1 58  ? -6.940  8.628   7.109   1.00 0.00 ? 58  LEU A HG   7  
ATOM 11439 H HD11 . LEU A 1 58  ? -4.630  8.308   6.137   1.00 0.00 ? 58  LEU A HD11 7  
ATOM 11440 H HD12 . LEU A 1 58  ? -5.403  8.258   4.552   1.00 0.00 ? 58  LEU A HD12 7  
ATOM 11441 H HD13 . LEU A 1 58  ? -5.809  7.048   5.770   1.00 0.00 ? 58  LEU A HD13 7  
ATOM 11442 H HD21 . LEU A 1 58  ? -5.457  10.482  7.052   1.00 0.00 ? 58  LEU A HD21 7  
ATOM 11443 H HD22 . LEU A 1 58  ? -7.020  11.058  6.472   1.00 0.00 ? 58  LEU A HD22 7  
ATOM 11444 H HD23 . LEU A 1 58  ? -5.722  10.726  5.325   1.00 0.00 ? 58  LEU A HD23 7  
ATOM 11445 N N    . GLU A 1 59  ? -10.798 8.472   4.715   1.00 0.00 ? 59  GLU A N    7  
ATOM 11446 C CA   . GLU A 1 59  ? -12.038 8.664   3.973   1.00 0.00 ? 59  GLU A CA   7  
ATOM 11447 C C    . GLU A 1 59  ? -11.993 9.956   3.163   1.00 0.00 ? 59  GLU A C    7  
ATOM 11448 O O    . GLU A 1 59  ? -12.408 9.990   2.004   1.00 0.00 ? 59  GLU A O    7  
ATOM 11449 C CB   . GLU A 1 59  ? -13.233 8.690   4.929   1.00 0.00 ? 59  GLU A CB   7  
ATOM 11450 C CG   . GLU A 1 59  ? -14.574 8.796   4.224   1.00 0.00 ? 59  GLU A CG   7  
ATOM 11451 C CD   . GLU A 1 59  ? -15.731 8.365   5.104   1.00 0.00 ? 59  GLU A CD   7  
ATOM 11452 O OE1  . GLU A 1 59  ? -15.853 7.151   5.372   1.00 0.00 ? 59  GLU A OE1  7  
ATOM 11453 O OE2  . GLU A 1 59  ? -16.515 9.241   5.525   1.00 0.00 ? 59  GLU A OE2  7  
ATOM 11454 H H    . GLU A 1 59  ? -10.666 8.953   5.559   1.00 0.00 ? 59  GLU A H    7  
ATOM 11455 H HA   . GLU A 1 59  ? -12.151 7.832   3.294   1.00 0.00 ? 59  GLU A HA   7  
ATOM 11456 H HB2  . GLU A 1 59  ? -13.228 7.784   5.517   1.00 0.00 ? 59  GLU A HB2  7  
ATOM 11457 H HB3  . GLU A 1 59  ? -13.129 9.538   5.590   1.00 0.00 ? 59  GLU A HB3  7  
ATOM 11458 H HG2  . GLU A 1 59  ? -14.731 9.823   3.928   1.00 0.00 ? 59  GLU A HG2  7  
ATOM 11459 H HG3  . GLU A 1 59  ? -14.556 8.169   3.346   1.00 0.00 ? 59  GLU A HG3  7  
ATOM 11460 N N    . ASP A 1 60  ? -11.486 11.017  3.781   1.00 0.00 ? 60  ASP A N    7  
ATOM 11461 C CA   . ASP A 1 60  ? -11.385 12.312  3.118   1.00 0.00 ? 60  ASP A CA   7  
ATOM 11462 C C    . ASP A 1 60  ? -10.130 12.384  2.253   1.00 0.00 ? 60  ASP A C    7  
ATOM 11463 O O    . ASP A 1 60  ? -9.478  13.425  2.174   1.00 0.00 ? 60  ASP A O    7  
ATOM 11464 C CB   . ASP A 1 60  ? -11.371 13.439  4.153   1.00 0.00 ? 60  ASP A CB   7  
ATOM 11465 C CG   . ASP A 1 60  ? -10.091 13.465  4.964   1.00 0.00 ? 60  ASP A CG   7  
ATOM 11466 O OD1  . ASP A 1 60  ? -9.358  12.454  4.949   1.00 0.00 ? 60  ASP A OD1  7  
ATOM 11467 O OD2  . ASP A 1 60  ? -9.821  14.497  5.612   1.00 0.00 ? 60  ASP A OD2  7  
ATOM 11468 H H    . ASP A 1 60  ? -11.171 10.927  4.705   1.00 0.00 ? 60  ASP A H    7  
ATOM 11469 H HA   . ASP A 1 60  ? -12.251 12.429  2.484   1.00 0.00 ? 60  ASP A HA   7  
ATOM 11470 H HB2  . ASP A 1 60  ? -11.473 14.387  3.645   1.00 0.00 ? 60  ASP A HB2  7  
ATOM 11471 H HB3  . ASP A 1 60  ? -12.203 13.307  4.830   1.00 0.00 ? 60  ASP A HB3  7  
ATOM 11472 N N    . SER A 1 61  ? -9.798  11.271  1.608   1.00 0.00 ? 61  SER A N    7  
ATOM 11473 C CA   . SER A 1 61  ? -8.619  11.206  0.753   1.00 0.00 ? 61  SER A CA   7  
ATOM 11474 C C    . SER A 1 61  ? -8.984  10.698  -0.639  1.00 0.00 ? 61  SER A C    7  
ATOM 11475 O O    . SER A 1 61  ? -10.078 10.184  -0.872  1.00 0.00 ? 61  SER A O    7  
ATOM 11476 C CB   . SER A 1 61  ? -7.559  10.297  1.378   1.00 0.00 ? 61  SER A CB   7  
ATOM 11477 O OG   . SER A 1 61  ? -7.386  9.115   0.615   1.00 0.00 ? 61  SER A OG   7  
ATOM 11478 H H    . SER A 1 61  ? -10.359 10.473  1.712   1.00 0.00 ? 61  SER A H    7  
ATOM 11479 H HA   . SER A 1 61  ? -8.218  12.204  0.665   1.00 0.00 ? 61  SER A HA   7  
ATOM 11480 H HB2  . SER A 1 61  ? -6.618  10.823  1.422   1.00 0.00 ? 61  SER A HB2  7  
ATOM 11481 H HB3  . SER A 1 61  ? -7.867  10.024  2.378   1.00 0.00 ? 61  SER A HB3  7  
ATOM 11482 H HG   . SER A 1 61  ? -7.786  8.374   1.077   1.00 0.00 ? 61  SER A HG   7  
ATOM 11483 N N    . PRO A 1 62  ? -8.046  10.844  -1.586  1.00 0.00 ? 62  PRO A N    7  
ATOM 11484 C CA   . PRO A 1 62  ? -8.244  10.406  -2.971  1.00 0.00 ? 62  PRO A CA   7  
ATOM 11485 C C    . PRO A 1 62  ? -8.277  8.887   -3.100  1.00 0.00 ? 62  PRO A C    7  
ATOM 11486 O O    . PRO A 1 62  ? -8.807  8.348   -4.071  1.00 0.00 ? 62  PRO A O    7  
ATOM 11487 C CB   . PRO A 1 62  ? -7.027  10.978  -3.702  1.00 0.00 ? 62  PRO A CB   7  
ATOM 11488 C CG   . PRO A 1 62  ? -5.983  11.118  -2.648  1.00 0.00 ? 62  PRO A CG   7  
ATOM 11489 C CD   . PRO A 1 62  ? -6.719  11.447  -1.378  1.00 0.00 ? 62  PRO A CD   7  
ATOM 11490 H HA   . PRO A 1 62  ? -9.148  10.822  -3.393  1.00 0.00 ? 62  PRO A HA   7  
ATOM 11491 H HB2  . PRO A 1 62  ? -6.716  10.294  -4.479  1.00 0.00 ? 62  PRO A HB2  7  
ATOM 11492 H HB3  . PRO A 1 62  ? -7.280  11.934  -4.136  1.00 0.00 ? 62  PRO A HB3  7  
ATOM 11493 H HG2  . PRO A 1 62  ? -5.445  10.189  -2.539  1.00 0.00 ? 62  PRO A HG2  7  
ATOM 11494 H HG3  . PRO A 1 62  ? -5.306  11.918  -2.906  1.00 0.00 ? 62  PRO A HG3  7  
ATOM 11495 H HD2  . PRO A 1 62  ? -6.222  11.003  -0.528  1.00 0.00 ? 62  PRO A HD2  7  
ATOM 11496 H HD3  . PRO A 1 62  ? -6.797  12.517  -1.254  1.00 0.00 ? 62  PRO A HD3  7  
ATOM 11497 N N    . ALA A 1 63  ? -7.708  8.202   -2.113  1.00 0.00 ? 63  ALA A N    7  
ATOM 11498 C CA   . ALA A 1 63  ? -7.675  6.745   -2.116  1.00 0.00 ? 63  ALA A CA   7  
ATOM 11499 C C    . ALA A 1 63  ? -8.905  6.166   -1.424  1.00 0.00 ? 63  ALA A C    7  
ATOM 11500 O O    . ALA A 1 63  ? -9.332  5.053   -1.725  1.00 0.00 ? 63  ALA A O    7  
ATOM 11501 C CB   . ALA A 1 63  ? -6.405  6.244   -1.443  1.00 0.00 ? 63  ALA A CB   7  
ATOM 11502 H H    . ALA A 1 63  ? -7.302  8.688   -1.365  1.00 0.00 ? 63  ALA A H    7  
ATOM 11503 H HA   . ALA A 1 63  ? -7.664  6.413   -3.144  1.00 0.00 ? 63  ALA A HA   7  
ATOM 11504 H HB1  . ALA A 1 63  ? -6.418  6.521   -0.400  1.00 0.00 ? 63  ALA A HB1  7  
ATOM 11505 H HB2  . ALA A 1 63  ? -6.352  5.169   -1.531  1.00 0.00 ? 63  ALA A HB2  7  
ATOM 11506 H HB3  . ALA A 1 63  ? -5.545  6.688   -1.923  1.00 0.00 ? 63  ALA A HB3  7  
ATOM 11507 N N    . GLY A 1 64  ? -9.469  6.931   -0.493  1.00 0.00 ? 64  GLY A N    7  
ATOM 11508 C CA   . GLY A 1 64  ? -10.644 6.477   0.227   1.00 0.00 ? 64  GLY A CA   7  
ATOM 11509 C C    . GLY A 1 64  ? -11.905 6.554   -0.611  1.00 0.00 ? 64  GLY A C    7  
ATOM 11510 O O    . GLY A 1 64  ? -12.753 5.664   -0.554  1.00 0.00 ? 64  GLY A O    7  
ATOM 11511 H H    . GLY A 1 64  ? -9.085  7.810   -0.295  1.00 0.00 ? 64  GLY A H    7  
ATOM 11512 H HA2  . GLY A 1 64  ? -10.491 5.453   0.535   1.00 0.00 ? 64  GLY A HA2  7  
ATOM 11513 H HA3  . GLY A 1 64  ? -10.772 7.091   1.107   1.00 0.00 ? 64  GLY A HA3  7  
ATOM 11514 N N    . LYS A 1 65  ? -12.029 7.622   -1.391  1.00 0.00 ? 65  LYS A N    7  
ATOM 11515 C CA   . LYS A 1 65  ? -13.195 7.814   -2.245  1.00 0.00 ? 65  LYS A CA   7  
ATOM 11516 C C    . LYS A 1 65  ? -13.274 6.726   -3.311  1.00 0.00 ? 65  LYS A C    7  
ATOM 11517 O O    . LYS A 1 65  ? -14.358 6.246   -3.644  1.00 0.00 ? 65  LYS A O    7  
ATOM 11518 C CB   . LYS A 1 65  ? -13.145 9.192   -2.911  1.00 0.00 ? 65  LYS A CB   7  
ATOM 11519 C CG   . LYS A 1 65  ? -13.161 10.345  -1.923  1.00 0.00 ? 65  LYS A CG   7  
ATOM 11520 C CD   . LYS A 1 65  ? -13.524 11.655  -2.601  1.00 0.00 ? 65  LYS A CD   7  
ATOM 11521 C CE   . LYS A 1 65  ? -12.941 12.848  -1.858  1.00 0.00 ? 65  LYS A CE   7  
ATOM 11522 N NZ   . LYS A 1 65  ? -13.439 14.140  -2.406  1.00 0.00 ? 65  LYS A NZ   7  
ATOM 11523 H H    . LYS A 1 65  ? -11.319 8.298   -1.394  1.00 0.00 ? 65  LYS A H    7  
ATOM 11524 H HA   . LYS A 1 65  ? -14.076 7.757   -1.623  1.00 0.00 ? 65  LYS A HA   7  
ATOM 11525 H HB2  . LYS A 1 65  ? -12.241 9.261   -3.499  1.00 0.00 ? 65  LYS A HB2  7  
ATOM 11526 H HB3  . LYS A 1 65  ? -13.999 9.294   -3.565  1.00 0.00 ? 65  LYS A HB3  7  
A