data_2EIF
# 
_entry.id   2EIF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2EIF         
RCSB  RCSB008406   
WWPDB D_1000008406 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          BSGCAIR30508 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2EIF 
_pdbx_database_status.recvd_initial_deposition_date   1998-10-12 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kim, K.K.'                                  1 
'Hung, L.W.'                                 2 
'Kim, R.'                                    3 
'Kim, S.H.'                                  4 
'Berkeley Structural Genomics Center (BSGC)' 5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structures of eukaryotic translation initiation factor 5A from Methanococcus jannaschii at 1.8 A resolution.' 
Proc.Natl.Acad.Sci.USA 95 10419 10424 1998 PNASA6 US 0027-8424 0040 ? 9724718 10.1073/pnas.95.18.10419 
1       
;Cloning, Expression, and Crystallization of a Hyperthermophilic Protein that is Homologous to the Eukaryotic Translation Initiation Factor, eIF5A
;
'Protein Sci.'         6  2268  2270  1997 PRCIEI US 0961-8368 0795 ? ?       ?                        
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kim, K.K.'  1 
primary 'Hung, L.W.' 2 
primary 'Yokota, H.' 3 
primary 'Kim, R.'    4 
primary 'Kim, S.H.'  5 
1       'Kim, K.K.'  6 
1       'Yokota, H.' 7 
1       'Kim, R.'    8 
1       'Kim, S.H.'  9 
# 
_cell.entry_id           2EIF 
_cell.length_a           80.483 
_cell.length_b           40.198 
_cell.length_c           48.580 
_cell.angle_alpha        90.00 
_cell.angle_beta         124.29 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2EIF 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'PROTEIN (EUKARYOTIC TRANSLATION INITIATION FACTOR 5A)' 14653.239 1   ? ? ? ? 
2 water   nat water                                                   18.015    108 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        IF-5A 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MVIIMPGTKQVNVGSLKVGQYVMIDGVPCEIVDISVSKPGKHGGAKARVVGIGIFEKVKKEFVAPTSSKVEVPIIDRRKG
QVLAIMGDMVQIMDLQTYETLELPIPEGIEGLEPGGEVEYIEAVGQYKITRVIGGK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MVIIMPGTKQVNVGSLKVGQYVMIDGVPCEIVDISVSKPGKHGGAKARVVGIGIFEKVKKEFVAPTSSKVEVPIIDRRKG
QVLAIMGDMVQIMDLQTYETLELPIPEGIEGLEPGGEVEYIEAVGQYKITRVIGGK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         BSGCAIR30508 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   ILE n 
1 4   ILE n 
1 5   MET n 
1 6   PRO n 
1 7   GLY n 
1 8   THR n 
1 9   LYS n 
1 10  GLN n 
1 11  VAL n 
1 12  ASN n 
1 13  VAL n 
1 14  GLY n 
1 15  SER n 
1 16  LEU n 
1 17  LYS n 
1 18  VAL n 
1 19  GLY n 
1 20  GLN n 
1 21  TYR n 
1 22  VAL n 
1 23  MET n 
1 24  ILE n 
1 25  ASP n 
1 26  GLY n 
1 27  VAL n 
1 28  PRO n 
1 29  CYS n 
1 30  GLU n 
1 31  ILE n 
1 32  VAL n 
1 33  ASP n 
1 34  ILE n 
1 35  SER n 
1 36  VAL n 
1 37  SER n 
1 38  LYS n 
1 39  PRO n 
1 40  GLY n 
1 41  LYS n 
1 42  HIS n 
1 43  GLY n 
1 44  GLY n 
1 45  ALA n 
1 46  LYS n 
1 47  ALA n 
1 48  ARG n 
1 49  VAL n 
1 50  VAL n 
1 51  GLY n 
1 52  ILE n 
1 53  GLY n 
1 54  ILE n 
1 55  PHE n 
1 56  GLU n 
1 57  LYS n 
1 58  VAL n 
1 59  LYS n 
1 60  LYS n 
1 61  GLU n 
1 62  PHE n 
1 63  VAL n 
1 64  ALA n 
1 65  PRO n 
1 66  THR n 
1 67  SER n 
1 68  SER n 
1 69  LYS n 
1 70  VAL n 
1 71  GLU n 
1 72  VAL n 
1 73  PRO n 
1 74  ILE n 
1 75  ILE n 
1 76  ASP n 
1 77  ARG n 
1 78  ARG n 
1 79  LYS n 
1 80  GLY n 
1 81  GLN n 
1 82  VAL n 
1 83  LEU n 
1 84  ALA n 
1 85  ILE n 
1 86  MET n 
1 87  GLY n 
1 88  ASP n 
1 89  MET n 
1 90  VAL n 
1 91  GLN n 
1 92  ILE n 
1 93  MET n 
1 94  ASP n 
1 95  LEU n 
1 96  GLN n 
1 97  THR n 
1 98  TYR n 
1 99  GLU n 
1 100 THR n 
1 101 LEU n 
1 102 GLU n 
1 103 LEU n 
1 104 PRO n 
1 105 ILE n 
1 106 PRO n 
1 107 GLU n 
1 108 GLY n 
1 109 ILE n 
1 110 GLU n 
1 111 GLY n 
1 112 LEU n 
1 113 GLU n 
1 114 PRO n 
1 115 GLY n 
1 116 GLY n 
1 117 GLU n 
1 118 VAL n 
1 119 GLU n 
1 120 TYR n 
1 121 ILE n 
1 122 GLU n 
1 123 ALA n 
1 124 VAL n 
1 125 GLY n 
1 126 GLN n 
1 127 TYR n 
1 128 LYS n 
1 129 ILE n 
1 130 THR n 
1 131 ARG n 
1 132 VAL n 
1 133 ILE n 
1 134 GLY n 
1 135 GLY n 
1 136 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Methanocaldococcus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   'Methanocaldococcus jannaschii' 
_entity_src_gen.gene_src_strain                    'DSM 2661' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Methanocaldococcus jannaschii' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     243232 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET21A/PSJS1240 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IF5A_METJA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          Q58625 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2EIF 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 136 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q58625 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  132 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       0 
_struct_ref_seq.pdbx_auth_seq_align_end       135 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2EIF MET A 1 ? UNP Q58625 ? ? 'CLONING ARTIFACT' 0 1 
1 2EIF VAL A 2 ? UNP Q58625 ? ? 'CLONING ARTIFACT' 1 2 
1 2EIF ILE A 3 ? UNP Q58625 ? ? 'CLONING ARTIFACT' 2 3 
1 2EIF ILE A 4 ? UNP Q58625 ? ? 'CLONING ARTIFACT' 3 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2EIF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.22 
_exptl_crystal.density_percent_sol   45 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    '0.1M TRIS-HCL (PH 8.5), 0.2M MGCL2, 30% PEG4000' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 ?   ? 1 
3 ?   ? 1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   1997-07-01 
_diffrn_detector.details                'MSC FOCUSING MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON      'NSLS BEAMLINE X4A'  NSLS X4A  ? ?    
2 SYNCHROTRON      'NSLS BEAMLINE X12B' NSLS X12B ? ?    
3 'ROTATING ANODE' RIGAKU               ?    ?    ? 1.54 
# 
_reflns.entry_id                     2EIF 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   11659 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            0.045 
_reflns.pdbx_Rsym_value              0.045 
_reflns.pdbx_netI_over_sigmaI        16.2 
_reflns.B_iso_Wilson_estimate        22.1 
_reflns.pdbx_redundancy              1.98 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.8 
_reflns_shell.d_res_low              1.83 
_reflns_shell.percent_possible_all   91.2 
_reflns_shell.Rmerge_I_obs           0.233 
_reflns_shell.pdbx_Rsym_value        0.233 
_reflns_shell.meanI_over_sigI_obs    3.7 
_reflns_shell.pdbx_redundancy        1.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2EIF 
_refine.ls_number_reflns_obs                     11482 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           1097804.99 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            1.8 
_refine.ls_percent_reflns_obs                    95.4 
_refine.ls_R_factor_obs                          0.214 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.214 
_refine.ls_R_factor_R_free                       0.249 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.3 
_refine.ls_number_reflns_R_free                  1185 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               25.3 
_refine.aniso_B[1][1]                            4.74 
_refine.aniso_B[2][2]                            -4.14 
_refine.aniso_B[3][3]                            -0.6 
_refine.aniso_B[1][2]                            0. 
_refine.aniso_B[1][3]                            4.88 
_refine.aniso_B[2][3]                            0. 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.397 
_refine.solvent_model_param_bsol                 48.9 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1EIF 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2EIF 
_refine_analyze.Luzzati_coordinate_error_obs    0.22 
_refine_analyze.Luzzati_sigma_a_obs             0.14 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.27 
_refine_analyze.Luzzati_sigma_a_free            0.19 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        992 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             108 
_refine_hist.number_atoms_total               1100 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.011 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.7   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      26.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.89  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             3.02  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            4.06  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             21.03 2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            14.80 2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.91 
_refine_ls_shell.number_reflns_R_work             1621 
_refine_ls_shell.R_factor_R_work                  0.285 
_refine_ls_shell.percent_reflns_obs               93.4 
_refine_ls_shell.R_factor_R_free                  0.342 
_refine_ls_shell.R_factor_R_free_error            0.023 
_refine_ls_shell.percent_reflns_R_free            11.9 
_refine_ls_shell.number_reflns_R_free             218 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2EIF 
_struct.title                     'Eukaryotic translation initiation factor 5A from Methanococcus jannaschii' 
_struct.pdbx_descriptor           'PROTEIN (EUKARYOTIC TRANSLATION INITIATION FACTOR 5A)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2EIF 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
_struct_keywords.text            
;EIF-5A, TRANSLATION, OB-FOLD, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, GENE REGULATION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       VAL 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        13 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       SER 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        15 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        VAL 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         12 
_struct_conf.end_auth_comp_id        SER 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         14 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
C ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 8   ? ASN A 12  ? THR A 7   ASN A 11  
A 2 LYS A 69  ? PRO A 73  ? LYS A 68  PRO A 72  
B 1 TYR A 21  ? ILE A 24  ? TYR A 20  ILE A 23  
B 2 VAL A 27  ? VAL A 36  ? VAL A 26  VAL A 35  
B 3 LYS A 46  ? GLY A 53  ? LYS A 45  GLY A 52  
B 4 LYS A 59  ? PRO A 65  ? LYS A 58  PRO A 64  
C 1 THR A 100 ? PRO A 104 ? THR A 99  PRO A 103 
C 2 MET A 89  ? ASP A 94  ? MET A 88  ASP A 93  
C 3 ILE A 75  ? MET A 86  ? ILE A 74  MET A 85  
C 4 GLU A 117 ? ALA A 123 ? GLU A 116 ALA A 122 
C 5 GLN A 126 ? VAL A 132 ? GLN A 125 VAL A 131 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 9   ? O LYS A 8   N VAL A 72  ? N VAL A 71  
B 1 2 O VAL A 22  ? O VAL A 21  N CYS A 29  ? N CYS A 28  
B 2 3 O GLU A 30  ? O GLU A 29  N ILE A 52  ? N ILE A 51  
B 3 4 O ALA A 47  ? O ALA A 46  N ALA A 64  ? N ALA A 63  
C 1 2 O LEU A 101 ? O LEU A 100 N ILE A 92  ? N ILE A 91  
C 2 3 O MET A 89  ? O MET A 88  N MET A 86  ? N MET A 85  
C 3 4 O ASP A 76  ? O ASP A 75  N GLU A 122 ? N GLU A 121 
C 4 5 O GLU A 119 ? O GLU A 118 N ARG A 131 ? N ARG A 130 
# 
_database_PDB_matrix.entry_id          2EIF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2EIF 
_atom_sites.fract_transf_matrix[1][1]   0.012425 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.008472 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.024877 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.024915 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? 16.707  -16.837 25.405  1.00 49.97 ? 0   MET A N   1 
ATOM   2    C CA  . MET A 1 1   ? 17.678  -17.757 24.741  1.00 49.97 ? 0   MET A CA  1 
ATOM   3    C C   . MET A 1 1   ? 17.843  -17.399 23.267  1.00 49.97 ? 0   MET A C   1 
ATOM   4    O O   . MET A 1 1   ? 17.167  -16.506 22.755  1.00 49.97 ? 0   MET A O   1 
ATOM   5    C CB  . MET A 1 1   ? 17.202  -19.202 24.879  1.00 49.97 ? 0   MET A CB  1 
ATOM   6    N N   . VAL A 1 2   ? 18.745  -18.094 22.584  1.00 49.97 ? 1   VAL A N   1 
ATOM   7    C CA  . VAL A 1 2   ? 18.982  -17.833 21.164  1.00 49.97 ? 1   VAL A CA  1 
ATOM   8    C C   . VAL A 1 2   ? 19.582  -16.440 20.933  1.00 49.97 ? 1   VAL A C   1 
ATOM   9    O O   . VAL A 1 2   ? 19.241  -15.484 21.632  1.00 49.97 ? 1   VAL A O   1 
ATOM   10   C CB  . VAL A 1 2   ? 17.663  -17.983 20.378  1.00 49.97 ? 1   VAL A CB  1 
ATOM   11   N N   . ILE A 1 3   ? 20.471  -16.328 19.948  1.00 50.77 ? 2   ILE A N   1 
ATOM   12   C CA  . ILE A 1 3   ? 21.110  -15.051 19.643  1.00 51.67 ? 2   ILE A CA  1 
ATOM   13   C C   . ILE A 1 3   ? 20.139  -14.074 18.984  1.00 51.24 ? 2   ILE A C   1 
ATOM   14   O O   . ILE A 1 3   ? 19.173  -14.483 18.345  1.00 54.34 ? 2   ILE A O   1 
ATOM   15   C CB  . ILE A 1 3   ? 22.321  -15.275 18.740  1.00 51.73 ? 2   ILE A CB  1 
ATOM   16   N N   . ILE A 1 4   ? 20.400  -12.781 19.142  1.00 48.95 ? 3   ILE A N   1 
ATOM   17   C CA  . ILE A 1 4   ? 19.546  -11.747 18.558  1.00 46.56 ? 3   ILE A CA  1 
ATOM   18   C C   . ILE A 1 4   ? 19.727  -11.674 17.044  1.00 44.15 ? 3   ILE A C   1 
ATOM   19   O O   . ILE A 1 4   ? 20.752  -11.177 16.569  1.00 45.05 ? 3   ILE A O   1 
ATOM   20   C CB  . ILE A 1 4   ? 19.869  -10.392 19.179  1.00 45.87 ? 3   ILE A CB  1 
ATOM   21   N N   . MET A 1 5   ? 18.732  -12.158 16.298  1.00 41.41 ? 4   MET A N   1 
ATOM   22   C CA  . MET A 1 5   ? 18.776  -12.146 14.828  1.00 36.40 ? 4   MET A CA  1 
ATOM   23   C C   . MET A 1 5   ? 19.474  -10.892 14.323  1.00 33.29 ? 4   MET A C   1 
ATOM   24   O O   . MET A 1 5   ? 19.321  -9.817  14.899  1.00 32.13 ? 4   MET A O   1 
ATOM   25   C CB  . MET A 1 5   ? 17.356  -12.229 14.247  1.00 38.04 ? 4   MET A CB  1 
ATOM   26   N N   . PRO A 1 6   ? 20.258  -11.015 13.237  1.00 28.76 ? 5   PRO A N   1 
ATOM   27   C CA  . PRO A 1 6   ? 20.989  -9.889  12.657  1.00 27.87 ? 5   PRO A CA  1 
ATOM   28   C C   . PRO A 1 6   ? 20.153  -8.721  12.145  1.00 26.04 ? 5   PRO A C   1 
ATOM   29   O O   . PRO A 1 6   ? 18.948  -8.847  11.925  1.00 24.97 ? 5   PRO A O   1 
ATOM   30   C CB  . PRO A 1 6   ? 21.784  -10.543 11.532  1.00 28.28 ? 5   PRO A CB  1 
ATOM   31   C CG  . PRO A 1 6   ? 20.877  -11.659 11.112  1.00 30.01 ? 5   PRO A CG  1 
ATOM   32   C CD  . PRO A 1 6   ? 20.538  -12.237 12.461  1.00 29.42 ? 5   PRO A CD  1 
ATOM   33   N N   . GLY A 1 7   ? 20.822  -7.588  11.956  1.00 24.25 ? 6   GLY A N   1 
ATOM   34   C CA  . GLY A 1 7   ? 20.155  -6.414  11.433  1.00 22.78 ? 6   GLY A CA  1 
ATOM   35   C C   . GLY A 1 7   ? 19.413  -5.561  12.436  1.00 21.83 ? 6   GLY A C   1 
ATOM   36   O O   . GLY A 1 7   ? 18.690  -4.649  12.038  1.00 20.71 ? 6   GLY A O   1 
ATOM   37   N N   . THR A 1 8   ? 19.565  -5.841  13.732  1.00 21.41 ? 7   THR A N   1 
ATOM   38   C CA  . THR A 1 8   ? 18.877  -5.032  14.747  1.00 20.73 ? 7   THR A CA  1 
ATOM   39   C C   . THR A 1 8   ? 19.862  -4.497  15.771  1.00 21.25 ? 7   THR A C   1 
ATOM   40   O O   . THR A 1 8   ? 21.006  -4.947  15.843  1.00 20.50 ? 7   THR A O   1 
ATOM   41   C CB  . THR A 1 8   ? 17.826  -5.849  15.530  1.00 21.00 ? 7   THR A CB  1 
ATOM   42   O OG1 . THR A 1 8   ? 18.490  -6.886  16.265  1.00 21.99 ? 7   THR A OG1 1 
ATOM   43   C CG2 . THR A 1 8   ? 16.807  -6.471  14.586  1.00 20.10 ? 7   THR A CG2 1 
ATOM   44   N N   . LYS A 1 9   ? 19.420  -3.502  16.537  1.00 21.73 ? 8   LYS A N   1 
ATOM   45   C CA  . LYS A 1 9   ? 20.217  -2.947  17.616  1.00 22.10 ? 8   LYS A CA  1 
ATOM   46   C C   . LYS A 1 9   ? 19.249  -2.845  18.794  1.00 20.64 ? 8   LYS A C   1 
ATOM   47   O O   . LYS A 1 9   ? 18.034  -2.779  18.613  1.00 20.26 ? 8   LYS A O   1 
ATOM   48   C CB  . LYS A 1 9   ? 20.802  -1.572  17.277  1.00 23.86 ? 8   LYS A CB  1 
ATOM   49   C CG  . LYS A 1 9   ? 19.801  -0.443  17.102  1.00 27.99 ? 8   LYS A CG  1 
ATOM   50   C CD  . LYS A 1 9   ? 20.514  0.903   16.922  1.00 30.45 ? 8   LYS A CD  1 
ATOM   51   C CE  . LYS A 1 9   ? 19.529  2.051   16.694  1.00 30.91 ? 8   LYS A CE  1 
ATOM   52   N NZ  . LYS A 1 9   ? 18.872  1.947   15.341  1.00 35.05 ? 8   LYS A NZ  1 
ATOM   53   N N   . GLN A 1 10  ? 19.793  -2.838  19.997  1.00 20.79 ? 9   GLN A N   1 
ATOM   54   C CA  . GLN A 1 10  ? 18.983  -2.794  21.215  1.00 19.78 ? 9   GLN A CA  1 
ATOM   55   C C   . GLN A 1 10  ? 18.911  -1.396  21.814  1.00 19.40 ? 9   GLN A C   1 
ATOM   56   O O   . GLN A 1 10  ? 19.936  -0.740  21.972  1.00 18.22 ? 9   GLN A O   1 
ATOM   57   C CB  . GLN A 1 10  ? 19.601  -3.776  22.209  1.00 23.35 ? 9   GLN A CB  1 
ATOM   58   C CG  . GLN A 1 10  ? 18.940  -3.889  23.548  1.00 29.54 ? 9   GLN A CG  1 
ATOM   59   C CD  . GLN A 1 10  ? 19.682  -4.859  24.482  1.00 32.80 ? 9   GLN A CD  1 
ATOM   60   O OE1 . GLN A 1 10  ? 20.844  -4.637  24.842  1.00 36.71 ? 9   GLN A OE1 1 
ATOM   61   N NE2 . GLN A 1 10  ? 19.007  -5.937  24.869  1.00 33.81 ? 9   GLN A NE2 1 
ATOM   62   N N   . VAL A 1 11  ? 17.707  -0.937  22.150  1.00 19.03 ? 10  VAL A N   1 
ATOM   63   C CA  . VAL A 1 11  ? 17.550  0.390   22.763  1.00 18.68 ? 10  VAL A CA  1 
ATOM   64   C C   . VAL A 1 11  ? 16.530  0.295   23.880  1.00 18.65 ? 10  VAL A C   1 
ATOM   65   O O   . VAL A 1 11  ? 15.824  -0.703  24.004  1.00 18.18 ? 10  VAL A O   1 
ATOM   66   C CB  . VAL A 1 11  ? 17.038  1.442   21.749  1.00 20.54 ? 10  VAL A CB  1 
ATOM   67   C CG1 . VAL A 1 11  ? 17.989  1.535   20.571  1.00 21.81 ? 10  VAL A CG1 1 
ATOM   68   C CG2 . VAL A 1 11  ? 15.621  1.065   21.269  1.00 19.18 ? 10  VAL A CG2 1 
ATOM   69   N N   . ASN A 1 12  ? 16.450  1.322   24.714  1.00 18.83 ? 11  ASN A N   1 
ATOM   70   C CA  . ASN A 1 12  ? 15.450  1.304   25.758  1.00 18.60 ? 11  ASN A CA  1 
ATOM   71   C C   . ASN A 1 12  ? 14.097  1.715   25.180  1.00 17.74 ? 11  ASN A C   1 
ATOM   72   O O   . ASN A 1 12  ? 14.010  2.627   24.359  1.00 15.97 ? 11  ASN A O   1 
ATOM   73   C CB  . ASN A 1 12  ? 15.814  2.258   26.906  1.00 22.12 ? 11  ASN A CB  1 
ATOM   74   C CG  . ASN A 1 12  ? 17.005  1.780   27.711  1.00 25.72 ? 11  ASN A CG  1 
ATOM   75   O OD1 . ASN A 1 12  ? 17.156  0.588   27.952  1.00 29.47 ? 11  ASN A OD1 1 
ATOM   76   N ND2 . ASN A 1 12  ? 17.838  2.710   28.157  1.00 27.24 ? 11  ASN A ND2 1 
ATOM   77   N N   . VAL A 1 13  ? 13.047  1.033   25.629  1.00 16.57 ? 12  VAL A N   1 
ATOM   78   C CA  . VAL A 1 13  ? 11.683  1.313   25.208  1.00 16.50 ? 12  VAL A CA  1 
ATOM   79   C C   . VAL A 1 13  ? 11.327  2.796   25.368  1.00 15.46 ? 12  VAL A C   1 
ATOM   80   O O   . VAL A 1 13  ? 10.648  3.380   24.507  1.00 13.76 ? 12  VAL A O   1 
ATOM   81   C CB  . VAL A 1 13  ? 10.695  0.456   26.023  1.00 16.86 ? 12  VAL A CB  1 
ATOM   82   C CG1 . VAL A 1 13  ? 9.258   0.940   25.811  1.00 16.19 ? 12  VAL A CG1 1 
ATOM   83   C CG2 . VAL A 1 13  ? 10.817  -1.018  25.572  1.00 14.96 ? 12  VAL A CG2 1 
ATOM   84   N N   . GLY A 1 14  ? 11.797  3.394   26.460  1.00 16.16 ? 13  GLY A N   1 
ATOM   85   C CA  . GLY A 1 14  ? 11.505  4.795   26.729  1.00 17.33 ? 13  GLY A CA  1 
ATOM   86   C C   . GLY A 1 14  ? 12.162  5.765   25.766  1.00 16.31 ? 13  GLY A C   1 
ATOM   87   O O   . GLY A 1 14  ? 11.846  6.970   25.767  1.00 17.51 ? 13  GLY A O   1 
ATOM   88   N N   . SER A 1 15  ? 13.081  5.271   24.957  1.00 16.09 ? 14  SER A N   1 
ATOM   89   C CA  . SER A 1 15  ? 13.759  6.114   23.972  1.00 16.01 ? 14  SER A CA  1 
ATOM   90   C C   . SER A 1 15  ? 13.081  6.057   22.602  1.00 16.25 ? 14  SER A C   1 
ATOM   91   O O   . SER A 1 15  ? 13.420  6.834   21.709  1.00 15.02 ? 14  SER A O   1 
ATOM   92   C CB  . SER A 1 15  ? 15.211  5.680   23.780  1.00 15.87 ? 14  SER A CB  1 
ATOM   93   O OG  . SER A 1 15  ? 15.291  4.417   23.130  1.00 16.49 ? 14  SER A OG  1 
ATOM   94   N N   . LEU A 1 16  ? 12.146  5.137   22.421  1.00 15.10 ? 15  LEU A N   1 
ATOM   95   C CA  . LEU A 1 16  ? 11.501  5.014   21.109  1.00 14.44 ? 15  LEU A CA  1 
ATOM   96   C C   . LEU A 1 16  ? 10.707  6.260   20.752  1.00 14.02 ? 15  LEU A C   1 
ATOM   97   O O   . LEU A 1 16  ? 10.112  6.887   21.607  1.00 17.36 ? 15  LEU A O   1 
ATOM   98   C CB  . LEU A 1 16  ? 10.581  3.791   21.073  1.00 15.18 ? 15  LEU A CB  1 
ATOM   99   C CG  . LEU A 1 16  ? 11.244  2.414   21.239  1.00 12.62 ? 15  LEU A CG  1 
ATOM   100  C CD1 . LEU A 1 16  ? 10.103  1.432   21.367  1.00 15.52 ? 15  LEU A CD1 1 
ATOM   101  C CD2 . LEU A 1 16  ? 12.177  2.045   20.064  1.00 13.76 ? 15  LEU A CD2 1 
ATOM   102  N N   . LYS A 1 17  ? 10.690  6.596   19.464  1.00 14.37 ? 16  LYS A N   1 
ATOM   103  C CA  . LYS A 1 17  ? 9.995   7.781   18.986  1.00 14.53 ? 16  LYS A CA  1 
ATOM   104  C C   . LYS A 1 17  ? 8.973   7.405   17.910  1.00 14.59 ? 16  LYS A C   1 
ATOM   105  O O   . LYS A 1 17  ? 9.242   6.547   17.062  1.00 13.71 ? 16  LYS A O   1 
ATOM   106  C CB  . LYS A 1 17  ? 11.011  8.757   18.370  1.00 13.00 ? 16  LYS A CB  1 
ATOM   107  C CG  . LYS A 1 17  ? 12.027  9.334   19.344  1.00 14.51 ? 16  LYS A CG  1 
ATOM   108  C CD  . LYS A 1 17  ? 13.230  9.927   18.599  1.00 21.76 ? 16  LYS A CD  1 
ATOM   109  C CE  . LYS A 1 17  ? 12.861  11.128  17.755  1.00 20.46 ? 16  LYS A CE  1 
ATOM   110  N NZ  . LYS A 1 17  ? 12.693  12.314  18.644  1.00 23.52 ? 16  LYS A NZ  1 
ATOM   111  N N   . VAL A 1 18  ? 7.815   8.050   17.955  1.00 13.18 ? 17  VAL A N   1 
ATOM   112  C CA  . VAL A 1 18  ? 6.780   7.809   16.946  1.00 15.47 ? 17  VAL A CA  1 
ATOM   113  C C   . VAL A 1 18  ? 7.402   8.074   15.565  1.00 15.81 ? 17  VAL A C   1 
ATOM   114  O O   . VAL A 1 18  ? 8.206   9.006   15.390  1.00 14.98 ? 17  VAL A O   1 
ATOM   115  C CB  . VAL A 1 18  ? 5.549   8.724   17.210  1.00 13.05 ? 17  VAL A CB  1 
ATOM   116  C CG1 . VAL A 1 18  ? 4.497   8.582   16.055  1.00 13.49 ? 17  VAL A CG1 1 
ATOM   117  C CG2 . VAL A 1 18  ? 4.887   8.322   18.545  1.00 13.03 ? 17  VAL A CG2 1 
ATOM   118  N N   . GLY A 1 19  ? 7.081   7.227   14.593  1.00 16.89 ? 18  GLY A N   1 
ATOM   119  C CA  . GLY A 1 19  ? 7.627   7.407   13.256  1.00 16.97 ? 18  GLY A CA  1 
ATOM   120  C C   . GLY A 1 19  ? 8.945   6.687   13.016  1.00 17.60 ? 18  GLY A C   1 
ATOM   121  O O   . GLY A 1 19  ? 9.380   6.553   11.861  1.00 18.62 ? 18  GLY A O   1 
ATOM   122  N N   . GLN A 1 20  ? 9.569   6.234   14.106  1.00 16.63 ? 19  GLN A N   1 
ATOM   123  C CA  . GLN A 1 20  ? 10.833  5.479   14.100  1.00 15.75 ? 19  GLN A CA  1 
ATOM   124  C C   . GLN A 1 20  ? 10.417  3.981   14.020  1.00 14.62 ? 19  GLN A C   1 
ATOM   125  O O   . GLN A 1 20  ? 9.229   3.670   13.959  1.00 15.06 ? 19  GLN A O   1 
ATOM   126  C CB  . GLN A 1 20  ? 11.570  5.770   15.405  1.00 20.15 ? 19  GLN A CB  1 
ATOM   127  C CG  . GLN A 1 20  ? 12.980  5.311   15.511  1.00 22.03 ? 19  GLN A CG  1 
ATOM   128  C CD  . GLN A 1 20  ? 13.319  4.701   16.882  1.00 24.56 ? 19  GLN A CD  1 
ATOM   129  O OE1 . GLN A 1 20  ? 13.170  5.359   17.946  1.00 15.60 ? 19  GLN A OE1 1 
ATOM   130  N NE2 . GLN A 1 20  ? 13.789  3.416   16.855  1.00 19.60 ? 19  GLN A NE2 1 
ATOM   131  N N   . TYR A 1 21  ? 11.378  3.069   14.045  1.00 15.64 ? 20  TYR A N   1 
ATOM   132  C CA  . TYR A 1 21  ? 11.068  1.647   13.880  1.00 15.16 ? 20  TYR A CA  1 
ATOM   133  C C   . TYR A 1 21  ? 11.370  0.767   15.094  1.00 14.83 ? 20  TYR A C   1 
ATOM   134  O O   . TYR A 1 21  ? 12.147  1.143   15.953  1.00 14.12 ? 20  TYR A O   1 
ATOM   135  C CB  . TYR A 1 21  ? 11.830  1.105   12.662  1.00 14.87 ? 20  TYR A CB  1 
ATOM   136  C CG  . TYR A 1 21  ? 11.653  1.988   11.459  1.00 20.19 ? 20  TYR A CG  1 
ATOM   137  C CD1 . TYR A 1 21  ? 12.533  3.053   11.222  1.00 21.65 ? 20  TYR A CD1 1 
ATOM   138  C CD2 . TYR A 1 21  ? 10.549  1.835   10.618  1.00 19.99 ? 20  TYR A CD2 1 
ATOM   139  C CE1 . TYR A 1 21  ? 12.314  3.952   10.175  1.00 22.91 ? 20  TYR A CE1 1 
ATOM   140  C CE2 . TYR A 1 21  ? 10.322  2.731   9.559   1.00 22.63 ? 20  TYR A CE2 1 
ATOM   141  C CZ  . TYR A 1 21  ? 11.213  3.781   9.346   1.00 24.08 ? 20  TYR A CZ  1 
ATOM   142  O OH  . TYR A 1 21  ? 11.045  4.620   8.263   1.00 24.42 ? 20  TYR A OH  1 
ATOM   143  N N   . VAL A 1 22  ? 10.726  -0.399  15.161  1.00 12.95 ? 21  VAL A N   1 
ATOM   144  C CA  . VAL A 1 22  ? 10.948  -1.304  16.278  1.00 12.92 ? 21  VAL A CA  1 
ATOM   145  C C   . VAL A 1 22  ? 10.468  -2.690  15.863  1.00 13.48 ? 21  VAL A C   1 
ATOM   146  O O   . VAL A 1 22  ? 9.607   -2.804  15.002  1.00 11.69 ? 21  VAL A O   1 
ATOM   147  C CB  . VAL A 1 22  ? 10.160  -0.854  17.527  1.00 13.66 ? 21  VAL A CB  1 
ATOM   148  C CG1 . VAL A 1 22  ? 8.656   -1.040  17.314  1.00 16.51 ? 21  VAL A CG1 1 
ATOM   149  C CG2 . VAL A 1 22  ? 10.647  -1.618  18.764  1.00 15.08 ? 21  VAL A CG2 1 
ATOM   150  N N   . MET A 1 23  ? 11.082  -3.728  16.431  1.00 12.31 ? 22  MET A N   1 
ATOM   151  C CA  . MET A 1 23  ? 10.665  -5.104  16.153  1.00 11.98 ? 22  MET A CA  1 
ATOM   152  C C   . MET A 1 23  ? 9.551   -5.457  17.146  1.00 13.10 ? 22  MET A C   1 
ATOM   153  O O   . MET A 1 23  ? 9.683   -5.188  18.355  1.00 12.70 ? 22  MET A O   1 
ATOM   154  C CB  . MET A 1 23  ? 11.827  -6.092  16.371  1.00 11.65 ? 22  MET A CB  1 
ATOM   155  C CG  . MET A 1 23  ? 13.059  -5.882  15.504  1.00 12.47 ? 22  MET A CG  1 
ATOM   156  S SD  . MET A 1 23  ? 12.705  -6.025  13.724  1.00 12.40 ? 22  MET A SD  1 
ATOM   157  C CE  . MET A 1 23  ? 12.132  -7.839  13.551  1.00 14.45 ? 22  MET A CE  1 
ATOM   158  N N   . ILE A 1 24  ? 8.456   -6.054  16.655  1.00 12.17 ? 23  ILE A N   1 
ATOM   159  C CA  . ILE A 1 24  ? 7.375   -6.465  17.553  1.00 11.87 ? 23  ILE A CA  1 
ATOM   160  C C   . ILE A 1 24  ? 6.988   -7.860  17.102  1.00 12.50 ? 23  ILE A C   1 
ATOM   161  O O   . ILE A 1 24  ? 6.605   -8.057  15.960  1.00 11.76 ? 23  ILE A O   1 
ATOM   162  C CB  . ILE A 1 24  ? 6.134   -5.568  17.487  1.00 10.17 ? 23  ILE A CB  1 
ATOM   163  C CG1 . ILE A 1 24  ? 6.526   -4.090  17.653  1.00 11.60 ? 23  ILE A CG1 1 
ATOM   164  C CG2 . ILE A 1 24  ? 5.174   -5.940  18.641  1.00 11.17 ? 23  ILE A CG2 1 
ATOM   165  C CD1 . ILE A 1 24  ? 5.313   -3.144  17.741  1.00 13.18 ? 23  ILE A CD1 1 
ATOM   166  N N   . ASP A 1 25  ? 7.106   -8.823  18.000  1.00 13.01 ? 24  ASP A N   1 
ATOM   167  C CA  . ASP A 1 25  ? 6.769   -10.217 17.683  1.00 14.28 ? 24  ASP A CA  1 
ATOM   168  C C   . ASP A 1 25  ? 7.435   -10.670 16.375  1.00 13.54 ? 24  ASP A C   1 
ATOM   169  O O   . ASP A 1 25  ? 6.816   -11.344 15.527  1.00 14.71 ? 24  ASP A O   1 
ATOM   170  C CB  . ASP A 1 25  ? 5.245   -10.412 17.617  1.00 15.51 ? 24  ASP A CB  1 
ATOM   171  C CG  . ASP A 1 25  ? 4.532   -9.958  18.894  1.00 13.79 ? 24  ASP A CG  1 
ATOM   172  O OD1 . ASP A 1 25  ? 5.104   -10.120 19.978  1.00 15.41 ? 24  ASP A OD1 1 
ATOM   173  O OD2 . ASP A 1 25  ? 3.386   -9.469  18.814  1.00 16.36 ? 24  ASP A OD2 1 
ATOM   174  N N   . GLY A 1 26  ? 8.704   -10.301 16.248  1.00 13.81 ? 25  GLY A N   1 
ATOM   175  C CA  . GLY A 1 26  ? 9.530   -10.669 15.107  1.00 15.23 ? 25  GLY A CA  1 
ATOM   176  C C   . GLY A 1 26  ? 9.249   -9.938  13.814  1.00 14.11 ? 25  GLY A C   1 
ATOM   177  O O   . GLY A 1 26  ? 9.817   -10.281 12.780  1.00 16.21 ? 25  GLY A O   1 
ATOM   178  N N   . VAL A 1 27  ? 8.369   -8.944  13.850  1.00 13.31 ? 26  VAL A N   1 
ATOM   179  C CA  . VAL A 1 27  ? 8.047   -8.217  12.628  1.00 14.01 ? 26  VAL A CA  1 
ATOM   180  C C   . VAL A 1 27  ? 8.594   -6.789  12.717  1.00 13.21 ? 26  VAL A C   1 
ATOM   181  O O   . VAL A 1 27  ? 8.363   -6.100  13.709  1.00 13.72 ? 26  VAL A O   1 
ATOM   182  C CB  . VAL A 1 27  ? 6.513   -8.174  12.418  1.00 13.78 ? 26  VAL A CB  1 
ATOM   183  C CG1 . VAL A 1 27  ? 6.153   -7.400  11.145  1.00 14.21 ? 26  VAL A CG1 1 
ATOM   184  C CG2 . VAL A 1 27  ? 5.970   -9.597  12.334  1.00 16.79 ? 26  VAL A CG2 1 
ATOM   185  N N   . PRO A 1 28  ? 9.301   -6.332  11.676  1.00 13.66 ? 27  PRO A N   1 
ATOM   186  C CA  . PRO A 1 28  ? 9.851   -4.972  11.702  1.00 12.93 ? 27  PRO A CA  1 
ATOM   187  C C   . PRO A 1 28  ? 8.693   -4.007  11.483  1.00 12.21 ? 27  PRO A C   1 
ATOM   188  O O   . PRO A 1 28  ? 7.952   -4.135  10.498  1.00 12.80 ? 27  PRO A O   1 
ATOM   189  C CB  . PRO A 1 28  ? 10.868  -4.996  10.550  1.00 12.21 ? 27  PRO A CB  1 
ATOM   190  C CG  . PRO A 1 28  ? 10.169  -5.864  9.560   1.00 13.91 ? 27  PRO A CG  1 
ATOM   191  C CD  . PRO A 1 28  ? 9.655   -7.017  10.415  1.00 12.89 ? 27  PRO A CD  1 
ATOM   192  N N   . CYS A 1 29  ? 8.536   -3.039  12.393  1.00 12.48 ? 28  CYS A N   1 
ATOM   193  C CA  . CYS A 1 29  ? 7.417   -2.103  12.328  1.00 12.56 ? 28  CYS A CA  1 
ATOM   194  C C   . CYS A 1 29  ? 7.818   -0.653  12.424  1.00 13.71 ? 28  CYS A C   1 
ATOM   195  O O   . CYS A 1 29  ? 8.913   -0.328  12.886  1.00 13.89 ? 28  CYS A O   1 
ATOM   196  C CB  . CYS A 1 29  ? 6.441   -2.347  13.492  1.00 11.87 ? 28  CYS A CB  1 
ATOM   197  S SG  . CYS A 1 29  ? 5.592   -3.983  13.555  1.00 14.63 ? 28  CYS A SG  1 
ATOM   198  N N   . GLU A 1 30  ? 6.899   0.199   11.987  1.00 13.29 ? 29  GLU A N   1 
ATOM   199  C CA  . GLU A 1 30  ? 7.052   1.646   12.107  1.00 14.15 ? 29  GLU A CA  1 
ATOM   200  C C   . GLU A 1 30  ? 6.109   1.990   13.263  1.00 12.45 ? 29  GLU A C   1 
ATOM   201  O O   . GLU A 1 30  ? 4.943   1.565   13.287  1.00 14.26 ? 29  GLU A O   1 
ATOM   202  C CB  . GLU A 1 30  ? 6.609   2.392   10.829  1.00 15.95 ? 29  GLU A CB  1 
ATOM   203  C CG  . GLU A 1 30  ? 6.489   3.913   11.096  1.00 19.32 ? 29  GLU A CG  1 
ATOM   204  C CD  . GLU A 1 30  ? 6.133   4.736   9.879   1.00 23.73 ? 29  GLU A CD  1 
ATOM   205  O OE1 . GLU A 1 30  ? 5.649   5.878   10.071  1.00 25.14 ? 29  GLU A OE1 1 
ATOM   206  O OE2 . GLU A 1 30  ? 6.363   4.273   8.743   1.00 23.30 ? 29  GLU A OE2 1 
ATOM   207  N N   . ILE A 1 31  ? 6.614   2.740   14.238  1.00 13.31 ? 30  ILE A N   1 
ATOM   208  C CA  . ILE A 1 31  ? 5.798   3.095   15.377  1.00 13.04 ? 30  ILE A CA  1 
ATOM   209  C C   . ILE A 1 31  ? 4.770   4.159   15.002  1.00 13.60 ? 30  ILE A C   1 
ATOM   210  O O   . ILE A 1 31  ? 5.107   5.220   14.420  1.00 12.01 ? 30  ILE A O   1 
ATOM   211  C CB  . ILE A 1 31  ? 6.668   3.571   16.553  1.00 13.42 ? 30  ILE A CB  1 
ATOM   212  C CG1 . ILE A 1 31  ? 7.584   2.422   16.994  1.00 13.68 ? 30  ILE A CG1 1 
ATOM   213  C CG2 . ILE A 1 31  ? 5.792   4.080   17.697  1.00 13.59 ? 30  ILE A CG2 1 
ATOM   214  C CD1 . ILE A 1 31  ? 8.646   2.829   18.043  1.00 15.57 ? 30  ILE A CD1 1 
ATOM   215  N N   . VAL A 1 32  ? 3.519   3.870   15.330  1.00 14.14 ? 31  VAL A N   1 
ATOM   216  C CA  . VAL A 1 32  ? 2.443   4.802   15.015  1.00 16.17 ? 31  VAL A CA  1 
ATOM   217  C C   . VAL A 1 32  ? 1.895   5.434   16.263  1.00 17.54 ? 31  VAL A C   1 
ATOM   218  O O   . VAL A 1 32  ? 1.324   6.535   16.203  1.00 18.37 ? 31  VAL A O   1 
ATOM   219  C CB  . VAL A 1 32  ? 1.292   4.121   14.205  1.00 16.59 ? 31  VAL A CB  1 
ATOM   220  C CG1 . VAL A 1 32  ? 1.840   3.562   12.928  1.00 18.29 ? 31  VAL A CG1 1 
ATOM   221  C CG2 . VAL A 1 32  ? 0.625   3.015   14.995  1.00 17.85 ? 31  VAL A CG2 1 
ATOM   222  N N   . ASP A 1 33  ? 2.077   4.779   17.406  1.00 15.61 ? 32  ASP A N   1 
ATOM   223  C CA  . ASP A 1 33  ? 1.550   5.351   18.629  1.00 17.05 ? 32  ASP A CA  1 
ATOM   224  C C   . ASP A 1 33  ? 2.305   4.870   19.861  1.00 16.42 ? 32  ASP A C   1 
ATOM   225  O O   . ASP A 1 33  ? 2.695   3.699   19.946  1.00 13.89 ? 32  ASP A O   1 
ATOM   226  C CB  . ASP A 1 33  ? 0.057   5.007   18.738  1.00 20.12 ? 32  ASP A CB  1 
ATOM   227  C CG  . ASP A 1 33  ? -0.652  5.801   19.800  1.00 25.20 ? 32  ASP A CG  1 
ATOM   228  O OD1 . ASP A 1 33  ? -0.531  5.485   21.009  1.00 25.77 ? 32  ASP A OD1 1 
ATOM   229  O OD2 . ASP A 1 33  ? -1.339  6.770   19.414  1.00 26.73 ? 32  ASP A OD2 1 
ATOM   230  N N   . ILE A 1 34  ? 2.530   5.785   20.795  1.00 14.74 ? 33  ILE A N   1 
ATOM   231  C CA  . ILE A 1 34  ? 3.212   5.462   22.056  1.00 14.79 ? 33  ILE A CA  1 
ATOM   232  C C   . ILE A 1 34  ? 2.432   6.119   23.205  1.00 15.50 ? 33  ILE A C   1 
ATOM   233  O O   . ILE A 1 34  ? 2.095   7.301   23.143  1.00 12.63 ? 33  ILE A O   1 
ATOM   234  C CB  . ILE A 1 34  ? 4.668   5.981   22.086  1.00 13.02 ? 33  ILE A CB  1 
ATOM   235  C CG1 . ILE A 1 34  ? 5.461   5.361   20.934  1.00 13.23 ? 33  ILE A CG1 1 
ATOM   236  C CG2 . ILE A 1 34  ? 5.329   5.644   23.455  1.00 10.96 ? 33  ILE A CG2 1 
ATOM   237  C CD1 . ILE A 1 34  ? 6.887   5.882   20.790  1.00 13.51 ? 33  ILE A CD1 1 
ATOM   238  N N   . SER A 1 35  ? 2.126   5.317   24.225  1.00 16.96 ? 34  SER A N   1 
ATOM   239  C CA  . SER A 1 35  ? 1.429   5.756   25.445  1.00 19.31 ? 34  SER A CA  1 
ATOM   240  C C   . SER A 1 35  ? 2.358   5.351   26.593  1.00 18.17 ? 34  SER A C   1 
ATOM   241  O O   . SER A 1 35  ? 2.857   4.225   26.594  1.00 18.15 ? 34  SER A O   1 
ATOM   242  C CB  . SER A 1 35  ? 0.119   4.997   25.625  1.00 21.01 ? 34  SER A CB  1 
ATOM   243  O OG  . SER A 1 35  ? -0.708  5.128   24.488  1.00 28.76 ? 34  SER A OG  1 
ATOM   244  N N   . VAL A 1 36  ? 2.592   6.242   27.553  1.00 17.34 ? 35  VAL A N   1 
ATOM   245  C CA  . VAL A 1 36  ? 3.472   5.949   28.695  1.00 17.83 ? 35  VAL A CA  1 
ATOM   246  C C   . VAL A 1 36  ? 2.675   6.200   29.977  1.00 20.93 ? 35  VAL A C   1 
ATOM   247  O O   . VAL A 1 36  ? 2.026   7.234   30.123  1.00 18.17 ? 35  VAL A O   1 
ATOM   248  C CB  . VAL A 1 36  ? 4.728   6.842   28.667  1.00 19.56 ? 35  VAL A CB  1 
ATOM   249  C CG1 . VAL A 1 36  ? 5.618   6.568   29.900  1.00 18.16 ? 35  VAL A CG1 1 
ATOM   250  C CG2 . VAL A 1 36  ? 5.511   6.571   27.364  1.00 19.84 ? 35  VAL A CG2 1 
ATOM   251  N N   . SER A 1 37  ? 2.713   5.248   30.903  1.00 22.01 ? 36  SER A N   1 
ATOM   252  C CA  . SER A 1 37  ? 1.944   5.366   32.143  1.00 23.55 ? 36  SER A CA  1 
ATOM   253  C C   . SER A 1 37  ? 2.613   6.212   33.222  1.00 25.91 ? 36  SER A C   1 
ATOM   254  O O   . SER A 1 37  ? 3.796   6.521   33.144  1.00 24.68 ? 36  SER A O   1 
ATOM   255  C CB  . SER A 1 37  ? 1.688   3.970   32.716  1.00 22.64 ? 36  SER A CB  1 
ATOM   256  O OG  . SER A 1 37  ? 2.911   3.417   33.166  1.00 25.19 ? 36  SER A OG  1 
ATOM   257  N N   . LYS A 1 38  ? 1.836   6.568   34.244  1.00 29.39 ? 37  LYS A N   1 
ATOM   258  C CA  . LYS A 1 38  ? 2.364   7.339   35.354  1.00 34.05 ? 37  LYS A CA  1 
ATOM   259  C C   . LYS A 1 38  ? 3.342   6.396   36.044  1.00 36.50 ? 37  LYS A C   1 
ATOM   260  O O   . LYS A 1 38  ? 3.207   5.175   35.939  1.00 34.59 ? 37  LYS A O   1 
ATOM   261  C CB  . LYS A 1 38  ? 1.237   7.731   36.322  1.00 35.80 ? 37  LYS A CB  1 
ATOM   262  C CG  . LYS A 1 38  ? 0.563   6.560   37.024  1.00 37.13 ? 37  LYS A CG  1 
ATOM   263  C CD  . LYS A 1 38  ? -0.485  7.052   38.026  1.00 39.44 ? 37  LYS A CD  1 
ATOM   264  C CE  . LYS A 1 38  ? -1.176  5.895   38.746  1.00 40.00 ? 37  LYS A CE  1 
ATOM   265  N NZ  . LYS A 1 38  ? -2.225  6.364   39.711  1.00 40.88 ? 37  LYS A NZ  1 
ATOM   266  N N   . PRO A 1 39  ? 4.350   6.942   36.739  1.00 39.74 ? 38  PRO A N   1 
ATOM   267  C CA  . PRO A 1 39  ? 5.300   6.063   37.411  1.00 41.45 ? 38  PRO A CA  1 
ATOM   268  C C   . PRO A 1 39  ? 4.562   5.139   38.365  1.00 43.87 ? 38  PRO A C   1 
ATOM   269  O O   . PRO A 1 39  ? 3.727   5.576   39.164  1.00 43.96 ? 38  PRO A O   1 
ATOM   270  C CB  . PRO A 1 39  ? 6.229   7.048   38.111  1.00 41.99 ? 38  PRO A CB  1 
ATOM   271  C CG  . PRO A 1 39  ? 5.326   8.245   38.355  1.00 42.10 ? 38  PRO A CG  1 
ATOM   272  C CD  . PRO A 1 39  ? 4.712   8.348   36.982  1.00 41.51 ? 38  PRO A CD  1 
ATOM   273  N N   . GLY A 1 40  ? 4.862   3.853   38.244  1.00 46.03 ? 39  GLY A N   1 
ATOM   274  C CA  . GLY A 1 40  ? 4.237   2.834   39.062  1.00 48.83 ? 39  GLY A CA  1 
ATOM   275  C C   . GLY A 1 40  ? 3.915   3.233   40.477  1.00 50.12 ? 39  GLY A C   1 
ATOM   276  O O   . GLY A 1 40  ? 2.755   3.500   40.818  1.00 51.44 ? 39  GLY A O   1 
ATOM   277  N N   . LYS A 1 41  ? 4.956   3.280   41.296  1.00 51.08 ? 40  LYS A N   1 
ATOM   278  C CA  . LYS A 1 41  ? 4.841   3.608   42.707  1.00 52.12 ? 40  LYS A CA  1 
ATOM   279  C C   . LYS A 1 41  ? 6.250   3.426   43.243  1.00 52.49 ? 40  LYS A C   1 
ATOM   280  O O   . LYS A 1 41  ? 6.538   3.660   44.417  1.00 52.96 ? 40  LYS A O   1 
ATOM   281  C CB  . LYS A 1 41  ? 3.857   2.630   43.368  1.00 52.51 ? 40  LYS A CB  1 
ATOM   282  C CG  . LYS A 1 41  ? 4.028   1.178   42.896  1.00 52.55 ? 40  LYS A CG  1 
ATOM   283  C CD  . LYS A 1 41  ? 2.897   0.242   43.348  1.00 53.54 ? 40  LYS A CD  1 
ATOM   284  C CE  . LYS A 1 41  ? 2.846   0.026   44.863  1.00 53.91 ? 40  LYS A CE  1 
ATOM   285  N NZ  . LYS A 1 41  ? 2.529   1.256   45.653  1.00 54.28 ? 40  LYS A NZ  1 
ATOM   286  N N   . HIS A 1 42  ? 7.129   3.013   42.335  1.00 52.50 ? 41  HIS A N   1 
ATOM   287  C CA  . HIS A 1 42  ? 8.526   2.774   42.644  1.00 51.67 ? 41  HIS A CA  1 
ATOM   288  C C   . HIS A 1 42  ? 9.351   3.562   41.619  1.00 50.49 ? 41  HIS A C   1 
ATOM   289  O O   . HIS A 1 42  ? 10.582  3.603   41.671  1.00 51.01 ? 41  HIS A O   1 
ATOM   290  C CB  . HIS A 1 42  ? 8.803   1.276   42.532  1.00 52.78 ? 41  HIS A CB  1 
ATOM   291  C CG  . HIS A 1 42  ? 7.720   0.423   43.123  1.00 54.01 ? 41  HIS A CG  1 
ATOM   292  N ND1 . HIS A 1 42  ? 7.292   0.555   44.428  1.00 55.07 ? 41  HIS A ND1 1 
ATOM   293  C CD2 . HIS A 1 42  ? 6.972   -0.570  42.583  1.00 54.24 ? 41  HIS A CD2 1 
ATOM   294  C CE1 . HIS A 1 42  ? 6.329   -0.318  44.666  1.00 54.83 ? 41  HIS A CE1 1 
ATOM   295  N NE2 . HIS A 1 42  ? 6.116   -1.014  43.563  1.00 54.80 ? 41  HIS A NE2 1 
ATOM   296  N N   . GLY A 1 43  ? 8.648   4.197   40.690  1.00 48.52 ? 42  GLY A N   1 
ATOM   297  C CA  . GLY A 1 43  ? 9.311   4.971   39.661  1.00 46.41 ? 42  GLY A CA  1 
ATOM   298  C C   . GLY A 1 43  ? 9.174   4.362   38.277  1.00 43.95 ? 42  GLY A C   1 
ATOM   299  O O   . GLY A 1 43  ? 9.319   5.060   37.270  1.00 44.78 ? 42  GLY A O   1 
ATOM   300  N N   . GLY A 1 44  ? 8.878   3.065   38.225  1.00 42.25 ? 43  GLY A N   1 
ATOM   301  C CA  . GLY A 1 44  ? 8.740   2.378   36.948  1.00 38.29 ? 43  GLY A CA  1 
ATOM   302  C C   . GLY A 1 44  ? 7.516   2.803   36.158  1.00 36.00 ? 43  GLY A C   1 
ATOM   303  O O   . GLY A 1 44  ? 6.481   3.119   36.734  1.00 36.95 ? 43  GLY A O   1 
ATOM   304  N N   . ALA A 1 45  ? 7.636   2.821   34.837  1.00 31.39 ? 44  ALA A N   1 
ATOM   305  C CA  . ALA A 1 45  ? 6.531   3.205   33.981  1.00 28.24 ? 44  ALA A CA  1 
ATOM   306  C C   . ALA A 1 45  ? 6.463   2.213   32.834  1.00 25.65 ? 44  ALA A C   1 
ATOM   307  O O   . ALA A 1 45  ? 7.478   1.710   32.394  1.00 25.51 ? 44  ALA A O   1 
ATOM   308  C CB  . ALA A 1 45  ? 6.748   4.622   33.429  1.00 29.24 ? 44  ALA A CB  1 
ATOM   309  N N   . LYS A 1 46  ? 5.255   1.929   32.378  1.00 25.77 ? 45  LYS A N   1 
ATOM   310  C CA  . LYS A 1 46  ? 5.026   1.024   31.258  1.00 24.40 ? 45  LYS A CA  1 
ATOM   311  C C   . LYS A 1 46  ? 4.734   1.888   30.032  1.00 22.59 ? 45  LYS A C   1 
ATOM   312  O O   . LYS A 1 46  ? 4.252   3.009   30.173  1.00 21.46 ? 45  LYS A O   1 
ATOM   313  C CB  . LYS A 1 46  ? 3.794   0.148   31.526  1.00 27.61 ? 45  LYS A CB  1 
ATOM   314  C CG  . LYS A 1 46  ? 3.967   -1.004  32.512  1.00 30.78 ? 45  LYS A CG  1 
ATOM   315  C CD  . LYS A 1 46  ? 4.757   -2.119  31.844  1.00 35.26 ? 45  LYS A CD  1 
ATOM   316  C CE  . LYS A 1 46  ? 4.608   -3.450  32.574  1.00 36.97 ? 45  LYS A CE  1 
ATOM   317  N NZ  . LYS A 1 46  ? 5.240   -4.570  31.808  1.00 37.35 ? 45  LYS A NZ  1 
ATOM   318  N N   . ALA A 1 47  ? 5.060   1.375   28.852  1.00 19.66 ? 46  ALA A N   1 
ATOM   319  C CA  . ALA A 1 47  ? 4.752   2.065   27.605  1.00 17.97 ? 46  ALA A CA  1 
ATOM   320  C C   . ALA A 1 47  ? 3.984   1.069   26.746  1.00 17.89 ? 46  ALA A C   1 
ATOM   321  O O   . ALA A 1 47  ? 4.264   -0.127  26.776  1.00 18.01 ? 46  ALA A O   1 
ATOM   322  C CB  . ALA A 1 47  ? 6.018   2.486   26.874  1.00 17.66 ? 46  ALA A CB  1 
ATOM   323  N N   . ARG A 1 48  ? 2.985   1.552   26.022  1.00 16.32 ? 47  ARG A N   1 
ATOM   324  C CA  . ARG A 1 48  ? 2.270   0.705   25.102  1.00 16.44 ? 47  ARG A CA  1 
ATOM   325  C C   . ARG A 1 48  ? 2.739   1.244   23.762  1.00 17.12 ? 47  ARG A C   1 
ATOM   326  O O   . ARG A 1 48  ? 2.617   2.448   23.483  1.00 16.69 ? 47  ARG A O   1 
ATOM   327  C CB  . ARG A 1 48  ? 0.756   0.859   25.194  1.00 18.73 ? 47  ARG A CB  1 
ATOM   328  C CG  . ARG A 1 48  ? 0.054   -0.081  24.228  1.00 21.77 ? 47  ARG A CG  1 
ATOM   329  C CD  . ARG A 1 48  ? -1.432  0.094   24.250  1.00 26.60 ? 47  ARG A CD  1 
ATOM   330  N NE  . ARG A 1 48  ? -1.776  1.502   24.072  1.00 30.03 ? 47  ARG A NE  1 
ATOM   331  C CZ  . ARG A 1 48  ? -3.019  1.963   23.978  1.00 30.24 ? 47  ARG A CZ  1 
ATOM   332  N NH1 . ARG A 1 48  ? -4.038  1.124   24.038  1.00 30.71 ? 47  ARG A NH1 1 
ATOM   333  N NH2 . ARG A 1 48  ? -3.241  3.264   23.874  1.00 30.51 ? 47  ARG A NH2 1 
ATOM   334  N N   . VAL A 1 49  ? 3.303   0.357   22.955  1.00 15.31 ? 48  VAL A N   1 
ATOM   335  C CA  . VAL A 1 49  ? 3.797   0.736   21.650  1.00 15.52 ? 48  VAL A CA  1 
ATOM   336  C C   . VAL A 1 49  ? 3.030   -0.005  20.571  1.00 16.44 ? 48  VAL A C   1 
ATOM   337  O O   . VAL A 1 49  ? 2.932   -1.232  20.584  1.00 17.32 ? 48  VAL A O   1 
ATOM   338  C CB  . VAL A 1 49  ? 5.311   0.437   21.556  1.00 14.23 ? 48  VAL A CB  1 
ATOM   339  C CG1 . VAL A 1 49  ? 5.851   0.771   20.168  1.00 13.94 ? 48  VAL A CG1 1 
ATOM   340  C CG2 . VAL A 1 49  ? 6.040   1.238   22.644  1.00 13.70 ? 48  VAL A CG2 1 
ATOM   341  N N   . VAL A 1 50  ? 2.466   0.764   19.654  1.00 14.90 ? 49  VAL A N   1 
ATOM   342  C CA  . VAL A 1 50  ? 1.692   0.237   18.549  1.00 14.12 ? 49  VAL A CA  1 
ATOM   343  C C   . VAL A 1 50  ? 2.411   0.524   17.243  1.00 15.03 ? 49  VAL A C   1 
ATOM   344  O O   . VAL A 1 50  ? 2.838   1.667   16.989  1.00 15.51 ? 49  VAL A O   1 
ATOM   345  C CB  . VAL A 1 50  ? 0.298   0.893   18.515  1.00 12.68 ? 49  VAL A CB  1 
ATOM   346  C CG1 . VAL A 1 50  ? -0.557  0.304   17.337  1.00 13.12 ? 49  VAL A CG1 1 
ATOM   347  C CG2 . VAL A 1 50  ? -0.393  0.668   19.829  1.00 14.75 ? 49  VAL A CG2 1 
ATOM   348  N N   . GLY A 1 51  ? 2.553   -0.508  16.414  1.00 14.89 ? 50  GLY A N   1 
ATOM   349  C CA  . GLY A 1 51  ? 3.235   -0.322  15.154  1.00 12.76 ? 50  GLY A CA  1 
ATOM   350  C C   . GLY A 1 51  ? 2.510   -0.942  13.979  1.00 14.35 ? 50  GLY A C   1 
ATOM   351  O O   . GLY A 1 51  ? 1.566   -1.714  14.167  1.00 14.46 ? 50  GLY A O   1 
ATOM   352  N N   . ILE A 1 52  ? 2.933   -0.546  12.784  1.00 13.90 ? 51  ILE A N   1 
ATOM   353  C CA  . ILE A 1 52  ? 2.413   -1.096  11.539  1.00 15.18 ? 51  ILE A CA  1 
ATOM   354  C C   . ILE A 1 52  ? 3.608   -1.712  10.830  1.00 13.75 ? 51  ILE A C   1 
ATOM   355  O O   . ILE A 1 52  ? 4.690   -1.123  10.781  1.00 11.98 ? 51  ILE A O   1 
ATOM   356  C CB  . ILE A 1 52  ? 1.780   -0.011  10.642  1.00 17.37 ? 51  ILE A CB  1 
ATOM   357  C CG1 . ILE A 1 52  ? 0.590   0.580   11.375  1.00 20.51 ? 51  ILE A CG1 1 
ATOM   358  C CG2 . ILE A 1 52  ? 1.272   -0.636  9.306   1.00 17.72 ? 51  ILE A CG2 1 
ATOM   359  C CD1 . ILE A 1 52  ? -0.422  -0.469  11.744  1.00 23.28 ? 51  ILE A CD1 1 
ATOM   360  N N   . GLY A 1 53  ? 3.430   -2.906  10.268  1.00 12.76 ? 52  GLY A N   1 
ATOM   361  C CA  . GLY A 1 53  ? 4.548   -3.511  9.577   1.00 13.01 ? 52  GLY A CA  1 
ATOM   362  C C   . GLY A 1 53  ? 5.154   -2.591  8.539   1.00 14.96 ? 52  GLY A C   1 
ATOM   363  O O   . GLY A 1 53  ? 4.440   -1.887  7.835   1.00 15.67 ? 52  GLY A O   1 
ATOM   364  N N   . ILE A 1 54  ? 6.473   -2.595  8.440   1.00 13.97 ? 53  ILE A N   1 
ATOM   365  C CA  . ILE A 1 54  ? 7.160   -1.800  7.444   1.00 15.74 ? 53  ILE A CA  1 
ATOM   366  C C   . ILE A 1 54  ? 6.853   -2.399  6.080   1.00 16.25 ? 53  ILE A C   1 
ATOM   367  O O   . ILE A 1 54  ? 6.518   -1.678  5.121   1.00 18.34 ? 53  ILE A O   1 
ATOM   368  C CB  . ILE A 1 54  ? 8.709   -1.854  7.644   1.00 16.22 ? 53  ILE A CB  1 
ATOM   369  C CG1 . ILE A 1 54  ? 9.097   -1.163  8.967   1.00 18.83 ? 53  ILE A CG1 1 
ATOM   370  C CG2 . ILE A 1 54  ? 9.416   -1.218  6.446   1.00 15.61 ? 53  ILE A CG2 1 
ATOM   371  C CD1 . ILE A 1 54  ? 10.586  -1.309  9.322   1.00 20.01 ? 53  ILE A CD1 1 
ATOM   372  N N   . PHE A 1 55  ? 6.945   -3.728  6.018   1.00 18.43 ? 54  PHE A N   1 
ATOM   373  C CA  . PHE A 1 55  ? 6.778   -4.491  4.768   1.00 18.31 ? 54  PHE A CA  1 
ATOM   374  C C   . PHE A 1 55  ? 5.492   -5.248  4.555   1.00 19.55 ? 54  PHE A C   1 
ATOM   375  O O   . PHE A 1 55  ? 5.267   -5.799  3.460   1.00 19.93 ? 54  PHE A O   1 
ATOM   376  C CB  . PHE A 1 55  ? 7.919   -5.487  4.623   1.00 14.52 ? 54  PHE A CB  1 
ATOM   377  C CG  . PHE A 1 55  ? 9.270   -4.863  4.759   1.00 16.73 ? 54  PHE A CG  1 
ATOM   378  C CD1 . PHE A 1 55  ? 9.975   -4.958  5.957   1.00 15.67 ? 54  PHE A CD1 1 
ATOM   379  C CD2 . PHE A 1 55  ? 9.833   -4.151  3.692   1.00 16.07 ? 54  PHE A CD2 1 
ATOM   380  C CE1 . PHE A 1 55  ? 11.244  -4.340  6.083   1.00 17.47 ? 54  PHE A CE1 1 
ATOM   381  C CE2 . PHE A 1 55  ? 11.085  -3.535  3.812   1.00 17.61 ? 54  PHE A CE2 1 
ATOM   382  C CZ  . PHE A 1 55  ? 11.792  -3.626  4.993   1.00 17.60 ? 54  PHE A CZ  1 
ATOM   383  N N   . GLU A 1 56  ? 4.670   -5.295  5.593   1.00 19.74 ? 55  GLU A N   1 
ATOM   384  C CA  . GLU A 1 56  ? 3.400   -6.004  5.566   1.00 23.09 ? 55  GLU A CA  1 
ATOM   385  C C   . GLU A 1 56  ? 2.387   -5.126  6.275   1.00 22.97 ? 55  GLU A C   1 
ATOM   386  O O   . GLU A 1 56  ? 2.696   -4.538  7.307   1.00 22.36 ? 55  GLU A O   1 
ATOM   387  C CB  . GLU A 1 56  ? 3.553   -7.322  6.323   1.00 26.18 ? 55  GLU A CB  1 
ATOM   388  C CG  . GLU A 1 56  ? 2.275   -8.100  6.553   1.00 31.22 ? 55  GLU A CG  1 
ATOM   389  C CD  . GLU A 1 56  ? 2.517   -9.342  7.413   1.00 32.71 ? 55  GLU A CD  1 
ATOM   390  O OE1 . GLU A 1 56  ? 1.539   -10.057 7.733   1.00 34.24 ? 55  GLU A OE1 1 
ATOM   391  O OE2 . GLU A 1 56  ? 3.693   -9.596  7.773   1.00 34.78 ? 55  GLU A OE2 1 
ATOM   392  N N   . LYS A 1 57  ? 1.177   -5.045  5.738   1.00 23.44 ? 56  LYS A N   1 
ATOM   393  C CA  . LYS A 1 57  ? 0.166   -4.217  6.367   1.00 23.58 ? 56  LYS A CA  1 
ATOM   394  C C   . LYS A 1 57  ? -0.458  -4.932  7.557   1.00 21.92 ? 56  LYS A C   1 
ATOM   395  O O   . LYS A 1 57  ? -1.587  -5.410  7.496   1.00 22.07 ? 56  LYS A O   1 
ATOM   396  C CB  . LYS A 1 57  ? -0.887  -3.815  5.331   1.00 27.99 ? 56  LYS A CB  1 
ATOM   397  C CG  . LYS A 1 57  ? -0.523  -2.528  4.554   1.00 34.26 ? 56  LYS A CG  1 
ATOM   398  C CD  . LYS A 1 57  ? 0.862   -2.585  3.901   1.00 37.38 ? 56  LYS A CD  1 
ATOM   399  C CE  . LYS A 1 57  ? 0.978   -3.724  2.881   1.00 40.13 ? 56  LYS A CE  1 
ATOM   400  N NZ  . LYS A 1 57  ? 2.350   -3.820  2.266   1.00 38.78 ? 56  LYS A NZ  1 
ATOM   401  N N   . VAL A 1 58  ? 0.291   -5.018  8.647   1.00 19.02 ? 57  VAL A N   1 
ATOM   402  C CA  . VAL A 1 58  ? -0.201  -5.695  9.832   1.00 18.88 ? 57  VAL A CA  1 
ATOM   403  C C   . VAL A 1 58  ? 0.028   -4.814  11.049  1.00 18.72 ? 57  VAL A C   1 
ATOM   404  O O   . VAL A 1 58  ? 1.018   -4.089  11.109  1.00 19.15 ? 57  VAL A O   1 
ATOM   405  C CB  . VAL A 1 58  ? 0.541   -7.044  10.043  1.00 20.88 ? 57  VAL A CB  1 
ATOM   406  C CG1 . VAL A 1 58  ? 2.049   -6.807  10.221  1.00 21.27 ? 57  VAL A CG1 1 
ATOM   407  C CG2 . VAL A 1 58  ? -0.033  -7.767  11.252  1.00 22.15 ? 57  VAL A CG2 1 
ATOM   408  N N   . LYS A 1 59  ? -0.900  -4.855  11.994  1.00 17.36 ? 58  LYS A N   1 
ATOM   409  C CA  . LYS A 1 59  ? -0.758  -4.077  13.222  1.00 17.46 ? 58  LYS A CA  1 
ATOM   410  C C   . LYS A 1 59  ? -0.172  -4.983  14.309  1.00 17.88 ? 58  LYS A C   1 
ATOM   411  O O   . LYS A 1 59  ? -0.560  -6.155  14.434  1.00 15.63 ? 58  LYS A O   1 
ATOM   412  C CB  . LYS A 1 59  ? -2.116  -3.543  13.689  1.00 18.99 ? 58  LYS A CB  1 
ATOM   413  C CG  . LYS A 1 59  ? -2.110  -2.928  15.107  1.00 19.37 ? 58  LYS A CG  1 
ATOM   414  C CD  . LYS A 1 59  ? -3.536  -2.672  15.584  1.00 22.08 ? 58  LYS A CD  1 
ATOM   415  C CE  . LYS A 1 59  ? -3.627  -2.156  17.017  1.00 24.73 ? 58  LYS A CE  1 
ATOM   416  N NZ  . LYS A 1 59  ? -5.056  -2.062  17.450  1.00 25.91 ? 58  LYS A NZ  1 
ATOM   417  N N   . LYS A 1 60  ? 0.765   -4.440  15.085  1.00 16.60 ? 59  LYS A N   1 
ATOM   418  C CA  . LYS A 1 60  ? 1.391   -5.172  16.176  1.00 15.56 ? 59  LYS A CA  1 
ATOM   419  C C   . LYS A 1 60  ? 1.520   -4.204  17.346  1.00 17.04 ? 59  LYS A C   1 
ATOM   420  O O   . LYS A 1 60  ? 1.573   -2.991  17.150  1.00 15.74 ? 59  LYS A O   1 
ATOM   421  C CB  . LYS A 1 60  ? 2.801   -5.656  15.793  1.00 16.98 ? 59  LYS A CB  1 
ATOM   422  C CG  . LYS A 1 60  ? 2.911   -6.682  14.683  1.00 18.43 ? 59  LYS A CG  1 
ATOM   423  C CD  . LYS A 1 60  ? 2.300   -8.021  15.092  1.00 17.97 ? 59  LYS A CD  1 
ATOM   424  C CE  . LYS A 1 60  ? 2.765   -9.149  14.168  1.00 17.16 ? 59  LYS A CE  1 
ATOM   425  N NZ  . LYS A 1 60  ? 2.197   -10.491 14.600  1.00 16.23 ? 59  LYS A NZ  1 
ATOM   426  N N   . GLU A 1 61  ? 1.556   -4.729  18.564  1.00 16.43 ? 60  GLU A N   1 
ATOM   427  C CA  . GLU A 1 61  ? 1.732   -3.853  19.714  1.00 18.27 ? 60  GLU A CA  1 
ATOM   428  C C   . GLU A 1 61  ? 2.324   -4.630  20.865  1.00 17.22 ? 60  GLU A C   1 
ATOM   429  O O   . GLU A 1 61  ? 2.263   -5.864  20.894  1.00 17.13 ? 60  GLU A O   1 
ATOM   430  C CB  . GLU A 1 61  ? 0.387   -3.242  20.146  1.00 20.61 ? 60  GLU A CB  1 
ATOM   431  C CG  . GLU A 1 61  ? -0.604  -4.229  20.733  1.00 26.66 ? 60  GLU A CG  1 
ATOM   432  C CD  . GLU A 1 61  ? -1.978  -3.621  20.961  1.00 30.50 ? 60  GLU A CD  1 
ATOM   433  O OE1 . GLU A 1 61  ? -2.066  -2.566  21.622  1.00 32.71 ? 60  GLU A OE1 1 
ATOM   434  O OE2 . GLU A 1 61  ? -2.976  -4.209  20.484  1.00 34.23 ? 60  GLU A OE2 1 
ATOM   435  N N   . PHE A 1 62  ? 2.926   -3.910  21.796  1.00 15.22 ? 61  PHE A N   1 
ATOM   436  C CA  . PHE A 1 62  ? 3.449   -4.525  23.003  1.00 15.39 ? 61  PHE A CA  1 
ATOM   437  C C   . PHE A 1 62  ? 3.350   -3.532  24.145  1.00 16.63 ? 61  PHE A C   1 
ATOM   438  O O   . PHE A 1 62  ? 3.183   -2.311  23.928  1.00 14.21 ? 61  PHE A O   1 
ATOM   439  C CB  . PHE A 1 62  ? 4.902   -5.026  22.820  1.00 16.14 ? 61  PHE A CB  1 
ATOM   440  C CG  . PHE A 1 62  ? 5.942   -3.940  22.636  1.00 16.08 ? 61  PHE A CG  1 
ATOM   441  C CD1 . PHE A 1 62  ? 6.440   -3.216  23.731  1.00 16.93 ? 61  PHE A CD1 1 
ATOM   442  C CD2 . PHE A 1 62  ? 6.474   -3.693  21.374  1.00 16.21 ? 61  PHE A CD2 1 
ATOM   443  C CE1 . PHE A 1 62  ? 7.467   -2.262  23.565  1.00 17.44 ? 61  PHE A CE1 1 
ATOM   444  C CE2 . PHE A 1 62  ? 7.500   -2.744  21.196  1.00 17.10 ? 61  PHE A CE2 1 
ATOM   445  C CZ  . PHE A 1 62  ? 8.000   -2.029  22.297  1.00 17.82 ? 61  PHE A CZ  1 
ATOM   446  N N   . VAL A 1 63  ? 3.408   -4.062  25.359  1.00 16.41 ? 62  VAL A N   1 
ATOM   447  C CA  . VAL A 1 63  ? 3.405   -3.244  26.555  1.00 15.26 ? 62  VAL A CA  1 
ATOM   448  C C   . VAL A 1 63  ? 4.655   -3.687  27.311  1.00 17.58 ? 62  VAL A C   1 
ATOM   449  O O   . VAL A 1 63  ? 4.893   -4.886  27.508  1.00 15.53 ? 62  VAL A O   1 
ATOM   450  C CB  . VAL A 1 63  ? 2.159   -3.470  27.444  1.00 15.37 ? 62  VAL A CB  1 
ATOM   451  C CG1 . VAL A 1 63  ? 2.291   -2.658  28.715  1.00 16.74 ? 62  VAL A CG1 1 
ATOM   452  C CG2 . VAL A 1 63  ? 0.880   -3.028  26.703  1.00 14.30 ? 62  VAL A CG2 1 
ATOM   453  N N   . ALA A 1 64  ? 5.465   -2.729  27.725  1.00 15.91 ? 63  ALA A N   1 
ATOM   454  C CA  . ALA A 1 64  ? 6.680   -3.076  28.437  1.00 16.40 ? 63  ALA A CA  1 
ATOM   455  C C   . ALA A 1 64  ? 7.210   -1.912  29.244  1.00 16.52 ? 63  ALA A C   1 
ATOM   456  O O   . ALA A 1 64  ? 6.842   -0.766  29.000  1.00 15.56 ? 63  ALA A O   1 
ATOM   457  C CB  . ALA A 1 64  ? 7.734   -3.525  27.433  1.00 16.98 ? 63  ALA A CB  1 
ATOM   458  N N   . PRO A 1 65  ? 8.060   -2.194  30.255  1.00 16.32 ? 64  PRO A N   1 
ATOM   459  C CA  . PRO A 1 65  ? 8.626   -1.111  31.057  1.00 17.23 ? 64  PRO A CA  1 
ATOM   460  C C   . PRO A 1 65  ? 9.472   -0.197  30.186  1.00 16.61 ? 64  PRO A C   1 
ATOM   461  O O   . PRO A 1 65  ? 10.191  -0.650  29.282  1.00 15.76 ? 64  PRO A O   1 
ATOM   462  C CB  . PRO A 1 65  ? 9.493   -1.862  32.078  1.00 18.81 ? 64  PRO A CB  1 
ATOM   463  C CG  . PRO A 1 65  ? 8.709   -3.165  32.251  1.00 18.56 ? 64  PRO A CG  1 
ATOM   464  C CD  . PRO A 1 65  ? 8.512   -3.493  30.784  1.00 17.35 ? 64  PRO A CD  1 
ATOM   465  N N   . THR A 1 66  ? 9.407   1.102   30.446  1.00 17.09 ? 65  THR A N   1 
ATOM   466  C CA  . THR A 1 66  ? 10.196  2.013   29.647  1.00 16.68 ? 65  THR A CA  1 
ATOM   467  C C   . THR A 1 66  ? 11.696  1.752   29.808  1.00 17.25 ? 65  THR A C   1 
ATOM   468  O O   . THR A 1 66  ? 12.462  2.046   28.910  1.00 16.25 ? 65  THR A O   1 
ATOM   469  C CB  . THR A 1 66  ? 9.861   3.486   29.998  1.00 17.52 ? 65  THR A CB  1 
ATOM   470  O OG1 . THR A 1 66  ? 9.993   3.668   31.412  1.00 18.78 ? 65  THR A OG1 1 
ATOM   471  C CG2 . THR A 1 66  ? 8.427   3.812   29.583  1.00 17.74 ? 65  THR A CG2 1 
ATOM   472  N N   . SER A 1 67  ? 12.104  1.139   30.923  1.00 18.14 ? 66  SER A N   1 
ATOM   473  C CA  . SER A 1 67  ? 13.514  0.852   31.149  1.00 19.95 ? 66  SER A CA  1 
ATOM   474  C C   . SER A 1 67  ? 13.916  -0.508  30.553  1.00 22.00 ? 66  SER A C   1 
ATOM   475  O O   . SER A 1 67  ? 15.080  -0.924  30.657  1.00 23.56 ? 66  SER A O   1 
ATOM   476  C CB  . SER A 1 67  ? 13.814  0.874   32.650  1.00 20.30 ? 66  SER A CB  1 
ATOM   477  O OG  . SER A 1 67  ? 12.987  -0.072  33.291  1.00 20.96 ? 66  SER A OG  1 
ATOM   478  N N   . SER A 1 68  ? 12.964  -1.209  29.939  1.00 22.09 ? 67  SER A N   1 
ATOM   479  C CA  . SER A 1 68  ? 13.295  -2.505  29.348  1.00 21.63 ? 67  SER A CA  1 
ATOM   480  C C   . SER A 1 68  ? 13.902  -2.305  27.960  1.00 21.87 ? 67  SER A C   1 
ATOM   481  O O   . SER A 1 68  ? 13.737  -1.247  27.351  1.00 18.97 ? 67  SER A O   1 
ATOM   482  C CB  . SER A 1 68  ? 12.051  -3.409  29.285  1.00 24.09 ? 67  SER A CB  1 
ATOM   483  O OG  . SER A 1 68  ? 11.121  -2.954  28.311  1.00 25.13 ? 67  SER A OG  1 
ATOM   484  N N   . LYS A 1 69  ? 14.616  -3.318  27.473  1.00 19.59 ? 68  LYS A N   1 
ATOM   485  C CA  . LYS A 1 69  ? 15.279  -3.252  26.167  1.00 20.99 ? 68  LYS A CA  1 
ATOM   486  C C   . LYS A 1 69  ? 14.402  -3.833  25.059  1.00 18.97 ? 68  LYS A C   1 
ATOM   487  O O   . LYS A 1 69  ? 13.545  -4.673  25.311  1.00 18.97 ? 68  LYS A O   1 
ATOM   488  C CB  . LYS A 1 69  ? 16.599  -4.034  26.213  1.00 22.77 ? 68  LYS A CB  1 
ATOM   489  C CG  . LYS A 1 69  ? 17.667  -3.482  27.157  1.00 26.09 ? 68  LYS A CG  1 
ATOM   490  C CD  . LYS A 1 69  ? 18.206  -2.139  26.678  1.00 27.88 ? 68  LYS A CD  1 
ATOM   491  C CE  . LYS A 1 69  ? 19.325  -1.619  27.581  1.00 29.53 ? 68  LYS A CE  1 
ATOM   492  N NZ  . LYS A 1 69  ? 18.834  -1.523  28.987  1.00 30.06 ? 68  LYS A NZ  1 
ATOM   493  N N   . VAL A 1 70  ? 14.605  -3.367  23.831  1.00 18.52 ? 69  VAL A N   1 
ATOM   494  C CA  . VAL A 1 70  ? 13.848  -3.890  22.698  1.00 17.76 ? 69  VAL A CA  1 
ATOM   495  C C   . VAL A 1 70  ? 14.722  -3.745  21.463  1.00 17.27 ? 69  VAL A C   1 
ATOM   496  O O   . VAL A 1 70  ? 15.610  -2.872  21.412  1.00 16.43 ? 69  VAL A O   1 
ATOM   497  C CB  . VAL A 1 70  ? 12.511  -3.118  22.507  1.00 19.83 ? 69  VAL A CB  1 
ATOM   498  C CG1 . VAL A 1 70  ? 12.787  -1.683  22.076  1.00 22.87 ? 69  VAL A CG1 1 
ATOM   499  C CG2 . VAL A 1 70  ? 11.619  -3.844  21.523  1.00 17.80 ? 69  VAL A CG2 1 
ATOM   500  N N   . GLU A 1 71  ? 14.492  -4.625  20.484  1.00 15.48 ? 70  GLU A N   1 
ATOM   501  C CA  . GLU A 1 71  ? 15.226  -4.631  19.226  1.00 16.32 ? 70  GLU A CA  1 
ATOM   502  C C   . GLU A 1 71  ? 14.600  -3.698  18.215  1.00 15.32 ? 70  GLU A C   1 
ATOM   503  O O   . GLU A 1 71  ? 13.384  -3.646  18.113  1.00 14.31 ? 70  GLU A O   1 
ATOM   504  C CB  . GLU A 1 71  ? 15.229  -6.039  18.613  1.00 21.09 ? 70  GLU A CB  1 
ATOM   505  C CG  . GLU A 1 71  ? 16.337  -6.965  19.089  1.00 28.32 ? 70  GLU A CG  1 
ATOM   506  C CD  . GLU A 1 71  ? 16.669  -6.828  20.561  1.00 32.14 ? 70  GLU A CD  1 
ATOM   507  O OE1 . GLU A 1 71  ? 15.775  -7.072  21.419  1.00 35.96 ? 70  GLU A OE1 1 
ATOM   508  O OE2 . GLU A 1 71  ? 17.849  -6.481  20.855  1.00 35.66 ? 70  GLU A OE2 1 
ATOM   509  N N   . VAL A 1 72  ? 15.443  -2.961  17.483  1.00 15.24 ? 71  VAL A N   1 
ATOM   510  C CA  . VAL A 1 72  ? 14.966  -2.067  16.426  1.00 16.51 ? 71  VAL A CA  1 
ATOM   511  C C   . VAL A 1 72  ? 15.722  -2.426  15.150  1.00 15.66 ? 71  VAL A C   1 
ATOM   512  O O   . VAL A 1 72  ? 16.931  -2.662  15.161  1.00 16.88 ? 71  VAL A O   1 
ATOM   513  C CB  . VAL A 1 72  ? 15.204  -0.571  16.778  1.00 17.53 ? 71  VAL A CB  1 
ATOM   514  C CG1 . VAL A 1 72  ? 14.479  -0.216  18.070  1.00 18.79 ? 71  VAL A CG1 1 
ATOM   515  C CG2 . VAL A 1 72  ? 16.652  -0.300  16.921  1.00 23.17 ? 71  VAL A CG2 1 
ATOM   516  N N   . PRO A 1 73  ? 15.005  -2.518  14.027  1.00 16.12 ? 72  PRO A N   1 
ATOM   517  C CA  . PRO A 1 73  ? 15.689  -2.859  12.779  1.00 16.16 ? 72  PRO A CA  1 
ATOM   518  C C   . PRO A 1 73  ? 16.531  -1.694  12.285  1.00 18.51 ? 72  PRO A C   1 
ATOM   519  O O   . PRO A 1 73  ? 16.098  -0.547  12.347  1.00 17.52 ? 72  PRO A O   1 
ATOM   520  C CB  . PRO A 1 73  ? 14.525  -3.171  11.853  1.00 17.22 ? 72  PRO A CB  1 
ATOM   521  C CG  . PRO A 1 73  ? 13.494  -2.175  12.296  1.00 16.50 ? 72  PRO A CG  1 
ATOM   522  C CD  . PRO A 1 73  ? 13.550  -2.401  13.800  1.00 15.58 ? 72  PRO A CD  1 
ATOM   523  N N   . ILE A 1 74  ? 17.737  -1.984  11.806  1.00 18.11 ? 73  ILE A N   1 
ATOM   524  C CA  . ILE A 1 74  ? 18.594  -0.942  11.261  1.00 18.30 ? 73  ILE A CA  1 
ATOM   525  C C   . ILE A 1 74  ? 18.133  -0.761  9.806   1.00 17.80 ? 73  ILE A C   1 
ATOM   526  O O   . ILE A 1 74  ? 17.974  -1.741  9.059   1.00 17.86 ? 73  ILE A O   1 
ATOM   527  C CB  . ILE A 1 74  ? 20.076  -1.354  11.373  1.00 18.99 ? 73  ILE A CB  1 
ATOM   528  C CG1 . ILE A 1 74  ? 20.406  -1.567  12.863  1.00 21.72 ? 73  ILE A CG1 1 
ATOM   529  C CG2 . ILE A 1 74  ? 20.990  -0.244  10.842  1.00 20.93 ? 73  ILE A CG2 1 
ATOM   530  C CD1 . ILE A 1 74  ? 21.823  -2.033  13.137  1.00 25.10 ? 73  ILE A CD1 1 
ATOM   531  N N   . ILE A 1 75  ? 17.857  0.491   9.438   1.00 17.93 ? 74  ILE A N   1 
ATOM   532  C CA  . ILE A 1 75  ? 17.369  0.827   8.102   1.00 19.12 ? 74  ILE A CA  1 
ATOM   533  C C   . ILE A 1 75  ? 18.508  1.278   7.202   1.00 19.89 ? 74  ILE A C   1 
ATOM   534  O O   . ILE A 1 75  ? 19.291  2.144   7.594   1.00 22.40 ? 74  ILE A O   1 
ATOM   535  C CB  . ILE A 1 75  ? 16.331  2.003   8.153   1.00 18.32 ? 74  ILE A CB  1 
ATOM   536  C CG1 . ILE A 1 75  ? 15.248  1.750   9.208   1.00 17.11 ? 74  ILE A CG1 1 
ATOM   537  C CG2 . ILE A 1 75  ? 15.767  2.252   6.767   1.00 19.32 ? 74  ILE A CG2 1 
ATOM   538  C CD1 . ILE A 1 75  ? 14.538  0.433   9.142   1.00 19.19 ? 74  ILE A CD1 1 
ATOM   539  N N   . ASP A 1 76  ? 18.620  0.703   6.006   1.00 20.64 ? 75  ASP A N   1 
ATOM   540  C CA  . ASP A 1 76  ? 19.664  1.126   5.053   1.00 20.68 ? 75  ASP A CA  1 
ATOM   541  C C   . ASP A 1 76  ? 18.878  1.909   3.994   1.00 20.15 ? 75  ASP A C   1 
ATOM   542  O O   . ASP A 1 76  ? 18.084  1.317   3.291   1.00 18.17 ? 75  ASP A O   1 
ATOM   543  C CB  . ASP A 1 76  ? 20.322  -0.081  4.375   1.00 22.35 ? 75  ASP A CB  1 
ATOM   544  C CG  . ASP A 1 76  ? 21.521  0.315   3.495   1.00 23.44 ? 75  ASP A CG  1 
ATOM   545  O OD1 . ASP A 1 76  ? 22.034  -0.552  2.765   1.00 26.94 ? 75  ASP A OD1 1 
ATOM   546  O OD2 . ASP A 1 76  ? 21.949  1.482   3.550   1.00 23.00 ? 75  ASP A OD2 1 
ATOM   547  N N   . ARG A 1 77  ? 19.068  3.224   3.909   1.00 20.01 ? 76  ARG A N   1 
ATOM   548  C CA  . ARG A 1 77  ? 18.325  4.007   2.930   1.00 21.46 ? 76  ARG A CA  1 
ATOM   549  C C   . ARG A 1 77  ? 19.168  4.092   1.688   1.00 21.20 ? 76  ARG A C   1 
ATOM   550  O O   . ARG A 1 77  ? 20.315  4.574   1.714   1.00 20.66 ? 76  ARG A O   1 
ATOM   551  C CB  . ARG A 1 77  ? 17.983  5.405   3.458   1.00 22.86 ? 76  ARG A CB  1 
ATOM   552  C CG  . ARG A 1 77  ? 16.998  5.356   4.591   1.00 25.88 ? 76  ARG A CG  1 
ATOM   553  C CD  . ARG A 1 77  ? 16.611  6.694   5.171   1.00 28.92 ? 76  ARG A CD  1 
ATOM   554  N NE  . ARG A 1 77  ? 15.625  6.432   6.218   1.00 30.51 ? 76  ARG A NE  1 
ATOM   555  C CZ  . ARG A 1 77  ? 14.363  6.081   5.986   1.00 28.81 ? 76  ARG A CZ  1 
ATOM   556  N NH1 . ARG A 1 77  ? 13.904  5.959   4.746   1.00 30.48 ? 76  ARG A NH1 1 
ATOM   557  N NH2 . ARG A 1 77  ? 13.578  5.769   6.998   1.00 30.74 ? 76  ARG A NH2 1 
ATOM   558  N N   . ARG A 1 78  ? 18.612  3.605   0.592   1.00 20.67 ? 77  ARG A N   1 
ATOM   559  C CA  . ARG A 1 78  ? 19.375  3.581   -0.647  1.00 20.06 ? 77  ARG A CA  1 
ATOM   560  C C   . ARG A 1 78  ? 18.662  4.271   -1.804  1.00 20.41 ? 77  ARG A C   1 
ATOM   561  O O   . ARG A 1 78  ? 17.530  4.729   -1.662  1.00 18.29 ? 77  ARG A O   1 
ATOM   562  C CB  . ARG A 1 78  ? 19.696  2.127   -1.003  1.00 19.75 ? 77  ARG A CB  1 
ATOM   563  C CG  . ARG A 1 78  ? 20.333  1.338   0.177   1.00 20.32 ? 77  ARG A CG  1 
ATOM   564  C CD  . ARG A 1 78  ? 20.710  -0.072  -0.228  1.00 17.90 ? 77  ARG A CD  1 
ATOM   565  N NE  . ARG A 1 78  ? 21.778  -0.097  -1.233  1.00 20.81 ? 77  ARG A NE  1 
ATOM   566  C CZ  . ARG A 1 78  ? 23.078  -0.007  -0.954  1.00 21.68 ? 77  ARG A CZ  1 
ATOM   567  N NH1 . ARG A 1 78  ? 23.482  0.111   0.299   1.00 20.16 ? 77  ARG A NH1 1 
ATOM   568  N NH2 . ARG A 1 78  ? 23.978  -0.045  -1.930  1.00 21.64 ? 77  ARG A NH2 1 
ATOM   569  N N   . LYS A 1 79  ? 19.338  4.353   -2.946  1.00 18.94 ? 78  LYS A N   1 
ATOM   570  C CA  . LYS A 1 79  ? 18.741  4.971   -4.134  1.00 20.65 ? 78  LYS A CA  1 
ATOM   571  C C   . LYS A 1 79  ? 18.872  4.003   -5.303  1.00 19.86 ? 78  LYS A C   1 
ATOM   572  O O   . LYS A 1 79  ? 19.874  3.282   -5.419  1.00 19.75 ? 78  LYS A O   1 
ATOM   573  C CB  . LYS A 1 79  ? 19.454  6.283   -4.488  1.00 22.85 ? 78  LYS A CB  1 
ATOM   574  C CG  . LYS A 1 79  ? 19.325  7.383   -3.441  1.00 27.41 ? 78  LYS A CG  1 
ATOM   575  C CD  . LYS A 1 79  ? 17.888  7.819   -3.232  1.00 29.53 ? 78  LYS A CD  1 
ATOM   576  C CE  . LYS A 1 79  ? 17.297  8.406   -4.506  1.00 31.89 ? 78  LYS A CE  1 
ATOM   577  N NZ  . LYS A 1 79  ? 15.901  8.899   -4.365  1.00 36.59 ? 78  LYS A NZ  1 
ATOM   578  N N   . GLY A 1 80  ? 17.861  3.989   -6.160  1.00 19.93 ? 79  GLY A N   1 
ATOM   579  C CA  . GLY A 1 80  ? 17.887  3.117   -7.311  1.00 19.83 ? 79  GLY A CA  1 
ATOM   580  C C   . GLY A 1 80  ? 17.272  3.775   -8.537  1.00 20.23 ? 79  GLY A C   1 
ATOM   581  O O   . GLY A 1 80  ? 16.632  4.821   -8.442  1.00 17.90 ? 79  GLY A O   1 
ATOM   582  N N   . GLN A 1 81  ? 17.487  3.162   -9.691  1.00 21.02 ? 80  GLN A N   1 
ATOM   583  C CA  . GLN A 1 81  ? 16.902  3.656   -10.929 1.00 21.03 ? 80  GLN A CA  1 
ATOM   584  C C   . GLN A 1 81  ? 16.006  2.535   -11.414 1.00 21.66 ? 80  GLN A C   1 
ATOM   585  O O   . GLN A 1 81  ? 16.421  1.378   -11.436 1.00 21.43 ? 80  GLN A O   1 
ATOM   586  C CB  . GLN A 1 81  ? 17.980  3.943   -11.972 1.00 22.96 ? 80  GLN A CB  1 
ATOM   587  C CG  . GLN A 1 81  ? 17.418  4.621   -13.214 1.00 24.88 ? 80  GLN A CG  1 
ATOM   588  C CD  . GLN A 1 81  ? 18.500  5.139   -14.136 1.00 26.70 ? 80  GLN A CD  1 
ATOM   589  O OE1 . GLN A 1 81  ? 18.264  6.042   -14.923 1.00 29.56 ? 80  GLN A OE1 1 
ATOM   590  N NE2 . GLN A 1 81  ? 19.686  4.557   -14.050 1.00 27.77 ? 80  GLN A NE2 1 
ATOM   591  N N   . VAL A 1 82  ? 14.776  2.863   -11.776 1.00 21.86 ? 81  VAL A N   1 
ATOM   592  C CA  . VAL A 1 82  ? 13.856  1.846   -12.259 1.00 23.51 ? 81  VAL A CA  1 
ATOM   593  C C   . VAL A 1 82  ? 14.304  1.378   -13.637 1.00 22.71 ? 81  VAL A C   1 
ATOM   594  O O   . VAL A 1 82  ? 14.624  2.196   -14.497 1.00 23.58 ? 81  VAL A O   1 
ATOM   595  C CB  . VAL A 1 82  ? 12.425  2.401   -12.351 1.00 23.39 ? 81  VAL A CB  1 
ATOM   596  C CG1 . VAL A 1 82  ? 11.478  1.344   -12.882 1.00 23.39 ? 81  VAL A CG1 1 
ATOM   597  C CG2 . VAL A 1 82  ? 11.984  2.891   -10.993 1.00 24.18 ? 81  VAL A CG2 1 
ATOM   598  N N   . LEU A 1 83  ? 14.345  0.065   -13.841 1.00 23.23 ? 82  LEU A N   1 
ATOM   599  C CA  . LEU A 1 83  ? 14.724  -0.478  -15.141 1.00 24.26 ? 82  LEU A CA  1 
ATOM   600  C C   . LEU A 1 83  ? 13.492  -1.064  -15.825 1.00 25.49 ? 82  LEU A C   1 
ATOM   601  O O   . LEU A 1 83  ? 13.390  -1.080  -17.058 1.00 24.40 ? 82  LEU A O   1 
ATOM   602  C CB  . LEU A 1 83  ? 15.758  -1.588  -14.981 1.00 24.81 ? 82  LEU A CB  1 
ATOM   603  C CG  . LEU A 1 83  ? 17.032  -1.257  -14.206 1.00 25.00 ? 82  LEU A CG  1 
ATOM   604  C CD1 . LEU A 1 83  ? 17.841  -2.519  -13.989 1.00 25.04 ? 82  LEU A CD1 1 
ATOM   605  C CD2 . LEU A 1 83  ? 17.838  -0.218  -14.966 1.00 26.19 ? 82  LEU A CD2 1 
ATOM   606  N N   . ALA A 1 84  ? 12.555  -1.561  -15.028 1.00 23.13 ? 83  ALA A N   1 
ATOM   607  C CA  . ALA A 1 84  ? 11.364  -2.162  -15.595 1.00 24.25 ? 83  ALA A CA  1 
ATOM   608  C C   . ALA A 1 84  ? 10.323  -2.462  -14.547 1.00 23.90 ? 83  ALA A C   1 
ATOM   609  O O   . ALA A 1 84  ? 10.645  -2.566  -13.371 1.00 23.70 ? 83  ALA A O   1 
ATOM   610  C CB  . ALA A 1 84  ? 11.734  -3.468  -16.316 1.00 24.99 ? 83  ALA A CB  1 
ATOM   611  N N   . ILE A 1 85  ? 9.071   -2.588  -14.983 1.00 22.85 ? 84  ILE A N   1 
ATOM   612  C CA  . ILE A 1 85  ? 7.979   -2.961  -14.093 1.00 22.96 ? 84  ILE A CA  1 
ATOM   613  C C   . ILE A 1 85  ? 7.198   -4.081  -14.773 1.00 24.73 ? 84  ILE A C   1 
ATOM   614  O O   . ILE A 1 85  ? 6.627   -3.906  -15.862 1.00 23.23 ? 84  ILE A O   1 
ATOM   615  C CB  . ILE A 1 85  ? 7.024   -1.799  -13.788 1.00 24.40 ? 84  ILE A CB  1 
ATOM   616  C CG1 . ILE A 1 85  ? 7.819   -0.593  -13.260 1.00 25.04 ? 84  ILE A CG1 1 
ATOM   617  C CG2 . ILE A 1 85  ? 6.008   -2.261  -12.715 1.00 24.54 ? 84  ILE A CG2 1 
ATOM   618  C CD1 . ILE A 1 85  ? 6.965   0.589   -12.846 1.00 28.65 ? 84  ILE A CD1 1 
ATOM   619  N N   . MET A 1 86  ? 7.186   -5.242  -14.138 1.00 26.08 ? 85  MET A N   1 
ATOM   620  C CA  . MET A 1 86  ? 6.512   -6.402  -14.685 1.00 28.92 ? 85  MET A CA  1 
ATOM   621  C C   . MET A 1 86  ? 5.772   -7.179  -13.612 1.00 28.54 ? 85  MET A C   1 
ATOM   622  O O   . MET A 1 86  ? 6.344   -7.514  -12.572 1.00 28.64 ? 85  MET A O   1 
ATOM   623  C CB  . MET A 1 86  ? 7.554   -7.286  -15.388 1.00 32.77 ? 85  MET A CB  1 
ATOM   624  C CG  . MET A 1 86  ? 8.847   -7.465  -14.567 1.00 38.67 ? 85  MET A CG  1 
ATOM   625  S SD  . MET A 1 86  ? 10.426  -7.579  -15.535 1.00 45.26 ? 85  MET A SD  1 
ATOM   626  C CE  . MET A 1 86  ? 11.655  -7.647  -14.173 1.00 43.82 ? 85  MET A CE  1 
ATOM   627  N N   . GLY A 1 87  ? 4.493   -7.452  -13.863 1.00 27.97 ? 86  GLY A N   1 
ATOM   628  C CA  . GLY A 1 87  ? 3.702   -8.203  -12.910 1.00 28.13 ? 86  GLY A CA  1 
ATOM   629  C C   . GLY A 1 87  ? 3.646   -7.476  -11.583 1.00 27.95 ? 86  GLY A C   1 
ATOM   630  O O   . GLY A 1 87  ? 3.260   -6.315  -11.544 1.00 29.21 ? 86  GLY A O   1 
ATOM   631  N N   . ASP A 1 88  ? 4.046   -8.141  -10.498 1.00 28.73 ? 87  ASP A N   1 
ATOM   632  C CA  . ASP A 1 88  ? 4.010   -7.502  -9.190  1.00 27.78 ? 87  ASP A CA  1 
ATOM   633  C C   . ASP A 1 88  ? 5.382   -7.078  -8.679  1.00 27.08 ? 87  ASP A C   1 
ATOM   634  O O   . ASP A 1 88  ? 5.581   -6.908  -7.473  1.00 26.63 ? 87  ASP A O   1 
ATOM   635  C CB  . ASP A 1 88  ? 3.340   -8.422  -8.165  1.00 31.40 ? 87  ASP A CB  1 
ATOM   636  C CG  . ASP A 1 88  ? 4.110   -9.707  -7.933  1.00 32.18 ? 87  ASP A CG  1 
ATOM   637  O OD1 . ASP A 1 88  ? 3.634   -10.529 -7.119  1.00 37.49 ? 87  ASP A OD1 1 
ATOM   638  O OD2 . ASP A 1 88  ? 5.179   -9.897  -8.554  1.00 34.99 ? 87  ASP A OD2 1 
ATOM   639  N N   . MET A 1 89  ? 6.324   -6.872  -9.588  1.00 25.08 ? 88  MET A N   1 
ATOM   640  C CA  . MET A 1 89  ? 7.664   -6.466  -9.173  1.00 24.58 ? 88  MET A CA  1 
ATOM   641  C C   . MET A 1 89  ? 8.250   -5.333  -9.998  1.00 23.29 ? 88  MET A C   1 
ATOM   642  O O   . MET A 1 89  ? 8.035   -5.254  -11.201 1.00 21.88 ? 88  MET A O   1 
ATOM   643  C CB  . MET A 1 89  ? 8.632   -7.646  -9.260  1.00 27.16 ? 88  MET A CB  1 
ATOM   644  C CG  . MET A 1 89  ? 8.417   -8.729  -8.219  1.00 33.25 ? 88  MET A CG  1 
ATOM   645  S SD  . MET A 1 89  ? 8.807   -8.160  -6.539  1.00 34.25 ? 88  MET A SD  1 
ATOM   646  C CE  . MET A 1 89  ? 8.272   -9.594  -5.589  1.00 34.68 ? 88  MET A CE  1 
ATOM   647  N N   . VAL A 1 90  ? 8.997   -4.471  -9.325  1.00 21.76 ? 89  VAL A N   1 
ATOM   648  C CA  . VAL A 1 90  ? 9.699   -3.367  -9.967  1.00 22.45 ? 89  VAL A CA  1 
ATOM   649  C C   . VAL A 1 90  ? 11.166  -3.779  -9.977  1.00 22.92 ? 89  VAL A C   1 
ATOM   650  O O   . VAL A 1 90  ? 11.725  -4.128  -8.934  1.00 23.29 ? 89  VAL A O   1 
ATOM   651  C CB  . VAL A 1 90  ? 9.618   -2.068  -9.154  1.00 21.75 ? 89  VAL A CB  1 
ATOM   652  C CG1 . VAL A 1 90  ? 10.414  -0.968  -9.859  1.00 21.28 ? 89  VAL A CG1 1 
ATOM   653  C CG2 . VAL A 1 90  ? 8.180   -1.654  -8.958  1.00 23.44 ? 89  VAL A CG2 1 
ATOM   654  N N   . GLN A 1 91  ? 11.801  -3.771  -11.139 1.00 22.99 ? 90  GLN A N   1 
ATOM   655  C CA  . GLN A 1 91  ? 13.220  -4.120  -11.162 1.00 22.70 ? 90  GLN A CA  1 
ATOM   656  C C   . GLN A 1 91  ? 14.009  -2.820  -11.139 1.00 21.14 ? 90  GLN A C   1 
ATOM   657  O O   . GLN A 1 91  ? 13.736  -1.920  -11.941 1.00 17.92 ? 90  GLN A O   1 
ATOM   658  C CB  . GLN A 1 91  ? 13.585  -4.910  -12.419 1.00 25.60 ? 90  GLN A CB  1 
ATOM   659  C CG  . GLN A 1 91  ? 15.087  -5.105  -12.553 1.00 32.75 ? 90  GLN A CG  1 
ATOM   660  C CD  . GLN A 1 91  ? 15.496  -5.871  -13.790 1.00 35.25 ? 90  GLN A CD  1 
ATOM   661  O OE1 . GLN A 1 91  ? 15.002  -5.610  -14.889 1.00 38.97 ? 90  GLN A OE1 1 
ATOM   662  N NE2 . GLN A 1 91  ? 16.428  -6.807  -13.625 1.00 37.65 ? 90  GLN A NE2 1 
ATOM   663  N N   . ILE A 1 92  ? 14.970  -2.719  -10.219 1.00 20.58 ? 91  ILE A N   1 
ATOM   664  C CA  . ILE A 1 92  ? 15.784  -1.512  -10.114 1.00 21.14 ? 91  ILE A CA  1 
ATOM   665  C C   . ILE A 1 92  ? 17.272  -1.825  -10.106 1.00 21.76 ? 91  ILE A C   1 
ATOM   666  O O   . ILE A 1 92  ? 17.685  -2.963  -9.916  1.00 22.37 ? 91  ILE A O   1 
ATOM   667  C CB  . ILE A 1 92  ? 15.464  -0.683  -8.826  1.00 20.15 ? 91  ILE A CB  1 
ATOM   668  C CG1 . ILE A 1 92  ? 15.841  -1.489  -7.574  1.00 21.55 ? 91  ILE A CG1 1 
ATOM   669  C CG2 . ILE A 1 92  ? 13.984  -0.310  -8.795  1.00 20.76 ? 91  ILE A CG2 1 
ATOM   670  C CD1 . ILE A 1 92  ? 15.771  -0.696  -6.247  1.00 22.92 ? 91  ILE A CD1 1 
ATOM   671  N N   . MET A 1 93  ? 18.078  -0.801  -10.341 1.00 22.34 ? 92  MET A N   1 
ATOM   672  C CA  . MET A 1 93  ? 19.529  -0.945  -10.306 1.00 22.02 ? 92  MET A CA  1 
ATOM   673  C C   . MET A 1 93  ? 19.990  -0.025  -9.178  1.00 20.41 ? 92  MET A C   1 
ATOM   674  O O   . MET A 1 93  ? 19.718  1.176   -9.216  1.00 22.42 ? 92  MET A O   1 
ATOM   675  C CB  . MET A 1 93  ? 20.157  -0.479  -11.617 1.00 22.76 ? 92  MET A CB  1 
ATOM   676  C CG  . MET A 1 93  ? 21.662  -0.566  -11.599 1.00 23.90 ? 92  MET A CG  1 
ATOM   677  S SD  . MET A 1 93  ? 22.464  0.237   -12.994 1.00 26.64 ? 92  MET A SD  1 
ATOM   678  C CE  . MET A 1 93  ? 22.045  1.943   -12.673 1.00 26.36 ? 92  MET A CE  1 
ATOM   679  N N   . ASP A 1 94  ? 20.661  -0.568  -8.170  1.00 21.01 ? 93  ASP A N   1 
ATOM   680  C CA  . ASP A 1 94  ? 21.135  0.263   -7.064  1.00 20.84 ? 93  ASP A CA  1 
ATOM   681  C C   . ASP A 1 94  ? 22.170  1.243   -7.650  1.00 20.77 ? 93  ASP A C   1 
ATOM   682  O O   . ASP A 1 94  ? 23.040  0.847   -8.432  1.00 20.09 ? 93  ASP A O   1 
ATOM   683  C CB  . ASP A 1 94  ? 21.787  -0.608  -5.989  1.00 21.28 ? 93  ASP A CB  1 
ATOM   684  C CG  . ASP A 1 94  ? 22.233  0.188   -4.779  1.00 24.10 ? 93  ASP A CG  1 
ATOM   685  O OD1 . ASP A 1 94  ? 21.377  0.599   -3.959  1.00 23.70 ? 93  ASP A OD1 1 
ATOM   686  O OD2 . ASP A 1 94  ? 23.459  0.413   -4.647  1.00 22.86 ? 93  ASP A OD2 1 
ATOM   687  N N   . LEU A 1 95  ? 22.084  2.510   -7.256  1.00 21.07 ? 94  LEU A N   1 
ATOM   688  C CA  . LEU A 1 95  ? 22.989  3.537   -7.785  1.00 21.92 ? 94  LEU A CA  1 
ATOM   689  C C   . LEU A 1 95  ? 24.386  3.577   -7.200  1.00 23.36 ? 94  LEU A C   1 
ATOM   690  O O   . LEU A 1 95  ? 25.207  4.421   -7.585  1.00 22.92 ? 94  LEU A O   1 
ATOM   691  C CB  . LEU A 1 95  ? 22.337  4.905   -7.614  1.00 22.15 ? 94  LEU A CB  1 
ATOM   692  C CG  . LEU A 1 95  ? 21.098  5.105   -8.489  1.00 24.02 ? 94  LEU A CG  1 
ATOM   693  C CD1 . LEU A 1 95  ? 20.443  6.453   -8.172  1.00 24.26 ? 94  LEU A CD1 1 
ATOM   694  C CD2 . LEU A 1 95  ? 21.524  5.023   -9.956  1.00 23.68 ? 94  LEU A CD2 1 
ATOM   695  N N   . GLN A 1 96  ? 24.656  2.694   -6.252  1.00 23.04 ? 95  GLN A N   1 
ATOM   696  C CA  . GLN A 1 96  ? 25.973  2.631   -5.660  1.00 25.94 ? 95  GLN A CA  1 
ATOM   697  C C   . GLN A 1 96  ? 26.713  1.357   -6.089  1.00 26.52 ? 95  GLN A C   1 
ATOM   698  O O   . GLN A 1 96  ? 27.921  1.398   -6.316  1.00 26.27 ? 95  GLN A O   1 
ATOM   699  C CB  . GLN A 1 96  ? 25.885  2.703   -4.130  1.00 27.98 ? 95  GLN A CB  1 
ATOM   700  C CG  . GLN A 1 96  ? 27.217  2.465   -3.434  1.00 31.63 ? 95  GLN A CG  1 
ATOM   701  C CD  . GLN A 1 96  ? 27.131  2.609   -1.923  1.00 33.51 ? 95  GLN A CD  1 
ATOM   702  O OE1 . GLN A 1 96  ? 26.100  2.323   -1.318  1.00 30.69 ? 95  GLN A OE1 1 
ATOM   703  N NE2 . GLN A 1 96  ? 28.233  3.016   -1.303  1.00 33.98 ? 95  GLN A NE2 1 
ATOM   704  N N   . THR A 1 97  ? 25.997  0.238   -6.202  1.00 25.97 ? 96  THR A N   1 
ATOM   705  C CA  . THR A 1 97  ? 26.620  -1.029  -6.597  1.00 25.81 ? 96  THR A CA  1 
ATOM   706  C C   . THR A 1 97  ? 26.384  -1.420  -8.060  1.00 26.96 ? 96  THR A C   1 
ATOM   707  O O   . THR A 1 97  ? 27.071  -2.297  -8.596  1.00 27.20 ? 96  THR A O   1 
ATOM   708  C CB  . THR A 1 97  ? 26.085  -2.191  -5.763  1.00 25.93 ? 96  THR A CB  1 
ATOM   709  O OG1 . THR A 1 97  ? 24.703  -2.389  -6.091  1.00 24.47 ? 96  THR A OG1 1 
ATOM   710  C CG2 . THR A 1 97  ? 26.208  -1.901  -4.286  1.00 24.69 ? 96  THR A CG2 1 
ATOM   711  N N   . TYR A 1 98  ? 25.405  -0.786  -8.692  1.00 26.96 ? 97  TYR A N   1 
ATOM   712  C CA  . TYR A 1 98  ? 25.041  -1.093  -10.071 1.00 28.23 ? 97  TYR A CA  1 
ATOM   713  C C   . TYR A 1 98  ? 24.483  -2.512  -10.185 1.00 30.08 ? 97  TYR A C   1 
ATOM   714  O O   . TYR A 1 98  ? 24.498  -3.111  -11.260 1.00 31.37 ? 97  TYR A O   1 
ATOM   715  C CB  . TYR A 1 98  ? 26.236  -0.899  -11.004 1.00 26.10 ? 97  TYR A CB  1 
ATOM   716  C CG  . TYR A 1 98  ? 26.647  0.553   -11.079 1.00 26.57 ? 97  TYR A CG  1 
ATOM   717  C CD1 . TYR A 1 98  ? 27.932  0.960   -10.740 1.00 24.90 ? 97  TYR A CD1 1 
ATOM   718  C CD2 . TYR A 1 98  ? 25.725  1.526   -11.436 1.00 27.12 ? 97  TYR A CD2 1 
ATOM   719  C CE1 . TYR A 1 98  ? 28.281  2.310   -10.752 1.00 24.57 ? 97  TYR A CE1 1 
ATOM   720  C CE2 . TYR A 1 98  ? 26.062  2.866   -11.448 1.00 26.57 ? 97  TYR A CE2 1 
ATOM   721  C CZ  . TYR A 1 98  ? 27.339  3.252   -11.103 1.00 25.72 ? 97  TYR A CZ  1 
ATOM   722  O OH  . TYR A 1 98  ? 27.644  4.588   -11.110 1.00 26.63 ? 97  TYR A OH  1 
ATOM   723  N N   . GLU A 1 99  ? 24.003  -3.033  -9.058  1.00 31.45 ? 98  GLU A N   1 
ATOM   724  C CA  . GLU A 1 99  ? 23.393  -4.360  -9.008  1.00 33.36 ? 98  GLU A CA  1 
ATOM   725  C C   . GLU A 1 99  ? 21.907  -4.144  -9.209  1.00 33.27 ? 98  GLU A C   1 
ATOM   726  O O   . GLU A 1 99  ? 21.365  -3.082  -8.868  1.00 31.56 ? 98  GLU A O   1 
ATOM   727  C CB  . GLU A 1 99  ? 23.585  -4.998  -7.645  1.00 35.75 ? 98  GLU A CB  1 
ATOM   728  C CG  . GLU A 1 99  ? 22.875  -4.201  -6.568  1.00 39.09 ? 98  GLU A CG  1 
ATOM   729  C CD  . GLU A 1 99  ? 23.193  -4.663  -5.175  1.00 40.47 ? 98  GLU A CD  1 
ATOM   730  O OE1 . GLU A 1 99  ? 22.870  -3.906  -4.227  1.00 39.69 ? 98  GLU A OE1 1 
ATOM   731  O OE2 . GLU A 1 99  ? 23.753  -5.779  -5.036  1.00 43.93 ? 98  GLU A OE2 1 
ATOM   732  N N   . THR A 1 100 ? 21.248  -5.162  -9.744  1.00 32.71 ? 99  THR A N   1 
ATOM   733  C CA  . THR A 1 100 ? 19.822  -5.085  -9.989  1.00 32.80 ? 99  THR A CA  1 
ATOM   734  C C   . THR A 1 100 ? 19.102  -5.950  -8.956  1.00 32.31 ? 99  THR A C   1 
ATOM   735  O O   . THR A 1 100 ? 19.626  -6.964  -8.504  1.00 32.26 ? 99  THR A O   1 
ATOM   736  C CB  . THR A 1 100 ? 19.511  -5.577  -11.400 1.00 33.14 ? 99  THR A CB  1 
ATOM   737  O OG1 . THR A 1 100 ? 19.873  -6.958  -11.514 1.00 34.84 ? 99  THR A OG1 1 
ATOM   738  C CG2 . THR A 1 100 ? 20.312  -4.767  -12.422 1.00 32.66 ? 99  THR A CG2 1 
ATOM   739  N N   . LEU A 1 101 ? 17.919  -5.518  -8.545  1.00 31.56 ? 100 LEU A N   1 
ATOM   740  C CA  . LEU A 1 101 ? 17.140  -6.282  -7.585  1.00 31.42 ? 100 LEU A CA  1 
ATOM   741  C C   . LEU A 1 101 ? 15.675  -6.025  -7.864  1.00 30.98 ? 100 LEU A C   1 
ATOM   742  O O   . LEU A 1 101 ? 15.330  -5.087  -8.593  1.00 29.54 ? 100 LEU A O   1 
ATOM   743  C CB  . LEU A 1 101 ? 17.480  -5.899  -6.132  1.00 31.60 ? 100 LEU A CB  1 
ATOM   744  C CG  . LEU A 1 101 ? 17.313  -4.448  -5.670  1.00 32.47 ? 100 LEU A CG  1 
ATOM   745  C CD1 . LEU A 1 101 ? 16.998  -4.412  -4.180  1.00 32.28 ? 100 LEU A CD1 1 
ATOM   746  C CD2 . LEU A 1 101 ? 18.565  -3.647  -5.987  1.00 31.29 ? 100 LEU A CD2 1 
ATOM   747  N N   . GLU A 1 102 ? 14.828  -6.859  -7.270  1.00 29.54 ? 101 GLU A N   1 
ATOM   748  C CA  . GLU A 1 102 ? 13.382  -6.789  -7.429  1.00 29.58 ? 101 GLU A CA  1 
ATOM   749  C C   . GLU A 1 102 ? 12.712  -6.335  -6.136  1.00 27.35 ? 101 GLU A C   1 
ATOM   750  O O   . GLU A 1 102 ? 13.076  -6.785  -5.042  1.00 24.89 ? 101 GLU A O   1 
ATOM   751  C CB  . GLU A 1 102 ? 12.835  -8.176  -7.788  1.00 33.82 ? 101 GLU A CB  1 
ATOM   752  C CG  . GLU A 1 102 ? 13.357  -8.803  -9.067  1.00 39.53 ? 101 GLU A CG  1 
ATOM   753  C CD  . GLU A 1 102 ? 12.530  -8.451  -10.298 1.00 43.60 ? 101 GLU A CD  1 
ATOM   754  O OE1 . GLU A 1 102 ? 12.647  -7.317  -10.812 1.00 46.88 ? 101 GLU A OE1 1 
ATOM   755  O OE2 . GLU A 1 102 ? 11.747  -9.319  -10.748 1.00 45.20 ? 101 GLU A OE2 1 
ATOM   756  N N   . LEU A 1 103 ? 11.736  -5.439  -6.266  1.00 23.57 ? 102 LEU A N   1 
ATOM   757  C CA  . LEU A 1 103 ? 10.992  -4.945  -5.116  1.00 23.57 ? 102 LEU A CA  1 
ATOM   758  C C   . LEU A 1 103 ? 9.525   -4.846  -5.484  1.00 22.52 ? 102 LEU A C   1 
ATOM   759  O O   . LEU A 1 103 ? 9.180   -4.744  -6.659  1.00 21.00 ? 102 LEU A O   1 
ATOM   760  C CB  . LEU A 1 103 ? 11.458  -3.546  -4.683  1.00 25.26 ? 102 LEU A CB  1 
ATOM   761  C CG  . LEU A 1 103 ? 12.882  -3.329  -4.175  1.00 26.31 ? 102 LEU A CG  1 
ATOM   762  C CD1 . LEU A 1 103 ? 13.868  -3.356  -5.349  1.00 27.97 ? 102 LEU A CD1 1 
ATOM   763  C CD2 . LEU A 1 103 ? 12.945  -1.999  -3.475  1.00 23.32 ? 102 LEU A CD2 1 
ATOM   764  N N   . PRO A 1 104 ? 8.635   -4.884  -4.483  1.00 21.39 ? 103 PRO A N   1 
ATOM   765  C CA  . PRO A 1 104 ? 7.204   -4.782  -4.758  1.00 20.96 ? 103 PRO A CA  1 
ATOM   766  C C   . PRO A 1 104 ? 6.868   -3.403  -5.354  1.00 20.23 ? 103 PRO A C   1 
ATOM   767  O O   . PRO A 1 104 ? 7.600   -2.424  -5.150  1.00 18.86 ? 103 PRO A O   1 
ATOM   768  C CB  . PRO A 1 104 ? 6.580   -4.946  -3.365  1.00 20.32 ? 103 PRO A CB  1 
ATOM   769  C CG  . PRO A 1 104 ? 7.626   -5.768  -2.617  1.00 20.97 ? 103 PRO A CG  1 
ATOM   770  C CD  . PRO A 1 104 ? 8.863   -5.026  -3.035  1.00 21.80 ? 103 PRO A CD  1 
ATOM   771  N N   . ILE A 1 105 ? 5.767   -3.334  -6.093  1.00 20.50 ? 104 ILE A N   1 
ATOM   772  C CA  . ILE A 1 105 ? 5.306   -2.053  -6.635  1.00 22.69 ? 104 ILE A CA  1 
ATOM   773  C C   . ILE A 1 105 ? 4.784   -1.298  -5.421  1.00 23.63 ? 104 ILE A C   1 
ATOM   774  O O   . ILE A 1 105 ? 3.930   -1.819  -4.709  1.00 23.48 ? 104 ILE A O   1 
ATOM   775  C CB  . ILE A 1 105 ? 4.129   -2.239  -7.603  1.00 24.10 ? 104 ILE A CB  1 
ATOM   776  C CG1 . ILE A 1 105 ? 4.604   -2.991  -8.847  1.00 23.81 ? 104 ILE A CG1 1 
ATOM   777  C CG2 . ILE A 1 105 ? 3.524   -0.860  -7.955  1.00 24.41 ? 104 ILE A CG2 1 
ATOM   778  C CD1 . ILE A 1 105 ? 3.523   -3.250  -9.837  1.00 25.04 ? 104 ILE A CD1 1 
ATOM   779  N N   . PRO A 1 106 ? 5.287   -0.068  -5.169  1.00 25.09 ? 105 PRO A N   1 
ATOM   780  C CA  . PRO A 1 106 ? 4.891   0.777   -4.031  1.00 27.42 ? 105 PRO A CA  1 
ATOM   781  C C   . PRO A 1 106 ? 3.468   1.339   -4.082  1.00 28.89 ? 105 PRO A C   1 
ATOM   782  O O   . PRO A 1 106 ? 2.803   1.283   -5.107  1.00 28.52 ? 105 PRO A O   1 
ATOM   783  C CB  . PRO A 1 106 ? 5.948   1.887   -4.058  1.00 27.25 ? 105 PRO A CB  1 
ATOM   784  C CG  . PRO A 1 106 ? 6.122   2.073   -5.545  1.00 27.96 ? 105 PRO A CG  1 
ATOM   785  C CD  . PRO A 1 106 ? 6.324   0.617   -5.961  1.00 25.85 ? 105 PRO A CD  1 
ATOM   786  N N   . GLU A 1 107 ? 3.031   1.889   -2.955  1.00 30.79 ? 106 GLU A N   1 
ATOM   787  C CA  . GLU A 1 107 ? 1.704   2.475   -2.816  1.00 34.34 ? 106 GLU A CA  1 
ATOM   788  C C   . GLU A 1 107 ? 1.628   3.713   -3.711  1.00 34.15 ? 106 GLU A C   1 
ATOM   789  O O   . GLU A 1 107 ? 0.636   3.931   -4.403  1.00 34.98 ? 106 GLU A O   1 
ATOM   790  C CB  . GLU A 1 107 ? 1.463   2.848   -1.339  1.00 37.66 ? 106 GLU A CB  1 
ATOM   791  C CG  . GLU A 1 107 ? 1.796   1.703   -0.353  1.00 42.29 ? 106 GLU A CG  1 
ATOM   792  C CD  . GLU A 1 107 ? 1.618   2.068   1.128   1.00 44.76 ? 106 GLU A CD  1 
ATOM   793  O OE1 . GLU A 1 107 ? 2.177   3.098   1.580   1.00 47.79 ? 106 GLU A OE1 1 
ATOM   794  O OE2 . GLU A 1 107 ? 0.931   1.308   1.850   1.00 48.21 ? 106 GLU A OE2 1 
ATOM   795  N N   . GLY A 1 108 ? 2.691   4.511   -3.706  1.00 33.72 ? 107 GLY A N   1 
ATOM   796  C CA  . GLY A 1 108 ? 2.727   5.703   -4.538  1.00 33.85 ? 107 GLY A CA  1 
ATOM   797  C C   . GLY A 1 108 ? 3.475   5.395   -5.819  1.00 34.65 ? 107 GLY A C   1 
ATOM   798  O O   . GLY A 1 108 ? 4.671   5.086   -5.791  1.00 33.21 ? 107 GLY A O   1 
ATOM   799  N N   . ILE A 1 109 ? 2.791   5.469   -6.952  1.00 34.75 ? 108 ILE A N   1 
ATOM   800  C CA  . ILE A 1 109 ? 3.450   5.152   -8.212  1.00 36.88 ? 108 ILE A CA  1 
ATOM   801  C C   . ILE A 1 109 ? 3.613   6.347   -9.146  1.00 37.09 ? 108 ILE A C   1 
ATOM   802  O O   . ILE A 1 109 ? 4.093   6.203   -10.265 1.00 36.14 ? 108 ILE A O   1 
ATOM   803  C CB  . ILE A 1 109 ? 2.686   4.042   -8.942  1.00 37.89 ? 108 ILE A CB  1 
ATOM   804  C CG1 . ILE A 1 109 ? 1.249   4.491   -9.211  1.00 39.54 ? 108 ILE A CG1 1 
ATOM   805  C CG2 . ILE A 1 109 ? 2.665   2.774   -8.084  1.00 39.91 ? 108 ILE A CG2 1 
ATOM   806  C CD1 . ILE A 1 109 ? 0.447   3.480   -10.009 1.00 40.75 ? 108 ILE A CD1 1 
ATOM   807  N N   . GLU A 1 110 ? 3.215   7.527   -8.681  1.00 37.92 ? 109 GLU A N   1 
ATOM   808  C CA  . GLU A 1 110 ? 3.320   8.743   -9.490  1.00 38.86 ? 109 GLU A CA  1 
ATOM   809  C C   . GLU A 1 110 ? 4.780   8.937   -9.899  1.00 37.78 ? 109 GLU A C   1 
ATOM   810  O O   . GLU A 1 110 ? 5.657   9.093   -9.048  1.00 37.87 ? 109 GLU A O   1 
ATOM   811  C CB  . GLU A 1 110 ? 2.824   9.958   -8.690  1.00 41.62 ? 109 GLU A CB  1 
ATOM   812  C CG  . GLU A 1 110 ? 3.796   10.449  -7.608  1.00 44.92 ? 109 GLU A CG  1 
ATOM   813  C CD  . GLU A 1 110 ? 4.205   9.357   -6.622  1.00 45.54 ? 109 GLU A CD  1 
ATOM   814  O OE1 . GLU A 1 110 ? 5.402   9.305   -6.271  1.00 47.62 ? 109 GLU A OE1 1 
ATOM   815  O OE2 . GLU A 1 110 ? 3.335   8.569   -6.188  1.00 47.49 ? 109 GLU A OE2 1 
ATOM   816  N N   . GLY A 1 111 ? 5.043   8.912   -11.202 1.00 36.73 ? 110 GLY A N   1 
ATOM   817  C CA  . GLY A 1 111 ? 6.406   9.070   -11.676 1.00 35.95 ? 110 GLY A CA  1 
ATOM   818  C C   . GLY A 1 111 ? 7.221   7.783   -11.621 1.00 36.27 ? 110 GLY A C   1 
ATOM   819  O O   . GLY A 1 111 ? 8.425   7.785   -11.898 1.00 36.58 ? 110 GLY A O   1 
ATOM   820  N N   . LEU A 1 112 ? 6.576   6.682   -11.251 1.00 34.88 ? 111 LEU A N   1 
ATOM   821  C CA  . LEU A 1 112 ? 7.260   5.394   -11.187 1.00 34.89 ? 111 LEU A CA  1 
ATOM   822  C C   . LEU A 1 112 ? 7.331   4.887   -12.616 1.00 34.83 ? 111 LEU A C   1 
ATOM   823  O O   . LEU A 1 112 ? 6.313   4.486   -13.180 1.00 35.98 ? 111 LEU A O   1 
ATOM   824  C CB  . LEU A 1 112 ? 6.474   4.391   -10.342 1.00 34.26 ? 111 LEU A CB  1 
ATOM   825  C CG  . LEU A 1 112 ? 7.216   3.076   -10.070 1.00 34.10 ? 111 LEU A CG  1 
ATOM   826  C CD1 . LEU A 1 112 ? 8.393   3.376   -9.150  1.00 33.62 ? 111 LEU A CD1 1 
ATOM   827  C CD2 . LEU A 1 112 ? 6.300   2.052   -9.417  1.00 34.03 ? 111 LEU A CD2 1 
ATOM   828  N N   . GLU A 1 113 ? 8.521   4.907   -13.206 1.00 34.61 ? 112 GLU A N   1 
ATOM   829  C CA  . GLU A 1 113 ? 8.670   4.456   -14.586 1.00 34.94 ? 112 GLU A CA  1 
ATOM   830  C C   . GLU A 1 113 ? 10.118  4.193   -14.936 1.00 33.49 ? 112 GLU A C   1 
ATOM   831  O O   . GLU A 1 113 ? 11.026  4.681   -14.274 1.00 32.96 ? 112 GLU A O   1 
ATOM   832  C CB  . GLU A 1 113 ? 8.129   5.518   -15.541 1.00 37.22 ? 112 GLU A CB  1 
ATOM   833  C CG  . GLU A 1 113 ? 8.887   6.819   -15.406 1.00 40.28 ? 112 GLU A CG  1 
ATOM   834  C CD  . GLU A 1 113 ? 8.422   7.874   -16.374 1.00 42.20 ? 112 GLU A CD  1 
ATOM   835  O OE1 . GLU A 1 113 ? 8.728   7.769   -17.583 1.00 44.51 ? 112 GLU A OE1 1 
ATOM   836  O OE2 . GLU A 1 113 ? 7.737   8.805   -15.917 1.00 44.97 ? 112 GLU A OE2 1 
ATOM   837  N N   . PRO A 1 114 ? 10.355  3.422   -16.003 1.00 32.99 ? 113 PRO A N   1 
ATOM   838  C CA  . PRO A 1 114 ? 11.731  3.133   -16.396 1.00 32.61 ? 113 PRO A CA  1 
ATOM   839  C C   . PRO A 1 114 ? 12.522  4.446   -16.467 1.00 32.28 ? 113 PRO A C   1 
ATOM   840  O O   . PRO A 1 114 ? 12.044  5.436   -17.024 1.00 33.41 ? 113 PRO A O   1 
ATOM   841  C CB  . PRO A 1 114 ? 11.545  2.451   -17.751 1.00 33.04 ? 113 PRO A CB  1 
ATOM   842  C CG  . PRO A 1 114 ? 10.237  1.669   -17.525 1.00 33.14 ? 113 PRO A CG  1 
ATOM   843  C CD  . PRO A 1 114 ? 9.403   2.799   -16.943 1.00 33.83 ? 113 PRO A CD  1 
ATOM   844  N N   . GLY A 1 115 ? 13.706  4.464   -15.857 1.00 31.08 ? 114 GLY A N   1 
ATOM   845  C CA  . GLY A 1 115 ? 14.527  5.666   -15.870 1.00 29.47 ? 114 GLY A CA  1 
ATOM   846  C C   . GLY A 1 115 ? 14.379  6.503   -14.612 1.00 27.80 ? 114 GLY A C   1 
ATOM   847  O O   . GLY A 1 115 ? 15.303  7.224   -14.211 1.00 28.45 ? 114 GLY A O   1 
ATOM   848  N N   . GLY A 1 116 ? 13.213  6.410   -13.990 1.00 26.61 ? 115 GLY A N   1 
ATOM   849  C CA  . GLY A 1 116 ? 12.954  7.170   -12.786 1.00 25.35 ? 115 GLY A CA  1 
ATOM   850  C C   . GLY A 1 116 ? 13.868  6.767   -11.646 1.00 24.86 ? 115 GLY A C   1 
ATOM   851  O O   . GLY A 1 116 ? 14.411  5.660   -11.638 1.00 22.71 ? 115 GLY A O   1 
ATOM   852  N N   . GLU A 1 117 ? 14.043  7.686   -10.698 1.00 22.42 ? 116 GLU A N   1 
ATOM   853  C CA  . GLU A 1 117 ? 14.871  7.461   -9.530  1.00 22.14 ? 116 GLU A CA  1 
ATOM   854  C C   . GLU A 1 117 ? 13.942  7.188   -8.371  1.00 21.27 ? 116 GLU A C   1 
ATOM   855  O O   . GLU A 1 117 ? 12.872  7.781   -8.267  1.00 22.19 ? 116 GLU A O   1 
ATOM   856  C CB  . GLU A 1 117 ? 15.727  8.694   -9.197  1.00 24.50 ? 116 GLU A CB  1 
ATOM   857  C CG  . GLU A 1 117 ? 16.658  8.456   -8.012  1.00 28.04 ? 116 GLU A CG  1 
ATOM   858  C CD  . GLU A 1 117 ? 17.553  9.639   -7.665  1.00 30.75 ? 116 GLU A CD  1 
ATOM   859  O OE1 . GLU A 1 117 ? 18.408  9.469   -6.766  1.00 33.85 ? 116 GLU A OE1 1 
ATOM   860  O OE2 . GLU A 1 117 ? 17.409  10.723  -8.269  1.00 31.71 ? 116 GLU A OE2 1 
ATOM   861  N N   . VAL A 1 118 ? 14.348  6.282   -7.494  1.00 20.46 ? 117 VAL A N   1 
ATOM   862  C CA  . VAL A 1 118 ? 13.539  5.952   -6.336  1.00 18.81 ? 117 VAL A CA  1 
ATOM   863  C C   . VAL A 1 118 ? 14.440  5.852   -5.098  1.00 19.20 ? 117 VAL A C   1 
ATOM   864  O O   . VAL A 1 118 ? 15.641  5.594   -5.206  1.00 19.69 ? 117 VAL A O   1 
ATOM   865  C CB  . VAL A 1 118 ? 12.837  4.580   -6.519  1.00 18.99 ? 117 VAL A CB  1 
ATOM   866  C CG1 . VAL A 1 118 ? 11.962  4.609   -7.777  1.00 19.28 ? 117 VAL A CG1 1 
ATOM   867  C CG2 . VAL A 1 118 ? 13.883  3.467   -6.631  1.00 19.30 ? 117 VAL A CG2 1 
ATOM   868  N N   . GLU A 1 119 ? 13.856  6.124   -3.939  1.00 19.83 ? 118 GLU A N   1 
ATOM   869  C CA  . GLU A 1 119 ? 14.544  5.950   -2.680  1.00 19.22 ? 118 GLU A CA  1 
ATOM   870  C C   . GLU A 1 119 ? 13.917  4.649   -2.211  1.00 18.17 ? 118 GLU A C   1 
ATOM   871  O O   . GLU A 1 119 ? 12.705  4.454   -2.348  1.00 17.84 ? 118 GLU A O   1 
ATOM   872  C CB  . GLU A 1 119 ? 14.194  7.043   -1.679  1.00 20.25 ? 118 GLU A CB  1 
ATOM   873  C CG  . GLU A 1 119 ? 14.848  8.369   -1.993  1.00 24.48 ? 118 GLU A CG  1 
ATOM   874  C CD  . GLU A 1 119 ? 14.276  9.536   -1.194  1.00 27.10 ? 118 GLU A CD  1 
ATOM   875  O OE1 . GLU A 1 119 ? 14.816  10.659  -1.318  1.00 29.88 ? 118 GLU A OE1 1 
ATOM   876  O OE2 . GLU A 1 119 ? 13.292  9.336   -0.452  1.00 28.90 ? 118 GLU A OE2 1 
ATOM   877  N N   . TYR A 1 120 ? 14.738  3.744   -1.697  1.00 18.05 ? 119 TYR A N   1 
ATOM   878  C CA  . TYR A 1 120 ? 14.220  2.473   -1.212  1.00 16.27 ? 119 TYR A CA  1 
ATOM   879  C C   . TYR A 1 120 ? 15.017  2.079   0.020   1.00 17.89 ? 119 TYR A C   1 
ATOM   880  O O   . TYR A 1 120 ? 16.142  2.568   0.235   1.00 17.25 ? 119 TYR A O   1 
ATOM   881  C CB  . TYR A 1 120 ? 14.273  1.383   -2.309  1.00 15.46 ? 119 TYR A CB  1 
ATOM   882  C CG  . TYR A 1 120 ? 15.631  0.788   -2.598  1.00 17.02 ? 119 TYR A CG  1 
ATOM   883  C CD1 . TYR A 1 120 ? 16.040  -0.375  -1.967  1.00 17.21 ? 119 TYR A CD1 1 
ATOM   884  C CD2 . TYR A 1 120 ? 16.489  1.368   -3.534  1.00 18.70 ? 119 TYR A CD2 1 
ATOM   885  C CE1 . TYR A 1 120 ? 17.260  -0.959  -2.253  1.00 18.29 ? 119 TYR A CE1 1 
ATOM   886  C CE2 . TYR A 1 120 ? 17.724  0.790   -3.831  1.00 18.58 ? 119 TYR A CE2 1 
ATOM   887  C CZ  . TYR A 1 120 ? 18.098  -0.375  -3.181  1.00 19.43 ? 119 TYR A CZ  1 
ATOM   888  O OH  . TYR A 1 120 ? 19.326  -0.937  -3.415  1.00 18.99 ? 119 TYR A OH  1 
ATOM   889  N N   . ILE A 1 121 ? 14.433  1.225   0.844   1.00 17.45 ? 120 ILE A N   1 
ATOM   890  C CA  . ILE A 1 121 ? 15.119  0.826   2.053   1.00 16.93 ? 120 ILE A CA  1 
ATOM   891  C C   . ILE A 1 121 ? 15.242  -0.689  2.132   1.00 16.52 ? 120 ILE A C   1 
ATOM   892  O O   . ILE A 1 121 ? 14.511  -1.430  1.475   1.00 16.01 ? 120 ILE A O   1 
ATOM   893  C CB  . ILE A 1 121 ? 14.371  1.299   3.324   1.00 17.31 ? 120 ILE A CB  1 
ATOM   894  C CG1 . ILE A 1 121 ? 12.959  0.675   3.392   1.00 18.38 ? 120 ILE A CG1 1 
ATOM   895  C CG2 . ILE A 1 121 ? 14.275  2.817   3.334   1.00 18.87 ? 120 ILE A CG2 1 
ATOM   896  C CD1 . ILE A 1 121 ? 12.217  0.953   4.709   1.00 19.27 ? 120 ILE A CD1 1 
ATOM   897  N N   . GLU A 1 122 ? 16.204  -1.109  2.937   1.00 17.39 ? 121 GLU A N   1 
ATOM   898  C CA  . GLU A 1 122 ? 16.437  -2.505  3.246   1.00 17.97 ? 121 GLU A CA  1 
ATOM   899  C C   . GLU A 1 122 ? 16.455  -2.514  4.759   1.00 18.21 ? 121 GLU A C   1 
ATOM   900  O O   . GLU A 1 122 ? 17.071  -1.660  5.372   1.00 20.07 ? 121 GLU A O   1 
ATOM   901  C CB  . GLU A 1 122 ? 17.799  -2.977  2.733   1.00 19.36 ? 121 GLU A CB  1 
ATOM   902  C CG  . GLU A 1 122 ? 18.159  -4.433  3.097   1.00 21.14 ? 121 GLU A CG  1 
ATOM   903  C CD  . GLU A 1 122 ? 18.832  -4.556  4.472   1.00 20.89 ? 121 GLU A CD  1 
ATOM   904  O OE1 . GLU A 1 122 ? 19.765  -3.778  4.729   1.00 21.80 ? 121 GLU A OE1 1 
ATOM   905  O OE2 . GLU A 1 122 ? 18.450  -5.425  5.278   1.00 20.66 ? 121 GLU A OE2 1 
ATOM   906  N N   . ALA A 1 123 ? 15.753  -3.459  5.352   1.00 17.49 ? 122 ALA A N   1 
ATOM   907  C CA  . ALA A 1 123 ? 15.742  -3.607  6.799   1.00 19.11 ? 122 ALA A CA  1 
ATOM   908  C C   . ALA A 1 123 ? 15.562  -5.105  6.982   1.00 17.99 ? 122 ALA A C   1 
ATOM   909  O O   . ALA A 1 123 ? 14.704  -5.695  6.348   1.00 19.07 ? 122 ALA A O   1 
ATOM   910  C CB  . ALA A 1 123 ? 14.572  -2.857  7.412   1.00 18.91 ? 122 ALA A CB  1 
ATOM   911  N N   . VAL A 1 124 ? 16.369  -5.696  7.861   1.00 19.91 ? 123 VAL A N   1 
ATOM   912  C CA  . VAL A 1 124 ? 16.338  -7.128  8.137   1.00 19.50 ? 123 VAL A CA  1 
ATOM   913  C C   . VAL A 1 124 ? 16.104  -8.018  6.916   1.00 20.80 ? 123 VAL A C   1 
ATOM   914  O O   . VAL A 1 124 ? 15.347  -8.988  6.948   1.00 22.23 ? 123 VAL A O   1 
ATOM   915  C CB  . VAL A 1 124 ? 15.332  -7.488  9.288   1.00 17.69 ? 123 VAL A CB  1 
ATOM   916  C CG1 . VAL A 1 124 ? 15.838  -6.877  10.607  1.00 13.95 ? 123 VAL A CG1 1 
ATOM   917  C CG2 . VAL A 1 124 ? 13.918  -7.020  8.961   1.00 17.77 ? 123 VAL A CG2 1 
ATOM   918  N N   . GLY A 1 125 ? 16.783  -7.673  5.831   1.00 22.24 ? 124 GLY A N   1 
ATOM   919  C CA  . GLY A 1 125 ? 16.694  -8.477  4.629   1.00 23.79 ? 124 GLY A CA  1 
ATOM   920  C C   . GLY A 1 125 ? 15.515  -8.240  3.706   1.00 24.19 ? 124 GLY A C   1 
ATOM   921  O O   . GLY A 1 125 ? 15.415  -8.904  2.673   1.00 25.55 ? 124 GLY A O   1 
ATOM   922  N N   . GLN A 1 126 ? 14.617  -7.329  4.066   1.00 21.63 ? 125 GLN A N   1 
ATOM   923  C CA  . GLN A 1 126 ? 13.467  -7.039  3.212   1.00 20.38 ? 125 GLN A CA  1 
ATOM   924  C C   . GLN A 1 126 ? 13.598  -5.657  2.597   1.00 18.96 ? 125 GLN A C   1 
ATOM   925  O O   . GLN A 1 126 ? 14.270  -4.796  3.154   1.00 16.97 ? 125 GLN A O   1 
ATOM   926  C CB  . GLN A 1 126 ? 12.186  -7.157  4.005   1.00 20.89 ? 125 GLN A CB  1 
ATOM   927  C CG  . GLN A 1 126 ? 11.946  -8.588  4.476   1.00 25.14 ? 125 GLN A CG  1 
ATOM   928  C CD  . GLN A 1 126 ? 10.626  -8.743  5.156   1.00 25.60 ? 125 GLN A CD  1 
ATOM   929  O OE1 . GLN A 1 126 ? 9.572   -8.580  4.536   1.00 26.94 ? 125 GLN A OE1 1 
ATOM   930  N NE2 . GLN A 1 126 ? 10.664  -9.043  6.445   1.00 25.82 ? 125 GLN A NE2 1 
ATOM   931  N N   . TYR A 1 127 ? 12.957  -5.459  1.447   1.00 17.86 ? 126 TYR A N   1 
ATOM   932  C CA  . TYR A 1 127 ? 13.063  -4.191  0.719   1.00 19.09 ? 126 TYR A CA  1 
ATOM   933  C C   . TYR A 1 127 ? 11.738  -3.579  0.282   1.00 17.69 ? 126 TYR A C   1 
ATOM   934  O O   . TYR A 1 127 ? 10.783  -4.295  -0.007  1.00 18.18 ? 126 TYR A O   1 
ATOM   935  C CB  . TYR A 1 127 ? 13.862  -4.383  -0.571  1.00 19.84 ? 126 TYR A CB  1 
ATOM   936  C CG  . TYR A 1 127 ? 15.238  -4.981  -0.422  1.00 21.83 ? 126 TYR A CG  1 
ATOM   937  C CD1 . TYR A 1 127 ? 15.412  -6.340  -0.143  1.00 23.15 ? 126 TYR A CD1 1 
ATOM   938  C CD2 . TYR A 1 127 ? 16.365  -4.185  -0.562  1.00 23.40 ? 126 TYR A CD2 1 
ATOM   939  C CE1 . TYR A 1 127 ? 16.696  -6.883  -0.012  1.00 25.85 ? 126 TYR A CE1 1 
ATOM   940  C CE2 . TYR A 1 127 ? 17.652  -4.712  -0.433  1.00 26.35 ? 126 TYR A CE2 1 
ATOM   941  C CZ  . TYR A 1 127 ? 17.807  -6.056  -0.159  1.00 25.37 ? 126 TYR A CZ  1 
ATOM   942  O OH  . TYR A 1 127 ? 19.075  -6.558  -0.026  1.00 28.45 ? 126 TYR A OH  1 
ATOM   943  N N   . LYS A 1 128 ? 11.712  -2.252  0.181   1.00 18.63 ? 127 LYS A N   1 
ATOM   944  C CA  . LYS A 1 128 ? 10.520  -1.565  -0.296  1.00 18.74 ? 127 LYS A CA  1 
ATOM   945  C C   . LYS A 1 128 ? 10.904  -0.176  -0.808  1.00 17.49 ? 127 LYS A C   1 
ATOM   946  O O   . LYS A 1 128 ? 11.794  0.456   -0.259  1.00 16.05 ? 127 LYS A O   1 
ATOM   947  C CB  . LYS A 1 128 ? 9.501   -1.382  0.821   1.00 22.25 ? 127 LYS A CB  1 
ATOM   948  C CG  . LYS A 1 128 ? 9.953   -0.364  1.835   1.00 24.39 ? 127 LYS A CG  1 
ATOM   949  C CD  . LYS A 1 128 ? 8.821   0.533   2.294   1.00 29.46 ? 127 LYS A CD  1 
ATOM   950  C CE  . LYS A 1 128 ? 7.733   -0.214  3.002   1.00 29.96 ? 127 LYS A CE  1 
ATOM   951  N NZ  . LYS A 1 128 ? 6.789   0.740   3.690   1.00 31.77 ? 127 LYS A NZ  1 
ATOM   952  N N   . ILE A 1 129 ? 10.246  0.278   -1.872  1.00 17.59 ? 128 ILE A N   1 
ATOM   953  C CA  . ILE A 1 129 ? 10.491  1.619   -2.413  1.00 18.19 ? 128 ILE A CA  1 
ATOM   954  C C   . ILE A 1 129 ? 9.758   2.560   -1.467  1.00 19.32 ? 128 ILE A C   1 
ATOM   955  O O   . ILE A 1 129 ? 8.598   2.314   -1.129  1.00 18.37 ? 128 ILE A O   1 
ATOM   956  C CB  . ILE A 1 129 ? 9.893   1.767   -3.829  1.00 18.50 ? 128 ILE A CB  1 
ATOM   957  C CG1 . ILE A 1 129 ? 10.679  0.915   -4.818  1.00 19.03 ? 128 ILE A CG1 1 
ATOM   958  C CG2 . ILE A 1 129 ? 9.926   3.244   -4.250  1.00 18.85 ? 128 ILE A CG2 1 
ATOM   959  C CD1 . ILE A 1 129 ? 9.980   0.725   -6.193  1.00 19.17 ? 128 ILE A CD1 1 
ATOM   960  N N   . THR A 1 130 ? 10.412  3.636   -1.044  1.00 20.21 ? 129 THR A N   1 
ATOM   961  C CA  . THR A 1 130 ? 9.784   4.564   -0.111  1.00 21.84 ? 129 THR A CA  1 
ATOM   962  C C   . THR A 1 130 ? 9.380   5.893   -0.734  1.00 22.79 ? 129 THR A C   1 
ATOM   963  O O   . THR A 1 130 ? 8.546   6.617   -0.173  1.00 21.95 ? 129 THR A O   1 
ATOM   964  C CB  . THR A 1 130 ? 10.703  4.874   1.066   1.00 21.45 ? 129 THR A CB  1 
ATOM   965  O OG1 . THR A 1 130 ? 11.973  5.286   0.561   1.00 21.89 ? 129 THR A OG1 1 
ATOM   966  C CG2 . THR A 1 130 ? 10.871  3.647   1.960   1.00 21.57 ? 129 THR A CG2 1 
ATOM   967  N N   . ARG A 1 131 ? 9.977   6.228   -1.870  1.00 23.64 ? 130 ARG A N   1 
ATOM   968  C CA  . ARG A 1 131 ? 9.606   7.477   -2.526  1.00 27.71 ? 130 ARG A CA  1 
ATOM   969  C C   . ARG A 1 131 ? 10.070  7.526   -3.970  1.00 29.39 ? 130 ARG A C   1 
ATOM   970  O O   . ARG A 1 131 ? 11.123  7.011   -4.300  1.00 25.54 ? 130 ARG A O   1 
ATOM   971  C CB  . ARG A 1 131 ? 10.171  8.660   -1.739  1.00 30.34 ? 130 ARG A CB  1 
ATOM   972  C CG  . ARG A 1 131 ? 9.877   10.016  -2.345  1.00 35.07 ? 130 ARG A CG  1 
ATOM   973  C CD  . ARG A 1 131 ? 10.400  11.156  -1.472  1.00 38.47 ? 130 ARG A CD  1 
ATOM   974  N NE  . ARG A 1 131 ? 10.412  12.406  -2.220  1.00 42.80 ? 130 ARG A NE  1 
ATOM   975  C CZ  . ARG A 1 131 ? 11.167  12.607  -3.296  1.00 44.45 ? 130 ARG A CZ  1 
ATOM   976  N NH1 . ARG A 1 131 ? 11.968  11.638  -3.737  1.00 45.75 ? 130 ARG A NH1 1 
ATOM   977  N NH2 . ARG A 1 131 ? 11.110  13.764  -3.950  1.00 47.66 ? 130 ARG A NH2 1 
ATOM   978  N N   . VAL A 1 132 ? 9.260   8.124   -4.838  1.00 33.30 ? 131 VAL A N   1 
ATOM   979  C CA  . VAL A 1 132 ? 9.640   8.232   -6.240  1.00 38.72 ? 131 VAL A CA  1 
ATOM   980  C C   . VAL A 1 132 ? 10.199  9.619   -6.515  1.00 42.39 ? 131 VAL A C   1 
ATOM   981  O O   . VAL A 1 132 ? 9.658   10.617  -6.033  1.00 43.76 ? 131 VAL A O   1 
ATOM   982  C CB  . VAL A 1 132 ? 8.455   7.977   -7.183  1.00 39.32 ? 131 VAL A CB  1 
ATOM   983  C CG1 . VAL A 1 132 ? 8.898   8.180   -8.621  1.00 39.35 ? 131 VAL A CG1 1 
ATOM   984  C CG2 . VAL A 1 132 ? 7.938   6.573   -6.999  1.00 38.72 ? 131 VAL A CG2 1 
ATOM   985  N N   . ILE A 1 133 ? 11.288  9.655   -7.280  1.00 45.29 ? 132 ILE A N   1 
ATOM   986  C CA  . ILE A 1 133 ? 11.988  10.879  -7.661  1.00 47.81 ? 132 ILE A CA  1 
ATOM   987  C C   . ILE A 1 133 ? 12.852  11.416  -6.533  1.00 48.14 ? 132 ILE A C   1 
ATOM   988  O O   . ILE A 1 133 ? 13.868  10.816  -6.180  1.00 48.82 ? 132 ILE A O   1 
ATOM   989  C CB  . ILE A 1 133 ? 11.003  11.983  -8.117  1.00 49.17 ? 132 ILE A CB  1 
ATOM   990  C CG1 . ILE A 1 133 ? 10.314  11.555  -9.413  1.00 49.62 ? 132 ILE A CG1 1 
ATOM   991  C CG2 . ILE A 1 133 ? 11.740  13.298  -8.301  1.00 50.21 ? 132 ILE A CG2 1 
ATOM   992  C CD1 . ILE A 1 133 ? 9.337   12.581  -9.965  1.00 50.65 ? 132 ILE A CD1 1 
HETATM 993  O O   . HOH B 2 .   ? 9.080   5.939   23.933  1.00 15.60 ? 136 HOH A O   1 
HETATM 994  O O   . HOH B 2 .   ? 8.482   7.760   25.726  1.00 17.11 ? 137 HOH A O   1 
HETATM 995  O O   . HOH B 2 .   ? 5.928   14.404  31.850  1.00 14.91 ? 138 HOH A O   1 
HETATM 996  O O   . HOH B 2 .   ? 2.481   10.681  21.805  1.00 17.74 ? 139 HOH A O   1 
HETATM 997  O O   . HOH B 2 .   ? 1.467   8.593   20.166  1.00 17.16 ? 140 HOH A O   1 
HETATM 998  O O   . HOH B 2 .   ? -5.551  15.923  30.894  1.00 18.73 ? 141 HOH A O   1 
HETATM 999  O O   . HOH B 2 .   ? 32.069  18.714  2.906   1.00 21.05 ? 142 HOH A O   1 
HETATM 1000 O O   . HOH B 2 .   ? 4.363   6.692   12.438  1.00 18.03 ? 143 HOH A O   1 
HETATM 1001 O O   . HOH B 2 .   ? 10.916  9.428   22.814  1.00 21.90 ? 144 HOH A O   1 
HETATM 1002 O O   . HOH B 2 .   ? 10.315  1.522   33.541  1.00 22.50 ? 145 HOH A O   1 
HETATM 1003 O O   . HOH B 2 .   ? 12.671  14.054  16.036  1.00 22.81 ? 146 HOH A O   1 
HETATM 1004 O O   . HOH B 2 .   ? 18.171  2.552   11.258  1.00 25.48 ? 147 HOH A O   1 
HETATM 1005 O O   . HOH B 2 .   ? 8.177   11.614  16.444  1.00 22.71 ? 148 HOH A O   1 
HETATM 1006 O O   . HOH B 2 .   ? 6.011   -1.766  -1.045  1.00 21.02 ? 149 HOH A O   1 
HETATM 1007 O O   . HOH B 2 .   ? 36.289  14.776  5.907   1.00 23.33 ? 150 HOH A O   1 
HETATM 1008 O O   . HOH B 2 .   ? -7.254  17.959  32.837  1.00 24.47 ? 151 HOH A O   1 
HETATM 1009 O O   . HOH B 2 .   ? 5.752   12.056  19.268  1.00 18.46 ? 152 HOH A O   1 
HETATM 1010 O O   . HOH B 2 .   ? 0.087   3.243   22.298  1.00 21.98 ? 153 HOH A O   1 
HETATM 1011 O O   . HOH B 2 .   ? -0.127  13.042  19.306  1.00 22.09 ? 154 HOH A O   1 
HETATM 1012 O O   . HOH B 2 .   ? 2.648   12.912  19.951  1.00 20.83 ? 155 HOH A O   1 
HETATM 1013 O O   . HOH B 2 .   ? 22.873  3.877   2.164   1.00 39.03 ? 156 HOH A O   1 
HETATM 1014 O O   . HOH B 2 .   ? 11.447  12.356  21.625  1.00 20.09 ? 157 HOH A O   1 
HETATM 1015 O O   . HOH B 2 .   ? 1.018   12.496  39.953  1.00 27.70 ? 158 HOH A O   1 
HETATM 1016 O O   . HOH B 2 .   ? 19.682  16.755  2.516   1.00 22.03 ? 159 HOH A O   1 
HETATM 1017 O O   . HOH B 2 .   ? -8.619  17.218  37.577  1.00 22.46 ? 160 HOH A O   1 
HETATM 1018 O O   . HOH B 2 .   ? 9.416   11.924  18.621  1.00 20.20 ? 161 HOH A O   1 
HETATM 1019 O O   . HOH B 2 .   ? 2.898   -6.672  -16.107 1.00 28.53 ? 162 HOH A O   1 
HETATM 1020 O O   . HOH B 2 .   ? 8.630   -1.795  -17.889 1.00 27.27 ? 163 HOH A O   1 
HETATM 1021 O O   . HOH B 2 .   ? 11.425  9.263   -16.166 1.00 54.31 ? 164 HOH A O   1 
HETATM 1022 O O   . HOH B 2 .   ? 14.435  0.744   -18.858 1.00 44.48 ? 165 HOH A O   1 
HETATM 1023 O O   . HOH B 2 .   ? 13.043  -6.433  -16.557 1.00 63.86 ? 166 HOH A O   1 
HETATM 1024 O O   . HOH B 2 .   ? 3.177   -2.161  -2.137  1.00 35.72 ? 167 HOH A O   1 
HETATM 1025 O O   . HOH B 2 .   ? 6.465   8.830   -4.077  1.00 24.19 ? 168 HOH A O   1 
HETATM 1026 O O   . HOH B 2 .   ? 12.574  9.979   -11.108 1.00 37.08 ? 169 HOH A O   1 
HETATM 1027 O O   . HOH B 2 .   ? 6.318   -3.093  1.223   1.00 34.12 ? 170 HOH A O   1 
HETATM 1028 O O   . HOH B 2 .   ? 8.763   -5.659  1.039   1.00 37.61 ? 171 HOH A O   1 
HETATM 1029 O O   . HOH B 2 .   ? 17.046  -8.527  -10.557 1.00 40.28 ? 172 HOH A O   1 
HETATM 1030 O O   . HOH B 2 .   ? -0.949  12.443  16.573  1.00 53.96 ? 173 HOH A O   1 
HETATM 1031 O O   . HOH B 2 .   ? 7.209   1.821   7.102   1.00 29.31 ? 174 HOH A O   1 
HETATM 1032 O O   . HOH B 2 .   ? 8.696   2.861   5.301   1.00 31.35 ? 175 HOH A O   1 
HETATM 1033 O O   . HOH B 2 .   ? 4.301   9.226   12.217  1.00 26.28 ? 176 HOH A O   1 
HETATM 1034 O O   . HOH B 2 .   ? 13.144  -10.114 0.452   1.00 50.42 ? 177 HOH A O   1 
HETATM 1035 O O   . HOH B 2 .   ? 8.535   5.543   7.457   1.00 33.23 ? 178 HOH A O   1 
HETATM 1036 O O   . HOH B 2 .   ? -2.166  7.074   22.765  1.00 46.59 ? 179 HOH A O   1 
HETATM 1037 O O   . HOH B 2 .   ? 10.712  5.288   5.119   1.00 30.97 ? 180 HOH A O   1 
HETATM 1038 O O   . HOH B 2 .   ? 20.600  11.272  -7.921  1.00 33.71 ? 181 HOH A O   1 
HETATM 1039 O O   . HOH B 2 .   ? -7.220  14.176  32.666  1.00 28.33 ? 182 HOH A O   1 
HETATM 1040 O O   . HOH B 2 .   ? 22.923  -7.281  -10.831 1.00 33.10 ? 183 HOH A O   1 
HETATM 1041 O O   . HOH B 2 .   ? -0.253  11.007  23.227  1.00 25.75 ? 184 HOH A O   1 
HETATM 1042 O O   . HOH B 2 .   ? -0.426  8.630   24.249  1.00 27.20 ? 185 HOH A O   1 
HETATM 1043 O O   . HOH B 2 .   ? 16.493  6.216   0.630   1.00 37.15 ? 186 HOH A O   1 
HETATM 1044 O O   . HOH B 2 .   ? 10.510  -10.564 10.428  1.00 28.73 ? 187 HOH A O   1 
HETATM 1045 O O   . HOH B 2 .   ? 13.318  -10.749 7.241   1.00 40.78 ? 188 HOH A O   1 
HETATM 1046 O O   . HOH B 2 .   ? 0.296   8.279   26.809  1.00 23.75 ? 189 HOH A O   1 
HETATM 1047 O O   . HOH B 2 .   ? 2.702   -6.916  25.345  1.00 22.78 ? 190 HOH A O   1 
HETATM 1048 O O   . HOH B 2 .   ? -3.729  3.497   39.615  1.00 25.85 ? 191 HOH A O   1 
HETATM 1049 O O   . HOH B 2 .   ? 14.181  3.603   14.138  1.00 20.18 ? 192 HOH A O   1 
HETATM 1050 O O   . HOH B 2 .   ? 19.861  4.424   7.188   1.00 48.04 ? 193 HOH A O   1 
HETATM 1051 O O   . HOH B 2 .   ? 16.620  1.921   12.958  1.00 22.04 ? 194 HOH A O   1 
HETATM 1052 O O   . HOH B 2 .   ? 3.157   2.299   36.799  1.00 32.99 ? 195 HOH A O   1 
HETATM 1053 O O   . HOH B 2 .   ? 5.939   11.977  32.482  1.00 26.34 ? 196 HOH A O   1 
HETATM 1054 O O   . HOH B 2 .   ? 10.909  -4.741  26.139  1.00 23.12 ? 197 HOH A O   1 
HETATM 1055 O O   . HOH B 2 .   ? 16.389  3.564   18.228  1.00 25.50 ? 198 HOH A O   1 
HETATM 1056 O O   . HOH B 2 .   ? 20.970  3.153   12.688  1.00 46.60 ? 199 HOH A O   1 
HETATM 1057 O O   . HOH B 2 .   ? 16.005  4.467   20.434  1.00 24.57 ? 200 HOH A O   1 
HETATM 1058 O O   . HOH B 2 .   ? 6.456   -1.303  35.292  1.00 45.72 ? 201 HOH A O   1 
HETATM 1059 O O   . HOH B 2 .   ? 9.667   6.204   32.156  1.00 39.17 ? 202 HOH A O   1 
HETATM 1060 O O   . HOH B 2 .   ? 14.635  5.444   28.196  1.00 28.01 ? 203 HOH A O   1 
HETATM 1061 O O   . HOH B 2 .   ? 18.355  3.559   24.483  1.00 28.68 ? 204 HOH A O   1 
HETATM 1062 O O   . HOH B 2 .   ? 15.190  -5.454  29.272  1.00 28.58 ? 205 HOH A O   1 
HETATM 1063 O O   . HOH B 2 .   ? 13.432  -3.054  32.800  1.00 34.73 ? 206 HOH A O   1 
HETATM 1064 O O   . HOH B 2 .   ? 22.483  -3.628  20.103  1.00 31.80 ? 207 HOH A O   1 
HETATM 1065 O O   . HOH B 2 .   ? -2.619  0.386   12.151  1.00 24.21 ? 208 HOH A O   1 
HETATM 1066 O O   . HOH B 2 .   ? -4.506  8.097   34.584  1.00 26.45 ? 209 HOH A O   1 
HETATM 1067 O O   . HOH B 2 .   ? -9.474  14.809  32.350  1.00 26.94 ? 210 HOH A O   1 
HETATM 1068 O O   . HOH B 2 .   ? 12.340  7.633   0.898   1.00 38.37 ? 211 HOH A O   1 
HETATM 1069 O O   . HOH B 2 .   ? 23.991  10.812  5.529   1.00 34.04 ? 212 HOH A O   1 
HETATM 1070 O O   . HOH B 2 .   ? 5.592   8.134   33.814  1.00 30.56 ? 213 HOH A O   1 
HETATM 1071 O O   . HOH B 2 .   ? -1.018  8.605   20.922  1.00 47.46 ? 214 HOH A O   1 
HETATM 1072 O O   . HOH B 2 .   ? 24.359  18.805  21.207  1.00 37.21 ? 215 HOH A O   1 
HETATM 1073 O O   . HOH B 2 .   ? 6.704   13.005  14.425  1.00 35.71 ? 216 HOH A O   1 
HETATM 1074 O O   . HOH B 2 .   ? 8.878   -5.473  24.092  1.00 26.67 ? 217 HOH A O   1 
HETATM 1075 O O   . HOH B 2 .   ? 16.512  5.549   9.470   1.00 43.90 ? 218 HOH A O   1 
HETATM 1076 O O   . HOH B 2 .   ? 1.142   9.132   17.613  1.00 34.15 ? 219 HOH A O   1 
HETATM 1077 O O   . HOH B 2 .   ? -9.034  16.541  31.210  1.00 32.26 ? 220 HOH A O   1 
HETATM 1078 O O   . HOH B 2 .   ? 12.040  13.617  36.872  1.00 42.96 ? 221 HOH A O   1 
HETATM 1079 O O   . HOH B 2 .   ? 17.904  5.759   26.368  1.00 36.95 ? 222 HOH A O   1 
HETATM 1080 O O   . HOH B 2 .   ? 4.900   0.952   6.605   1.00 34.70 ? 223 HOH A O   1 
HETATM 1081 O O   . HOH B 2 .   ? 3.372   11.795  38.110  1.00 39.08 ? 224 HOH A O   1 
HETATM 1082 O O   . HOH B 2 .   ? 3.860   0.381   1.812   1.00 35.77 ? 225 HOH A O   1 
HETATM 1083 O O   . HOH B 2 .   ? -10.035 12.748  26.542  1.00 36.90 ? 226 HOH A O   1 
HETATM 1084 O O   . HOH B 2 .   ? 6.169   2.978   0.023   1.00 26.96 ? 227 HOH A O   1 
HETATM 1085 O O   . HOH B 2 .   ? 9.404   7.363   28.626  1.00 26.92 ? 228 HOH A O   1 
HETATM 1086 O O   . HOH B 2 .   ? 20.020  13.913  2.871   1.00 34.10 ? 229 HOH A O   1 
HETATM 1087 O O   . HOH B 2 .   ? 20.511  2.129   25.624  1.00 34.60 ? 230 HOH A O   1 
HETATM 1088 O O   . HOH B 2 .   ? 5.990   11.046  34.998  1.00 42.76 ? 231 HOH A O   1 
HETATM 1089 O O   . HOH B 2 .   ? -4.063  5.807   35.986  1.00 35.22 ? 232 HOH A O   1 
HETATM 1090 O O   . HOH B 2 .   ? 10.528  -6.872  27.417  1.00 35.22 ? 233 HOH A O   1 
HETATM 1091 O O   . HOH B 2 .   ? 5.033   12.897  10.289  1.00 35.22 ? 234 HOH A O   1 
HETATM 1092 O O   . HOH B 2 .   ? 8.362   7.618   9.527   1.00 35.22 ? 235 HOH A O   1 
HETATM 1093 O O   . HOH B 2 .   ? 2.534   5.369   7.941   1.00 35.22 ? 236 HOH A O   1 
HETATM 1094 O O   . HOH B 2 .   ? 8.628   11.473  37.309  1.00 35.22 ? 237 HOH A O   1 
HETATM 1095 O O   . HOH B 2 .   ? 4.077   -4.972  -0.795  1.00 35.22 ? 238 HOH A O   1 
HETATM 1096 O O   . HOH B 2 .   ? -11.972 9.772   26.916  1.00 35.22 ? 239 HOH A O   1 
HETATM 1097 O O   . HOH B 2 .   ? 15.688  -9.738  13.427  1.00 35.22 ? 240 HOH A O   1 
HETATM 1098 O O   . HOH B 2 .   ? 5.220   4.993   6.405   1.00 35.22 ? 241 HOH A O   1 
HETATM 1099 O O   . HOH B 2 .   ? -8.340  10.078  39.549  1.00 35.22 ? 242 HOH A O   1 
HETATM 1100 O O   . HOH B 2 .   ? -9.351  15.495  34.608  1.00 35.22 ? 243 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   0   MET ALA A . n 
A 1 2   VAL 2   1   1   VAL ALA A . n 
A 1 3   ILE 3   2   2   ILE ALA A . n 
A 1 4   ILE 4   3   3   ILE ALA A . n 
A 1 5   MET 5   4   4   MET ALA A . n 
A 1 6   PRO 6   5   5   PRO PRO A . n 
A 1 7   GLY 7   6   6   GLY GLY A . n 
A 1 8   THR 8   7   7   THR THR A . n 
A 1 9   LYS 9   8   8   LYS LYS A . n 
A 1 10  GLN 10  9   9   GLN GLN A . n 
A 1 11  VAL 11  10  10  VAL VAL A . n 
A 1 12  ASN 12  11  11  ASN ASN A . n 
A 1 13  VAL 13  12  12  VAL VAL A . n 
A 1 14  GLY 14  13  13  GLY GLY A . n 
A 1 15  SER 15  14  14  SER SER A . n 
A 1 16  LEU 16  15  15  LEU LEU A . n 
A 1 17  LYS 17  16  16  LYS LYS A . n 
A 1 18  VAL 18  17  17  VAL VAL A . n 
A 1 19  GLY 19  18  18  GLY GLY A . n 
A 1 20  GLN 20  19  19  GLN GLN A . n 
A 1 21  TYR 21  20  20  TYR TYR A . n 
A 1 22  VAL 22  21  21  VAL VAL A . n 
A 1 23  MET 23  22  22  MET MET A . n 
A 1 24  ILE 24  23  23  ILE ILE A . n 
A 1 25  ASP 25  24  24  ASP ASP A . n 
A 1 26  GLY 26  25  25  GLY GLY A . n 
A 1 27  VAL 27  26  26  VAL VAL A . n 
A 1 28  PRO 28  27  27  PRO PRO A . n 
A 1 29  CYS 29  28  28  CYS CYS A . n 
A 1 30  GLU 30  29  29  GLU GLU A . n 
A 1 31  ILE 31  30  30  ILE ILE A . n 
A 1 32  VAL 32  31  31  VAL VAL A . n 
A 1 33  ASP 33  32  32  ASP ASP A . n 
A 1 34  ILE 34  33  33  ILE ILE A . n 
A 1 35  SER 35  34  34  SER SER A . n 
A 1 36  VAL 36  35  35  VAL VAL A . n 
A 1 37  SER 37  36  36  SER SER A . n 
A 1 38  LYS 38  37  37  LYS LYS A . n 
A 1 39  PRO 39  38  38  PRO PRO A . n 
A 1 40  GLY 40  39  39  GLY GLY A . n 
A 1 41  LYS 41  40  40  LYS LYS A . n 
A 1 42  HIS 42  41  41  HIS HIS A . n 
A 1 43  GLY 43  42  42  GLY GLY A . n 
A 1 44  GLY 44  43  43  GLY GLY A . n 
A 1 45  ALA 45  44  44  ALA ALA A . n 
A 1 46  LYS 46  45  45  LYS LYS A . n 
A 1 47  ALA 47  46  46  ALA ALA A . n 
A 1 48  ARG 48  47  47  ARG ARG A . n 
A 1 49  VAL 49  48  48  VAL VAL A . n 
A 1 50  VAL 50  49  49  VAL VAL A . n 
A 1 51  GLY 51  50  50  GLY GLY A . n 
A 1 52  ILE 52  51  51  ILE ILE A . n 
A 1 53  GLY 53  52  52  GLY GLY A . n 
A 1 54  ILE 54  53  53  ILE ILE A . n 
A 1 55  PHE 55  54  54  PHE PHE A . n 
A 1 56  GLU 56  55  55  GLU GLU A . n 
A 1 57  LYS 57  56  56  LYS LYS A . n 
A 1 58  VAL 58  57  57  VAL VAL A . n 
A 1 59  LYS 59  58  58  LYS LYS A . n 
A 1 60  LYS 60  59  59  LYS LYS A . n 
A 1 61  GLU 61  60  60  GLU GLU A . n 
A 1 62  PHE 62  61  61  PHE PHE A . n 
A 1 63  VAL 63  62  62  VAL VAL A . n 
A 1 64  ALA 64  63  63  ALA ALA A . n 
A 1 65  PRO 65  64  64  PRO PRO A . n 
A 1 66  THR 66  65  65  THR THR A . n 
A 1 67  SER 67  66  66  SER SER A . n 
A 1 68  SER 68  67  67  SER SER A . n 
A 1 69  LYS 69  68  68  LYS LYS A . n 
A 1 70  VAL 70  69  69  VAL VAL A . n 
A 1 71  GLU 71  70  70  GLU GLU A . n 
A 1 72  VAL 72  71  71  VAL VAL A . n 
A 1 73  PRO 73  72  72  PRO PRO A . n 
A 1 74  ILE 74  73  73  ILE ILE A . n 
A 1 75  ILE 75  74  74  ILE ILE A . n 
A 1 76  ASP 76  75  75  ASP ASP A . n 
A 1 77  ARG 77  76  76  ARG ARG A . n 
A 1 78  ARG 78  77  77  ARG ARG A . n 
A 1 79  LYS 79  78  78  LYS LYS A . n 
A 1 80  GLY 80  79  79  GLY GLY A . n 
A 1 81  GLN 81  80  80  GLN GLN A . n 
A 1 82  VAL 82  81  81  VAL VAL A . n 
A 1 83  LEU 83  82  82  LEU LEU A . n 
A 1 84  ALA 84  83  83  ALA ALA A . n 
A 1 85  ILE 85  84  84  ILE ILE A . n 
A 1 86  MET 86  85  85  MET MET A . n 
A 1 87  GLY 87  86  86  GLY GLY A . n 
A 1 88  ASP 88  87  87  ASP ASP A . n 
A 1 89  MET 89  88  88  MET MET A . n 
A 1 90  VAL 90  89  89  VAL VAL A . n 
A 1 91  GLN 91  90  90  GLN GLN A . n 
A 1 92  ILE 92  91  91  ILE ILE A . n 
A 1 93  MET 93  92  92  MET MET A . n 
A 1 94  ASP 94  93  93  ASP ASP A . n 
A 1 95  LEU 95  94  94  LEU LEU A . n 
A 1 96  GLN 96  95  95  GLN GLN A . n 
A 1 97  THR 97  96  96  THR THR A . n 
A 1 98  TYR 98  97  97  TYR TYR A . n 
A 1 99  GLU 99  98  98  GLU GLU A . n 
A 1 100 THR 100 99  99  THR THR A . n 
A 1 101 LEU 101 100 100 LEU LEU A . n 
A 1 102 GLU 102 101 101 GLU GLU A . n 
A 1 103 LEU 103 102 102 LEU LEU A . n 
A 1 104 PRO 104 103 103 PRO PRO A . n 
A 1 105 ILE 105 104 104 ILE ILE A . n 
A 1 106 PRO 106 105 105 PRO PRO A . n 
A 1 107 GLU 107 106 106 GLU GLU A . n 
A 1 108 GLY 108 107 107 GLY GLY A . n 
A 1 109 ILE 109 108 108 ILE ILE A . n 
A 1 110 GLU 110 109 109 GLU GLU A . n 
A 1 111 GLY 111 110 110 GLY GLY A . n 
A 1 112 LEU 112 111 111 LEU LEU A . n 
A 1 113 GLU 113 112 112 GLU GLU A . n 
A 1 114 PRO 114 113 113 PRO PRO A . n 
A 1 115 GLY 115 114 114 GLY GLY A . n 
A 1 116 GLY 116 115 115 GLY GLY A . n 
A 1 117 GLU 117 116 116 GLU GLU A . n 
A 1 118 VAL 118 117 117 VAL VAL A . n 
A 1 119 GLU 119 118 118 GLU GLU A . n 
A 1 120 TYR 120 119 119 TYR TYR A . n 
A 1 121 ILE 121 120 120 ILE ILE A . n 
A 1 122 GLU 122 121 121 GLU GLU A . n 
A 1 123 ALA 123 122 122 ALA ALA A . n 
A 1 124 VAL 124 123 123 VAL VAL A . n 
A 1 125 GLY 125 124 124 GLY GLY A . n 
A 1 126 GLN 126 125 125 GLN GLN A . n 
A 1 127 TYR 127 126 126 TYR TYR A . n 
A 1 128 LYS 128 127 127 LYS LYS A . n 
A 1 129 ILE 129 128 128 ILE ILE A . n 
A 1 130 THR 130 129 129 THR THR A . n 
A 1 131 ARG 131 130 130 ARG ARG A . n 
A 1 132 VAL 132 131 131 VAL VAL A . n 
A 1 133 ILE 133 132 132 ILE ILE A . n 
A 1 134 GLY 134 133 ?   ?   ?   A . n 
A 1 135 GLY 135 134 ?   ?   ?   A . n 
A 1 136 LYS 136 135 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'PSI, Protein Structure Initiative' 
_pdbx_SG_project.full_name_of_center   'Berkeley Structural Genomics Center' 
_pdbx_SG_project.initial_of_center     BSGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   136 1   HOH HOH A . 
B 2 HOH 2   137 2   HOH HOH A . 
B 2 HOH 3   138 3   HOH HOH A . 
B 2 HOH 4   139 4   HOH HOH A . 
B 2 HOH 5   140 5   HOH HOH A . 
B 2 HOH 6   141 6   HOH HOH A . 
B 2 HOH 7   142 7   HOH HOH A . 
B 2 HOH 8   143 8   HOH HOH A . 
B 2 HOH 9   144 9   HOH HOH A . 
B 2 HOH 10  145 10  HOH HOH A . 
B 2 HOH 11  146 11  HOH HOH A . 
B 2 HOH 12  147 12  HOH HOH A . 
B 2 HOH 13  148 13  HOH HOH A . 
B 2 HOH 14  149 14  HOH HOH A . 
B 2 HOH 15  150 15  HOH HOH A . 
B 2 HOH 16  151 16  HOH HOH A . 
B 2 HOH 17  152 17  HOH HOH A . 
B 2 HOH 18  153 18  HOH HOH A . 
B 2 HOH 19  154 19  HOH HOH A . 
B 2 HOH 20  155 20  HOH HOH A . 
B 2 HOH 21  156 21  HOH HOH A . 
B 2 HOH 22  157 22  HOH HOH A . 
B 2 HOH 23  158 23  HOH HOH A . 
B 2 HOH 24  159 24  HOH HOH A . 
B 2 HOH 25  160 25  HOH HOH A . 
B 2 HOH 26  161 26  HOH HOH A . 
B 2 HOH 27  162 27  HOH HOH A . 
B 2 HOH 28  163 28  HOH HOH A . 
B 2 HOH 29  164 29  HOH HOH A . 
B 2 HOH 30  165 30  HOH HOH A . 
B 2 HOH 31  166 31  HOH HOH A . 
B 2 HOH 32  167 32  HOH HOH A . 
B 2 HOH 33  168 33  HOH HOH A . 
B 2 HOH 34  169 34  HOH HOH A . 
B 2 HOH 35  170 35  HOH HOH A . 
B 2 HOH 36  171 36  HOH HOH A . 
B 2 HOH 37  172 37  HOH HOH A . 
B 2 HOH 38  173 38  HOH HOH A . 
B 2 HOH 39  174 39  HOH HOH A . 
B 2 HOH 40  175 40  HOH HOH A . 
B 2 HOH 41  176 41  HOH HOH A . 
B 2 HOH 42  177 42  HOH HOH A . 
B 2 HOH 43  178 43  HOH HOH A . 
B 2 HOH 44  179 44  HOH HOH A . 
B 2 HOH 45  180 45  HOH HOH A . 
B 2 HOH 46  181 46  HOH HOH A . 
B 2 HOH 47  182 47  HOH HOH A . 
B 2 HOH 48  183 48  HOH HOH A . 
B 2 HOH 49  184 49  HOH HOH A . 
B 2 HOH 50  185 50  HOH HOH A . 
B 2 HOH 51  186 51  HOH HOH A . 
B 2 HOH 52  187 52  HOH HOH A . 
B 2 HOH 53  188 53  HOH HOH A . 
B 2 HOH 54  189 54  HOH HOH A . 
B 2 HOH 55  190 55  HOH HOH A . 
B 2 HOH 56  191 56  HOH HOH A . 
B 2 HOH 57  192 57  HOH HOH A . 
B 2 HOH 58  193 58  HOH HOH A . 
B 2 HOH 59  194 59  HOH HOH A . 
B 2 HOH 60  195 60  HOH HOH A . 
B 2 HOH 61  196 61  HOH HOH A . 
B 2 HOH 62  197 62  HOH HOH A . 
B 2 HOH 63  198 63  HOH HOH A . 
B 2 HOH 64  199 64  HOH HOH A . 
B 2 HOH 65  200 65  HOH HOH A . 
B 2 HOH 66  201 66  HOH HOH A . 
B 2 HOH 67  202 67  HOH HOH A . 
B 2 HOH 68  203 68  HOH HOH A . 
B 2 HOH 69  204 69  HOH HOH A . 
B 2 HOH 70  205 70  HOH HOH A . 
B 2 HOH 71  206 71  HOH HOH A . 
B 2 HOH 72  207 72  HOH HOH A . 
B 2 HOH 73  208 73  HOH HOH A . 
B 2 HOH 74  209 74  HOH HOH A . 
B 2 HOH 75  210 75  HOH HOH A . 
B 2 HOH 76  211 76  HOH HOH A . 
B 2 HOH 77  212 77  HOH HOH A . 
B 2 HOH 78  213 78  HOH HOH A . 
B 2 HOH 79  214 79  HOH HOH A . 
B 2 HOH 80  215 80  HOH HOH A . 
B 2 HOH 81  216 81  HOH HOH A . 
B 2 HOH 82  217 82  HOH HOH A . 
B 2 HOH 83  218 83  HOH HOH A . 
B 2 HOH 84  219 84  HOH HOH A . 
B 2 HOH 85  220 85  HOH HOH A . 
B 2 HOH 86  221 86  HOH HOH A . 
B 2 HOH 87  222 87  HOH HOH A . 
B 2 HOH 88  223 88  HOH HOH A . 
B 2 HOH 89  224 89  HOH HOH A . 
B 2 HOH 90  225 90  HOH HOH A . 
B 2 HOH 91  226 91  HOH HOH A . 
B 2 HOH 92  227 92  HOH HOH A . 
B 2 HOH 93  228 93  HOH HOH A . 
B 2 HOH 94  229 94  HOH HOH A . 
B 2 HOH 95  230 95  HOH HOH A . 
B 2 HOH 96  231 96  HOH HOH A . 
B 2 HOH 97  232 97  HOH HOH A . 
B 2 HOH 98  233 98  HOH HOH A . 
B 2 HOH 99  234 99  HOH HOH A . 
B 2 HOH 100 235 100 HOH HOH A . 
B 2 HOH 101 236 101 HOH HOH A . 
B 2 HOH 102 237 102 HOH HOH A . 
B 2 HOH 103 238 103 HOH HOH A . 
B 2 HOH 104 239 104 HOH HOH A . 
B 2 HOH 105 240 105 HOH HOH A . 
B 2 HOH 106 241 106 HOH HOH A . 
B 2 HOH 107 242 107 HOH HOH A . 
B 2 HOH 108 243 108 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-10-12 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Source and taxonomy'       
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CCP4      'model building' .   ? 1 
CNS       refinement       0.3 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
CCP4      phasing          .   ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    210 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    220 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.12 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 VAL A 1   ? ? 65.98  144.37 
2 1 MET A 4   ? ? -35.64 142.77 
3 1 LYS A 40  ? ? 175.53 -1.45  
4 1 VAL A 123 ? ? 38.45  42.93  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A MET 0 ? CG  ? A MET 1 CG  
2  1 Y 1 A MET 0 ? SD  ? A MET 1 SD  
3  1 Y 1 A MET 0 ? CE  ? A MET 1 CE  
4  1 Y 1 A VAL 1 ? CG1 ? A VAL 2 CG1 
5  1 Y 1 A VAL 1 ? CG2 ? A VAL 2 CG2 
6  1 Y 1 A ILE 2 ? CG1 ? A ILE 3 CG1 
7  1 Y 1 A ILE 2 ? CG2 ? A ILE 3 CG2 
8  1 Y 1 A ILE 2 ? CD1 ? A ILE 3 CD1 
9  1 Y 1 A ILE 3 ? CG1 ? A ILE 4 CG1 
10 1 Y 1 A ILE 3 ? CG2 ? A ILE 4 CG2 
11 1 Y 1 A ILE 3 ? CD1 ? A ILE 4 CD1 
12 1 Y 1 A MET 4 ? CG  ? A MET 5 CG  
13 1 Y 1 A MET 4 ? SD  ? A MET 5 SD  
14 1 Y 1 A MET 4 ? CE  ? A MET 5 CE  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 133 ? A GLY 134 
2 1 Y 1 A GLY 134 ? A GLY 135 
3 1 Y 1 A LYS 135 ? A LYS 136 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#