data_2EN7
# 
_entry.id   2EN7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2EN7         pdb_00002en7 10.2210/pdb2en7/pdb 
RCSB  RCSB026870   ?            ?                   
WWPDB D_1000026870 ?            ?                   
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hso003011774.11 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2EN7 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-28 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tochio, N.'                                             1  
'Tomizawa, T.'                                           2  
'Abe, H.'                                                3  
'Saito, K.'                                              4  
'Li, H.'                                                 5  
'Sato, M.'                                               6  
'Koshiba, S.'                                            7  
'Kobayashi, N.'                                          8  
'Kigawa, T.'                                             9  
'Yokoyama, S.'                                           10 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 11 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of the C2H2 type zinc finger (region 495-525) of human Zinc finger protein 268' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Tochio, N.'    1  ? 
primary 'Tomizawa, T.'  2  ? 
primary 'Abe, H.'       3  ? 
primary 'Saito, K.'     4  ? 
primary 'Li, H.'        5  ? 
primary 'Sato, M.'      6  ? 
primary 'Koshiba, S.'   7  ? 
primary 'Kobayashi, N.' 8  ? 
primary 'Kigawa, T.'    9  ? 
primary 'Yokoyama, S.'  10 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Zinc finger protein 268' 4528.010 1 ? ? zf-C2H2 ? 
2 non-polymer syn 'ZINC ION'                65.409   1 ? ? ?       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Zinc finger protein HZF3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSSGSSGTGMKPYVCNECGKAFRSKSYLIIHTRTHTGESGPSSG 
_entity_poly.pdbx_seq_one_letter_code_can   GSSGSSGTGMKPYVCNECGKAFRSKSYLIIHTRTHTGESGPSSG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hso003011774.11 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  THR n 
1 9  GLY n 
1 10 MET n 
1 11 LYS n 
1 12 PRO n 
1 13 TYR n 
1 14 VAL n 
1 15 CYS n 
1 16 ASN n 
1 17 GLU n 
1 18 CYS n 
1 19 GLY n 
1 20 LYS n 
1 21 ALA n 
1 22 PHE n 
1 23 ARG n 
1 24 SER n 
1 25 LYS n 
1 26 SER n 
1 27 TYR n 
1 28 LEU n 
1 29 ILE n 
1 30 ILE n 
1 31 HIS n 
1 32 THR n 
1 33 ARG n 
1 34 THR n 
1 35 HIS n 
1 36 THR n 
1 37 GLY n 
1 38 GLU n 
1 39 SER n 
1 40 GLY n 
1 41 PRO n 
1 42 SER n 
1 43 SER n 
1 44 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ZNF268 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P061218-09 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ZN268_HUMAN 
_struct_ref.pdbx_db_accession          Q14587 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   TGMKPYVCNECGKAFRSKSYLIIHTRTHTGE 
_struct_ref.pdbx_align_begin           495 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2EN7 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 38 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q14587 
_struct_ref_seq.db_align_beg                  495 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  525 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       38 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2EN7 GLY A 1  ? UNP Q14587 ? ? 'expression tag' 1  1  
1 2EN7 SER A 2  ? UNP Q14587 ? ? 'expression tag' 2  2  
1 2EN7 SER A 3  ? UNP Q14587 ? ? 'expression tag' 3  3  
1 2EN7 GLY A 4  ? UNP Q14587 ? ? 'expression tag' 4  4  
1 2EN7 SER A 5  ? UNP Q14587 ? ? 'expression tag' 5  5  
1 2EN7 SER A 6  ? UNP Q14587 ? ? 'expression tag' 6  6  
1 2EN7 GLY A 7  ? UNP Q14587 ? ? 'expression tag' 7  7  
1 2EN7 SER A 39 ? UNP Q14587 ? ? 'expression tag' 39 8  
1 2EN7 GLY A 40 ? UNP Q14587 ? ? 'expression tag' 40 9  
1 2EN7 PRO A 41 ? UNP Q14587 ? ? 'expression tag' 41 10 
1 2EN7 SER A 42 ? UNP Q14587 ? ? 'expression tag' 42 11 
1 2EN7 SER A 43 ? UNP Q14587 ? ? 'expression tag' 43 12 
1 2EN7 GLY A 44 ? UNP Q14587 ? ? 'expression tag' 44 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         296 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'about 1.0mM sample U-15N,13C; 20mM d-Tris-HCl; 100mM NaCl; 0.05mM ZnCl2; 1mM IDA; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             AVANCE 
_pdbx_nmr_spectrometer.field_strength    900 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.entry_id           2EN7 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations, target function' 
_pdbx_nmr_ensemble.entry_id                                      2EN7 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
_pdbx_nmr_representative.entry_id             2EN7 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XwinNMR 3.5      Bruker          1 
processing           NMRPipe 20030801 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      KUJIRA  0.9820   'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.method            'SOLUTION NMR' 
_exptl.entry_id          2EN7 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2EN7 
_struct.title                     
'Solution structure of the C2H2 type zinc finger (region 495-525) of human Zinc finger protein 268' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2EN7 
_struct_keywords.text            
;zf-C2H2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
;
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       SER 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        24 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ARG 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        33 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        SER 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         24 
_struct_conf.end_auth_comp_id        ARG 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         33 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A CYS 15 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 15 A ZN 181 1_555 ? ? ? ? ? ? ? 2.392 ? ? 
metalc2 metalc ? ? A CYS 18 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 181 1_555 ? ? ? ? ? ? ? 2.189 ? ? 
metalc3 metalc ? ? A HIS 31 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 31 A ZN 181 1_555 ? ? ? ? ? ? ? 2.100 ? ? 
metalc4 metalc ? ? A HIS 35 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 35 A ZN 181 1_555 ? ? ? ? ? ? ? 1.924 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_atom_sites.entry_id                    2EN7 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1  ? -21.886 -10.946 0.704   1.00 0.00 ? 1   GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1  ? -21.348 -12.173 1.261   1.00 0.00 ? 1   GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1  ? -20.538 -12.962 0.251   1.00 0.00 ? 1   GLY A C    1  
ATOM   4     O  O    . GLY A 1 1  ? -21.010 -13.240 -0.852  1.00 0.00 ? 1   GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1  ? -21.820 -10.776 -0.259  1.00 0.00 ? 1   GLY A H1   1  
ATOM   6     H  HA2  . GLY A 1 1  ? -20.716 -11.928 2.101   1.00 0.00 ? 1   GLY A HA2  1  
ATOM   7     H  HA3  . GLY A 1 1  ? -22.167 -12.787 1.606   1.00 0.00 ? 1   GLY A HA3  1  
ATOM   8     N  N    . SER A 1 2  ? -19.315 -13.321 0.626   1.00 0.00 ? 2   SER A N    1  
ATOM   9     C  CA   . SER A 1 2  ? -18.436 -14.077 -0.257  1.00 0.00 ? 2   SER A CA   1  
ATOM   10    C  C    . SER A 1 2  ? -17.174 -14.518 0.479   1.00 0.00 ? 2   SER A C    1  
ATOM   11    O  O    . SER A 1 2  ? -16.723 -13.854 1.412   1.00 0.00 ? 2   SER A O    1  
ATOM   12    C  CB   . SER A 1 2  ? -18.059 -13.236 -1.479  1.00 0.00 ? 2   SER A CB   1  
ATOM   13    O  OG   . SER A 1 2  ? -17.037 -13.863 -2.234  1.00 0.00 ? 2   SER A OG   1  
ATOM   14    H  H    . SER A 1 2  ? -18.996 -13.069 1.518   1.00 0.00 ? 2   SER A H    1  
ATOM   15    H  HA   . SER A 1 2  ? -18.971 -14.955 -0.587  1.00 0.00 ? 2   SER A HA   1  
ATOM   16    H  HB2  . SER A 1 2  ? -18.928 -13.109 -2.107  1.00 0.00 ? 2   SER A HB2  1  
ATOM   17    H  HB3  . SER A 1 2  ? -17.707 -12.269 -1.151  1.00 0.00 ? 2   SER A HB3  1  
ATOM   18    H  HG   . SER A 1 2  ? -17.349 -14.018 -3.129  1.00 0.00 ? 2   SER A HG   1  
ATOM   19    N  N    . SER A 1 3  ? -16.610 -15.643 0.052   1.00 0.00 ? 3   SER A N    1  
ATOM   20    C  CA   . SER A 1 3  ? -15.403 -16.176 0.672   1.00 0.00 ? 3   SER A CA   1  
ATOM   21    C  C    . SER A 1 3  ? -14.342 -16.484 -0.380  1.00 0.00 ? 3   SER A C    1  
ATOM   22    O  O    . SER A 1 3  ? -14.473 -17.433 -1.151  1.00 0.00 ? 3   SER A O    1  
ATOM   23    C  CB   . SER A 1 3  ? -15.729 -17.441 1.469   1.00 0.00 ? 3   SER A CB   1  
ATOM   24    O  OG   . SER A 1 3  ? -14.548 -18.061 1.948   1.00 0.00 ? 3   SER A OG   1  
ATOM   25    H  H    . SER A 1 3  ? -17.017 -16.128 -0.697  1.00 0.00 ? 3   SER A H    1  
ATOM   26    H  HA   . SER A 1 3  ? -15.017 -15.426 1.346   1.00 0.00 ? 3   SER A HA   1  
ATOM   27    H  HB2  . SER A 1 3  ? -16.352 -17.182 2.312   1.00 0.00 ? 3   SER A HB2  1  
ATOM   28    H  HB3  . SER A 1 3  ? -16.255 -18.138 0.833   1.00 0.00 ? 3   SER A HB3  1  
ATOM   29    H  HG   . SER A 1 3  ? -13.845 -17.410 2.004   1.00 0.00 ? 3   SER A HG   1  
ATOM   30    N  N    . GLY A 1 4  ? -13.289 -15.673 -0.404  1.00 0.00 ? 4   GLY A N    1  
ATOM   31    C  CA   . GLY A 1 4  ? -12.220 -15.874 -1.365  1.00 0.00 ? 4   GLY A CA   1  
ATOM   32    C  C    . GLY A 1 4  ? -11.192 -14.759 -1.331  1.00 0.00 ? 4   GLY A C    1  
ATOM   33    O  O    . GLY A 1 4  ? -9.994  -15.014 -1.211  1.00 0.00 ? 4   GLY A O    1  
ATOM   34    H  H    . GLY A 1 4  ? -13.237 -14.931 0.235   1.00 0.00 ? 4   GLY A H    1  
ATOM   35    H  HA2  . GLY A 1 4  ? -11.727 -16.810 -1.149  1.00 0.00 ? 4   GLY A HA2  1  
ATOM   36    H  HA3  . GLY A 1 4  ? -12.647 -15.923 -2.356  1.00 0.00 ? 4   GLY A HA3  1  
ATOM   37    N  N    . SER A 1 5  ? -11.662 -13.520 -1.438  1.00 0.00 ? 5   SER A N    1  
ATOM   38    C  CA   . SER A 1 5  ? -10.774 -12.363 -1.425  1.00 0.00 ? 5   SER A CA   1  
ATOM   39    C  C    . SER A 1 5  ? -9.812  -12.403 -2.607  1.00 0.00 ? 5   SER A C    1  
ATOM   40    O  O    . SER A 1 5  ? -8.624  -12.110 -2.465  1.00 0.00 ? 5   SER A O    1  
ATOM   41    C  CB   . SER A 1 5  ? -9.988  -12.313 -0.113  1.00 0.00 ? 5   SER A CB   1  
ATOM   42    O  OG   . SER A 1 5  ? -9.573  -10.990 0.182   1.00 0.00 ? 5   SER A OG   1  
ATOM   43    H  H    . SER A 1 5  ? -12.628 -13.382 -1.531  1.00 0.00 ? 5   SER A H    1  
ATOM   44    H  HA   . SER A 1 5  ? -11.385 -11.476 -1.502  1.00 0.00 ? 5   SER A HA   1  
ATOM   45    H  HB2  . SER A 1 5  ? -10.612 -12.669 0.692   1.00 0.00 ? 5   SER A HB2  1  
ATOM   46    H  HB3  . SER A 1 5  ? -9.113  -12.942 -0.197  1.00 0.00 ? 5   SER A HB3  1  
ATOM   47    H  HG   . SER A 1 5  ? -8.928  -10.704 -0.470  1.00 0.00 ? 5   SER A HG   1  
ATOM   48    N  N    . SER A 1 6  ? -10.333 -12.767 -3.775  1.00 0.00 ? 6   SER A N    1  
ATOM   49    C  CA   . SER A 1 6  ? -9.520  -12.849 -4.982  1.00 0.00 ? 6   SER A CA   1  
ATOM   50    C  C    . SER A 1 6  ? -9.788  -11.660 -5.900  1.00 0.00 ? 6   SER A C    1  
ATOM   51    O  O    . SER A 1 6  ? -10.793 -10.966 -5.757  1.00 0.00 ? 6   SER A O    1  
ATOM   52    C  CB   . SER A 1 6  ? -9.804  -14.156 -5.726  1.00 0.00 ? 6   SER A CB   1  
ATOM   53    O  OG   . SER A 1 6  ? -8.767  -14.457 -6.643  1.00 0.00 ? 6   SER A OG   1  
ATOM   54    H  H    . SER A 1 6  ? -11.287 -12.988 -3.824  1.00 0.00 ? 6   SER A H    1  
ATOM   55    H  HA   . SER A 1 6  ? -8.482  -12.833 -4.685  1.00 0.00 ? 6   SER A HA   1  
ATOM   56    H  HB2  . SER A 1 6  ? -9.884  -14.962 -5.014  1.00 0.00 ? 6   SER A HB2  1  
ATOM   57    H  HB3  . SER A 1 6  ? -10.733 -14.062 -6.269  1.00 0.00 ? 6   SER A HB3  1  
ATOM   58    H  HG   . SER A 1 6  ? -7.930  -14.141 -6.295  1.00 0.00 ? 6   SER A HG   1  
ATOM   59    N  N    . GLY A 1 7  ? -8.879  -11.431 -6.843  1.00 0.00 ? 7   GLY A N    1  
ATOM   60    C  CA   . GLY A 1 7  ? -9.034  -10.326 -7.770  1.00 0.00 ? 7   GLY A CA   1  
ATOM   61    C  C    . GLY A 1 7  ? -7.789  -10.087 -8.601  1.00 0.00 ? 7   GLY A C    1  
ATOM   62    O  O    . GLY A 1 7  ? -7.135  -11.034 -9.040  1.00 0.00 ? 7   GLY A O    1  
ATOM   63    H  H    . GLY A 1 7  ? -8.097  -12.018 -6.909  1.00 0.00 ? 7   GLY A H    1  
ATOM   64    H  HA2  . GLY A 1 7  ? -9.861  -10.538 -8.431  1.00 0.00 ? 7   GLY A HA2  1  
ATOM   65    H  HA3  . GLY A 1 7  ? -9.256  -9.429  -7.210  1.00 0.00 ? 7   GLY A HA3  1  
ATOM   66    N  N    . THR A 1 8  ? -7.460  -8.818  -8.821  1.00 0.00 ? 8   THR A N    1  
ATOM   67    C  CA   . THR A 1 8  ? -6.288  -8.457  -9.607  1.00 0.00 ? 8   THR A CA   1  
ATOM   68    C  C    . THR A 1 8  ? -5.049  -8.343  -8.727  1.00 0.00 ? 8   THR A C    1  
ATOM   69    O  O    . THR A 1 8  ? -4.246  -7.424  -8.883  1.00 0.00 ? 8   THR A O    1  
ATOM   70    C  CB   . THR A 1 8  ? -6.498  -7.125  -10.352 1.00 0.00 ? 8   THR A CB   1  
ATOM   71    O  OG1  . THR A 1 8  ? -5.405  -6.884  -11.244 1.00 0.00 ? 8   THR A OG1  1  
ATOM   72    C  CG2  . THR A 1 8  ? -6.622  -5.970  -9.370  1.00 0.00 ? 8   THR A CG2  1  
ATOM   73    H  H    . THR A 1 8  ? -8.021  -8.108  -8.445  1.00 0.00 ? 8   THR A H    1  
ATOM   74    H  HA   . THR A 1 8  ? -6.126  -9.234  -10.341 1.00 0.00 ? 8   THR A HA   1  
ATOM   75    H  HB   . THR A 1 8  ? -7.413  -7.191  -10.925 1.00 0.00 ? 8   THR A HB   1  
ATOM   76    H  HG1  . THR A 1 8  ? -5.721  -6.411  -12.018 1.00 0.00 ? 8   THR A HG1  1  
ATOM   77    H  HG21 . THR A 1 8  ? -7.267  -6.259  -8.554  1.00 0.00 ? 8   THR A HG21 1  
ATOM   78    H  HG22 . THR A 1 8  ? -7.042  -5.112  -9.874  1.00 0.00 ? 8   THR A HG22 1  
ATOM   79    H  HG23 . THR A 1 8  ? -5.645  -5.719  -8.985  1.00 0.00 ? 8   THR A HG23 1  
ATOM   80    N  N    . GLY A 1 9  ? -4.898  -9.285  -7.800  1.00 0.00 ? 9   GLY A N    1  
ATOM   81    C  CA   . GLY A 1 9  ? -3.753  -9.272  -6.908  1.00 0.00 ? 9   GLY A CA   1  
ATOM   82    C  C    . GLY A 1 9  ? -3.851  -10.326 -5.824  1.00 0.00 ? 9   GLY A C    1  
ATOM   83    O  O    . GLY A 1 9  ? -4.842  -11.052 -5.742  1.00 0.00 ? 9   GLY A O    1  
ATOM   84    H  H    . GLY A 1 9  ? -5.570  -9.994  -7.721  1.00 0.00 ? 9   GLY A H    1  
ATOM   85    H  HA2  . GLY A 1 9  ? -2.858  -9.447  -7.486  1.00 0.00 ? 9   GLY A HA2  1  
ATOM   86    H  HA3  . GLY A 1 9  ? -3.685  -8.299  -6.443  1.00 0.00 ? 9   GLY A HA3  1  
ATOM   87    N  N    . MET A 1 10 ? -2.820  -10.413 -4.990  1.00 0.00 ? 10  MET A N    1  
ATOM   88    C  CA   . MET A 1 10 ? -2.795  -11.387 -3.905  1.00 0.00 ? 10  MET A CA   1  
ATOM   89    C  C    . MET A 1 10 ? -3.591  -10.886 -2.705  1.00 0.00 ? 10  MET A C    1  
ATOM   90    O  O    . MET A 1 10 ? -4.542  -11.532 -2.263  1.00 0.00 ? 10  MET A O    1  
ATOM   91    C  CB   . MET A 1 10 ? -1.352  -11.680 -3.488  1.00 0.00 ? 10  MET A CB   1  
ATOM   92    C  CG   . MET A 1 10 ? -0.453  -12.076 -4.647  1.00 0.00 ? 10  MET A CG   1  
ATOM   93    S  SD   . MET A 1 10 ? -0.756  -13.760 -5.218  1.00 0.00 ? 10  MET A SD   1  
ATOM   94    C  CE   . MET A 1 10 ? -0.017  -14.706 -3.888  1.00 0.00 ? 10  MET A CE   1  
ATOM   95    H  H    . MET A 1 10 ? -2.059  -9.807  -5.105  1.00 0.00 ? 10  MET A H    1  
ATOM   96    H  HA   . MET A 1 10 ? -3.247  -12.298 -4.267  1.00 0.00 ? 10  MET A HA   1  
ATOM   97    H  HB2  . MET A 1 10 ? -0.938  -10.797 -3.024  1.00 0.00 ? 10  MET A HB2  1  
ATOM   98    H  HB3  . MET A 1 10 ? -1.354  -12.487 -2.770  1.00 0.00 ? 10  MET A HB3  1  
ATOM   99    H  HG2  . MET A 1 10 ? -0.626  -11.397 -5.469  1.00 0.00 ? 10  MET A HG2  1  
ATOM   100   H  HG3  . MET A 1 10 ? 0.576   -11.998 -4.329  1.00 0.00 ? 10  MET A HG3  1  
ATOM   101   H  HE1  . MET A 1 10 ? -0.551  -15.638 -3.770  1.00 0.00 ? 10  MET A HE1  1  
ATOM   102   H  HE2  . MET A 1 10 ? 1.017   -14.910 -4.123  1.00 0.00 ? 10  MET A HE2  1  
ATOM   103   H  HE3  . MET A 1 10 ? -0.073  -14.140 -2.970  1.00 0.00 ? 10  MET A HE3  1  
ATOM   104   N  N    . LYS A 1 11 ? -3.198  -9.730  -2.180  1.00 0.00 ? 11  LYS A N    1  
ATOM   105   C  CA   . LYS A 1 11 ? -3.876  -9.140  -1.032  1.00 0.00 ? 11  LYS A CA   1  
ATOM   106   C  C    . LYS A 1 11 ? -4.777  -7.988  -1.464  1.00 0.00 ? 11  LYS A C    1  
ATOM   107   O  O    . LYS A 1 11 ? -4.640  -7.438  -2.557  1.00 0.00 ? 11  LYS A O    1  
ATOM   108   C  CB   . LYS A 1 11 ? -2.852  -8.645  -0.008  1.00 0.00 ? 11  LYS A CB   1  
ATOM   109   C  CG   . LYS A 1 11 ? -2.473  -9.689  1.028   1.00 0.00 ? 11  LYS A CG   1  
ATOM   110   C  CD   . LYS A 1 11 ? -1.046  -9.500  1.514   1.00 0.00 ? 11  LYS A CD   1  
ATOM   111   C  CE   . LYS A 1 11 ? -0.409  -10.825 1.902   1.00 0.00 ? 11  LYS A CE   1  
ATOM   112   N  NZ   . LYS A 1 11 ? -0.740  -11.212 3.301   1.00 0.00 ? 11  LYS A NZ   1  
ATOM   113   H  H    . LYS A 1 11 ? -2.434  -9.261  -2.577  1.00 0.00 ? 11  LYS A H    1  
ATOM   114   H  HA   . LYS A 1 11 ? -4.485  -9.906  -0.577  1.00 0.00 ? 11  LYS A HA   1  
ATOM   115   H  HB2  . LYS A 1 11 ? -1.955  -8.344  -0.531  1.00 0.00 ? 11  LYS A HB2  1  
ATOM   116   H  HB3  . LYS A 1 11 ? -3.261  -7.788  0.507   1.00 0.00 ? 11  LYS A HB3  1  
ATOM   117   H  HG2  . LYS A 1 11 ? -3.143  -9.606  1.871   1.00 0.00 ? 11  LYS A HG2  1  
ATOM   118   H  HG3  . LYS A 1 11 ? -2.566  -10.671 0.587   1.00 0.00 ? 11  LYS A HG3  1  
ATOM   119   H  HD2  . LYS A 1 11 ? -0.462  -9.050  0.725   1.00 0.00 ? 11  LYS A HD2  1  
ATOM   120   H  HD3  . LYS A 1 11 ? -1.052  -8.847  2.376   1.00 0.00 ? 11  LYS A HD3  1  
ATOM   121   H  HE2  . LYS A 1 11 ? -0.767  -11.591 1.232   1.00 0.00 ? 11  LYS A HE2  1  
ATOM   122   H  HE3  . LYS A 1 11 ? 0.663   -10.736 1.806   1.00 0.00 ? 11  LYS A HE3  1  
ATOM   123   H  HZ1  . LYS A 1 11 ? -0.279  -10.562 3.970   1.00 0.00 ? 11  LYS A HZ1  1  
ATOM   124   H  HZ2  . LYS A 1 11 ? -0.411  -12.180 3.492   1.00 0.00 ? 11  LYS A HZ2  1  
ATOM   125   H  HZ3  . LYS A 1 11 ? -1.769  -11.172 3.449   1.00 0.00 ? 11  LYS A HZ3  1  
ATOM   126   N  N    . PRO A 1 12 ? -5.720  -7.612  -0.587  1.00 0.00 ? 12  PRO A N    1  
ATOM   127   C  CA   . PRO A 1 12 ? -6.660  -6.520  -0.856  1.00 0.00 ? 12  PRO A CA   1  
ATOM   128   C  C    . PRO A 1 12 ? -5.979  -5.155  -0.858  1.00 0.00 ? 12  PRO A C    1  
ATOM   129   O  O    . PRO A 1 12 ? -5.498  -4.692  -1.893  1.00 0.00 ? 12  PRO A O    1  
ATOM   130   C  CB   . PRO A 1 12 ? -7.657  -6.617  0.302   1.00 0.00 ? 12  PRO A CB   1  
ATOM   131   C  CG   . PRO A 1 12 ? -6.897  -7.275  1.402   1.00 0.00 ? 12  PRO A CG   1  
ATOM   132   C  CD   . PRO A 1 12 ? -5.940  -8.223  0.734   1.00 0.00 ? 12  PRO A CD   1  
ATOM   133   H  HA   . PRO A 1 12 ? -7.178  -6.664  -1.793  1.00 0.00 ? 12  PRO A HA   1  
ATOM   134   H  HB2  . PRO A 1 12 ? -7.984  -5.626  0.583   1.00 0.00 ? 12  PRO A HB2  1  
ATOM   135   H  HB3  . PRO A 1 12 ? -8.507  -7.210  -0.000  1.00 0.00 ? 12  PRO A HB3  1  
ATOM   136   H  HG2  . PRO A 1 12 ? -6.357  -6.533  1.969   1.00 0.00 ? 12  PRO A HG2  1  
ATOM   137   H  HG3  . PRO A 1 12 ? -7.576  -7.818  2.042   1.00 0.00 ? 12  PRO A HG3  1  
ATOM   138   H  HD2  . PRO A 1 12 ? -5.016  -8.280  1.291   1.00 0.00 ? 12  PRO A HD2  1  
ATOM   139   H  HD3  . PRO A 1 12 ? -6.385  -9.202  0.636   1.00 0.00 ? 12  PRO A HD3  1  
ATOM   140   N  N    . TYR A 1 13 ? -5.940  -4.517  0.306   1.00 0.00 ? 13  TYR A N    1  
ATOM   141   C  CA   . TYR A 1 13 ? -5.319  -3.204  0.437   1.00 0.00 ? 13  TYR A CA   1  
ATOM   142   C  C    . TYR A 1 13 ? -3.979  -3.305  1.159   1.00 0.00 ? 13  TYR A C    1  
ATOM   143   O  O    . TYR A 1 13 ? -3.462  -2.315  1.676   1.00 0.00 ? 13  TYR A O    1  
ATOM   144   C  CB   . TYR A 1 13 ? -6.247  -2.251  1.192   1.00 0.00 ? 13  TYR A CB   1  
ATOM   145   C  CG   . TYR A 1 13 ? -7.713  -2.587  1.041   1.00 0.00 ? 13  TYR A CG   1  
ATOM   146   C  CD1  . TYR A 1 13 ? -8.282  -3.639  1.750   1.00 0.00 ? 13  TYR A CD1  1  
ATOM   147   C  CD2  . TYR A 1 13 ? -8.531  -1.853  0.191   1.00 0.00 ? 13  TYR A CD2  1  
ATOM   148   C  CE1  . TYR A 1 13 ? -9.621  -3.950  1.614   1.00 0.00 ? 13  TYR A CE1  1  
ATOM   149   C  CE2  . TYR A 1 13 ? -9.871  -2.156  0.050   1.00 0.00 ? 13  TYR A CE2  1  
ATOM   150   C  CZ   . TYR A 1 13 ? -10.411 -3.206  0.764   1.00 0.00 ? 13  TYR A CZ   1  
ATOM   151   O  OH   . TYR A 1 13 ? -11.746 -3.512  0.627   1.00 0.00 ? 13  TYR A OH   1  
ATOM   152   H  H    . TYR A 1 13 ? -6.340  -4.937  1.096   1.00 0.00 ? 13  TYR A H    1  
ATOM   153   H  HA   . TYR A 1 13 ? -5.151  -2.816  -0.557  1.00 0.00 ? 13  TYR A HA   1  
ATOM   154   H  HB2  . TYR A 1 13 ? -6.007  -2.283  2.244   1.00 0.00 ? 13  TYR A HB2  1  
ATOM   155   H  HB3  . TYR A 1 13 ? -6.097  -1.247  0.824   1.00 0.00 ? 13  TYR A HB3  1  
ATOM   156   H  HD1  . TYR A 1 13 ? -7.660  -4.220  2.415   1.00 0.00 ? 13  TYR A HD1  1  
ATOM   157   H  HD2  . TYR A 1 13 ? -8.105  -1.031  -0.366  1.00 0.00 ? 13  TYR A HD2  1  
ATOM   158   H  HE1  . TYR A 1 13 ? -10.044 -4.772  2.173   1.00 0.00 ? 13  TYR A HE1  1  
ATOM   159   H  HE2  . TYR A 1 13 ? -10.491 -1.573  -0.616  1.00 0.00 ? 13  TYR A HE2  1  
ATOM   160   H  HH   . TYR A 1 13 ? -12.029 -3.314  -0.269  1.00 0.00 ? 13  TYR A HH   1  
ATOM   161   N  N    . VAL A 1 14 ? -3.420  -4.511  1.190   1.00 0.00 ? 14  VAL A N    1  
ATOM   162   C  CA   . VAL A 1 14 ? -2.139  -4.744  1.847   1.00 0.00 ? 14  VAL A CA   1  
ATOM   163   C  C    . VAL A 1 14 ? -0.983  -4.243  0.989   1.00 0.00 ? 14  VAL A C    1  
ATOM   164   O  O    . VAL A 1 14 ? -1.030  -4.316  -0.239  1.00 0.00 ? 14  VAL A O    1  
ATOM   165   C  CB   . VAL A 1 14 ? -1.928  -6.239  2.152   1.00 0.00 ? 14  VAL A CB   1  
ATOM   166   C  CG1  . VAL A 1 14 ? -0.727  -6.433  3.065   1.00 0.00 ? 14  VAL A CG1  1  
ATOM   167   C  CG2  . VAL A 1 14 ? -3.182  -6.838  2.771   1.00 0.00 ? 14  VAL A CG2  1  
ATOM   168   H  H    . VAL A 1 14 ? -3.881  -5.262  0.761   1.00 0.00 ? 14  VAL A H    1  
ATOM   169   H  HA   . VAL A 1 14 ? -2.141  -4.204  2.783   1.00 0.00 ? 14  VAL A HA   1  
ATOM   170   H  HB   . VAL A 1 14 ? -1.732  -6.751  1.221   1.00 0.00 ? 14  VAL A HB   1  
ATOM   171   H  HG11 . VAL A 1 14 ? -0.045  -7.140  2.615   1.00 0.00 ? 14  VAL A HG11 1  
ATOM   172   H  HG12 . VAL A 1 14 ? -0.226  -5.487  3.208   1.00 0.00 ? 14  VAL A HG12 1  
ATOM   173   H  HG13 . VAL A 1 14 ? -1.059  -6.813  4.020   1.00 0.00 ? 14  VAL A HG13 1  
ATOM   174   H  HG21 . VAL A 1 14 ? -3.046  -7.901  2.902   1.00 0.00 ? 14  VAL A HG21 1  
ATOM   175   H  HG22 . VAL A 1 14 ? -3.364  -6.377  3.730   1.00 0.00 ? 14  VAL A HG22 1  
ATOM   176   H  HG23 . VAL A 1 14 ? -4.026  -6.661  2.120   1.00 0.00 ? 14  VAL A HG23 1  
ATOM   177   N  N    . CYS A 1 15 ? 0.055   -3.735  1.644   1.00 0.00 ? 15  CYS A N    1  
ATOM   178   C  CA   . CYS A 1 15 ? 1.225   -3.221  0.942   1.00 0.00 ? 15  CYS A CA   1  
ATOM   179   C  C    . CYS A 1 15 ? 2.086   -4.363  0.411   1.00 0.00 ? 15  CYS A C    1  
ATOM   180   O  O    . CYS A 1 15 ? 2.765   -5.049  1.174   1.00 0.00 ? 15  CYS A O    1  
ATOM   181   C  CB   . CYS A 1 15 ? 2.055   -2.333  1.872   1.00 0.00 ? 15  CYS A CB   1  
ATOM   182   S  SG   . CYS A 1 15 ? 2.960   -1.003  1.018   1.00 0.00 ? 15  CYS A SG   1  
ATOM   183   H  H    . CYS A 1 15 ? 0.034   -3.704  2.624   1.00 0.00 ? 15  CYS A H    1  
ATOM   184   H  HA   . CYS A 1 15 ? 0.879   -2.629  0.108   1.00 0.00 ? 15  CYS A HA   1  
ATOM   185   H  HB2  . CYS A 1 15 ? 1.399   -1.871  2.596   1.00 0.00 ? 15  CYS A HB2  1  
ATOM   186   H  HB3  . CYS A 1 15 ? 2.779   -2.945  2.390   1.00 0.00 ? 15  CYS A HB3  1  
ATOM   187   N  N    . ASN A 1 16 ? 2.052   -4.561  -0.903  1.00 0.00 ? 16  ASN A N    1  
ATOM   188   C  CA   . ASN A 1 16 ? 2.828   -5.620  -1.537  1.00 0.00 ? 16  ASN A CA   1  
ATOM   189   C  C    . ASN A 1 16 ? 4.323   -5.333  -1.437  1.00 0.00 ? 16  ASN A C    1  
ATOM   190   O  O    . ASN A 1 16 ? 5.149   -6.139  -1.864  1.00 0.00 ? 16  ASN A O    1  
ATOM   191   C  CB   . ASN A 1 16 ? 2.423   -5.769  -3.005  1.00 0.00 ? 16  ASN A CB   1  
ATOM   192   C  CG   . ASN A 1 16 ? 0.932   -5.589  -3.215  1.00 0.00 ? 16  ASN A CG   1  
ATOM   193   O  OD1  . ASN A 1 16 ? 0.184   -6.563  -3.305  1.00 0.00 ? 16  ASN A OD1  1  
ATOM   194   N  ND2  . ASN A 1 16 ? 0.492   -4.338  -3.293  1.00 0.00 ? 16  ASN A ND2  1  
ATOM   195   H  H    . ASN A 1 16 ? 1.491   -3.981  -1.460  1.00 0.00 ? 16  ASN A H    1  
ATOM   196   H  HA   . ASN A 1 16 ? 2.615   -6.543  -1.019  1.00 0.00 ? 16  ASN A HA   1  
ATOM   197   H  HB2  . ASN A 1 16 ? 2.942   -5.025  -3.593  1.00 0.00 ? 16  ASN A HB2  1  
ATOM   198   H  HB3  . ASN A 1 16 ? 2.701   -6.753  -3.352  1.00 0.00 ? 16  ASN A HB3  1  
ATOM   199   H  HD21 . ASN A 1 16 ? 1.145   -3.612  -3.212  1.00 0.00 ? 16  ASN A HD21 1  
ATOM   200   H  HD22 . ASN A 1 16 ? -0.467  -4.193  -3.428  1.00 0.00 ? 16  ASN A HD22 1  
ATOM   201   N  N    . GLU A 1 17 ? 4.662   -4.180  -0.870  1.00 0.00 ? 17  GLU A N    1  
ATOM   202   C  CA   . GLU A 1 17 ? 6.058   -3.787  -0.714  1.00 0.00 ? 17  GLU A CA   1  
ATOM   203   C  C    . GLU A 1 17 ? 6.602   -4.236  0.640   1.00 0.00 ? 17  GLU A C    1  
ATOM   204   O  O    . GLU A 1 17 ? 7.685   -4.814  0.725   1.00 0.00 ? 17  GLU A O    1  
ATOM   205   C  CB   . GLU A 1 17 ? 6.203   -2.271  -0.857  1.00 0.00 ? 17  GLU A CB   1  
ATOM   206   C  CG   . GLU A 1 17 ? 5.688   -1.732  -2.181  1.00 0.00 ? 17  GLU A CG   1  
ATOM   207   C  CD   . GLU A 1 17 ? 6.681   -1.916  -3.312  1.00 0.00 ? 17  GLU A CD   1  
ATOM   208   O  OE1  . GLU A 1 17 ? 7.052   -3.075  -3.594  1.00 0.00 ? 17  GLU A OE1  1  
ATOM   209   O  OE2  . GLU A 1 17 ? 7.088   -0.901  -3.915  1.00 0.00 ? 17  GLU A OE2  1  
ATOM   210   H  H    . GLU A 1 17 ? 3.958   -3.579  -0.549  1.00 0.00 ? 17  GLU A H    1  
ATOM   211   H  HA   . GLU A 1 17 ? 6.627   -4.269  -1.494  1.00 0.00 ? 17  GLU A HA   1  
ATOM   212   H  HB2  . GLU A 1 17 ? 5.655   -1.792  -0.059  1.00 0.00 ? 17  GLU A HB2  1  
ATOM   213   H  HB3  . GLU A 1 17 ? 7.248   -2.012  -0.770  1.00 0.00 ? 17  GLU A HB3  1  
ATOM   214   H  HG2  . GLU A 1 17 ? 4.776   -2.251  -2.436  1.00 0.00 ? 17  GLU A HG2  1  
ATOM   215   H  HG3  . GLU A 1 17 ? 5.482   -0.678  -2.070  1.00 0.00 ? 17  GLU A HG3  1  
ATOM   216   N  N    . CYS A 1 18 ? 5.841   -3.965  1.695   1.00 0.00 ? 18  CYS A N    1  
ATOM   217   C  CA   . CYS A 1 18 ? 6.245   -4.339  3.045   1.00 0.00 ? 18  CYS A CA   1  
ATOM   218   C  C    . CYS A 1 18 ? 5.286   -5.370  3.634   1.00 0.00 ? 18  CYS A C    1  
ATOM   219   O  O    . CYS A 1 18 ? 5.690   -6.242  4.402   1.00 0.00 ? 18  CYS A O    1  
ATOM   220   C  CB   . CYS A 1 18 ? 6.298   -3.102  3.945   1.00 0.00 ? 18  CYS A CB   1  
ATOM   221   S  SG   . CYS A 1 18 ? 4.751   -2.140  3.977   1.00 0.00 ? 18  CYS A SG   1  
ATOM   222   H  H    . CYS A 1 18 ? 4.987   -3.502  1.563   1.00 0.00 ? 18  CYS A H    1  
ATOM   223   H  HA   . CYS A 1 18 ? 7.231   -4.774  2.988   1.00 0.00 ? 18  CYS A HA   1  
ATOM   224   H  HB2  . CYS A 1 18 ? 6.512   -3.413  4.957   1.00 0.00 ? 18  CYS A HB2  1  
ATOM   225   H  HB3  . CYS A 1 18 ? 7.085   -2.449  3.600   1.00 0.00 ? 18  CYS A HB3  1  
ATOM   226   N  N    . GLY A 1 19 ? 4.012   -5.262  3.268   1.00 0.00 ? 19  GLY A N    1  
ATOM   227   C  CA   . GLY A 1 19 ? 3.016   -6.191  3.768   1.00 0.00 ? 19  GLY A CA   1  
ATOM   228   C  C    . GLY A 1 19 ? 2.030   -5.530  4.712   1.00 0.00 ? 19  GLY A C    1  
ATOM   229   O  O    . GLY A 1 19 ? 1.207   -6.203  5.333   1.00 0.00 ? 19  GLY A O    1  
ATOM   230   H  H    . GLY A 1 19 ? 3.747   -4.547  2.652   1.00 0.00 ? 19  GLY A H    1  
ATOM   231   H  HA2  . GLY A 1 19 ? 2.474   -6.606  2.932   1.00 0.00 ? 19  GLY A HA2  1  
ATOM   232   H  HA3  . GLY A 1 19 ? 3.517   -6.991  4.293   1.00 0.00 ? 19  GLY A HA3  1  
ATOM   233   N  N    . LYS A 1 20 ? 2.113   -4.208  4.821   1.00 0.00 ? 20  LYS A N    1  
ATOM   234   C  CA   . LYS A 1 20 ? 1.222   -3.455  5.695   1.00 0.00 ? 20  LYS A CA   1  
ATOM   235   C  C    . LYS A 1 20 ? -0.230  -3.608  5.255   1.00 0.00 ? 20  LYS A C    1  
ATOM   236   O  O    . LYS A 1 20 ? -0.618  -3.134  4.187   1.00 0.00 ? 20  LYS A O    1  
ATOM   237   C  CB   . LYS A 1 20 ? 1.611   -1.975  5.701   1.00 0.00 ? 20  LYS A CB   1  
ATOM   238   C  CG   . LYS A 1 20 ? 1.304   -1.270  7.011   1.00 0.00 ? 20  LYS A CG   1  
ATOM   239   C  CD   . LYS A 1 20 ? -0.159  -1.418  7.394   1.00 0.00 ? 20  LYS A CD   1  
ATOM   240   C  CE   . LYS A 1 20 ? -0.587  -0.345  8.383   1.00 0.00 ? 20  LYS A CE   1  
ATOM   241   N  NZ   . LYS A 1 20 ? -0.292  -0.738  9.789   1.00 0.00 ? 20  LYS A NZ   1  
ATOM   242   H  H    . LYS A 1 20 ? 2.790   -3.727  4.299   1.00 0.00 ? 20  LYS A H    1  
ATOM   243   H  HA   . LYS A 1 20 ? 1.326   -3.850  6.694   1.00 0.00 ? 20  LYS A HA   1  
ATOM   244   H  HB2  . LYS A 1 20 ? 2.671   -1.893  5.512   1.00 0.00 ? 20  LYS A HB2  1  
ATOM   245   H  HB3  . LYS A 1 20 ? 1.073   -1.471  4.911   1.00 0.00 ? 20  LYS A HB3  1  
ATOM   246   H  HG2  . LYS A 1 20 ? 1.914   -1.699  7.792   1.00 0.00 ? 20  LYS A HG2  1  
ATOM   247   H  HG3  . LYS A 1 20 ? 1.535   -0.220  6.907   1.00 0.00 ? 20  LYS A HG3  1  
ATOM   248   H  HD2  . LYS A 1 20 ? -0.766  -1.333  6.504   1.00 0.00 ? 20  LYS A HD2  1  
ATOM   249   H  HD3  . LYS A 1 20 ? -0.309  -2.390  7.842   1.00 0.00 ? 20  LYS A HD3  1  
ATOM   250   H  HE2  . LYS A 1 20 ? -0.059  0.568   8.155   1.00 0.00 ? 20  LYS A HE2  1  
ATOM   251   H  HE3  . LYS A 1 20 ? -1.650  -0.182  8.280   1.00 0.00 ? 20  LYS A HE3  1  
ATOM   252   H  HZ1  . LYS A 1 20 ? -0.742  -0.072  10.449  1.00 0.00 ? 20  LYS A HZ1  1  
ATOM   253   H  HZ2  . LYS A 1 20 ? 0.735   -0.731  9.953   1.00 0.00 ? 20  LYS A HZ2  1  
ATOM   254   H  HZ3  . LYS A 1 20 ? -0.656  -1.694  9.977   1.00 0.00 ? 20  LYS A HZ3  1  
ATOM   255   N  N    . ALA A 1 21 ? -1.029  -4.272  6.084   1.00 0.00 ? 21  ALA A N    1  
ATOM   256   C  CA   . ALA A 1 21 ? -2.439  -4.484  5.782   1.00 0.00 ? 21  ALA A CA   1  
ATOM   257   C  C    . ALA A 1 21 ? -3.294  -3.342  6.319   1.00 0.00 ? 21  ALA A C    1  
ATOM   258   O  O    . ALA A 1 21 ? -3.092  -2.878  7.442   1.00 0.00 ? 21  ALA A O    1  
ATOM   259   C  CB   . ALA A 1 21 ? -2.908  -5.813  6.356   1.00 0.00 ? 21  ALA A CB   1  
ATOM   260   H  H    . ALA A 1 21 ? -0.661  -4.627  6.920   1.00 0.00 ? 21  ALA A H    1  
ATOM   261   H  HA   . ALA A 1 21 ? -2.547  -4.527  4.707   1.00 0.00 ? 21  ALA A HA   1  
ATOM   262   H  HB1  . ALA A 1 21 ? -3.229  -5.670  7.377   1.00 0.00 ? 21  ALA A HB1  1  
ATOM   263   H  HB2  . ALA A 1 21 ? -3.733  -6.187  5.767   1.00 0.00 ? 21  ALA A HB2  1  
ATOM   264   H  HB3  . ALA A 1 21 ? -2.095  -6.523  6.330   1.00 0.00 ? 21  ALA A HB3  1  
ATOM   265   N  N    . PHE A 1 22 ? -4.248  -2.892  5.511   1.00 0.00 ? 22  PHE A N    1  
ATOM   266   C  CA   . PHE A 1 22 ? -5.133  -1.802  5.906   1.00 0.00 ? 22  PHE A CA   1  
ATOM   267   C  C    . PHE A 1 22 ? -6.596  -2.199  5.731   1.00 0.00 ? 22  PHE A C    1  
ATOM   268   O  O    . PHE A 1 22 ? -6.904  -3.343  5.397   1.00 0.00 ? 22  PHE A O    1  
ATOM   269   C  CB   . PHE A 1 22 ? -4.830  -0.548  5.083   1.00 0.00 ? 22  PHE A CB   1  
ATOM   270   C  CG   . PHE A 1 22 ? -3.380  -0.159  5.094   1.00 0.00 ? 22  PHE A CG   1  
ATOM   271   C  CD1  . PHE A 1 22 ? -2.464  -0.826  4.296   1.00 0.00 ? 22  PHE A CD1  1  
ATOM   272   C  CD2  . PHE A 1 22 ? -2.932  0.873   5.903   1.00 0.00 ? 22  PHE A CD2  1  
ATOM   273   C  CE1  . PHE A 1 22 ? -1.128  -0.470  4.303   1.00 0.00 ? 22  PHE A CE1  1  
ATOM   274   C  CE2  . PHE A 1 22 ? -1.597  1.233   5.914   1.00 0.00 ? 22  PHE A CE2  1  
ATOM   275   C  CZ   . PHE A 1 22 ? -0.694  0.560   5.114   1.00 0.00 ? 22  PHE A CZ   1  
ATOM   276   H  H    . PHE A 1 22 ? -4.359  -3.303  4.628   1.00 0.00 ? 22  PHE A H    1  
ATOM   277   H  HA   . PHE A 1 22 ? -4.952  -1.590  6.948   1.00 0.00 ? 22  PHE A HA   1  
ATOM   278   H  HB2  . PHE A 1 22 ? -5.119  -0.721  4.057   1.00 0.00 ? 22  PHE A HB2  1  
ATOM   279   H  HB3  . PHE A 1 22 ? -5.400  0.279   5.479   1.00 0.00 ? 22  PHE A HB3  1  
ATOM   280   H  HD1  . PHE A 1 22 ? -2.803  -1.632  3.660   1.00 0.00 ? 22  PHE A HD1  1  
ATOM   281   H  HD2  . PHE A 1 22 ? -3.636  1.399   6.530   1.00 0.00 ? 22  PHE A HD2  1  
ATOM   282   H  HE1  . PHE A 1 22 ? -0.425  -0.999  3.676   1.00 0.00 ? 22  PHE A HE1  1  
ATOM   283   H  HE2  . PHE A 1 22 ? -1.260  2.038   6.549   1.00 0.00 ? 22  PHE A HE2  1  
ATOM   284   H  HZ   . PHE A 1 22 ? 0.348   0.840   5.121   1.00 0.00 ? 22  PHE A HZ   1  
ATOM   285   N  N    . ARG A 1 23 ? -7.492  -1.245  5.960   1.00 0.00 ? 23  ARG A N    1  
ATOM   286   C  CA   . ARG A 1 23 ? -8.923  -1.494  5.830   1.00 0.00 ? 23  ARG A CA   1  
ATOM   287   C  C    . ARG A 1 23 ? -9.438  -1.011  4.477   1.00 0.00 ? 23  ARG A C    1  
ATOM   288   O  O    . ARG A 1 23 ? -10.304 -1.642  3.870   1.00 0.00 ? 23  ARG A O    1  
ATOM   289   C  CB   . ARG A 1 23 ? -9.688  -0.798  6.957   1.00 0.00 ? 23  ARG A CB   1  
ATOM   290   C  CG   . ARG A 1 23 ? -9.240  -1.218  8.347   1.00 0.00 ? 23  ARG A CG   1  
ATOM   291   C  CD   . ARG A 1 23 ? -9.758  -0.264  9.411   1.00 0.00 ? 23  ARG A CD   1  
ATOM   292   N  NE   . ARG A 1 23 ? -9.187  -0.547  10.725  1.00 0.00 ? 23  ARG A NE   1  
ATOM   293   C  CZ   . ARG A 1 23 ? -9.704  -0.097  11.863  1.00 0.00 ? 23  ARG A CZ   1  
ATOM   294   N  NH1  . ARG A 1 23 ? -10.797 0.652   11.849  1.00 0.00 ? 23  ARG A NH1  1  
ATOM   295   N  NH2  . ARG A 1 23 ? -9.126  -0.398  13.020  1.00 0.00 ? 23  ARG A NH2  1  
ATOM   296   H  H    . ARG A 1 23 ? -7.185  -0.353  6.224   1.00 0.00 ? 23  ARG A H    1  
ATOM   297   H  HA   . ARG A 1 23 ? -9.082  -2.560  5.903   1.00 0.00 ? 23  ARG A HA   1  
ATOM   298   H  HB2  . ARG A 1 23 ? -9.550  0.269   6.865   1.00 0.00 ? 23  ARG A HB2  1  
ATOM   299   H  HB3  . ARG A 1 23 ? -10.739 -1.027  6.856   1.00 0.00 ? 23  ARG A HB3  1  
ATOM   300   H  HG2  . ARG A 1 23 ? -9.618  -2.209  8.553   1.00 0.00 ? 23  ARG A HG2  1  
ATOM   301   H  HG3  . ARG A 1 23 ? -8.161  -1.229  8.379   1.00 0.00 ? 23  ARG A HG3  1  
ATOM   302   H  HD2  . ARG A 1 23 ? -9.500  0.746   9.127   1.00 0.00 ? 23  ARG A HD2  1  
ATOM   303   H  HD3  . ARG A 1 23 ? -10.832 -0.357  9.468   1.00 0.00 ? 23  ARG A HD3  1  
ATOM   304   H  HE   . ARG A 1 23 ? -8.378  -1.099  10.759  1.00 0.00 ? 23  ARG A HE   1  
ATOM   305   H  HH11 . ARG A 1 23 ? -11.235 0.879   10.979  1.00 0.00 ? 23  ARG A HH11 1  
ATOM   306   H  HH12 . ARG A 1 23 ? -11.185 0.988   12.707  1.00 0.00 ? 23  ARG A HH12 1  
ATOM   307   H  HH21 . ARG A 1 23 ? -8.302  -0.963  13.035  1.00 0.00 ? 23  ARG A HH21 1  
ATOM   308   H  HH22 . ARG A 1 23 ? -9.516  -0.059  13.876  1.00 0.00 ? 23  ARG A HH22 1  
ATOM   309   N  N    . SER A 1 24 ? -8.899  0.111   4.010   1.00 0.00 ? 24  SER A N    1  
ATOM   310   C  CA   . SER A 1 24 ? -9.307  0.681   2.732   1.00 0.00 ? 24  SER A CA   1  
ATOM   311   C  C    . SER A 1 24 ? -8.092  0.985   1.860   1.00 0.00 ? 24  SER A C    1  
ATOM   312   O  O    . SER A 1 24 ? -6.981  1.157   2.362   1.00 0.00 ? 24  SER A O    1  
ATOM   313   C  CB   . SER A 1 24 ? -10.121 1.956   2.955   1.00 0.00 ? 24  SER A CB   1  
ATOM   314   O  OG   . SER A 1 24 ? -11.378 1.663   3.541   1.00 0.00 ? 24  SER A OG   1  
ATOM   315   H  H    . SER A 1 24 ? -8.213  0.567   4.541   1.00 0.00 ? 24  SER A H    1  
ATOM   316   H  HA   . SER A 1 24 ? -9.925  -0.047  2.227   1.00 0.00 ? 24  SER A HA   1  
ATOM   317   H  HB2  . SER A 1 24 ? -9.577  2.618   3.611   1.00 0.00 ? 24  SER A HB2  1  
ATOM   318   H  HB3  . SER A 1 24 ? -10.285 2.446   2.005   1.00 0.00 ? 24  SER A HB3  1  
ATOM   319   H  HG   . SER A 1 24 ? -11.282 1.610   4.494   1.00 0.00 ? 24  SER A HG   1  
ATOM   320   N  N    . LYS A 1 25 ? -8.312  1.049   0.551   1.00 0.00 ? 25  LYS A N    1  
ATOM   321   C  CA   . LYS A 1 25 ? -7.238  1.333   -0.392  1.00 0.00 ? 25  LYS A CA   1  
ATOM   322   C  C    . LYS A 1 25 ? -6.650  2.719   -0.146  1.00 0.00 ? 25  LYS A C    1  
ATOM   323   O  O    . LYS A 1 25 ? -5.463  2.950   -0.376  1.00 0.00 ? 25  LYS A O    1  
ATOM   324   C  CB   . LYS A 1 25 ? -7.755  1.235   -1.829  1.00 0.00 ? 25  LYS A CB   1  
ATOM   325   C  CG   . LYS A 1 25 ? -8.909  2.177   -2.127  1.00 0.00 ? 25  LYS A CG   1  
ATOM   326   C  CD   . LYS A 1 25 ? -8.933  2.584   -3.590  1.00 0.00 ? 25  LYS A CD   1  
ATOM   327   C  CE   . LYS A 1 25 ? -9.594  1.520   -4.454  1.00 0.00 ? 25  LYS A CE   1  
ATOM   328   N  NZ   . LYS A 1 25 ? -11.068 1.475   -4.247  1.00 0.00 ? 25  LYS A NZ   1  
ATOM   329   H  H    . LYS A 1 25 ? -9.220  0.902   0.212   1.00 0.00 ? 25  LYS A H    1  
ATOM   330   H  HA   . LYS A 1 25 ? -6.464  0.596   -0.246  1.00 0.00 ? 25  LYS A HA   1  
ATOM   331   H  HB2  . LYS A 1 25 ? -6.945  1.466   -2.507  1.00 0.00 ? 25  LYS A HB2  1  
ATOM   332   H  HB3  . LYS A 1 25 ? -8.087  0.224   -2.011  1.00 0.00 ? 25  LYS A HB3  1  
ATOM   333   H  HG2  . LYS A 1 25 ? -9.837  1.681   -1.886  1.00 0.00 ? 25  LYS A HG2  1  
ATOM   334   H  HG3  . LYS A 1 25 ? -8.804  3.064   -1.517  1.00 0.00 ? 25  LYS A HG3  1  
ATOM   335   H  HD2  . LYS A 1 25 ? -9.487  3.506   -3.689  1.00 0.00 ? 25  LYS A HD2  1  
ATOM   336   H  HD3  . LYS A 1 25 ? -7.918  2.733   -3.931  1.00 0.00 ? 25  LYS A HD3  1  
ATOM   337   H  HE2  . LYS A 1 25 ? -9.391  1.740   -5.491  1.00 0.00 ? 25  LYS A HE2  1  
ATOM   338   H  HE3  . LYS A 1 25 ? -9.173  0.558   -4.200  1.00 0.00 ? 25  LYS A HE3  1  
ATOM   339   H  HZ1  . LYS A 1 25 ? -11.544 2.096   -4.931  1.00 0.00 ? 25  LYS A HZ1  1  
ATOM   340   H  HZ2  . LYS A 1 25 ? -11.303 1.791   -3.284  1.00 0.00 ? 25  LYS A HZ2  1  
ATOM   341   H  HZ3  . LYS A 1 25 ? -11.417 0.503   -4.375  1.00 0.00 ? 25  LYS A HZ3  1  
ATOM   342   N  N    . SER A 1 26 ? -7.488  3.638   0.324   1.00 0.00 ? 26  SER A N    1  
ATOM   343   C  CA   . SER A 1 26 ? -7.051  5.001   0.600   1.00 0.00 ? 26  SER A CA   1  
ATOM   344   C  C    . SER A 1 26 ? -5.980  5.020   1.687   1.00 0.00 ? 26  SER A C    1  
ATOM   345   O  O    . SER A 1 26 ? -5.088  5.867   1.681   1.00 0.00 ? 26  SER A O    1  
ATOM   346   C  CB   . SER A 1 26 ? -8.240  5.864   1.025   1.00 0.00 ? 26  SER A CB   1  
ATOM   347   O  OG   . SER A 1 26 ? -8.873  5.329   2.175   1.00 0.00 ? 26  SER A OG   1  
ATOM   348   H  H    . SER A 1 26 ? -8.423  3.393   0.487   1.00 0.00 ? 26  SER A H    1  
ATOM   349   H  HA   . SER A 1 26 ? -6.631  5.405   -0.309  1.00 0.00 ? 26  SER A HA   1  
ATOM   350   H  HB2  . SER A 1 26 ? -7.895  6.862   1.251   1.00 0.00 ? 26  SER A HB2  1  
ATOM   351   H  HB3  . SER A 1 26 ? -8.958  5.905   0.219   1.00 0.00 ? 26  SER A HB3  1  
ATOM   352   H  HG   . SER A 1 26 ? -8.453  5.680   2.964   1.00 0.00 ? 26  SER A HG   1  
ATOM   353   N  N    . TYR A 1 27 ? -6.077  4.078   2.619   1.00 0.00 ? 27  TYR A N    1  
ATOM   354   C  CA   . TYR A 1 27 ? -5.119  3.986   3.715   1.00 0.00 ? 27  TYR A CA   1  
ATOM   355   C  C    . TYR A 1 27 ? -3.787  3.425   3.228   1.00 0.00 ? 27  TYR A C    1  
ATOM   356   O  O    . TYR A 1 27 ? -2.724  3.789   3.733   1.00 0.00 ? 27  TYR A O    1  
ATOM   357   C  CB   . TYR A 1 27 ? -5.677  3.107   4.835   1.00 0.00 ? 27  TYR A CB   1  
ATOM   358   C  CG   . TYR A 1 27 ? -6.462  3.876   5.874   1.00 0.00 ? 27  TYR A CG   1  
ATOM   359   C  CD1  . TYR A 1 27 ? -5.982  5.073   6.391   1.00 0.00 ? 27  TYR A CD1  1  
ATOM   360   C  CD2  . TYR A 1 27 ? -7.684  3.405   6.338   1.00 0.00 ? 27  TYR A CD2  1  
ATOM   361   C  CE1  . TYR A 1 27 ? -6.695  5.778   7.341   1.00 0.00 ? 27  TYR A CE1  1  
ATOM   362   C  CE2  . TYR A 1 27 ? -8.405  4.104   7.287   1.00 0.00 ? 27  TYR A CE2  1  
ATOM   363   C  CZ   . TYR A 1 27 ? -7.907  5.290   7.785   1.00 0.00 ? 27  TYR A CZ   1  
ATOM   364   O  OH   . TYR A 1 27 ? -8.621  5.989   8.730   1.00 0.00 ? 27  TYR A OH   1  
ATOM   365   H  H    . TYR A 1 27 ? -6.810  3.430   2.571   1.00 0.00 ? 27  TYR A H    1  
ATOM   366   H  HA   . TYR A 1 27 ? -4.958  4.983   4.099   1.00 0.00 ? 27  TYR A HA   1  
ATOM   367   H  HB2  . TYR A 1 27 ? -6.332  2.364   4.408   1.00 0.00 ? 27  TYR A HB2  1  
ATOM   368   H  HB3  . TYR A 1 27 ? -4.858  2.613   5.337   1.00 0.00 ? 27  TYR A HB3  1  
ATOM   369   H  HD1  . TYR A 1 27 ? -5.033  5.452   6.041   1.00 0.00 ? 27  TYR A HD1  1  
ATOM   370   H  HD2  . TYR A 1 27 ? -8.071  2.476   5.947   1.00 0.00 ? 27  TYR A HD2  1  
ATOM   371   H  HE1  . TYR A 1 27 ? -6.305  6.707   7.731   1.00 0.00 ? 27  TYR A HE1  1  
ATOM   372   H  HE2  . TYR A 1 27 ? -9.353  3.722   7.635   1.00 0.00 ? 27  TYR A HE2  1  
ATOM   373   H  HH   . TYR A 1 27 ? -8.924  6.818   8.354   1.00 0.00 ? 27  TYR A HH   1  
ATOM   374   N  N    . LEU A 1 28 ? -3.851  2.535   2.243   1.00 0.00 ? 28  LEU A N    1  
ATOM   375   C  CA   . LEU A 1 28 ? -2.651  1.922   1.686   1.00 0.00 ? 28  LEU A CA   1  
ATOM   376   C  C    . LEU A 1 28 ? -1.955  2.872   0.716   1.00 0.00 ? 28  LEU A C    1  
ATOM   377   O  O    . LEU A 1 28 ? -0.729  2.868   0.601   1.00 0.00 ? 28  LEU A O    1  
ATOM   378   C  CB   . LEU A 1 28 ? -3.006  0.616   0.972   1.00 0.00 ? 28  LEU A CB   1  
ATOM   379   C  CG   . LEU A 1 28 ? -1.955  0.075   0.002   1.00 0.00 ? 28  LEU A CG   1  
ATOM   380   C  CD1  . LEU A 1 28 ? -0.717  -0.383  0.757   1.00 0.00 ? 28  LEU A CD1  1  
ATOM   381   C  CD2  . LEU A 1 28 ? -2.531  -1.066  -0.825  1.00 0.00 ? 28  LEU A CD2  1  
ATOM   382   H  H    . LEU A 1 28 ? -4.727  2.284   1.882   1.00 0.00 ? 28  LEU A H    1  
ATOM   383   H  HA   . LEU A 1 28 ? -1.980  1.706   2.503   1.00 0.00 ? 28  LEU A HA   1  
ATOM   384   H  HB2  . LEU A 1 28 ? -3.178  -0.136  1.726   1.00 0.00 ? 28  LEU A HB2  1  
ATOM   385   H  HB3  . LEU A 1 28 ? -3.918  0.781   0.416   1.00 0.00 ? 28  LEU A HB3  1  
ATOM   386   H  HG   . LEU A 1 28 ? -1.659  0.864   -0.676  1.00 0.00 ? 28  LEU A HG   1  
ATOM   387   H  HD11 . LEU A 1 28 ? -0.736  -1.457  0.861   1.00 0.00 ? 28  LEU A HD11 1  
ATOM   388   H  HD12 . LEU A 1 28 ? -0.703  0.073   1.735   1.00 0.00 ? 28  LEU A HD12 1  
ATOM   389   H  HD13 . LEU A 1 28 ? 0.167   -0.089  0.210   1.00 0.00 ? 28  LEU A HD13 1  
ATOM   390   H  HD21 . LEU A 1 28 ? -1.971  -1.969  -0.631  1.00 0.00 ? 28  LEU A HD21 1  
ATOM   391   H  HD22 . LEU A 1 28 ? -2.464  -0.818  -1.874  1.00 0.00 ? 28  LEU A HD22 1  
ATOM   392   H  HD23 . LEU A 1 28 ? -3.566  -1.218  -0.556  1.00 0.00 ? 28  LEU A HD23 1  
ATOM   393   N  N    . ILE A 1 29 ? -2.744  3.685   0.022   1.00 0.00 ? 29  ILE A N    1  
ATOM   394   C  CA   . ILE A 1 29 ? -2.203  4.642   -0.934  1.00 0.00 ? 29  ILE A CA   1  
ATOM   395   C  C    . ILE A 1 29 ? -1.410  5.736   -0.228  1.00 0.00 ? 29  ILE A C    1  
ATOM   396   O  O    . ILE A 1 29 ? -0.304  6.082   -0.645  1.00 0.00 ? 29  ILE A O    1  
ATOM   397   C  CB   . ILE A 1 29 ? -3.319  5.292   -1.773  1.00 0.00 ? 29  ILE A CB   1  
ATOM   398   C  CG1  . ILE A 1 29 ? -4.023  4.238   -2.630  1.00 0.00 ? 29  ILE A CG1  1  
ATOM   399   C  CG2  . ILE A 1 29 ? -2.749  6.399   -2.646  1.00 0.00 ? 29  ILE A CG2  1  
ATOM   400   C  CD1  . ILE A 1 29 ? -5.470  4.567   -2.925  1.00 0.00 ? 29  ILE A CD1  1  
ATOM   401   H  H    . ILE A 1 29 ? -3.714  3.640   0.158   1.00 0.00 ? 29  ILE A H    1  
ATOM   402   H  HA   . ILE A 1 29 ? -1.543  4.108   -1.603  1.00 0.00 ? 29  ILE A HA   1  
ATOM   403   H  HB   . ILE A 1 29 ? -4.036  5.733   -1.097  1.00 0.00 ? 29  ILE A HB   1  
ATOM   404   H  HG12 . ILE A 1 29 ? -3.506  4.146   -3.572  1.00 0.00 ? 29  ILE A HG12 1  
ATOM   405   H  HG13 . ILE A 1 29 ? -3.996  3.289   -2.115  1.00 0.00 ? 29  ILE A HG13 1  
ATOM   406   H  HG21 . ILE A 1 29 ? -1.670  6.374   -2.601  1.00 0.00 ? 29  ILE A HG21 1  
ATOM   407   H  HG22 . ILE A 1 29 ? -3.068  6.253   -3.667  1.00 0.00 ? 29  ILE A HG22 1  
ATOM   408   H  HG23 . ILE A 1 29 ? -3.102  7.356   -2.292  1.00 0.00 ? 29  ILE A HG23 1  
ATOM   409   H  HD11 . ILE A 1 29 ? -6.041  4.531   -2.009  1.00 0.00 ? 29  ILE A HD11 1  
ATOM   410   H  HD12 . ILE A 1 29 ? -5.535  5.558   -3.350  1.00 0.00 ? 29  ILE A HD12 1  
ATOM   411   H  HD13 . ILE A 1 29 ? -5.867  3.847   -3.625  1.00 0.00 ? 29  ILE A HD13 1  
ATOM   412   N  N    . ILE A 1 30 ? -1.981  6.276   0.843   1.00 0.00 ? 30  ILE A N    1  
ATOM   413   C  CA   . ILE A 1 30 ? -1.326  7.329   1.609   1.00 0.00 ? 30  ILE A CA   1  
ATOM   414   C  C    . ILE A 1 30 ? -0.118  6.787   2.367   1.00 0.00 ? 30  ILE A C    1  
ATOM   415   O  O    . ILE A 1 30 ? 0.710   7.551   2.864   1.00 0.00 ? 30  ILE A O    1  
ATOM   416   C  CB   . ILE A 1 30 ? -2.296  7.983   2.611   1.00 0.00 ? 30  ILE A CB   1  
ATOM   417   C  CG1  . ILE A 1 30 ? -2.685  6.984   3.703   1.00 0.00 ? 30  ILE A CG1  1  
ATOM   418   C  CG2  . ILE A 1 30 ? -3.533  8.498   1.892   1.00 0.00 ? 30  ILE A CG2  1  
ATOM   419   C  CD1  . ILE A 1 30 ? -2.987  7.633   5.036   1.00 0.00 ? 30  ILE A CD1  1  
ATOM   420   H  H    . ILE A 1 30 ? -2.864  5.958   1.126   1.00 0.00 ? 30  ILE A H    1  
ATOM   421   H  HA   . ILE A 1 30 ? -0.992  8.087   0.915   1.00 0.00 ? 30  ILE A HA   1  
ATOM   422   H  HB   . ILE A 1 30 ? -1.795  8.824   3.065   1.00 0.00 ? 30  ILE A HB   1  
ATOM   423   H  HG12 . ILE A 1 30 ? -3.565  6.444   3.391   1.00 0.00 ? 30  ILE A HG12 1  
ATOM   424   H  HG13 . ILE A 1 30 ? -1.873  6.287   3.849   1.00 0.00 ? 30  ILE A HG13 1  
ATOM   425   H  HG21 . ILE A 1 30 ? -4.350  8.579   2.593   1.00 0.00 ? 30  ILE A HG21 1  
ATOM   426   H  HG22 . ILE A 1 30 ? -3.325  9.470   1.470   1.00 0.00 ? 30  ILE A HG22 1  
ATOM   427   H  HG23 . ILE A 1 30 ? -3.802  7.813   1.102   1.00 0.00 ? 30  ILE A HG23 1  
ATOM   428   H  HD11 . ILE A 1 30 ? -3.226  8.676   4.882   1.00 0.00 ? 30  ILE A HD11 1  
ATOM   429   H  HD12 . ILE A 1 30 ? -3.828  7.136   5.496   1.00 0.00 ? 30  ILE A HD12 1  
ATOM   430   H  HD13 . ILE A 1 30 ? -2.123  7.553   5.679   1.00 0.00 ? 30  ILE A HD13 1  
ATOM   431   N  N    . HIS A 1 31 ? -0.023  5.464   2.449   1.00 0.00 ? 31  HIS A N    1  
ATOM   432   C  CA   . HIS A 1 31 ? 1.086   4.819   3.144   1.00 0.00 ? 31  HIS A CA   1  
ATOM   433   C  C    . HIS A 1 31 ? 2.207   4.469   2.170   1.00 0.00 ? 31  HIS A C    1  
ATOM   434   O  O    . HIS A 1 31 ? 3.371   4.798   2.402   1.00 0.00 ? 31  HIS A O    1  
ATOM   435   C  CB   . HIS A 1 31 ? 0.602   3.557   3.859   1.00 0.00 ? 31  HIS A CB   1  
ATOM   436   C  CG   . HIS A 1 31 ? 1.666   2.515   4.019   1.00 0.00 ? 31  HIS A CG   1  
ATOM   437   N  ND1  . HIS A 1 31 ? 2.214   2.180   5.239   1.00 0.00 ? 31  HIS A ND1  1  
ATOM   438   C  CD2  . HIS A 1 31 ? 2.280   1.730   3.103   1.00 0.00 ? 31  HIS A CD2  1  
ATOM   439   C  CE1  . HIS A 1 31 ? 3.121   1.235   5.067   1.00 0.00 ? 31  HIS A CE1  1  
ATOM   440   N  NE2  . HIS A 1 31 ? 3.181   0.944   3.780   1.00 0.00 ? 31  HIS A NE2  1  
ATOM   441   H  H    . HIS A 1 31 ? -0.714  4.908   2.032   1.00 0.00 ? 31  HIS A H    1  
ATOM   442   H  HA   . HIS A 1 31 ? 1.467   5.514   3.877   1.00 0.00 ? 31  HIS A HA   1  
ATOM   443   H  HB2  . HIS A 1 31 ? 0.248   3.823   4.844   1.00 0.00 ? 31  HIS A HB2  1  
ATOM   444   H  HB3  . HIS A 1 31 ? -0.210  3.121   3.296   1.00 0.00 ? 31  HIS A HB3  1  
ATOM   445   H  HD1  . HIS A 1 31 ? 1.975   2.577   6.102   1.00 0.00 ? 31  HIS A HD1  1  
ATOM   446   H  HD2  . HIS A 1 31 ? 2.098   1.723   2.038   1.00 0.00 ? 31  HIS A HD2  1  
ATOM   447   H  HE1  . HIS A 1 31 ? 3.713   0.778   5.845   1.00 0.00 ? 31  HIS A HE1  1  
ATOM   448   N  N    . THR A 1 32 ? 1.849   3.798   1.080   1.00 0.00 ? 32  THR A N    1  
ATOM   449   C  CA   . THR A 1 32 ? 2.824   3.401   0.072   1.00 0.00 ? 32  THR A CA   1  
ATOM   450   C  C    . THR A 1 32 ? 3.764   4.552   -0.267  1.00 0.00 ? 32  THR A C    1  
ATOM   451   O  O    . THR A 1 32 ? 4.865   4.338   -0.776  1.00 0.00 ? 32  THR A O    1  
ATOM   452   C  CB   . THR A 1 32 ? 2.135   2.918   -1.218  1.00 0.00 ? 32  THR A CB   1  
ATOM   453   O  OG1  . THR A 1 32 ? 1.240   1.840   -0.922  1.00 0.00 ? 32  THR A OG1  1  
ATOM   454   C  CG2  . THR A 1 32 ? 3.162   2.464   -2.244  1.00 0.00 ? 32  THR A CG2  1  
ATOM   455   H  H    . THR A 1 32 ? 0.906   3.564   0.951   1.00 0.00 ? 32  THR A H    1  
ATOM   456   H  HA   . THR A 1 32 ? 3.404   2.582   0.473   1.00 0.00 ? 32  THR A HA   1  
ATOM   457   H  HB   . THR A 1 32 ? 1.571   3.740   -1.635  1.00 0.00 ? 32  THR A HB   1  
ATOM   458   H  HG1  . THR A 1 32 ? 1.597   1.318   -0.199  1.00 0.00 ? 32  THR A HG1  1  
ATOM   459   H  HG21 . THR A 1 32 ? 2.925   1.463   -2.571  1.00 0.00 ? 32  THR A HG21 1  
ATOM   460   H  HG22 . THR A 1 32 ? 4.146   2.472   -1.796  1.00 0.00 ? 32  THR A HG22 1  
ATOM   461   H  HG23 . THR A 1 32 ? 3.146   3.134   -3.090  1.00 0.00 ? 32  THR A HG23 1  
ATOM   462   N  N    . ARG A 1 33 ? 3.324   5.773   0.017   1.00 0.00 ? 33  ARG A N    1  
ATOM   463   C  CA   . ARG A 1 33 ? 4.126   6.958   -0.259  1.00 0.00 ? 33  ARG A CA   1  
ATOM   464   C  C    . ARG A 1 33 ? 5.203   7.145   0.806   1.00 0.00 ? 33  ARG A C    1  
ATOM   465   O  O    . ARG A 1 33 ? 6.327   7.548   0.503   1.00 0.00 ? 33  ARG A O    1  
ATOM   466   C  CB   . ARG A 1 33 ? 3.235   8.200   -0.321  1.00 0.00 ? 33  ARG A CB   1  
ATOM   467   C  CG   . ARG A 1 33 ? 2.228   8.285   0.814   1.00 0.00 ? 33  ARG A CG   1  
ATOM   468   C  CD   . ARG A 1 33 ? 1.528   9.635   0.838   1.00 0.00 ? 33  ARG A CD   1  
ATOM   469   N  NE   . ARG A 1 33 ? 2.475   10.740  0.954   1.00 0.00 ? 33  ARG A NE   1  
ATOM   470   C  CZ   . ARG A 1 33 ? 2.133   12.018  0.829   1.00 0.00 ? 33  ARG A CZ   1  
ATOM   471   N  NH1  . ARG A 1 33 ? 0.872   12.349  0.585   1.00 0.00 ? 33  ARG A NH1  1  
ATOM   472   N  NH2  . ARG A 1 33 ? 3.052   12.967  0.947   1.00 0.00 ? 33  ARG A NH2  1  
ATOM   473   H  H    . ARG A 1 33 ? 2.437   5.879   0.422   1.00 0.00 ? 33  ARG A H    1  
ATOM   474   H  HA   . ARG A 1 33 ? 4.604   6.820   -1.217  1.00 0.00 ? 33  ARG A HA   1  
ATOM   475   H  HB2  . ARG A 1 33 ? 3.860   9.080   -0.284  1.00 0.00 ? 33  ARG A HB2  1  
ATOM   476   H  HB3  . ARG A 1 33 ? 2.693   8.193   -1.255  1.00 0.00 ? 33  ARG A HB3  1  
ATOM   477   H  HG2  . ARG A 1 33 ? 1.487   7.510   0.684   1.00 0.00 ? 33  ARG A HG2  1  
ATOM   478   H  HG3  . ARG A 1 33 ? 2.743   8.139   1.751   1.00 0.00 ? 33  ARG A HG3  1  
ATOM   479   H  HD2  . ARG A 1 33 ? 0.965   9.750   -0.076  1.00 0.00 ? 33  ARG A HD2  1  
ATOM   480   H  HD3  . ARG A 1 33 ? 0.854   9.660   1.681   1.00 0.00 ? 33  ARG A HD3  1  
ATOM   481   H  HE   . ARG A 1 33 ? 3.412   10.518  1.134   1.00 0.00 ? 33  ARG A HE   1  
ATOM   482   H  HH11 . ARG A 1 33 ? 0.177   11.636  0.496   1.00 0.00 ? 33  ARG A HH11 1  
ATOM   483   H  HH12 . ARG A 1 33 ? 0.617   13.311  0.492   1.00 0.00 ? 33  ARG A HH12 1  
ATOM   484   H  HH21 . ARG A 1 33 ? 4.003   12.721  1.132   1.00 0.00 ? 33  ARG A HH21 1  
ATOM   485   H  HH22 . ARG A 1 33 ? 2.794   13.928  0.853   1.00 0.00 ? 33  ARG A HH22 1  
ATOM   486   N  N    . THR A 1 34 ? 4.853   6.851   2.054   1.00 0.00 ? 34  THR A N    1  
ATOM   487   C  CA   . THR A 1 34 ? 5.788   6.988   3.163   1.00 0.00 ? 34  THR A CA   1  
ATOM   488   C  C    . THR A 1 34 ? 7.109   6.291   2.858   1.00 0.00 ? 34  THR A C    1  
ATOM   489   O  O    . THR A 1 34 ? 8.174   6.746   3.277   1.00 0.00 ? 34  THR A O    1  
ATOM   490   C  CB   . THR A 1 34 ? 5.204   6.409   4.465   1.00 0.00 ? 34  THR A CB   1  
ATOM   491   O  OG1  . THR A 1 34 ? 5.872   6.977   5.597   1.00 0.00 ? 34  THR A OG1  1  
ATOM   492   C  CG2  . THR A 1 34 ? 5.344   4.895   4.495   1.00 0.00 ? 34  THR A CG2  1  
ATOM   493   H  H    . THR A 1 34 ? 3.942   6.535   2.231   1.00 0.00 ? 34  THR A H    1  
ATOM   494   H  HA   . THR A 1 34 ? 5.974   8.041   3.314   1.00 0.00 ? 34  THR A HA   1  
ATOM   495   H  HB   . THR A 1 34 ? 4.154   6.659   4.513   1.00 0.00 ? 34  THR A HB   1  
ATOM   496   H  HG1  . THR A 1 34 ? 6.728   6.557   5.708   1.00 0.00 ? 34  THR A HG1  1  
ATOM   497   H  HG21 . THR A 1 34 ? 5.296   4.509   3.488   1.00 0.00 ? 34  THR A HG21 1  
ATOM   498   H  HG22 . THR A 1 34 ? 4.543   4.470   5.081   1.00 0.00 ? 34  THR A HG22 1  
ATOM   499   H  HG23 . THR A 1 34 ? 6.293   4.630   4.937   1.00 0.00 ? 34  THR A HG23 1  
ATOM   500   N  N    . HIS A 1 35 ? 7.033   5.185   2.125   1.00 0.00 ? 35  HIS A N    1  
ATOM   501   C  CA   . HIS A 1 35 ? 8.224   4.425   1.762   1.00 0.00 ? 35  HIS A CA   1  
ATOM   502   C  C    . HIS A 1 35 ? 9.317   5.348   1.232   1.00 0.00 ? 35  HIS A C    1  
ATOM   503   O  O    . HIS A 1 35 ? 10.495  4.988   1.214   1.00 0.00 ? 35  HIS A O    1  
ATOM   504   C  CB   . HIS A 1 35 ? 7.881   3.367   0.713   1.00 0.00 ? 35  HIS A CB   1  
ATOM   505   C  CG   . HIS A 1 35 ? 7.323   2.105   1.295   1.00 0.00 ? 35  HIS A CG   1  
ATOM   506   N  ND1  . HIS A 1 35 ? 8.083   0.974   1.507   1.00 0.00 ? 35  HIS A ND1  1  
ATOM   507   C  CD2  . HIS A 1 35 ? 6.072   1.800   1.712   1.00 0.00 ? 35  HIS A CD2  1  
ATOM   508   C  CE1  . HIS A 1 35 ? 7.323   0.027   2.027   1.00 0.00 ? 35  HIS A CE1  1  
ATOM   509   N  NE2  . HIS A 1 35 ? 6.098   0.503   2.163   1.00 0.00 ? 35  HIS A NE2  1  
ATOM   510   H  H    . HIS A 1 35 ? 6.156   4.872   1.820   1.00 0.00 ? 35  HIS A H    1  
ATOM   511   H  HA   . HIS A 1 35 ? 8.587   3.932   2.651   1.00 0.00 ? 35  HIS A HA   1  
ATOM   512   H  HB2  . HIS A 1 35 ? 7.146   3.771   0.032   1.00 0.00 ? 35  HIS A HB2  1  
ATOM   513   H  HB3  . HIS A 1 35 ? 8.774   3.113   0.161   1.00 0.00 ? 35  HIS A HB3  1  
ATOM   514   H  HD1  . HIS A 1 35 ? 9.037   0.879   1.304   1.00 0.00 ? 35  HIS A HD1  1  
ATOM   515   H  HD2  . HIS A 1 35 ? 5.212   2.454   1.694   1.00 0.00 ? 35  HIS A HD2  1  
ATOM   516   H  HE1  . HIS A 1 35 ? 7.648   -0.967  2.297   1.00 0.00 ? 35  HIS A HE1  1  
ATOM   517   N  N    . THR A 1 36 ? 8.919   6.541   0.800   1.00 0.00 ? 36  THR A N    1  
ATOM   518   C  CA   . THR A 1 36 ? 9.864   7.515   0.267   1.00 0.00 ? 36  THR A CA   1  
ATOM   519   C  C    . THR A 1 36 ? 10.546  8.289   1.389   1.00 0.00 ? 36  THR A C    1  
ATOM   520   O  O    . THR A 1 36 ? 10.769  9.494   1.279   1.00 0.00 ? 36  THR A O    1  
ATOM   521   C  CB   . THR A 1 36 ? 9.169   8.511   -0.680  1.00 0.00 ? 36  THR A CB   1  
ATOM   522   O  OG1  . THR A 1 36 ? 8.269   9.344   0.060   1.00 0.00 ? 36  THR A OG1  1  
ATOM   523   C  CG2  . THR A 1 36 ? 8.407   7.778   -1.773  1.00 0.00 ? 36  THR A CG2  1  
ATOM   524   H  H    . THR A 1 36 ? 7.967   6.769   0.840   1.00 0.00 ? 36  THR A H    1  
ATOM   525   H  HA   . THR A 1 36 ? 10.614  6.979   -0.295  1.00 0.00 ? 36  THR A HA   1  
ATOM   526   H  HB   . THR A 1 36 ? 9.924   9.132   -1.142  1.00 0.00 ? 36  THR A HB   1  
ATOM   527   H  HG1  . THR A 1 36 ? 7.845   8.825   0.748   1.00 0.00 ? 36  THR A HG1  1  
ATOM   528   H  HG21 . THR A 1 36 ? 8.027   8.492   -2.488  1.00 0.00 ? 36  THR A HG21 1  
ATOM   529   H  HG22 . THR A 1 36 ? 7.584   7.234   -1.335  1.00 0.00 ? 36  THR A HG22 1  
ATOM   530   H  HG23 . THR A 1 36 ? 9.070   7.087   -2.272  1.00 0.00 ? 36  THR A HG23 1  
ATOM   531   N  N    . GLY A 1 37 ? 10.877  7.588   2.470   1.00 0.00 ? 37  GLY A N    1  
ATOM   532   C  CA   . GLY A 1 37 ? 11.532  8.227   3.596   1.00 0.00 ? 37  GLY A CA   1  
ATOM   533   C  C    . GLY A 1 37 ? 12.983  7.810   3.736   1.00 0.00 ? 37  GLY A C    1  
ATOM   534   O  O    . GLY A 1 37 ? 13.462  7.572   4.844   1.00 0.00 ? 37  GLY A O    1  
ATOM   535   H  H    . GLY A 1 37 ? 10.675  6.630   2.502   1.00 0.00 ? 37  GLY A H    1  
ATOM   536   H  HA2  . GLY A 1 37 ? 11.487  9.298   3.465   1.00 0.00 ? 37  GLY A HA2  1  
ATOM   537   H  HA3  . GLY A 1 37 ? 11.005  7.962   4.501   1.00 0.00 ? 37  GLY A HA3  1  
ATOM   538   N  N    . GLU A 1 38 ? 13.683  7.721   2.609   1.00 0.00 ? 38  GLU A N    1  
ATOM   539   C  CA   . GLU A 1 38 ? 15.087  7.327   2.612   1.00 0.00 ? 38  GLU A CA   1  
ATOM   540   C  C    . GLU A 1 38 ? 15.989  8.529   2.347   1.00 0.00 ? 38  GLU A C    1  
ATOM   541   O  O    . GLU A 1 38 ? 16.984  8.737   3.041   1.00 0.00 ? 38  GLU A O    1  
ATOM   542   C  CB   . GLU A 1 38 ? 15.338  6.245   1.560   1.00 0.00 ? 38  GLU A CB   1  
ATOM   543   C  CG   . GLU A 1 38 ? 14.809  4.877   1.956   1.00 0.00 ? 38  GLU A CG   1  
ATOM   544   C  CD   . GLU A 1 38 ? 15.099  3.815   0.913   1.00 0.00 ? 38  GLU A CD   1  
ATOM   545   O  OE1  . GLU A 1 38 ? 16.243  3.314   0.880   1.00 0.00 ? 38  GLU A OE1  1  
ATOM   546   O  OE2  . GLU A 1 38 ? 14.184  3.485   0.130   1.00 0.00 ? 38  GLU A OE2  1  
ATOM   547   H  H    . GLU A 1 38 ? 13.244  7.924   1.757   1.00 0.00 ? 38  GLU A H    1  
ATOM   548   H  HA   . GLU A 1 38 ? 15.317  6.928   3.588   1.00 0.00 ? 38  GLU A HA   1  
ATOM   549   H  HB2  . GLU A 1 38 ? 14.862  6.540   0.636   1.00 0.00 ? 38  GLU A HB2  1  
ATOM   550   H  HB3  . GLU A 1 38 ? 16.402  6.162   1.394   1.00 0.00 ? 38  GLU A HB3  1  
ATOM   551   H  HG2  . GLU A 1 38 ? 15.270  4.582   2.886   1.00 0.00 ? 38  GLU A HG2  1  
ATOM   552   H  HG3  . GLU A 1 38 ? 13.739  4.944   2.091   1.00 0.00 ? 38  GLU A HG3  1  
ATOM   553   N  N    . SER A 1 39 ? 15.634  9.317   1.337   1.00 0.00 ? 39  SER A N    1  
ATOM   554   C  CA   . SER A 1 39 ? 16.413  10.496  0.977   1.00 0.00 ? 39  SER A CA   1  
ATOM   555   C  C    . SER A 1 39 ? 16.699  11.355  2.205   1.00 0.00 ? 39  SER A C    1  
ATOM   556   O  O    . SER A 1 39 ? 17.854  11.605  2.546   1.00 0.00 ? 39  SER A O    1  
ATOM   557   C  CB   . SER A 1 39 ? 15.670  11.322  -0.076  1.00 0.00 ? 39  SER A CB   1  
ATOM   558   O  OG   . SER A 1 39 ? 15.873  10.794  -1.375  1.00 0.00 ? 39  SER A OG   1  
ATOM   559   H  H    . SER A 1 39 ? 14.829  9.099   0.821   1.00 0.00 ? 39  SER A H    1  
ATOM   560   H  HA   . SER A 1 39 ? 17.351  10.159  0.561   1.00 0.00 ? 39  SER A HA   1  
ATOM   561   H  HB2  . SER A 1 39 ? 14.613  11.312  0.143   1.00 0.00 ? 39  SER A HB2  1  
ATOM   562   H  HB3  . SER A 1 39 ? 16.033  12.339  -0.052  1.00 0.00 ? 39  SER A HB3  1  
ATOM   563   H  HG   . SER A 1 39 ? 15.101  10.288  -1.639  1.00 0.00 ? 39  SER A HG   1  
ATOM   564   N  N    . GLY A 1 40 ? 15.636  11.804  2.866   1.00 0.00 ? 40  GLY A N    1  
ATOM   565   C  CA   . GLY A 1 40 ? 15.793  12.630  4.049   1.00 0.00 ? 40  GLY A CA   1  
ATOM   566   C  C    . GLY A 1 40 ? 16.918  12.151  4.945   1.00 0.00 ? 40  GLY A C    1  
ATOM   567   O  O    . GLY A 1 40 ? 18.064  12.583  4.824   1.00 0.00 ? 40  GLY A O    1  
ATOM   568   H  H    . GLY A 1 40 ? 14.738  11.572  2.548   1.00 0.00 ? 40  GLY A H    1  
ATOM   569   H  HA2  . GLY A 1 40 ? 15.998  13.644  3.742   1.00 0.00 ? 40  GLY A HA2  1  
ATOM   570   H  HA3  . GLY A 1 40 ? 14.870  12.614  4.610   1.00 0.00 ? 40  GLY A HA3  1  
ATOM   571   N  N    . PRO A 1 41 ? 16.593  11.238  5.872   1.00 0.00 ? 41  PRO A N    1  
ATOM   572   C  CA   . PRO A 1 41 ? 17.571  10.681  6.812   1.00 0.00 ? 41  PRO A CA   1  
ATOM   573   C  C    . PRO A 1 41 ? 18.580  9.768   6.125   1.00 0.00 ? 41  PRO A C    1  
ATOM   574   O  O    . PRO A 1 41 ? 18.231  9.010   5.220   1.00 0.00 ? 41  PRO A O    1  
ATOM   575   C  CB   . PRO A 1 41 ? 16.707  9.882   7.791   1.00 0.00 ? 41  PRO A CB   1  
ATOM   576   C  CG   . PRO A 1 41 ? 15.484  9.530   7.017   1.00 0.00 ? 41  PRO A CG   1  
ATOM   577   C  CD   . PRO A 1 41 ? 15.246  10.677  6.074   1.00 0.00 ? 41  PRO A CD   1  
ATOM   578   H  HA   . PRO A 1 41 ? 18.096  11.460  7.345   1.00 0.00 ? 41  PRO A HA   1  
ATOM   579   H  HB2  . PRO A 1 41 ? 17.242  8.998   8.109   1.00 0.00 ? 41  PRO A HB2  1  
ATOM   580   H  HB3  . PRO A 1 41 ? 16.469  10.494  8.649   1.00 0.00 ? 41  PRO A HB3  1  
ATOM   581   H  HG2  . PRO A 1 41 ? 15.649  8.618   6.464   1.00 0.00 ? 41  PRO A HG2  1  
ATOM   582   H  HG3  . PRO A 1 41 ? 14.645  9.418   7.688   1.00 0.00 ? 41  PRO A HG3  1  
ATOM   583   H  HD2  . PRO A 1 41 ? 14.833  10.321  5.142   1.00 0.00 ? 41  PRO A HD2  1  
ATOM   584   H  HD3  . PRO A 1 41 ? 14.590  11.407  6.525   1.00 0.00 ? 41  PRO A HD3  1  
ATOM   585   N  N    . SER A 1 42 ? 19.834  9.845   6.561   1.00 0.00 ? 42  SER A N    1  
ATOM   586   C  CA   . SER A 1 42 ? 20.895  9.027   5.985   1.00 0.00 ? 42  SER A CA   1  
ATOM   587   C  C    . SER A 1 42 ? 22.104  8.973   6.914   1.00 0.00 ? 42  SER A C    1  
ATOM   588   O  O    . SER A 1 42 ? 22.128  9.625   7.958   1.00 0.00 ? 42  SER A O    1  
ATOM   589   C  CB   . SER A 1 42 ? 21.310  9.581   4.620   1.00 0.00 ? 42  SER A CB   1  
ATOM   590   O  OG   . SER A 1 42 ? 21.881  8.567   3.811   1.00 0.00 ? 42  SER A OG   1  
ATOM   591   H  H    . SER A 1 42 ? 20.050  10.469  7.286   1.00 0.00 ? 42  SER A H    1  
ATOM   592   H  HA   . SER A 1 42 ? 20.510  8.027   5.856   1.00 0.00 ? 42  SER A HA   1  
ATOM   593   H  HB2  . SER A 1 42 ? 20.443  9.980   4.117   1.00 0.00 ? 42  SER A HB2  1  
ATOM   594   H  HB3  . SER A 1 42 ? 22.039  10.366  4.760   1.00 0.00 ? 42  SER A HB3  1  
ATOM   595   H  HG   . SER A 1 42 ? 21.466  7.725   4.013   1.00 0.00 ? 42  SER A HG   1  
ATOM   596   N  N    . SER A 1 43 ? 23.106  8.191   6.526   1.00 0.00 ? 43  SER A N    1  
ATOM   597   C  CA   . SER A 1 43 ? 24.317  8.048   7.325   1.00 0.00 ? 43  SER A CA   1  
ATOM   598   C  C    . SER A 1 43 ? 25.561  8.283   6.473   1.00 0.00 ? 43  SER A C    1  
ATOM   599   O  O    . SER A 1 43 ? 25.545  8.077   5.260   1.00 0.00 ? 43  SER A O    1  
ATOM   600   C  CB   . SER A 1 43 ? 24.375  6.656   7.957   1.00 0.00 ? 43  SER A CB   1  
ATOM   601   O  OG   . SER A 1 43 ? 25.370  6.594   8.964   1.00 0.00 ? 43  SER A OG   1  
ATOM   602   H  H    . SER A 1 43 ? 23.027  7.697   5.683   1.00 0.00 ? 43  SER A H    1  
ATOM   603   H  HA   . SER A 1 43 ? 24.287  8.789   8.109   1.00 0.00 ? 43  SER A HA   1  
ATOM   604   H  HB2  . SER A 1 43 ? 23.418  6.425   8.399   1.00 0.00 ? 43  SER A HB2  1  
ATOM   605   H  HB3  . SER A 1 43 ? 24.605  5.926   7.195   1.00 0.00 ? 43  SER A HB3  1  
ATOM   606   H  HG   . SER A 1 43 ? 25.495  5.682   9.236   1.00 0.00 ? 43  SER A HG   1  
ATOM   607   N  N    . GLY A 1 44 ? 26.640  8.717   7.118   1.00 0.00 ? 44  GLY A N    1  
ATOM   608   C  CA   . GLY A 1 44 ? 27.877  8.974   6.405   1.00 0.00 ? 44  GLY A CA   1  
ATOM   609   C  C    . GLY A 1 44 ? 28.514  7.706   5.874   1.00 0.00 ? 44  GLY A C    1  
ATOM   610   O  O    . GLY A 1 44 ? 28.371  7.415   4.687   1.00 0.00 ? 44  GLY A O    1  
ATOM   611   H  H    . GLY A 1 44 ? 26.594  8.864   8.086   1.00 0.00 ? 44  GLY A H    1  
ATOM   612   H  HA2  . GLY A 1 44 ? 27.672  9.636   5.577   1.00 0.00 ? 44  GLY A HA2  1  
ATOM   613   H  HA3  . GLY A 1 44 ? 28.572  9.458   7.076   1.00 0.00 ? 44  GLY A HA3  1  
HETATM 614   ZN ZN   . ZN  B 2 .  ? 4.475   -0.349  2.749   1.00 0.00 ? 181 ZN  A ZN   1  
ATOM   615   N  N    . GLY A 1 1  ? -8.695  -7.367  -14.813 1.00 0.00 ? 1   GLY A N    2  
ATOM   616   C  CA   . GLY A 1 1  ? -8.065  -8.331  -13.929 1.00 0.00 ? 1   GLY A CA   2  
ATOM   617   C  C    . GLY A 1 1  ? -7.124  -9.263  -14.664 1.00 0.00 ? 1   GLY A C    2  
ATOM   618   O  O    . GLY A 1 1  ? -7.152  -9.344  -15.892 1.00 0.00 ? 1   GLY A O    2  
ATOM   619   H  H1   . GLY A 1 1  ? -8.472  -7.362  -15.767 1.00 0.00 ? 1   GLY A H1   2  
ATOM   620   H  HA2  . GLY A 1 1  ? -7.510  -7.799  -13.171 1.00 0.00 ? 1   GLY A HA2  2  
ATOM   621   H  HA3  . GLY A 1 1  ? -8.835  -8.919  -13.450 1.00 0.00 ? 1   GLY A HA3  2  
ATOM   622   N  N    . SER A 1 2  ? -6.285  -9.969  -13.912 1.00 0.00 ? 2   SER A N    2  
ATOM   623   C  CA   . SER A 1 2  ? -5.326  -10.897 -14.501 1.00 0.00 ? 2   SER A CA   2  
ATOM   624   C  C    . SER A 1 2  ? -5.189  -12.152 -13.645 1.00 0.00 ? 2   SER A C    2  
ATOM   625   O  O    . SER A 1 2  ? -5.529  -12.150 -12.462 1.00 0.00 ? 2   SER A O    2  
ATOM   626   C  CB   . SER A 1 2  ? -3.962  -10.222 -14.659 1.00 0.00 ? 2   SER A CB   2  
ATOM   627   O  OG   . SER A 1 2  ? -4.072  -9.017  -15.397 1.00 0.00 ? 2   SER A OG   2  
ATOM   628   H  H    . SER A 1 2  ? -6.310  -9.861  -12.938 1.00 0.00 ? 2   SER A H    2  
ATOM   629   H  HA   . SER A 1 2  ? -5.694  -11.179 -15.476 1.00 0.00 ? 2   SER A HA   2  
ATOM   630   H  HB2  . SER A 1 2  ? -3.560  -9.997  -13.683 1.00 0.00 ? 2   SER A HB2  2  
ATOM   631   H  HB3  . SER A 1 2  ? -3.292  -10.890 -15.180 1.00 0.00 ? 2   SER A HB3  2  
ATOM   632   H  HG   . SER A 1 2  ? -4.780  -9.098  -16.040 1.00 0.00 ? 2   SER A HG   2  
ATOM   633   N  N    . SER A 1 3  ? -4.689  -13.223 -14.252 1.00 0.00 ? 3   SER A N    2  
ATOM   634   C  CA   . SER A 1 3  ? -4.510  -14.488 -13.548 1.00 0.00 ? 3   SER A CA   2  
ATOM   635   C  C    . SER A 1 3  ? -3.098  -15.028 -13.753 1.00 0.00 ? 3   SER A C    2  
ATOM   636   O  O    . SER A 1 3  ? -2.446  -14.730 -14.752 1.00 0.00 ? 3   SER A O    2  
ATOM   637   C  CB   . SER A 1 3  ? -5.537  -15.514 -14.031 1.00 0.00 ? 3   SER A CB   2  
ATOM   638   O  OG   . SER A 1 3  ? -5.735  -16.531 -13.063 1.00 0.00 ? 3   SER A OG   2  
ATOM   639   H  H    . SER A 1 3  ? -4.437  -13.162 -15.198 1.00 0.00 ? 3   SER A H    2  
ATOM   640   H  HA   . SER A 1 3  ? -4.664  -14.305 -12.495 1.00 0.00 ? 3   SER A HA   2  
ATOM   641   H  HB2  . SER A 1 3  ? -6.479  -15.019 -14.213 1.00 0.00 ? 3   SER A HB2  2  
ATOM   642   H  HB3  . SER A 1 3  ? -5.185  -15.968 -14.946 1.00 0.00 ? 3   SER A HB3  2  
ATOM   643   H  HG   . SER A 1 3  ? -5.800  -17.382 -13.502 1.00 0.00 ? 3   SER A HG   2  
ATOM   644   N  N    . GLY A 1 4  ? -2.633  -15.828 -12.798 1.00 0.00 ? 4   GLY A N    2  
ATOM   645   C  CA   . GLY A 1 4  ? -1.302  -16.398 -12.891 1.00 0.00 ? 4   GLY A CA   2  
ATOM   646   C  C    . GLY A 1 4  ? -1.318  -17.828 -13.394 1.00 0.00 ? 4   GLY A C    2  
ATOM   647   O  O    . GLY A 1 4  ? -2.381  -18.430 -13.540 1.00 0.00 ? 4   GLY A O    2  
ATOM   648   H  H    . GLY A 1 4  ? -3.198  -16.031 -12.023 1.00 0.00 ? 4   GLY A H    2  
ATOM   649   H  HA2  . GLY A 1 4  ? -0.711  -15.796 -13.565 1.00 0.00 ? 4   GLY A HA2  2  
ATOM   650   H  HA3  . GLY A 1 4  ? -0.845  -16.378 -11.912 1.00 0.00 ? 4   GLY A HA3  2  
ATOM   651   N  N    . SER A 1 5  ? -0.135  -18.372 -13.662 1.00 0.00 ? 5   SER A N    2  
ATOM   652   C  CA   . SER A 1 5  ? -0.017  -19.739 -14.158 1.00 0.00 ? 5   SER A CA   2  
ATOM   653   C  C    . SER A 1 5  ? 0.541   -20.662 -13.079 1.00 0.00 ? 5   SER A C    2  
ATOM   654   O  O    . SER A 1 5  ? -0.005  -21.734 -12.820 1.00 0.00 ? 5   SER A O    2  
ATOM   655   C  CB   . SER A 1 5  ? 0.882   -19.779 -15.395 1.00 0.00 ? 5   SER A CB   2  
ATOM   656   O  OG   . SER A 1 5  ? 0.131   -19.565 -16.578 1.00 0.00 ? 5   SER A OG   2  
ATOM   657   H  H    . SER A 1 5  ? 0.677   -17.841 -13.525 1.00 0.00 ? 5   SER A H    2  
ATOM   658   H  HA   . SER A 1 5  ? -1.005  -20.079 -14.430 1.00 0.00 ? 5   SER A HA   2  
ATOM   659   H  HB2  . SER A 1 5  ? 1.634   -19.009 -15.316 1.00 0.00 ? 5   SER A HB2  2  
ATOM   660   H  HB3  . SER A 1 5  ? 1.361   -20.746 -15.456 1.00 0.00 ? 5   SER A HB3  2  
ATOM   661   H  HG   . SER A 1 5  ? 0.666   -19.792 -17.342 1.00 0.00 ? 5   SER A HG   2  
ATOM   662   N  N    . SER A 1 6  ? 1.634   -20.236 -12.452 1.00 0.00 ? 6   SER A N    2  
ATOM   663   C  CA   . SER A 1 6  ? 2.270   -21.025 -11.404 1.00 0.00 ? 6   SER A CA   2  
ATOM   664   C  C    . SER A 1 6  ? 2.462   -20.194 -10.139 1.00 0.00 ? 6   SER A C    2  
ATOM   665   O  O    . SER A 1 6  ? 3.514   -20.243 -9.504  1.00 0.00 ? 6   SER A O    2  
ATOM   666   C  CB   . SER A 1 6  ? 3.619   -21.560 -11.886 1.00 0.00 ? 6   SER A CB   2  
ATOM   667   O  OG   . SER A 1 6  ? 4.538   -20.503 -12.105 1.00 0.00 ? 6   SER A OG   2  
ATOM   668   H  H    . SER A 1 6  ? 2.023   -19.372 -12.704 1.00 0.00 ? 6   SER A H    2  
ATOM   669   H  HA   . SER A 1 6  ? 1.622   -21.859 -11.177 1.00 0.00 ? 6   SER A HA   2  
ATOM   670   H  HB2  . SER A 1 6  ? 4.027   -22.226 -11.141 1.00 0.00 ? 6   SER A HB2  2  
ATOM   671   H  HB3  . SER A 1 6  ? 3.480   -22.098 -12.813 1.00 0.00 ? 6   SER A HB3  2  
ATOM   672   H  HG   . SER A 1 6  ? 4.341   -19.779 -11.507 1.00 0.00 ? 6   SER A HG   2  
ATOM   673   N  N    . GLY A 1 7  ? 1.435   -19.428 -9.780  1.00 0.00 ? 7   GLY A N    2  
ATOM   674   C  CA   . GLY A 1 7  ? 1.510   -18.596 -8.594  1.00 0.00 ? 7   GLY A CA   2  
ATOM   675   C  C    . GLY A 1 7  ? 0.678   -17.335 -8.716  1.00 0.00 ? 7   GLY A C    2  
ATOM   676   O  O    . GLY A 1 7  ? 1.092   -16.368 -9.355  1.00 0.00 ? 7   GLY A O    2  
ATOM   677   H  H    . GLY A 1 7  ? 0.621   -19.429 -10.325 1.00 0.00 ? 7   GLY A H    2  
ATOM   678   H  HA2  . GLY A 1 7  ? 1.160   -19.165 -7.745  1.00 0.00 ? 7   GLY A HA2  2  
ATOM   679   H  HA3  . GLY A 1 7  ? 2.541   -18.318 -8.427  1.00 0.00 ? 7   GLY A HA3  2  
ATOM   680   N  N    . THR A 1 8  ? -0.502  -17.345 -8.103  1.00 0.00 ? 8   THR A N    2  
ATOM   681   C  CA   . THR A 1 8  ? -1.396  -16.195 -8.149  1.00 0.00 ? 8   THR A CA   2  
ATOM   682   C  C    . THR A 1 8  ? -1.566  -15.575 -6.767  1.00 0.00 ? 8   THR A C    2  
ATOM   683   O  O    . THR A 1 8  ? -2.551  -15.832 -6.077  1.00 0.00 ? 8   THR A O    2  
ATOM   684   C  CB   . THR A 1 8  ? -2.782  -16.583 -8.698  1.00 0.00 ? 8   THR A CB   2  
ATOM   685   O  OG1  . THR A 1 8  ? -2.641  -17.246 -9.960  1.00 0.00 ? 8   THR A OG1  2  
ATOM   686   C  CG2  . THR A 1 8  ? -3.663  -15.353 -8.862  1.00 0.00 ? 8   THR A CG2  2  
ATOM   687   H  H    . THR A 1 8  ? -0.776  -18.146 -7.610  1.00 0.00 ? 8   THR A H    2  
ATOM   688   H  HA   . THR A 1 8  ? -0.962  -15.461 -8.812  1.00 0.00 ? 8   THR A HA   2  
ATOM   689   H  HB   . THR A 1 8  ? -3.255  -17.256 -7.998  1.00 0.00 ? 8   THR A HB   2  
ATOM   690   H  HG1  . THR A 1 8  ? -2.693  -18.196 -9.830  1.00 0.00 ? 8   THR A HG1  2  
ATOM   691   H  HG21 . THR A 1 8  ? -3.265  -14.545 -8.267  1.00 0.00 ? 8   THR A HG21 2  
ATOM   692   H  HG22 . THR A 1 8  ? -4.666  -15.582 -8.532  1.00 0.00 ? 8   THR A HG22 2  
ATOM   693   H  HG23 . THR A 1 8  ? -3.683  -15.060 -9.901  1.00 0.00 ? 8   THR A HG23 2  
ATOM   694   N  N    . GLY A 1 9  ? -0.597  -14.756 -6.368  1.00 0.00 ? 9   GLY A N    2  
ATOM   695   C  CA   . GLY A 1 9  ? -0.659  -14.111 -5.069  1.00 0.00 ? 9   GLY A CA   2  
ATOM   696   C  C    . GLY A 1 9  ? -1.044  -12.648 -5.166  1.00 0.00 ? 9   GLY A C    2  
ATOM   697   O  O    . GLY A 1 9  ? -0.288  -11.834 -5.695  1.00 0.00 ? 9   GLY A O    2  
ATOM   698   H  H    . GLY A 1 9  ? 0.166   -14.588 -6.960  1.00 0.00 ? 9   GLY A H    2  
ATOM   699   H  HA2  . GLY A 1 9  ? -1.386  -14.625 -4.459  1.00 0.00 ? 9   GLY A HA2  2  
ATOM   700   H  HA3  . GLY A 1 9  ? 0.310   -14.185 -4.597  1.00 0.00 ? 9   GLY A HA3  2  
ATOM   701   N  N    . MET A 1 10 ? -2.225  -12.314 -4.655  1.00 0.00 ? 10  MET A N    2  
ATOM   702   C  CA   . MET A 1 10 ? -2.709  -10.939 -4.687  1.00 0.00 ? 10  MET A CA   2  
ATOM   703   C  C    . MET A 1 10 ? -3.269  -10.528 -3.329  1.00 0.00 ? 10  MET A C    2  
ATOM   704   O  O    . MET A 1 10 ? -3.764  -11.363 -2.571  1.00 0.00 ? 10  MET A O    2  
ATOM   705   C  CB   . MET A 1 10 ? -3.784  -10.779 -5.764  1.00 0.00 ? 10  MET A CB   2  
ATOM   706   C  CG   . MET A 1 10 ? -3.224  -10.709 -7.176  1.00 0.00 ? 10  MET A CG   2  
ATOM   707   S  SD   . MET A 1 10 ? -4.370  -9.946  -8.340  1.00 0.00 ? 10  MET A SD   2  
ATOM   708   C  CE   . MET A 1 10 ? -5.720  -11.122 -8.306  1.00 0.00 ? 10  MET A CE   2  
ATOM   709   H  H    . MET A 1 10 ? -2.784  -13.008 -4.246  1.00 0.00 ? 10  MET A H    2  
ATOM   710   H  HA   . MET A 1 10 ? -1.874  -10.299 -4.928  1.00 0.00 ? 10  MET A HA   2  
ATOM   711   H  HB2  . MET A 1 10 ? -4.459  -11.620 -5.710  1.00 0.00 ? 10  MET A HB2  2  
ATOM   712   H  HB3  . MET A 1 10 ? -4.336  -9.871  -5.574  1.00 0.00 ? 10  MET A HB3  2  
ATOM   713   H  HG2  . MET A 1 10 ? -2.312  -10.130 -7.159  1.00 0.00 ? 10  MET A HG2  2  
ATOM   714   H  HG3  . MET A 1 10 ? -3.005  -11.711 -7.512  1.00 0.00 ? 10  MET A HG3  2  
ATOM   715   H  HE1  . MET A 1 10 ? -5.658  -11.715 -7.405  1.00 0.00 ? 10  MET A HE1  2  
ATOM   716   H  HE2  . MET A 1 10 ? -6.661  -10.591 -8.323  1.00 0.00 ? 10  MET A HE2  2  
ATOM   717   H  HE3  . MET A 1 10 ? -5.656  -11.768 -9.168  1.00 0.00 ? 10  MET A HE3  2  
ATOM   718   N  N    . LYS A 1 11 ? -3.188  -9.237  -3.027  1.00 0.00 ? 11  LYS A N    2  
ATOM   719   C  CA   . LYS A 1 11 ? -3.687  -8.714  -1.761  1.00 0.00 ? 11  LYS A CA   2  
ATOM   720   C  C    . LYS A 1 11 ? -4.630  -7.538  -1.991  1.00 0.00 ? 11  LYS A C    2  
ATOM   721   O  O    . LYS A 1 11 ? -4.535  -6.821  -2.988  1.00 0.00 ? 11  LYS A O    2  
ATOM   722   C  CB   . LYS A 1 11 ? -2.521  -8.280  -0.870  1.00 0.00 ? 11  LYS A CB   2  
ATOM   723   C  CG   . LYS A 1 11 ? -1.484  -9.368  -0.652  1.00 0.00 ? 11  LYS A CG   2  
ATOM   724   C  CD   . LYS A 1 11 ? -2.029  -10.495 0.209   1.00 0.00 ? 11  LYS A CD   2  
ATOM   725   C  CE   . LYS A 1 11 ? -1.937  -10.160 1.689   1.00 0.00 ? 11  LYS A CE   2  
ATOM   726   N  NZ   . LYS A 1 11 ? -2.106  -11.368 2.543   1.00 0.00 ? 11  LYS A NZ   2  
ATOM   727   H  H    . LYS A 1 11 ? -2.783  -8.620  -3.672  1.00 0.00 ? 11  LYS A H    2  
ATOM   728   H  HA   . LYS A 1 11 ? -4.232  -9.505  -1.267  1.00 0.00 ? 11  LYS A HA   2  
ATOM   729   H  HB2  . LYS A 1 11 ? -2.033  -7.431  -1.325  1.00 0.00 ? 11  LYS A HB2  2  
ATOM   730   H  HB3  . LYS A 1 11 ? -2.911  -7.986  0.095   1.00 0.00 ? 11  LYS A HB3  2  
ATOM   731   H  HG2  . LYS A 1 11 ? -1.191  -9.770  -1.611  1.00 0.00 ? 11  LYS A HG2  2  
ATOM   732   H  HG3  . LYS A 1 11 ? -0.622  -8.937  -0.162  1.00 0.00 ? 11  LYS A HG3  2  
ATOM   733   H  HD2  . LYS A 1 11 ? -3.065  -10.663 -0.047  1.00 0.00 ? 11  LYS A HD2  2  
ATOM   734   H  HD3  . LYS A 1 11 ? -1.459  -11.392 0.015   1.00 0.00 ? 11  LYS A HD3  2  
ATOM   735   H  HE2  . LYS A 1 11 ? -0.971  -9.723  1.887   1.00 0.00 ? 11  LYS A HE2  2  
ATOM   736   H  HE3  . LYS A 1 11 ? -2.711  -9.447  1.932   1.00 0.00 ? 11  LYS A HE3  2  
ATOM   737   H  HZ1  . LYS A 1 11 ? -2.215  -12.214 1.948   1.00 0.00 ? 11  LYS A HZ1  2  
ATOM   738   H  HZ2  . LYS A 1 11 ? -2.951  -11.268 3.141   1.00 0.00 ? 11  LYS A HZ2  2  
ATOM   739   H  HZ3  . LYS A 1 11 ? -1.275  -11.493 3.155   1.00 0.00 ? 11  LYS A HZ3  2  
ATOM   740   N  N    . PRO A 1 12 ? -5.562  -7.331  -1.049  1.00 0.00 ? 12  PRO A N    2  
ATOM   741   C  CA   . PRO A 1 12 ? -6.539  -6.241  -1.127  1.00 0.00 ? 12  PRO A CA   2  
ATOM   742   C  C    . PRO A 1 12 ? -5.896  -4.872  -0.931  1.00 0.00 ? 12  PRO A C    2  
ATOM   743   O  O    . PRO A 1 12 ? -5.455  -4.239  -1.890  1.00 0.00 ? 12  PRO A O    2  
ATOM   744   C  CB   . PRO A 1 12 ? -7.505  -6.547  0.020   1.00 0.00 ? 12  PRO A CB   2  
ATOM   745   C  CG   . PRO A 1 12 ? -6.701  -7.343  0.990   1.00 0.00 ? 12  PRO A CG   2  
ATOM   746   C  CD   . PRO A 1 12 ? -5.733  -8.146  0.166   1.00 0.00 ? 12  PRO A CD   2  
ATOM   747   H  HA   . PRO A 1 12 ? -7.075  -6.255  -2.064  1.00 0.00 ? 12  PRO A HA   2  
ATOM   748   H  HB2  . PRO A 1 12 ? -7.852  -5.622  0.459   1.00 0.00 ? 12  PRO A HB2  2  
ATOM   749   H  HB3  . PRO A 1 12 ? -8.345  -7.113  -0.353  1.00 0.00 ? 12  PRO A HB3  2  
ATOM   750   H  HG2  . PRO A 1 12 ? -6.167  -6.680  1.655   1.00 0.00 ? 12  PRO A HG2  2  
ATOM   751   H  HG3  . PRO A 1 12 ? -7.349  -7.999  1.552   1.00 0.00 ? 12  PRO A HG3  2  
ATOM   752   H  HD2  . PRO A 1 12 ? -4.795  -8.260  0.689   1.00 0.00 ? 12  PRO A HD2  2  
ATOM   753   H  HD3  . PRO A 1 12 ? -6.153  -9.111  -0.074  1.00 0.00 ? 12  PRO A HD3  2  
ATOM   754   N  N    . TYR A 1 13 ? -5.846  -4.421  0.318   1.00 0.00 ? 13  TYR A N    2  
ATOM   755   C  CA   . TYR A 1 13 ? -5.258  -3.125  0.639   1.00 0.00 ? 13  TYR A CA   2  
ATOM   756   C  C    . TYR A 1 13 ? -3.903  -3.295  1.318   1.00 0.00 ? 13  TYR A C    2  
ATOM   757   O  O    . TYR A 1 13 ? -3.287  -2.322  1.754   1.00 0.00 ? 13  TYR A O    2  
ATOM   758   C  CB   . TYR A 1 13 ? -6.198  -2.326  1.544   1.00 0.00 ? 13  TYR A CB   2  
ATOM   759   C  CG   . TYR A 1 13 ? -7.657  -2.681  1.366   1.00 0.00 ? 13  TYR A CG   2  
ATOM   760   C  CD1  . TYR A 1 13 ? -8.181  -3.844  1.916   1.00 0.00 ? 13  TYR A CD1  2  
ATOM   761   C  CD2  . TYR A 1 13 ? -8.511  -1.852  0.650   1.00 0.00 ? 13  TYR A CD2  2  
ATOM   762   C  CE1  . TYR A 1 13 ? -9.513  -4.173  1.755   1.00 0.00 ? 13  TYR A CE1  2  
ATOM   763   C  CE2  . TYR A 1 13 ? -9.845  -2.172  0.485   1.00 0.00 ? 13  TYR A CE2  2  
ATOM   764   C  CZ   . TYR A 1 13 ? -10.341 -3.333  1.039   1.00 0.00 ? 13  TYR A CZ   2  
ATOM   765   O  OH   . TYR A 1 13 ? -11.669 -3.656  0.879   1.00 0.00 ? 13  TYR A OH   2  
ATOM   766   H  H    . TYR A 1 13 ? -6.214  -4.971  1.040   1.00 0.00 ? 13  TYR A H    2  
ATOM   767   H  HA   . TYR A 1 13 ? -5.120  -2.585  -0.286  1.00 0.00 ? 13  TYR A HA   2  
ATOM   768   H  HB2  . TYR A 1 13 ? -5.936  -2.509  2.575   1.00 0.00 ? 13  TYR A HB2  2  
ATOM   769   H  HB3  . TYR A 1 13 ? -6.084  -1.274  1.330   1.00 0.00 ? 13  TYR A HB3  2  
ATOM   770   H  HD1  . TYR A 1 13 ? -7.530  -4.500  2.477   1.00 0.00 ? 13  TYR A HD1  2  
ATOM   771   H  HD2  . TYR A 1 13 ? -8.119  -0.943  0.216   1.00 0.00 ? 13  TYR A HD2  2  
ATOM   772   H  HE1  . TYR A 1 13 ? -9.902  -5.082  2.190   1.00 0.00 ? 13  TYR A HE1  2  
ATOM   773   H  HE2  . TYR A 1 13 ? -10.494 -1.515  -0.076  1.00 0.00 ? 13  TYR A HE2  2  
ATOM   774   H  HH   . TYR A 1 13 ? -11.808 -4.573  1.128   1.00 0.00 ? 13  TYR A HH   2  
ATOM   775   N  N    . VAL A 1 14 ? -3.442  -4.539  1.402   1.00 0.00 ? 14  VAL A N    2  
ATOM   776   C  CA   . VAL A 1 14 ? -2.159  -4.839  2.026   1.00 0.00 ? 14  VAL A CA   2  
ATOM   777   C  C    . VAL A 1 14 ? -1.001  -4.463  1.108   1.00 0.00 ? 14  VAL A C    2  
ATOM   778   O  O    . VAL A 1 14 ? -1.051  -4.696  -0.100  1.00 0.00 ? 14  VAL A O    2  
ATOM   779   C  CB   . VAL A 1 14 ? -2.046  -6.331  2.390   1.00 0.00 ? 14  VAL A CB   2  
ATOM   780   C  CG1  . VAL A 1 14 ? -0.784  -6.590  3.198   1.00 0.00 ? 14  VAL A CG1  2  
ATOM   781   C  CG2  . VAL A 1 14 ? -3.281  -6.787  3.154   1.00 0.00 ? 14  VAL A CG2  2  
ATOM   782   H  H    . VAL A 1 14 ? -3.978  -5.273  1.036   1.00 0.00 ? 14  VAL A H    2  
ATOM   783   H  HA   . VAL A 1 14 ? -2.087  -4.261  2.936   1.00 0.00 ? 14  VAL A HA   2  
ATOM   784   H  HB   . VAL A 1 14 ? -1.984  -6.901  1.475   1.00 0.00 ? 14  VAL A HB   2  
ATOM   785   H  HG11 . VAL A 1 14 ? 0.054   -6.101  2.723   1.00 0.00 ? 14  VAL A HG11 2  
ATOM   786   H  HG12 . VAL A 1 14 ? -0.910  -6.201  4.198   1.00 0.00 ? 14  VAL A HG12 2  
ATOM   787   H  HG13 . VAL A 1 14 ? -0.599  -7.653  3.246   1.00 0.00 ? 14  VAL A HG13 2  
ATOM   788   H  HG21 . VAL A 1 14 ? -3.138  -7.800  3.497   1.00 0.00 ? 14  VAL A HG21 2  
ATOM   789   H  HG22 . VAL A 1 14 ? -3.439  -6.137  4.002   1.00 0.00 ? 14  VAL A HG22 2  
ATOM   790   H  HG23 . VAL A 1 14 ? -4.143  -6.745  2.503   1.00 0.00 ? 14  VAL A HG23 2  
ATOM   791   N  N    . CYS A 1 15 ? 0.042   -3.879  1.689   1.00 0.00 ? 15  CYS A N    2  
ATOM   792   C  CA   . CYS A 1 15 ? 1.214   -3.470  0.924   1.00 0.00 ? 15  CYS A CA   2  
ATOM   793   C  C    . CYS A 1 15 ? 1.974   -4.685  0.401   1.00 0.00 ? 15  CYS A C    2  
ATOM   794   O  O    . CYS A 1 15 ? 2.439   -5.520  1.176   1.00 0.00 ? 15  CYS A O    2  
ATOM   795   C  CB   . CYS A 1 15 ? 2.138   -2.610  1.789   1.00 0.00 ? 15  CYS A CB   2  
ATOM   796   S  SG   . CYS A 1 15 ? 3.093   -1.373  0.854   1.00 0.00 ? 15  CYS A SG   2  
ATOM   797   H  H    . CYS A 1 15 ? 0.023   -3.719  2.657   1.00 0.00 ? 15  CYS A H    2  
ATOM   798   H  HA   . CYS A 1 15 ? 0.874   -2.884  0.084   1.00 0.00 ? 15  CYS A HA   2  
ATOM   799   H  HB2  . CYS A 1 15 ? 1.545   -2.081  2.521   1.00 0.00 ? 15  CYS A HB2  2  
ATOM   800   H  HB3  . CYS A 1 15 ? 2.841   -3.252  2.299   1.00 0.00 ? 15  CYS A HB3  2  
ATOM   801   N  N    . ASN A 1 16 ? 2.095   -4.777  -0.919  1.00 0.00 ? 16  ASN A N    2  
ATOM   802   C  CA   . ASN A 1 16 ? 2.798   -5.890  -1.547  1.00 0.00 ? 16  ASN A CA   2  
ATOM   803   C  C    . ASN A 1 16 ? 4.303   -5.639  -1.570  1.00 0.00 ? 16  ASN A C    2  
ATOM   804   O  O    . ASN A 1 16 ? 5.030   -6.243  -2.358  1.00 0.00 ? 16  ASN A O    2  
ATOM   805   C  CB   . ASN A 1 16 ? 2.284   -6.107  -2.971  1.00 0.00 ? 16  ASN A CB   2  
ATOM   806   C  CG   . ASN A 1 16 ? 2.376   -7.557  -3.405  1.00 0.00 ? 16  ASN A CG   2  
ATOM   807   O  OD1  . ASN A 1 16 ? 1.596   -8.400  -2.961  1.00 0.00 ? 16  ASN A OD1  2  
ATOM   808   N  ND2  . ASN A 1 16 ? 3.333   -7.854  -4.276  1.00 0.00 ? 16  ASN A ND2  2  
ATOM   809   H  H    . ASN A 1 16 ? 1.703   -4.080  -1.485  1.00 0.00 ? 16  ASN A H    2  
ATOM   810   H  HA   . ASN A 1 16 ? 2.601   -6.777  -0.964  1.00 0.00 ? 16  ASN A HA   2  
ATOM   811   H  HB2  . ASN A 1 16 ? 1.249   -5.800  -3.025  1.00 0.00 ? 16  ASN A HB2  2  
ATOM   812   H  HB3  . ASN A 1 16 ? 2.868   -5.508  -3.654  1.00 0.00 ? 16  ASN A HB3  2  
ATOM   813   H  HD21 . ASN A 1 16 ? 3.917   -7.132  -4.587  1.00 0.00 ? 16  ASN A HD21 2  
ATOM   814   H  HD22 . ASN A 1 16 ? 3.414   -8.785  -4.574  1.00 0.00 ? 16  ASN A HD22 2  
ATOM   815   N  N    . GLU A 1 17 ? 4.762   -4.746  -0.699  1.00 0.00 ? 17  GLU A N    2  
ATOM   816   C  CA   . GLU A 1 17 ? 6.180   -4.416  -0.620  1.00 0.00 ? 17  GLU A CA   2  
ATOM   817   C  C    . GLU A 1 17 ? 6.719   -4.663  0.786   1.00 0.00 ? 17  GLU A C    2  
ATOM   818   O  O    . GLU A 1 17 ? 7.844   -5.131  0.959   1.00 0.00 ? 17  GLU A O    2  
ATOM   819   C  CB   . GLU A 1 17 ? 6.410   -2.956  -1.017  1.00 0.00 ? 17  GLU A CB   2  
ATOM   820   C  CG   . GLU A 1 17 ? 5.780   -2.581  -2.348  1.00 0.00 ? 17  GLU A CG   2  
ATOM   821   C  CD   . GLU A 1 17 ? 6.705   -2.833  -3.523  1.00 0.00 ? 17  GLU A CD   2  
ATOM   822   O  OE1  . GLU A 1 17 ? 7.528   -1.945  -3.830  1.00 0.00 ? 17  GLU A OE1  2  
ATOM   823   O  OE2  . GLU A 1 17 ? 6.606   -3.917  -4.134  1.00 0.00 ? 17  GLU A OE2  2  
ATOM   824   H  H    . GLU A 1 17 ? 4.132   -4.298  -0.096  1.00 0.00 ? 17  GLU A H    2  
ATOM   825   H  HA   . GLU A 1 17 ? 6.708   -5.054  -1.312  1.00 0.00 ? 17  GLU A HA   2  
ATOM   826   H  HB2  . GLU A 1 17 ? 5.993   -2.318  -0.252  1.00 0.00 ? 17  GLU A HB2  2  
ATOM   827   H  HB3  . GLU A 1 17 ? 7.473   -2.777  -1.083  1.00 0.00 ? 17  GLU A HB3  2  
ATOM   828   H  HG2  . GLU A 1 17 ? 4.882   -3.165  -2.484  1.00 0.00 ? 17  GLU A HG2  2  
ATOM   829   H  HG3  . GLU A 1 17 ? 5.525   -1.531  -2.328  1.00 0.00 ? 17  GLU A HG3  2  
ATOM   830   N  N    . CYS A 1 18 ? 5.907   -4.344  1.789   1.00 0.00 ? 18  CYS A N    2  
ATOM   831   C  CA   . CYS A 1 18 ? 6.300   -4.529  3.180   1.00 0.00 ? 18  CYS A CA   2  
ATOM   832   C  C    . CYS A 1 18 ? 5.341   -5.477  3.895   1.00 0.00 ? 18  CYS A C    2  
ATOM   833   O  O    . CYS A 1 18 ? 5.743   -6.235  4.777   1.00 0.00 ? 18  CYS A O    2  
ATOM   834   C  CB   . CYS A 1 18 ? 6.338   -3.182  3.905   1.00 0.00 ? 18  CYS A CB   2  
ATOM   835   S  SG   . CYS A 1 18 ? 4.760   -2.273  3.869   1.00 0.00 ? 18  CYS A SG   2  
ATOM   836   H  H    . CYS A 1 18 ? 5.021   -3.974  1.588   1.00 0.00 ? 18  CYS A H    2  
ATOM   837   H  HA   . CYS A 1 18 ? 7.289   -4.962  3.191   1.00 0.00 ? 18  CYS A HA   2  
ATOM   838   H  HB2  . CYS A 1 18 ? 6.598   -3.347  4.941   1.00 0.00 ? 18  CYS A HB2  2  
ATOM   839   H  HB3  . CYS A 1 18 ? 7.089   -2.556  3.446   1.00 0.00 ? 18  CYS A HB3  2  
ATOM   840   N  N    . GLY A 1 19 ? 4.070   -5.427  3.507   1.00 0.00 ? 19  GLY A N    2  
ATOM   841   C  CA   . GLY A 1 19 ? 3.074   -6.286  4.120   1.00 0.00 ? 19  GLY A CA   2  
ATOM   842   C  C    . GLY A 1 19 ? 2.128   -5.522  5.025   1.00 0.00 ? 19  GLY A C    2  
ATOM   843   O  O    . GLY A 1 19 ? 1.396   -6.117  5.816   1.00 0.00 ? 19  GLY A O    2  
ATOM   844   H  H    . GLY A 1 19 ? 3.808   -4.803  2.799   1.00 0.00 ? 19  GLY A H    2  
ATOM   845   H  HA2  . GLY A 1 19 ? 2.501   -6.767  3.342   1.00 0.00 ? 19  GLY A HA2  2  
ATOM   846   H  HA3  . GLY A 1 19 ? 3.577   -7.043  4.703   1.00 0.00 ? 19  GLY A HA3  2  
ATOM   847   N  N    . LYS A 1 20 ? 2.143   -4.198  4.912   1.00 0.00 ? 20  LYS A N    2  
ATOM   848   C  CA   . LYS A 1 20 ? 1.281   -3.350  5.726   1.00 0.00 ? 20  LYS A CA   2  
ATOM   849   C  C    . LYS A 1 20 ? -0.180  -3.508  5.318   1.00 0.00 ? 20  LYS A C    2  
ATOM   850   O  O    . LYS A 1 20 ? -0.577  -3.101  4.227   1.00 0.00 ? 20  LYS A O    2  
ATOM   851   C  CB   . LYS A 1 20 ? 1.703   -1.884  5.595   1.00 0.00 ? 20  LYS A CB   2  
ATOM   852   C  CG   . LYS A 1 20 ? 1.300   -1.027  6.783   1.00 0.00 ? 20  LYS A CG   2  
ATOM   853   C  CD   . LYS A 1 20 ? 2.220   -1.254  7.971   1.00 0.00 ? 20  LYS A CD   2  
ATOM   854   C  CE   . LYS A 1 20 ? 1.964   -0.240  9.075   1.00 0.00 ? 20  LYS A CE   2  
ATOM   855   N  NZ   . LYS A 1 20 ? 2.999   -0.311  10.144  1.00 0.00 ? 20  LYS A NZ   2  
ATOM   856   H  H    . LYS A 1 20 ? 2.749   -3.781  4.263   1.00 0.00 ? 20  LYS A H    2  
ATOM   857   H  HA   . LYS A 1 20 ? 1.391   -3.656  6.755   1.00 0.00 ? 20  LYS A HA   2  
ATOM   858   H  HB2  . LYS A 1 20 ? 2.777   -1.839  5.492   1.00 0.00 ? 20  LYS A HB2  2  
ATOM   859   H  HB3  . LYS A 1 20 ? 1.247   -1.469  4.708   1.00 0.00 ? 20  LYS A HB3  2  
ATOM   860   H  HG2  . LYS A 1 20 ? 1.348   0.013   6.498   1.00 0.00 ? 20  LYS A HG2  2  
ATOM   861   H  HG3  . LYS A 1 20 ? 0.289   -1.277  7.069   1.00 0.00 ? 20  LYS A HG3  2  
ATOM   862   H  HD2  . LYS A 1 20 ? 2.051   -2.246  8.362   1.00 0.00 ? 20  LYS A HD2  2  
ATOM   863   H  HD3  . LYS A 1 20 ? 3.246   -1.165  7.643   1.00 0.00 ? 20  LYS A HD3  2  
ATOM   864   H  HE2  . LYS A 1 20 ? 1.970   0.750   8.646   1.00 0.00 ? 20  LYS A HE2  2  
ATOM   865   H  HE3  . LYS A 1 20 ? 0.995   -0.437  9.510   1.00 0.00 ? 20  LYS A HE3  2  
ATOM   866   H  HZ1  . LYS A 1 20 ? 3.886   0.117   9.812   1.00 0.00 ? 20  LYS A HZ1  2  
ATOM   867   H  HZ2  . LYS A 1 20 ? 3.179   -1.303  10.401  1.00 0.00 ? 20  LYS A HZ2  2  
ATOM   868   H  HZ3  . LYS A 1 20 ? 2.674   0.200   10.990  1.00 0.00 ? 20  LYS A HZ3  2  
ATOM   869   N  N    . ALA A 1 21 ? -0.975  -4.100  6.203   1.00 0.00 ? 21  ALA A N    2  
ATOM   870   C  CA   . ALA A 1 21 ? -2.393  -4.308  5.936   1.00 0.00 ? 21  ALA A CA   2  
ATOM   871   C  C    . ALA A 1 21 ? -3.222  -3.119  6.410   1.00 0.00 ? 21  ALA A C    2  
ATOM   872   O  O    . ALA A 1 21 ? -2.918  -2.507  7.434   1.00 0.00 ? 21  ALA A O    2  
ATOM   873   C  CB   . ALA A 1 21 ? -2.873  -5.588  6.604   1.00 0.00 ? 21  ALA A CB   2  
ATOM   874   H  H    . ALA A 1 21 ? -0.600  -4.403  7.056   1.00 0.00 ? 21  ALA A H    2  
ATOM   875   H  HA   . ALA A 1 21 ? -2.519  -4.419  4.869   1.00 0.00 ? 21  ALA A HA   2  
ATOM   876   H  HB1  . ALA A 1 21 ? -2.417  -6.439  6.120   1.00 0.00 ? 21  ALA A HB1  2  
ATOM   877   H  HB2  . ALA A 1 21 ? -2.595  -5.575  7.648   1.00 0.00 ? 21  ALA A HB2  2  
ATOM   878   H  HB3  . ALA A 1 21 ? -3.947  -5.658  6.518   1.00 0.00 ? 21  ALA A HB3  2  
ATOM   879   N  N    . PHE A 1 22 ? -4.269  -2.797  5.659   1.00 0.00 ? 22  PHE A N    2  
ATOM   880   C  CA   . PHE A 1 22 ? -5.141  -1.679  6.002   1.00 0.00 ? 22  PHE A CA   2  
ATOM   881   C  C    . PHE A 1 22 ? -6.609  -2.077  5.881   1.00 0.00 ? 22  PHE A C    2  
ATOM   882   O  O    . PHE A 1 22 ? -6.928  -3.203  5.499   1.00 0.00 ? 22  PHE A O    2  
ATOM   883   C  CB   . PHE A 1 22 ? -4.850  -0.481  5.096   1.00 0.00 ? 22  PHE A CB   2  
ATOM   884   C  CG   . PHE A 1 22 ? -3.411  -0.050  5.115   1.00 0.00 ? 22  PHE A CG   2  
ATOM   885   C  CD1  . PHE A 1 22 ? -2.464  -0.719  4.357   1.00 0.00 ? 22  PHE A CD1  2  
ATOM   886   C  CD2  . PHE A 1 22 ? -3.006  1.023   5.892   1.00 0.00 ? 22  PHE A CD2  2  
ATOM   887   C  CE1  . PHE A 1 22 ? -1.139  -0.325  4.372   1.00 0.00 ? 22  PHE A CE1  2  
ATOM   888   C  CE2  . PHE A 1 22 ? -1.683  1.422   5.911   1.00 0.00 ? 22  PHE A CE2  2  
ATOM   889   C  CZ   . PHE A 1 22 ? -0.748  0.746   5.151   1.00 0.00 ? 22  PHE A CZ   2  
ATOM   890   H  H    . PHE A 1 22 ? -4.460  -3.323  4.854   1.00 0.00 ? 22  PHE A H    2  
ATOM   891   H  HA   . PHE A 1 22 ? -4.938  -1.403  7.025   1.00 0.00 ? 22  PHE A HA   2  
ATOM   892   H  HB2  . PHE A 1 22 ? -5.105  -0.737  4.079   1.00 0.00 ? 22  PHE A HB2  2  
ATOM   893   H  HB3  . PHE A 1 22 ? -5.452  0.356   5.414   1.00 0.00 ? 22  PHE A HB3  2  
ATOM   894   H  HD1  . PHE A 1 22 ? -2.769  -1.558  3.747   1.00 0.00 ? 22  PHE A HD1  2  
ATOM   895   H  HD2  . PHE A 1 22 ? -3.735  1.552   6.488   1.00 0.00 ? 22  PHE A HD2  2  
ATOM   896   H  HE1  . PHE A 1 22 ? -0.411  -0.856  3.777   1.00 0.00 ? 22  PHE A HE1  2  
ATOM   897   H  HE2  . PHE A 1 22 ? -1.379  2.259   6.521   1.00 0.00 ? 22  PHE A HE2  2  
ATOM   898   H  HZ   . PHE A 1 22 ? 0.287   1.056   5.164   1.00 0.00 ? 22  PHE A HZ   2  
ATOM   899   N  N    . ARG A 1 23 ? -7.498  -1.145  6.211   1.00 0.00 ? 23  ARG A N    2  
ATOM   900   C  CA   . ARG A 1 23 ? -8.932  -1.399  6.142   1.00 0.00 ? 23  ARG A CA   2  
ATOM   901   C  C    . ARG A 1 23 ? -9.502  -0.931  4.806   1.00 0.00 ? 23  ARG A C    2  
ATOM   902   O  O    . ARG A 1 23 ? -10.423 -1.543  4.265   1.00 0.00 ? 23  ARG A O    2  
ATOM   903   C  CB   . ARG A 1 23 ? -9.652  -0.693  7.292   1.00 0.00 ? 23  ARG A CB   2  
ATOM   904   C  CG   . ARG A 1 23 ? -11.044 -1.239  7.565   1.00 0.00 ? 23  ARG A CG   2  
ATOM   905   C  CD   . ARG A 1 23 ? -11.749 -0.447  8.655   1.00 0.00 ? 23  ARG A CD   2  
ATOM   906   N  NE   . ARG A 1 23 ? -12.214 0.851   8.175   1.00 0.00 ? 23  ARG A NE   2  
ATOM   907   C  CZ   . ARG A 1 23 ? -13.326 1.017   7.467   1.00 0.00 ? 23  ARG A CZ   2  
ATOM   908   N  NH1  . ARG A 1 23 ? -14.082 -0.027  7.159   1.00 0.00 ? 23  ARG A NH1  2  
ATOM   909   N  NH2  . ARG A 1 23 ? -13.684 2.231   7.065   1.00 0.00 ? 23  ARG A NH2  2  
ATOM   910   H  H    . ARG A 1 23 ? -7.181  -0.267  6.509   1.00 0.00 ? 23  ARG A H    2  
ATOM   911   H  HA   . ARG A 1 23 ? -9.085  -2.464  6.232   1.00 0.00 ? 23  ARG A HA   2  
ATOM   912   H  HB2  . ARG A 1 23 ? -9.064  -0.802  8.191   1.00 0.00 ? 23  ARG A HB2  2  
ATOM   913   H  HB3  . ARG A 1 23 ? -9.740  0.357   7.055   1.00 0.00 ? 23  ARG A HB3  2  
ATOM   914   H  HG2  . ARG A 1 23 ? -11.628 -1.180  6.658   1.00 0.00 ? 23  ARG A HG2  2  
ATOM   915   H  HG3  . ARG A 1 23 ? -10.962 -2.269  7.877   1.00 0.00 ? 23  ARG A HG3  2  
ATOM   916   H  HD2  . ARG A 1 23 ? -12.598 -1.016  9.004   1.00 0.00 ? 23  ARG A HD2  2  
ATOM   917   H  HD3  . ARG A 1 23 ? -11.059 -0.292  9.472   1.00 0.00 ? 23  ARG A HD3  2  
ATOM   918   H  HE   . ARG A 1 23 ? -11.671 1.637   8.391   1.00 0.00 ? 23  ARG A HE   2  
ATOM   919   H  HH11 . ARG A 1 23 ? -13.816 -0.942  7.461   1.00 0.00 ? 23  ARG A HH11 2  
ATOM   920   H  HH12 . ARG A 1 23 ? -14.920 0.101   6.627   1.00 0.00 ? 23  ARG A HH12 2  
ATOM   921   H  HH21 . ARG A 1 23 ? -13.116 3.021   7.296   1.00 0.00 ? 23  ARG A HH21 2  
ATOM   922   H  HH22 . ARG A 1 23 ? -14.520 2.355   6.533   1.00 0.00 ? 23  ARG A HH22 2  
ATOM   923   N  N    . SER A 1 24 ? -8.950  0.158   4.281   1.00 0.00 ? 24  SER A N    2  
ATOM   924   C  CA   . SER A 1 24 ? -9.406  0.711   3.011   1.00 0.00 ? 24  SER A CA   2  
ATOM   925   C  C    . SER A 1 24 ? -8.235  0.917   2.056   1.00 0.00 ? 24  SER A C    2  
ATOM   926   O  O    . SER A 1 24 ? -7.072  0.829   2.452   1.00 0.00 ? 24  SER A O    2  
ATOM   927   C  CB   . SER A 1 24 ? -10.132 2.038   3.240   1.00 0.00 ? 24  SER A CB   2  
ATOM   928   O  OG   . SER A 1 24 ? -11.393 1.831   3.853   1.00 0.00 ? 24  SER A OG   2  
ATOM   929   H  H    . SER A 1 24 ? -8.218  0.601   4.761   1.00 0.00 ? 24  SER A H    2  
ATOM   930   H  HA   . SER A 1 24 ? -10.095 0.005   2.571   1.00 0.00 ? 24  SER A HA   2  
ATOM   931   H  HB2  . SER A 1 24 ? -9.533  2.667   3.881   1.00 0.00 ? 24  SER A HB2  2  
ATOM   932   H  HB3  . SER A 1 24 ? -10.282 2.531   2.291   1.00 0.00 ? 24  SER A HB3  2  
ATOM   933   H  HG   . SER A 1 24 ? -12.085 1.896   3.190   1.00 0.00 ? 24  SER A HG   2  
ATOM   934   N  N    . LYS A 1 25 ? -8.550  1.190   0.794   1.00 0.00 ? 25  LYS A N    2  
ATOM   935   C  CA   . LYS A 1 25 ? -7.526  1.411   -0.220  1.00 0.00 ? 25  LYS A CA   2  
ATOM   936   C  C    . LYS A 1 25 ? -6.819  2.744   0.001   1.00 0.00 ? 25  LYS A C    2  
ATOM   937   O  O    . LYS A 1 25 ? -5.592  2.824   -0.057  1.00 0.00 ? 25  LYS A O    2  
ATOM   938   C  CB   . LYS A 1 25 ? -8.148  1.376   -1.618  1.00 0.00 ? 25  LYS A CB   2  
ATOM   939   C  CG   . LYS A 1 25 ? -7.132  1.508   -2.739  1.00 0.00 ? 25  LYS A CG   2  
ATOM   940   C  CD   . LYS A 1 25 ? -7.759  1.230   -4.095  1.00 0.00 ? 25  LYS A CD   2  
ATOM   941   C  CE   . LYS A 1 25 ? -8.395  2.481   -4.682  1.00 0.00 ? 25  LYS A CE   2  
ATOM   942   N  NZ   . LYS A 1 25 ? -9.823  2.618   -4.278  1.00 0.00 ? 25  LYS A NZ   2  
ATOM   943   H  H    . LYS A 1 25 ? -9.495  1.247   0.539   1.00 0.00 ? 25  LYS A H    2  
ATOM   944   H  HA   . LYS A 1 25 ? -6.801  0.615   -0.138  1.00 0.00 ? 25  LYS A HA   2  
ATOM   945   H  HB2  . LYS A 1 25 ? -8.672  0.440   -1.743  1.00 0.00 ? 25  LYS A HB2  2  
ATOM   946   H  HB3  . LYS A 1 25 ? -8.855  2.189   -1.704  1.00 0.00 ? 25  LYS A HB3  2  
ATOM   947   H  HG2  . LYS A 1 25 ? -6.735  2.512   -2.737  1.00 0.00 ? 25  LYS A HG2  2  
ATOM   948   H  HG3  . LYS A 1 25 ? -6.331  0.802   -2.571  1.00 0.00 ? 25  LYS A HG3  2  
ATOM   949   H  HD2  . LYS A 1 25 ? -6.993  0.879   -4.771  1.00 0.00 ? 25  LYS A HD2  2  
ATOM   950   H  HD3  . LYS A 1 25 ? -8.518  0.469   -3.982  1.00 0.00 ? 25  LYS A HD3  2  
ATOM   951   H  HE2  . LYS A 1 25 ? -7.848  3.344   -4.335  1.00 0.00 ? 25  LYS A HE2  2  
ATOM   952   H  HE3  . LYS A 1 25 ? -8.338  2.427   -5.759  1.00 0.00 ? 25  LYS A HE3  2  
ATOM   953   H  HZ1  . LYS A 1 25 ? -10.177 3.562   -4.533  1.00 0.00 ? 25  LYS A HZ1  2  
ATOM   954   H  HZ2  . LYS A 1 25 ? -9.917  2.489   -3.251  1.00 0.00 ? 25  LYS A HZ2  2  
ATOM   955   H  HZ3  . LYS A 1 25 ? -10.400 1.900   -4.761  1.00 0.00 ? 25  LYS A HZ3  2  
ATOM   956   N  N    . SER A 1 26 ? -7.601  3.788   0.255   1.00 0.00 ? 26  SER A N    2  
ATOM   957   C  CA   . SER A 1 26 ? -7.050  5.119   0.483   1.00 0.00 ? 26  SER A CA   2  
ATOM   958   C  C    . SER A 1 26 ? -6.000  5.090   1.589   1.00 0.00 ? 26  SER A C    2  
ATOM   959   O  O    . SER A 1 26 ? -5.085  5.913   1.614   1.00 0.00 ? 26  SER A O    2  
ATOM   960   C  CB   . SER A 1 26 ? -8.165  6.101   0.847   1.00 0.00 ? 26  SER A CB   2  
ATOM   961   O  OG   . SER A 1 26 ? -8.684  5.827   2.137   1.00 0.00 ? 26  SER A OG   2  
ATOM   962   H  H    . SER A 1 26 ? -8.573  3.661   0.288   1.00 0.00 ? 26  SER A H    2  
ATOM   963   H  HA   . SER A 1 26 ? -6.581  5.444   -0.434  1.00 0.00 ? 26  SER A HA   2  
ATOM   964   H  HB2  . SER A 1 26 ? -7.773  7.106   0.836   1.00 0.00 ? 26  SER A HB2  2  
ATOM   965   H  HB3  . SER A 1 26 ? -8.964  6.018   0.125   1.00 0.00 ? 26  SER A HB3  2  
ATOM   966   H  HG   . SER A 1 26 ? -9.625  6.015   2.150   1.00 0.00 ? 26  SER A HG   2  
ATOM   967   N  N    . TYR A 1 27 ? -6.139  4.136   2.503   1.00 0.00 ? 27  TYR A N    2  
ATOM   968   C  CA   . TYR A 1 27 ? -5.205  4.000   3.615   1.00 0.00 ? 27  TYR A CA   2  
ATOM   969   C  C    . TYR A 1 27 ? -3.860  3.465   3.133   1.00 0.00 ? 27  TYR A C    2  
ATOM   970   O  O    . TYR A 1 27 ? -2.804  3.897   3.598   1.00 0.00 ? 27  TYR A O    2  
ATOM   971   C  CB   . TYR A 1 27 ? -5.784  3.071   4.683   1.00 0.00 ? 27  TYR A CB   2  
ATOM   972   C  CG   . TYR A 1 27 ? -6.597  3.791   5.735   1.00 0.00 ? 27  TYR A CG   2  
ATOM   973   C  CD1  . TYR A 1 27 ? -6.135  4.966   6.315   1.00 0.00 ? 27  TYR A CD1  2  
ATOM   974   C  CD2  . TYR A 1 27 ? -7.827  3.295   6.151   1.00 0.00 ? 27  TYR A CD2  2  
ATOM   975   C  CE1  . TYR A 1 27 ? -6.874  5.627   7.277   1.00 0.00 ? 27  TYR A CE1  2  
ATOM   976   C  CE2  . TYR A 1 27 ? -8.573  3.950   7.111   1.00 0.00 ? 27  TYR A CE2  2  
ATOM   977   C  CZ   . TYR A 1 27 ? -8.093  5.115   7.671   1.00 0.00 ? 27  TYR A CZ   2  
ATOM   978   O  OH   . TYR A 1 27 ? -8.833  5.769   8.629   1.00 0.00 ? 27  TYR A OH   2  
ATOM   979   H  H    . TYR A 1 27 ? -6.889  3.509   2.430   1.00 0.00 ? 27  TYR A H    2  
ATOM   980   H  HA   . TYR A 1 27 ? -5.057  4.980   4.045   1.00 0.00 ? 27  TYR A HA   2  
ATOM   981   H  HB2  . TYR A 1 27 ? -6.425  2.344   4.210   1.00 0.00 ? 27  TYR A HB2  2  
ATOM   982   H  HB3  . TYR A 1 27 ? -4.974  2.559   5.182   1.00 0.00 ? 27  TYR A HB3  2  
ATOM   983   H  HD1  . TYR A 1 27 ? -5.180  5.365   6.004   1.00 0.00 ? 27  TYR A HD1  2  
ATOM   984   H  HD2  . TYR A 1 27 ? -8.200  2.382   5.710   1.00 0.00 ? 27  TYR A HD2  2  
ATOM   985   H  HE1  . TYR A 1 27 ? -6.498  6.539   7.716   1.00 0.00 ? 27  TYR A HE1  2  
ATOM   986   H  HE2  . TYR A 1 27 ? -9.527  3.549   7.420   1.00 0.00 ? 27  TYR A HE2  2  
ATOM   987   H  HH   . TYR A 1 27 ? -9.267  5.125   9.194   1.00 0.00 ? 27  TYR A HH   2  
ATOM   988   N  N    . LEU A 1 28 ? -3.906  2.523   2.198   1.00 0.00 ? 28  LEU A N    2  
ATOM   989   C  CA   . LEU A 1 28 ? -2.692  1.927   1.652   1.00 0.00 ? 28  LEU A CA   2  
ATOM   990   C  C    . LEU A 1 28 ? -1.990  2.895   0.704   1.00 0.00 ? 28  LEU A C    2  
ATOM   991   O  O    . LEU A 1 28 ? -0.769  2.852   0.550   1.00 0.00 ? 28  LEU A O    2  
ATOM   992   C  CB   . LEU A 1 28 ? -3.024  0.627   0.917   1.00 0.00 ? 28  LEU A CB   2  
ATOM   993   C  CG   . LEU A 1 28 ? -1.934  0.080   -0.006  1.00 0.00 ? 28  LEU A CG   2  
ATOM   994   C  CD1  . LEU A 1 28 ? -0.787  -0.498  0.808   1.00 0.00 ? 28  LEU A CD1  2  
ATOM   995   C  CD2  . LEU A 1 28 ? -2.508  -0.971  -0.944  1.00 0.00 ? 28  LEU A CD2  2  
ATOM   996   H  H    . LEU A 1 28 ? -4.777  2.219   1.867   1.00 0.00 ? 28  LEU A H    2  
ATOM   997   H  HA   . LEU A 1 28 ? -2.031  1.707   2.476   1.00 0.00 ? 28  LEU A HA   2  
ATOM   998   H  HB2  . LEU A 1 28 ? -3.237  -0.127  1.659   1.00 0.00 ? 28  LEU A HB2  2  
ATOM   999   H  HB3  . LEU A 1 28 ? -3.908  0.802   0.320   1.00 0.00 ? 28  LEU A HB3  2  
ATOM   1000  H  HG   . LEU A 1 28 ? -1.542  0.889   -0.607  1.00 0.00 ? 28  LEU A HG   2  
ATOM   1001  H  HD11 . LEU A 1 28 ? -0.835  -1.576  0.782   1.00 0.00 ? 28  LEU A HD11 2  
ATOM   1002  H  HD12 . LEU A 1 28 ? -0.863  -0.159  1.830   1.00 0.00 ? 28  LEU A HD12 2  
ATOM   1003  H  HD13 . LEU A 1 28 ? 0.153   -0.169  0.389   1.00 0.00 ? 28  LEU A HD13 2  
ATOM   1004  H  HD21 . LEU A 1 28 ? -2.470  -0.605  -1.960  1.00 0.00 ? 28  LEU A HD21 2  
ATOM   1005  H  HD22 . LEU A 1 28 ? -3.533  -1.174  -0.673  1.00 0.00 ? 28  LEU A HD22 2  
ATOM   1006  H  HD23 . LEU A 1 28 ? -1.928  -1.879  -0.866  1.00 0.00 ? 28  LEU A HD23 2  
ATOM   1007  N  N    . ILE A 1 29 ? -2.769  3.767   0.074   1.00 0.00 ? 29  ILE A N    2  
ATOM   1008  C  CA   . ILE A 1 29 ? -2.221  4.748   -0.855  1.00 0.00 ? 29  ILE A CA   2  
ATOM   1009  C  C    . ILE A 1 29 ? -1.422  5.817   -0.118  1.00 0.00 ? 29  ILE A C    2  
ATOM   1010  O  O    . ILE A 1 29 ? -0.326  6.188   -0.540  1.00 0.00 ? 29  ILE A O    2  
ATOM   1011  C  CB   . ILE A 1 29 ? -3.333  5.428   -1.676  1.00 0.00 ? 29  ILE A CB   2  
ATOM   1012  C  CG1  . ILE A 1 29 ? -4.017  4.410   -2.590  1.00 0.00 ? 29  ILE A CG1  2  
ATOM   1013  C  CG2  . ILE A 1 29 ? -2.761  6.579   -2.490  1.00 0.00 ? 29  ILE A CG2  2  
ATOM   1014  C  CD1  . ILE A 1 29 ? -5.434  4.788   -2.962  1.00 0.00 ? 29  ILE A CD1  2  
ATOM   1015  H  H    . ILE A 1 29 ? -3.735  3.752   0.239   1.00 0.00 ? 29  ILE A H    2  
ATOM   1016  H  HA   . ILE A 1 29 ? -1.564  4.229   -1.538  1.00 0.00 ? 29  ILE A HA   2  
ATOM   1017  H  HB   . ILE A 1 29 ? -4.061  5.831   -0.989  1.00 0.00 ? 29  ILE A HB   2  
ATOM   1018  H  HG12 . ILE A 1 29 ? -3.450  4.316   -3.503  1.00 0.00 ? 29  ILE A HG12 2  
ATOM   1019  H  HG13 . ILE A 1 29 ? -4.048  3.453   -2.091  1.00 0.00 ? 29  ILE A HG13 2  
ATOM   1020  H  HG21 . ILE A 1 29 ? -1.683  6.557   -2.436  1.00 0.00 ? 29  ILE A HG21 2  
ATOM   1021  H  HG22 . ILE A 1 29 ? -3.071  6.480   -3.519  1.00 0.00 ? 29  ILE A HG22 2  
ATOM   1022  H  HG23 . ILE A 1 29 ? -3.123  7.516   -2.093  1.00 0.00 ? 29  ILE A HG23 2  
ATOM   1023  H  HD11 . ILE A 1 29 ? -5.485  5.851   -3.150  1.00 0.00 ? 29  ILE A HD11 2  
ATOM   1024  H  HD12 . ILE A 1 29 ? -5.729  4.252   -3.851  1.00 0.00 ? 29  ILE A HD12 2  
ATOM   1025  H  HD13 . ILE A 1 29 ? -6.099  4.535   -2.150  1.00 0.00 ? 29  ILE A HD13 2  
ATOM   1026  N  N    . ILE A 1 30 ? -1.977  6.308   0.985   1.00 0.00 ? 30  ILE A N    2  
ATOM   1027  C  CA   . ILE A 1 30 ? -1.315  7.333   1.782   1.00 0.00 ? 30  ILE A CA   2  
ATOM   1028  C  C    . ILE A 1 30 ? -0.055  6.785   2.444   1.00 0.00 ? 30  ILE A C    2  
ATOM   1029  O  O    . ILE A 1 30 ? 0.804   7.545   2.893   1.00 0.00 ? 30  ILE A O    2  
ATOM   1030  C  CB   . ILE A 1 30 ? -2.251  7.892   2.869   1.00 0.00 ? 30  ILE A CB   2  
ATOM   1031  C  CG1  . ILE A 1 30 ? -2.570  6.811   3.904   1.00 0.00 ? 30  ILE A CG1  2  
ATOM   1032  C  CG2  . ILE A 1 30 ? -3.530  8.428   2.243   1.00 0.00 ? 30  ILE A CG2  2  
ATOM   1033  C  CD1  . ILE A 1 30 ? -2.829  7.359   5.290   1.00 0.00 ? 30  ILE A CD1  2  
ATOM   1034  H  H    . ILE A 1 30 ? -2.853  5.973   1.269   1.00 0.00 ? 30  ILE A H    2  
ATOM   1035  H  HA   . ILE A 1 30 ? -1.039  8.142   1.121   1.00 0.00 ? 30  ILE A HA   2  
ATOM   1036  H  HB   . ILE A 1 30 ? -1.748  8.712   3.359   1.00 0.00 ? 30  ILE A HB   2  
ATOM   1037  H  HG12 . ILE A 1 30 ? -3.450  6.272   3.592   1.00 0.00 ? 30  ILE A HG12 2  
ATOM   1038  H  HG13 . ILE A 1 30 ? -1.737  6.127   3.967   1.00 0.00 ? 30  ILE A HG13 2  
ATOM   1039  H  HG21 . ILE A 1 30 ? -3.557  9.503   2.344   1.00 0.00 ? 30  ILE A HG21 2  
ATOM   1040  H  HG22 . ILE A 1 30 ? -3.555  8.165   1.196   1.00 0.00 ? 30  ILE A HG22 2  
ATOM   1041  H  HG23 . ILE A 1 30 ? -4.384  7.998   2.744   1.00 0.00 ? 30  ILE A HG23 2  
ATOM   1042  H  HD11 . ILE A 1 30 ? -1.984  7.139   5.928   1.00 0.00 ? 30  ILE A HD11 2  
ATOM   1043  H  HD12 . ILE A 1 30 ? -2.967  8.429   5.235   1.00 0.00 ? 30  ILE A HD12 2  
ATOM   1044  H  HD13 . ILE A 1 30 ? -3.717  6.901   5.699   1.00 0.00 ? 30  ILE A HD13 2  
ATOM   1045  N  N    . HIS A 1 31 ? 0.050   5.461   2.500   1.00 0.00 ? 31  HIS A N    2  
ATOM   1046  C  CA   . HIS A 1 31 ? 1.207   4.811   3.105   1.00 0.00 ? 31  HIS A CA   2  
ATOM   1047  C  C    . HIS A 1 31 ? 2.256   4.476   2.049   1.00 0.00 ? 31  HIS A C    2  
ATOM   1048  O  O    . HIS A 1 31 ? 3.409   4.895   2.150   1.00 0.00 ? 31  HIS A O    2  
ATOM   1049  C  CB   . HIS A 1 31 ? 0.778   3.538   3.836   1.00 0.00 ? 31  HIS A CB   2  
ATOM   1050  C  CG   . HIS A 1 31 ? 1.860   2.506   3.927   1.00 0.00 ? 31  HIS A CG   2  
ATOM   1051  N  ND1  . HIS A 1 31 ? 2.653   2.344   5.044   1.00 0.00 ? 31  HIS A ND1  2  
ATOM   1052  C  CD2  . HIS A 1 31 ? 2.278   1.580   3.033   1.00 0.00 ? 31  HIS A CD2  2  
ATOM   1053  C  CE1  . HIS A 1 31 ? 3.512   1.363   4.832   1.00 0.00 ? 31  HIS A CE1  2  
ATOM   1054  N  NE2  . HIS A 1 31 ? 3.305   0.883   3.619   1.00 0.00 ? 31  HIS A NE2  2  
ATOM   1055  H  H    . HIS A 1 31 ? -0.668  4.909   2.125   1.00 0.00 ? 31  HIS A H    2  
ATOM   1056  H  HA   . HIS A 1 31 ? 1.638   5.497   3.818   1.00 0.00 ? 31  HIS A HA   2  
ATOM   1057  H  HB2  . HIS A 1 31 ? 0.478   3.792   4.842   1.00 0.00 ? 31  HIS A HB2  2  
ATOM   1058  H  HB3  . HIS A 1 31 ? -0.060  3.096   3.316   1.00 0.00 ? 31  HIS A HB3  2  
ATOM   1059  H  HD1  . HIS A 1 31 ? 2.595   2.869   5.868   1.00 0.00 ? 31  HIS A HD1  2  
ATOM   1060  H  HD2  . HIS A 1 31 ? 1.878   1.419   2.042   1.00 0.00 ? 31  HIS A HD2  2  
ATOM   1061  H  HE1  . HIS A 1 31 ? 4.257   1.013   5.530   1.00 0.00 ? 31  HIS A HE1  2  
ATOM   1062  N  N    . THR A 1 32 ? 1.848   3.717   1.036   1.00 0.00 ? 32  THR A N    2  
ATOM   1063  C  CA   . THR A 1 32 ? 2.753   3.325   -0.037  1.00 0.00 ? 32  THR A CA   2  
ATOM   1064  C  C    . THR A 1 32 ? 3.682   4.471   -0.419  1.00 0.00 ? 32  THR A C    2  
ATOM   1065  O  O    . THR A 1 32 ? 4.779   4.248   -0.933  1.00 0.00 ? 32  THR A O    2  
ATOM   1066  C  CB   . THR A 1 32 ? 1.977   2.869   -1.287  1.00 0.00 ? 32  THR A CB   2  
ATOM   1067  O  OG1  . THR A 1 32 ? 1.082   1.804   -0.946  1.00 0.00 ? 32  THR A OG1  2  
ATOM   1068  C  CG2  . THR A 1 32 ? 2.932   2.406   -2.377  1.00 0.00 ? 32  THR A CG2  2  
ATOM   1069  H  H    . THR A 1 32 ? 0.917   3.415   1.012   1.00 0.00 ? 32  THR A H    2  
ATOM   1070  H  HA   . THR A 1 32 ? 3.347   2.494   0.315   1.00 0.00 ? 32  THR A HA   2  
ATOM   1071  H  HB   . THR A 1 32 ? 1.404   3.705   -1.661  1.00 0.00 ? 32  THR A HB   2  
ATOM   1072  H  HG1  . THR A 1 32 ? 0.927   1.807   0.001   1.00 0.00 ? 32  THR A HG1  2  
ATOM   1073  H  HG21 . THR A 1 32 ? 2.388   2.282   -3.302  1.00 0.00 ? 32  THR A HG21 2  
ATOM   1074  H  HG22 . THR A 1 32 ? 3.374   1.463   -2.092  1.00 0.00 ? 32  THR A HG22 2  
ATOM   1075  H  HG23 . THR A 1 32 ? 3.709   3.143   -2.512  1.00 0.00 ? 32  THR A HG23 2  
ATOM   1076  N  N    . ARG A 1 33 ? 3.237   5.697   -0.166  1.00 0.00 ? 33  ARG A N    2  
ATOM   1077  C  CA   . ARG A 1 33 ? 4.029   6.879   -0.485  1.00 0.00 ? 33  ARG A CA   2  
ATOM   1078  C  C    . ARG A 1 33 ? 5.076   7.139   0.595   1.00 0.00 ? 33  ARG A C    2  
ATOM   1079  O  O    . ARG A 1 33 ? 6.219   7.486   0.297   1.00 0.00 ? 33  ARG A O    2  
ATOM   1080  C  CB   . ARG A 1 33 ? 3.123   8.101   -0.637  1.00 0.00 ? 33  ARG A CB   2  
ATOM   1081  C  CG   . ARG A 1 33 ? 2.300   8.407   0.604   1.00 0.00 ? 33  ARG A CG   2  
ATOM   1082  C  CD   . ARG A 1 33 ? 1.210   9.427   0.313   1.00 0.00 ? 33  ARG A CD   2  
ATOM   1083  N  NE   . ARG A 1 33 ? 1.758   10.761  0.077   1.00 0.00 ? 33  ARG A NE   2  
ATOM   1084  C  CZ   . ARG A 1 33 ? 1.126   11.703  -0.614  1.00 0.00 ? 33  ARG A CZ   2  
ATOM   1085  N  NH1  . ARG A 1 33 ? -0.069  11.459  -1.135  1.00 0.00 ? 33  ARG A NH1  2  
ATOM   1086  N  NH2  . ARG A 1 33 ? 1.689   12.892  -0.785  1.00 0.00 ? 33  ARG A NH2  2  
ATOM   1087  H  H    . ARG A 1 33 ? 2.354   5.810   0.245   1.00 0.00 ? 33  ARG A H    2  
ATOM   1088  H  HA   . ARG A 1 33 ? 4.534   6.697   -1.422  1.00 0.00 ? 33  ARG A HA   2  
ATOM   1089  H  HB2  . ARG A 1 33 ? 3.734   8.964   -0.858  1.00 0.00 ? 33  ARG A HB2  2  
ATOM   1090  H  HB3  . ARG A 1 33 ? 2.444   7.931   -1.459  1.00 0.00 ? 33  ARG A HB3  2  
ATOM   1091  H  HG2  . ARG A 1 33 ? 1.839   7.495   0.954   1.00 0.00 ? 33  ARG A HG2  2  
ATOM   1092  H  HG3  . ARG A 1 33 ? 2.953   8.800   1.370   1.00 0.00 ? 33  ARG A HG3  2  
ATOM   1093  H  HD2  . ARG A 1 33 ? 0.666   9.112   -0.565  1.00 0.00 ? 33  ARG A HD2  2  
ATOM   1094  H  HD3  . ARG A 1 33 ? 0.539   9.468   1.157   1.00 0.00 ? 33  ARG A HD3  2  
ATOM   1095  H  HE   . ARG A 1 33 ? 2.640   10.962  0.453   1.00 0.00 ? 33  ARG A HE   2  
ATOM   1096  H  HH11 . ARG A 1 33 ? -0.496  10.564  -1.007  1.00 0.00 ? 33  ARG A HH11 2  
ATOM   1097  H  HH12 . ARG A 1 33 ? -0.543  12.171  -1.654  1.00 0.00 ? 33  ARG A HH12 2  
ATOM   1098  H  HH21 . ARG A 1 33 ? 2.590   13.080  -0.394  1.00 0.00 ? 33  ARG A HH21 2  
ATOM   1099  H  HH22 . ARG A 1 33 ? 1.213   13.600  -1.306  1.00 0.00 ? 33  ARG A HH22 2  
ATOM   1100  N  N    . THR A 1 34 ? 4.677   6.969   1.852   1.00 0.00 ? 34  THR A N    2  
ATOM   1101  C  CA   . THR A 1 34 ? 5.578   7.187   2.976   1.00 0.00 ? 34  THR A CA   2  
ATOM   1102  C  C    . THR A 1 34 ? 6.914   6.487   2.753   1.00 0.00 ? 34  THR A C    2  
ATOM   1103  O  O    . THR A 1 34 ? 7.953   6.944   3.232   1.00 0.00 ? 34  THR A O    2  
ATOM   1104  C  CB   . THR A 1 34 ? 4.962   6.686   4.296   1.00 0.00 ? 34  THR A CB   2  
ATOM   1105  O  OG1  . THR A 1 34 ? 5.549   7.377   5.404   1.00 0.00 ? 34  THR A OG1  2  
ATOM   1106  C  CG2  . THR A 1 34 ? 5.173   5.188   4.456   1.00 0.00 ? 34  THR A CG2  2  
ATOM   1107  H  H    . THR A 1 34 ? 3.753   6.692   2.026   1.00 0.00 ? 34  THR A H    2  
ATOM   1108  H  HA   . THR A 1 34 ? 5.750   8.250   3.064   1.00 0.00 ? 34  THR A HA   2  
ATOM   1109  H  HB   . THR A 1 34 ? 3.900   6.885   4.278   1.00 0.00 ? 34  THR A HB   2  
ATOM   1110  H  HG1  . THR A 1 34 ? 4.876   7.894   5.852   1.00 0.00 ? 34  THR A HG1  2  
ATOM   1111  H  HG21 . THR A 1 34 ? 6.134   5.007   4.915   1.00 0.00 ? 34  THR A HG21 2  
ATOM   1112  H  HG22 . THR A 1 34 ? 5.143   4.714   3.486   1.00 0.00 ? 34  THR A HG22 2  
ATOM   1113  H  HG23 . THR A 1 34 ? 4.393   4.780   5.081   1.00 0.00 ? 34  THR A HG23 2  
ATOM   1114  N  N    . HIS A 1 35 ? 6.881   5.377   2.024   1.00 0.00 ? 35  HIS A N    2  
ATOM   1115  C  CA   . HIS A 1 35 ? 8.090   4.614   1.736   1.00 0.00 ? 35  HIS A CA   2  
ATOM   1116  C  C    . HIS A 1 35 ? 9.201   5.528   1.228   1.00 0.00 ? 35  HIS A C    2  
ATOM   1117  O  O    . HIS A 1 35 ? 10.378  5.166   1.252   1.00 0.00 ? 35  HIS A O    2  
ATOM   1118  C  CB   . HIS A 1 35 ? 7.798   3.524   0.705   1.00 0.00 ? 35  HIS A CB   2  
ATOM   1119  C  CG   . HIS A 1 35 ? 7.194   2.287   1.295   1.00 0.00 ? 35  HIS A CG   2  
ATOM   1120  N  ND1  . HIS A 1 35 ? 7.937   1.179   1.643   1.00 0.00 ? 35  HIS A ND1  2  
ATOM   1121  C  CD2  . HIS A 1 35 ? 5.909   1.988   1.599   1.00 0.00 ? 35  HIS A CD2  2  
ATOM   1122  C  CE1  . HIS A 1 35 ? 7.135   0.251   2.134   1.00 0.00 ? 35  HIS A CE1  2  
ATOM   1123  N  NE2  . HIS A 1 35 ? 5.899   0.717   2.120   1.00 0.00 ? 35  HIS A NE2  2  
ATOM   1124  H  H    . HIS A 1 35 ? 6.022   5.063   1.670   1.00 0.00 ? 35  HIS A H    2  
ATOM   1125  H  HA   . HIS A 1 35 ? 8.415   4.150   2.655   1.00 0.00 ? 35  HIS A HA   2  
ATOM   1126  H  HB2  . HIS A 1 35 ? 7.109   3.910   -0.032  1.00 0.00 ? 35  HIS A HB2  2  
ATOM   1127  H  HB3  . HIS A 1 35 ? 8.720   3.243   0.216   1.00 0.00 ? 35  HIS A HB3  2  
ATOM   1128  H  HD1  . HIS A 1 35 ? 8.907   1.086   1.543   1.00 0.00 ? 35  HIS A HD1  2  
ATOM   1129  H  HD2  . HIS A 1 35 ? 5.050   2.629   1.460   1.00 0.00 ? 35  HIS A HD2  2  
ATOM   1130  H  HE1  . HIS A 1 35 ? 7.438   -0.723  2.489   1.00 0.00 ? 35  HIS A HE1  2  
ATOM   1131  N  N    . THR A 1 36 ? 8.819   6.715   0.766   1.00 0.00 ? 36  THR A N    2  
ATOM   1132  C  CA   . THR A 1 36 ? 9.782   7.680   0.250   1.00 0.00 ? 36  THR A CA   2  
ATOM   1133  C  C    . THR A 1 36 ? 10.823  8.036   1.306   1.00 0.00 ? 36  THR A C    2  
ATOM   1134  O  O    . THR A 1 36 ? 12.011  8.148   1.006   1.00 0.00 ? 36  THR A O    2  
ATOM   1135  C  CB   . THR A 1 36 ? 9.086   8.969   -0.224  1.00 0.00 ? 36  THR A CB   2  
ATOM   1136  O  OG1  . THR A 1 36 ? 8.080   8.655   -1.194  1.00 0.00 ? 36  THR A OG1  2  
ATOM   1137  C  CG2  . THR A 1 36 ? 10.093  9.938   -0.826  1.00 0.00 ? 36  THR A CG2  2  
ATOM   1138  H  H    . THR A 1 36 ? 7.867   6.945   0.773   1.00 0.00 ? 36  THR A H    2  
ATOM   1139  H  HA   . THR A 1 36 ? 10.281  7.232   -0.597  1.00 0.00 ? 36  THR A HA   2  
ATOM   1140  H  HB   . THR A 1 36 ? 8.618   9.442   0.628   1.00 0.00 ? 36  THR A HB   2  
ATOM   1141  H  HG1  . THR A 1 36 ? 8.379   7.922   -1.738  1.00 0.00 ? 36  THR A HG1  2  
ATOM   1142  H  HG21 . THR A 1 36 ? 11.088  9.532   -0.724  1.00 0.00 ? 36  THR A HG21 2  
ATOM   1143  H  HG22 . THR A 1 36 ? 10.036  10.884  -0.308  1.00 0.00 ? 36  THR A HG22 2  
ATOM   1144  H  HG23 . THR A 1 36 ? 9.869   10.085  -1.872  1.00 0.00 ? 36  THR A HG23 2  
ATOM   1145  N  N    . GLY A 1 37 ? 10.369  8.212   2.543   1.00 0.00 ? 37  GLY A N    2  
ATOM   1146  C  CA   . GLY A 1 37 ? 11.274  8.554   3.624   1.00 0.00 ? 37  GLY A CA   2  
ATOM   1147  C  C    . GLY A 1 37 ? 10.828  7.984   4.956   1.00 0.00 ? 37  GLY A C    2  
ATOM   1148  O  O    . GLY A 1 37 ? 10.038  8.601   5.668   1.00 0.00 ? 37  GLY A O    2  
ATOM   1149  H  H    . GLY A 1 37 ? 9.411   8.110   2.723   1.00 0.00 ? 37  GLY A H    2  
ATOM   1150  H  HA2  . GLY A 1 37 ? 12.257  8.171   3.391   1.00 0.00 ? 37  GLY A HA2  2  
ATOM   1151  H  HA3  . GLY A 1 37 ? 11.329  9.630   3.706   1.00 0.00 ? 37  GLY A HA3  2  
ATOM   1152  N  N    . GLU A 1 38 ? 11.335  6.802   5.291   1.00 0.00 ? 38  GLU A N    2  
ATOM   1153  C  CA   . GLU A 1 38 ? 10.981  6.148   6.546   1.00 0.00 ? 38  GLU A CA   2  
ATOM   1154  C  C    . GLU A 1 38 ? 12.207  5.990   7.441   1.00 0.00 ? 38  GLU A C    2  
ATOM   1155  O  O    . GLU A 1 38 ? 13.307  5.715   6.963   1.00 0.00 ? 38  GLU A O    2  
ATOM   1156  C  CB   . GLU A 1 38 ? 10.355  4.779   6.274   1.00 0.00 ? 38  GLU A CB   2  
ATOM   1157  C  CG   . GLU A 1 38 ? 9.482   4.272   7.410   1.00 0.00 ? 38  GLU A CG   2  
ATOM   1158  C  CD   . GLU A 1 38 ? 9.202   2.785   7.313   1.00 0.00 ? 38  GLU A CD   2  
ATOM   1159  O  OE1  . GLU A 1 38 ? 10.003  2.072   6.672   1.00 0.00 ? 38  GLU A OE1  2  
ATOM   1160  O  OE2  . GLU A 1 38 ? 8.184   2.334   7.877   1.00 0.00 ? 38  GLU A OE2  2  
ATOM   1161  H  H    . GLU A 1 38 ? 11.961  6.359   4.681   1.00 0.00 ? 38  GLU A H    2  
ATOM   1162  H  HA   . GLU A 1 38 ? 10.259  6.770   7.051   1.00 0.00 ? 38  GLU A HA   2  
ATOM   1163  H  HB2  . GLU A 1 38 ? 9.748   4.844   5.383   1.00 0.00 ? 38  GLU A HB2  2  
ATOM   1164  H  HB3  . GLU A 1 38 ? 11.145  4.061   6.108   1.00 0.00 ? 38  GLU A HB3  2  
ATOM   1165  H  HG2  . GLU A 1 38 ? 9.983   4.468   8.346   1.00 0.00 ? 38  GLU A HG2  2  
ATOM   1166  H  HG3  . GLU A 1 38 ? 8.541   4.803   7.388   1.00 0.00 ? 38  GLU A HG3  2  
ATOM   1167  N  N    . SER A 1 39 ? 12.007  6.166   8.744   1.00 0.00 ? 39  SER A N    2  
ATOM   1168  C  CA   . SER A 1 39 ? 13.096  6.048   9.707   1.00 0.00 ? 39  SER A CA   2  
ATOM   1169  C  C    . SER A 1 39 ? 14.274  6.929   9.305   1.00 0.00 ? 39  SER A C    2  
ATOM   1170  O  O    . SER A 1 39 ? 15.428  6.507   9.365   1.00 0.00 ? 39  SER A O    2  
ATOM   1171  C  CB   . SER A 1 39 ? 13.549  4.591   9.819   1.00 0.00 ? 39  SER A CB   2  
ATOM   1172  O  OG   . SER A 1 39 ? 14.469  4.424   10.884  1.00 0.00 ? 39  SER A OG   2  
ATOM   1173  H  H    . SER A 1 39 ? 11.107  6.384   9.064   1.00 0.00 ? 39  SER A H    2  
ATOM   1174  H  HA   . SER A 1 39 ? 12.726  6.376   10.667  1.00 0.00 ? 39  SER A HA   2  
ATOM   1175  H  HB2  . SER A 1 39 ? 12.690  3.963   10.000  1.00 0.00 ? 39  SER A HB2  2  
ATOM   1176  H  HB3  . SER A 1 39 ? 14.026  4.293   8.897   1.00 0.00 ? 39  SER A HB3  2  
ATOM   1177  H  HG   . SER A 1 39 ? 14.551  3.491   11.094  1.00 0.00 ? 39  SER A HG   2  
ATOM   1178  N  N    . GLY A 1 40 ? 13.974  8.158   8.896   1.00 0.00 ? 40  GLY A N    2  
ATOM   1179  C  CA   . GLY A 1 40 ? 15.018  9.081   8.490   1.00 0.00 ? 40  GLY A CA   2  
ATOM   1180  C  C    . GLY A 1 40 ? 15.665  9.779   9.669   1.00 0.00 ? 40  GLY A C    2  
ATOM   1181  O  O    . GLY A 1 40 ? 15.157  9.751   10.790  1.00 0.00 ? 40  GLY A O    2  
ATOM   1182  H  H    . GLY A 1 40 ? 13.036  8.440   8.869   1.00 0.00 ? 40  GLY A H    2  
ATOM   1183  H  HA2  . GLY A 1 40 ? 15.776  8.534   7.948   1.00 0.00 ? 40  GLY A HA2  2  
ATOM   1184  H  HA3  . GLY A 1 40 ? 14.589  9.826   7.836   1.00 0.00 ? 40  GLY A HA3  2  
ATOM   1185  N  N    . PRO A 1 41 ? 16.815  10.424  9.422   1.00 0.00 ? 41  PRO A N    2  
ATOM   1186  C  CA   . PRO A 1 41 ? 17.558  11.144  10.461  1.00 0.00 ? 41  PRO A CA   2  
ATOM   1187  C  C    . PRO A 1 41 ? 16.836  12.406  10.921  1.00 0.00 ? 41  PRO A C    2  
ATOM   1188  O  O    . PRO A 1 41 ? 17.346  13.156  11.752  1.00 0.00 ? 41  PRO A O    2  
ATOM   1189  C  CB   . PRO A 1 41 ? 18.875  11.504  9.770   1.00 0.00 ? 41  PRO A CB   2  
ATOM   1190  C  CG   . PRO A 1 41 ? 18.544  11.540  8.318   1.00 0.00 ? 41  PRO A CG   2  
ATOM   1191  C  CD   . PRO A 1 41 ? 17.478  10.500  8.110   1.00 0.00 ? 41  PRO A CD   2  
ATOM   1192  H  HA   . PRO A 1 41 ? 17.758  10.514  11.315  1.00 0.00 ? 41  PRO A HA   2  
ATOM   1193  H  HB2  . PRO A 1 41 ? 19.218  12.467  10.122  1.00 0.00 ? 41  PRO A HB2  2  
ATOM   1194  H  HB3  . PRO A 1 41 ? 19.617  10.750  9.986   1.00 0.00 ? 41  PRO A HB3  2  
ATOM   1195  H  HG2  . PRO A 1 41 ? 18.171  12.517  8.051   1.00 0.00 ? 41  PRO A HG2  2  
ATOM   1196  H  HG3  . PRO A 1 41 ? 19.421  11.300  7.735   1.00 0.00 ? 41  PRO A HG3  2  
ATOM   1197  H  HD2  . PRO A 1 41 ? 16.785  10.817  7.345   1.00 0.00 ? 41  PRO A HD2  2  
ATOM   1198  H  HD3  . PRO A 1 41 ? 17.924  9.551   7.848   1.00 0.00 ? 41  PRO A HD3  2  
ATOM   1199  N  N    . SER A 1 42 ? 15.645  12.633  10.374  1.00 0.00 ? 42  SER A N    2  
ATOM   1200  C  CA   . SER A 1 42 ? 14.854  13.807  10.726  1.00 0.00 ? 42  SER A CA   2  
ATOM   1201  C  C    . SER A 1 42 ? 15.665  15.085  10.536  1.00 0.00 ? 42  SER A C    2  
ATOM   1202  O  O    . SER A 1 42 ? 15.629  15.987  11.373  1.00 0.00 ? 42  SER A O    2  
ATOM   1203  C  CB   . SER A 1 42 ? 14.371  13.707  12.175  1.00 0.00 ? 42  SER A CB   2  
ATOM   1204  O  OG   . SER A 1 42 ? 15.434  13.936  13.084  1.00 0.00 ? 42  SER A OG   2  
ATOM   1205  H  H    . SER A 1 42 ? 15.292  11.998  9.717   1.00 0.00 ? 42  SER A H    2  
ATOM   1206  H  HA   . SER A 1 42 ? 13.997  13.837  10.071  1.00 0.00 ? 42  SER A HA   2  
ATOM   1207  H  HB2  . SER A 1 42 ? 13.602  14.443  12.347  1.00 0.00 ? 42  SER A HB2  2  
ATOM   1208  H  HB3  . SER A 1 42 ? 13.970  12.719  12.350  1.00 0.00 ? 42  SER A HB3  2  
ATOM   1209  H  HG   . SER A 1 42 ? 15.249  14.723  13.601  1.00 0.00 ? 42  SER A HG   2  
ATOM   1210  N  N    . SER A 1 43 ? 16.395  15.156  9.428   1.00 0.00 ? 43  SER A N    2  
ATOM   1211  C  CA   . SER A 1 43 ? 17.218  16.321  9.128   1.00 0.00 ? 43  SER A CA   2  
ATOM   1212  C  C    . SER A 1 43 ? 16.548  17.205  8.080   1.00 0.00 ? 43  SER A C    2  
ATOM   1213  O  O    . SER A 1 43 ? 16.490  18.425  8.225   1.00 0.00 ? 43  SER A O    2  
ATOM   1214  C  CB   . SER A 1 43 ? 18.599  15.884  8.635   1.00 0.00 ? 43  SER A CB   2  
ATOM   1215  O  OG   . SER A 1 43 ? 19.388  17.003  8.268   1.00 0.00 ? 43  SER A OG   2  
ATOM   1216  H  H    . SER A 1 43 ? 16.383  14.404  8.799   1.00 0.00 ? 43  SER A H    2  
ATOM   1217  H  HA   . SER A 1 43 ? 17.334  16.889  10.039  1.00 0.00 ? 43  SER A HA   2  
ATOM   1218  H  HB2  . SER A 1 43 ? 19.105  15.344  9.421   1.00 0.00 ? 43  SER A HB2  2  
ATOM   1219  H  HB3  . SER A 1 43 ? 18.484  15.242  7.773   1.00 0.00 ? 43  SER A HB3  2  
ATOM   1220  H  HG   . SER A 1 43 ? 19.858  17.329  9.038   1.00 0.00 ? 43  SER A HG   2  
ATOM   1221  N  N    . GLY A 1 44 ? 16.041  16.577  7.022   1.00 0.00 ? 44  GLY A N    2  
ATOM   1222  C  CA   . GLY A 1 44 ? 15.381  17.320  5.965   1.00 0.00 ? 44  GLY A CA   2  
ATOM   1223  C  C    . GLY A 1 44 ? 13.873  17.181  6.013   1.00 0.00 ? 44  GLY A C    2  
ATOM   1224  O  O    . GLY A 1 44 ? 13.225  17.320  4.976   1.00 0.00 ? 44  GLY A O    2  
ATOM   1225  H  H    . GLY A 1 44 ? 16.117  15.602  6.960   1.00 0.00 ? 44  GLY A H    2  
ATOM   1226  H  HA2  . GLY A 1 44 ? 15.639  18.364  6.058   1.00 0.00 ? 44  GLY A HA2  2  
ATOM   1227  H  HA3  . GLY A 1 44 ? 15.735  16.957  5.011   1.00 0.00 ? 44  GLY A HA3  2  
HETATM 1228  ZN ZN   . ZN  B 2 .  ? 4.489   -0.514  2.592   1.00 0.00 ? 181 ZN  A ZN   2  
ATOM   1229  N  N    . GLY A 1 1  ? -4.819  -27.319 6.410   1.00 0.00 ? 1   GLY A N    3  
ATOM   1230  C  CA   . GLY A 1 1  ? -5.576  -27.683 5.227   1.00 0.00 ? 1   GLY A CA   3  
ATOM   1231  C  C    . GLY A 1 1  ? -4.792  -27.467 3.948   1.00 0.00 ? 1   GLY A C    3  
ATOM   1232  O  O    . GLY A 1 1  ? -5.337  -26.999 2.949   1.00 0.00 ? 1   GLY A O    3  
ATOM   1233  H  H1   . GLY A 1 1  ? -5.118  -26.571 6.969   1.00 0.00 ? 1   GLY A H1   3  
ATOM   1234  H  HA2  . GLY A 1 1  ? -5.852  -28.725 5.296   1.00 0.00 ? 1   GLY A HA2  3  
ATOM   1235  H  HA3  . GLY A 1 1  ? -6.474  -27.084 5.190   1.00 0.00 ? 1   GLY A HA3  3  
ATOM   1236  N  N    . SER A 1 2  ? -3.508  -27.809 3.978   1.00 0.00 ? 2   SER A N    3  
ATOM   1237  C  CA   . SER A 1 2  ? -2.645  -27.644 2.814   1.00 0.00 ? 2   SER A CA   3  
ATOM   1238  C  C    . SER A 1 2  ? -3.405  -27.952 1.527   1.00 0.00 ? 2   SER A C    3  
ATOM   1239  O  O    . SER A 1 2  ? -3.303  -27.221 0.542   1.00 0.00 ? 2   SER A O    3  
ATOM   1240  C  CB   . SER A 1 2  ? -1.421  -28.555 2.927   1.00 0.00 ? 2   SER A CB   3  
ATOM   1241  O  OG   . SER A 1 2  ? -0.449  -27.998 3.794   1.00 0.00 ? 2   SER A OG   3  
ATOM   1242  H  H    . SER A 1 2  ? -3.131  -28.177 4.804   1.00 0.00 ? 2   SER A H    3  
ATOM   1243  H  HA   . SER A 1 2  ? -2.317  -26.616 2.787   1.00 0.00 ? 2   SER A HA   3  
ATOM   1244  H  HB2  . SER A 1 2  ? -1.725  -29.515 3.316   1.00 0.00 ? 2   SER A HB2  3  
ATOM   1245  H  HB3  . SER A 1 2  ? -0.981  -28.686 1.948   1.00 0.00 ? 2   SER A HB3  3  
ATOM   1246  H  HG   . SER A 1 2  ? 0.224   -27.551 3.276   1.00 0.00 ? 2   SER A HG   3  
ATOM   1247  N  N    . SER A 1 3  ? -4.168  -29.041 1.544   1.00 0.00 ? 3   SER A N    3  
ATOM   1248  C  CA   . SER A 1 3  ? -4.943  -29.449 0.378   1.00 0.00 ? 3   SER A CA   3  
ATOM   1249  C  C    . SER A 1 3  ? -5.935  -28.362 -0.023  1.00 0.00 ? 3   SER A C    3  
ATOM   1250  O  O    . SER A 1 3  ? -6.930  -28.131 0.663   1.00 0.00 ? 3   SER A O    3  
ATOM   1251  C  CB   . SER A 1 3  ? -5.687  -30.755 0.666   1.00 0.00 ? 3   SER A CB   3  
ATOM   1252  O  OG   . SER A 1 3  ? -6.444  -30.657 1.861   1.00 0.00 ? 3   SER A OG   3  
ATOM   1253  H  H    . SER A 1 3  ? -4.208  -29.584 2.359   1.00 0.00 ? 3   SER A H    3  
ATOM   1254  H  HA   . SER A 1 3  ? -4.254  -29.610 -0.438  1.00 0.00 ? 3   SER A HA   3  
ATOM   1255  H  HB2  . SER A 1 3  ? -6.356  -30.972 -0.152  1.00 0.00 ? 3   SER A HB2  3  
ATOM   1256  H  HB3  . SER A 1 3  ? -4.972  -31.558 0.771   1.00 0.00 ? 3   SER A HB3  3  
ATOM   1257  H  HG   . SER A 1 3  ? -7.380  -30.691 1.651   1.00 0.00 ? 3   SER A HG   3  
ATOM   1258  N  N    . GLY A 1 4  ? -5.656  -27.697 -1.140  1.00 0.00 ? 4   GLY A N    3  
ATOM   1259  C  CA   . GLY A 1 4  ? -6.532  -26.642 -1.614  1.00 0.00 ? 4   GLY A CA   3  
ATOM   1260  C  C    . GLY A 1 4  ? -6.211  -25.298 -0.991  1.00 0.00 ? 4   GLY A C    3  
ATOM   1261  O  O    . GLY A 1 4  ? -6.747  -24.950 0.061   1.00 0.00 ? 4   GLY A O    3  
ATOM   1262  H  H    . GLY A 1 4  ? -4.848  -27.925 -1.646  1.00 0.00 ? 4   GLY A H    3  
ATOM   1263  H  HA2  . GLY A 1 4  ? -6.435  -26.563 -2.686  1.00 0.00 ? 4   GLY A HA2  3  
ATOM   1264  H  HA3  . GLY A 1 4  ? -7.553  -26.902 -1.373  1.00 0.00 ? 4   GLY A HA3  3  
ATOM   1265  N  N    . SER A 1 5  ? -5.332  -24.542 -1.640  1.00 0.00 ? 5   SER A N    3  
ATOM   1266  C  CA   . SER A 1 5  ? -4.935  -23.230 -1.141  1.00 0.00 ? 5   SER A CA   3  
ATOM   1267  C  C    . SER A 1 5  ? -5.472  -22.121 -2.041  1.00 0.00 ? 5   SER A C    3  
ATOM   1268  O  O    . SER A 1 5  ? -4.999  -21.933 -3.162  1.00 0.00 ? 5   SER A O    3  
ATOM   1269  C  CB   . SER A 1 5  ? -3.411  -23.136 -1.049  1.00 0.00 ? 5   SER A CB   3  
ATOM   1270  O  OG   . SER A 1 5  ? -2.812  -23.307 -2.322  1.00 0.00 ? 5   SER A OG   3  
ATOM   1271  H  H    . SER A 1 5  ? -4.939  -24.875 -2.474  1.00 0.00 ? 5   SER A H    3  
ATOM   1272  H  HA   . SER A 1 5  ? -5.355  -23.111 -0.153  1.00 0.00 ? 5   SER A HA   3  
ATOM   1273  H  HB2  . SER A 1 5  ? -3.136  -22.166 -0.662  1.00 0.00 ? 5   SER A HB2  3  
ATOM   1274  H  HB3  . SER A 1 5  ? -3.045  -23.906 -0.385  1.00 0.00 ? 5   SER A HB3  3  
ATOM   1275  H  HG   . SER A 1 5  ? -2.059  -22.717 -2.403  1.00 0.00 ? 5   SER A HG   3  
ATOM   1276  N  N    . SER A 1 6  ? -6.462  -21.389 -1.541  1.00 0.00 ? 6   SER A N    3  
ATOM   1277  C  CA   . SER A 1 6  ? -7.067  -20.301 -2.300  1.00 0.00 ? 6   SER A CA   3  
ATOM   1278  C  C    . SER A 1 6  ? -6.715  -18.949 -1.686  1.00 0.00 ? 6   SER A C    3  
ATOM   1279  O  O    . SER A 1 6  ? -6.280  -18.033 -2.382  1.00 0.00 ? 6   SER A O    3  
ATOM   1280  C  CB   . SER A 1 6  ? -8.586  -20.470 -2.352  1.00 0.00 ? 6   SER A CB   3  
ATOM   1281  O  OG   . SER A 1 6  ? -9.164  -19.600 -3.311  1.00 0.00 ? 6   SER A OG   3  
ATOM   1282  H  H    . SER A 1 6  ? -6.796  -21.588 -0.641  1.00 0.00 ? 6   SER A H    3  
ATOM   1283  H  HA   . SER A 1 6  ? -6.674  -20.340 -3.305  1.00 0.00 ? 6   SER A HA   3  
ATOM   1284  H  HB2  . SER A 1 6  ? -8.824  -21.488 -2.619  1.00 0.00 ? 6   SER A HB2  3  
ATOM   1285  H  HB3  . SER A 1 6  ? -9.004  -20.244 -1.381  1.00 0.00 ? 6   SER A HB3  3  
ATOM   1286  H  HG   . SER A 1 6  ? -8.814  -18.714 -3.191  1.00 0.00 ? 6   SER A HG   3  
ATOM   1287  N  N    . GLY A 1 7  ? -6.906  -18.834 -0.375  1.00 0.00 ? 7   GLY A N    3  
ATOM   1288  C  CA   . GLY A 1 7  ? -6.605  -17.591 0.312   1.00 0.00 ? 7   GLY A CA   3  
ATOM   1289  C  C    . GLY A 1 7  ? -5.116  -17.384 0.508   1.00 0.00 ? 7   GLY A C    3  
ATOM   1290  O  O    . GLY A 1 7  ? -4.644  -17.236 1.636   1.00 0.00 ? 7   GLY A O    3  
ATOM   1291  H  H    . GLY A 1 7  ? -7.256  -19.598 0.129   1.00 0.00 ? 7   GLY A H    3  
ATOM   1292  H  HA2  . GLY A 1 7  ? -7.000  -16.769 -0.265  1.00 0.00 ? 7   GLY A HA2  3  
ATOM   1293  H  HA3  . GLY A 1 7  ? -7.085  -17.603 1.280   1.00 0.00 ? 7   GLY A HA3  3  
ATOM   1294  N  N    . THR A 1 8  ? -4.371  -17.374 -0.594  1.00 0.00 ? 8   THR A N    3  
ATOM   1295  C  CA   . THR A 1 8  ? -2.927  -17.186 -0.539  1.00 0.00 ? 8   THR A CA   3  
ATOM   1296  C  C    . THR A 1 8  ? -2.528  -15.823 -1.091  1.00 0.00 ? 8   THR A C    3  
ATOM   1297  O  O    . THR A 1 8  ? -1.616  -15.177 -0.577  1.00 0.00 ? 8   THR A O    3  
ATOM   1298  C  CB   . THR A 1 8  ? -2.187  -18.283 -1.328  1.00 0.00 ? 8   THR A CB   3  
ATOM   1299  O  OG1  . THR A 1 8  ? -2.492  -18.173 -2.723  1.00 0.00 ? 8   THR A OG1  3  
ATOM   1300  C  CG2  . THR A 1 8  ? -2.576  -19.666 -0.827  1.00 0.00 ? 8   THR A CG2  3  
ATOM   1301  H  H    . THR A 1 8  ? -4.805  -17.497 -1.464  1.00 0.00 ? 8   THR A H    3  
ATOM   1302  H  HA   . THR A 1 8  ? -2.622  -17.249 0.496   1.00 0.00 ? 8   THR A HA   3  
ATOM   1303  H  HB   . THR A 1 8  ? -1.124  -18.151 -1.188  1.00 0.00 ? 8   THR A HB   3  
ATOM   1304  H  HG1  . THR A 1 8  ? -3.368  -17.793 -2.830  1.00 0.00 ? 8   THR A HG1  3  
ATOM   1305  H  HG21 . THR A 1 8  ? -2.417  -20.390 -1.611  1.00 0.00 ? 8   THR A HG21 3  
ATOM   1306  H  HG22 . THR A 1 8  ? -3.618  -19.666 -0.542  1.00 0.00 ? 8   THR A HG22 3  
ATOM   1307  H  HG23 . THR A 1 8  ? -1.969  -19.922 0.029   1.00 0.00 ? 8   THR A HG23 3  
ATOM   1308  N  N    . GLY A 1 9  ? -3.220  -15.389 -2.140  1.00 0.00 ? 9   GLY A N    3  
ATOM   1309  C  CA   . GLY A 1 9  ? -2.923  -14.103 -2.744  1.00 0.00 ? 9   GLY A CA   3  
ATOM   1310  C  C    . GLY A 1 9  ? -3.974  -13.057 -2.427  1.00 0.00 ? 9   GLY A C    3  
ATOM   1311  O  O    . GLY A 1 9  ? -4.374  -12.286 -3.299  1.00 0.00 ? 9   GLY A O    3  
ATOM   1312  H  H    . GLY A 1 9  ? -3.938  -15.946 -2.507  1.00 0.00 ? 9   GLY A H    3  
ATOM   1313  H  HA2  . GLY A 1 9  ? -1.967  -13.759 -2.380  1.00 0.00 ? 9   GLY A HA2  3  
ATOM   1314  H  HA3  . GLY A 1 9  ? -2.866  -14.226 -3.815  1.00 0.00 ? 9   GLY A HA3  3  
ATOM   1315  N  N    . MET A 1 10 ? -4.423  -13.031 -1.177  1.00 0.00 ? 10  MET A N    3  
ATOM   1316  C  CA   . MET A 1 10 ? -5.435  -12.073 -0.748  1.00 0.00 ? 10  MET A CA   3  
ATOM   1317  C  C    . MET A 1 10 ? -4.787  -10.778 -0.266  1.00 0.00 ? 10  MET A C    3  
ATOM   1318  O  O    . MET A 1 10 ? -4.629  -10.561 0.936   1.00 0.00 ? 10  MET A O    3  
ATOM   1319  C  CB   . MET A 1 10 ? -6.296  -12.671 0.366   1.00 0.00 ? 10  MET A CB   3  
ATOM   1320  C  CG   . MET A 1 10 ? -7.695  -12.079 0.437   1.00 0.00 ? 10  MET A CG   3  
ATOM   1321  S  SD   . MET A 1 10 ? -7.749  -10.538 1.370   1.00 0.00 ? 10  MET A SD   3  
ATOM   1322  C  CE   . MET A 1 10 ? -8.523  -11.089 2.889   1.00 0.00 ? 10  MET A CE   3  
ATOM   1323  H  H    . MET A 1 10 ? -4.066  -13.671 -0.526  1.00 0.00 ? 10  MET A H    3  
ATOM   1324  H  HA   . MET A 1 10 ? -6.063  -11.852 -1.598  1.00 0.00 ? 10  MET A HA   3  
ATOM   1325  H  HB2  . MET A 1 10 ? -6.387  -13.735 0.202   1.00 0.00 ? 10  MET A HB2  3  
ATOM   1326  H  HB3  . MET A 1 10 ? -5.808  -12.501 1.314   1.00 0.00 ? 10  MET A HB3  3  
ATOM   1327  H  HG2  . MET A 1 10 ? -8.042  -11.888 -0.567  1.00 0.00 ? 10  MET A HG2  3  
ATOM   1328  H  HG3  . MET A 1 10 ? -8.349  -12.795 0.911   1.00 0.00 ? 10  MET A HG3  3  
ATOM   1329  H  HE1  . MET A 1 10 ? -8.319  -12.140 3.035   1.00 0.00 ? 10  MET A HE1  3  
ATOM   1330  H  HE2  . MET A 1 10 ? -8.125  -10.526 3.721   1.00 0.00 ? 10  MET A HE2  3  
ATOM   1331  H  HE3  . MET A 1 10 ? -9.590  -10.933 2.826   1.00 0.00 ? 10  MET A HE3  3  
ATOM   1332  N  N    . LYS A 1 11 ? -4.414  -9.921  -1.210  1.00 0.00 ? 11  LYS A N    3  
ATOM   1333  C  CA   . LYS A 1 11 ? -3.785  -8.647  -0.882  1.00 0.00 ? 11  LYS A CA   3  
ATOM   1334  C  C    . LYS A 1 11 ? -4.396  -7.512  -1.697  1.00 0.00 ? 11  LYS A C    3  
ATOM   1335  O  O    . LYS A 1 11 ? -3.790  -6.993  -2.635  1.00 0.00 ? 11  LYS A O    3  
ATOM   1336  C  CB   . LYS A 1 11 ? -2.278  -8.719  -1.138  1.00 0.00 ? 11  LYS A CB   3  
ATOM   1337  C  CG   . LYS A 1 11 ? -1.503  -9.404  -0.025  1.00 0.00 ? 11  LYS A CG   3  
ATOM   1338  C  CD   . LYS A 1 11 ? -0.102  -9.784  -0.473  1.00 0.00 ? 11  LYS A CD   3  
ATOM   1339  C  CE   . LYS A 1 11 ? 0.829   -8.581  -0.470  1.00 0.00 ? 11  LYS A CE   3  
ATOM   1340  N  NZ   . LYS A 1 11 ? 2.133   -8.887  -1.121  1.00 0.00 ? 11  LYS A NZ   3  
ATOM   1341  H  H    . LYS A 1 11 ? -4.567  -10.150 -2.151  1.00 0.00 ? 11  LYS A H    3  
ATOM   1342  H  HA   . LYS A 1 11 ? -3.954  -8.453  0.166   1.00 0.00 ? 11  LYS A HA   3  
ATOM   1343  H  HB2  . LYS A 1 11 ? -2.106  -9.263  -2.055  1.00 0.00 ? 11  LYS A HB2  3  
ATOM   1344  H  HB3  . LYS A 1 11 ? -1.895  -7.714  -1.249  1.00 0.00 ? 11  LYS A HB3  3  
ATOM   1345  H  HG2  . LYS A 1 11 ? -1.431  -8.732  0.817   1.00 0.00 ? 11  LYS A HG2  3  
ATOM   1346  H  HG3  . LYS A 1 11 ? -2.032  -10.299 0.270   1.00 0.00 ? 11  LYS A HG3  3  
ATOM   1347  H  HD2  . LYS A 1 11 ? 0.292   -10.531 0.200   1.00 0.00 ? 11  LYS A HD2  3  
ATOM   1348  H  HD3  . LYS A 1 11 ? -0.150  -10.188 -1.474  1.00 0.00 ? 11  LYS A HD3  3  
ATOM   1349  H  HE2  . LYS A 1 11 ? 0.353   -7.772  -1.002  1.00 0.00 ? 11  LYS A HE2  3  
ATOM   1350  H  HE3  . LYS A 1 11 ? 1.008   -8.283  0.552   1.00 0.00 ? 11  LYS A HE3  3  
ATOM   1351  H  HZ1  . LYS A 1 11 ? 2.809   -8.116  -0.948  1.00 0.00 ? 11  LYS A HZ1  3  
ATOM   1352  H  HZ2  . LYS A 1 11 ? 2.003   -8.997  -2.147  1.00 0.00 ? 11  LYS A HZ2  3  
ATOM   1353  H  HZ3  . LYS A 1 11 ? 2.526   -9.770  -0.736  1.00 0.00 ? 11  LYS A HZ3  3  
ATOM   1354  N  N    . PRO A 1 12 ? -5.625  -7.116  -1.333  1.00 0.00 ? 12  PRO A N    3  
ATOM   1355  C  CA   . PRO A 1 12 ? -6.344  -6.037  -2.016  1.00 0.00 ? 12  PRO A CA   3  
ATOM   1356  C  C    . PRO A 1 12 ? -5.719  -4.670  -1.758  1.00 0.00 ? 12  PRO A C    3  
ATOM   1357  O  O    . PRO A 1 12 ? -5.389  -3.941  -2.694  1.00 0.00 ? 12  PRO A O    3  
ATOM   1358  C  CB   . PRO A 1 12 ? -7.747  -6.106  -1.410  1.00 0.00 ? 12  PRO A CB   3  
ATOM   1359  C  CG   . PRO A 1 12 ? -7.551  -6.728  -0.071  1.00 0.00 ? 12  PRO A CG   3  
ATOM   1360  C  CD   . PRO A 1 12 ? -6.406  -7.690  -0.224  1.00 0.00 ? 12  PRO A CD   3  
ATOM   1361  H  HA   . PRO A 1 12 ? -6.400  -6.210  -3.081  1.00 0.00 ? 12  PRO A HA   3  
ATOM   1362  H  HB2  . PRO A 1 12 ? -8.157  -5.109  -1.328  1.00 0.00 ? 12  PRO A HB2  3  
ATOM   1363  H  HB3  . PRO A 1 12 ? -8.384  -6.712  -2.037  1.00 0.00 ? 12  PRO A HB3  3  
ATOM   1364  H  HG2  . PRO A 1 12 ? -7.308  -5.968  0.655   1.00 0.00 ? 12  PRO A HG2  3  
ATOM   1365  H  HG3  . PRO A 1 12 ? -8.447  -7.256  0.223   1.00 0.00 ? 12  PRO A HG3  3  
ATOM   1366  H  HD2  . PRO A 1 12 ? -5.820  -7.727  0.682   1.00 0.00 ? 12  PRO A HD2  3  
ATOM   1367  H  HD3  . PRO A 1 12 ? -6.771  -8.674  -0.480  1.00 0.00 ? 12  PRO A HD3  3  
ATOM   1368  N  N    . TYR A 1 13 ? -5.559  -4.329  -0.484  1.00 0.00 ? 13  TYR A N    3  
ATOM   1369  C  CA   . TYR A 1 13 ? -4.976  -3.048  -0.104  1.00 0.00 ? 13  TYR A CA   3  
ATOM   1370  C  C    . TYR A 1 13 ? -3.673  -3.249  0.663   1.00 0.00 ? 13  TYR A C    3  
ATOM   1371  O  O    . TYR A 1 13 ? -3.168  -2.329  1.307   1.00 0.00 ? 13  TYR A O    3  
ATOM   1372  C  CB   . TYR A 1 13 ? -5.963  -2.247  0.747   1.00 0.00 ? 13  TYR A CB   3  
ATOM   1373  C  CG   . TYR A 1 13 ? -7.410  -2.606  0.496   1.00 0.00 ? 13  TYR A CG   3  
ATOM   1374  C  CD1  . TYR A 1 13 ? -7.987  -3.715  1.103   1.00 0.00 ? 13  TYR A CD1  3  
ATOM   1375  C  CD2  . TYR A 1 13 ? -8.201  -1.836  -0.348  1.00 0.00 ? 13  TYR A CD2  3  
ATOM   1376  C  CE1  . TYR A 1 13 ? -9.308  -4.047  0.875   1.00 0.00 ? 13  TYR A CE1  3  
ATOM   1377  C  CE2  . TYR A 1 13 ? -9.523  -2.160  -0.581  1.00 0.00 ? 13  TYR A CE2  3  
ATOM   1378  C  CZ   . TYR A 1 13 ? -10.072 -3.267  0.033   1.00 0.00 ? 13  TYR A CZ   3  
ATOM   1379  O  OH   . TYR A 1 13 ? -11.389 -3.594  -0.196  1.00 0.00 ? 13  TYR A OH   3  
ATOM   1380  H  H    . TYR A 1 13 ? -5.842  -4.952  0.217   1.00 0.00 ? 13  TYR A H    3  
ATOM   1381  H  HA   . TYR A 1 13 ? -4.766  -2.497  -1.009  1.00 0.00 ? 13  TYR A HA   3  
ATOM   1382  H  HB2  . TYR A 1 13 ? -5.754  -2.425  1.791   1.00 0.00 ? 13  TYR A HB2  3  
ATOM   1383  H  HB3  . TYR A 1 13 ? -5.840  -1.195  0.535   1.00 0.00 ? 13  TYR A HB3  3  
ATOM   1384  H  HD1  . TYR A 1 13 ? -7.385  -4.324  1.762   1.00 0.00 ? 13  TYR A HD1  3  
ATOM   1385  H  HD2  . TYR A 1 13 ? -7.768  -0.970  -0.827  1.00 0.00 ? 13  TYR A HD2  3  
ATOM   1386  H  HE1  . TYR A 1 13 ? -9.738  -4.914  1.355   1.00 0.00 ? 13  TYR A HE1  3  
ATOM   1387  H  HE2  . TYR A 1 13 ? -10.122 -1.549  -1.240  1.00 0.00 ? 13  TYR A HE2  3  
ATOM   1388  H  HH   . TYR A 1 13 ? -11.443 -4.208  -0.932  1.00 0.00 ? 13  TYR A HH   3  
ATOM   1389  N  N    . VAL A 1 14 ? -3.131  -4.461  0.589   1.00 0.00 ? 14  VAL A N    3  
ATOM   1390  C  CA   . VAL A 1 14 ? -1.886  -4.785  1.274   1.00 0.00 ? 14  VAL A CA   3  
ATOM   1391  C  C    . VAL A 1 14 ? -0.681  -4.252  0.506   1.00 0.00 ? 14  VAL A C    3  
ATOM   1392  O  O    . VAL A 1 14 ? -0.642  -4.306  -0.723  1.00 0.00 ? 14  VAL A O    3  
ATOM   1393  C  CB   . VAL A 1 14 ? -1.728  -6.306  1.463   1.00 0.00 ? 14  VAL A CB   3  
ATOM   1394  C  CG1  . VAL A 1 14 ? -0.471  -6.617  2.260   1.00 0.00 ? 14  VAL A CG1  3  
ATOM   1395  C  CG2  . VAL A 1 14 ? -2.958  -6.888  2.143   1.00 0.00 ? 14  VAL A CG2  3  
ATOM   1396  H  H    . VAL A 1 14 ? -3.580  -5.154  0.061   1.00 0.00 ? 14  VAL A H    3  
ATOM   1397  H  HA   . VAL A 1 14 ? -1.911  -4.323  2.250   1.00 0.00 ? 14  VAL A HA   3  
ATOM   1398  H  HB   . VAL A 1 14 ? -1.632  -6.761  0.488   1.00 0.00 ? 14  VAL A HB   3  
ATOM   1399  H  HG11 . VAL A 1 14 ? -0.148  -7.625  2.044   1.00 0.00 ? 14  VAL A HG11 3  
ATOM   1400  H  HG12 . VAL A 1 14 ? 0.310   -5.922  1.988   1.00 0.00 ? 14  VAL A HG12 3  
ATOM   1401  H  HG13 . VAL A 1 14 ? -0.682  -6.527  3.316   1.00 0.00 ? 14  VAL A HG13 3  
ATOM   1402  H  HG21 . VAL A 1 14 ? -3.031  -7.941  1.915   1.00 0.00 ? 14  VAL A HG21 3  
ATOM   1403  H  HG22 . VAL A 1 14 ? -2.875  -6.755  3.211   1.00 0.00 ? 14  VAL A HG22 3  
ATOM   1404  H  HG23 . VAL A 1 14 ? -3.842  -6.380  1.784   1.00 0.00 ? 14  VAL A HG23 3  
ATOM   1405  N  N    . CYS A 1 15 ? 0.300   -3.737  1.239   1.00 0.00 ? 15  CYS A N    3  
ATOM   1406  C  CA   . CYS A 1 15 ? 1.507   -3.194  0.628   1.00 0.00 ? 15  CYS A CA   3  
ATOM   1407  C  C    . CYS A 1 15 ? 2.366   -4.307  0.036   1.00 0.00 ? 15  CYS A C    3  
ATOM   1408  O  O    . CYS A 1 15 ? 2.954   -5.105  0.765   1.00 0.00 ? 15  CYS A O    3  
ATOM   1409  C  CB   . CYS A 1 15 ? 2.316   -2.405  1.661   1.00 0.00 ? 15  CYS A CB   3  
ATOM   1410  S  SG   . CYS A 1 15 ? 3.277   -1.027  0.957   1.00 0.00 ? 15  CYS A SG   3  
ATOM   1411  H  H    . CYS A 1 15 ? 0.211   -3.723  2.216   1.00 0.00 ? 15  CYS A H    3  
ATOM   1412  H  HA   . CYS A 1 15 ? 1.206   -2.527  -0.165  1.00 0.00 ? 15  CYS A HA   3  
ATOM   1413  H  HB2  . CYS A 1 15 ? 1.640   -1.992  2.396   1.00 0.00 ? 15  CYS A HB2  3  
ATOM   1414  H  HB3  . CYS A 1 15 ? 3.008   -3.073  2.151   1.00 0.00 ? 15  CYS A HB3  3  
ATOM   1415  N  N    . ASN A 1 16 ? 2.434   -4.353  -1.290  1.00 0.00 ? 16  ASN A N    3  
ATOM   1416  C  CA   . ASN A 1 16 ? 3.220   -5.369  -1.981  1.00 0.00 ? 16  ASN A CA   3  
ATOM   1417  C  C    . ASN A 1 16 ? 4.710   -5.176  -1.715  1.00 0.00 ? 16  ASN A C    3  
ATOM   1418  O  O    . ASN A 1 16 ? 5.538   -5.962  -2.175  1.00 0.00 ? 16  ASN A O    3  
ATOM   1419  C  CB   . ASN A 1 16 ? 2.948   -5.318  -3.486  1.00 0.00 ? 16  ASN A CB   3  
ATOM   1420  C  CG   . ASN A 1 16 ? 1.493   -5.585  -3.820  1.00 0.00 ? 16  ASN A CG   3  
ATOM   1421  O  OD1  . ASN A 1 16 ? 0.809   -4.733  -4.388  1.00 0.00 ? 16  ASN A OD1  3  
ATOM   1422  N  ND2  . ASN A 1 16 ? 1.013   -6.771  -3.467  1.00 0.00 ? 16  ASN A ND2  3  
ATOM   1423  H  H    . ASN A 1 16 ? 1.942   -3.689  -1.817  1.00 0.00 ? 16  ASN A H    3  
ATOM   1424  H  HA   . ASN A 1 16 ? 2.920   -6.334  -1.602  1.00 0.00 ? 16  ASN A HA   3  
ATOM   1425  H  HB2  . ASN A 1 16 ? 3.210   -4.339  -3.860  1.00 0.00 ? 16  ASN A HB2  3  
ATOM   1426  H  HB3  . ASN A 1 16 ? 3.555   -6.062  -3.981  1.00 0.00 ? 16  ASN A HB3  3  
ATOM   1427  H  HD21 . ASN A 1 16 ? 1.616   -7.400  -3.017  1.00 0.00 ? 16  ASN A HD21 3  
ATOM   1428  H  HD22 . ASN A 1 16 ? 0.076   -6.970  -3.671  1.00 0.00 ? 16  ASN A HD22 3  
ATOM   1429  N  N    . GLU A 1 17 ? 5.042   -4.127  -0.970  1.00 0.00 ? 17  GLU A N    3  
ATOM   1430  C  CA   . GLU A 1 17 ? 6.432   -3.832  -0.643  1.00 0.00 ? 17  GLU A CA   3  
ATOM   1431  C  C    . GLU A 1 17 ? 6.788   -4.354  0.746   1.00 0.00 ? 17  GLU A C    3  
ATOM   1432  O  O    . GLU A 1 17 ? 7.635   -5.236  0.892   1.00 0.00 ? 17  GLU A O    3  
ATOM   1433  C  CB   . GLU A 1 17 ? 6.688   -2.325  -0.714  1.00 0.00 ? 17  GLU A CB   3  
ATOM   1434  C  CG   . GLU A 1 17 ? 6.055   -1.657  -1.923  1.00 0.00 ? 17  GLU A CG   3  
ATOM   1435  C  CD   . GLU A 1 17 ? 4.660   -1.136  -1.639  1.00 0.00 ? 17  GLU A CD   3  
ATOM   1436  O  OE1  . GLU A 1 17 ? 3.711   -1.949  -1.648  1.00 0.00 ? 17  GLU A OE1  3  
ATOM   1437  O  OE2  . GLU A 1 17 ? 4.516   0.083   -1.409  1.00 0.00 ? 17  GLU A OE2  3  
ATOM   1438  H  H    . GLU A 1 17 ? 4.336   -3.537  -0.632  1.00 0.00 ? 17  GLU A H    3  
ATOM   1439  H  HA   . GLU A 1 17 ? 7.056   -4.328  -1.371  1.00 0.00 ? 17  GLU A HA   3  
ATOM   1440  H  HB2  . GLU A 1 17 ? 6.289   -1.862  0.177   1.00 0.00 ? 17  GLU A HB2  3  
ATOM   1441  H  HB3  . GLU A 1 17 ? 7.753   -2.154  -0.751  1.00 0.00 ? 17  GLU A HB3  3  
ATOM   1442  H  HG2  . GLU A 1 17 ? 6.677   -0.828  -2.227  1.00 0.00 ? 17  GLU A HG2  3  
ATOM   1443  H  HG3  . GLU A 1 17 ? 5.999   -2.376  -2.727  1.00 0.00 ? 17  GLU A HG3  3  
ATOM   1444  N  N    . CYS A 1 18 ? 6.135   -3.803  1.763   1.00 0.00 ? 18  CYS A N    3  
ATOM   1445  C  CA   . CYS A 1 18 ? 6.381   -4.211  3.141   1.00 0.00 ? 18  CYS A CA   3  
ATOM   1446  C  C    . CYS A 1 18 ? 5.375   -5.270  3.583   1.00 0.00 ? 18  CYS A C    3  
ATOM   1447  O  O    . CYS A 1 18 ? 5.638   -6.048  4.499   1.00 0.00 ? 18  CYS A O    3  
ATOM   1448  C  CB   . CYS A 1 18 ? 6.307   -3.001  4.074   1.00 0.00 ? 18  CYS A CB   3  
ATOM   1449  S  SG   . CYS A 1 18 ? 4.715   -2.118  4.022   1.00 0.00 ? 18  CYS A SG   3  
ATOM   1450  H  H    . CYS A 1 18 ? 5.471   -3.104  1.584   1.00 0.00 ? 18  CYS A H    3  
ATOM   1451  H  HA   . CYS A 1 18 ? 7.373   -4.633  3.191   1.00 0.00 ? 18  CYS A HA   3  
ATOM   1452  H  HB2  . CYS A 1 18 ? 6.467   -3.330  5.091   1.00 0.00 ? 18  CYS A HB2  3  
ATOM   1453  H  HB3  . CYS A 1 18 ? 7.082   -2.299  3.803   1.00 0.00 ? 18  CYS A HB3  3  
ATOM   1454  N  N    . GLY A 1 19 ? 4.220   -5.293  2.924   1.00 0.00 ? 19  GLY A N    3  
ATOM   1455  C  CA   . GLY A 1 19 ? 3.192   -6.259  3.263   1.00 0.00 ? 19  GLY A CA   3  
ATOM   1456  C  C    . GLY A 1 19 ? 2.169   -5.702  4.232   1.00 0.00 ? 19  GLY A C    3  
ATOM   1457  O  O    . GLY A 1 19 ? 1.375   -6.448  4.806   1.00 0.00 ? 19  GLY A O    3  
ATOM   1458  H  H    . GLY A 1 19 ? 4.065   -4.648  2.202   1.00 0.00 ? 19  GLY A H    3  
ATOM   1459  H  HA2  . GLY A 1 19 ? 2.687   -6.563  2.358   1.00 0.00 ? 19  GLY A HA2  3  
ATOM   1460  H  HA3  . GLY A 1 19 ? 3.660   -7.124  3.710   1.00 0.00 ? 19  GLY A HA3  3  
ATOM   1461  N  N    . LYS A 1 20 ? 2.187   -4.386  4.418   1.00 0.00 ? 20  LYS A N    3  
ATOM   1462  C  CA   . LYS A 1 20 ? 1.255   -3.728  5.325   1.00 0.00 ? 20  LYS A CA   3  
ATOM   1463  C  C    . LYS A 1 20 ? -0.181  -3.871  4.828   1.00 0.00 ? 20  LYS A C    3  
ATOM   1464  O  O    . LYS A 1 20 ? -0.545  -3.324  3.788   1.00 0.00 ? 20  LYS A O    3  
ATOM   1465  C  CB   . LYS A 1 20 ? 1.610   -2.246  5.468   1.00 0.00 ? 20  LYS A CB   3  
ATOM   1466  C  CG   . LYS A 1 20 ? 0.900   -1.559  6.621   1.00 0.00 ? 20  LYS A CG   3  
ATOM   1467  C  CD   . LYS A 1 20 ? 1.673   -1.707  7.920   1.00 0.00 ? 20  LYS A CD   3  
ATOM   1468  C  CE   . LYS A 1 20 ? 1.391   -0.554  8.871   1.00 0.00 ? 20  LYS A CE   3  
ATOM   1469  N  NZ   . LYS A 1 20 ? 2.305   0.598   8.634   1.00 0.00 ? 20  LYS A NZ   3  
ATOM   1470  H  H    . LYS A 1 20 ? 2.844   -3.844  3.931   1.00 0.00 ? 20  LYS A H    3  
ATOM   1471  H  HA   . LYS A 1 20 ? 1.338   -4.204  6.290   1.00 0.00 ? 20  LYS A HA   3  
ATOM   1472  H  HB2  . LYS A 1 20 ? 2.675   -2.158  5.624   1.00 0.00 ? 20  LYS A HB2  3  
ATOM   1473  H  HB3  . LYS A 1 20 ? 1.346   -1.735  4.553   1.00 0.00 ? 20  LYS A HB3  3  
ATOM   1474  H  HG2  . LYS A 1 20 ? 0.797   -0.508  6.393   1.00 0.00 ? 20  LYS A HG2  3  
ATOM   1475  H  HG3  . LYS A 1 20 ? -0.079  -2.000  6.743   1.00 0.00 ? 20  LYS A HG3  3  
ATOM   1476  H  HD2  . LYS A 1 20 ? 1.385   -2.631  8.398   1.00 0.00 ? 20  LYS A HD2  3  
ATOM   1477  H  HD3  . LYS A 1 20 ? 2.731   -1.729  7.699   1.00 0.00 ? 20  LYS A HD3  3  
ATOM   1478  H  HE2  . LYS A 1 20 ? 0.372   -0.229  8.729   1.00 0.00 ? 20  LYS A HE2  3  
ATOM   1479  H  HE3  . LYS A 1 20 ? 1.520   -0.902  9.886   1.00 0.00 ? 20  LYS A HE3  3  
ATOM   1480  H  HZ1  . LYS A 1 20 ? 2.803   0.845   9.512   1.00 0.00 ? 20  LYS A HZ1  3  
ATOM   1481  H  HZ2  . LYS A 1 20 ? 1.761   1.424   8.312   1.00 0.00 ? 20  LYS A HZ2  3  
ATOM   1482  H  HZ3  . LYS A 1 20 ? 3.006   0.353   7.906   1.00 0.00 ? 20  LYS A HZ3  3  
ATOM   1483  N  N    . ALA A 1 21 ? -0.991  -4.609  5.580   1.00 0.00 ? 21  ALA A N    3  
ATOM   1484  C  CA   . ALA A 1 21 ? -2.387  -4.821  5.217   1.00 0.00 ? 21  ALA A CA   3  
ATOM   1485  C  C    . ALA A 1 21 ? -3.279  -3.736  5.811   1.00 0.00 ? 21  ALA A C    3  
ATOM   1486  O  O    . ALA A 1 21 ? -3.212  -3.448  7.006   1.00 0.00 ? 21  ALA A O    3  
ATOM   1487  C  CB   . ALA A 1 21 ? -2.849  -6.196  5.676   1.00 0.00 ? 21  ALA A CB   3  
ATOM   1488  H  H    . ALA A 1 21 ? -0.642  -5.020  6.398   1.00 0.00 ? 21  ALA A H    3  
ATOM   1489  H  HA   . ALA A 1 21 ? -2.461  -4.784  4.140   1.00 0.00 ? 21  ALA A HA   3  
ATOM   1490  H  HB1  . ALA A 1 21 ? -2.138  -6.941  5.351   1.00 0.00 ? 21  ALA A HB1  3  
ATOM   1491  H  HB2  . ALA A 1 21 ? -2.918  -6.210  6.754   1.00 0.00 ? 21  ALA A HB2  3  
ATOM   1492  H  HB3  . ALA A 1 21 ? -3.817  -6.411  5.250   1.00 0.00 ? 21  ALA A HB3  3  
ATOM   1493  N  N    . PHE A 1 22 ? -4.113  -3.135  4.968   1.00 0.00 ? 22  PHE A N    3  
ATOM   1494  C  CA   . PHE A 1 22 ? -5.018  -2.080  5.410   1.00 0.00 ? 22  PHE A CA   3  
ATOM   1495  C  C    . PHE A 1 22 ? -6.473  -2.497  5.220   1.00 0.00 ? 22  PHE A C    3  
ATOM   1496  O  O    . PHE A 1 22 ? -6.759  -3.607  4.771   1.00 0.00 ? 22  PHE A O    3  
ATOM   1497  C  CB   . PHE A 1 22 ? -4.741  -0.787  4.639   1.00 0.00 ? 22  PHE A CB   3  
ATOM   1498  C  CG   . PHE A 1 22 ? -3.307  -0.346  4.704   1.00 0.00 ? 22  PHE A CG   3  
ATOM   1499  C  CD1  . PHE A 1 22 ? -2.327  -1.024  3.998   1.00 0.00 ? 22  PHE A CD1  3  
ATOM   1500  C  CD2  . PHE A 1 22 ? -2.939  0.748   5.472   1.00 0.00 ? 22  PHE A CD2  3  
ATOM   1501  C  CE1  . PHE A 1 22 ? -1.006  -0.620  4.055   1.00 0.00 ? 22  PHE A CE1  3  
ATOM   1502  C  CE2  . PHE A 1 22 ? -1.621  1.157   5.532   1.00 0.00 ? 22  PHE A CE2  3  
ATOM   1503  C  CZ   . PHE A 1 22 ? -0.653  0.471   4.824   1.00 0.00 ? 22  PHE A CZ   3  
ATOM   1504  H  H    . PHE A 1 22 ? -4.120  -3.408  4.027   1.00 0.00 ? 22  PHE A H    3  
ATOM   1505  H  HA   . PHE A 1 22 ? -4.838  -1.909  6.460   1.00 0.00 ? 22  PHE A HA   3  
ATOM   1506  H  HB2  . PHE A 1 22 ? -4.996  -0.934  3.601   1.00 0.00 ? 22  PHE A HB2  3  
ATOM   1507  H  HB3  . PHE A 1 22 ? -5.352  0.004   5.048   1.00 0.00 ? 22  PHE A HB3  3  
ATOM   1508  H  HD1  . PHE A 1 22 ? -2.603  -1.879  3.396   1.00 0.00 ? 22  PHE A HD1  3  
ATOM   1509  H  HD2  . PHE A 1 22 ? -3.695  1.284   6.027   1.00 0.00 ? 22  PHE A HD2  3  
ATOM   1510  H  HE1  . PHE A 1 22 ? -0.252  -1.158  3.500   1.00 0.00 ? 22  PHE A HE1  3  
ATOM   1511  H  HE2  . PHE A 1 22 ? -1.347  2.010   6.135   1.00 0.00 ? 22  PHE A HE2  3  
ATOM   1512  H  HZ   . PHE A 1 22 ? 0.378   0.789   4.870   1.00 0.00 ? 22  PHE A HZ   3  
ATOM   1513  N  N    . ARG A 1 23 ? -7.390  -1.599  5.567   1.00 0.00 ? 23  ARG A N    3  
ATOM   1514  C  CA   . ARG A 1 23 ? -8.815  -1.873  5.438   1.00 0.00 ? 23  ARG A CA   3  
ATOM   1515  C  C    . ARG A 1 23 ? -9.349  -1.359  4.104   1.00 0.00 ? 23  ARG A C    3  
ATOM   1516  O  O    . ARG A 1 23 ? -10.214 -1.982  3.488   1.00 0.00 ? 23  ARG A O    3  
ATOM   1517  C  CB   . ARG A 1 23 ? -9.587  -1.229  6.591   1.00 0.00 ? 23  ARG A CB   3  
ATOM   1518  C  CG   . ARG A 1 23 ? -9.214  -1.781  7.957   1.00 0.00 ? 23  ARG A CG   3  
ATOM   1519  C  CD   . ARG A 1 23 ? -9.664  -0.853  9.074   1.00 0.00 ? 23  ARG A CD   3  
ATOM   1520  N  NE   . ARG A 1 23 ? -8.912  0.399   9.082   1.00 0.00 ? 23  ARG A NE   3  
ATOM   1521  C  CZ   . ARG A 1 23 ? -9.107  1.367   9.971   1.00 0.00 ? 23  ARG A CZ   3  
ATOM   1522  N  NH1  . ARG A 1 23 ? -10.024 1.228   10.918  1.00 0.00 ? 23  ARG A NH1  3  
ATOM   1523  N  NH2  . ARG A 1 23 ? -8.383  2.477   9.913   1.00 0.00 ? 23  ARG A NH2  3  
ATOM   1524  H  H    . ARG A 1 23 ? -7.100  -0.732  5.919   1.00 0.00 ? 23  ARG A H    3  
ATOM   1525  H  HA   . ARG A 1 23 ? -8.953  -2.944  5.478   1.00 0.00 ? 23  ARG A HA   3  
ATOM   1526  H  HB2  . ARG A 1 23 ? -9.392  -0.167  6.590   1.00 0.00 ? 23  ARG A HB2  3  
ATOM   1527  H  HB3  . ARG A 1 23 ? -10.643 -1.392  6.436   1.00 0.00 ? 23  ARG A HB3  3  
ATOM   1528  H  HG2  . ARG A 1 23 ? -9.689  -2.742  8.089   1.00 0.00 ? 23  ARG A HG2  3  
ATOM   1529  H  HG3  . ARG A 1 23 ? -8.142  -1.897  8.007   1.00 0.00 ? 23  ARG A HG3  3  
ATOM   1530  H  HD2  . ARG A 1 23 ? -10.713 -0.631  8.940   1.00 0.00 ? 23  ARG A HD2  3  
ATOM   1531  H  HD3  . ARG A 1 23 ? -9.521  -1.355  10.020  1.00 0.00 ? 23  ARG A HD3  3  
ATOM   1532  H  HE   . ARG A 1 23 ? -8.230  0.523   8.391   1.00 0.00 ? 23  ARG A HE   3  
ATOM   1533  H  HH11 . ARG A 1 23 ? -10.571 0.392   10.965  1.00 0.00 ? 23  ARG A HH11 3  
ATOM   1534  H  HH12 . ARG A 1 23 ? -10.168 1.958   11.587  1.00 0.00 ? 23  ARG A HH12 3  
ATOM   1535  H  HH21 . ARG A 1 23 ? -7.690  2.586   9.201   1.00 0.00 ? 23  ARG A HH21 3  
ATOM   1536  H  HH22 . ARG A 1 23 ? -8.530  3.205   10.582  1.00 0.00 ? 23  ARG A HH22 3  
ATOM   1537  N  N    . SER A 1 24 ? -8.827  -0.219  3.664   1.00 0.00 ? 24  SER A N    3  
ATOM   1538  C  CA   . SER A 1 24 ? -9.254  0.382   2.405   1.00 0.00 ? 24  SER A CA   3  
ATOM   1539  C  C    . SER A 1 24 ? -8.050  0.772   1.553   1.00 0.00 ? 24  SER A C    3  
ATOM   1540  O  O    . SER A 1 24 ? -6.923  0.839   2.044   1.00 0.00 ? 24  SER A O    3  
ATOM   1541  C  CB   . SER A 1 24 ? -10.124 1.612   2.672   1.00 0.00 ? 24  SER A CB   3  
ATOM   1542  O  OG   . SER A 1 24 ? -11.150 1.318   3.604   1.00 0.00 ? 24  SER A OG   3  
ATOM   1543  H  H    . SER A 1 24 ? -8.140  0.231   4.200   1.00 0.00 ? 24  SER A H    3  
ATOM   1544  H  HA   . SER A 1 24 ? -9.837  -0.351  1.869   1.00 0.00 ? 24  SER A HA   3  
ATOM   1545  H  HB2  . SER A 1 24 ? -9.509  2.405   3.070   1.00 0.00 ? 24  SER A HB2  3  
ATOM   1546  H  HB3  . SER A 1 24 ? -10.577 1.937   1.746   1.00 0.00 ? 24  SER A HB3  3  
ATOM   1547  H  HG   . SER A 1 24 ? -11.416 2.125   4.053   1.00 0.00 ? 24  SER A HG   3  
ATOM   1548  N  N    . LYS A 1 25 ? -8.297  1.029   0.273   1.00 0.00 ? 25  LYS A N    3  
ATOM   1549  C  CA   . LYS A 1 25 ? -7.235  1.413   -0.649  1.00 0.00 ? 25  LYS A CA   3  
ATOM   1550  C  C    . LYS A 1 25 ? -6.688  2.794   -0.303  1.00 0.00 ? 25  LYS A C    3  
ATOM   1551  O  O    . LYS A 1 25 ? -5.487  3.041   -0.413  1.00 0.00 ? 25  LYS A O    3  
ATOM   1552  C  CB   . LYS A 1 25 ? -7.755  1.405   -2.089  1.00 0.00 ? 25  LYS A CB   3  
ATOM   1553  C  CG   . LYS A 1 25 ? -8.976  2.284   -2.299  1.00 0.00 ? 25  LYS A CG   3  
ATOM   1554  C  CD   . LYS A 1 25 ? -8.583  3.704   -2.672  1.00 0.00 ? 25  LYS A CD   3  
ATOM   1555  C  CE   . LYS A 1 25 ? -8.398  3.855   -4.174  1.00 0.00 ? 25  LYS A CE   3  
ATOM   1556  N  NZ   . LYS A 1 25 ? -9.699  4.022   -4.879  1.00 0.00 ? 25  LYS A NZ   3  
ATOM   1557  H  H    . LYS A 1 25 ? -9.217  0.958   -0.059  1.00 0.00 ? 25  LYS A H    3  
ATOM   1558  H  HA   . LYS A 1 25 ? -6.439  0.690   -0.559  1.00 0.00 ? 25  LYS A HA   3  
ATOM   1559  H  HB2  . LYS A 1 25 ? -6.970  1.753   -2.744  1.00 0.00 ? 25  LYS A HB2  3  
ATOM   1560  H  HB3  . LYS A 1 25 ? -8.016  0.392   -2.359  1.00 0.00 ? 25  LYS A HB3  3  
ATOM   1561  H  HG2  . LYS A 1 25 ? -9.575  1.867   -3.095  1.00 0.00 ? 25  LYS A HG2  3  
ATOM   1562  H  HG3  . LYS A 1 25 ? -9.553  2.308   -1.386  1.00 0.00 ? 25  LYS A HG3  3  
ATOM   1563  H  HD2  . LYS A 1 25 ? -9.360  4.380   -2.347  1.00 0.00 ? 25  LYS A HD2  3  
ATOM   1564  H  HD3  . LYS A 1 25 ? -7.656  3.954   -2.177  1.00 0.00 ? 25  LYS A HD3  3  
ATOM   1565  H  HE2  . LYS A 1 25 ? -7.783  4.721   -4.362  1.00 0.00 ? 25  LYS A HE2  3  
ATOM   1566  H  HE3  . LYS A 1 25 ? -7.903  2.973   -4.553  1.00 0.00 ? 25  LYS A HE3  3  
ATOM   1567  H  HZ1  . LYS A 1 25 ? -10.485 3.949   -4.202  1.00 0.00 ? 25  LYS A HZ1  3  
ATOM   1568  H  HZ2  . LYS A 1 25 ? -9.810  3.283   -5.604  1.00 0.00 ? 25  LYS A HZ2  3  
ATOM   1569  H  HZ3  . LYS A 1 25 ? -9.739  4.953   -5.341  1.00 0.00 ? 25  LYS A HZ3  3  
ATOM   1570  N  N    . SER A 1 26 ? -7.575  3.690   0.118   1.00 0.00 ? 26  SER A N    3  
ATOM   1571  C  CA   . SER A 1 26 ? -7.180  5.046   0.478   1.00 0.00 ? 26  SER A CA   3  
ATOM   1572  C  C    . SER A 1 26 ? -6.303  5.043   1.726   1.00 0.00 ? 26  SER A C    3  
ATOM   1573  O  O    . SER A 1 26 ? -5.587  6.007   1.998   1.00 0.00 ? 26  SER A O    3  
ATOM   1574  C  CB   . SER A 1 26 ? -8.418  5.915   0.713   1.00 0.00 ? 26  SER A CB   3  
ATOM   1575  O  OG   . SER A 1 26 ? -8.052  7.238   1.065   1.00 0.00 ? 26  SER A OG   3  
ATOM   1576  H  H    . SER A 1 26 ? -8.519  3.432   0.185   1.00 0.00 ? 26  SER A H    3  
ATOM   1577  H  HA   . SER A 1 26 ? -6.614  5.456   -0.345  1.00 0.00 ? 26  SER A HA   3  
ATOM   1578  H  HB2  . SER A 1 26 ? -9.009  5.945   -0.189  1.00 0.00 ? 26  SER A HB2  3  
ATOM   1579  H  HB3  . SER A 1 26 ? -9.005  5.491   1.515   1.00 0.00 ? 26  SER A HB3  3  
ATOM   1580  H  HG   . SER A 1 26 ? -8.379  7.437   1.946   1.00 0.00 ? 26  SER A HG   3  
ATOM   1581  N  N    . TYR A 1 27 ? -6.364  3.952   2.482   1.00 0.00 ? 27  TYR A N    3  
ATOM   1582  C  CA   . TYR A 1 27 ? -5.577  3.823   3.703   1.00 0.00 ? 27  TYR A CA   3  
ATOM   1583  C  C    . TYR A 1 27 ? -4.162  3.345   3.391   1.00 0.00 ? 27  TYR A C    3  
ATOM   1584  O  O    . TYR A 1 27 ? -3.216  3.651   4.119   1.00 0.00 ? 27  TYR A O    3  
ATOM   1585  C  CB   . TYR A 1 27 ? -6.254  2.851   4.670   1.00 0.00 ? 27  TYR A CB   3  
ATOM   1586  C  CG   . TYR A 1 27 ? -5.997  3.168   6.126   1.00 0.00 ? 27  TYR A CG   3  
ATOM   1587  C  CD1  . TYR A 1 27 ? -6.093  4.470   6.601   1.00 0.00 ? 27  TYR A CD1  3  
ATOM   1588  C  CD2  . TYR A 1 27 ? -5.660  2.165   7.027   1.00 0.00 ? 27  TYR A CD2  3  
ATOM   1589  C  CE1  . TYR A 1 27 ? -5.859  4.764   7.930   1.00 0.00 ? 27  TYR A CE1  3  
ATOM   1590  C  CE2  . TYR A 1 27 ? -5.425  2.450   8.358   1.00 0.00 ? 27  TYR A CE2  3  
ATOM   1591  C  CZ   . TYR A 1 27 ? -5.525  3.751   8.805   1.00 0.00 ? 27  TYR A CZ   3  
ATOM   1592  O  OH   . TYR A 1 27 ? -5.293  4.040   10.130  1.00 0.00 ? 27  TYR A OH   3  
ATOM   1593  H  H    . TYR A 1 27 ? -6.953  3.217   2.213   1.00 0.00 ? 27  TYR A H    3  
ATOM   1594  H  HA   . TYR A 1 27 ? -5.522  4.797   4.166   1.00 0.00 ? 27  TYR A HA   3  
ATOM   1595  H  HB2  . TYR A 1 27 ? -7.321  2.877   4.509   1.00 0.00 ? 27  TYR A HB2  3  
ATOM   1596  H  HB3  . TYR A 1 27 ? -5.890  1.852   4.479   1.00 0.00 ? 27  TYR A HB3  3  
ATOM   1597  H  HD1  . TYR A 1 27 ? -6.355  5.261   5.914   1.00 0.00 ? 27  TYR A HD1  3  
ATOM   1598  H  HD2  . TYR A 1 27 ? -5.582  1.147   6.674   1.00 0.00 ? 27  TYR A HD2  3  
ATOM   1599  H  HE1  . TYR A 1 27 ? -5.938  5.783   8.281   1.00 0.00 ? 27  TYR A HE1  3  
ATOM   1600  H  HE2  . TYR A 1 27 ? -5.164  1.657   9.043   1.00 0.00 ? 27  TYR A HE2  3  
ATOM   1601  H  HH   . TYR A 1 27 ? -4.350  4.155   10.271  1.00 0.00 ? 27  TYR A HH   3  
ATOM   1602  N  N    . LEU A 1 28 ? -4.024  2.594   2.304   1.00 0.00 ? 28  LEU A N    3  
ATOM   1603  C  CA   . LEU A 1 28 ? -2.725  2.074   1.893   1.00 0.00 ? 28  LEU A CA   3  
ATOM   1604  C  C    . LEU A 1 28 ? -1.966  3.100   1.058   1.00 0.00 ? 28  LEU A C    3  
ATOM   1605  O  O    . LEU A 1 28 ? -0.743  3.205   1.147   1.00 0.00 ? 28  LEU A O    3  
ATOM   1606  C  CB   . LEU A 1 28 ? -2.901  0.780   1.096   1.00 0.00 ? 28  LEU A CB   3  
ATOM   1607  C  CG   . LEU A 1 28 ? -1.810  0.470   0.070   1.00 0.00 ? 28  LEU A CG   3  
ATOM   1608  C  CD1  . LEU A 1 28 ? -0.539  0.008   0.765   1.00 0.00 ? 28  LEU A CD1  3  
ATOM   1609  C  CD2  . LEU A 1 28 ? -2.292  -0.581  -0.919  1.00 0.00 ? 28  LEU A CD2  3  
ATOM   1610  H  H    . LEU A 1 28 ? -4.814  2.384   1.764   1.00 0.00 ? 28  LEU A H    3  
ATOM   1611  H  HA   . LEU A 1 28 ? -2.155  1.862   2.786   1.00 0.00 ? 28  LEU A HA   3  
ATOM   1612  H  HB2  . LEU A 1 28 ? -2.935  -0.039  1.799   1.00 0.00 ? 28  LEU A HB2  3  
ATOM   1613  H  HB3  . LEU A 1 28 ? -3.843  0.841   0.571   1.00 0.00 ? 28  LEU A HB3  3  
ATOM   1614  H  HG   . LEU A 1 28 ? -1.579  1.370   -0.483  1.00 0.00 ? 28  LEU A HG   3  
ATOM   1615  H  HD11 . LEU A 1 28 ? -0.789  -0.430  1.719   1.00 0.00 ? 28  LEU A HD11 3  
ATOM   1616  H  HD12 . LEU A 1 28 ? 0.115   0.854   0.918   1.00 0.00 ? 28  LEU A HD12 3  
ATOM   1617  H  HD13 . LEU A 1 28 ? -0.039  -0.726  0.150   1.00 0.00 ? 28  LEU A HD13 3  
ATOM   1618  H  HD21 . LEU A 1 28 ? -1.501  -1.295  -1.099  1.00 0.00 ? 28  LEU A HD21 3  
ATOM   1619  H  HD22 . LEU A 1 28 ? -2.564  -0.103  -1.848  1.00 0.00 ? 28  LEU A HD22 3  
ATOM   1620  H  HD23 . LEU A 1 28 ? -3.152  -1.091  -0.511  1.00 0.00 ? 28  LEU A HD23 3  
ATOM   1621  N  N    . ILE A 1 29 ? -2.701  3.855   0.249   1.00 0.00 ? 29  ILE A N    3  
ATOM   1622  C  CA   . ILE A 1 29 ? -2.097  4.875   -0.600  1.00 0.00 ? 29  ILE A CA   3  
ATOM   1623  C  C    . ILE A 1 29 ? -1.406  5.947   0.236   1.00 0.00 ? 29  ILE A C    3  
ATOM   1624  O  O    . ILE A 1 29 ? -0.329  6.427   -0.119  1.00 0.00 ? 29  ILE A O    3  
ATOM   1625  C  CB   . ILE A 1 29 ? -3.146  5.546   -1.507  1.00 0.00 ? 29  ILE A CB   3  
ATOM   1626  C  CG1  . ILE A 1 29 ? -3.671  4.547   -2.541  1.00 0.00 ? 29  ILE A CG1  3  
ATOM   1627  C  CG2  . ILE A 1 29 ? -2.550  6.764   -2.196  1.00 0.00 ? 29  ILE A CG2  3  
ATOM   1628  C  CD1  . ILE A 1 29 ? -5.097  4.813   -2.969  1.00 0.00 ? 29  ILE A CD1  3  
ATOM   1629  H  H    . ILE A 1 29 ? -3.671  3.724   0.222   1.00 0.00 ? 29  ILE A H    3  
ATOM   1630  H  HA   . ILE A 1 29 ? -1.362  4.394   -1.228  1.00 0.00 ? 29  ILE A HA   3  
ATOM   1631  H  HB   . ILE A 1 29 ? -3.966  5.877   -0.889  1.00 0.00 ? 29  ILE A HB   3  
ATOM   1632  H  HG12 . ILE A 1 29 ? -3.048  4.588   -3.421  1.00 0.00 ? 29  ILE A HG12 3  
ATOM   1633  H  HG13 . ILE A 1 29 ? -3.629  3.552   -2.122  1.00 0.00 ? 29  ILE A HG13 3  
ATOM   1634  H  HG21 . ILE A 1 29 ? -3.108  6.978   -3.095  1.00 0.00 ? 29  ILE A HG21 3  
ATOM   1635  H  HG22 . ILE A 1 29 ? -2.601  7.613   -1.531  1.00 0.00 ? 29  ILE A HG22 3  
ATOM   1636  H  HG23 . ILE A 1 29 ? -1.519  6.567   -2.449  1.00 0.00 ? 29  ILE A HG23 3  
ATOM   1637  H  HD11 . ILE A 1 29 ? -5.751  4.728   -2.112  1.00 0.00 ? 29  ILE A HD11 3  
ATOM   1638  H  HD12 . ILE A 1 29 ? -5.171  5.810   -3.378  1.00 0.00 ? 29  ILE A HD12 3  
ATOM   1639  H  HD13 . ILE A 1 29 ? -5.389  4.092   -3.717  1.00 0.00 ? 29  ILE A HD13 3  
ATOM   1640  N  N    . ILE A 1 30 ? -2.031  6.317   1.349   1.00 0.00 ? 30  ILE A N    3  
ATOM   1641  C  CA   . ILE A 1 30 ? -1.474  7.330   2.237   1.00 0.00 ? 30  ILE A CA   3  
ATOM   1642  C  C    . ILE A 1 30 ? -0.208  6.825   2.920   1.00 0.00 ? 30  ILE A C    3  
ATOM   1643  O  O    . ILE A 1 30 ? 0.600   7.613   3.413   1.00 0.00 ? 30  ILE A O    3  
ATOM   1644  C  CB   . ILE A 1 30 ? -2.490  7.754   3.313   1.00 0.00 ? 30  ILE A CB   3  
ATOM   1645  C  CG1  . ILE A 1 30 ? -3.006  6.529   4.070   1.00 0.00 ? 30  ILE A CG1  3  
ATOM   1646  C  CG2  . ILE A 1 30 ? -3.644  8.518   2.681   1.00 0.00 ? 30  ILE A CG2  3  
ATOM   1647  C  CD1  . ILE A 1 30 ? -3.390  6.822   5.504   1.00 0.00 ? 30  ILE A CD1  3  
ATOM   1648  H  H    . ILE A 1 30 ? -2.887  5.898   1.578   1.00 0.00 ? 30  ILE A H    3  
ATOM   1649  H  HA   . ILE A 1 30 ? -1.228  8.197   1.640   1.00 0.00 ? 30  ILE A HA   3  
ATOM   1650  H  HB   . ILE A 1 30 ? -1.992  8.414   4.007   1.00 0.00 ? 30  ILE A HB   3  
ATOM   1651  H  HG12 . ILE A 1 30 ? -3.879  6.143   3.567   1.00 0.00 ? 30  ILE A HG12 3  
ATOM   1652  H  HG13 . ILE A 1 30 ? -2.236  5.771   4.080   1.00 0.00 ? 30  ILE A HG13 3  
ATOM   1653  H  HG21 . ILE A 1 30 ? -3.320  8.951   1.746   1.00 0.00 ? 30  ILE A HG21 3  
ATOM   1654  H  HG22 . ILE A 1 30 ? -4.465  7.841   2.497   1.00 0.00 ? 30  ILE A HG22 3  
ATOM   1655  H  HG23 . ILE A 1 30 ? -3.966  9.303   3.348   1.00 0.00 ? 30  ILE A HG23 3  
ATOM   1656  H  HD11 . ILE A 1 30 ? -2.506  6.790   6.126   1.00 0.00 ? 30  ILE A HD11 3  
ATOM   1657  H  HD12 . ILE A 1 30 ? -3.836  7.803   5.565   1.00 0.00 ? 30  ILE A HD12 3  
ATOM   1658  H  HD13 . ILE A 1 30 ? -4.097  6.082   5.847   1.00 0.00 ? 30  ILE A HD13 3  
ATOM   1659  N  N    . HIS A 1 31 ? -0.039  5.507   2.943   1.00 0.00 ? 31  HIS A N    3  
ATOM   1660  C  CA   . HIS A 1 31 ? 1.131   4.897   3.564   1.00 0.00 ? 31  HIS A CA   3  
ATOM   1661  C  C    . HIS A 1 31 ? 2.224   4.644   2.530   1.00 0.00 ? 31  HIS A C    3  
ATOM   1662  O  O    . HIS A 1 31 ? 3.406   4.874   2.791   1.00 0.00 ? 31  HIS A O    3  
ATOM   1663  C  CB   . HIS A 1 31 ? 0.746   3.584   4.247   1.00 0.00 ? 31  HIS A CB   3  
ATOM   1664  C  CG   . HIS A 1 31 ? 1.854   2.576   4.276   1.00 0.00 ? 31  HIS A CG   3  
ATOM   1665  N  ND1  . HIS A 1 31 ? 2.434   2.129   5.444   1.00 0.00 ? 31  HIS A ND1  3  
ATOM   1666  C  CD2  . HIS A 1 31 ? 2.486   1.927   3.270   1.00 0.00 ? 31  HIS A CD2  3  
ATOM   1667  C  CE1  . HIS A 1 31 ? 3.377   1.249   5.155   1.00 0.00 ? 31  HIS A CE1  3  
ATOM   1668  N  NE2  . HIS A 1 31 ? 3.428   1.109   3.843   1.00 0.00 ? 31  HIS A NE2  3  
ATOM   1669  H  H    . HIS A 1 31 ? -0.718  4.931   2.534   1.00 0.00 ? 31  HIS A H    3  
ATOM   1670  H  HA   . HIS A 1 31 ? 1.508   5.582   4.308   1.00 0.00 ? 31  HIS A HA   3  
ATOM   1671  H  HB2  . HIS A 1 31 ? 0.458   3.788   5.268   1.00 0.00 ? 31  HIS A HB2  3  
ATOM   1672  H  HB3  . HIS A 1 31 ? -0.090  3.145   3.723   1.00 0.00 ? 31  HIS A HB3  3  
ATOM   1673  H  HD1  . HIS A 1 31 ? 2.192   2.414   6.349   1.00 0.00 ? 31  HIS A HD1  3  
ATOM   1674  H  HD2  . HIS A 1 31 ? 2.287   2.034   2.213   1.00 0.00 ? 31  HIS A HD2  3  
ATOM   1675  H  HE1  . HIS A 1 31 ? 3.999   0.732   5.870   1.00 0.00 ? 31  HIS A HE1  3  
ATOM   1676  N  N    . THR A 1 32 ? 1.823   4.169   1.355   1.00 0.00 ? 32  THR A N    3  
ATOM   1677  C  CA   . THR A 1 32 ? 2.768   3.883   0.283   1.00 0.00 ? 32  THR A CA   3  
ATOM   1678  C  C    . THR A 1 32 ? 3.724   5.051   0.067   1.00 0.00 ? 32  THR A C    3  
ATOM   1679  O  O    . THR A 1 32 ? 4.817   4.879   -0.473  1.00 0.00 ? 32  THR A O    3  
ATOM   1680  C  CB   . THR A 1 32 ? 2.041   3.578   -1.040  1.00 0.00 ? 32  THR A CB   3  
ATOM   1681  O  OG1  . THR A 1 32 ? 2.935   2.929   -1.952  1.00 0.00 ? 32  THR A OG1  3  
ATOM   1682  C  CG2  . THR A 1 32 ? 1.505   4.855   -1.670  1.00 0.00 ? 32  THR A CG2  3  
ATOM   1683  H  H    . THR A 1 32 ? 0.868   4.007   1.208   1.00 0.00 ? 32  THR A H    3  
ATOM   1684  H  HA   . THR A 1 32 ? 3.339   3.011   0.566   1.00 0.00 ? 32  THR A HA   3  
ATOM   1685  H  HB   . THR A 1 32 ? 1.209   2.920   -0.833  1.00 0.00 ? 32  THR A HB   3  
ATOM   1686  H  HG1  . THR A 1 32 ? 3.840   3.168   -1.737  1.00 0.00 ? 32  THR A HG1  3  
ATOM   1687  H  HG21 . THR A 1 32 ? 2.100   5.106   -2.535  1.00 0.00 ? 32  THR A HG21 3  
ATOM   1688  H  HG22 . THR A 1 32 ? 1.557   5.660   -0.952  1.00 0.00 ? 32  THR A HG22 3  
ATOM   1689  H  HG23 . THR A 1 32 ? 0.478   4.704   -1.970  1.00 0.00 ? 32  THR A HG23 3  
ATOM   1690  N  N    . ARG A 1 33 ? 3.305   6.239   0.492   1.00 0.00 ? 33  ARG A N    3  
ATOM   1691  C  CA   . ARG A 1 33 ? 4.125   7.435   0.344   1.00 0.00 ? 33  ARG A CA   3  
ATOM   1692  C  C    . ARG A 1 33 ? 5.280   7.430   1.341   1.00 0.00 ? 33  ARG A C    3  
ATOM   1693  O  O    . ARG A 1 33 ? 6.373   7.913   1.045   1.00 0.00 ? 33  ARG A O    3  
ATOM   1694  C  CB   . ARG A 1 33 ? 3.272   8.691   0.541   1.00 0.00 ? 33  ARG A CB   3  
ATOM   1695  C  CG   . ARG A 1 33 ? 2.292   8.585   1.698   1.00 0.00 ? 33  ARG A CG   3  
ATOM   1696  C  CD   . ARG A 1 33 ? 1.857   9.958   2.186   1.00 0.00 ? 33  ARG A CD   3  
ATOM   1697  N  NE   . ARG A 1 33 ? 2.922   10.643  2.914   1.00 0.00 ? 33  ARG A NE   3  
ATOM   1698  C  CZ   . ARG A 1 33 ? 2.705   11.611  3.796   1.00 0.00 ? 33  ARG A CZ   3  
ATOM   1699  N  NH1  . ARG A 1 33 ? 1.467   12.007  4.060   1.00 0.00 ? 33  ARG A NH1  3  
ATOM   1700  N  NH2  . ARG A 1 33 ? 3.726   12.186  4.418   1.00 0.00 ? 33  ARG A NH2  3  
ATOM   1701  H  H    . ARG A 1 33 ? 2.424   6.312   0.915   1.00 0.00 ? 33  ARG A H    3  
ATOM   1702  H  HA   . ARG A 1 33 ? 4.529   7.439   -0.657  1.00 0.00 ? 33  ARG A HA   3  
ATOM   1703  H  HB2  . ARG A 1 33 ? 3.926   9.530   0.728   1.00 0.00 ? 33  ARG A HB2  3  
ATOM   1704  H  HB3  . ARG A 1 33 ? 2.712   8.875   -0.362  1.00 0.00 ? 33  ARG A HB3  3  
ATOM   1705  H  HG2  . ARG A 1 33 ? 1.419   8.040   1.369   1.00 0.00 ? 33  ARG A HG2  3  
ATOM   1706  H  HG3  . ARG A 1 33 ? 2.765   8.056   2.511   1.00 0.00 ? 33  ARG A HG3  3  
ATOM   1707  H  HD2  . ARG A 1 33 ? 1.575   10.557  1.333   1.00 0.00 ? 33  ARG A HD2  3  
ATOM   1708  H  HD3  . ARG A 1 33 ? 1.006   9.840   2.840   1.00 0.00 ? 33  ARG A HD3  3  
ATOM   1709  H  HE   . ARG A 1 33 ? 3.845   10.366  2.735   1.00 0.00 ? 33  ARG A HE   3  
ATOM   1710  H  HH11 . ARG A 1 33 ? 0.695   11.575  3.593   1.00 0.00 ? 33  ARG A HH11 3  
ATOM   1711  H  HH12 . ARG A 1 33 ? 1.306   12.736  4.725   1.00 0.00 ? 33  ARG A HH12 3  
ATOM   1712  H  HH21 . ARG A 1 33 ? 4.661   11.890  4.222   1.00 0.00 ? 33  ARG A HH21 3  
ATOM   1713  H  HH22 . ARG A 1 33 ? 3.562   12.915  5.082   1.00 0.00 ? 33  ARG A HH22 3  
ATOM   1714  N  N    . THR A 1 34 ? 5.030   6.882   2.526   1.00 0.00 ? 34  THR A N    3  
ATOM   1715  C  CA   . THR A 1 34 ? 6.047   6.815   3.568   1.00 0.00 ? 34  THR A CA   3  
ATOM   1716  C  C    . THR A 1 34 ? 7.302   6.109   3.066   1.00 0.00 ? 34  THR A C    3  
ATOM   1717  O  O    . THR A 1 34 ? 8.361   6.186   3.690   1.00 0.00 ? 34  THR A O    3  
ATOM   1718  C  CB   . THR A 1 34 ? 5.524   6.082   4.817   1.00 0.00 ? 34  THR A CB   3  
ATOM   1719  O  OG1  . THR A 1 34 ? 5.298   4.700   4.516   1.00 0.00 ? 34  THR A OG1  3  
ATOM   1720  C  CG2  . THR A 1 34 ? 4.234   6.715   5.316   1.00 0.00 ? 34  THR A CG2  3  
ATOM   1721  H  H    . THR A 1 34 ? 4.139   6.514   2.703   1.00 0.00 ? 34  THR A H    3  
ATOM   1722  H  HA   . THR A 1 34 ? 6.303   7.826   3.849   1.00 0.00 ? 34  THR A HA   3  
ATOM   1723  H  HB   . THR A 1 34 ? 6.269   6.155   5.597   1.00 0.00 ? 34  THR A HB   3  
ATOM   1724  H  HG1  . THR A 1 34 ? 4.735   4.314   5.191   1.00 0.00 ? 34  THR A HG1  3  
ATOM   1725  H  HG21 . THR A 1 34 ? 3.868   6.162   6.168   1.00 0.00 ? 34  THR A HG21 3  
ATOM   1726  H  HG22 . THR A 1 34 ? 3.495   6.694   4.529   1.00 0.00 ? 34  THR A HG22 3  
ATOM   1727  H  HG23 . THR A 1 34 ? 4.424   7.738   5.605   1.00 0.00 ? 34  THR A HG23 3  
ATOM   1728  N  N    . HIS A 1 35 ? 7.176   5.422   1.935   1.00 0.00 ? 35  HIS A N    3  
ATOM   1729  C  CA   . HIS A 1 35 ? 8.302   4.703   1.349   1.00 0.00 ? 35  HIS A CA   3  
ATOM   1730  C  C    . HIS A 1 35 ? 9.149   5.632   0.484   1.00 0.00 ? 35  HIS A C    3  
ATOM   1731  O  O    . HIS A 1 35 ? 9.964   5.178   -0.320  1.00 0.00 ? 35  HIS A O    3  
ATOM   1732  C  CB   . HIS A 1 35 ? 7.802   3.524   0.513   1.00 0.00 ? 35  HIS A CB   3  
ATOM   1733  C  CG   . HIS A 1 35 ? 7.277   2.387   1.334   1.00 0.00 ? 35  HIS A CG   3  
ATOM   1734  N  ND1  . HIS A 1 35 ? 8.093   1.439   1.915   1.00 0.00 ? 35  HIS A ND1  3  
ATOM   1735  C  CD2  . HIS A 1 35 ? 6.011   2.049   1.672   1.00 0.00 ? 35  HIS A CD2  3  
ATOM   1736  C  CE1  . HIS A 1 35 ? 7.351   0.567   2.574   1.00 0.00 ? 35  HIS A CE1  3  
ATOM   1737  N  NE2  . HIS A 1 35 ? 6.084   0.915   2.442   1.00 0.00 ? 35  HIS A NE2  3  
ATOM   1738  H  H    . HIS A 1 35 ? 6.307   5.398   1.484   1.00 0.00 ? 35  HIS A H    3  
ATOM   1739  H  HA   . HIS A 1 35 ? 8.912   4.327   2.156   1.00 0.00 ? 35  HIS A HA   3  
ATOM   1740  H  HB2  . HIS A 1 35 ? 7.005   3.862   -0.133  1.00 0.00 ? 35  HIS A HB2  3  
ATOM   1741  H  HB3  . HIS A 1 35 ? 8.615   3.150   -0.093  1.00 0.00 ? 35  HIS A HB3  3  
ATOM   1742  H  HD1  . HIS A 1 35 ? 9.070   1.410   1.853   1.00 0.00 ? 35  HIS A HD1  3  
ATOM   1743  H  HD2  . HIS A 1 35 ? 5.109   2.574   1.388   1.00 0.00 ? 35  HIS A HD2  3  
ATOM   1744  H  HE1  . HIS A 1 35 ? 7.717   -0.285  3.126   1.00 0.00 ? 35  HIS A HE1  3  
ATOM   1745  N  N    . THR A 1 36 ? 8.951   6.935   0.655   1.00 0.00 ? 36  THR A N    3  
ATOM   1746  C  CA   . THR A 1 36 ? 9.695   7.928   -0.111  1.00 0.00 ? 36  THR A CA   3  
ATOM   1747  C  C    . THR A 1 36 ? 11.111  8.089   0.429   1.00 0.00 ? 36  THR A C    3  
ATOM   1748  O  O    . THR A 1 36 ? 12.040  8.389   -0.320  1.00 0.00 ? 36  THR A O    3  
ATOM   1749  C  CB   . THR A 1 36 ? 8.990   9.298   -0.089  1.00 0.00 ? 36  THR A CB   3  
ATOM   1750  O  OG1  . THR A 1 36 ? 9.717   10.235  -0.890  1.00 0.00 ? 36  THR A OG1  3  
ATOM   1751  C  CG2  . THR A 1 36 ? 8.871   9.822   1.334   1.00 0.00 ? 36  THR A CG2  3  
ATOM   1752  H  H    . THR A 1 36 ? 8.287   7.235   1.311   1.00 0.00 ? 36  THR A H    3  
ATOM   1753  H  HA   . THR A 1 36 ? 9.746   7.589   -1.135  1.00 0.00 ? 36  THR A HA   3  
ATOM   1754  H  HB   . THR A 1 36 ? 7.996   9.181   -0.498  1.00 0.00 ? 36  THR A HB   3  
ATOM   1755  H  HG1  . THR A 1 36 ? 10.157  9.771   -1.606  1.00 0.00 ? 36  THR A HG1  3  
ATOM   1756  H  HG21 . THR A 1 36 ? 8.391   9.079   1.952   1.00 0.00 ? 36  THR A HG21 3  
ATOM   1757  H  HG22 . THR A 1 36 ? 8.282   10.728  1.336   1.00 0.00 ? 36  THR A HG22 3  
ATOM   1758  H  HG23 . THR A 1 36 ? 9.856   10.033  1.723   1.00 0.00 ? 36  THR A HG23 3  
ATOM   1759  N  N    . GLY A 1 37 ? 11.270  7.889   1.733   1.00 0.00 ? 37  GLY A N    3  
ATOM   1760  C  CA   . GLY A 1 37 ? 12.577  8.016   2.350   1.00 0.00 ? 37  GLY A CA   3  
ATOM   1761  C  C    . GLY A 1 37 ? 13.642  7.222   1.621   1.00 0.00 ? 37  GLY A C    3  
ATOM   1762  O  O    . GLY A 1 37 ? 14.677  7.766   1.238   1.00 0.00 ? 37  GLY A O    3  
ATOM   1763  H  H    . GLY A 1 37 ? 10.492  7.652   2.282   1.00 0.00 ? 37  GLY A H    3  
ATOM   1764  H  HA2  . GLY A 1 37 ? 12.860  9.058   2.356   1.00 0.00 ? 37  GLY A HA2  3  
ATOM   1765  H  HA3  . GLY A 1 37 ? 12.517  7.664   3.370   1.00 0.00 ? 37  GLY A HA3  3  
ATOM   1766  N  N    . GLU A 1 38 ? 13.389  5.930   1.430   1.00 0.00 ? 38  GLU A N    3  
ATOM   1767  C  CA   . GLU A 1 38 ? 14.336  5.060   0.744   1.00 0.00 ? 38  GLU A CA   3  
ATOM   1768  C  C    . GLU A 1 38 ? 14.665  5.601   -0.645  1.00 0.00 ? 38  GLU A C    3  
ATOM   1769  O  O    . GLU A 1 38 ? 15.820  5.893   -0.951  1.00 0.00 ? 38  GLU A O    3  
ATOM   1770  C  CB   . GLU A 1 38 ? 13.771  3.643   0.631   1.00 0.00 ? 38  GLU A CB   3  
ATOM   1771  C  CG   . GLU A 1 38 ? 14.679  2.684   -0.121  1.00 0.00 ? 38  GLU A CG   3  
ATOM   1772  C  CD   . GLU A 1 38 ? 15.882  2.256   0.697   1.00 0.00 ? 38  GLU A CD   3  
ATOM   1773  O  OE1  . GLU A 1 38 ? 16.282  3.013   1.605   1.00 0.00 ? 38  GLU A OE1  3  
ATOM   1774  O  OE2  . GLU A 1 38 ? 16.423  1.163   0.428   1.00 0.00 ? 38  GLU A OE2  3  
ATOM   1775  H  H    . GLU A 1 38 ? 12.546  5.555   1.759   1.00 0.00 ? 38  GLU A H    3  
ATOM   1776  H  HA   . GLU A 1 38 ? 15.243  5.030   1.329   1.00 0.00 ? 38  GLU A HA   3  
ATOM   1777  H  HB2  . GLU A 1 38 ? 13.613  3.251   1.625   1.00 0.00 ? 38  GLU A HB2  3  
ATOM   1778  H  HB3  . GLU A 1 38 ? 12.823  3.686   0.116   1.00 0.00 ? 38  GLU A HB3  3  
ATOM   1779  H  HG2  . GLU A 1 38 ? 14.112  1.804   -0.385  1.00 0.00 ? 38  GLU A HG2  3  
ATOM   1780  H  HG3  . GLU A 1 38 ? 15.028  3.169   -1.020  1.00 0.00 ? 38  GLU A HG3  3  
ATOM   1781  N  N    . SER A 1 39 ? 13.639  5.730   -1.480  1.00 0.00 ? 39  SER A N    3  
ATOM   1782  C  CA   . SER A 1 39 ? 13.818  6.230   -2.838  1.00 0.00 ? 39  SER A CA   3  
ATOM   1783  C  C    . SER A 1 39 ? 14.016  7.743   -2.837  1.00 0.00 ? 39  SER A C    3  
ATOM   1784  O  O    . SER A 1 39 ? 13.999  8.382   -1.786  1.00 0.00 ? 39  SER A O    3  
ATOM   1785  C  CB   . SER A 1 39 ? 12.611  5.863   -3.703  1.00 0.00 ? 39  SER A CB   3  
ATOM   1786  O  OG   . SER A 1 39 ? 11.418  6.419   -3.177  1.00 0.00 ? 39  SER A OG   3  
ATOM   1787  H  H    . SER A 1 39 ? 12.741  5.479   -1.177  1.00 0.00 ? 39  SER A H    3  
ATOM   1788  H  HA   . SER A 1 39 ? 14.701  5.764   -3.250  1.00 0.00 ? 39  SER A HA   3  
ATOM   1789  H  HB2  . SER A 1 39 ? 12.759  6.241   -4.703  1.00 0.00 ? 39  SER A HB2  3  
ATOM   1790  H  HB3  . SER A 1 39 ? 12.509  4.788   -3.736  1.00 0.00 ? 39  SER A HB3  3  
ATOM   1791  H  HG   . SER A 1 39 ? 11.519  6.557   -2.232  1.00 0.00 ? 39  SER A HG   3  
ATOM   1792  N  N    . GLY A 1 40 ? 14.204  8.310   -4.026  1.00 0.00 ? 40  GLY A N    3  
ATOM   1793  C  CA   . GLY A 1 40 ? 14.403  9.743   -4.141  1.00 0.00 ? 40  GLY A CA   3  
ATOM   1794  C  C    . GLY A 1 40 ? 14.444  10.208  -5.583  1.00 0.00 ? 40  GLY A C    3  
ATOM   1795  O  O    . GLY A 1 40 ? 15.504  10.516  -6.128  1.00 0.00 ? 40  GLY A O    3  
ATOM   1796  H  H    . GLY A 1 40 ? 14.208  7.750   -4.830  1.00 0.00 ? 40  GLY A H    3  
ATOM   1797  H  HA2  . GLY A 1 40 ? 13.596  10.249  -3.633  1.00 0.00 ? 40  GLY A HA2  3  
ATOM   1798  H  HA3  . GLY A 1 40 ? 15.336  10.005  -3.664  1.00 0.00 ? 40  GLY A HA3  3  
ATOM   1799  N  N    . PRO A 1 41 ? 13.268  10.263  -6.225  1.00 0.00 ? 41  PRO A N    3  
ATOM   1800  C  CA   . PRO A 1 41 ? 13.148  10.692  -7.621  1.00 0.00 ? 41  PRO A CA   3  
ATOM   1801  C  C    . PRO A 1 41 ? 13.424  12.182  -7.796  1.00 0.00 ? 41  PRO A C    3  
ATOM   1802  O  O    . PRO A 1 41 ? 12.819  13.018  -7.125  1.00 0.00 ? 41  PRO A O    3  
ATOM   1803  C  CB   . PRO A 1 41 ? 11.690  10.375  -7.966  1.00 0.00 ? 41  PRO A CB   3  
ATOM   1804  C  CG   . PRO A 1 41 ? 10.977  10.404  -6.658  1.00 0.00 ? 41  PRO A CG   3  
ATOM   1805  C  CD   . PRO A 1 41 ? 11.964  9.911   -5.637  1.00 0.00 ? 41  PRO A CD   3  
ATOM   1806  H  HA   . PRO A 1 41 ? 13.803  10.127  -8.268  1.00 0.00 ? 41  PRO A HA   3  
ATOM   1807  H  HB2  . PRO A 1 41 ? 11.306  11.125  -8.643  1.00 0.00 ? 41  PRO A HB2  3  
ATOM   1808  H  HB3  . PRO A 1 41 ? 11.629  9.400   -8.427  1.00 0.00 ? 41  PRO A HB3  3  
ATOM   1809  H  HG2  . PRO A 1 41 ? 10.672  11.414  -6.429  1.00 0.00 ? 41  PRO A HG2  3  
ATOM   1810  H  HG3  . PRO A 1 41 ? 10.118  9.750   -6.694  1.00 0.00 ? 41  PRO A HG3  3  
ATOM   1811  H  HD2  . PRO A 1 41 ? 11.817  10.418  -4.694  1.00 0.00 ? 41  PRO A HD2  3  
ATOM   1812  H  HD3  . PRO A 1 41 ? 11.875  8.842   -5.511  1.00 0.00 ? 41  PRO A HD3  3  
ATOM   1813  N  N    . SER A 1 42 ? 14.341  12.506  -8.702  1.00 0.00 ? 42  SER A N    3  
ATOM   1814  C  CA   . SER A 1 42 ? 14.700  13.896  -8.962  1.00 0.00 ? 42  SER A CA   3  
ATOM   1815  C  C    . SER A 1 42 ? 14.290  14.307  -10.373 1.00 0.00 ? 42  SER A C    3  
ATOM   1816  O  O    . SER A 1 42 ? 14.090  13.461  -11.245 1.00 0.00 ? 42  SER A O    3  
ATOM   1817  C  CB   . SER A 1 42 ? 16.204  14.099  -8.776  1.00 0.00 ? 42  SER A CB   3  
ATOM   1818  O  OG   . SER A 1 42 ? 16.933  13.533  -9.852  1.00 0.00 ? 42  SER A OG   3  
ATOM   1819  H  H    . SER A 1 42 ? 14.789  11.794  -9.205  1.00 0.00 ? 42  SER A H    3  
ATOM   1820  H  HA   . SER A 1 42 ? 14.171  14.513  -8.252  1.00 0.00 ? 42  SER A HA   3  
ATOM   1821  H  HB2  . SER A 1 42 ? 16.419  15.156  -8.729  1.00 0.00 ? 42  SER A HB2  3  
ATOM   1822  H  HB3  . SER A 1 42 ? 16.518  13.627  -7.856  1.00 0.00 ? 42  SER A HB3  3  
ATOM   1823  H  HG   . SER A 1 42 ? 16.765  12.588  -9.889  1.00 0.00 ? 42  SER A HG   3  
ATOM   1824  N  N    . SER A 1 43 ? 14.166  15.613  -10.590 1.00 0.00 ? 43  SER A N    3  
ATOM   1825  C  CA   . SER A 1 43 ? 13.777  16.138  -11.893 1.00 0.00 ? 43  SER A CA   3  
ATOM   1826  C  C    . SER A 1 43 ? 12.453  15.532  -12.349 1.00 0.00 ? 43  SER A C    3  
ATOM   1827  O  O    . SER A 1 43 ? 12.295  15.161  -13.511 1.00 0.00 ? 43  SER A O    3  
ATOM   1828  C  CB   . SER A 1 43 ? 14.866  15.851  -12.928 1.00 0.00 ? 43  SER A CB   3  
ATOM   1829  O  OG   . SER A 1 43 ? 14.518  16.384  -14.195 1.00 0.00 ? 43  SER A OG   3  
ATOM   1830  H  H    . SER A 1 43 ? 14.339  16.237  -9.854  1.00 0.00 ? 43  SER A H    3  
ATOM   1831  H  HA   . SER A 1 43 ? 13.656  17.207  -11.797 1.00 0.00 ? 43  SER A HA   3  
ATOM   1832  H  HB2  . SER A 1 43 ? 15.793  16.299  -12.605 1.00 0.00 ? 43  SER A HB2  3  
ATOM   1833  H  HB3  . SER A 1 43 ? 14.995  14.783  -13.023 1.00 0.00 ? 43  SER A HB3  3  
ATOM   1834  H  HG   . SER A 1 43 ? 13.905  17.113  -14.078 1.00 0.00 ? 43  SER A HG   3  
ATOM   1835  N  N    . GLY A 1 44 ? 11.503  15.436  -11.424 1.00 0.00 ? 44  GLY A N    3  
ATOM   1836  C  CA   . GLY A 1 44 ? 10.205  14.874  -11.749 1.00 0.00 ? 44  GLY A CA   3  
ATOM   1837  C  C    . GLY A 1 44 ? 9.873   13.657  -10.909 1.00 0.00 ? 44  GLY A C    3  
ATOM   1838  O  O    . GLY A 1 44 ? 9.021   12.866  -11.311 1.00 0.00 ? 44  GLY A O    3  
ATOM   1839  H  H    . GLY A 1 44 ? 11.685  15.748  -10.513 1.00 0.00 ? 44  GLY A H    3  
ATOM   1840  H  HA2  . GLY A 1 44 ? 9.448   15.628  -11.587 1.00 0.00 ? 44  GLY A HA2  3  
ATOM   1841  H  HA3  . GLY A 1 44 ? 10.199  14.590  -12.791 1.00 0.00 ? 44  GLY A HA3  3  
HETATM 1842  ZN ZN   . ZN  B 2 .  ? 4.571   -0.278  2.815   1.00 0.00 ? 181 ZN  A ZN   3  
ATOM   1843  N  N    . GLY A 1 1  ? 0.959   -33.456 -12.082 1.00 0.00 ? 1   GLY A N    4  
ATOM   1844  C  CA   . GLY A 1 1  ? 1.605   -32.342 -11.412 1.00 0.00 ? 1   GLY A CA   4  
ATOM   1845  C  C    . GLY A 1 1  ? 1.302   -32.304 -9.927  1.00 0.00 ? 1   GLY A C    4  
ATOM   1846  O  O    . GLY A 1 1  ? 0.911   -33.313 -9.340  1.00 0.00 ? 1   GLY A O    4  
ATOM   1847  H  H1   . GLY A 1 1  ? 0.640   -33.353 -13.003 1.00 0.00 ? 1   GLY A H1   4  
ATOM   1848  H  HA2  . GLY A 1 1  ? 2.673   -32.424 -11.549 1.00 0.00 ? 1   GLY A HA2  4  
ATOM   1849  H  HA3  . GLY A 1 1  ? 1.264   -31.421 -11.861 1.00 0.00 ? 1   GLY A HA3  4  
ATOM   1850  N  N    . SER A 1 2  ? 1.484   -31.137 -9.318  1.00 0.00 ? 2   SER A N    4  
ATOM   1851  C  CA   . SER A 1 2  ? 1.233   -30.972 -7.891  1.00 0.00 ? 2   SER A CA   4  
ATOM   1852  C  C    . SER A 1 2  ? 0.735   -29.563 -7.586  1.00 0.00 ? 2   SER A C    4  
ATOM   1853  O  O    . SER A 1 2  ? 1.201   -28.587 -8.173  1.00 0.00 ? 2   SER A O    4  
ATOM   1854  C  CB   . SER A 1 2  ? 2.505   -31.260 -7.091  1.00 0.00 ? 2   SER A CB   4  
ATOM   1855  O  OG   . SER A 1 2  ? 3.406   -30.168 -7.157  1.00 0.00 ? 2   SER A OG   4  
ATOM   1856  H  H    . SER A 1 2  ? 1.798   -30.369 -9.840  1.00 0.00 ? 2   SER A H    4  
ATOM   1857  H  HA   . SER A 1 2  ? 0.470   -31.681 -7.605  1.00 0.00 ? 2   SER A HA   4  
ATOM   1858  H  HB2  . SER A 1 2  ? 2.246   -31.435 -6.058  1.00 0.00 ? 2   SER A HB2  4  
ATOM   1859  H  HB3  . SER A 1 2  ? 2.990   -32.137 -7.495  1.00 0.00 ? 2   SER A HB3  4  
ATOM   1860  H  HG   . SER A 1 2  ? 3.954   -30.252 -7.941  1.00 0.00 ? 2   SER A HG   4  
ATOM   1861  N  N    . SER A 1 3  ? -0.217  -29.465 -6.663  1.00 0.00 ? 3   SER A N    4  
ATOM   1862  C  CA   . SER A 1 3  ? -0.783  -28.176 -6.281  1.00 0.00 ? 3   SER A CA   4  
ATOM   1863  C  C    . SER A 1 3  ? 0.317   -27.197 -5.883  1.00 0.00 ? 3   SER A C    4  
ATOM   1864  O  O    . SER A 1 3  ? 1.182   -27.515 -5.068  1.00 0.00 ? 3   SER A O    4  
ATOM   1865  C  CB   . SER A 1 3  ? -1.769  -28.351 -5.125  1.00 0.00 ? 3   SER A CB   4  
ATOM   1866  O  OG   . SER A 1 3  ? -3.022  -28.821 -5.591  1.00 0.00 ? 3   SER A OG   4  
ATOM   1867  H  H    . SER A 1 3  ? -0.548  -30.280 -6.230  1.00 0.00 ? 3   SER A H    4  
ATOM   1868  H  HA   . SER A 1 3  ? -1.309  -27.779 -7.136  1.00 0.00 ? 3   SER A HA   4  
ATOM   1869  H  HB2  . SER A 1 3  ? -1.371  -29.063 -4.420  1.00 0.00 ? 3   SER A HB2  4  
ATOM   1870  H  HB3  . SER A 1 3  ? -1.915  -27.400 -4.634  1.00 0.00 ? 3   SER A HB3  4  
ATOM   1871  H  HG   . SER A 1 3  ? -3.689  -28.144 -5.456  1.00 0.00 ? 3   SER A HG   4  
ATOM   1872  N  N    . GLY A 1 4  ? 0.277   -26.002 -6.465  1.00 0.00 ? 4   GLY A N    4  
ATOM   1873  C  CA   . GLY A 1 4  ? 1.275   -24.994 -6.159  1.00 0.00 ? 4   GLY A CA   4  
ATOM   1874  C  C    . GLY A 1 4  ? 0.695   -23.593 -6.136  1.00 0.00 ? 4   GLY A C    4  
ATOM   1875  O  O    . GLY A 1 4  ? -0.421  -23.368 -6.604  1.00 0.00 ? 4   GLY A O    4  
ATOM   1876  H  H    . GLY A 1 4  ? -0.436  -25.804 -7.108  1.00 0.00 ? 4   GLY A H    4  
ATOM   1877  H  HA2  . GLY A 1 4  ? 1.705   -25.210 -5.193  1.00 0.00 ? 4   GLY A HA2  4  
ATOM   1878  H  HA3  . GLY A 1 4  ? 2.053   -25.036 -6.907  1.00 0.00 ? 4   GLY A HA3  4  
ATOM   1879  N  N    . SER A 1 5  ? 1.455   -22.650 -5.589  1.00 0.00 ? 5   SER A N    4  
ATOM   1880  C  CA   . SER A 1 5  ? 1.008   -21.264 -5.501  1.00 0.00 ? 5   SER A CA   4  
ATOM   1881  C  C    . SER A 1 5  ? 0.398   -20.805 -6.823  1.00 0.00 ? 5   SER A C    4  
ATOM   1882  O  O    . SER A 1 5  ? 0.981   -21.003 -7.889  1.00 0.00 ? 5   SER A O    4  
ATOM   1883  C  CB   . SER A 1 5  ? 2.176   -20.352 -5.121  1.00 0.00 ? 5   SER A CB   4  
ATOM   1884  O  OG   . SER A 1 5  ? 2.719   -20.717 -3.864  1.00 0.00 ? 5   SER A OG   4  
ATOM   1885  H  H    . SER A 1 5  ? 2.336   -22.891 -5.233  1.00 0.00 ? 5   SER A H    4  
ATOM   1886  H  HA   . SER A 1 5  ? 0.253   -21.208 -4.731  1.00 0.00 ? 5   SER A HA   4  
ATOM   1887  H  HB2  . SER A 1 5  ? 2.949   -20.430 -5.870  1.00 0.00 ? 5   SER A HB2  4  
ATOM   1888  H  HB3  . SER A 1 5  ? 1.828   -19.331 -5.067  1.00 0.00 ? 5   SER A HB3  4  
ATOM   1889  H  HG   . SER A 1 5  ? 2.058   -20.589 -3.180  1.00 0.00 ? 5   SER A HG   4  
ATOM   1890  N  N    . SER A 1 6  ? -0.778  -20.192 -6.743  1.00 0.00 ? 6   SER A N    4  
ATOM   1891  C  CA   . SER A 1 6  ? -1.469  -19.707 -7.932  1.00 0.00 ? 6   SER A CA   4  
ATOM   1892  C  C    . SER A 1 6  ? -1.595  -18.187 -7.906  1.00 0.00 ? 6   SER A C    4  
ATOM   1893  O  O    . SER A 1 6  ? -1.344  -17.515 -8.906  1.00 0.00 ? 6   SER A O    4  
ATOM   1894  C  CB   . SER A 1 6  ? -2.857  -20.343 -8.036  1.00 0.00 ? 6   SER A CB   4  
ATOM   1895  O  OG   . SER A 1 6  ? -3.684  -19.940 -6.958  1.00 0.00 ? 6   SER A OG   4  
ATOM   1896  H  H    . SER A 1 6  ? -1.192  -20.064 -5.864  1.00 0.00 ? 6   SER A H    4  
ATOM   1897  H  HA   . SER A 1 6  ? -0.886  -19.994 -8.794  1.00 0.00 ? 6   SER A HA   4  
ATOM   1898  H  HB2  . SER A 1 6  ? -3.320  -20.041 -8.962  1.00 0.00 ? 6   SER A HB2  4  
ATOM   1899  H  HB3  . SER A 1 6  ? -2.759  -21.419 -8.016  1.00 0.00 ? 6   SER A HB3  4  
ATOM   1900  H  HG   . SER A 1 6  ? -3.784  -18.985 -6.971  1.00 0.00 ? 6   SER A HG   4  
ATOM   1901  N  N    . GLY A 1 7  ? -1.985  -17.651 -6.754  1.00 0.00 ? 7   GLY A N    4  
ATOM   1902  C  CA   . GLY A 1 7  ? -2.138  -16.215 -6.617  1.00 0.00 ? 7   GLY A CA   4  
ATOM   1903  C  C    . GLY A 1 7  ? -0.982  -15.577 -5.873  1.00 0.00 ? 7   GLY A C    4  
ATOM   1904  O  O    . GLY A 1 7  ? -1.101  -15.244 -4.693  1.00 0.00 ? 7   GLY A O    4  
ATOM   1905  H  H    . GLY A 1 7  ? -2.171  -18.236 -5.990  1.00 0.00 ? 7   GLY A H    4  
ATOM   1906  H  HA2  . GLY A 1 7  ? -2.205  -15.776 -7.602  1.00 0.00 ? 7   GLY A HA2  4  
ATOM   1907  H  HA3  . GLY A 1 7  ? -3.053  -16.011 -6.081  1.00 0.00 ? 7   GLY A HA3  4  
ATOM   1908  N  N    . THR A 1 8  ? 0.142   -15.406 -6.562  1.00 0.00 ? 8   THR A N    4  
ATOM   1909  C  CA   . THR A 1 8  ? 1.325   -14.806 -5.958  1.00 0.00 ? 8   THR A CA   4  
ATOM   1910  C  C    . THR A 1 8  ? 0.964   -13.555 -5.166  1.00 0.00 ? 8   THR A C    4  
ATOM   1911  O  O    . THR A 1 8  ? 1.543   -13.285 -4.115  1.00 0.00 ? 8   THR A O    4  
ATOM   1912  C  CB   . THR A 1 8  ? 2.375   -14.441 -7.024  1.00 0.00 ? 8   THR A CB   4  
ATOM   1913  O  OG1  . THR A 1 8  ? 1.771   -13.659 -8.060  1.00 0.00 ? 8   THR A OG1  4  
ATOM   1914  C  CG2  . THR A 1 8  ? 2.997   -15.693 -7.624  1.00 0.00 ? 8   THR A CG2  4  
ATOM   1915  H  H    . THR A 1 8  ? 0.174   -15.691 -7.499  1.00 0.00 ? 8   THR A H    4  
ATOM   1916  H  HA   . THR A 1 8  ? 1.761   -15.532 -5.287  1.00 0.00 ? 8   THR A HA   4  
ATOM   1917  H  HB   . THR A 1 8  ? 3.156   -13.860 -6.554  1.00 0.00 ? 8   THR A HB   4  
ATOM   1918  H  HG1  . THR A 1 8  ? 2.253   -13.787 -8.881  1.00 0.00 ? 8   THR A HG1  4  
ATOM   1919  H  HG21 . THR A 1 8  ? 2.335   -16.099 -8.373  1.00 0.00 ? 8   THR A HG21 4  
ATOM   1920  H  HG22 . THR A 1 8  ? 3.152   -16.426 -6.846  1.00 0.00 ? 8   THR A HG22 4  
ATOM   1921  H  HG23 . THR A 1 8  ? 3.944   -15.443 -8.077  1.00 0.00 ? 8   THR A HG23 4  
ATOM   1922  N  N    . GLY A 1 9  ? 0.002   -12.793 -5.678  1.00 0.00 ? 9   GLY A N    4  
ATOM   1923  C  CA   . GLY A 1 9  ? -0.420  -11.579 -5.005  1.00 0.00 ? 9   GLY A CA   4  
ATOM   1924  C  C    . GLY A 1 9  ? -1.928  -11.431 -4.967  1.00 0.00 ? 9   GLY A C    4  
ATOM   1925  O  O    . GLY A 1 9  ? -2.521  -10.823 -5.858  1.00 0.00 ? 9   GLY A O    4  
ATOM   1926  H  H    . GLY A 1 9  ? -0.424  -13.057 -6.520  1.00 0.00 ? 9   GLY A H    4  
ATOM   1927  H  HA2  . GLY A 1 9  ? -0.044  -11.592 -3.993  1.00 0.00 ? 9   GLY A HA2  4  
ATOM   1928  H  HA3  . GLY A 1 9  ? 0.001   -10.729 -5.523  1.00 0.00 ? 9   GLY A HA3  4  
ATOM   1929  N  N    . MET A 1 10 ? -2.550  -11.988 -3.934  1.00 0.00 ? 10  MET A N    4  
ATOM   1930  C  CA   . MET A 1 10 ? -3.998  -11.916 -3.784  1.00 0.00 ? 10  MET A CA   4  
ATOM   1931  C  C    . MET A 1 10 ? -4.378  -11.088 -2.561  1.00 0.00 ? 10  MET A C    4  
ATOM   1932  O  O    . MET A 1 10 ? -5.308  -11.430 -1.830  1.00 0.00 ? 10  MET A O    4  
ATOM   1933  C  CB   . MET A 1 10 ? -4.592  -13.321 -3.668  1.00 0.00 ? 10  MET A CB   4  
ATOM   1934  C  CG   . MET A 1 10 ? -4.538  -14.113 -4.964  1.00 0.00 ? 10  MET A CG   4  
ATOM   1935  S  SD   . MET A 1 10 ? -5.320  -15.731 -4.822  1.00 0.00 ? 10  MET A SD   4  
ATOM   1936  C  CE   . MET A 1 10 ? -6.586  -15.607 -6.084  1.00 0.00 ? 10  MET A CE   4  
ATOM   1937  H  H    . MET A 1 10 ? -2.023  -12.460 -3.255  1.00 0.00 ? 10  MET A H    4  
ATOM   1938  H  HA   . MET A 1 10 ? -4.399  -11.438 -4.666  1.00 0.00 ? 10  MET A HA   4  
ATOM   1939  H  HB2  . MET A 1 10 ? -4.046  -13.868 -2.913  1.00 0.00 ? 10  MET A HB2  4  
ATOM   1940  H  HB3  . MET A 1 10 ? -5.625  -13.239 -3.364  1.00 0.00 ? 10  MET A HB3  4  
ATOM   1941  H  HG2  . MET A 1 10 ? -5.043  -13.552 -5.735  1.00 0.00 ? 10  MET A HG2  4  
ATOM   1942  H  HG3  . MET A 1 10 ? -3.503  -14.251 -5.241  1.00 0.00 ? 10  MET A HG3  4  
ATOM   1943  H  HE1  . MET A 1 10 ? -6.403  -16.346 -6.850  1.00 0.00 ? 10  MET A HE1  4  
ATOM   1944  H  HE2  . MET A 1 10 ? -7.555  -15.781 -5.640  1.00 0.00 ? 10  MET A HE2  4  
ATOM   1945  H  HE3  . MET A 1 10 ? -6.562  -14.620 -6.521  1.00 0.00 ? 10  MET A HE3  4  
ATOM   1946  N  N    . LYS A 1 11 ? -3.652  -9.997  -2.342  1.00 0.00 ? 11  LYS A N    4  
ATOM   1947  C  CA   . LYS A 1 11 ? -3.912  -9.119  -1.207  1.00 0.00 ? 11  LYS A CA   4  
ATOM   1948  C  C    . LYS A 1 11 ? -4.825  -7.965  -1.610  1.00 0.00 ? 11  LYS A C    4  
ATOM   1949  O  O    . LYS A 1 11 ? -4.730  -7.422  -2.711  1.00 0.00 ? 11  LYS A O    4  
ATOM   1950  C  CB   . LYS A 1 11 ? -2.597  -8.570  -0.648  1.00 0.00 ? 11  LYS A CB   4  
ATOM   1951  C  CG   . LYS A 1 11 ? -1.961  -9.468  0.399   1.00 0.00 ? 11  LYS A CG   4  
ATOM   1952  C  CD   . LYS A 1 11 ? -0.480  -9.170  0.563   1.00 0.00 ? 11  LYS A CD   4  
ATOM   1953  C  CE   . LYS A 1 11 ? 0.326   -9.678  -0.624  1.00 0.00 ? 11  LYS A CE   4  
ATOM   1954  N  NZ   . LYS A 1 11 ? 0.795   -11.076 -0.418  1.00 0.00 ? 11  LYS A NZ   4  
ATOM   1955  H  H    . LYS A 1 11 ? -2.923  -9.776  -2.960  1.00 0.00 ? 11  LYS A H    4  
ATOM   1956  H  HA   . LYS A 1 11 ? -4.403  -9.701  -0.443  1.00 0.00 ? 11  LYS A HA   4  
ATOM   1957  H  HB2  . LYS A 1 11 ? -1.897  -8.448  -1.461  1.00 0.00 ? 11  LYS A HB2  4  
ATOM   1958  H  HB3  . LYS A 1 11 ? -2.786  -7.606  -0.199  1.00 0.00 ? 11  LYS A HB3  4  
ATOM   1959  H  HG2  . LYS A 1 11 ? -2.455  -9.309  1.346   1.00 0.00 ? 11  LYS A HG2  4  
ATOM   1960  H  HG3  . LYS A 1 11 ? -2.080  -10.499 0.097   1.00 0.00 ? 11  LYS A HG3  4  
ATOM   1961  H  HD2  . LYS A 1 11 ? -0.343  -8.102  0.645   1.00 0.00 ? 11  LYS A HD2  4  
ATOM   1962  H  HD3  . LYS A 1 11 ? -0.122  -9.651  1.462   1.00 0.00 ? 11  LYS A HD3  4  
ATOM   1963  H  HE2  . LYS A 1 11 ? -0.296  -9.642  -1.505  1.00 0.00 ? 11  LYS A HE2  4  
ATOM   1964  H  HE3  . LYS A 1 11 ? 1.183   -9.036  -0.761  1.00 0.00 ? 11  LYS A HE3  4  
ATOM   1965  H  HZ1  . LYS A 1 11 ? 1.125   -11.478 -1.318  1.00 0.00 ? 11  LYS A HZ1  4  
ATOM   1966  H  HZ2  . LYS A 1 11 ? 0.018   -11.663 -0.052  1.00 0.00 ? 11  LYS A HZ2  4  
ATOM   1967  H  HZ3  . LYS A 1 11 ? 1.578   -11.093 0.266   1.00 0.00 ? 11  LYS A HZ3  4  
ATOM   1968  N  N    . PRO A 1 12 ? -5.731  -7.580  -0.699  1.00 0.00 ? 12  PRO A N    4  
ATOM   1969  C  CA   . PRO A 1 12 ? -6.678  -6.486  -0.936  1.00 0.00 ? 12  PRO A CA   4  
ATOM   1970  C  C    . PRO A 1 12 ? -5.992  -5.125  -0.974  1.00 0.00 ? 12  PRO A C    4  
ATOM   1971  O  O    . PRO A 1 12 ? -5.554  -4.668  -2.030  1.00 0.00 ? 12  PRO A O    4  
ATOM   1972  C  CB   . PRO A 1 12 ? -7.628  -6.574  0.260   1.00 0.00 ? 12  PRO A CB   4  
ATOM   1973  C  CG   . PRO A 1 12 ? -6.828  -7.228  1.333   1.00 0.00 ? 12  PRO A CG   4  
ATOM   1974  C  CD   . PRO A 1 12 ? -5.901  -8.183  0.634   1.00 0.00 ? 12  PRO A CD   4  
ATOM   1975  H  HA   . PRO A 1 12 ? -7.233  -6.634  -1.851  1.00 0.00 ? 12  PRO A HA   4  
ATOM   1976  H  HB2  . PRO A 1 12 ? -7.940  -5.580  0.549   1.00 0.00 ? 12  PRO A HB2  4  
ATOM   1977  H  HB3  . PRO A 1 12 ? -8.492  -7.165  -0.004  1.00 0.00 ? 12  PRO A HB3  4  
ATOM   1978  H  HG2  . PRO A 1 12 ? -6.263  -6.485  1.874   1.00 0.00 ? 12  PRO A HG2  4  
ATOM   1979  H  HG3  . PRO A 1 12 ? -7.483  -7.765  2.003   1.00 0.00 ? 12  PRO A HG3  4  
ATOM   1980  H  HD2  . PRO A 1 12 ? -4.956  -8.241  1.154   1.00 0.00 ? 12  PRO A HD2  4  
ATOM   1981  H  HD3  . PRO A 1 12 ? -6.353  -9.161  0.559   1.00 0.00 ? 12  PRO A HD3  4  
ATOM   1982  N  N    . TYR A 1 13 ? -5.903  -4.481  0.185   1.00 0.00 ? 13  TYR A N    4  
ATOM   1983  C  CA   . TYR A 1 13 ? -5.272  -3.170  0.284   1.00 0.00 ? 13  TYR A CA   4  
ATOM   1984  C  C    . TYR A 1 13 ? -3.934  -3.263  1.012   1.00 0.00 ? 13  TYR A C    4  
ATOM   1985  O  O    . TYR A 1 13 ? -3.407  -2.261  1.496   1.00 0.00 ? 13  TYR A O    4  
ATOM   1986  C  CB   . TYR A 1 13 ? -6.194  -2.191  1.011   1.00 0.00 ? 13  TYR A CB   4  
ATOM   1987  C  CG   . TYR A 1 13 ? -7.661  -2.537  0.890   1.00 0.00 ? 13  TYR A CG   4  
ATOM   1988  C  CD1  . TYR A 1 13 ? -8.216  -3.569  1.636   1.00 0.00 ? 13  TYR A CD1  4  
ATOM   1989  C  CD2  . TYR A 1 13 ? -8.493  -1.830  0.030   1.00 0.00 ? 13  TYR A CD2  4  
ATOM   1990  C  CE1  . TYR A 1 13 ? -9.555  -3.890  1.528   1.00 0.00 ? 13  TYR A CE1  4  
ATOM   1991  C  CE2  . TYR A 1 13 ? -9.834  -2.143  -0.083  1.00 0.00 ? 13  TYR A CE2  4  
ATOM   1992  C  CZ   . TYR A 1 13 ? -10.360 -3.173  0.667   1.00 0.00 ? 13  TYR A CZ   4  
ATOM   1993  O  OH   . TYR A 1 13 ? -11.695 -3.488  0.558   1.00 0.00 ? 13  TYR A OH   4  
ATOM   1994  H  H    . TYR A 1 13 ? -6.271  -4.896  0.992   1.00 0.00 ? 13  TYR A H    4  
ATOM   1995  H  HA   . TYR A 1 13 ? -5.099  -2.809  -0.719  1.00 0.00 ? 13  TYR A HA   4  
ATOM   1996  H  HB2  . TYR A 1 13 ? -5.942  -2.180  2.060   1.00 0.00 ? 13  TYR A HB2  4  
ATOM   1997  H  HB3  . TYR A 1 13 ? -6.052  -1.201  0.602   1.00 0.00 ? 13  TYR A HB3  4  
ATOM   1998  H  HD1  . TYR A 1 13 ? -7.582  -4.128  2.310   1.00 0.00 ? 13  TYR A HD1  4  
ATOM   1999  H  HD2  . TYR A 1 13 ? -8.078  -1.024  -0.557  1.00 0.00 ? 13  TYR A HD2  4  
ATOM   2000  H  HE1  . TYR A 1 13 ? -9.967  -4.696  2.116   1.00 0.00 ? 13  TYR A HE1  4  
ATOM   2001  H  HE2  . TYR A 1 13 ? -10.465 -1.582  -0.758  1.00 0.00 ? 13  TYR A HE2  4  
ATOM   2002  H  HH   . TYR A 1 13 ? -11.854 -4.349  0.953   1.00 0.00 ? 13  TYR A HH   4  
ATOM   2003  N  N    . VAL A 1 14 ? -3.390  -4.473  1.084   1.00 0.00 ? 14  VAL A N    4  
ATOM   2004  C  CA   . VAL A 1 14 ? -2.113  -4.699  1.751   1.00 0.00 ? 14  VAL A CA   4  
ATOM   2005  C  C    . VAL A 1 14 ? -0.951  -4.220  0.889   1.00 0.00 ? 14  VAL A C    4  
ATOM   2006  O  O    . VAL A 1 14 ? -0.988  -4.326  -0.337  1.00 0.00 ? 14  VAL A O    4  
ATOM   2007  C  CB   . VAL A 1 14 ? -1.910  -6.188  2.086   1.00 0.00 ? 14  VAL A CB   4  
ATOM   2008  C  CG1  . VAL A 1 14 ? -0.747  -6.365  3.050   1.00 0.00 ? 14  VAL A CG1  4  
ATOM   2009  C  CG2  . VAL A 1 14 ? -3.186  -6.783  2.662   1.00 0.00 ? 14  VAL A CG2  4  
ATOM   2010  H  H    . VAL A 1 14 ? -3.858  -5.233  0.679   1.00 0.00 ? 14  VAL A H    4  
ATOM   2011  H  HA   . VAL A 1 14 ? -2.116  -4.141  2.676   1.00 0.00 ? 14  VAL A HA   4  
ATOM   2012  H  HB   . VAL A 1 14 ? -1.674  -6.713  1.172   1.00 0.00 ? 14  VAL A HB   4  
ATOM   2013  H  HG11 . VAL A 1 14 ? -1.092  -6.207  4.062   1.00 0.00 ? 14  VAL A HG11 4  
ATOM   2014  H  HG12 . VAL A 1 14 ? -0.350  -7.365  2.956   1.00 0.00 ? 14  VAL A HG12 4  
ATOM   2015  H  HG13 . VAL A 1 14 ? 0.025   -5.647  2.818   1.00 0.00 ? 14  VAL A HG13 4  
ATOM   2016  H  HG21 . VAL A 1 14 ? -4.023  -6.144  2.422   1.00 0.00 ? 14  VAL A HG21 4  
ATOM   2017  H  HG22 . VAL A 1 14 ? -3.349  -7.763  2.239   1.00 0.00 ? 14  VAL A HG22 4  
ATOM   2018  H  HG23 . VAL A 1 14 ? -3.094  -6.865  3.736   1.00 0.00 ? 14  VAL A HG23 4  
ATOM   2019  N  N    . CYS A 1 15 ? 0.082   -3.692  1.538   1.00 0.00 ? 15  CYS A N    4  
ATOM   2020  C  CA   . CYS A 1 15 ? 1.257   -3.197  0.831   1.00 0.00 ? 15  CYS A CA   4  
ATOM   2021  C  C    . CYS A 1 15 ? 2.034   -4.346  0.195   1.00 0.00 ? 15  CYS A C    4  
ATOM   2022  O  O    . CYS A 1 15 ? 2.480   -5.263  0.883   1.00 0.00 ? 15  CYS A O    4  
ATOM   2023  C  CB   . CYS A 1 15 ? 2.164   -2.422  1.789   1.00 0.00 ? 15  CYS A CB   4  
ATOM   2024  S  SG   . CYS A 1 15 ? 3.120   -1.090  0.994   1.00 0.00 ? 15  CYS A SG   4  
ATOM   2025  H  H    . CYS A 1 15 ? 0.053   -3.635  2.516   1.00 0.00 ? 15  CYS A H    4  
ATOM   2026  H  HA   . CYS A 1 15 ? 0.919   -2.531  0.051   1.00 0.00 ? 15  CYS A HA   4  
ATOM   2027  H  HB2  . CYS A 1 15 ? 1.558   -1.973  2.562   1.00 0.00 ? 15  CYS A HB2  4  
ATOM   2028  H  HB3  . CYS A 1 15 ? 2.866   -3.106  2.241   1.00 0.00 ? 15  CYS A HB3  4  
ATOM   2029  N  N    . ASN A 1 16 ? 2.192   -4.287  -1.123  1.00 0.00 ? 16  ASN A N    4  
ATOM   2030  C  CA   . ASN A 1 16 ? 2.915   -5.322  -1.853  1.00 0.00 ? 16  ASN A CA   4  
ATOM   2031  C  C    . ASN A 1 16 ? 4.417   -5.053  -1.834  1.00 0.00 ? 16  ASN A C    4  
ATOM   2032  O  O    . ASN A 1 16 ? 5.136   -5.431  -2.758  1.00 0.00 ? 16  ASN A O    4  
ATOM   2033  C  CB   . ASN A 1 16 ? 2.418   -5.399  -3.298  1.00 0.00 ? 16  ASN A CB   4  
ATOM   2034  C  CG   . ASN A 1 16 ? 0.958   -5.801  -3.386  1.00 0.00 ? 16  ASN A CG   4  
ATOM   2035  O  OD1  . ASN A 1 16 ? 0.636   -6.946  -3.703  1.00 0.00 ? 16  ASN A OD1  4  
ATOM   2036  N  ND2  . ASN A 1 16 ? 0.067   -4.857  -3.105  1.00 0.00 ? 16  ASN A ND2  4  
ATOM   2037  H  H    . ASN A 1 16 ? 1.814   -3.530  -1.617  1.00 0.00 ? 16  ASN A H    4  
ATOM   2038  H  HA   . ASN A 1 16 ? 2.724   -6.266  -1.365  1.00 0.00 ? 16  ASN A HA   4  
ATOM   2039  H  HB2  . ASN A 1 16 ? 2.533   -4.431  -3.764  1.00 0.00 ? 16  ASN A HB2  4  
ATOM   2040  H  HB3  . ASN A 1 16 ? 3.006   -6.126  -3.837  1.00 0.00 ? 16  ASN A HB3  4  
ATOM   2041  H  HD21 . ASN A 1 16 ? 0.396   -3.967  -2.860  1.00 0.00 ? 16  ASN A HD21 4  
ATOM   2042  H  HD22 . ASN A 1 16 ? -0.884  -5.090  -3.153  1.00 0.00 ? 16  ASN A HD22 4  
ATOM   2043  N  N    . GLU A 1 17 ? 4.882   -4.398  -0.775  1.00 0.00 ? 17  GLU A N    4  
ATOM   2044  C  CA   . GLU A 1 17 ? 6.298   -4.079  -0.637  1.00 0.00 ? 17  GLU A CA   4  
ATOM   2045  C  C    . GLU A 1 17 ? 6.803   -4.438  0.757   1.00 0.00 ? 17  GLU A C    4  
ATOM   2046  O  O    . GLU A 1 17 ? 7.915   -4.944  0.916   1.00 0.00 ? 17  GLU A O    4  
ATOM   2047  C  CB   . GLU A 1 17 ? 6.538   -2.592  -0.911  1.00 0.00 ? 17  GLU A CB   4  
ATOM   2048  C  CG   . GLU A 1 17 ? 5.898   -2.100  -2.198  1.00 0.00 ? 17  GLU A CG   4  
ATOM   2049  C  CD   . GLU A 1 17 ? 6.822   -2.228  -3.394  1.00 0.00 ? 17  GLU A CD   4  
ATOM   2050  O  OE1  . GLU A 1 17 ? 6.989   -3.359  -3.896  1.00 0.00 ? 17  GLU A OE1  4  
ATOM   2051  O  OE2  . GLU A 1 17 ? 7.376   -1.196  -3.828  1.00 0.00 ? 17  GLU A OE2  4  
ATOM   2052  H  H    . GLU A 1 17 ? 4.259   -4.123  -0.071  1.00 0.00 ? 17  GLU A H    4  
ATOM   2053  H  HA   . GLU A 1 17 ? 6.842   -4.661  -1.365  1.00 0.00 ? 17  GLU A HA   4  
ATOM   2054  H  HB2  . GLU A 1 17 ? 6.134   -2.018  -0.090  1.00 0.00 ? 17  GLU A HB2  4  
ATOM   2055  H  HB3  . GLU A 1 17 ? 7.602   -2.417  -0.972  1.00 0.00 ? 17  GLU A HB3  4  
ATOM   2056  H  HG2  . GLU A 1 17 ? 5.007   -2.679  -2.387  1.00 0.00 ? 17  GLU A HG2  4  
ATOM   2057  H  HG3  . GLU A 1 17 ? 5.631   -1.060  -2.078  1.00 0.00 ? 17  GLU A HG3  4  
ATOM   2058  N  N    . CYS A 1 18 ? 5.979   -4.173  1.765   1.00 0.00 ? 18  CYS A N    4  
ATOM   2059  C  CA   . CYS A 1 18 ? 6.341   -4.466  3.147   1.00 0.00 ? 18  CYS A CA   4  
ATOM   2060  C  C    . CYS A 1 18 ? 5.359   -5.456  3.767   1.00 0.00 ? 18  CYS A C    4  
ATOM   2061  O  O    . CYS A 1 18 ? 5.740   -6.298  4.580   1.00 0.00 ? 18  CYS A O    4  
ATOM   2062  C  CB   . CYS A 1 18 ? 6.373   -3.178  3.972   1.00 0.00 ? 18  CYS A CB   4  
ATOM   2063  S  SG   . CYS A 1 18 ? 4.798   -2.264  3.985   1.00 0.00 ? 18  CYS A SG   4  
ATOM   2064  H  H    . CYS A 1 18 ? 5.106   -3.769  1.576   1.00 0.00 ? 18  CYS A H    4  
ATOM   2065  H  HA   . CYS A 1 18 ? 7.326   -4.907  3.146   1.00 0.00 ? 18  CYS A HA   4  
ATOM   2066  H  HB2  . CYS A 1 18 ? 6.618   -3.422  4.996   1.00 0.00 ? 18  CYS A HB2  4  
ATOM   2067  H  HB3  . CYS A 1 18 ? 7.132   -2.522  3.572   1.00 0.00 ? 18  CYS A HB3  4  
ATOM   2068  N  N    . GLY A 1 19 ? 4.093   -5.349  3.377   1.00 0.00 ? 19  GLY A N    4  
ATOM   2069  C  CA   . GLY A 1 19 ? 3.076   -6.241  3.904   1.00 0.00 ? 19  GLY A CA   4  
ATOM   2070  C  C    . GLY A 1 19 ? 2.118   -5.536  4.844   1.00 0.00 ? 19  GLY A C    4  
ATOM   2071  O  O    . GLY A 1 19 ? 1.469   -6.173  5.674   1.00 0.00 ? 19  GLY A O    4  
ATOM   2072  H  H    . GLY A 1 19 ? 3.846   -4.659  2.726   1.00 0.00 ? 19  GLY A H    4  
ATOM   2073  H  HA2  . GLY A 1 19 ? 2.516   -6.657  3.080   1.00 0.00 ? 19  GLY A HA2  4  
ATOM   2074  H  HA3  . GLY A 1 19 ? 3.561   -7.044  4.439   1.00 0.00 ? 19  GLY A HA3  4  
ATOM   2075  N  N    . LYS A 1 20 ? 2.028   -4.217  4.715   1.00 0.00 ? 20  LYS A N    4  
ATOM   2076  C  CA   . LYS A 1 20 ? 1.143   -3.424  5.559   1.00 0.00 ? 20  LYS A CA   4  
ATOM   2077  C  C    . LYS A 1 20 ? -0.314  -3.608  5.145   1.00 0.00 ? 20  LYS A C    4  
ATOM   2078  O  O    . LYS A 1 20 ? -0.724  -3.169  4.071   1.00 0.00 ? 20  LYS A O    4  
ATOM   2079  C  CB   . LYS A 1 20 ? 1.522   -1.943  5.482   1.00 0.00 ? 20  LYS A CB   4  
ATOM   2080  C  CG   . LYS A 1 20 ? 1.218   -1.170  6.754   1.00 0.00 ? 20  LYS A CG   4  
ATOM   2081  C  CD   . LYS A 1 20 ? 2.161   -1.558  7.881   1.00 0.00 ? 20  LYS A CD   4  
ATOM   2082  C  CE   . LYS A 1 20 ? 1.691   -1.002  9.216   1.00 0.00 ? 20  LYS A CE   4  
ATOM   2083  N  NZ   . LYS A 1 20 ? 2.179   -1.820  10.361  1.00 0.00 ? 20  LYS A NZ   4  
ATOM   2084  H  H    . LYS A 1 20 ? 2.571   -3.765  4.035   1.00 0.00 ? 20  LYS A H    4  
ATOM   2085  H  HA   . LYS A 1 20 ? 1.261   -3.764  6.577   1.00 0.00 ? 20  LYS A HA   4  
ATOM   2086  H  HB2  . LYS A 1 20 ? 2.581   -1.865  5.283   1.00 0.00 ? 20  LYS A HB2  4  
ATOM   2087  H  HB3  . LYS A 1 20 ? 0.976   -1.486  4.669   1.00 0.00 ? 20  LYS A HB3  4  
ATOM   2088  H  HG2  . LYS A 1 20 ? 1.325   -0.114  6.557   1.00 0.00 ? 20  LYS A HG2  4  
ATOM   2089  H  HG3  . LYS A 1 20 ? 0.202   -1.380  7.058   1.00 0.00 ? 20  LYS A HG3  4  
ATOM   2090  H  HD2  . LYS A 1 20 ? 2.204   -2.635  7.948   1.00 0.00 ? 20  LYS A HD2  4  
ATOM   2091  H  HD3  . LYS A 1 20 ? 3.145   -1.168  7.665   1.00 0.00 ? 20  LYS A HD3  4  
ATOM   2092  H  HE2  . LYS A 1 20 ? 2.062   0.006   9.322   1.00 0.00 ? 20  LYS A HE2  4  
ATOM   2093  H  HE3  . LYS A 1 20 ? 0.611   -0.991  9.227   1.00 0.00 ? 20  LYS A HE3  4  
ATOM   2094  H  HZ1  . LYS A 1 20 ? 3.122   -2.204  10.149  1.00 0.00 ? 20  LYS A HZ1  4  
ATOM   2095  H  HZ2  . LYS A 1 20 ? 1.526   -2.610  10.538  1.00 0.00 ? 20  LYS A HZ2  4  
ATOM   2096  H  HZ3  . LYS A 1 20 ? 2.238   -1.236  11.218  1.00 0.00 ? 20  LYS A HZ3  4  
ATOM   2097  N  N    . ALA A 1 21 ? -1.090  -4.260  6.004   1.00 0.00 ? 21  ALA A N    4  
ATOM   2098  C  CA   . ALA A 1 21 ? -2.501  -4.499  5.728   1.00 0.00 ? 21  ALA A CA   4  
ATOM   2099  C  C    . ALA A 1 21 ? -3.365  -3.358  6.255   1.00 0.00 ? 21  ALA A C    4  
ATOM   2100  O  O    . ALA A 1 21 ? -3.228  -2.942  7.405   1.00 0.00 ? 21  ALA A O    4  
ATOM   2101  C  CB   . ALA A 1 21 ? -2.942  -5.822  6.339   1.00 0.00 ? 21  ALA A CB   4  
ATOM   2102  H  H    . ALA A 1 21 ? -0.705  -4.586  6.844   1.00 0.00 ? 21  ALA A H    4  
ATOM   2103  H  HA   . ALA A 1 21 ? -2.625  -4.567  4.657   1.00 0.00 ? 21  ALA A HA   4  
ATOM   2104  H  HB1  . ALA A 1 21 ? -2.677  -6.631  5.675   1.00 0.00 ? 21  ALA A HB1  4  
ATOM   2105  H  HB2  . ALA A 1 21 ? -2.448  -5.960  7.290   1.00 0.00 ? 21  ALA A HB2  4  
ATOM   2106  H  HB3  . ALA A 1 21 ? -4.011  -5.811  6.487   1.00 0.00 ? 21  ALA A HB3  4  
ATOM   2107  N  N    . PHE A 1 22 ? -4.254  -2.855  5.405   1.00 0.00 ? 22  PHE A N    4  
ATOM   2108  C  CA   . PHE A 1 22 ? -5.139  -1.760  5.784   1.00 0.00 ? 22  PHE A CA   4  
ATOM   2109  C  C    . PHE A 1 22 ? -6.602  -2.152  5.595   1.00 0.00 ? 22  PHE A C    4  
ATOM   2110  O  O    . PHE A 1 22 ? -6.906  -3.256  5.145   1.00 0.00 ? 22  PHE A O    4  
ATOM   2111  C  CB   . PHE A 1 22 ? -4.824  -0.511  4.958   1.00 0.00 ? 22  PHE A CB   4  
ATOM   2112  C  CG   . PHE A 1 22 ? -3.383  -0.091  5.032   1.00 0.00 ? 22  PHE A CG   4  
ATOM   2113  C  CD1  . PHE A 1 22 ? -2.955  0.790   6.012   1.00 0.00 ? 22  PHE A CD1  4  
ATOM   2114  C  CD2  . PHE A 1 22 ? -2.458  -0.578  4.123   1.00 0.00 ? 22  PHE A CD2  4  
ATOM   2115  C  CE1  . PHE A 1 22 ? -1.630  1.178   6.082   1.00 0.00 ? 22  PHE A CE1  4  
ATOM   2116  C  CE2  . PHE A 1 22 ? -1.132  -0.194  4.188   1.00 0.00 ? 22  PHE A CE2  4  
ATOM   2117  C  CZ   . PHE A 1 22 ? -0.717  0.685   5.170   1.00 0.00 ? 22  PHE A CZ   4  
ATOM   2118  H  H    . PHE A 1 22 ? -4.316  -3.229  4.501   1.00 0.00 ? 22  PHE A H    4  
ATOM   2119  H  HA   . PHE A 1 22 ? -4.969  -1.543  6.827   1.00 0.00 ? 22  PHE A HA   4  
ATOM   2120  H  HB2  . PHE A 1 22 ? -5.059  -0.705  3.922   1.00 0.00 ? 22  PHE A HB2  4  
ATOM   2121  H  HB3  . PHE A 1 22 ? -5.429  0.309   5.313   1.00 0.00 ? 22  PHE A HB3  4  
ATOM   2122  H  HD1  . PHE A 1 22 ? -3.667  1.176   6.726   1.00 0.00 ? 22  PHE A HD1  4  
ATOM   2123  H  HD2  . PHE A 1 22 ? -2.782  -1.266  3.355   1.00 0.00 ? 22  PHE A HD2  4  
ATOM   2124  H  HE1  . PHE A 1 22 ? -1.308  1.865   6.850   1.00 0.00 ? 22  PHE A HE1  4  
ATOM   2125  H  HE2  . PHE A 1 22 ? -0.421  -0.582  3.474   1.00 0.00 ? 22  PHE A HE2  4  
ATOM   2126  H  HZ   . PHE A 1 22 ? 0.318   0.987   5.222   1.00 0.00 ? 22  PHE A HZ   4  
ATOM   2127  N  N    . ARG A 1 23 ? -7.503  -1.239  5.944   1.00 0.00 ? 23  ARG A N    4  
ATOM   2128  C  CA   . ARG A 1 23 ? -8.933  -1.489  5.815   1.00 0.00 ? 23  ARG A CA   4  
ATOM   2129  C  C    . ARG A 1 23 ? -9.443  -1.041  4.449   1.00 0.00 ? 23  ARG A C    4  
ATOM   2130  O  O    . ARG A 1 23 ? -10.420 -1.581  3.931   1.00 0.00 ? 23  ARG A O    4  
ATOM   2131  C  CB   . ARG A 1 23 ? -9.701  -0.763  6.921   1.00 0.00 ? 23  ARG A CB   4  
ATOM   2132  C  CG   . ARG A 1 23 ? -9.799  0.739   6.710   1.00 0.00 ? 23  ARG A CG   4  
ATOM   2133  C  CD   . ARG A 1 23 ? -11.081 1.302   7.302   1.00 0.00 ? 23  ARG A CD   4  
ATOM   2134  N  NE   . ARG A 1 23 ? -12.172 1.318   6.331   1.00 0.00 ? 23  ARG A NE   4  
ATOM   2135  C  CZ   . ARG A 1 23 ? -13.224 2.123   6.422   1.00 0.00 ? 23  ARG A CZ   4  
ATOM   2136  N  NH1  . ARG A 1 23 ? -13.328 2.973   7.434   1.00 0.00 ? 23  ARG A NH1  4  
ATOM   2137  N  NH2  . ARG A 1 23 ? -14.176 2.078   5.498   1.00 0.00 ? 23  ARG A NH2  4  
ATOM   2138  H  H    . ARG A 1 23 ? -7.198  -0.377  6.297   1.00 0.00 ? 23  ARG A H    4  
ATOM   2139  H  HA   . ARG A 1 23 ? -9.094  -2.552  5.915   1.00 0.00 ? 23  ARG A HA   4  
ATOM   2140  H  HB2  . ARG A 1 23 ? -10.703 -1.163  6.970   1.00 0.00 ? 23  ARG A HB2  4  
ATOM   2141  H  HB3  . ARG A 1 23 ? -9.205  -0.941  7.863   1.00 0.00 ? 23  ARG A HB3  4  
ATOM   2142  H  HG2  . ARG A 1 23 ? -8.955  1.216   7.187   1.00 0.00 ? 23  ARG A HG2  4  
ATOM   2143  H  HG3  . ARG A 1 23 ? -9.780  0.945   5.650   1.00 0.00 ? 23  ARG A HG3  4  
ATOM   2144  H  HD2  . ARG A 1 23 ? -11.371 0.693   8.145   1.00 0.00 ? 23  ARG A HD2  4  
ATOM   2145  H  HD3  . ARG A 1 23 ? -10.893 2.312   7.636   1.00 0.00 ? 23  ARG A HD3  4  
ATOM   2146  H  HE   . ARG A 1 23 ? -12.115 0.698   5.575   1.00 0.00 ? 23  ARG A HE   4  
ATOM   2147  H  HH11 . ARG A 1 23 ? -12.612 3.010   8.130   1.00 0.00 ? 23  ARG A HH11 4  
ATOM   2148  H  HH12 . ARG A 1 23 ? -14.121 3.579   7.499   1.00 0.00 ? 23  ARG A HH12 4  
ATOM   2149  H  HH21 . ARG A 1 23 ? -14.102 1.439   4.734   1.00 0.00 ? 23  ARG A HH21 4  
ATOM   2150  H  HH22 . ARG A 1 23 ? -14.968 2.684   5.568   1.00 0.00 ? 23  ARG A HH22 4  
ATOM   2151  N  N    . SER A 1 24 ? -8.774  -0.048  3.870   1.00 0.00 ? 24  SER A N    4  
ATOM   2152  C  CA   . SER A 1 24 ? -9.161  0.476   2.566   1.00 0.00 ? 24  SER A CA   4  
ATOM   2153  C  C    . SER A 1 24 ? -7.935  0.913   1.770   1.00 0.00 ? 24  SER A C    4  
ATOM   2154  O  O    . SER A 1 24 ? -6.874  1.178   2.336   1.00 0.00 ? 24  SER A O    4  
ATOM   2155  C  CB   . SER A 1 24 ? -10.122 1.655   2.732   1.00 0.00 ? 24  SER A CB   4  
ATOM   2156  O  OG   . SER A 1 24 ? -10.578 2.122   1.474   1.00 0.00 ? 24  SER A OG   4  
ATOM   2157  H  H    . SER A 1 24 ? -8.003  0.342   4.333   1.00 0.00 ? 24  SER A H    4  
ATOM   2158  H  HA   . SER A 1 24 ? -9.663  -0.313  2.027   1.00 0.00 ? 24  SER A HA   4  
ATOM   2159  H  HB2  . SER A 1 24 ? -10.974 1.342   3.316   1.00 0.00 ? 24  SER A HB2  4  
ATOM   2160  H  HB3  . SER A 1 24 ? -9.613  2.462   3.239   1.00 0.00 ? 24  SER A HB3  4  
ATOM   2161  H  HG   . SER A 1 24 ? -10.664 1.381   0.869   1.00 0.00 ? 24  SER A HG   4  
ATOM   2162  N  N    . LYS A 1 25 ? -8.088  0.986   0.452   1.00 0.00 ? 25  LYS A N    4  
ATOM   2163  C  CA   . LYS A 1 25 ? -6.996  1.391   -0.424  1.00 0.00 ? 25  LYS A CA   4  
ATOM   2164  C  C    . LYS A 1 25 ? -6.446  2.754   -0.015  1.00 0.00 ? 25  LYS A C    4  
ATOM   2165  O  O    . LYS A 1 25 ? -5.234  2.967   -0.002  1.00 0.00 ? 25  LYS A O    4  
ATOM   2166  C  CB   . LYS A 1 25 ? -7.471  1.437   -1.878  1.00 0.00 ? 25  LYS A CB   4  
ATOM   2167  C  CG   . LYS A 1 25 ? -6.376  1.136   -2.886  1.00 0.00 ? 25  LYS A CG   4  
ATOM   2168  C  CD   . LYS A 1 25 ? -6.947  0.597   -4.187  1.00 0.00 ? 25  LYS A CD   4  
ATOM   2169  C  CE   . LYS A 1 25 ? -7.593  1.699   -5.012  1.00 0.00 ? 25  LYS A CE   4  
ATOM   2170  N  NZ   . LYS A 1 25 ? -7.616  1.366   -6.463  1.00 0.00 ? 25  LYS A NZ   4  
ATOM   2171  H  H    . LYS A 1 25 ? -8.958  0.762   0.059   1.00 0.00 ? 25  LYS A H    4  
ATOM   2172  H  HA   . LYS A 1 25 ? -6.209  0.657   -0.335  1.00 0.00 ? 25  LYS A HA   4  
ATOM   2173  H  HB2  . LYS A 1 25 ? -8.261  0.713   -2.009  1.00 0.00 ? 25  LYS A HB2  4  
ATOM   2174  H  HB3  . LYS A 1 25 ? -7.861  2.423   -2.086  1.00 0.00 ? 25  LYS A HB3  4  
ATOM   2175  H  HG2  . LYS A 1 25 ? -5.831  2.045   -3.095  1.00 0.00 ? 25  LYS A HG2  4  
ATOM   2176  H  HG3  . LYS A 1 25 ? -5.704  0.401   -2.466  1.00 0.00 ? 25  LYS A HG3  4  
ATOM   2177  H  HD2  . LYS A 1 25 ? -6.150  0.152   -4.764  1.00 0.00 ? 25  LYS A HD2  4  
ATOM   2178  H  HD3  . LYS A 1 25 ? -7.691  -0.154  -3.959  1.00 0.00 ? 25  LYS A HD3  4  
ATOM   2179  H  HE2  . LYS A 1 25 ? -8.607  1.841   -4.668  1.00 0.00 ? 25  LYS A HE2  4  
ATOM   2180  H  HE3  . LYS A 1 25 ? -7.034  2.612   -4.869  1.00 0.00 ? 25  LYS A HE3  4  
ATOM   2181  H  HZ1  . LYS A 1 25 ? -8.269  1.999   -6.965  1.00 0.00 ? 25  LYS A HZ1  4  
ATOM   2182  H  HZ2  . LYS A 1 25 ? -7.929  0.383   -6.599  1.00 0.00 ? 25  LYS A HZ2  4  
ATOM   2183  H  HZ3  . LYS A 1 25 ? -6.664  1.474   -6.869  1.00 0.00 ? 25  LYS A HZ3  4  
ATOM   2184  N  N    . SER A 1 26 ? -7.346  3.673   0.322   1.00 0.00 ? 26  SER A N    4  
ATOM   2185  C  CA   . SER A 1 26 ? -6.951  5.016   0.730   1.00 0.00 ? 26  SER A CA   4  
ATOM   2186  C  C    . SER A 1 26 ? -5.861  4.961   1.796   1.00 0.00 ? 26  SER A C    4  
ATOM   2187  O  O    . SER A 1 26 ? -4.919  5.753   1.777   1.00 0.00 ? 26  SER A O    4  
ATOM   2188  C  CB   . SER A 1 26 ? -8.161  5.786   1.261   1.00 0.00 ? 26  SER A CB   4  
ATOM   2189  O  OG   . SER A 1 26 ? -7.922  7.183   1.248   1.00 0.00 ? 26  SER A OG   4  
ATOM   2190  H  H    . SER A 1 26 ? -8.298  3.442   0.292   1.00 0.00 ? 26  SER A H    4  
ATOM   2191  H  HA   . SER A 1 26 ? -6.563  5.526   -0.139  1.00 0.00 ? 26  SER A HA   4  
ATOM   2192  H  HB2  . SER A 1 26 ? -9.020  5.575   0.643   1.00 0.00 ? 26  SER A HB2  4  
ATOM   2193  H  HB3  . SER A 1 26 ? -8.364  5.478   2.277   1.00 0.00 ? 26  SER A HB3  4  
ATOM   2194  H  HG   . SER A 1 26 ? -8.670  7.640   1.640   1.00 0.00 ? 26  SER A HG   4  
ATOM   2195  N  N    . TYR A 1 27 ? -5.996  4.020   2.723   1.00 0.00 ? 27  TYR A N    4  
ATOM   2196  C  CA   . TYR A 1 27 ? -5.025  3.862   3.799   1.00 0.00 ? 27  TYR A CA   4  
ATOM   2197  C  C    . TYR A 1 27 ? -3.703  3.318   3.265   1.00 0.00 ? 27  TYR A C    4  
ATOM   2198  O  O    . TYR A 1 27 ? -2.638  3.583   3.822   1.00 0.00 ? 27  TYR A O    4  
ATOM   2199  C  CB   . TYR A 1 27 ? -5.575  2.927   4.878   1.00 0.00 ? 27  TYR A CB   4  
ATOM   2200  C  CG   . TYR A 1 27 ? -6.344  3.644   5.965   1.00 0.00 ? 27  TYR A CG   4  
ATOM   2201  C  CD1  . TYR A 1 27 ? -5.798  4.738   6.624   1.00 0.00 ? 27  TYR A CD1  4  
ATOM   2202  C  CD2  . TYR A 1 27 ? -7.617  3.226   6.333   1.00 0.00 ? 27  TYR A CD2  4  
ATOM   2203  C  CE1  . TYR A 1 27 ? -6.497  5.395   7.618   1.00 0.00 ? 27  TYR A CE1  4  
ATOM   2204  C  CE2  . TYR A 1 27 ? -8.324  3.879   7.324   1.00 0.00 ? 27  TYR A CE2  4  
ATOM   2205  C  CZ   . TYR A 1 27 ? -7.760  4.962   7.964   1.00 0.00 ? 27  TYR A CZ   4  
ATOM   2206  O  OH   . TYR A 1 27 ? -8.460  5.614   8.953   1.00 0.00 ? 27  TYR A OH   4  
ATOM   2207  H  H    . TYR A 1 27 ? -6.768  3.418   2.685   1.00 0.00 ? 27  TYR A H    4  
ATOM   2208  H  HA   . TYR A 1 27 ? -4.850  4.835   4.234   1.00 0.00 ? 27  TYR A HA   4  
ATOM   2209  H  HB2  . TYR A 1 27 ? -6.239  2.211   4.420   1.00 0.00 ? 27  TYR A HB2  4  
ATOM   2210  H  HB3  . TYR A 1 27 ? -4.753  2.403   5.344   1.00 0.00 ? 27  TYR A HB3  4  
ATOM   2211  H  HD1  . TYR A 1 27 ? -4.808  5.075   6.351   1.00 0.00 ? 27  TYR A HD1  4  
ATOM   2212  H  HD2  . TYR A 1 27 ? -8.056  2.377   5.830   1.00 0.00 ? 27  TYR A HD2  4  
ATOM   2213  H  HE1  . TYR A 1 27 ? -6.055  6.244   8.119   1.00 0.00 ? 27  TYR A HE1  4  
ATOM   2214  H  HE2  . TYR A 1 27 ? -9.313  3.539   7.596   1.00 0.00 ? 27  TYR A HE2  4  
ATOM   2215  H  HH   . TYR A 1 27 ? -8.481  5.068   9.743   1.00 0.00 ? 27  TYR A HH   4  
ATOM   2216  N  N    . LEU A 1 28 ? -3.781  2.555   2.180   1.00 0.00 ? 28  LEU A N    4  
ATOM   2217  C  CA   . LEU A 1 28 ? -2.592  1.973   1.567   1.00 0.00 ? 28  LEU A CA   4  
ATOM   2218  C  C    . LEU A 1 28 ? -1.915  2.972   0.635   1.00 0.00 ? 28  LEU A C    4  
ATOM   2219  O  O    . LEU A 1 28 ? -0.703  2.913   0.421   1.00 0.00 ? 28  LEU A O    4  
ATOM   2220  C  CB   . LEU A 1 28 ? -2.961  0.706   0.794   1.00 0.00 ? 28  LEU A CB   4  
ATOM   2221  C  CG   . LEU A 1 28 ? -1.911  0.191   -0.192  1.00 0.00 ? 28  LEU A CG   4  
ATOM   2222  C  CD1  . LEU A 1 28 ? -0.725  -0.401  0.553   1.00 0.00 ? 28  LEU A CD1  4  
ATOM   2223  C  CD2  . LEU A 1 28 ? -2.522  -0.839  -1.131  1.00 0.00 ? 28  LEU A CD2  4  
ATOM   2224  H  H    . LEU A 1 28 ? -4.658  2.379   1.780   1.00 0.00 ? 28  LEU A H    4  
ATOM   2225  H  HA   . LEU A 1 28 ? -1.905  1.714   2.359   1.00 0.00 ? 28  LEU A HA   4  
ATOM   2226  H  HB2  . LEU A 1 28 ? -3.152  -0.077  1.512   1.00 0.00 ? 28  LEU A HB2  4  
ATOM   2227  H  HB3  . LEU A 1 28 ? -3.866  0.910   0.238   1.00 0.00 ? 28  LEU A HB3  4  
ATOM   2228  H  HG   . LEU A 1 28 ? -1.551  1.018   -0.789  1.00 0.00 ? 28  LEU A HG   4  
ATOM   2229  H  HD11 . LEU A 1 28 ? 0.113   -0.493  -0.121  1.00 0.00 ? 28  LEU A HD11 4  
ATOM   2230  H  HD12 . LEU A 1 28 ? -0.989  -1.376  0.934   1.00 0.00 ? 28  LEU A HD12 4  
ATOM   2231  H  HD13 . LEU A 1 28 ? -0.458  0.246   1.376   1.00 0.00 ? 28  LEU A HD13 4  
ATOM   2232  H  HD21 . LEU A 1 28 ? -2.381  -0.521  -2.154  1.00 0.00 ? 28  LEU A HD21 4  
ATOM   2233  H  HD22 . LEU A 1 28 ? -3.577  -0.933  -0.925  1.00 0.00 ? 28  LEU A HD22 4  
ATOM   2234  H  HD23 . LEU A 1 28 ? -2.039  -1.794  -0.981  1.00 0.00 ? 28  LEU A HD23 4  
ATOM   2235  N  N    . ILE A 1 29 ? -2.703  3.889   0.086   1.00 0.00 ? 29  ILE A N    4  
ATOM   2236  C  CA   . ILE A 1 29 ? -2.179  4.903   -0.820  1.00 0.00 ? 29  ILE A CA   4  
ATOM   2237  C  C    . ILE A 1 29 ? -1.419  5.983   -0.057  1.00 0.00 ? 29  ILE A C    4  
ATOM   2238  O  O    . ILE A 1 29 ? -0.412  6.504   -0.536  1.00 0.00 ? 29  ILE A O    4  
ATOM   2239  C  CB   . ILE A 1 29 ? -3.305  5.565   -1.638  1.00 0.00 ? 29  ILE A CB   4  
ATOM   2240  C  CG1  . ILE A 1 29 ? -4.072  4.509   -2.437  1.00 0.00 ? 29  ILE A CG1  4  
ATOM   2241  C  CG2  . ILE A 1 29 ? -2.733  6.627   -2.564  1.00 0.00 ? 29  ILE A CG2  4  
ATOM   2242  C  CD1  . ILE A 1 29 ? -5.519  4.872   -2.684  1.00 0.00 ? 29  ILE A CD1  4  
ATOM   2243  H  H    . ILE A 1 29 ? -3.660  3.884   0.295   1.00 0.00 ? 29  ILE A H    4  
ATOM   2244  H  HA   . ILE A 1 29 ? -1.501  4.418   -1.507  1.00 0.00 ? 29  ILE A HA   4  
ATOM   2245  H  HB   . ILE A 1 29 ? -3.982  6.048   -0.950  1.00 0.00 ? 29  ILE A HB   4  
ATOM   2246  H  HG12 . ILE A 1 29 ? -3.595  4.376   -3.395  1.00 0.00 ? 29  ILE A HG12 4  
ATOM   2247  H  HG13 . ILE A 1 29 ? -4.051  3.574   -1.896  1.00 0.00 ? 29  ILE A HG13 4  
ATOM   2248  H  HG21 . ILE A 1 29 ? -3.314  7.533   -2.476  1.00 0.00 ? 29  ILE A HG21 4  
ATOM   2249  H  HG22 . ILE A 1 29 ? -1.708  6.829   -2.290  1.00 0.00 ? 29  ILE A HG22 4  
ATOM   2250  H  HG23 . ILE A 1 29 ? -2.770  6.274   -3.584  1.00 0.00 ? 29  ILE A HG23 4  
ATOM   2251  H  HD11 . ILE A 1 29 ? -5.866  4.379   -3.581  1.00 0.00 ? 29  ILE A HD11 4  
ATOM   2252  H  HD12 . ILE A 1 29 ? -6.119  4.553   -1.845  1.00 0.00 ? 29  ILE A HD12 4  
ATOM   2253  H  HD13 . ILE A 1 29 ? -5.607  5.941   -2.805  1.00 0.00 ? 29  ILE A HD13 4  
ATOM   2254  N  N    . ILE A 1 30 ? -1.908  6.312   1.134   1.00 0.00 ? 30  ILE A N    4  
ATOM   2255  C  CA   . ILE A 1 30 ? -1.273  7.327   1.965   1.00 0.00 ? 30  ILE A CA   4  
ATOM   2256  C  C    . ILE A 1 30 ? -0.024  6.778   2.646   1.00 0.00 ? 30  ILE A C    4  
ATOM   2257  O  O    . ILE A 1 30 ? 0.825   7.537   3.116   1.00 0.00 ? 30  ILE A O    4  
ATOM   2258  C  CB   . ILE A 1 30 ? -2.238  7.859   3.041   1.00 0.00 ? 30  ILE A CB   4  
ATOM   2259  C  CG1  . ILE A 1 30 ? -2.715  6.716   3.940   1.00 0.00 ? 30  ILE A CG1  4  
ATOM   2260  C  CG2  . ILE A 1 30 ? -3.423  8.557   2.390   1.00 0.00 ? 30  ILE A CG2  4  
ATOM   2261  C  CD1  . ILE A 1 30 ? -1.818  6.472   5.133   1.00 0.00 ? 30  ILE A CD1  4  
ATOM   2262  H  H    . ILE A 1 30 ? -2.714  5.862   1.461   1.00 0.00 ? 30  ILE A H    4  
ATOM   2263  H  HA   . ILE A 1 30 ? -0.989  8.151   1.326   1.00 0.00 ? 30  ILE A HA   4  
ATOM   2264  H  HB   . ILE A 1 30 ? -1.710  8.583   3.641   1.00 0.00 ? 30  ILE A HB   4  
ATOM   2265  H  HG12 . ILE A 1 30 ? -3.702  6.944   4.309   1.00 0.00 ? 30  ILE A HG12 4  
ATOM   2266  H  HG13 . ILE A 1 30 ? -2.753  5.805   3.360   1.00 0.00 ? 30  ILE A HG13 4  
ATOM   2267  H  HG21 . ILE A 1 30 ? -4.338  8.069   2.692   1.00 0.00 ? 30  ILE A HG21 4  
ATOM   2268  H  HG22 . ILE A 1 30 ? -3.447  9.591   2.703   1.00 0.00 ? 30  ILE A HG22 4  
ATOM   2269  H  HG23 . ILE A 1 30 ? -3.325  8.508   1.316   1.00 0.00 ? 30  ILE A HG23 4  
ATOM   2270  H  HD11 . ILE A 1 30 ? -1.294  7.384   5.382   1.00 0.00 ? 30  ILE A HD11 4  
ATOM   2271  H  HD12 . ILE A 1 30 ? -2.417  6.161   5.976   1.00 0.00 ? 30  ILE A HD12 4  
ATOM   2272  H  HD13 . ILE A 1 30 ? -1.102  5.701   4.894   1.00 0.00 ? 30  ILE A HD13 4  
ATOM   2273  N  N    . HIS A 1 31 ? 0.083   5.454   2.695   1.00 0.00 ? 31  HIS A N    4  
ATOM   2274  C  CA   . HIS A 1 31 ? 1.230   4.802   3.316   1.00 0.00 ? 31  HIS A CA   4  
ATOM   2275  C  C    . HIS A 1 31 ? 2.298   4.475   2.277   1.00 0.00 ? 31  HIS A C    4  
ATOM   2276  O  O    . HIS A 1 31 ? 3.477   4.780   2.464   1.00 0.00 ? 31  HIS A O    4  
ATOM   2277  C  CB   . HIS A 1 31 ? 0.791   3.524   4.033   1.00 0.00 ? 31  HIS A CB   4  
ATOM   2278  C  CG   . HIS A 1 31 ? 1.870   2.490   4.128   1.00 0.00 ? 31  HIS A CG   4  
ATOM   2279  N  ND1  . HIS A 1 31 ? 2.591   2.258   5.280   1.00 0.00 ? 31  HIS A ND1  4  
ATOM   2280  C  CD2  . HIS A 1 31 ? 2.349   1.623   3.205   1.00 0.00 ? 31  HIS A CD2  4  
ATOM   2281  C  CE1  . HIS A 1 31 ? 3.467   1.294   5.062   1.00 0.00 ? 31  HIS A CE1  4  
ATOM   2282  N  NE2  . HIS A 1 31 ? 3.341   0.891   3.811   1.00 0.00 ? 31  HIS A NE2  4  
ATOM   2283  H  H    . HIS A 1 31 ? -0.626  4.903   2.303   1.00 0.00 ? 31  HIS A H    4  
ATOM   2284  H  HA   . HIS A 1 31 ? 1.648   5.485   4.040   1.00 0.00 ? 31  HIS A HA   4  
ATOM   2285  H  HB2  . HIS A 1 31 ? 0.480   3.772   5.037   1.00 0.00 ? 31  HIS A HB2  4  
ATOM   2286  H  HB3  . HIS A 1 31 ? -0.041  3.088   3.499   1.00 0.00 ? 31  HIS A HB3  4  
ATOM   2287  H  HD1  . HIS A 1 31 ? 2.478   2.731   6.131   1.00 0.00 ? 31  HIS A HD1  4  
ATOM   2288  H  HD2  . HIS A 1 31 ? 2.014   1.524   2.182   1.00 0.00 ? 31  HIS A HD2  4  
ATOM   2289  H  HE1  . HIS A 1 31 ? 4.168   0.901   5.784   1.00 0.00 ? 31  HIS A HE1  4  
ATOM   2290  N  N    . THR A 1 32 ? 1.879   3.852   1.180   1.00 0.00 ? 32  THR A N    4  
ATOM   2291  C  CA   . THR A 1 32 ? 2.799   3.482   0.112   1.00 0.00 ? 32  THR A CA   4  
ATOM   2292  C  C    . THR A 1 32 ? 3.714   4.645   -0.252  1.00 0.00 ? 32  THR A C    4  
ATOM   2293  O  O    . THR A 1 32 ? 4.838   4.442   -0.714  1.00 0.00 ? 32  THR A O    4  
ATOM   2294  C  CB   . THR A 1 32 ? 2.042   3.024   -1.149  1.00 0.00 ? 32  THR A CB   4  
ATOM   2295  O  OG1  . THR A 1 32 ? 2.944   2.380   -2.055  1.00 0.00 ? 32  THR A OG1  4  
ATOM   2296  C  CG2  . THR A 1 32 ? 1.378   4.206   -1.839  1.00 0.00 ? 32  THR A CG2  4  
ATOM   2297  H  H    . THR A 1 32 ? 0.928   3.635   1.089   1.00 0.00 ? 32  THR A H    4  
ATOM   2298  H  HA   . THR A 1 32 ? 3.403   2.657   0.463   1.00 0.00 ? 32  THR A HA   4  
ATOM   2299  H  HB   . THR A 1 32 ? 1.276   2.321   -0.855  1.00 0.00 ? 32  THR A HB   4  
ATOM   2300  H  HG1  . THR A 1 32 ? 3.837   2.697   -1.897  1.00 0.00 ? 32  THR A HG1  4  
ATOM   2301  H  HG21 . THR A 1 32 ? 2.120   4.763   -2.391  1.00 0.00 ? 32  THR A HG21 4  
ATOM   2302  H  HG22 . THR A 1 32 ? 0.924   4.847   -1.099  1.00 0.00 ? 32  THR A HG22 4  
ATOM   2303  H  HG23 . THR A 1 32 ? 0.619   3.846   -2.518  1.00 0.00 ? 32  THR A HG23 4  
ATOM   2304  N  N    . ARG A 1 33 ? 3.227   5.863   -0.042  1.00 0.00 ? 33  ARG A N    4  
ATOM   2305  C  CA   . ARG A 1 33 ? 4.002   7.059   -0.350  1.00 0.00 ? 33  ARG A CA   4  
ATOM   2306  C  C    . ARG A 1 33 ? 5.076   7.298   0.707   1.00 0.00 ? 33  ARG A C    4  
ATOM   2307  O  O    . ARG A 1 33 ? 6.225   7.603   0.384   1.00 0.00 ? 33  ARG A O    4  
ATOM   2308  C  CB   . ARG A 1 33 ? 3.083   8.279   -0.442  1.00 0.00 ? 33  ARG A CB   4  
ATOM   2309  C  CG   . ARG A 1 33 ? 2.358   8.595   0.856   1.00 0.00 ? 33  ARG A CG   4  
ATOM   2310  C  CD   . ARG A 1 33 ? 1.031   9.291   0.598   1.00 0.00 ? 33  ARG A CD   4  
ATOM   2311  N  NE   . ARG A 1 33 ? 1.208   10.579  -0.066  1.00 0.00 ? 33  ARG A NE   4  
ATOM   2312  C  CZ   . ARG A 1 33 ? 1.670   11.664  0.546   1.00 0.00 ? 33  ARG A CZ   4  
ATOM   2313  N  NH1  . ARG A 1 33 ? 1.999   11.616  1.830   1.00 0.00 ? 33  ARG A NH1  4  
ATOM   2314  N  NH2  . ARG A 1 33 ? 1.803   12.801  -0.126  1.00 0.00 ? 33  ARG A NH2  4  
ATOM   2315  H  H    . ARG A 1 33 ? 2.325   5.961   0.327   1.00 0.00 ? 33  ARG A H    4  
ATOM   2316  H  HA   . ARG A 1 33 ? 4.481   6.908   -1.306  1.00 0.00 ? 33  ARG A HA   4  
ATOM   2317  H  HB2  . ARG A 1 33 ? 3.673   9.140   -0.718  1.00 0.00 ? 33  ARG A HB2  4  
ATOM   2318  H  HB3  . ARG A 1 33 ? 2.343   8.099   -1.208  1.00 0.00 ? 33  ARG A HB3  4  
ATOM   2319  H  HG2  . ARG A 1 33 ? 2.172   7.673   1.387   1.00 0.00 ? 33  ARG A HG2  4  
ATOM   2320  H  HG3  . ARG A 1 33 ? 2.982   9.240   1.457   1.00 0.00 ? 33  ARG A HG3  4  
ATOM   2321  H  HD2  . ARG A 1 33 ? 0.422   8.655   -0.028  1.00 0.00 ? 33  ARG A HD2  4  
ATOM   2322  H  HD3  . ARG A 1 33 ? 0.533   9.448   1.543   1.00 0.00 ? 33  ARG A HD3  4  
ATOM   2323  H  HE   . ARG A 1 33 ? 0.971   10.638  -1.015  1.00 0.00 ? 33  ARG A HE   4  
ATOM   2324  H  HH11 . ARG A 1 33 ? 1.900   10.760  2.338   1.00 0.00 ? 33  ARG A HH11 4  
ATOM   2325  H  HH12 . ARG A 1 33 ? 2.347   12.434  2.288   1.00 0.00 ? 33  ARG A HH12 4  
ATOM   2326  H  HH21 . ARG A 1 33 ? 1.556   12.841  -1.093  1.00 0.00 ? 33  ARG A HH21 4  
ATOM   2327  H  HH22 . ARG A 1 33 ? 2.150   13.616  0.336   1.00 0.00 ? 33  ARG A HH22 4  
ATOM   2328  N  N    . THR A 1 34 ? 4.695   7.158   1.973   1.00 0.00 ? 34  THR A N    4  
ATOM   2329  C  CA   . THR A 1 34 ? 5.624   7.359   3.078   1.00 0.00 ? 34  THR A CA   4  
ATOM   2330  C  C    . THR A 1 34 ? 6.934   6.616   2.838   1.00 0.00 ? 34  THR A C    4  
ATOM   2331  O  O    . THR A 1 34 ? 8.003   7.076   3.239   1.00 0.00 ? 34  THR A O    4  
ATOM   2332  C  CB   . THR A 1 34 ? 5.019   6.890   4.414   1.00 0.00 ? 34  THR A CB   4  
ATOM   2333  O  OG1  . THR A 1 34 ? 4.928   5.461   4.436   1.00 0.00 ? 34  THR A OG1  4  
ATOM   2334  C  CG2  . THR A 1 34 ? 3.639   7.495   4.624   1.00 0.00 ? 34  THR A CG2  4  
ATOM   2335  H  H    . THR A 1 34 ? 3.767   6.913   2.167   1.00 0.00 ? 34  THR A H    4  
ATOM   2336  H  HA   . THR A 1 34 ? 5.830   8.417   3.151   1.00 0.00 ? 34  THR A HA   4  
ATOM   2337  H  HB   . THR A 1 34 ? 5.664   7.215   5.218   1.00 0.00 ? 34  THR A HB   4  
ATOM   2338  H  HG1  . THR A 1 34 ? 4.880   5.130   3.536   1.00 0.00 ? 34  THR A HG1  4  
ATOM   2339  H  HG21 . THR A 1 34 ? 3.299   7.943   3.703   1.00 0.00 ? 34  THR A HG21 4  
ATOM   2340  H  HG22 . THR A 1 34 ? 3.690   8.250   5.395   1.00 0.00 ? 34  THR A HG22 4  
ATOM   2341  H  HG23 . THR A 1 34 ? 2.948   6.720   4.924   1.00 0.00 ? 34  THR A HG23 4  
ATOM   2342  N  N    . HIS A 1 35 ? 6.843   5.465   2.179   1.00 0.00 ? 35  HIS A N    4  
ATOM   2343  C  CA   . HIS A 1 35 ? 8.022   4.658   1.885   1.00 0.00 ? 35  HIS A CA   4  
ATOM   2344  C  C    . HIS A 1 35 ? 9.135   5.518   1.294   1.00 0.00 ? 35  HIS A C    4  
ATOM   2345  O  O    . HIS A 1 35 ? 10.319  5.256   1.509   1.00 0.00 ? 35  HIS A O    4  
ATOM   2346  C  CB   . HIS A 1 35 ? 7.665   3.530   0.916   1.00 0.00 ? 35  HIS A CB   4  
ATOM   2347  C  CG   . HIS A 1 35 ? 7.231   2.270   1.599   1.00 0.00 ? 35  HIS A CG   4  
ATOM   2348  N  ND1  . HIS A 1 35 ? 8.057   1.542   2.430   1.00 0.00 ? 35  HIS A ND1  4  
ATOM   2349  C  CD2  . HIS A 1 35 ? 6.050   1.609   1.572   1.00 0.00 ? 35  HIS A CD2  4  
ATOM   2350  C  CE1  . HIS A 1 35 ? 7.402   0.487   2.883   1.00 0.00 ? 35  HIS A CE1  4  
ATOM   2351  N  NE2  . HIS A 1 35 ? 6.182   0.505   2.377   1.00 0.00 ? 35  HIS A NE2  4  
ATOM   2352  H  H    . HIS A 1 35 ? 5.963   5.151   1.885   1.00 0.00 ? 35  HIS A H    4  
ATOM   2353  H  HA   . HIS A 1 35 ? 8.370   4.228   2.812   1.00 0.00 ? 35  HIS A HA   4  
ATOM   2354  H  HB2  . HIS A 1 35 ? 6.857   3.855   0.277   1.00 0.00 ? 35  HIS A HB2  4  
ATOM   2355  H  HB3  . HIS A 1 35 ? 8.528   3.299   0.308   1.00 0.00 ? 35  HIS A HB3  4  
ATOM   2356  H  HD1  . HIS A 1 35 ? 8.984   1.764   2.653   1.00 0.00 ? 35  HIS A HD1  4  
ATOM   2357  H  HD2  . HIS A 1 35 ? 5.167   1.897   1.019   1.00 0.00 ? 35  HIS A HD2  4  
ATOM   2358  H  HE1  . HIS A 1 35 ? 7.797   -0.262  3.553   1.00 0.00 ? 35  HIS A HE1  4  
ATOM   2359  N  N    . THR A 1 36 ? 8.748   6.548   0.546   1.00 0.00 ? 36  THR A N    4  
ATOM   2360  C  CA   . THR A 1 36 ? 9.712   7.445   -0.077  1.00 0.00 ? 36  THR A CA   4  
ATOM   2361  C  C    . THR A 1 36 ? 10.972  6.695   -0.494  1.00 0.00 ? 36  THR A C    4  
ATOM   2362  O  O    . THR A 1 36 ? 12.084  7.200   -0.346  1.00 0.00 ? 36  THR A O    4  
ATOM   2363  C  CB   . THR A 1 36 ? 10.103  8.595   0.870   1.00 0.00 ? 36  THR A CB   4  
ATOM   2364  O  OG1  . THR A 1 36 ? 10.495  8.070   2.143   1.00 0.00 ? 36  THR A OG1  4  
ATOM   2365  C  CG2  . THR A 1 36 ? 8.944   9.564   1.051   1.00 0.00 ? 36  THR A CG2  4  
ATOM   2366  H  H    . THR A 1 36 ? 7.790   6.705   0.411   1.00 0.00 ? 36  THR A H    4  
ATOM   2367  H  HA   . THR A 1 36 ? 9.251   7.871   -0.956  1.00 0.00 ? 36  THR A HA   4  
ATOM   2368  H  HB   . THR A 1 36 ? 10.936  9.131   0.437   1.00 0.00 ? 36  THR A HB   4  
ATOM   2369  H  HG1  . THR A 1 36 ? 11.454  8.052   2.200   1.00 0.00 ? 36  THR A HG1  4  
ATOM   2370  H  HG21 . THR A 1 36 ? 8.585   9.880   0.083   1.00 0.00 ? 36  THR A HG21 4  
ATOM   2371  H  HG22 . THR A 1 36 ? 9.279   10.426  1.609   1.00 0.00 ? 36  THR A HG22 4  
ATOM   2372  H  HG23 . THR A 1 36 ? 8.146   9.075   1.589   1.00 0.00 ? 36  THR A HG23 4  
ATOM   2373  N  N    . GLY A 1 37 ? 10.790  5.486   -1.016  1.00 0.00 ? 37  GLY A N    4  
ATOM   2374  C  CA   . GLY A 1 37 ? 11.922  4.686   -1.447  1.00 0.00 ? 37  GLY A CA   4  
ATOM   2375  C  C    . GLY A 1 37 ? 12.874  4.369   -0.310  1.00 0.00 ? 37  GLY A C    4  
ATOM   2376  O  O    . GLY A 1 37 ? 14.053  4.715   -0.367  1.00 0.00 ? 37  GLY A O    4  
ATOM   2377  H  H    . GLY A 1 37 ? 9.880   5.134   -1.110  1.00 0.00 ? 37  GLY A H    4  
ATOM   2378  H  HA2  . GLY A 1 37 ? 11.556  3.760   -1.864  1.00 0.00 ? 37  GLY A HA2  4  
ATOM   2379  H  HA3  . GLY A 1 37 ? 12.460  5.226   -2.211  1.00 0.00 ? 37  GLY A HA3  4  
ATOM   2380  N  N    . GLU A 1 38 ? 12.360  3.711   0.724   1.00 0.00 ? 38  GLU A N    4  
ATOM   2381  C  CA   . GLU A 1 38 ? 13.174  3.351   1.880   1.00 0.00 ? 38  GLU A CA   4  
ATOM   2382  C  C    . GLU A 1 38 ? 13.503  1.861   1.870   1.00 0.00 ? 38  GLU A C    4  
ATOM   2383  O  O    . GLU A 1 38 ? 14.621  1.460   2.194   1.00 0.00 ? 38  GLU A O    4  
ATOM   2384  C  CB   . GLU A 1 38 ? 12.448  3.716   3.176   1.00 0.00 ? 38  GLU A CB   4  
ATOM   2385  C  CG   . GLU A 1 38 ? 11.108  3.017   3.341   1.00 0.00 ? 38  GLU A CG   4  
ATOM   2386  C  CD   . GLU A 1 38 ? 11.239  1.647   3.977   1.00 0.00 ? 38  GLU A CD   4  
ATOM   2387  O  OE1  . GLU A 1 38 ? 12.184  1.450   4.770   1.00 0.00 ? 38  GLU A OE1  4  
ATOM   2388  O  OE2  . GLU A 1 38 ? 10.398  0.773   3.683   1.00 0.00 ? 38  GLU A OE2  4  
ATOM   2389  H  H    . GLU A 1 38 ? 11.412  3.463   0.711   1.00 0.00 ? 38  GLU A H    4  
ATOM   2390  H  HA   . GLU A 1 38 ? 14.095  3.912   1.825   1.00 0.00 ? 38  GLU A HA   4  
ATOM   2391  H  HB2  . GLU A 1 38 ? 13.075  3.449   4.014   1.00 0.00 ? 38  GLU A HB2  4  
ATOM   2392  H  HB3  . GLU A 1 38 ? 12.277  4.782   3.191   1.00 0.00 ? 38  GLU A HB3  4  
ATOM   2393  H  HG2  . GLU A 1 38 ? 10.472  3.627   3.964   1.00 0.00 ? 38  GLU A HG2  4  
ATOM   2394  H  HG3  . GLU A 1 38 ? 10.654  2.904   2.367   1.00 0.00 ? 38  GLU A HG3  4  
ATOM   2395  N  N    . SER A 1 39 ? 12.522  1.047   1.496   1.00 0.00 ? 39  SER A N    4  
ATOM   2396  C  CA   . SER A 1 39 ? 12.705  -0.399  1.448   1.00 0.00 ? 39  SER A CA   4  
ATOM   2397  C  C    . SER A 1 39 ? 13.599  -0.795  0.277   1.00 0.00 ? 39  SER A C    4  
ATOM   2398  O  O    . SER A 1 39 ? 14.285  -1.815  0.322   1.00 0.00 ? 39  SER A O    4  
ATOM   2399  C  CB   . SER A 1 39 ? 11.352  -1.102  1.332   1.00 0.00 ? 39  SER A CB   4  
ATOM   2400  O  OG   . SER A 1 39 ? 10.571  -0.538  0.292   1.00 0.00 ? 39  SER A OG   4  
ATOM   2401  H  H    . SER A 1 39 ? 11.653  1.427   1.250   1.00 0.00 ? 39  SER A H    4  
ATOM   2402  H  HA   . SER A 1 39 ? 13.182  -0.704  2.368   1.00 0.00 ? 39  SER A HA   4  
ATOM   2403  H  HB2  . SER A 1 39 ? 11.509  -2.149  1.119   1.00 0.00 ? 39  SER A HB2  4  
ATOM   2404  H  HB3  . SER A 1 39 ? 10.815  -1.001  2.264   1.00 0.00 ? 39  SER A HB3  4  
ATOM   2405  H  HG   . SER A 1 39 ? 10.961  -0.759  -0.557  1.00 0.00 ? 39  SER A HG   4  
ATOM   2406  N  N    . GLY A 1 40 ? 13.585  0.021   -0.773  1.00 0.00 ? 40  GLY A N    4  
ATOM   2407  C  CA   . GLY A 1 40 ? 14.397  -0.259  -1.942  1.00 0.00 ? 40  GLY A CA   4  
ATOM   2408  C  C    . GLY A 1 40 ? 13.621  -0.978  -3.028  1.00 0.00 ? 40  GLY A C    4  
ATOM   2409  O  O    . GLY A 1 40 ? 12.706  -1.755  -2.756  1.00 0.00 ? 40  GLY A O    4  
ATOM   2410  H  H    . GLY A 1 40 ? 13.018  0.821   -0.753  1.00 0.00 ? 40  GLY A H    4  
ATOM   2411  H  HA2  . GLY A 1 40 ? 14.772  0.672   -2.338  1.00 0.00 ? 40  GLY A HA2  4  
ATOM   2412  H  HA3  . GLY A 1 40 ? 15.233  -0.875  -1.645  1.00 0.00 ? 40  GLY A HA3  4  
ATOM   2413  N  N    . PRO A 1 41 ? 13.987  -0.718  -4.292  1.00 0.00 ? 41  PRO A N    4  
ATOM   2414  C  CA   . PRO A 1 41 ? 13.330  -1.335  -5.449  1.00 0.00 ? 41  PRO A CA   4  
ATOM   2415  C  C    . PRO A 1 41 ? 13.636  -2.824  -5.563  1.00 0.00 ? 41  PRO A C    4  
ATOM   2416  O  O    . PRO A 1 41 ? 14.637  -3.218  -6.162  1.00 0.00 ? 41  PRO A O    4  
ATOM   2417  C  CB   . PRO A 1 41 ? 13.920  -0.575  -6.639  1.00 0.00 ? 41  PRO A CB   4  
ATOM   2418  C  CG   . PRO A 1 41 ? 15.242  -0.083  -6.157  1.00 0.00 ? 41  PRO A CG   4  
ATOM   2419  C  CD   . PRO A 1 41 ? 15.069  0.198   -4.690  1.00 0.00 ? 41  PRO A CD   4  
ATOM   2420  H  HA   . PRO A 1 41 ? 12.260  -1.190  -5.421  1.00 0.00 ? 41  PRO A HA   4  
ATOM   2421  H  HB2  . PRO A 1 41 ? 14.030  -1.246  -7.479  1.00 0.00 ? 41  PRO A HB2  4  
ATOM   2422  H  HB3  . PRO A 1 41 ? 13.269  0.243   -6.907  1.00 0.00 ? 41  PRO A HB3  4  
ATOM   2423  H  HG2  . PRO A 1 41 ? 15.993  -0.843  -6.307  1.00 0.00 ? 41  PRO A HG2  4  
ATOM   2424  H  HG3  . PRO A 1 41 ? 15.510  0.821   -6.682  1.00 0.00 ? 41  PRO A HG3  4  
ATOM   2425  H  HD2  . PRO A 1 41 ? 15.979  -0.025  -4.153  1.00 0.00 ? 41  PRO A HD2  4  
ATOM   2426  H  HD3  . PRO A 1 41 ? 14.779  1.227   -4.535  1.00 0.00 ? 41  PRO A HD3  4  
ATOM   2427  N  N    . SER A 1 42 ? 12.768  -3.648  -4.985  1.00 0.00 ? 42  SER A N    4  
ATOM   2428  C  CA   . SER A 1 42 ? 12.948  -5.095  -5.019  1.00 0.00 ? 42  SER A CA   4  
ATOM   2429  C  C    . SER A 1 42 ? 12.208  -5.707  -6.204  1.00 0.00 ? 42  SER A C    4  
ATOM   2430  O  O    . SER A 1 42 ? 11.552  -6.741  -6.074  1.00 0.00 ? 42  SER A O    4  
ATOM   2431  C  CB   . SER A 1 42 ? 12.453  -5.723  -3.714  1.00 0.00 ? 42  SER A CB   4  
ATOM   2432  O  OG   . SER A 1 42 ? 11.037  -5.757  -3.670  1.00 0.00 ? 42  SER A OG   4  
ATOM   2433  H  H    . SER A 1 42 ? 11.990  -3.274  -4.522  1.00 0.00 ? 42  SER A H    4  
ATOM   2434  H  HA   . SER A 1 42 ? 14.004  -5.295  -5.127  1.00 0.00 ? 42  SER A HA   4  
ATOM   2435  H  HB2  . SER A 1 42 ? 12.828  -6.732  -3.639  1.00 0.00 ? 42  SER A HB2  4  
ATOM   2436  H  HB3  . SER A 1 42 ? 12.814  -5.141  -2.879  1.00 0.00 ? 42  SER A HB3  4  
ATOM   2437  H  HG   . SER A 1 42 ? 10.745  -6.643  -3.445  1.00 0.00 ? 42  SER A HG   4  
ATOM   2438  N  N    . SER A 1 43 ? 12.317  -5.060  -7.360  1.00 0.00 ? 43  SER A N    4  
ATOM   2439  C  CA   . SER A 1 43 ? 11.655  -5.537  -8.569  1.00 0.00 ? 43  SER A CA   4  
ATOM   2440  C  C    . SER A 1 43 ? 10.138  -5.468  -8.420  1.00 0.00 ? 43  SER A C    4  
ATOM   2441  O  O    . SER A 1 43 ? 9.422   -6.388  -8.814  1.00 0.00 ? 43  SER A O    4  
ATOM   2442  C  CB   . SER A 1 43 ? 12.084  -6.972  -8.878  1.00 0.00 ? 43  SER A CB   4  
ATOM   2443  O  OG   . SER A 1 43 ? 12.031  -7.232  -10.270 1.00 0.00 ? 43  SER A OG   4  
ATOM   2444  H  H    . SER A 1 43 ? 12.854  -4.240  -7.400  1.00 0.00 ? 43  SER A H    4  
ATOM   2445  H  HA   . SER A 1 43 ? 11.955  -4.897  -9.385  1.00 0.00 ? 43  SER A HA   4  
ATOM   2446  H  HB2  . SER A 1 43 ? 13.096  -7.125  -8.534  1.00 0.00 ? 43  SER A HB2  4  
ATOM   2447  H  HB3  . SER A 1 43 ? 11.423  -7.660  -8.370  1.00 0.00 ? 43  SER A HB3  4  
ATOM   2448  H  HG   . SER A 1 43 ? 11.268  -6.790  -10.649 1.00 0.00 ? 43  SER A HG   4  
ATOM   2449  N  N    . GLY A 1 44 ? 9.655   -4.369  -7.849  1.00 0.00 ? 44  GLY A N    4  
ATOM   2450  C  CA   . GLY A 1 44 ? 8.226   -4.199  -7.658  1.00 0.00 ? 44  GLY A CA   4  
ATOM   2451  C  C    . GLY A 1 44 ? 7.603   -3.306  -8.713  1.00 0.00 ? 44  GLY A C    4  
ATOM   2452  O  O    . GLY A 1 44 ? 8.316   -2.512  -9.324  1.00 0.00 ? 44  GLY A O    4  
ATOM   2453  H  H    . GLY A 1 44 ? 10.273  -3.668  -7.555  1.00 0.00 ? 44  GLY A H    4  
ATOM   2454  H  HA2  . GLY A 1 44 ? 7.751   -5.168  -7.695  1.00 0.00 ? 44  GLY A HA2  4  
ATOM   2455  H  HA3  . GLY A 1 44 ? 8.054   -3.762  -6.686  1.00 0.00 ? 44  GLY A HA3  4  
HETATM 2456  ZN ZN   . ZN  B 2 .  ? 4.544   -0.435  2.795   1.00 0.00 ? 181 ZN  A ZN   4  
ATOM   2457  N  N    . GLY A 1 1  ? 8.784   -22.631 -2.695  1.00 0.00 ? 1   GLY A N    5  
ATOM   2458  C  CA   . GLY A 1 1  ? 8.666   -23.271 -3.992  1.00 0.00 ? 1   GLY A CA   5  
ATOM   2459  C  C    . GLY A 1 1  ? 9.442   -22.542 -5.071  1.00 0.00 ? 1   GLY A C    5  
ATOM   2460  O  O    . GLY A 1 1  ? 9.762   -21.363 -4.925  1.00 0.00 ? 1   GLY A O    5  
ATOM   2461  H  H1   . GLY A 1 1  ? 9.160   -21.729 -2.628  1.00 0.00 ? 1   GLY A H1   5  
ATOM   2462  H  HA2  . GLY A 1 1  ? 9.037   -24.283 -3.917  1.00 0.00 ? 1   GLY A HA2  5  
ATOM   2463  H  HA3  . GLY A 1 1  ? 7.623   -23.301 -4.272  1.00 0.00 ? 1   GLY A HA3  5  
ATOM   2464  N  N    . SER A 1 2  ? 9.746   -23.246 -6.157  1.00 0.00 ? 2   SER A N    5  
ATOM   2465  C  CA   . SER A 1 2  ? 10.494  -22.660 -7.263  1.00 0.00 ? 2   SER A CA   5  
ATOM   2466  C  C    . SER A 1 2  ? 9.833   -21.371 -7.743  1.00 0.00 ? 2   SER A C    5  
ATOM   2467  O  O    . SER A 1 2  ? 10.487  -20.336 -7.874  1.00 0.00 ? 2   SER A O    5  
ATOM   2468  C  CB   . SER A 1 2  ? 10.598  -23.655 -8.420  1.00 0.00 ? 2   SER A CB   5  
ATOM   2469  O  OG   . SER A 1 2  ? 9.320   -24.144 -8.788  1.00 0.00 ? 2   SER A OG   5  
ATOM   2470  H  H    . SER A 1 2  ? 9.462   -24.182 -6.214  1.00 0.00 ? 2   SER A H    5  
ATOM   2471  H  HA   . SER A 1 2  ? 11.487  -22.430 -6.907  1.00 0.00 ? 2   SER A HA   5  
ATOM   2472  H  HB2  . SER A 1 2  ? 11.042  -23.165 -9.274  1.00 0.00 ? 2   SER A HB2  5  
ATOM   2473  H  HB3  . SER A 1 2  ? 11.217  -24.488 -8.120  1.00 0.00 ? 2   SER A HB3  5  
ATOM   2474  H  HG   . SER A 1 2  ? 9.220   -24.093 -9.742  1.00 0.00 ? 2   SER A HG   5  
ATOM   2475  N  N    . SER A 1 3  ? 8.531   -21.442 -8.004  1.00 0.00 ? 3   SER A N    5  
ATOM   2476  C  CA   . SER A 1 3  ? 7.781   -20.283 -8.473  1.00 0.00 ? 3   SER A CA   5  
ATOM   2477  C  C    . SER A 1 3  ? 6.717   -19.878 -7.458  1.00 0.00 ? 3   SER A C    5  
ATOM   2478  O  O    . SER A 1 3  ? 6.103   -20.726 -6.813  1.00 0.00 ? 3   SER A O    5  
ATOM   2479  C  CB   . SER A 1 3  ? 7.126   -20.585 -9.822  1.00 0.00 ? 3   SER A CB   5  
ATOM   2480  O  OG   . SER A 1 3  ? 8.096   -20.666 -10.853 1.00 0.00 ? 3   SER A OG   5  
ATOM   2481  H  H    . SER A 1 3  ? 8.065   -22.296 -7.880  1.00 0.00 ? 3   SER A H    5  
ATOM   2482  H  HA   . SER A 1 3  ? 8.476   -19.466 -8.595  1.00 0.00 ? 3   SER A HA   5  
ATOM   2483  H  HB2  . SER A 1 3  ? 6.603   -21.527 -9.763  1.00 0.00 ? 3   SER A HB2  5  
ATOM   2484  H  HB3  . SER A 1 3  ? 6.426   -19.799 -10.064 1.00 0.00 ? 3   SER A HB3  5  
ATOM   2485  H  HG   . SER A 1 3  ? 7.991   -19.923 -11.451 1.00 0.00 ? 3   SER A HG   5  
ATOM   2486  N  N    . GLY A 1 4  ? 6.504   -18.572 -7.323  1.00 0.00 ? 4   GLY A N    5  
ATOM   2487  C  CA   . GLY A 1 4  ? 5.514   -18.075 -6.385  1.00 0.00 ? 4   GLY A CA   5  
ATOM   2488  C  C    . GLY A 1 4  ? 6.075   -17.902 -4.987  1.00 0.00 ? 4   GLY A C    5  
ATOM   2489  O  O    . GLY A 1 4  ? 5.411   -18.221 -4.001  1.00 0.00 ? 4   GLY A O    5  
ATOM   2490  H  H    . GLY A 1 4  ? 7.023   -17.941 -7.864  1.00 0.00 ? 4   GLY A H    5  
ATOM   2491  H  HA2  . GLY A 1 4  ? 5.148   -17.122 -6.736  1.00 0.00 ? 4   GLY A HA2  5  
ATOM   2492  H  HA3  . GLY A 1 4  ? 4.690   -18.773 -6.346  1.00 0.00 ? 4   GLY A HA3  5  
ATOM   2493  N  N    . SER A 1 5  ? 7.301   -17.396 -4.902  1.00 0.00 ? 5   SER A N    5  
ATOM   2494  C  CA   . SER A 1 5  ? 7.953   -17.186 -3.615  1.00 0.00 ? 5   SER A CA   5  
ATOM   2495  C  C    . SER A 1 5  ? 8.115   -15.697 -3.324  1.00 0.00 ? 5   SER A C    5  
ATOM   2496  O  O    . SER A 1 5  ? 7.813   -15.232 -2.225  1.00 0.00 ? 5   SER A O    5  
ATOM   2497  C  CB   . SER A 1 5  ? 9.321   -17.873 -3.594  1.00 0.00 ? 5   SER A CB   5  
ATOM   2498  O  OG   . SER A 1 5  ? 10.197  -17.293 -4.545  1.00 0.00 ? 5   SER A OG   5  
ATOM   2499  H  H    . SER A 1 5  ? 7.779   -17.161 -5.725  1.00 0.00 ? 5   SER A H    5  
ATOM   2500  H  HA   . SER A 1 5  ? 7.329   -17.625 -2.851  1.00 0.00 ? 5   SER A HA   5  
ATOM   2501  H  HB2  . SER A 1 5  ? 9.757   -17.771 -2.612  1.00 0.00 ? 5   SER A HB2  5  
ATOM   2502  H  HB3  . SER A 1 5  ? 9.198   -18.920 -3.827  1.00 0.00 ? 5   SER A HB3  5  
ATOM   2503  H  HG   . SER A 1 5  ? 10.324  -17.901 -5.277  1.00 0.00 ? 5   SER A HG   5  
ATOM   2504  N  N    . SER A 1 6  ? 8.592   -14.955 -4.318  1.00 0.00 ? 6   SER A N    5  
ATOM   2505  C  CA   . SER A 1 6  ? 8.798   -13.519 -4.169  1.00 0.00 ? 6   SER A CA   5  
ATOM   2506  C  C    . SER A 1 6  ? 7.473   -12.803 -3.925  1.00 0.00 ? 6   SER A C    5  
ATOM   2507  O  O    . SER A 1 6  ? 6.826   -12.335 -4.861  1.00 0.00 ? 6   SER A O    5  
ATOM   2508  C  CB   . SER A 1 6  ? 9.477   -12.948 -5.415  1.00 0.00 ? 6   SER A CB   5  
ATOM   2509  O  OG   . SER A 1 6  ? 10.250  -11.804 -5.095  1.00 0.00 ? 6   SER A OG   5  
ATOM   2510  H  H    . SER A 1 6  ? 8.814   -15.384 -5.171  1.00 0.00 ? 6   SER A H    5  
ATOM   2511  H  HA   . SER A 1 6  ? 9.440   -13.363 -3.315  1.00 0.00 ? 6   SER A HA   5  
ATOM   2512  H  HB2  . SER A 1 6  ? 10.126  -13.697 -5.844  1.00 0.00 ? 6   SER A HB2  5  
ATOM   2513  H  HB3  . SER A 1 6  ? 8.723   -12.668 -6.136  1.00 0.00 ? 6   SER A HB3  5  
ATOM   2514  H  HG   . SER A 1 6  ? 10.814  -11.580 -5.839  1.00 0.00 ? 6   SER A HG   5  
ATOM   2515  N  N    . GLY A 1 7  ? 7.075   -12.723 -2.659  1.00 0.00 ? 7   GLY A N    5  
ATOM   2516  C  CA   . GLY A 1 7  ? 5.830   -12.063 -2.313  1.00 0.00 ? 7   GLY A CA   5  
ATOM   2517  C  C    . GLY A 1 7  ? 4.716   -12.378 -3.291  1.00 0.00 ? 7   GLY A C    5  
ATOM   2518  O  O    . GLY A 1 7  ? 4.442   -11.599 -4.205  1.00 0.00 ? 7   GLY A O    5  
ATOM   2519  H  H    . GLY A 1 7  ? 7.632   -13.114 -1.953  1.00 0.00 ? 7   GLY A H    5  
ATOM   2520  H  HA2  . GLY A 1 7  ? 5.528   -12.381 -1.326  1.00 0.00 ? 7   GLY A HA2  5  
ATOM   2521  H  HA3  . GLY A 1 7  ? 5.992   -10.995 -2.302  1.00 0.00 ? 7   GLY A HA3  5  
ATOM   2522  N  N    . THR A 1 8  ? 4.070   -13.524 -3.102  1.00 0.00 ? 8   THR A N    5  
ATOM   2523  C  CA   . THR A 1 8  ? 2.982   -13.942 -3.977  1.00 0.00 ? 8   THR A CA   5  
ATOM   2524  C  C    . THR A 1 8  ? 2.009   -12.796 -4.231  1.00 0.00 ? 8   THR A C    5  
ATOM   2525  O  O    . THR A 1 8  ? 1.550   -12.596 -5.354  1.00 0.00 ? 8   THR A O    5  
ATOM   2526  C  CB   . THR A 1 8  ? 2.209   -15.134 -3.382  1.00 0.00 ? 8   THR A CB   5  
ATOM   2527  O  OG1  . THR A 1 8  ? 1.124   -15.494 -4.244  1.00 0.00 ? 8   THR A OG1  5  
ATOM   2528  C  CG2  . THR A 1 8  ? 1.673   -14.795 -1.999  1.00 0.00 ? 8   THR A CG2  5  
ATOM   2529  H  H    . THR A 1 8  ? 4.334   -14.103 -2.356  1.00 0.00 ? 8   THR A H    5  
ATOM   2530  H  HA   . THR A 1 8  ? 3.411   -14.253 -4.918  1.00 0.00 ? 8   THR A HA   5  
ATOM   2531  H  HB   . THR A 1 8  ? 2.883   -15.974 -3.294  1.00 0.00 ? 8   THR A HB   5  
ATOM   2532  H  HG1  . THR A 1 8  ? 1.324   -15.220 -5.142  1.00 0.00 ? 8   THR A HG1  5  
ATOM   2533  H  HG21 . THR A 1 8  ? 2.499   -14.608 -1.329  1.00 0.00 ? 8   THR A HG21 5  
ATOM   2534  H  HG22 . THR A 1 8  ? 1.088   -15.623 -1.626  1.00 0.00 ? 8   THR A HG22 5  
ATOM   2535  H  HG23 . THR A 1 8  ? 1.051   -13.914 -2.060  1.00 0.00 ? 8   THR A HG23 5  
ATOM   2536  N  N    . GLY A 1 9  ? 1.700   -12.044 -3.178  1.00 0.00 ? 9   GLY A N    5  
ATOM   2537  C  CA   . GLY A 1 9  ? 0.784   -10.926 -3.309  1.00 0.00 ? 9   GLY A CA   5  
ATOM   2538  C  C    . GLY A 1 9  ? -0.664  -11.341 -3.142  1.00 0.00 ? 9   GLY A C    5  
ATOM   2539  O  O    . GLY A 1 9  ? -1.048  -11.874 -2.101  1.00 0.00 ? 9   GLY A O    5  
ATOM   2540  H  H    . GLY A 1 9  ? 2.097   -12.251 -2.306  1.00 0.00 ? 9   GLY A H    5  
ATOM   2541  H  HA2  . GLY A 1 9  ? 1.025   -10.188 -2.559  1.00 0.00 ? 9   GLY A HA2  5  
ATOM   2542  H  HA3  . GLY A 1 9  ? 0.910   -10.485 -4.287  1.00 0.00 ? 9   GLY A HA3  5  
ATOM   2543  N  N    . MET A 1 10 ? -1.471  -11.094 -4.168  1.00 0.00 ? 10  MET A N    5  
ATOM   2544  C  CA   . MET A 1 10 ? -2.886  -11.445 -4.130  1.00 0.00 ? 10  MET A CA   5  
ATOM   2545  C  C    . MET A 1 10 ? -3.553  -10.879 -2.880  1.00 0.00 ? 10  MET A C    5  
ATOM   2546  O  O    . MET A 1 10 ? -4.403  -11.527 -2.269  1.00 0.00 ? 10  MET A O    5  
ATOM   2547  C  CB   . MET A 1 10 ? -3.057  -12.965 -4.169  1.00 0.00 ? 10  MET A CB   5  
ATOM   2548  C  CG   . MET A 1 10 ? -4.462  -13.409 -4.544  1.00 0.00 ? 10  MET A CG   5  
ATOM   2549  S  SD   . MET A 1 10 ? -4.785  -13.268 -6.313  1.00 0.00 ? 10  MET A SD   5  
ATOM   2550  C  CE   . MET A 1 10 ? -6.451  -13.918 -6.405  1.00 0.00 ? 10  MET A CE   5  
ATOM   2551  H  H    . MET A 1 10 ? -1.107  -10.666 -4.971  1.00 0.00 ? 10  MET A H    5  
ATOM   2552  H  HA   . MET A 1 10 ? -3.357  -11.016 -5.001  1.00 0.00 ? 10  MET A HA   5  
ATOM   2553  H  HB2  . MET A 1 10 ? -2.368  -13.375 -4.892  1.00 0.00 ? 10  MET A HB2  5  
ATOM   2554  H  HB3  . MET A 1 10 ? -2.825  -13.367 -3.194  1.00 0.00 ? 10  MET A HB3  5  
ATOM   2555  H  HG2  . MET A 1 10 ? -4.590  -14.440 -4.251  1.00 0.00 ? 10  MET A HG2  5  
ATOM   2556  H  HG3  . MET A 1 10 ? -5.173  -12.795 -4.012  1.00 0.00 ? 10  MET A HG3  5  
ATOM   2557  H  HE1  . MET A 1 10 ? -7.123  -13.140 -6.741  1.00 0.00 ? 10  MET A HE1  5  
ATOM   2558  H  HE2  . MET A 1 10 ? -6.478  -14.742 -7.102  1.00 0.00 ? 10  MET A HE2  5  
ATOM   2559  H  HE3  . MET A 1 10 ? -6.758  -14.262 -5.429  1.00 0.00 ? 10  MET A HE3  5  
ATOM   2560  N  N    . LYS A 1 11 ? -3.162  -9.665  -2.505  1.00 0.00 ? 11  LYS A N    5  
ATOM   2561  C  CA   . LYS A 1 11 ? -3.723  -9.010  -1.329  1.00 0.00 ? 11  LYS A CA   5  
ATOM   2562  C  C    . LYS A 1 11 ? -4.630  -7.852  -1.732  1.00 0.00 ? 11  LYS A C    5  
ATOM   2563  O  O    . LYS A 1 11 ? -4.474  -7.251  -2.795  1.00 0.00 ? 11  LYS A O    5  
ATOM   2564  C  CB   . LYS A 1 11 ? -2.601  -8.501  -0.421  1.00 0.00 ? 11  LYS A CB   5  
ATOM   2565  C  CG   . LYS A 1 11 ? -1.618  -9.581  -0.004  1.00 0.00 ? 11  LYS A CG   5  
ATOM   2566  C  CD   . LYS A 1 11 ? -2.311  -10.703 0.752   1.00 0.00 ? 11  LYS A CD   5  
ATOM   2567  C  CE   . LYS A 1 11 ? -2.817  -10.233 2.107   1.00 0.00 ? 11  LYS A CE   5  
ATOM   2568  N  NZ   . LYS A 1 11 ? -3.186  -11.375 2.988   1.00 0.00 ? 11  LYS A NZ   5  
ATOM   2569  H  H    . LYS A 1 11 ? -2.481  -9.198  -3.034  1.00 0.00 ? 11  LYS A H    5  
ATOM   2570  H  HA   . LYS A 1 11 ? -4.308  -9.739  -0.790  1.00 0.00 ? 11  LYS A HA   5  
ATOM   2571  H  HB2  . LYS A 1 11 ? -2.055  -7.728  -0.942  1.00 0.00 ? 11  LYS A HB2  5  
ATOM   2572  H  HB3  . LYS A 1 11 ? -3.041  -8.080  0.472   1.00 0.00 ? 11  LYS A HB3  5  
ATOM   2573  H  HG2  . LYS A 1 11 ? -1.152  -9.991  -0.887  1.00 0.00 ? 11  LYS A HG2  5  
ATOM   2574  H  HG3  . LYS A 1 11 ? -0.864  -9.142  0.633   1.00 0.00 ? 11  LYS A HG3  5  
ATOM   2575  H  HD2  . LYS A 1 11 ? -3.149  -11.054 0.169   1.00 0.00 ? 11  LYS A HD2  5  
ATOM   2576  H  HD3  . LYS A 1 11 ? -1.609  -11.512 0.900   1.00 0.00 ? 11  LYS A HD3  5  
ATOM   2577  H  HE2  . LYS A 1 11 ? -2.041  -9.657  2.586   1.00 0.00 ? 11  LYS A HE2  5  
ATOM   2578  H  HE3  . LYS A 1 11 ? -3.686  -9.610  1.955   1.00 0.00 ? 11  LYS A HE3  5  
ATOM   2579  H  HZ1  . LYS A 1 11 ? -3.174  -12.263 2.446   1.00 0.00 ? 11  LYS A HZ1  5  
ATOM   2580  H  HZ2  . LYS A 1 11 ? -4.140  -11.232 3.376   1.00 0.00 ? 11  LYS A HZ2  5  
ATOM   2581  H  HZ3  . LYS A 1 11 ? -2.512  -11.453 3.775   1.00 0.00 ? 11  LYS A HZ3  5  
ATOM   2582  N  N    . PRO A 1 12 ? -5.600  -7.529  -0.864  1.00 0.00 ? 12  PRO A N    5  
ATOM   2583  C  CA   . PRO A 1 12 ? -6.550  -6.440  -1.107  1.00 0.00 ? 12  PRO A CA   5  
ATOM   2584  C  C    . PRO A 1 12 ? -5.890  -5.067  -1.031  1.00 0.00 ? 12  PRO A C    5  
ATOM   2585  O  O    . PRO A 1 12 ? -5.390  -4.551  -2.030  1.00 0.00 ? 12  PRO A O    5  
ATOM   2586  C  CB   . PRO A 1 12 ? -7.574  -6.604  0.018   1.00 0.00 ? 12  PRO A CB   5  
ATOM   2587  C  CG   . PRO A 1 12 ? -6.833  -7.300  1.107   1.00 0.00 ? 12  PRO A CG   5  
ATOM   2588  C  CD   . PRO A 1 12 ? -5.844  -8.203  0.422   1.00 0.00 ? 12  PRO A CD   5  
ATOM   2589  H  HA   . PRO A 1 12 ? -7.042  -6.548  -2.063  1.00 0.00 ? 12  PRO A HA   5  
ATOM   2590  H  HB2  . PRO A 1 12 ? -7.923  -5.632  0.336   1.00 0.00 ? 12  PRO A HB2  5  
ATOM   2591  H  HB3  . PRO A 1 12 ? -8.407  -7.195  -0.332  1.00 0.00 ? 12  PRO A HB3  5  
ATOM   2592  H  HG2  . PRO A 1 12 ? -6.318  -6.577  1.721   1.00 0.00 ? 12  PRO A HG2  5  
ATOM   2593  H  HG3  . PRO A 1 12 ? -7.519  -7.882  1.704   1.00 0.00 ? 12  PRO A HG3  5  
ATOM   2594  H  HD2  . PRO A 1 12 ? -4.934  -8.273  1.000   1.00 0.00 ? 12  PRO A HD2  5  
ATOM   2595  H  HD3  . PRO A 1 12 ? -6.272  -9.183  0.268   1.00 0.00 ? 12  PRO A HD3  5  
ATOM   2596  N  N    . TYR A 1 13 ? -5.891  -4.482  0.162   1.00 0.00 ? 13  TYR A N    5  
ATOM   2597  C  CA   . TYR A 1 13 ? -5.294  -3.168  0.368   1.00 0.00 ? 13  TYR A CA   5  
ATOM   2598  C  C    . TYR A 1 13 ? -3.961  -3.284  1.101   1.00 0.00 ? 13  TYR A C    5  
ATOM   2599  O  O    . TYR A 1 13 ? -3.418  -2.293  1.589   1.00 0.00 ? 13  TYR A O    5  
ATOM   2600  C  CB   . TYR A 1 13 ? -6.246  -2.270  1.160   1.00 0.00 ? 13  TYR A CB   5  
ATOM   2601  C  CG   . TYR A 1 13 ? -7.706  -2.613  0.962   1.00 0.00 ? 13  TYR A CG   5  
ATOM   2602  C  CD1  . TYR A 1 13 ? -8.275  -3.707  1.602   1.00 0.00 ? 13  TYR A CD1  5  
ATOM   2603  C  CD2  . TYR A 1 13 ? -8.515  -1.842  0.137   1.00 0.00 ? 13  TYR A CD2  5  
ATOM   2604  C  CE1  . TYR A 1 13 ? -9.608  -4.025  1.424   1.00 0.00 ? 13  TYR A CE1  5  
ATOM   2605  C  CE2  . TYR A 1 13 ? -9.849  -2.152  -0.045  1.00 0.00 ? 13  TYR A CE2  5  
ATOM   2606  C  CZ   . TYR A 1 13 ? -10.391 -3.244  0.600   1.00 0.00 ? 13  TYR A CZ   5  
ATOM   2607  O  OH   . TYR A 1 13 ? -11.719 -3.556  0.421   1.00 0.00 ? 13  TYR A OH   5  
ATOM   2608  H  H    . TYR A 1 13 ? -6.305  -4.943  0.921   1.00 0.00 ? 13  TYR A H    5  
ATOM   2609  H  HA   . TYR A 1 13 ? -5.121  -2.726  -0.602  1.00 0.00 ? 13  TYR A HA   5  
ATOM   2610  H  HB2  . TYR A 1 13 ? -6.024  -2.360  2.212   1.00 0.00 ? 13  TYR A HB2  5  
ATOM   2611  H  HB3  . TYR A 1 13 ? -6.102  -1.244  0.852   1.00 0.00 ? 13  TYR A HB3  5  
ATOM   2612  H  HD1  . TYR A 1 13 ? -7.659  -4.316  2.248   1.00 0.00 ? 13  TYR A HD1  5  
ATOM   2613  H  HD2  . TYR A 1 13 ? -8.089  -0.987  -0.367  1.00 0.00 ? 13  TYR A HD2  5  
ATOM   2614  H  HE1  . TYR A 1 13 ? -10.032 -4.880  1.930   1.00 0.00 ? 13  TYR A HE1  5  
ATOM   2615  H  HE2  . TYR A 1 13 ? -10.463 -1.541  -0.691  1.00 0.00 ? 13  TYR A HE2  5  
ATOM   2616  H  HH   . TYR A 1 13 ? -12.031 -4.067  1.172   1.00 0.00 ? 13  TYR A HH   5  
ATOM   2617  N  N    . VAL A 1 14 ? -3.438  -4.504  1.174   1.00 0.00 ? 14  VAL A N    5  
ATOM   2618  C  CA   . VAL A 1 14 ? -2.167  -4.753  1.845   1.00 0.00 ? 14  VAL A CA   5  
ATOM   2619  C  C    . VAL A 1 14 ? -0.994  -4.292  0.988   1.00 0.00 ? 14  VAL A C    5  
ATOM   2620  O  O    . VAL A 1 14 ? -1.001  -4.452  -0.233  1.00 0.00 ? 14  VAL A O    5  
ATOM   2621  C  CB   . VAL A 1 14 ? -1.991  -6.246  2.177   1.00 0.00 ? 14  VAL A CB   5  
ATOM   2622  C  CG1  . VAL A 1 14 ? -0.823  -6.447  3.132   1.00 0.00 ? 14  VAL A CG1  5  
ATOM   2623  C  CG2  . VAL A 1 14 ? -3.273  -6.817  2.764   1.00 0.00 ? 14  VAL A CG2  5  
ATOM   2624  H  H    . VAL A 1 14 ? -3.917  -5.255  0.766   1.00 0.00 ? 14  VAL A H    5  
ATOM   2625  H  HA   . VAL A 1 14 ? -2.165  -4.197  2.771   1.00 0.00 ? 14  VAL A HA   5  
ATOM   2626  H  HB   . VAL A 1 14 ? -1.772  -6.775  1.261   1.00 0.00 ? 14  VAL A HB   5  
ATOM   2627  H  HG11 . VAL A 1 14 ? -0.461  -7.461  3.049   1.00 0.00 ? 14  VAL A HG11 5  
ATOM   2628  H  HG12 . VAL A 1 14 ? -0.030  -5.758  2.880   1.00 0.00 ? 14  VAL A HG12 5  
ATOM   2629  H  HG13 . VAL A 1 14 ? -1.151  -6.264  4.145   1.00 0.00 ? 14  VAL A HG13 5  
ATOM   2630  H  HG21 . VAL A 1 14 ? -4.105  -6.567  2.122   1.00 0.00 ? 14  VAL A HG21 5  
ATOM   2631  H  HG22 . VAL A 1 14 ? -3.187  -7.890  2.840   1.00 0.00 ? 14  VAL A HG22 5  
ATOM   2632  H  HG23 . VAL A 1 14 ? -3.438  -6.398  3.746   1.00 0.00 ? 14  VAL A HG23 5  
ATOM   2633  N  N    . CYS A 1 15 ? 0.015   -3.718  1.636   1.00 0.00 ? 15  CYS A N    5  
ATOM   2634  C  CA   . CYS A 1 15 ? 1.197   -3.233  0.934   1.00 0.00 ? 15  CYS A CA   5  
ATOM   2635  C  C    . CYS A 1 15 ? 1.972   -4.390  0.309   1.00 0.00 ? 15  CYS A C    5  
ATOM   2636  O  O    . CYS A 1 15 ? 2.398   -5.312  1.004   1.00 0.00 ? 15  CYS A O    5  
ATOM   2637  C  CB   . CYS A 1 15 ? 2.103   -2.457  1.893   1.00 0.00 ? 15  CYS A CB   5  
ATOM   2638  S  SG   . CYS A 1 15 ? 3.067   -1.133  1.097   1.00 0.00 ? 15  CYS A SG   5  
ATOM   2639  H  H    . CYS A 1 15 ? -0.037  -3.618  2.610   1.00 0.00 ? 15  CYS A H    5  
ATOM   2640  H  HA   . CYS A 1 15 ? 0.869   -2.571  0.148   1.00 0.00 ? 15  CYS A HA   5  
ATOM   2641  H  HB2  . CYS A 1 15 ? 1.494   -2.003  2.662   1.00 0.00 ? 15  CYS A HB2  5  
ATOM   2642  H  HB3  . CYS A 1 15 ? 2.800   -3.143  2.351   1.00 0.00 ? 15  CYS A HB3  5  
ATOM   2643  N  N    . ASN A 1 16 ? 2.151   -4.333  -1.006  1.00 0.00 ? 16  ASN A N    5  
ATOM   2644  C  CA   . ASN A 1 16 ? 2.874   -5.376  -1.725  1.00 0.00 ? 16  ASN A CA   5  
ATOM   2645  C  C    . ASN A 1 16 ? 4.380   -5.136  -1.662  1.00 0.00 ? 16  ASN A C    5  
ATOM   2646  O  O    . ASN A 1 16 ? 5.131   -5.619  -2.508  1.00 0.00 ? 16  ASN A O    5  
ATOM   2647  C  CB   . ASN A 1 16 ? 2.416   -5.431  -3.184  1.00 0.00 ? 16  ASN A CB   5  
ATOM   2648  C  CG   . ASN A 1 16 ? 2.512   -6.827  -3.768  1.00 0.00 ? 16  ASN A CG   5  
ATOM   2649  O  OD1  . ASN A 1 16 ? 1.613   -7.649  -3.590  1.00 0.00 ? 16  ASN A OD1  5  
ATOM   2650  N  ND2  . ASN A 1 16 ? 3.605   -7.100  -4.470  1.00 0.00 ? 16  ASN A ND2  5  
ATOM   2651  H  H    . ASN A 1 16 ? 1.788   -3.572  -1.506  1.00 0.00 ? 16  ASN A H    5  
ATOM   2652  H  HA   . ASN A 1 16 ? 2.652   -6.320  -1.252  1.00 0.00 ? 16  ASN A HA   5  
ATOM   2653  H  HB2  . ASN A 1 16 ? 1.387   -5.106  -3.244  1.00 0.00 ? 16  ASN A HB2  5  
ATOM   2654  H  HB3  . ASN A 1 16 ? 3.033   -4.770  -3.774  1.00 0.00 ? 16  ASN A HB3  5  
ATOM   2655  H  HD21 . ASN A 1 16 ? 4.280   -6.396  -4.570  1.00 0.00 ? 16  ASN A HD21 5  
ATOM   2656  H  HD22 . ASN A 1 16 ? 3.693   -7.995  -4.859  1.00 0.00 ? 16  ASN A HD22 5  
ATOM   2657  N  N    . GLU A 1 17 ? 4.812   -4.387  -0.652  1.00 0.00 ? 17  GLU A N    5  
ATOM   2658  C  CA   . GLU A 1 17 ? 6.228   -4.084  -0.479  1.00 0.00 ? 17  GLU A CA   5  
ATOM   2659  C  C    . GLU A 1 17 ? 6.707   -4.494  0.910   1.00 0.00 ? 17  GLU A C    5  
ATOM   2660  O  O    . GLU A 1 17 ? 7.759   -5.116  1.059   1.00 0.00 ? 17  GLU A O    5  
ATOM   2661  C  CB   . GLU A 1 17 ? 6.483   -2.591  -0.698  1.00 0.00 ? 17  GLU A CB   5  
ATOM   2662  C  CG   . GLU A 1 17 ? 5.987   -2.079  -2.040  1.00 0.00 ? 17  GLU A CG   5  
ATOM   2663  C  CD   . GLU A 1 17 ? 7.039   -2.179  -3.127  1.00 0.00 ? 17  GLU A CD   5  
ATOM   2664  O  OE1  . GLU A 1 17 ? 7.878   -1.259  -3.226  1.00 0.00 ? 17  GLU A OE1  5  
ATOM   2665  O  OE2  . GLU A 1 17 ? 7.025   -3.176  -3.879  1.00 0.00 ? 17  GLU A OE2  5  
ATOM   2666  H  H    . GLU A 1 17 ? 4.165   -4.031  -0.009  1.00 0.00 ? 17  GLU A H    5  
ATOM   2667  H  HA   . GLU A 1 17 ? 6.780   -4.646  -1.217  1.00 0.00 ? 17  GLU A HA   5  
ATOM   2668  H  HB2  . GLU A 1 17 ? 5.985   -2.035  0.083   1.00 0.00 ? 17  GLU A HB2  5  
ATOM   2669  H  HB3  . GLU A 1 17 ? 7.545   -2.407  -0.637  1.00 0.00 ? 17  GLU A HB3  5  
ATOM   2670  H  HG2  . GLU A 1 17 ? 5.128   -2.662  -2.338  1.00 0.00 ? 17  GLU A HG2  5  
ATOM   2671  H  HG3  . GLU A 1 17 ? 5.699   -1.044  -1.932  1.00 0.00 ? 17  GLU A HG3  5  
ATOM   2672  N  N    . CYS A 1 18 ? 5.927   -4.141  1.927   1.00 0.00 ? 18  CYS A N    5  
ATOM   2673  C  CA   . CYS A 1 18 ? 6.269   -4.471  3.305   1.00 0.00 ? 18  CYS A CA   5  
ATOM   2674  C  C    . CYS A 1 18 ? 5.278   -5.474  3.887   1.00 0.00 ? 18  CYS A C    5  
ATOM   2675  O  O    . CYS A 1 18 ? 5.641   -6.320  4.703   1.00 0.00 ? 18  CYS A O    5  
ATOM   2676  C  CB   . CYS A 1 18 ? 6.293   -3.205  4.163   1.00 0.00 ? 18  CYS A CB   5  
ATOM   2677  S  SG   . CYS A 1 18 ? 4.748   -2.241  4.109   1.00 0.00 ? 18  CYS A SG   5  
ATOM   2678  H  H    . CYS A 1 18 ? 5.100   -3.646  1.745   1.00 0.00 ? 18  CYS A H    5  
ATOM   2679  H  HA   . CYS A 1 18 ? 7.253   -4.914  3.305   1.00 0.00 ? 18  CYS A HA   5  
ATOM   2680  H  HB2  . CYS A 1 18 ? 6.472   -3.480  5.192   1.00 0.00 ? 18  CYS A HB2  5  
ATOM   2681  H  HB3  . CYS A 1 18 ? 7.093   -2.564  3.824   1.00 0.00 ? 18  CYS A HB3  5  
ATOM   2682  N  N    . GLY A 1 19 ? 4.023   -5.374  3.459   1.00 0.00 ? 19  GLY A N    5  
ATOM   2683  C  CA   . GLY A 1 19 ? 2.998   -6.279  3.947   1.00 0.00 ? 19  GLY A CA   5  
ATOM   2684  C  C    . GLY A 1 19 ? 2.028   -5.599  4.893   1.00 0.00 ? 19  GLY A C    5  
ATOM   2685  O  O    . GLY A 1 19 ? 1.306   -6.263  5.637   1.00 0.00 ? 19  GLY A O    5  
ATOM   2686  H  H    . GLY A 1 19 ? 3.791   -4.680  2.807   1.00 0.00 ? 19  GLY A H    5  
ATOM   2687  H  HA2  . GLY A 1 19 ? 2.449   -6.672  3.105   1.00 0.00 ? 19  GLY A HA2  5  
ATOM   2688  H  HA3  . GLY A 1 19 ? 3.475   -7.097  4.467   1.00 0.00 ? 19  GLY A HA3  5  
ATOM   2689  N  N    . LYS A 1 20 ? 2.010   -4.271  4.866   1.00 0.00 ? 20  LYS A N    5  
ATOM   2690  C  CA   . LYS A 1 20 ? 1.121   -3.499  5.727   1.00 0.00 ? 20  LYS A CA   5  
ATOM   2691  C  C    . LYS A 1 20 ? -0.330  -3.644  5.280   1.00 0.00 ? 20  LYS A C    5  
ATOM   2692  O  O    . LYS A 1 20 ? -0.706  -3.183  4.202   1.00 0.00 ? 20  LYS A O    5  
ATOM   2693  C  CB   . LYS A 1 20 ? 1.524   -2.023  5.718   1.00 0.00 ? 20  LYS A CB   5  
ATOM   2694  C  CG   . LYS A 1 20 ? 1.262   -1.313  7.035   1.00 0.00 ? 20  LYS A CG   5  
ATOM   2695  C  CD   . LYS A 1 20 ? -0.210  -1.357  7.408   1.00 0.00 ? 20  LYS A CD   5  
ATOM   2696  C  CE   . LYS A 1 20 ? -0.573  -0.244  8.379   1.00 0.00 ? 20  LYS A CE   5  
ATOM   2697  N  NZ   . LYS A 1 20 ? -1.855  -0.518  9.084   1.00 0.00 ? 20  LYS A NZ   5  
ATOM   2698  H  H    . LYS A 1 20 ? 2.609   -3.797  4.250   1.00 0.00 ? 20  LYS A H    5  
ATOM   2699  H  HA   . LYS A 1 20 ? 1.216   -3.883  6.731   1.00 0.00 ? 20  LYS A HA   5  
ATOM   2700  H  HB2  . LYS A 1 20 ? 2.579   -1.951  5.498   1.00 0.00 ? 20  LYS A HB2  5  
ATOM   2701  H  HB3  . LYS A 1 20 ? 0.969   -1.515  4.942   1.00 0.00 ? 20  LYS A HB3  5  
ATOM   2702  H  HG2  . LYS A 1 20 ? 1.834   -1.795  7.813   1.00 0.00 ? 20  LYS A HG2  5  
ATOM   2703  H  HG3  . LYS A 1 20 ? 1.570   -0.281  6.944   1.00 0.00 ? 20  LYS A HG3  5  
ATOM   2704  H  HD2  . LYS A 1 20 ? -0.804  -1.246  6.513   1.00 0.00 ? 20  LYS A HD2  5  
ATOM   2705  H  HD3  . LYS A 1 20 ? -0.427  -2.310  7.870   1.00 0.00 ? 20  LYS A HD3  5  
ATOM   2706  H  HE2  . LYS A 1 20 ? 0.217   -0.149  9.109   1.00 0.00 ? 20  LYS A HE2  5  
ATOM   2707  H  HE3  . LYS A 1 20 ? -0.665  0.680   7.827   1.00 0.00 ? 20  LYS A HE3  5  
ATOM   2708  H  HZ1  . LYS A 1 20 ? -2.619  -0.664  8.394   1.00 0.00 ? 20  LYS A HZ1  5  
ATOM   2709  H  HZ2  . LYS A 1 20 ? -2.104  0.284   9.697   1.00 0.00 ? 20  LYS A HZ2  5  
ATOM   2710  H  HZ3  . LYS A 1 20 ? -1.765  -1.372  9.671   1.00 0.00 ? 20  LYS A HZ3  5  
ATOM   2711  N  N    . ALA A 1 21 ? -1.140  -4.285  6.115   1.00 0.00 ? 21  ALA A N    5  
ATOM   2712  C  CA   . ALA A 1 21 ? -2.551  -4.486  5.807   1.00 0.00 ? 21  ALA A CA   5  
ATOM   2713  C  C    . ALA A 1 21 ? -3.395  -3.322  6.314   1.00 0.00 ? 21  ALA A C    5  
ATOM   2714  O  O    . ALA A 1 21 ? -3.214  -2.854  7.438   1.00 0.00 ? 21  ALA A O    5  
ATOM   2715  C  CB   . ALA A 1 21 ? -3.040  -5.796  6.407   1.00 0.00 ? 21  ALA A CB   5  
ATOM   2716  H  H    . ALA A 1 21 ? -0.782  -4.630  6.959   1.00 0.00 ? 21  ALA A H    5  
ATOM   2717  H  HA   . ALA A 1 21 ? -2.652  -4.551  4.733   1.00 0.00 ? 21  ALA A HA   5  
ATOM   2718  H  HB1  . ALA A 1 21 ? -2.441  -6.042  7.270   1.00 0.00 ? 21  ALA A HB1  5  
ATOM   2719  H  HB2  . ALA A 1 21 ? -4.074  -5.691  6.703   1.00 0.00 ? 21  ALA A HB2  5  
ATOM   2720  H  HB3  . ALA A 1 21 ? -2.954  -6.583  5.672   1.00 0.00 ? 21  ALA A HB3  5  
ATOM   2721  N  N    . PHE A 1 22 ? -4.318  -2.858  5.477   1.00 0.00 ? 22  PHE A N    5  
ATOM   2722  C  CA   . PHE A 1 22 ? -5.189  -1.747  5.840   1.00 0.00 ? 22  PHE A CA   5  
ATOM   2723  C  C    . PHE A 1 22 ? -6.657  -2.130  5.673   1.00 0.00 ? 22  PHE A C    5  
ATOM   2724  O  O    . PHE A 1 22 ? -6.976  -3.255  5.289   1.00 0.00 ? 22  PHE A O    5  
ATOM   2725  C  CB   . PHE A 1 22 ? -4.870  -0.520  4.984   1.00 0.00 ? 22  PHE A CB   5  
ATOM   2726  C  CG   . PHE A 1 22 ? -3.415  -0.149  4.987   1.00 0.00 ? 22  PHE A CG   5  
ATOM   2727  C  CD1  . PHE A 1 22 ? -2.503  -0.859  4.223   1.00 0.00 ? 22  PHE A CD1  5  
ATOM   2728  C  CD2  . PHE A 1 22 ? -2.958  0.911   5.755   1.00 0.00 ? 22  PHE A CD2  5  
ATOM   2729  C  CE1  . PHE A 1 22 ? -1.163  -0.519  4.224   1.00 0.00 ? 22  PHE A CE1  5  
ATOM   2730  C  CE2  . PHE A 1 22 ? -1.620  1.255   5.760   1.00 0.00 ? 22  PHE A CE2  5  
ATOM   2731  C  CZ   . PHE A 1 22 ? -0.721  0.538   4.994   1.00 0.00 ? 22  PHE A CZ   5  
ATOM   2732  H  H    . PHE A 1 22 ? -4.414  -3.273  4.594   1.00 0.00 ? 22  PHE A H    5  
ATOM   2733  H  HA   . PHE A 1 22 ? -5.007  -1.509  6.877   1.00 0.00 ? 22  PHE A HA   5  
ATOM   2734  H  HB2  . PHE A 1 22 ? -5.159  -0.718  3.962   1.00 0.00 ? 22  PHE A HB2  5  
ATOM   2735  H  HB3  . PHE A 1 22 ? -5.431  0.325   5.355   1.00 0.00 ? 22  PHE A HB3  5  
ATOM   2736  H  HD1  . PHE A 1 22 ? -2.848  -1.687  3.620   1.00 0.00 ? 22  PHE A HD1  5  
ATOM   2737  H  HD2  . PHE A 1 22 ? -3.660  1.471   6.356   1.00 0.00 ? 22  PHE A HD2  5  
ATOM   2738  H  HE1  . PHE A 1 22 ? -0.463  -1.082  3.624   1.00 0.00 ? 22  PHE A HE1  5  
ATOM   2739  H  HE2  . PHE A 1 22 ? -1.277  2.082   6.363   1.00 0.00 ? 22  PHE A HE2  5  
ATOM   2740  H  HZ   . PHE A 1 22 ? 0.325   0.805   4.995   1.00 0.00 ? 22  PHE A HZ   5  
ATOM   2741  N  N    . ARG A 1 23 ? -7.545  -1.186  5.966   1.00 0.00 ? 23  ARG A N    5  
ATOM   2742  C  CA   . ARG A 1 23 ? -8.979  -1.424  5.851   1.00 0.00 ? 23  ARG A CA   5  
ATOM   2743  C  C    . ARG A 1 23 ? -9.497  -0.974  4.488   1.00 0.00 ? 23  ARG A C    5  
ATOM   2744  O  O    . ARG A 1 23 ? -10.398 -1.591  3.920   1.00 0.00 ? 23  ARG A O    5  
ATOM   2745  C  CB   . ARG A 1 23 ? -9.731  -0.689  6.962   1.00 0.00 ? 23  ARG A CB   5  
ATOM   2746  C  CG   . ARG A 1 23 ? -9.286  -1.082  8.361   1.00 0.00 ? 23  ARG A CG   5  
ATOM   2747  C  CD   . ARG A 1 23 ? -10.311 -0.673  9.407   1.00 0.00 ? 23  ARG A CD   5  
ATOM   2748  N  NE   . ARG A 1 23 ? -11.549 -1.439  9.290   1.00 0.00 ? 23  ARG A NE   5  
ATOM   2749  C  CZ   . ARG A 1 23 ? -12.726 -1.005  9.728   1.00 0.00 ? 23  ARG A CZ   5  
ATOM   2750  N  NH1  . ARG A 1 23 ? -12.824 0.183   10.308  1.00 0.00 ? 23  ARG A NH1  5  
ATOM   2751  N  NH2  . ARG A 1 23 ? -13.808 -1.760  9.584   1.00 0.00 ? 23  ARG A NH2  5  
ATOM   2752  H  H    . ARG A 1 23 ? -7.229  -0.308  6.268   1.00 0.00 ? 23  ARG A H    5  
ATOM   2753  H  HA   . ARG A 1 23 ? -9.149  -2.485  5.955   1.00 0.00 ? 23  ARG A HA   5  
ATOM   2754  H  HB2  . ARG A 1 23 ? -9.575  0.374   6.844   1.00 0.00 ? 23  ARG A HB2  5  
ATOM   2755  H  HB3  . ARG A 1 23 ? -10.785 -0.902  6.869   1.00 0.00 ? 23  ARG A HB3  5  
ATOM   2756  H  HG2  . ARG A 1 23 ? -9.157  -2.154  8.400   1.00 0.00 ? 23  ARG A HG2  5  
ATOM   2757  H  HG3  . ARG A 1 23 ? -8.347  -0.596  8.580   1.00 0.00 ? 23  ARG A HG3  5  
ATOM   2758  H  HD2  . ARG A 1 23 ? -9.890  -0.836  10.388  1.00 0.00 ? 23  ARG A HD2  5  
ATOM   2759  H  HD3  . ARG A 1 23 ? -10.534 0.376   9.281   1.00 0.00 ? 23  ARG A HD3  5  
ATOM   2760  H  HE   . ARG A 1 23 ? -11.499 -2.319  8.864   1.00 0.00 ? 23  ARG A HE   5  
ATOM   2761  H  HH11 . ARG A 1 23 ? -12.011 0.754   10.417  1.00 0.00 ? 23  ARG A HH11 5  
ATOM   2762  H  HH12 . ARG A 1 23 ? -13.712 0.507   10.636  1.00 0.00 ? 23  ARG A HH12 5  
ATOM   2763  H  HH21 . ARG A 1 23 ? -13.737 -2.656  9.147   1.00 0.00 ? 23  ARG A HH21 5  
ATOM   2764  H  HH22 . ARG A 1 23 ? -14.693 -1.433  9.914   1.00 0.00 ? 23  ARG A HH22 5  
ATOM   2765  N  N    . SER A 1 24 ? -8.921  0.106   3.969   1.00 0.00 ? 24  SER A N    5  
ATOM   2766  C  CA   . SER A 1 24 ? -9.327  0.642   2.675   1.00 0.00 ? 24  SER A CA   5  
ATOM   2767  C  C    . SER A 1 24 ? -8.110  1.049   1.850   1.00 0.00 ? 24  SER A C    5  
ATOM   2768  O  O    . SER A 1 24 ? -7.044  1.336   2.394   1.00 0.00 ? 24  SER A O    5  
ATOM   2769  C  CB   . SER A 1 24 ? -10.255 1.843   2.865   1.00 0.00 ? 24  SER A CB   5  
ATOM   2770  O  OG   . SER A 1 24 ? -9.657  2.822   3.697   1.00 0.00 ? 24  SER A OG   5  
ATOM   2771  H  H    . SER A 1 24 ? -8.207  0.554   4.470   1.00 0.00 ? 24  SER A H    5  
ATOM   2772  H  HA   . SER A 1 24 ? -9.861  -0.135  2.147   1.00 0.00 ? 24  SER A HA   5  
ATOM   2773  H  HB2  . SER A 1 24 ? -10.467 2.286   1.904   1.00 0.00 ? 24  SER A HB2  5  
ATOM   2774  H  HB3  . SER A 1 24 ? -11.177 1.514   3.321   1.00 0.00 ? 24  SER A HB3  5  
ATOM   2775  H  HG   . SER A 1 24 ? -9.173  2.390   4.403   1.00 0.00 ? 24  SER A HG   5  
ATOM   2776  N  N    . LYS A 1 25 ? -8.278  1.073   0.532   1.00 0.00 ? 25  LYS A N    5  
ATOM   2777  C  CA   . LYS A 1 25 ? -7.196  1.447   -0.371  1.00 0.00 ? 25  LYS A CA   5  
ATOM   2778  C  C    . LYS A 1 25 ? -6.662  2.836   -0.036  1.00 0.00 ? 25  LYS A C    5  
ATOM   2779  O  O    . LYS A 1 25 ? -5.451  3.050   0.016   1.00 0.00 ? 25  LYS A O    5  
ATOM   2780  C  CB   . LYS A 1 25 ? -7.680  1.412   -1.823  1.00 0.00 ? 25  LYS A CB   5  
ATOM   2781  C  CG   . LYS A 1 25 ? -6.554  1.466   -2.841  1.00 0.00 ? 25  LYS A CG   5  
ATOM   2782  C  CD   . LYS A 1 25 ? -7.037  2.005   -4.177  1.00 0.00 ? 25  LYS A CD   5  
ATOM   2783  C  CE   . LYS A 1 25 ? -7.885  0.982   -4.917  1.00 0.00 ? 25  LYS A CE   5  
ATOM   2784  N  NZ   . LYS A 1 25 ? -7.074  -0.174  -5.390  1.00 0.00 ? 25  LYS A NZ   5  
ATOM   2785  H  H    . LYS A 1 25 ? -9.152  0.835   0.157   1.00 0.00 ? 25  LYS A H    5  
ATOM   2786  H  HA   . LYS A 1 25 ? -6.399  0.729   -0.249  1.00 0.00 ? 25  LYS A HA   5  
ATOM   2787  H  HB2  . LYS A 1 25 ? -8.238  0.501   -1.981  1.00 0.00 ? 25  LYS A HB2  5  
ATOM   2788  H  HB3  . LYS A 1 25 ? -8.332  2.257   -1.992  1.00 0.00 ? 25  LYS A HB3  5  
ATOM   2789  H  HG2  . LYS A 1 25 ? -5.773  2.110   -2.466  1.00 0.00 ? 25  LYS A HG2  5  
ATOM   2790  H  HG3  . LYS A 1 25 ? -6.163  0.469   -2.985  1.00 0.00 ? 25  LYS A HG3  5  
ATOM   2791  H  HD2  . LYS A 1 25 ? -7.629  2.891   -4.006  1.00 0.00 ? 25  LYS A HD2  5  
ATOM   2792  H  HD3  . LYS A 1 25 ? -6.179  2.255   -4.785  1.00 0.00 ? 25  LYS A HD3  5  
ATOM   2793  H  HE2  . LYS A 1 25 ? -8.654  0.622   -4.251  1.00 0.00 ? 25  LYS A HE2  5  
ATOM   2794  H  HE3  . LYS A 1 25 ? -8.343  1.462   -5.769  1.00 0.00 ? 25  LYS A HE3  5  
ATOM   2795  H  HZ1  . LYS A 1 25 ? -6.760  -0.746  -4.580  1.00 0.00 ? 25  LYS A HZ1  5  
ATOM   2796  H  HZ2  . LYS A 1 25 ? -6.238  0.165   -5.907  1.00 0.00 ? 25  LYS A HZ2  5  
ATOM   2797  H  HZ3  . LYS A 1 25 ? -7.641  -0.773  -6.024  1.00 0.00 ? 25  LYS A HZ3  5  
ATOM   2798  N  N    . SER A 1 26 ? -7.574  3.776   0.194   1.00 0.00 ? 26  SER A N    5  
ATOM   2799  C  CA   . SER A 1 26 ? -7.195  5.145   0.522   1.00 0.00 ? 26  SER A CA   5  
ATOM   2800  C  C    . SER A 1 26 ? -6.277  5.177   1.741   1.00 0.00 ? 26  SER A C    5  
ATOM   2801  O  O    . SER A 1 26 ? -5.492  6.109   1.916   1.00 0.00 ? 26  SER A O    5  
ATOM   2802  C  CB   . SER A 1 26 ? -8.441  5.993   0.786   1.00 0.00 ? 26  SER A CB   5  
ATOM   2803  O  OG   . SER A 1 26 ? -9.203  5.459   1.855   1.00 0.00 ? 26  SER A OG   5  
ATOM   2804  H  H    . SER A 1 26 ? -8.525  3.543   0.138   1.00 0.00 ? 26  SER A H    5  
ATOM   2805  H  HA   . SER A 1 26 ? -6.664  5.554   -0.324  1.00 0.00 ? 26  SER A HA   5  
ATOM   2806  H  HB2  . SER A 1 26 ? -8.142  6.998   1.040   1.00 0.00 ? 26  SER A HB2  5  
ATOM   2807  H  HB3  . SER A 1 26 ? -9.054  6.013   -0.103  1.00 0.00 ? 26  SER A HB3  5  
ATOM   2808  H  HG   . SER A 1 26 ? -9.480  6.171   2.437   1.00 0.00 ? 26  SER A HG   5  
ATOM   2809  N  N    . TYR A 1 27 ? -6.381  4.152   2.579   1.00 0.00 ? 27  TYR A N    5  
ATOM   2810  C  CA   . TYR A 1 27 ? -5.563  4.062   3.782   1.00 0.00 ? 27  TYR A CA   5  
ATOM   2811  C  C    . TYR A 1 27 ? -4.174  3.522   3.458   1.00 0.00 ? 27  TYR A C    5  
ATOM   2812  O  O    . TYR A 1 27 ? -3.186  3.892   4.095   1.00 0.00 ? 27  TYR A O    5  
ATOM   2813  C  CB   . TYR A 1 27 ? -6.241  3.166   4.820   1.00 0.00 ? 27  TYR A CB   5  
ATOM   2814  C  CG   . TYR A 1 27 ? -5.946  3.562   6.249   1.00 0.00 ? 27  TYR A CG   5  
ATOM   2815  C  CD1  . TYR A 1 27 ? -5.994  4.892   6.646   1.00 0.00 ? 27  TYR A CD1  5  
ATOM   2816  C  CD2  . TYR A 1 27 ? -5.618  2.605   7.202   1.00 0.00 ? 27  TYR A CD2  5  
ATOM   2817  C  CE1  . TYR A 1 27 ? -5.724  5.259   7.950   1.00 0.00 ? 27  TYR A CE1  5  
ATOM   2818  C  CE2  . TYR A 1 27 ? -5.347  2.962   8.509   1.00 0.00 ? 27  TYR A CE2  5  
ATOM   2819  C  CZ   . TYR A 1 27 ? -5.401  4.290   8.878   1.00 0.00 ? 27  TYR A CZ   5  
ATOM   2820  O  OH   . TYR A 1 27 ? -5.132  4.651   10.178  1.00 0.00 ? 27  TYR A OH   5  
ATOM   2821  H  H    . TYR A 1 27 ? -7.025  3.439   2.385   1.00 0.00 ? 27  TYR A H    5  
ATOM   2822  H  HA   . TYR A 1 27 ? -5.464  5.057   4.191   1.00 0.00 ? 27  TYR A HA   5  
ATOM   2823  H  HB2  . TYR A 1 27 ? -7.310  3.209   4.679   1.00 0.00 ? 27  TYR A HB2  5  
ATOM   2824  H  HB3  . TYR A 1 27 ? -5.906  2.148   4.681   1.00 0.00 ? 27  TYR A HB3  5  
ATOM   2825  H  HD1  . TYR A 1 27 ? -6.248  5.648   5.917   1.00 0.00 ? 27  TYR A HD1  5  
ATOM   2826  H  HD2  . TYR A 1 27 ? -5.576  1.566   6.909   1.00 0.00 ? 27  TYR A HD2  5  
ATOM   2827  H  HE1  . TYR A 1 27 ? -5.766  6.298   8.239   1.00 0.00 ? 27  TYR A HE1  5  
ATOM   2828  H  HE2  . TYR A 1 27 ? -5.094  2.204   9.235   1.00 0.00 ? 27  TYR A HE2  5  
ATOM   2829  H  HH   . TYR A 1 27 ? -5.364  5.573   10.308  1.00 0.00 ? 27  TYR A HH   5  
ATOM   2830  N  N    . LEU A 1 28 ? -4.105  2.646   2.462   1.00 0.00 ? 28  LEU A N    5  
ATOM   2831  C  CA   . LEU A 1 28 ? -2.837  2.054   2.050   1.00 0.00 ? 28  LEU A CA   5  
ATOM   2832  C  C    . LEU A 1 28 ? -2.056  3.009   1.153   1.00 0.00 ? 28  LEU A C    5  
ATOM   2833  O  O    . LEU A 1 28 ? -0.835  3.122   1.265   1.00 0.00 ? 28  LEU A O    5  
ATOM   2834  C  CB   . LEU A 1 28 ? -3.082  0.733   1.318   1.00 0.00 ? 28  LEU A CB   5  
ATOM   2835  C  CG   . LEU A 1 28 ? -1.930  0.223   0.451   1.00 0.00 ? 28  LEU A CG   5  
ATOM   2836  C  CD1  . LEU A 1 28 ? -0.809  -0.324  1.321   1.00 0.00 ? 28  LEU A CD1  5  
ATOM   2837  C  CD2  . LEU A 1 28 ? -2.424  -0.842  -0.519  1.00 0.00 ? 28  LEU A CD2  5  
ATOM   2838  H  H    . LEU A 1 28 ? -4.926  2.390   1.992   1.00 0.00 ? 28  LEU A H    5  
ATOM   2839  H  HA   . LEU A 1 28 ? -2.257  1.860   2.940   1.00 0.00 ? 28  LEU A HA   5  
ATOM   2840  H  HB2  . LEU A 1 28 ? -3.297  -0.021  2.059   1.00 0.00 ? 28  LEU A HB2  5  
ATOM   2841  H  HB3  . LEU A 1 28 ? -3.945  0.865   0.680   1.00 0.00 ? 28  LEU A HB3  5  
ATOM   2842  H  HG   . LEU A 1 28 ? -1.532  1.045   -0.128  1.00 0.00 ? 28  LEU A HG   5  
ATOM   2843  H  HD11 . LEU A 1 28 ? -1.109  -1.273  1.740   1.00 0.00 ? 28  LEU A HD11 5  
ATOM   2844  H  HD12 . LEU A 1 28 ? -0.600  0.373   2.119   1.00 0.00 ? 28  LEU A HD12 5  
ATOM   2845  H  HD13 . LEU A 1 28 ? 0.078   -0.460  0.720   1.00 0.00 ? 28  LEU A HD13 5  
ATOM   2846  H  HD21 . LEU A 1 28 ? -2.393  -0.453  -1.526  1.00 0.00 ? 28  LEU A HD21 5  
ATOM   2847  H  HD22 . LEU A 1 28 ? -3.438  -1.114  -0.268  1.00 0.00 ? 28  LEU A HD22 5  
ATOM   2848  H  HD23 . LEU A 1 28 ? -1.790  -1.714  -0.449  1.00 0.00 ? 28  LEU A HD23 5  
ATOM   2849  N  N    . ILE A 1 29 ? -2.769  3.694   0.265   1.00 0.00 ? 29  ILE A N    5  
ATOM   2850  C  CA   . ILE A 1 29 ? -2.143  4.641   -0.649  1.00 0.00 ? 29  ILE A CA   5  
ATOM   2851  C  C    . ILE A 1 29 ? -1.372  5.713   0.114   1.00 0.00 ? 29  ILE A C    5  
ATOM   2852  O  O    . ILE A 1 29 ? -0.237  6.042   -0.234  1.00 0.00 ? 29  ILE A O    5  
ATOM   2853  C  CB   . ILE A 1 29 ? -3.185  5.322   -1.555  1.00 0.00 ? 29  ILE A CB   5  
ATOM   2854  C  CG1  . ILE A 1 29 ? -3.844  4.292   -2.475  1.00 0.00 ? 29  ILE A CG1  5  
ATOM   2855  C  CG2  . ILE A 1 29 ? -2.535  6.430   -2.371  1.00 0.00 ? 29  ILE A CG2  5  
ATOM   2856  C  CD1  . ILE A 1 29 ? -5.238  4.680   -2.917  1.00 0.00 ? 29  ILE A CD1  5  
ATOM   2857  H  H    . ILE A 1 29 ? -3.738  3.560   0.224   1.00 0.00 ? 29  ILE A H    5  
ATOM   2858  H  HA   . ILE A 1 29 ? -1.453  4.094   -1.275  1.00 0.00 ? 29  ILE A HA   5  
ATOM   2859  H  HB   . ILE A 1 29 ? -3.941  5.768   -0.926  1.00 0.00 ? 29  ILE A HB   5  
ATOM   2860  H  HG12 . ILE A 1 29 ? -3.239  4.169   -3.359  1.00 0.00 ? 29  ILE A HG12 5  
ATOM   2861  H  HG13 . ILE A 1 29 ? -3.911  3.347   -1.954  1.00 0.00 ? 29  ILE A HG13 5  
ATOM   2862  H  HG21 . ILE A 1 29 ? -1.614  6.066   -2.801  1.00 0.00 ? 29  ILE A HG21 5  
ATOM   2863  H  HG22 . ILE A 1 29 ? -3.205  6.734   -3.161  1.00 0.00 ? 29  ILE A HG22 5  
ATOM   2864  H  HG23 . ILE A 1 29 ? -2.326  7.273   -1.731  1.00 0.00 ? 29  ILE A HG23 5  
ATOM   2865  H  HD11 . ILE A 1 29 ? -5.689  3.856   -3.450  1.00 0.00 ? 29  ILE A HD11 5  
ATOM   2866  H  HD12 . ILE A 1 29 ? -5.837  4.918   -2.050  1.00 0.00 ? 29  ILE A HD12 5  
ATOM   2867  H  HD13 . ILE A 1 29 ? -5.184  5.541   -3.565  1.00 0.00 ? 29  ILE A HD13 5  
ATOM   2868  N  N    . ILE A 1 30 ? -1.994  6.253   1.157   1.00 0.00 ? 30  ILE A N    5  
ATOM   2869  C  CA   . ILE A 1 30 ? -1.365  7.285   1.971   1.00 0.00 ? 30  ILE A CA   5  
ATOM   2870  C  C    . ILE A 1 30 ? -0.124  6.749   2.677   1.00 0.00 ? 30  ILE A C    5  
ATOM   2871  O  O    . ILE A 1 30 ? 0.702   7.516   3.173   1.00 0.00 ? 30  ILE A O    5  
ATOM   2872  C  CB   . ILE A 1 30 ? -2.340  7.843   3.025   1.00 0.00 ? 30  ILE A CB   5  
ATOM   2873  C  CG1  . ILE A 1 30 ? -2.786  6.732   3.978   1.00 0.00 ? 30  ILE A CG1  5  
ATOM   2874  C  CG2  . ILE A 1 30 ? -3.542  8.482   2.347   1.00 0.00 ? 30  ILE A CG2  5  
ATOM   2875  C  CD1  . ILE A 1 30 ? -3.169  7.233   5.352   1.00 0.00 ? 30  ILE A CD1  5  
ATOM   2876  H  H    . ILE A 1 30 ? -2.897  5.948   1.385   1.00 0.00 ? 30  ILE A H    5  
ATOM   2877  H  HA   . ILE A 1 30 ? -1.072  8.093   1.316   1.00 0.00 ? 30  ILE A HA   5  
ATOM   2878  H  HB   . ILE A 1 30 ? -1.826  8.607   3.589   1.00 0.00 ? 30  ILE A HB   5  
ATOM   2879  H  HG12 . ILE A 1 30 ? -3.643  6.229   3.558   1.00 0.00 ? 30  ILE A HG12 5  
ATOM   2880  H  HG13 . ILE A 1 30 ? -1.979  6.023   4.095   1.00 0.00 ? 30  ILE A HG13 5  
ATOM   2881  H  HG21 . ILE A 1 30 ? -4.432  7.917   2.584   1.00 0.00 ? 30  ILE A HG21 5  
ATOM   2882  H  HG22 . ILE A 1 30 ? -3.657  9.496   2.701   1.00 0.00 ? 30  ILE A HG22 5  
ATOM   2883  H  HG23 . ILE A 1 30 ? -3.393  8.488   1.278   1.00 0.00 ? 30  ILE A HG23 5  
ATOM   2884  H  HD11 . ILE A 1 30 ? -3.232  8.312   5.338   1.00 0.00 ? 30  ILE A HD11 5  
ATOM   2885  H  HD12 . ILE A 1 30 ? -4.128  6.822   5.631   1.00 0.00 ? 30  ILE A HD12 5  
ATOM   2886  H  HD13 . ILE A 1 30 ? -2.423  6.926   6.069   1.00 0.00 ? 30  ILE A HD13 5  
ATOM   2887  N  N    . HIS A 1 31 ? 0.002   5.426   2.717   1.00 0.00 ? 31  HIS A N    5  
ATOM   2888  C  CA   . HIS A 1 31 ? 1.144   4.786   3.360   1.00 0.00 ? 31  HIS A CA   5  
ATOM   2889  C  C    . HIS A 1 31 ? 2.242   4.485   2.343   1.00 0.00 ? 31  HIS A C    5  
ATOM   2890  O  O    . HIS A 1 31 ? 3.414   4.786   2.571   1.00 0.00 ? 31  HIS A O    5  
ATOM   2891  C  CB   . HIS A 1 31 ? 0.708   3.495   4.054   1.00 0.00 ? 31  HIS A CB   5  
ATOM   2892  C  CG   . HIS A 1 31 ? 1.804   2.482   4.177   1.00 0.00 ? 31  HIS A CG   5  
ATOM   2893  N  ND1  . HIS A 1 31 ? 2.290   2.042   5.391   1.00 0.00 ? 31  HIS A ND1  5  
ATOM   2894  C  CD2  . HIS A 1 31 ? 2.509   1.820   3.230   1.00 0.00 ? 31  HIS A CD2  5  
ATOM   2895  C  CE1  . HIS A 1 31 ? 3.246   1.155   5.185   1.00 0.00 ? 31  HIS A CE1  5  
ATOM   2896  N  NE2  . HIS A 1 31 ? 3.398   1.002   3.882   1.00 0.00 ? 31  HIS A NE2  5  
ATOM   2897  H  H    . HIS A 1 31 ? -0.689  4.867   2.304   1.00 0.00 ? 31  HIS A H    5  
ATOM   2898  H  HA   . HIS A 1 31 ? 1.534   5.468   4.099   1.00 0.00 ? 31  HIS A HA   5  
ATOM   2899  H  HB2  . HIS A 1 31 ? 0.361   3.730   5.049   1.00 0.00 ? 31  HIS A HB2  5  
ATOM   2900  H  HB3  . HIS A 1 31 ? -0.098  3.046   3.492   1.00 0.00 ? 31  HIS A HB3  5  
ATOM   2901  H  HD1  . HIS A 1 31 ? 1.980   2.338   6.272   1.00 0.00 ? 31  HIS A HD1  5  
ATOM   2902  H  HD2  . HIS A 1 31 ? 2.393   1.917   2.160   1.00 0.00 ? 31  HIS A HD2  5  
ATOM   2903  H  HE1  . HIS A 1 31 ? 3.809   0.642   5.950   1.00 0.00 ? 31  HIS A HE1  5  
ATOM   2904  N  N    . THR A 1 32 ? 1.854   3.887   1.221   1.00 0.00 ? 32  THR A N    5  
ATOM   2905  C  CA   . THR A 1 32 ? 2.804   3.544   0.170   1.00 0.00 ? 32  THR A CA   5  
ATOM   2906  C  C    . THR A 1 32 ? 3.795   4.678   -0.068  1.00 0.00 ? 32  THR A C    5  
ATOM   2907  O  O    . THR A 1 32 ? 4.996   4.447   -0.203  1.00 0.00 ? 32  THR A O    5  
ATOM   2908  C  CB   . THR A 1 32 ? 2.086   3.218   -1.153  1.00 0.00 ? 32  THR A CB   5  
ATOM   2909  O  OG1  . THR A 1 32 ? 1.120   2.182   -0.944  1.00 0.00 ? 32  THR A OG1  5  
ATOM   2910  C  CG2  . THR A 1 32 ? 3.082   2.784   -2.217  1.00 0.00 ? 32  THR A CG2  5  
ATOM   2911  H  H    . THR A 1 32 ? 0.906   3.672   1.098   1.00 0.00 ? 32  THR A H    5  
ATOM   2912  H  HA   . THR A 1 32 ? 3.347   2.664   0.486   1.00 0.00 ? 32  THR A HA   5  
ATOM   2913  H  HB   . THR A 1 32 ? 1.579   4.108   -1.498  1.00 0.00 ? 32  THR A HB   5  
ATOM   2914  H  HG1  . THR A 1 32 ? 1.019   1.672   -1.752  1.00 0.00 ? 32  THR A HG1  5  
ATOM   2915  H  HG21 . THR A 1 32 ? 3.551   1.859   -1.915  1.00 0.00 ? 32  THR A HG21 5  
ATOM   2916  H  HG22 . THR A 1 32 ? 3.837   3.547   -2.337  1.00 0.00 ? 32  THR A HG22 5  
ATOM   2917  H  HG23 . THR A 1 32 ? 2.567   2.637   -3.154  1.00 0.00 ? 32  THR A HG23 5  
ATOM   2918  N  N    . ARG A 1 33 ? 3.283   5.903   -0.117  1.00 0.00 ? 33  ARG A N    5  
ATOM   2919  C  CA   . ARG A 1 33 ? 4.124   7.074   -0.339  1.00 0.00 ? 33  ARG A CA   5  
ATOM   2920  C  C    . ARG A 1 33 ? 5.284   7.106   0.652   1.00 0.00 ? 33  ARG A C    5  
ATOM   2921  O  O    . ARG A 1 33 ? 6.402   7.489   0.304   1.00 0.00 ? 33  ARG A O    5  
ATOM   2922  C  CB   . ARG A 1 33 ? 3.296   8.354   -0.212  1.00 0.00 ? 33  ARG A CB   5  
ATOM   2923  C  CG   . ARG A 1 33 ? 2.442   8.406   1.044   1.00 0.00 ? 33  ARG A CG   5  
ATOM   2924  C  CD   . ARG A 1 33 ? 1.491   9.591   1.022   1.00 0.00 ? 33  ARG A CD   5  
ATOM   2925  N  NE   . ARG A 1 33 ? 0.687   9.626   -0.197  1.00 0.00 ? 33  ARG A NE   5  
ATOM   2926  C  CZ   . ARG A 1 33 ? 1.081   10.216  -1.320  1.00 0.00 ? 33  ARG A CZ   5  
ATOM   2927  N  NH1  . ARG A 1 33 ? 2.261   10.817  -1.378  1.00 0.00 ? 33  ARG A NH1  5  
ATOM   2928  N  NH2  . ARG A 1 33 ? 0.293   10.205  -2.388  1.00 0.00 ? 33  ARG A NH2  5  
ATOM   2929  H  H    . ARG A 1 33 ? 2.317   6.023   -0.001  1.00 0.00 ? 33  ARG A H    5  
ATOM   2930  H  HA   . ARG A 1 33 ? 4.522   7.011   -1.340  1.00 0.00 ? 33  ARG A HA   5  
ATOM   2931  H  HB2  . ARG A 1 33 ? 3.965   9.202   -0.202  1.00 0.00 ? 33  ARG A HB2  5  
ATOM   2932  H  HB3  . ARG A 1 33 ? 2.643   8.431   -1.069  1.00 0.00 ? 33  ARG A HB3  5  
ATOM   2933  H  HG2  . ARG A 1 33 ? 1.865   7.496   1.114   1.00 0.00 ? 33  ARG A HG2  5  
ATOM   2934  H  HG3  . ARG A 1 33 ? 3.090   8.490   1.904   1.00 0.00 ? 33  ARG A HG3  5  
ATOM   2935  H  HD2  . ARG A 1 33 ? 0.831   9.522   1.875   1.00 0.00 ? 33  ARG A HD2  5  
ATOM   2936  H  HD3  . ARG A 1 33 ? 2.069   10.501  1.088   1.00 0.00 ? 33  ARG A HD3  5  
ATOM   2937  H  HE   . ARG A 1 33 ? -0.189  9.188   -0.175  1.00 0.00 ? 33  ARG A HE   5  
ATOM   2938  H  HH11 . ARG A 1 33 ? 2.857   10.826  -0.576  1.00 0.00 ? 33  ARG A HH11 5  
ATOM   2939  H  HH12 . ARG A 1 33 ? 2.556   11.259  -2.226  1.00 0.00 ? 33  ARG A HH12 5  
ATOM   2940  H  HH21 . ARG A 1 33 ? -0.597  9.753   -2.347  1.00 0.00 ? 33  ARG A HH21 5  
ATOM   2941  H  HH22 . ARG A 1 33 ? 0.590   10.649  -3.232  1.00 0.00 ? 33  ARG A HH22 5  
ATOM   2942  N  N    . THR A 1 34 ? 5.011   6.700   1.888   1.00 0.00 ? 34  THR A N    5  
ATOM   2943  C  CA   . THR A 1 34 ? 6.031   6.684   2.930   1.00 0.00 ? 34  THR A CA   5  
ATOM   2944  C  C    . THR A 1 34 ? 7.280   5.944   2.465   1.00 0.00 ? 34  THR A C    5  
ATOM   2945  O  O    . THR A 1 34 ? 8.357   6.099   3.042   1.00 0.00 ? 34  THR A O    5  
ATOM   2946  C  CB   . THR A 1 34 ? 5.506   6.024   4.219   1.00 0.00 ? 34  THR A CB   5  
ATOM   2947  O  OG1  . THR A 1 34 ? 5.384   4.610   4.030   1.00 0.00 ? 34  THR A OG1  5  
ATOM   2948  C  CG2  . THR A 1 34 ? 4.158   6.607   4.615   1.00 0.00 ? 34  THR A CG2  5  
ATOM   2949  H  H    . THR A 1 34 ? 4.102   6.406   2.104   1.00 0.00 ? 34  THR A H    5  
ATOM   2950  H  HA   . THR A 1 34 ? 6.294   7.707   3.155   1.00 0.00 ? 34  THR A HA   5  
ATOM   2951  H  HB   . THR A 1 34 ? 6.212   6.214   5.015   1.00 0.00 ? 34  THR A HB   5  
ATOM   2952  H  HG1  . THR A 1 34 ? 5.248   4.422   3.099   1.00 0.00 ? 34  THR A HG1  5  
ATOM   2953  H  HG21 . THR A 1 34 ? 4.248   7.102   5.570   1.00 0.00 ? 34  THR A HG21 5  
ATOM   2954  H  HG22 . THR A 1 34 ? 3.430   5.812   4.689   1.00 0.00 ? 34  THR A HG22 5  
ATOM   2955  H  HG23 . THR A 1 34 ? 3.840   7.319   3.868   1.00 0.00 ? 34  THR A HG23 5  
ATOM   2956  N  N    . HIS A 1 35 ? 7.129   5.138   1.419   1.00 0.00 ? 35  HIS A N    5  
ATOM   2957  C  CA   . HIS A 1 35 ? 8.247   4.374   0.875   1.00 0.00 ? 35  HIS A CA   5  
ATOM   2958  C  C    . HIS A 1 35 ? 9.098   5.239   -0.049  1.00 0.00 ? 35  HIS A C    5  
ATOM   2959  O  O    . HIS A 1 35 ? 9.907   4.728   -0.825  1.00 0.00 ? 35  HIS A O    5  
ATOM   2960  C  CB   . HIS A 1 35 ? 7.734   3.149   0.118   1.00 0.00 ? 35  HIS A CB   5  
ATOM   2961  C  CG   . HIS A 1 35 ? 7.205   2.069   1.012   1.00 0.00 ? 35  HIS A CG   5  
ATOM   2962  N  ND1  . HIS A 1 35 ? 7.953   0.975   1.394   1.00 0.00 ? 35  HIS A ND1  5  
ATOM   2963  C  CD2  . HIS A 1 35 ? 5.996   1.921   1.601   1.00 0.00 ? 35  HIS A CD2  5  
ATOM   2964  C  CE1  . HIS A 1 35 ? 7.225   0.200   2.178   1.00 0.00 ? 35  HIS A CE1  5  
ATOM   2965  N  NE2  . HIS A 1 35 ? 6.033   0.752   2.320   1.00 0.00 ? 35  HIS A NE2  5  
ATOM   2966  H  H    . HIS A 1 35 ? 6.246   5.055   1.002   1.00 0.00 ? 35  HIS A H    5  
ATOM   2967  H  HA   . HIS A 1 35 ? 8.857   4.045   1.703   1.00 0.00 ? 35  HIS A HA   5  
ATOM   2968  H  HB2  . HIS A 1 35 ? 6.936   3.451   -0.544  1.00 0.00 ? 35  HIS A HB2  5  
ATOM   2969  H  HB3  . HIS A 1 35 ? 8.541   2.731   -0.467  1.00 0.00 ? 35  HIS A HB3  5  
ATOM   2970  H  HD1  . HIS A 1 35 ? 8.878   0.794   1.128   1.00 0.00 ? 35  HIS A HD1  5  
ATOM   2971  H  HD2  . HIS A 1 35 ? 5.155   2.597   1.520   1.00 0.00 ? 35  HIS A HD2  5  
ATOM   2972  H  HE1  . HIS A 1 35 ? 7.549   -0.727  2.628   1.00 0.00 ? 35  HIS A HE1  5  
ATOM   2973  N  N    . THR A 1 36 ? 8.910   6.552   0.038   1.00 0.00 ? 36  THR A N    5  
ATOM   2974  C  CA   . THR A 1 36 ? 9.659   7.488   -0.792  1.00 0.00 ? 36  THR A CA   5  
ATOM   2975  C  C    . THR A 1 36 ? 10.909  7.981   -0.073  1.00 0.00 ? 36  THR A C    5  
ATOM   2976  O  O    . THR A 1 36 ? 11.967  8.135   -0.682  1.00 0.00 ? 36  THR A O    5  
ATOM   2977  C  CB   . THR A 1 36 ? 8.796   8.701   -1.189  1.00 0.00 ? 36  THR A CB   5  
ATOM   2978  O  OG1  . THR A 1 36 ? 7.782   8.298   -2.117  1.00 0.00 ? 36  THR A OG1  5  
ATOM   2979  C  CG2  . THR A 1 36 ? 9.653   9.794   -1.808  1.00 0.00 ? 36  THR A CG2  5  
ATOM   2980  H  H    . THR A 1 36 ? 8.251   6.898   0.675   1.00 0.00 ? 36  THR A H    5  
ATOM   2981  H  HA   . THR A 1 36 ? 9.954   6.971   -1.694  1.00 0.00 ? 36  THR A HA   5  
ATOM   2982  H  HB   . THR A 1 36 ? 8.324   9.094   -0.300  1.00 0.00 ? 36  THR A HB   5  
ATOM   2983  H  HG1  . THR A 1 36 ? 6.939   8.675   -1.853  1.00 0.00 ? 36  THR A HG1  5  
ATOM   2984  H  HG21 . THR A 1 36 ? 10.479  10.020  -1.151  1.00 0.00 ? 36  THR A HG21 5  
ATOM   2985  H  HG22 . THR A 1 36 ? 9.055   10.682  -1.953  1.00 0.00 ? 36  THR A HG22 5  
ATOM   2986  H  HG23 . THR A 1 36 ? 10.033  9.457   -2.761  1.00 0.00 ? 36  THR A HG23 5  
ATOM   2987  N  N    . GLY A 1 37 ? 10.781  8.227   1.228   1.00 0.00 ? 37  GLY A N    5  
ATOM   2988  C  CA   . GLY A 1 37 ? 11.909  8.699   2.008   1.00 0.00 ? 37  GLY A CA   5  
ATOM   2989  C  C    . GLY A 1 37 ? 11.492  9.236   3.363   1.00 0.00 ? 37  GLY A C    5  
ATOM   2990  O  O    . GLY A 1 37 ? 12.100  10.173  3.879   1.00 0.00 ? 37  GLY A O    5  
ATOM   2991  H  H    . GLY A 1 37 ? 9.913   8.086   1.660   1.00 0.00 ? 37  GLY A H    5  
ATOM   2992  H  HA2  . GLY A 1 37 ? 12.600  7.883   2.153   1.00 0.00 ? 37  GLY A HA2  5  
ATOM   2993  H  HA3  . GLY A 1 37 ? 12.407  9.486   1.460   1.00 0.00 ? 37  GLY A HA3  5  
ATOM   2994  N  N    . GLU A 1 38 ? 10.452  8.642   3.939   1.00 0.00 ? 38  GLU A N    5  
ATOM   2995  C  CA   . GLU A 1 38 ? 9.954   9.069   5.241   1.00 0.00 ? 38  GLU A CA   5  
ATOM   2996  C  C    . GLU A 1 38 ? 9.902   7.895   6.215   1.00 0.00 ? 38  GLU A C    5  
ATOM   2997  O  O    . GLU A 1 38 ? 8.936   7.736   6.961   1.00 0.00 ? 38  GLU A O    5  
ATOM   2998  C  CB   . GLU A 1 38 ? 8.563   9.691   5.101   1.00 0.00 ? 38  GLU A CB   5  
ATOM   2999  C  CG   . GLU A 1 38 ? 8.269   10.763  6.137   1.00 0.00 ? 38  GLU A CG   5  
ATOM   3000  C  CD   . GLU A 1 38 ? 6.783   10.953  6.374   1.00 0.00 ? 38  GLU A CD   5  
ATOM   3001  O  OE1  . GLU A 1 38 ? 6.017   10.933  5.388   1.00 0.00 ? 38  GLU A OE1  5  
ATOM   3002  O  OE2  . GLU A 1 38 ? 6.387   11.121  7.547   1.00 0.00 ? 38  GLU A OE2  5  
ATOM   3003  H  H    . GLU A 1 38 ? 10.009  7.900   3.477   1.00 0.00 ? 38  GLU A H    5  
ATOM   3004  H  HA   . GLU A 1 38 ? 10.633  9.813   5.629   1.00 0.00 ? 38  GLU A HA   5  
ATOM   3005  H  HB2  . GLU A 1 38 ? 8.478   10.135  4.120   1.00 0.00 ? 38  GLU A HB2  5  
ATOM   3006  H  HB3  . GLU A 1 38 ? 7.822   8.912   5.200   1.00 0.00 ? 38  GLU A HB3  5  
ATOM   3007  H  HG2  . GLU A 1 38 ? 8.733   10.481  7.070   1.00 0.00 ? 38  GLU A HG2  5  
ATOM   3008  H  HG3  . GLU A 1 38 ? 8.687   11.699  5.797   1.00 0.00 ? 38  GLU A HG3  5  
ATOM   3009  N  N    . SER A 1 39 ? 10.948  7.076   6.202   1.00 0.00 ? 39  SER A N    5  
ATOM   3010  C  CA   . SER A 1 39 ? 11.021  5.914   7.080   1.00 0.00 ? 39  SER A CA   5  
ATOM   3011  C  C    . SER A 1 39 ? 12.271  5.970   7.952   1.00 0.00 ? 39  SER A C    5  
ATOM   3012  O  O    . SER A 1 39 ? 13.353  5.561   7.533   1.00 0.00 ? 39  SER A O    5  
ATOM   3013  C  CB   . SER A 1 39 ? 11.016  4.625   6.257   1.00 0.00 ? 39  SER A CB   5  
ATOM   3014  O  OG   . SER A 1 39 ? 9.740   4.387   5.688   1.00 0.00 ? 39  SER A OG   5  
ATOM   3015  H  H    . SER A 1 39 ? 11.688  7.256   5.584   1.00 0.00 ? 39  SER A H    5  
ATOM   3016  H  HA   . SER A 1 39 ? 10.150  5.926   7.719   1.00 0.00 ? 39  SER A HA   5  
ATOM   3017  H  HB2  . SER A 1 39 ? 11.742  4.706   5.462   1.00 0.00 ? 39  SER A HB2  5  
ATOM   3018  H  HB3  . SER A 1 39 ? 11.274  3.792   6.896   1.00 0.00 ? 39  SER A HB3  5  
ATOM   3019  H  HG   . SER A 1 39 ? 9.097   4.257   6.388   1.00 0.00 ? 39  SER A HG   5  
ATOM   3020  N  N    . GLY A 1 40 ? 12.114  6.480   9.170   1.00 0.00 ? 40  GLY A N    5  
ATOM   3021  C  CA   . GLY A 1 40 ? 13.237  6.580   10.083  1.00 0.00 ? 40  GLY A CA   5  
ATOM   3022  C  C    . GLY A 1 40 ? 13.119  5.627   11.256  1.00 0.00 ? 40  GLY A C    5  
ATOM   3023  O  O    . GLY A 1 40 ? 12.664  5.995   12.339  1.00 0.00 ? 40  GLY A O    5  
ATOM   3024  H  H    . GLY A 1 40 ? 11.227  6.790   9.451   1.00 0.00 ? 40  GLY A H    5  
ATOM   3025  H  HA2  . GLY A 1 40 ? 14.146  6.360   9.544   1.00 0.00 ? 40  GLY A HA2  5  
ATOM   3026  H  HA3  . GLY A 1 40 ? 13.290  7.591   10.460  1.00 0.00 ? 40  GLY A HA3  5  
ATOM   3027  N  N    . PRO A 1 41 ? 13.533  4.369   11.045  1.00 0.00 ? 41  PRO A N    5  
ATOM   3028  C  CA   . PRO A 1 41 ? 13.479  3.334   12.081  1.00 0.00 ? 41  PRO A CA   5  
ATOM   3029  C  C    . PRO A 1 41 ? 14.485  3.581   13.200  1.00 0.00 ? 41  PRO A C    5  
ATOM   3030  O  O    . PRO A 1 41 ? 15.240  4.553   13.166  1.00 0.00 ? 41  PRO A O    5  
ATOM   3031  C  CB   . PRO A 1 41 ? 13.830  2.052   11.321  1.00 0.00 ? 41  PRO A CB   5  
ATOM   3032  C  CG   . PRO A 1 41 ? 14.635  2.512   10.155  1.00 0.00 ? 41  PRO A CG   5  
ATOM   3033  C  CD   . PRO A 1 41 ? 14.086  3.860   9.778   1.00 0.00 ? 41  PRO A CD   5  
ATOM   3034  H  HA   . PRO A 1 41 ? 12.489  3.245   12.503  1.00 0.00 ? 41  PRO A HA   5  
ATOM   3035  H  HB2  . PRO A 1 41 ? 14.401  1.395   11.962  1.00 0.00 ? 41  PRO A HB2  5  
ATOM   3036  H  HB3  . PRO A 1 41 ? 12.924  1.558   11.005  1.00 0.00 ? 41  PRO A HB3  5  
ATOM   3037  H  HG2  . PRO A 1 41 ? 15.674  2.595   10.435  1.00 0.00 ? 41  PRO A HG2  5  
ATOM   3038  H  HG3  . PRO A 1 41 ? 14.520  1.819   9.334   1.00 0.00 ? 41  PRO A HG3  5  
ATOM   3039  H  HD2  . PRO A 1 41 ? 14.875  4.502   9.417   1.00 0.00 ? 41  PRO A HD2  5  
ATOM   3040  H  HD3  . PRO A 1 41 ? 13.310  3.757   9.034   1.00 0.00 ? 41  PRO A HD3  5  
ATOM   3041  N  N    . SER A 1 42 ? 14.491  2.696   14.192  1.00 0.00 ? 42  SER A N    5  
ATOM   3042  C  CA   . SER A 1 42 ? 15.403  2.821   15.323  1.00 0.00 ? 42  SER A CA   5  
ATOM   3043  C  C    . SER A 1 42 ? 16.816  3.142   14.848  1.00 0.00 ? 42  SER A C    5  
ATOM   3044  O  O    . SER A 1 42 ? 17.341  2.495   13.942  1.00 0.00 ? 42  SER A O    5  
ATOM   3045  C  CB   . SER A 1 42 ? 15.409  1.530   16.144  1.00 0.00 ? 42  SER A CB   5  
ATOM   3046  O  OG   . SER A 1 42 ? 16.369  1.593   17.185  1.00 0.00 ? 42  SER A OG   5  
ATOM   3047  H  H    . SER A 1 42 ? 13.865  1.942   14.162  1.00 0.00 ? 42  SER A H    5  
ATOM   3048  H  HA   . SER A 1 42 ? 15.051  3.631   15.944  1.00 0.00 ? 42  SER A HA   5  
ATOM   3049  H  HB2  . SER A 1 42 ? 14.433  1.378   16.580  1.00 0.00 ? 42  SER A HB2  5  
ATOM   3050  H  HB3  . SER A 1 42 ? 15.649  0.697   15.499  1.00 0.00 ? 42  SER A HB3  5  
ATOM   3051  H  HG   . SER A 1 42 ? 16.292  0.813   17.740  1.00 0.00 ? 42  SER A HG   5  
ATOM   3052  N  N    . SER A 1 43 ? 17.428  4.147   15.468  1.00 0.00 ? 43  SER A N    5  
ATOM   3053  C  CA   . SER A 1 43 ? 18.779  4.559   15.107  1.00 0.00 ? 43  SER A CA   5  
ATOM   3054  C  C    . SER A 1 43 ? 19.756  4.273   16.244  1.00 0.00 ? 43  SER A C    5  
ATOM   3055  O  O    . SER A 1 43 ? 20.621  5.090   16.554  1.00 0.00 ? 43  SER A O    5  
ATOM   3056  C  CB   . SER A 1 43 ? 18.806  6.048   14.759  1.00 0.00 ? 43  SER A CB   5  
ATOM   3057  O  OG   . SER A 1 43 ? 17.937  6.334   13.676  1.00 0.00 ? 43  SER A OG   5  
ATOM   3058  H  H    . SER A 1 43 ? 16.957  4.625   16.183  1.00 0.00 ? 43  SER A H    5  
ATOM   3059  H  HA   . SER A 1 43 ? 19.079  3.989   14.240  1.00 0.00 ? 43  SER A HA   5  
ATOM   3060  H  HB2  . SER A 1 43 ? 18.493  6.622   15.618  1.00 0.00 ? 43  SER A HB2  5  
ATOM   3061  H  HB3  . SER A 1 43 ? 19.811  6.332   14.483  1.00 0.00 ? 43  SER A HB3  5  
ATOM   3062  H  HG   . SER A 1 43 ? 17.835  7.285   13.591  1.00 0.00 ? 43  SER A HG   5  
ATOM   3063  N  N    . GLY A 1 44 ? 19.609  3.105   16.863  1.00 0.00 ? 44  GLY A N    5  
ATOM   3064  C  CA   . GLY A 1 44 ? 20.483  2.732   17.959  1.00 0.00 ? 44  GLY A CA   5  
ATOM   3065  C  C    . GLY A 1 44 ? 20.626  3.835   18.989  1.00 0.00 ? 44  GLY A C    5  
ATOM   3066  O  O    . GLY A 1 44 ? 19.682  4.081   19.738  1.00 0.00 ? 44  GLY A O    5  
ATOM   3067  H  H    . GLY A 1 44 ? 18.901  2.493   16.573  1.00 0.00 ? 44  GLY A H    5  
ATOM   3068  H  HA2  . GLY A 1 44 ? 20.082  1.853   18.442  1.00 0.00 ? 44  GLY A HA2  5  
ATOM   3069  H  HA3  . GLY A 1 44 ? 21.460  2.498   17.562  1.00 0.00 ? 44  GLY A HA3  5  
HETATM 3070  ZN ZN   . ZN  B 2 .  ? 4.525   -0.455  2.867   1.00 0.00 ? 181 ZN  A ZN   5  
ATOM   3071  N  N    . GLY A 1 1  ? 12.734  -14.260 -21.767 1.00 0.00 ? 1   GLY A N    6  
ATOM   3072  C  CA   . GLY A 1 1  ? 11.577  -14.691 -21.005 1.00 0.00 ? 1   GLY A CA   6  
ATOM   3073  C  C    . GLY A 1 1  ? 10.642  -13.545 -20.672 1.00 0.00 ? 1   GLY A C    6  
ATOM   3074  O  O    . GLY A 1 1  ? 10.960  -12.383 -20.923 1.00 0.00 ? 1   GLY A O    6  
ATOM   3075  H  H1   . GLY A 1 1  ? 13.600  -14.700 -21.630 1.00 0.00 ? 1   GLY A H1   6  
ATOM   3076  H  HA2  . GLY A 1 1  ? 11.036  -15.428 -21.580 1.00 0.00 ? 1   GLY A HA2  6  
ATOM   3077  H  HA3  . GLY A 1 1  ? 11.915  -15.144 -20.084 1.00 0.00 ? 1   GLY A HA3  6  
ATOM   3078  N  N    . SER A 1 2  ? 9.485   -13.873 -20.105 1.00 0.00 ? 2   SER A N    6  
ATOM   3079  C  CA   . SER A 1 2  ? 8.499   -12.862 -19.742 1.00 0.00 ? 2   SER A CA   6  
ATOM   3080  C  C    . SER A 1 2  ? 8.201   -12.906 -18.247 1.00 0.00 ? 2   SER A C    6  
ATOM   3081  O  O    . SER A 1 2  ? 8.567   -13.858 -17.557 1.00 0.00 ? 2   SER A O    6  
ATOM   3082  C  CB   . SER A 1 2  ? 7.208   -13.070 -20.537 1.00 0.00 ? 2   SER A CB   6  
ATOM   3083  O  OG   . SER A 1 2  ? 7.315   -12.516 -21.837 1.00 0.00 ? 2   SER A OG   6  
ATOM   3084  H  H    . SER A 1 2  ? 9.290   -14.817 -19.930 1.00 0.00 ? 2   SER A H    6  
ATOM   3085  H  HA   . SER A 1 2  ? 8.911   -11.894 -19.987 1.00 0.00 ? 2   SER A HA   6  
ATOM   3086  H  HB2  . SER A 1 2  ? 7.009   -14.127 -20.625 1.00 0.00 ? 2   SER A HB2  6  
ATOM   3087  H  HB3  . SER A 1 2  ? 6.390   -12.590 -20.020 1.00 0.00 ? 2   SER A HB3  6  
ATOM   3088  H  HG   . SER A 1 2  ? 6.546   -12.764 -22.355 1.00 0.00 ? 2   SER A HG   6  
ATOM   3089  N  N    . SER A 1 3  ? 7.535   -11.868 -17.751 1.00 0.00 ? 3   SER A N    6  
ATOM   3090  C  CA   . SER A 1 3  ? 7.190   -11.785 -16.337 1.00 0.00 ? 3   SER A CA   6  
ATOM   3091  C  C    . SER A 1 3  ? 5.916   -12.570 -16.041 1.00 0.00 ? 3   SER A C    6  
ATOM   3092  O  O    . SER A 1 3  ? 4.816   -12.019 -16.061 1.00 0.00 ? 3   SER A O    6  
ATOM   3093  C  CB   . SER A 1 3  ? 7.012   -10.325 -15.918 1.00 0.00 ? 3   SER A CB   6  
ATOM   3094  O  OG   . SER A 1 3  ? 6.471   -10.231 -14.612 1.00 0.00 ? 3   SER A OG   6  
ATOM   3095  H  H    . SER A 1 3  ? 7.271   -11.140 -18.352 1.00 0.00 ? 3   SER A H    6  
ATOM   3096  H  HA   . SER A 1 3  ? 8.004   -12.216 -15.772 1.00 0.00 ? 3   SER A HA   6  
ATOM   3097  H  HB2  . SER A 1 3  ? 7.971   -9.829  -15.934 1.00 0.00 ? 3   SER A HB2  6  
ATOM   3098  H  HB3  . SER A 1 3  ? 6.342   -9.834  -16.610 1.00 0.00 ? 3   SER A HB3  6  
ATOM   3099  H  HG   . SER A 1 3  ? 5.758   -9.587  -14.607 1.00 0.00 ? 3   SER A HG   6  
ATOM   3100  N  N    . GLY A 1 4  ? 6.073   -13.861 -15.766 1.00 0.00 ? 4   GLY A N    6  
ATOM   3101  C  CA   . GLY A 1 4  ? 4.928   -14.702 -15.471 1.00 0.00 ? 4   GLY A CA   6  
ATOM   3102  C  C    . GLY A 1 4  ? 5.037   -15.376 -14.117 1.00 0.00 ? 4   GLY A C    6  
ATOM   3103  O  O    . GLY A 1 4  ? 6.030   -15.206 -13.410 1.00 0.00 ? 4   GLY A O    6  
ATOM   3104  H  H    . GLY A 1 4  ? 6.974   -14.246 -15.765 1.00 0.00 ? 4   GLY A H    6  
ATOM   3105  H  HA2  . GLY A 1 4  ? 4.035   -14.094 -15.487 1.00 0.00 ? 4   GLY A HA2  6  
ATOM   3106  H  HA3  . GLY A 1 4  ? 4.847   -15.462 -16.233 1.00 0.00 ? 4   GLY A HA3  6  
ATOM   3107  N  N    . SER A 1 5  ? 4.014   -16.143 -13.755 1.00 0.00 ? 5   SER A N    6  
ATOM   3108  C  CA   . SER A 1 5  ? 3.997   -16.841 -12.475 1.00 0.00 ? 5   SER A CA   6  
ATOM   3109  C  C    . SER A 1 5  ? 4.467   -15.924 -11.350 1.00 0.00 ? 5   SER A C    6  
ATOM   3110  O  O    . SER A 1 5  ? 5.224   -16.337 -10.472 1.00 0.00 ? 5   SER A O    6  
ATOM   3111  C  CB   . SER A 1 5  ? 4.884   -18.086 -12.537 1.00 0.00 ? 5   SER A CB   6  
ATOM   3112  O  OG   . SER A 1 5  ? 6.228   -17.741 -12.827 1.00 0.00 ? 5   SER A OG   6  
ATOM   3113  H  H    . SER A 1 5  ? 3.251   -16.239 -14.363 1.00 0.00 ? 5   SER A H    6  
ATOM   3114  H  HA   . SER A 1 5  ? 2.980   -17.144 -12.276 1.00 0.00 ? 5   SER A HA   6  
ATOM   3115  H  HB2  . SER A 1 5  ? 4.853   -18.595 -11.586 1.00 0.00 ? 5   SER A HB2  6  
ATOM   3116  H  HB3  . SER A 1 5  ? 4.520   -18.746 -13.311 1.00 0.00 ? 5   SER A HB3  6  
ATOM   3117  H  HG   . SER A 1 5  ? 6.805   -18.468 -12.583 1.00 0.00 ? 5   SER A HG   6  
ATOM   3118  N  N    . SER A 1 6  ? 4.011   -14.676 -11.384 1.00 0.00 ? 6   SER A N    6  
ATOM   3119  C  CA   . SER A 1 6  ? 4.387   -13.697 -10.370 1.00 0.00 ? 6   SER A CA   6  
ATOM   3120  C  C    . SER A 1 6  ? 3.171   -13.262 -9.557  1.00 0.00 ? 6   SER A C    6  
ATOM   3121  O  O    . SER A 1 6  ? 3.006   -12.083 -9.248  1.00 0.00 ? 6   SER A O    6  
ATOM   3122  C  CB   . SER A 1 6  ? 5.039   -12.478 -11.024 1.00 0.00 ? 6   SER A CB   6  
ATOM   3123  O  OG   . SER A 1 6  ? 5.594   -11.611 -10.049 1.00 0.00 ? 6   SER A OG   6  
ATOM   3124  H  H    . SER A 1 6  ? 3.410   -14.406 -12.109 1.00 0.00 ? 6   SER A H    6  
ATOM   3125  H  HA   . SER A 1 6  ? 5.100   -14.164 -9.707  1.00 0.00 ? 6   SER A HA   6  
ATOM   3126  H  HB2  . SER A 1 6  ? 5.827   -12.806 -11.686 1.00 0.00 ? 6   SER A HB2  6  
ATOM   3127  H  HB3  . SER A 1 6  ? 4.296   -11.936 -11.590 1.00 0.00 ? 6   SER A HB3  6  
ATOM   3128  H  HG   . SER A 1 6  ? 6.432   -11.267 -10.366 1.00 0.00 ? 6   SER A HG   6  
ATOM   3129  N  N    . GLY A 1 7  ? 2.320   -14.226 -9.215  1.00 0.00 ? 7   GLY A N    6  
ATOM   3130  C  CA   . GLY A 1 7  ? 1.129   -13.924 -8.442  1.00 0.00 ? 7   GLY A CA   6  
ATOM   3131  C  C    . GLY A 1 7  ? 0.107   -13.136 -9.237  1.00 0.00 ? 7   GLY A C    6  
ATOM   3132  O  O    . GLY A 1 7  ? 0.446   -12.475 -10.219 1.00 0.00 ? 7   GLY A O    6  
ATOM   3133  H  H    . GLY A 1 7  ? 2.503   -15.149 -9.490  1.00 0.00 ? 7   GLY A H    6  
ATOM   3134  H  HA2  . GLY A 1 7  ? 0.681   -14.850 -8.116  1.00 0.00 ? 7   GLY A HA2  6  
ATOM   3135  H  HA3  . GLY A 1 7  ? 1.414   -13.348 -7.574  1.00 0.00 ? 7   GLY A HA3  6  
ATOM   3136  N  N    . THR A 1 8  ? -1.152  -13.207 -8.814  1.00 0.00 ? 8   THR A N    6  
ATOM   3137  C  CA   . THR A 1 8  ? -2.228  -12.498 -9.494  1.00 0.00 ? 8   THR A CA   6  
ATOM   3138  C  C    . THR A 1 8  ? -3.131  -11.782 -8.496  1.00 0.00 ? 8   THR A C    6  
ATOM   3139  O  O    . THR A 1 8  ? -4.159  -12.314 -8.081  1.00 0.00 ? 8   THR A O    6  
ATOM   3140  C  CB   . THR A 1 8  ? -3.082  -13.457 -10.345 1.00 0.00 ? 8   THR A CB   6  
ATOM   3141  O  OG1  . THR A 1 8  ? -2.238  -14.240 -11.197 1.00 0.00 ? 8   THR A OG1  6  
ATOM   3142  C  CG2  . THR A 1 8  ? -4.085  -12.684 -11.189 1.00 0.00 ? 8   THR A CG2  6  
ATOM   3143  H  H    . THR A 1 8  ? -1.360  -13.751 -8.025  1.00 0.00 ? 8   THR A H    6  
ATOM   3144  H  HA   . THR A 1 8  ? -1.782  -11.766 -10.152 1.00 0.00 ? 8   THR A HA   6  
ATOM   3145  H  HB   . THR A 1 8  ? -3.624  -14.116 -9.683  1.00 0.00 ? 8   THR A HB   6  
ATOM   3146  H  HG1  . THR A 1 8  ? -2.769  -14.650 -11.884 1.00 0.00 ? 8   THR A HG1  6  
ATOM   3147  H  HG21 . THR A 1 8  ? -4.558  -13.355 -11.890 1.00 0.00 ? 8   THR A HG21 6  
ATOM   3148  H  HG22 . THR A 1 8  ? -3.573  -11.901 -11.730 1.00 0.00 ? 8   THR A HG22 6  
ATOM   3149  H  HG23 . THR A 1 8  ? -4.834  -12.247 -10.546 1.00 0.00 ? 8   THR A HG23 6  
ATOM   3150  N  N    . GLY A 1 9  ? -2.740  -10.569 -8.116  1.00 0.00 ? 9   GLY A N    6  
ATOM   3151  C  CA   . GLY A 1 9  ? -3.526  -9.799  -7.170  1.00 0.00 ? 9   GLY A CA   6  
ATOM   3152  C  C    . GLY A 1 9  ? -4.200  -10.671 -6.131  1.00 0.00 ? 9   GLY A C    6  
ATOM   3153  O  O    . GLY A 1 9  ? -5.338  -11.102 -6.316  1.00 0.00 ? 9   GLY A O    6  
ATOM   3154  H  H    . GLY A 1 9  ? -1.911  -10.194 -8.481  1.00 0.00 ? 9   GLY A H    6  
ATOM   3155  H  HA2  . GLY A 1 9  ? -2.878  -9.095  -6.669  1.00 0.00 ? 9   GLY A HA2  6  
ATOM   3156  H  HA3  . GLY A 1 9  ? -4.284  -9.252  -7.711  1.00 0.00 ? 9   GLY A HA3  6  
ATOM   3157  N  N    . MET A 1 10 ? -3.497  -10.934 -5.034  1.00 0.00 ? 10  MET A N    6  
ATOM   3158  C  CA   . MET A 1 10 ? -4.035  -11.762 -3.961  1.00 0.00 ? 10  MET A CA   6  
ATOM   3159  C  C    . MET A 1 10 ? -4.412  -10.910 -2.754  1.00 0.00 ? 10  MET A C    6  
ATOM   3160  O  O    . MET A 1 10 ? -5.474  -11.093 -2.158  1.00 0.00 ? 10  MET A O    6  
ATOM   3161  C  CB   . MET A 1 10 ? -3.017  -12.828 -3.551  1.00 0.00 ? 10  MET A CB   6  
ATOM   3162  C  CG   . MET A 1 10 ? -3.013  -14.047 -4.458  1.00 0.00 ? 10  MET A CG   6  
ATOM   3163  S  SD   . MET A 1 10 ? -4.631  -14.836 -4.567  1.00 0.00 ? 10  MET A SD   6  
ATOM   3164  C  CE   . MET A 1 10 ? -4.871  -14.874 -6.342  1.00 0.00 ? 10  MET A CE   6  
ATOM   3165  H  H    . MET A 1 10 ? -2.594  -10.562 -4.944  1.00 0.00 ? 10  MET A H    6  
ATOM   3166  H  HA   . MET A 1 10 ? -4.923  -12.250 -4.334  1.00 0.00 ? 10  MET A HA   6  
ATOM   3167  H  HB2  . MET A 1 10 ? -2.030  -12.391 -3.567  1.00 0.00 ? 10  MET A HB2  6  
ATOM   3168  H  HB3  . MET A 1 10 ? -3.241  -13.155 -2.546  1.00 0.00 ? 10  MET A HB3  6  
ATOM   3169  H  HG2  . MET A 1 10 ? -2.711  -13.741 -5.449  1.00 0.00 ? 10  MET A HG2  6  
ATOM   3170  H  HG3  . MET A 1 10 ? -2.303  -14.763 -4.073  1.00 0.00 ? 10  MET A HG3  6  
ATOM   3171  H  HE1  . MET A 1 10 ? -4.059  -14.350 -6.825  1.00 0.00 ? 10  MET A HE1  6  
ATOM   3172  H  HE2  . MET A 1 10 ? -4.891  -15.899 -6.681  1.00 0.00 ? 10  MET A HE2  6  
ATOM   3173  H  HE3  . MET A 1 10 ? -5.806  -14.394 -6.588  1.00 0.00 ? 10  MET A HE3  6  
ATOM   3174  N  N    . LYS A 1 11 ? -3.535  -9.977  -2.397  1.00 0.00 ? 11  LYS A N    6  
ATOM   3175  C  CA   . LYS A 1 11 ? -3.775  -9.095  -1.261  1.00 0.00 ? 11  LYS A CA   6  
ATOM   3176  C  C    . LYS A 1 11 ? -4.679  -7.932  -1.657  1.00 0.00 ? 11  LYS A C    6  
ATOM   3177  O  O    . LYS A 1 11 ? -4.557  -7.361  -2.741  1.00 0.00 ? 11  LYS A O    6  
ATOM   3178  C  CB   . LYS A 1 11 ? -2.449  -8.562  -0.713  1.00 0.00 ? 11  LYS A CB   6  
ATOM   3179  C  CG   . LYS A 1 11 ? -1.852  -9.426  0.384   1.00 0.00 ? 11  LYS A CG   6  
ATOM   3180  C  CD   . LYS A 1 11 ? -1.080  -10.602 -0.191  1.00 0.00 ? 11  LYS A CD   6  
ATOM   3181  C  CE   . LYS A 1 11 ? 0.274   -10.168 -0.733  1.00 0.00 ? 11  LYS A CE   6  
ATOM   3182  N  NZ   . LYS A 1 11 ? 1.337   -10.243 0.307   1.00 0.00 ? 11  LYS A NZ   6  
ATOM   3183  H  H    . LYS A 1 11 ? -2.706  -9.879  -2.911  1.00 0.00 ? 11  LYS A H    6  
ATOM   3184  H  HA   . LYS A 1 11 ? -4.267  -9.672  -0.491  1.00 0.00 ? 11  LYS A HA   6  
ATOM   3185  H  HB2  . LYS A 1 11 ? -1.737  -8.502  -1.523  1.00 0.00 ? 11  LYS A HB2  6  
ATOM   3186  H  HB3  . LYS A 1 11 ? -2.611  -7.571  -0.314  1.00 0.00 ? 11  LYS A HB3  6  
ATOM   3187  H  HG2  . LYS A 1 11 ? -1.181  -8.825  0.978   1.00 0.00 ? 11  LYS A HG2  6  
ATOM   3188  H  HG3  . LYS A 1 11 ? -2.651  -9.802  1.008   1.00 0.00 ? 11  LYS A HG3  6  
ATOM   3189  H  HD2  . LYS A 1 11 ? -0.925  -11.335 0.587   1.00 0.00 ? 11  LYS A HD2  6  
ATOM   3190  H  HD3  . LYS A 1 11 ? -1.655  -11.042 -0.994  1.00 0.00 ? 11  LYS A HD3  6  
ATOM   3191  H  HE2  . LYS A 1 11 ? 0.541   -10.813 -1.555  1.00 0.00 ? 11  LYS A HE2  6  
ATOM   3192  H  HE3  . LYS A 1 11 ? 0.196   -9.150  -1.084  1.00 0.00 ? 11  LYS A HE3  6  
ATOM   3193  H  HZ1  . LYS A 1 11 ? 2.274   -10.139 -0.132  1.00 0.00 ? 11  LYS A HZ1  6  
ATOM   3194  H  HZ2  . LYS A 1 11 ? 1.294   -11.159 0.797   1.00 0.00 ? 11  LYS A HZ2  6  
ATOM   3195  H  HZ3  . LYS A 1 11 ? 1.207   -9.483  1.006   1.00 0.00 ? 11  LYS A HZ3  6  
ATOM   3196  N  N    . PRO A 1 12 ? -5.606  -7.570  -0.758  1.00 0.00 ? 12  PRO A N    6  
ATOM   3197  C  CA   . PRO A 1 12 ? -6.547  -6.470  -0.991  1.00 0.00 ? 12  PRO A CA   6  
ATOM   3198  C  C    . PRO A 1 12 ? -5.861  -5.108  -0.978  1.00 0.00 ? 12  PRO A C    6  
ATOM   3199  O  O    . PRO A 1 12 ? -5.399  -4.625  -2.011  1.00 0.00 ? 12  PRO A O    6  
ATOM   3200  C  CB   . PRO A 1 12 ? -7.526  -6.587  0.180   1.00 0.00 ? 12  PRO A CB   6  
ATOM   3201  C  CG   . PRO A 1 12 ? -6.752  -7.268  1.255   1.00 0.00 ? 12  PRO A CG   6  
ATOM   3202  C  CD   . PRO A 1 12 ? -5.808  -8.206  0.555   1.00 0.00 ? 12  PRO A CD   6  
ATOM   3203  H  HA   . PRO A 1 12 ? -7.080  -6.594  -1.922  1.00 0.00 ? 12  PRO A HA   6  
ATOM   3204  H  HB2  . PRO A 1 12 ? -7.845  -5.600  0.485   1.00 0.00 ? 12  PRO A HB2  6  
ATOM   3205  H  HB3  . PRO A 1 12 ? -8.383  -7.171  -0.120  1.00 0.00 ? 12  PRO A HB3  6  
ATOM   3206  H  HG2  . PRO A 1 12 ? -6.200  -6.538  1.828   1.00 0.00 ? 12  PRO A HG2  6  
ATOM   3207  H  HG3  . PRO A 1 12 ? -7.423  -7.821  1.895   1.00 0.00 ? 12  PRO A HG3  6  
ATOM   3208  H  HD2  . PRO A 1 12 ? -4.877  -8.277  1.096   1.00 0.00 ? 12  PRO A HD2  6  
ATOM   3209  H  HD3  . PRO A 1 12 ? -6.258  -9.181  0.444   1.00 0.00 ? 12  PRO A HD3  6  
ATOM   3210  N  N    . TYR A 1 13 ? -5.798  -4.494  0.199   1.00 0.00 ? 13  TYR A N    6  
ATOM   3211  C  CA   . TYR A 1 13 ? -5.170  -3.186  0.346   1.00 0.00 ? 13  TYR A CA   6  
ATOM   3212  C  C    . TYR A 1 13 ? -3.844  -3.300  1.093   1.00 0.00 ? 13  TYR A C    6  
ATOM   3213  O  O    . TYR A 1 13 ? -3.330  -2.314  1.622   1.00 0.00 ? 13  TYR A O    6  
ATOM   3214  C  CB   . TYR A 1 13 ? -6.105  -2.229  1.086   1.00 0.00 ? 13  TYR A CB   6  
ATOM   3215  C  CG   . TYR A 1 13 ? -7.570  -2.567  0.926   1.00 0.00 ? 13  TYR A CG   6  
ATOM   3216  C  CD1  . TYR A 1 13 ? -8.141  -3.620  1.629   1.00 0.00 ? 13  TYR A CD1  6  
ATOM   3217  C  CD2  . TYR A 1 13 ? -8.382  -1.834  0.070   1.00 0.00 ? 13  TYR A CD2  6  
ATOM   3218  C  CE1  . TYR A 1 13 ? -9.478  -3.934  1.485   1.00 0.00 ? 13  TYR A CE1  6  
ATOM   3219  C  CE2  . TYR A 1 13 ? -9.722  -2.139  -0.079  1.00 0.00 ? 13  TYR A CE2  6  
ATOM   3220  C  CZ   . TYR A 1 13 ? -10.265 -3.190  0.630   1.00 0.00 ? 13  TYR A CZ   6  
ATOM   3221  O  OH   . TYR A 1 13 ? -11.598 -3.498  0.485   1.00 0.00 ? 13  TYR A OH   6  
ATOM   3222  H  H    . TYR A 1 13 ? -6.184  -4.930  0.987   1.00 0.00 ? 13  TYR A H    6  
ATOM   3223  H  HA   . TYR A 1 13 ? -4.980  -2.796  -0.643  1.00 0.00 ? 13  TYR A HA   6  
ATOM   3224  H  HB2  . TYR A 1 13 ? -5.873  -2.253  2.140   1.00 0.00 ? 13  TYR A HB2  6  
ATOM   3225  H  HB3  . TYR A 1 13 ? -5.953  -1.227  0.712   1.00 0.00 ? 13  TYR A HB3  6  
ATOM   3226  H  HD1  . TYR A 1 13 ? -7.522  -4.200  2.299   1.00 0.00 ? 13  TYR A HD1  6  
ATOM   3227  H  HD2  . TYR A 1 13 ? -7.954  -1.011  -0.484  1.00 0.00 ? 13  TYR A HD2  6  
ATOM   3228  H  HE1  . TYR A 1 13 ? -9.904  -4.756  2.041   1.00 0.00 ? 13  TYR A HE1  6  
ATOM   3229  H  HE2  . TYR A 1 13 ? -10.338 -1.557  -0.749  1.00 0.00 ? 13  TYR A HE2  6  
ATOM   3230  H  HH   . TYR A 1 13 ? -12.016 -2.848  -0.085  1.00 0.00 ? 13  TYR A HH   6  
ATOM   3231  N  N    . VAL A 1 14 ? -3.295  -4.510  1.130   1.00 0.00 ? 14  VAL A N    6  
ATOM   3232  C  CA   . VAL A 1 14 ? -2.029  -4.754  1.810   1.00 0.00 ? 14  VAL A CA   6  
ATOM   3233  C  C    . VAL A 1 14 ? -0.854  -4.237  0.986   1.00 0.00 ? 14  VAL A C    6  
ATOM   3234  O  O    . VAL A 1 14 ? -0.881  -4.274  -0.244  1.00 0.00 ? 14  VAL A O    6  
ATOM   3235  C  CB   . VAL A 1 14 ? -1.823  -6.254  2.092   1.00 0.00 ? 14  VAL A CB   6  
ATOM   3236  C  CG1  . VAL A 1 14 ? -0.667  -6.463  3.058   1.00 0.00 ? 14  VAL A CG1  6  
ATOM   3237  C  CG2  . VAL A 1 14 ? -3.101  -6.874  2.636   1.00 0.00 ? 14  VAL A CG2  6  
ATOM   3238  H  H    . VAL A 1 14 ? -3.753  -5.256  0.690   1.00 0.00 ? 14  VAL A H    6  
ATOM   3239  H  HA   . VAL A 1 14 ? -2.051  -4.231  2.755   1.00 0.00 ? 14  VAL A HA   6  
ATOM   3240  H  HB   . VAL A 1 14 ? -1.578  -6.744  1.161   1.00 0.00 ? 14  VAL A HB   6  
ATOM   3241  H  HG11 . VAL A 1 14 ? -0.199  -7.416  2.859   1.00 0.00 ? 14  VAL A HG11 6  
ATOM   3242  H  HG12 . VAL A 1 14 ? 0.057   -5.671  2.930   1.00 0.00 ? 14  VAL A HG12 6  
ATOM   3243  H  HG13 . VAL A 1 14 ? -1.039  -6.450  4.072   1.00 0.00 ? 14  VAL A HG13 6  
ATOM   3244  H  HG21 . VAL A 1 14 ? -3.954  -6.320  2.271   1.00 0.00 ? 14  VAL A HG21 6  
ATOM   3245  H  HG22 . VAL A 1 14 ? -3.171  -7.900  2.308   1.00 0.00 ? 14  VAL A HG22 6  
ATOM   3246  H  HG23 . VAL A 1 14 ? -3.087  -6.841  3.716   1.00 0.00 ? 14  VAL A HG23 6  
ATOM   3247  N  N    . CYS A 1 15 ? 0.176   -3.756  1.673   1.00 0.00 ? 15  CYS A N    6  
ATOM   3248  C  CA   . CYS A 1 15 ? 1.362   -3.231  1.006   1.00 0.00 ? 15  CYS A CA   6  
ATOM   3249  C  C    . CYS A 1 15 ? 2.250   -4.365  0.503   1.00 0.00 ? 15  CYS A C    6  
ATOM   3250  O  O    . CYS A 1 15 ? 2.894   -5.059  1.290   1.00 0.00 ? 15  CYS A O    6  
ATOM   3251  C  CB   . CYS A 1 15 ? 2.153   -2.333  1.959   1.00 0.00 ? 15  CYS A CB   6  
ATOM   3252  S  SG   . CYS A 1 15 ? 3.071   -0.995  1.130   1.00 0.00 ? 15  CYS A SG   6  
ATOM   3253  H  H    . CYS A 1 15 ? 0.139   -3.753  2.653   1.00 0.00 ? 15  CYS A H    6  
ATOM   3254  H  HA   . CYS A 1 15 ? 1.035   -2.645  0.161   1.00 0.00 ? 15  CYS A HA   6  
ATOM   3255  H  HB2  . CYS A 1 15 ? 1.470   -1.876  2.661   1.00 0.00 ? 15  CYS A HB2  6  
ATOM   3256  H  HB3  . CYS A 1 15 ? 2.867   -2.936  2.500   1.00 0.00 ? 15  CYS A HB3  6  
ATOM   3257  N  N    . ASN A 1 16 ? 2.279   -4.548  -0.813  1.00 0.00 ? 16  ASN A N    6  
ATOM   3258  C  CA   . ASN A 1 16 ? 3.088   -5.598  -1.422  1.00 0.00 ? 16  ASN A CA   6  
ATOM   3259  C  C    . ASN A 1 16 ? 4.576   -5.311  -1.242  1.00 0.00 ? 16  ASN A C    6  
ATOM   3260  O  O    . ASN A 1 16 ? 5.423   -6.122  -1.615  1.00 0.00 ? 16  ASN A O    6  
ATOM   3261  C  CB   . ASN A 1 16 ? 2.758   -5.727  -2.910  1.00 0.00 ? 16  ASN A CB   6  
ATOM   3262  C  CG   . ASN A 1 16 ? 1.412   -6.384  -3.149  1.00 0.00 ? 16  ASN A CG   6  
ATOM   3263  O  OD1  . ASN A 1 16 ? 1.326   -7.599  -3.330  1.00 0.00 ? 16  ASN A OD1  6  
ATOM   3264  N  ND2  . ASN A 1 16 ? 0.354   -5.582  -3.150  1.00 0.00 ? 16  ASN A ND2  6  
ATOM   3265  H  H    . ASN A 1 16 ? 1.744   -3.963  -1.389  1.00 0.00 ? 16  ASN A H    6  
ATOM   3266  H  HA   . ASN A 1 16 ? 2.850   -6.527  -0.927  1.00 0.00 ? 16  ASN A HA   6  
ATOM   3267  H  HB2  . ASN A 1 16 ? 2.739   -4.742  -3.355  1.00 0.00 ? 16  ASN A HB2  6  
ATOM   3268  H  HB3  . ASN A 1 16 ? 3.519   -6.321  -3.392  1.00 0.00 ? 16  ASN A HB3  6  
ATOM   3269  H  HD21 . ASN A 1 16 ? 0.498   -4.625  -2.999  1.00 0.00 ? 16  ASN A HD21 6  
ATOM   3270  H  HD22 . ASN A 1 16 ? -0.528  -5.981  -3.301  1.00 0.00 ? 16  ASN A HD22 6  
ATOM   3271  N  N    . GLU A 1 17 ? 4.885   -4.152  -0.669  1.00 0.00 ? 17  GLU A N    6  
ATOM   3272  C  CA   . GLU A 1 17 ? 6.270   -3.759  -0.441  1.00 0.00 ? 17  GLU A CA   6  
ATOM   3273  C  C    . GLU A 1 17 ? 6.748   -4.220  0.933   1.00 0.00 ? 17  GLU A C    6  
ATOM   3274  O  O    . GLU A 1 17 ? 7.785   -4.873  1.056   1.00 0.00 ? 17  GLU A O    6  
ATOM   3275  C  CB   . GLU A 1 17 ? 6.420   -2.241  -0.561  1.00 0.00 ? 17  GLU A CB   6  
ATOM   3276  C  CG   . GLU A 1 17 ? 6.014   -1.695  -1.921  1.00 0.00 ? 17  GLU A CG   6  
ATOM   3277  C  CD   . GLU A 1 17 ? 7.119   -1.818  -2.952  1.00 0.00 ? 17  GLU A CD   6  
ATOM   3278  O  OE1  . GLU A 1 17 ? 8.304   -1.781  -2.558  1.00 0.00 ? 17  GLU A OE1  6  
ATOM   3279  O  OE2  . GLU A 1 17 ? 6.800   -1.950  -4.151  1.00 0.00 ? 17  GLU A OE2  6  
ATOM   3280  H  H    . GLU A 1 17 ? 4.164   -3.547  -0.394  1.00 0.00 ? 17  GLU A H    6  
ATOM   3281  H  HA   . GLU A 1 17 ? 6.878   -4.232  -1.197  1.00 0.00 ? 17  GLU A HA   6  
ATOM   3282  H  HB2  . GLU A 1 17 ? 5.804   -1.770  0.191   1.00 0.00 ? 17  GLU A HB2  6  
ATOM   3283  H  HB3  . GLU A 1 17 ? 7.452   -1.978  -0.385  1.00 0.00 ? 17  GLU A HB3  6  
ATOM   3284  H  HG2  . GLU A 1 17 ? 5.153   -2.244  -2.272  1.00 0.00 ? 17  GLU A HG2  6  
ATOM   3285  H  HG3  . GLU A 1 17 ? 5.756   -0.652  -1.813  1.00 0.00 ? 17  GLU A HG3  6  
ATOM   3286  N  N    . CYS A 1 18 ? 5.984   -3.876  1.964   1.00 0.00 ? 18  CYS A N    6  
ATOM   3287  C  CA   . CYS A 1 18 ? 6.327   -4.253  3.330   1.00 0.00 ? 18  CYS A CA   6  
ATOM   3288  C  C    . CYS A 1 18 ? 5.346   -5.289  3.872   1.00 0.00 ? 18  CYS A C    6  
ATOM   3289  O  O    . CYS A 1 18 ? 5.708   -6.135  4.688   1.00 0.00 ? 18  CYS A O    6  
ATOM   3290  C  CB   . CYS A 1 18 ? 6.334   -3.020  4.235   1.00 0.00 ? 18  CYS A CB   6  
ATOM   3291  S  SG   . CYS A 1 18 ? 4.781   -2.068  4.207   1.00 0.00 ? 18  CYS A SG   6  
ATOM   3292  H  H    . CYS A 1 18 ? 5.168   -3.356  1.803   1.00 0.00 ? 18  CYS A H    6  
ATOM   3293  H  HA   . CYS A 1 18 ? 7.316   -4.685  3.317   1.00 0.00 ? 18  CYS A HA   6  
ATOM   3294  H  HB2  . CYS A 1 18 ? 6.508   -3.332  5.255   1.00 0.00 ? 18  CYS A HB2  6  
ATOM   3295  H  HB3  . CYS A 1 18 ? 7.130   -2.360  3.926   1.00 0.00 ? 18  CYS A HB3  6  
ATOM   3296  N  N    . GLY A 1 19 ? 4.101   -5.216  3.410   1.00 0.00 ? 19  GLY A N    6  
ATOM   3297  C  CA   . GLY A 1 19 ? 3.088   -6.153  3.858   1.00 0.00 ? 19  GLY A CA   6  
ATOM   3298  C  C    . GLY A 1 19 ? 2.079   -5.513  4.792   1.00 0.00 ? 19  GLY A C    6  
ATOM   3299  O  O    . GLY A 1 19 ? 1.322   -6.208  5.470   1.00 0.00 ? 19  GLY A O    6  
ATOM   3300  H  H    . GLY A 1 19 ? 3.870   -4.520  2.759   1.00 0.00 ? 19  GLY A H    6  
ATOM   3301  H  HA2  . GLY A 1 19 ? 2.567   -6.543  2.996   1.00 0.00 ? 19  GLY A HA2  6  
ATOM   3302  H  HA3  . GLY A 1 19 ? 3.571   -6.969  4.374   1.00 0.00 ? 19  GLY A HA3  6  
ATOM   3303  N  N    . LYS A 1 20 ? 2.069   -4.185  4.829   1.00 0.00 ? 20  LYS A N    6  
ATOM   3304  C  CA   . LYS A 1 20 ? 1.147   -3.450  5.686   1.00 0.00 ? 20  LYS A CA   6  
ATOM   3305  C  C    . LYS A 1 20 ? -0.294  -3.639  5.224   1.00 0.00 ? 20  LYS A C    6  
ATOM   3306  O  O    . LYS A 1 20 ? -0.676  -3.179  4.148   1.00 0.00 ? 20  LYS A O    6  
ATOM   3307  C  CB   . LYS A 1 20 ? 1.501   -1.961  5.693   1.00 0.00 ? 20  LYS A CB   6  
ATOM   3308  C  CG   . LYS A 1 20 ? 1.089   -1.244  6.967   1.00 0.00 ? 20  LYS A CG   6  
ATOM   3309  C  CD   . LYS A 1 20 ? 1.967   -1.644  8.141   1.00 0.00 ? 20  LYS A CD   6  
ATOM   3310  C  CE   . LYS A 1 20 ? 1.743   -0.734  9.339   1.00 0.00 ? 20  LYS A CE   6  
ATOM   3311  N  NZ   . LYS A 1 20 ? 2.388   -1.270  10.570  1.00 0.00 ? 20  LYS A NZ   6  
ATOM   3312  H  H    . LYS A 1 20 ? 2.697   -3.687  4.264   1.00 0.00 ? 20  LYS A H    6  
ATOM   3313  H  HA   . LYS A 1 20 ? 1.245   -3.839  6.689   1.00 0.00 ? 20  LYS A HA   6  
ATOM   3314  H  HB2  . LYS A 1 20 ? 2.569   -1.857  5.575   1.00 0.00 ? 20  LYS A HB2  6  
ATOM   3315  H  HB3  . LYS A 1 20 ? 1.007   -1.483  4.859   1.00 0.00 ? 20  LYS A HB3  6  
ATOM   3316  H  HG2  . LYS A 1 20 ? 1.176   -0.178  6.813   1.00 0.00 ? 20  LYS A HG2  6  
ATOM   3317  H  HG3  . LYS A 1 20 ? 0.063   -1.494  7.194   1.00 0.00 ? 20  LYS A HG3  6  
ATOM   3318  H  HD2  . LYS A 1 20 ? 1.732   -2.659  8.425   1.00 0.00 ? 20  LYS A HD2  6  
ATOM   3319  H  HD3  . LYS A 1 20 ? 3.003   -1.582  7.841   1.00 0.00 ? 20  LYS A HD3  6  
ATOM   3320  H  HE2  . LYS A 1 20 ? 2.158   0.237   9.119   1.00 0.00 ? 20  LYS A HE2  6  
ATOM   3321  H  HE3  . LYS A 1 20 ? 0.681   -0.641  9.510   1.00 0.00 ? 20  LYS A HE3  6  
ATOM   3322  H  HZ1  . LYS A 1 20 ? 2.388   -2.310  10.550  1.00 0.00 ? 20  LYS A HZ1  6  
ATOM   3323  H  HZ2  . LYS A 1 20 ? 1.868   -0.950  11.413  1.00 0.00 ? 20  LYS A HZ2  6  
ATOM   3324  H  HZ3  . LYS A 1 20 ? 3.370   -0.934  10.634  1.00 0.00 ? 20  LYS A HZ3  6  
ATOM   3325  N  N    . ALA A 1 21 ? -1.090  -4.317  6.044   1.00 0.00 ? 21  ALA A N    6  
ATOM   3326  C  CA   . ALA A 1 21 ? -2.490  -4.563  5.720   1.00 0.00 ? 21  ALA A CA   6  
ATOM   3327  C  C    . ALA A 1 21 ? -3.381  -3.445  6.252   1.00 0.00 ? 21  ALA A C    6  
ATOM   3328  O  O    . ALA A 1 21 ? -3.302  -3.080  7.425   1.00 0.00 ? 21  ALA A O    6  
ATOM   3329  C  CB   . ALA A 1 21 ? -2.933  -5.906  6.281   1.00 0.00 ? 21  ALA A CB   6  
ATOM   3330  H  H    . ALA A 1 21 ? -0.728  -4.658  6.888   1.00 0.00 ? 21  ALA A H    6  
ATOM   3331  H  HA   . ALA A 1 21 ? -2.582  -4.602  4.644   1.00 0.00 ? 21  ALA A HA   6  
ATOM   3332  H  HB1  . ALA A 1 21 ? -4.006  -5.994  6.197   1.00 0.00 ? 21  ALA A HB1  6  
ATOM   3333  H  HB2  . ALA A 1 21 ? -2.461  -6.702  5.722   1.00 0.00 ? 21  ALA A HB2  6  
ATOM   3334  H  HB3  . ALA A 1 21 ? -2.646  -5.975  7.319   1.00 0.00 ? 21  ALA A HB3  6  
ATOM   3335  N  N    . PHE A 1 22 ? -4.228  -2.906  5.382   1.00 0.00 ? 22  PHE A N    6  
ATOM   3336  C  CA   . PHE A 1 22 ? -5.134  -1.829  5.764   1.00 0.00 ? 22  PHE A CA   6  
ATOM   3337  C  C    . PHE A 1 22 ? -6.588  -2.244  5.564   1.00 0.00 ? 22  PHE A C    6  
ATOM   3338  O  O    . PHE A 1 22 ? -6.871  -3.330  5.058   1.00 0.00 ? 22  PHE A O    6  
ATOM   3339  C  CB   . PHE A 1 22 ? -4.834  -0.569  4.949   1.00 0.00 ? 22  PHE A CB   6  
ATOM   3340  C  CG   . PHE A 1 22 ? -3.409  -0.107  5.060   1.00 0.00 ? 22  PHE A CG   6  
ATOM   3341  C  CD1  . PHE A 1 22 ? -2.430  -0.635  4.235   1.00 0.00 ? 22  PHE A CD1  6  
ATOM   3342  C  CD2  . PHE A 1 22 ? -3.050  0.854   5.991   1.00 0.00 ? 22  PHE A CD2  6  
ATOM   3343  C  CE1  . PHE A 1 22 ? -1.117  -0.211  4.335   1.00 0.00 ? 22  PHE A CE1  6  
ATOM   3344  C  CE2  . PHE A 1 22 ? -1.740  1.281   6.095   1.00 0.00 ? 22  PHE A CE2  6  
ATOM   3345  C  CZ   . PHE A 1 22 ? -0.772  0.747   5.267   1.00 0.00 ? 22  PHE A CZ   6  
ATOM   3346  H  H    . PHE A 1 22 ? -4.245  -3.241  4.461   1.00 0.00 ? 22  PHE A H    6  
ATOM   3347  H  HA   . PHE A 1 22 ? -4.973  -1.617  6.810   1.00 0.00 ? 22  PHE A HA   6  
ATOM   3348  H  HB2  . PHE A 1 22 ? -5.038  -0.767  3.907   1.00 0.00 ? 22  PHE A HB2  6  
ATOM   3349  H  HB3  . PHE A 1 22 ? -5.472  0.232   5.290   1.00 0.00 ? 22  PHE A HB3  6  
ATOM   3350  H  HD1  . PHE A 1 22 ? -2.699  -1.385  3.505   1.00 0.00 ? 22  PHE A HD1  6  
ATOM   3351  H  HD2  . PHE A 1 22 ? -3.805  1.272   6.641   1.00 0.00 ? 22  PHE A HD2  6  
ATOM   3352  H  HE1  . PHE A 1 22 ? -0.364  -0.631  3.685   1.00 0.00 ? 22  PHE A HE1  6  
ATOM   3353  H  HE2  . PHE A 1 22 ? -1.472  2.031   6.825   1.00 0.00 ? 22  PHE A HE2  6  
ATOM   3354  H  HZ   . PHE A 1 22 ? 0.252   1.079   5.346   1.00 0.00 ? 22  PHE A HZ   6  
ATOM   3355  N  N    . ARG A 1 23 ? -7.507  -1.371  5.966   1.00 0.00 ? 23  ARG A N    6  
ATOM   3356  C  CA   . ARG A 1 23 ? -8.932  -1.647  5.834   1.00 0.00 ? 23  ARG A CA   6  
ATOM   3357  C  C    . ARG A 1 23 ? -9.461  -1.144  4.494   1.00 0.00 ? 23  ARG A C    6  
ATOM   3358  O  O    . ARG A 1 23 ? -10.343 -1.757  3.893   1.00 0.00 ? 23  ARG A O    6  
ATOM   3359  C  CB   . ARG A 1 23 ? -9.709  -0.994  6.978   1.00 0.00 ? 23  ARG A CB   6  
ATOM   3360  C  CG   . ARG A 1 23 ? -11.186 -1.352  6.995   1.00 0.00 ? 23  ARG A CG   6  
ATOM   3361  C  CD   . ARG A 1 23 ? -11.992 -0.352  7.808   1.00 0.00 ? 23  ARG A CD   6  
ATOM   3362  N  NE   . ARG A 1 23 ? -11.746 -0.486  9.242   1.00 0.00 ? 23  ARG A NE   6  
ATOM   3363  C  CZ   . ARG A 1 23 ? -12.294 -1.432  9.996   1.00 0.00 ? 23  ARG A CZ   6  
ATOM   3364  N  NH1  . ARG A 1 23 ? -13.115 -2.322  9.457   1.00 0.00 ? 23  ARG A NH1  6  
ATOM   3365  N  NH2  . ARG A 1 23 ? -12.021 -1.489  11.293  1.00 0.00 ? 23  ARG A NH2  6  
ATOM   3366  H  H    . ARG A 1 23 ? -7.219  -0.522  6.363   1.00 0.00 ? 23  ARG A H    6  
ATOM   3367  H  HA   . ARG A 1 23 ? -9.069  -2.717  5.882   1.00 0.00 ? 23  ARG A HA   6  
ATOM   3368  H  HB2  . ARG A 1 23 ? -9.275  -1.306  7.917   1.00 0.00 ? 23  ARG A HB2  6  
ATOM   3369  H  HB3  . ARG A 1 23 ? -9.622  0.079   6.890   1.00 0.00 ? 23  ARG A HB3  6  
ATOM   3370  H  HG2  . ARG A 1 23 ? -11.557 -1.357  5.981   1.00 0.00 ? 23  ARG A HG2  6  
ATOM   3371  H  HG3  . ARG A 1 23 ? -11.303 -2.334  7.429   1.00 0.00 ? 23  ARG A HG3  6  
ATOM   3372  H  HD2  . ARG A 1 23 ? -11.721 0.646   7.498   1.00 0.00 ? 23  ARG A HD2  6  
ATOM   3373  H  HD3  . ARG A 1 23 ? -13.042 -0.516  7.616   1.00 0.00 ? 23  ARG A HD3  6  
ATOM   3374  H  HE   . ARG A 1 23 ? -11.142 0.162   9.661   1.00 0.00 ? 23  ARG A HE   6  
ATOM   3375  H  HH11 . ARG A 1 23 ? -13.322 -2.283  8.479   1.00 0.00 ? 23  ARG A HH11 6  
ATOM   3376  H  HH12 . ARG A 1 23 ? -13.525 -3.035  10.027  1.00 0.00 ? 23  ARG A HH12 6  
ATOM   3377  H  HH21 . ARG A 1 23 ? -11.402 -0.819  11.704  1.00 0.00 ? 23  ARG A HH21 6  
ATOM   3378  H  HH22 . ARG A 1 23 ? -12.434 -2.201  11.860  1.00 0.00 ? 23  ARG A HH22 6  
ATOM   3379  N  N    . SER A 1 24 ? -8.915  -0.023  4.031   1.00 0.00 ? 24  SER A N    6  
ATOM   3380  C  CA   . SER A 1 24 ? -9.335  0.565   2.765   1.00 0.00 ? 24  SER A CA   6  
ATOM   3381  C  C    . SER A 1 24 ? -8.136  0.798   1.851   1.00 0.00 ? 24  SER A C    6  
ATOM   3382  O  O    . SER A 1 24 ? -6.986  0.706   2.280   1.00 0.00 ? 24  SER A O    6  
ATOM   3383  C  CB   . SER A 1 24 ? -10.068 1.885   3.010   1.00 0.00 ? 24  SER A CB   6  
ATOM   3384  O  OG   . SER A 1 24 ? -11.154 1.708   3.903   1.00 0.00 ? 24  SER A OG   6  
ATOM   3385  H  H    . SER A 1 24 ? -8.216  0.419   4.556   1.00 0.00 ? 24  SER A H    6  
ATOM   3386  H  HA   . SER A 1 24 ? -10.010 -0.128  2.285   1.00 0.00 ? 24  SER A HA   6  
ATOM   3387  H  HB2  . SER A 1 24 ? -9.382  2.602   3.435   1.00 0.00 ? 24  SER A HB2  6  
ATOM   3388  H  HB3  . SER A 1 24 ? -10.447 2.263   2.071   1.00 0.00 ? 24  SER A HB3  6  
ATOM   3389  H  HG   . SER A 1 24 ? -11.981 1.789   3.422   1.00 0.00 ? 24  SER A HG   6  
ATOM   3390  N  N    . LYS A 1 25 ? -8.414  1.100   0.587   1.00 0.00 ? 25  LYS A N    6  
ATOM   3391  C  CA   . LYS A 1 25 ? -7.360  1.348   -0.390  1.00 0.00 ? 25  LYS A CA   6  
ATOM   3392  C  C    . LYS A 1 25 ? -6.665  2.677   -0.116  1.00 0.00 ? 25  LYS A C    6  
ATOM   3393  O  O    . LYS A 1 25 ? -5.438  2.768   -0.160  1.00 0.00 ? 25  LYS A O    6  
ATOM   3394  C  CB   . LYS A 1 25 ? -7.940  1.346   -1.807  1.00 0.00 ? 25  LYS A CB   6  
ATOM   3395  C  CG   . LYS A 1 25 ? -6.929  1.720   -2.878  1.00 0.00 ? 25  LYS A CG   6  
ATOM   3396  C  CD   . LYS A 1 25 ? -7.607  2.014   -4.205  1.00 0.00 ? 25  LYS A CD   6  
ATOM   3397  C  CE   . LYS A 1 25 ? -8.167  3.428   -4.244  1.00 0.00 ? 25  LYS A CE   6  
ATOM   3398  N  NZ   . LYS A 1 25 ? -9.553  3.492   -3.704  1.00 0.00 ? 25  LYS A NZ   6  
ATOM   3399  H  H    . LYS A 1 25 ? -9.351  1.158   0.304   1.00 0.00 ? 25  LYS A H    6  
ATOM   3400  H  HA   . LYS A 1 25 ? -6.636  0.552   -0.306  1.00 0.00 ? 25  LYS A HA   6  
ATOM   3401  H  HB2  . LYS A 1 25 ? -8.318  0.359   -2.027  1.00 0.00 ? 25  LYS A HB2  6  
ATOM   3402  H  HB3  . LYS A 1 25 ? -8.756  2.052   -1.850  1.00 0.00 ? 25  LYS A HB3  6  
ATOM   3403  H  HG2  . LYS A 1 25 ? -6.390  2.599   -2.559  1.00 0.00 ? 25  LYS A HG2  6  
ATOM   3404  H  HG3  . LYS A 1 25 ? -6.239  0.900   -3.010  1.00 0.00 ? 25  LYS A HG3  6  
ATOM   3405  H  HD2  . LYS A 1 25 ? -6.886  1.903   -5.001  1.00 0.00 ? 25  LYS A HD2  6  
ATOM   3406  H  HD3  . LYS A 1 25 ? -8.416  1.312   -4.350  1.00 0.00 ? 25  LYS A HD3  6  
ATOM   3407  H  HE2  . LYS A 1 25 ? -7.530  4.070   -3.655  1.00 0.00 ? 25  LYS A HE2  6  
ATOM   3408  H  HE3  . LYS A 1 25 ? -8.173  3.771   -5.269  1.00 0.00 ? 25  LYS A HE3  6  
ATOM   3409  H  HZ1  . LYS A 1 25 ? -9.546  3.908   -2.751  1.00 0.00 ? 25  LYS A HZ1  6  
ATOM   3410  H  HZ2  . LYS A 1 25 ? -9.959  2.536   -3.651  1.00 0.00 ? 25  LYS A HZ2  6  
ATOM   3411  H  HZ3  . LYS A 1 25 ? -10.151 4.076   -4.322  1.00 0.00 ? 25  LYS A HZ3  6  
ATOM   3412  N  N    . SER A 1 26 ? -7.457  3.706   0.170   1.00 0.00 ? 26  SER A N    6  
ATOM   3413  C  CA   . SER A 1 26 ? -6.917  5.031   0.450   1.00 0.00 ? 26  SER A CA   6  
ATOM   3414  C  C    . SER A 1 26 ? -5.887  4.972   1.574   1.00 0.00 ? 26  SER A C    6  
ATOM   3415  O  O    . SER A 1 26 ? -4.924  5.739   1.590   1.00 0.00 ? 26  SER A O    6  
ATOM   3416  C  CB   . SER A 1 26 ? -8.044  5.995   0.825   1.00 0.00 ? 26  SER A CB   6  
ATOM   3417  O  OG   . SER A 1 26 ? -7.608  7.342   0.756   1.00 0.00 ? 26  SER A OG   6  
ATOM   3418  H  H    . SER A 1 26 ? -8.428  3.570   0.190   1.00 0.00 ? 26  SER A H    6  
ATOM   3419  H  HA   . SER A 1 26 ? -6.433  5.388   -0.447  1.00 0.00 ? 26  SER A HA   6  
ATOM   3420  H  HB2  . SER A 1 26 ? -8.871  5.862   0.144   1.00 0.00 ? 26  SER A HB2  6  
ATOM   3421  H  HB3  . SER A 1 26 ? -8.371  5.787   1.834   1.00 0.00 ? 26  SER A HB3  6  
ATOM   3422  H  HG   . SER A 1 26 ? -8.347  7.928   0.936   1.00 0.00 ? 26  SER A HG   6  
ATOM   3423  N  N    . TYR A 1 27 ? -6.098  4.056   2.513   1.00 0.00 ? 27  TYR A N    6  
ATOM   3424  C  CA   . TYR A 1 27 ? -5.191  3.898   3.643   1.00 0.00 ? 27  TYR A CA   6  
ATOM   3425  C  C    . TYR A 1 27 ? -3.841  3.354   3.185   1.00 0.00 ? 27  TYR A C    6  
ATOM   3426  O  O    . TYR A 1 27 ? -2.799  3.685   3.754   1.00 0.00 ? 27  TYR A O    6  
ATOM   3427  C  CB   . TYR A 1 27 ? -5.802  2.962   4.687   1.00 0.00 ? 27  TYR A CB   6  
ATOM   3428  C  CG   . TYR A 1 27 ? -6.635  3.677   5.727   1.00 0.00 ? 27  TYR A CG   6  
ATOM   3429  C  CD1  . TYR A 1 27 ? -6.136  4.782   6.406   1.00 0.00 ? 27  TYR A CD1  6  
ATOM   3430  C  CD2  . TYR A 1 27 ? -7.921  3.248   6.031   1.00 0.00 ? 27  TYR A CD2  6  
ATOM   3431  C  CE1  . TYR A 1 27 ? -6.893  5.438   7.357   1.00 0.00 ? 27  TYR A CE1  6  
ATOM   3432  C  CE2  . TYR A 1 27 ? -8.686  3.899   6.979   1.00 0.00 ? 27  TYR A CE2  6  
ATOM   3433  C  CZ   . TYR A 1 27 ? -8.168  4.993   7.640   1.00 0.00 ? 27  TYR A CZ   6  
ATOM   3434  O  OH   . TYR A 1 27 ? -8.926  5.643   8.586   1.00 0.00 ? 27  TYR A OH   6  
ATOM   3435  H  H    . TYR A 1 27 ? -6.884  3.474   2.446   1.00 0.00 ? 27  TYR A H    6  
ATOM   3436  H  HA   . TYR A 1 27 ? -5.042  4.870   4.088   1.00 0.00 ? 27  TYR A HA   6  
ATOM   3437  H  HB2  . TYR A 1 27 ? -6.437  2.245   4.191   1.00 0.00 ? 27  TYR A HB2  6  
ATOM   3438  H  HB3  . TYR A 1 27 ? -5.008  2.439   5.201   1.00 0.00 ? 27  TYR A HB3  6  
ATOM   3439  H  HD1  . TYR A 1 27 ? -5.137  5.128   6.182   1.00 0.00 ? 27  TYR A HD1  6  
ATOM   3440  H  HD2  . TYR A 1 27 ? -8.324  2.390   5.512   1.00 0.00 ? 27  TYR A HD2  6  
ATOM   3441  H  HE1  . TYR A 1 27 ? -6.488  6.295   7.874   1.00 0.00 ? 27  TYR A HE1  6  
ATOM   3442  H  HE2  . TYR A 1 27 ? -9.684  3.550   7.201   1.00 0.00 ? 27  TYR A HE2  6  
ATOM   3443  H  HH   . TYR A 1 27 ? -9.858  5.524   8.386   1.00 0.00 ? 27  TYR A HH   6  
ATOM   3444  N  N    . LEU A 1 28 ? -3.866  2.519   2.153   1.00 0.00 ? 28  LEU A N    6  
ATOM   3445  C  CA   . LEU A 1 28 ? -2.645  1.928   1.616   1.00 0.00 ? 28  LEU A CA   6  
ATOM   3446  C  C    . LEU A 1 28 ? -1.899  2.926   0.735   1.00 0.00 ? 28  LEU A C    6  
ATOM   3447  O  O    . LEU A 1 28 ? -0.669  2.923   0.682   1.00 0.00 ? 28  LEU A O    6  
ATOM   3448  C  CB   . LEU A 1 28 ? -2.974  0.669   0.813   1.00 0.00 ? 28  LEU A CB   6  
ATOM   3449  C  CG   . LEU A 1 28 ? -1.889  0.183   -0.148  1.00 0.00 ? 28  LEU A CG   6  
ATOM   3450  C  CD1  . LEU A 1 28 ? -0.703  -0.377  0.624   1.00 0.00 ? 28  LEU A CD1  6  
ATOM   3451  C  CD2  . LEU A 1 28 ? -2.449  -0.864  -1.100  1.00 0.00 ? 28  LEU A CD2  6  
ATOM   3452  H  H    . LEU A 1 28 ? -4.726  2.293   1.741   1.00 0.00 ? 28  LEU A H    6  
ATOM   3453  H  HA   . LEU A 1 28 ? -2.013  1.660   2.449   1.00 0.00 ? 28  LEU A HA   6  
ATOM   3454  H  HB2  . LEU A 1 28 ? -3.175  -0.127  1.514   1.00 0.00 ? 28  LEU A HB2  6  
ATOM   3455  H  HB3  . LEU A 1 28 ? -3.864  0.869   0.235   1.00 0.00 ? 28  LEU A HB3  6  
ATOM   3456  H  HG   . LEU A 1 28 ? -1.538  1.019   -0.737  1.00 0.00 ? 28  LEU A HG   6  
ATOM   3457  H  HD11 . LEU A 1 28 ? -0.300  0.389   1.269   1.00 0.00 ? 28  LEU A HD11 6  
ATOM   3458  H  HD12 . LEU A 1 28 ? 0.058   -0.701  -0.071  1.00 0.00 ? 28  LEU A HD12 6  
ATOM   3459  H  HD13 . LEU A 1 28 ? -1.027  -1.217  1.220   1.00 0.00 ? 28  LEU A HD13 6  
ATOM   3460  H  HD21 . LEU A 1 28 ? -1.821  -1.742  -1.080  1.00 0.00 ? 28  LEU A HD21 6  
ATOM   3461  H  HD22 . LEU A 1 28 ? -2.474  -0.462  -2.102  1.00 0.00 ? 28  LEU A HD22 6  
ATOM   3462  H  HD23 . LEU A 1 28 ? -3.451  -1.129  -0.794  1.00 0.00 ? 28  LEU A HD23 6  
ATOM   3463  N  N    . ILE A 1 29 ? -2.652  3.779   0.049   1.00 0.00 ? 29  ILE A N    6  
ATOM   3464  C  CA   . ILE A 1 29 ? -2.062  4.784   -0.826  1.00 0.00 ? 29  ILE A CA   6  
ATOM   3465  C  C    . ILE A 1 29 ? -1.342  5.860   -0.021  1.00 0.00 ? 29  ILE A C    6  
ATOM   3466  O  O    . ILE A 1 29 ? -0.228  6.263   -0.359  1.00 0.00 ? 29  ILE A O    6  
ATOM   3467  C  CB   . ILE A 1 29 ? -3.127  5.452   -1.716  1.00 0.00 ? 29  ILE A CB   6  
ATOM   3468  C  CG1  . ILE A 1 29 ? -3.778  4.415   -2.634  1.00 0.00 ? 29  ILE A CG1  6  
ATOM   3469  C  CG2  . ILE A 1 29 ? -2.507  6.576   -2.532  1.00 0.00 ? 29  ILE A CG2  6  
ATOM   3470  C  CD1  . ILE A 1 29 ? -5.202  4.755   -3.015  1.00 0.00 ? 29  ILE A CD1  6  
ATOM   3471  H  H    . ILE A 1 29 ? -3.627  3.732   0.133   1.00 0.00 ? 29  ILE A H    6  
ATOM   3472  H  HA   . ILE A 1 29 ? -1.346  4.289   -1.467  1.00 0.00 ? 29  ILE A HA   6  
ATOM   3473  H  HB   . ILE A 1 29 ? -3.883  5.879   -1.075  1.00 0.00 ? 29  ILE A HB   6  
ATOM   3474  H  HG12 . ILE A 1 29 ? -3.202  4.336   -3.542  1.00 0.00 ? 29  ILE A HG12 6  
ATOM   3475  H  HG13 . ILE A 1 29 ? -3.788  3.458   -2.134  1.00 0.00 ? 29  ILE A HG13 6  
ATOM   3476  H  HG21 . ILE A 1 29 ? -1.457  6.657   -2.293  1.00 0.00 ? 29  ILE A HG21 6  
ATOM   3477  H  HG22 . ILE A 1 29 ? -2.619  6.360   -3.584  1.00 0.00 ? 29  ILE A HG22 6  
ATOM   3478  H  HG23 . ILE A 1 29 ? -3.003  7.506   -2.300  1.00 0.00 ? 29  ILE A HG23 6  
ATOM   3479  H  HD11 . ILE A 1 29 ? -5.855  4.561   -2.176  1.00 0.00 ? 29  ILE A HD11 6  
ATOM   3480  H  HD12 . ILE A 1 29 ? -5.264  5.800   -3.283  1.00 0.00 ? 29  ILE A HD12 6  
ATOM   3481  H  HD13 . ILE A 1 29 ? -5.505  4.149   -3.855  1.00 0.00 ? 29  ILE A HD13 6  
ATOM   3482  N  N    . ILE A 1 30 ? -1.984  6.320   1.048   1.00 0.00 ? 30  ILE A N    6  
ATOM   3483  C  CA   . ILE A 1 30 ? -1.403  7.348   1.904   1.00 0.00 ? 30  ILE A CA   6  
ATOM   3484  C  C    . ILE A 1 30 ? -0.174  6.822   2.638   1.00 0.00 ? 30  ILE A C    6  
ATOM   3485  O  O    . ILE A 1 30 ? 0.636   7.596   3.148   1.00 0.00 ? 30  ILE A O    6  
ATOM   3486  C  CB   . ILE A 1 30 ? -2.423  7.862   2.937   1.00 0.00 ? 30  ILE A CB   6  
ATOM   3487  C  CG1  . ILE A 1 30 ? -2.961  6.702   3.776   1.00 0.00 ? 30  ILE A CG1  6  
ATOM   3488  C  CG2  . ILE A 1 30 ? -3.562  8.591   2.239   1.00 0.00 ? 30  ILE A CG2  6  
ATOM   3489  C  CD1  . ILE A 1 30 ? -2.149  6.430   5.023   1.00 0.00 ? 30  ILE A CD1  6  
ATOM   3490  H  H    . ILE A 1 30 ? -2.868  5.960   1.266   1.00 0.00 ? 30  ILE A H    6  
ATOM   3491  H  HA   . ILE A 1 30 ? -1.107  8.176   1.276   1.00 0.00 ? 30  ILE A HA   6  
ATOM   3492  H  HB   . ILE A 1 30 ? -1.922  8.564   3.585   1.00 0.00 ? 30  ILE A HB   6  
ATOM   3493  H  HG12 . ILE A 1 30 ? -3.971  6.924   4.081   1.00 0.00 ? 30  ILE A HG12 6  
ATOM   3494  H  HG13 . ILE A 1 30 ? -2.961  5.803   3.176   1.00 0.00 ? 30  ILE A HG13 6  
ATOM   3495  H  HG21 . ILE A 1 30 ? -3.544  8.360   1.184   1.00 0.00 ? 30  ILE A HG21 6  
ATOM   3496  H  HG22 . ILE A 1 30 ? -4.504  8.273   2.660   1.00 0.00 ? 30  ILE A HG22 6  
ATOM   3497  H  HG23 . ILE A 1 30 ? -3.446  9.655   2.377   1.00 0.00 ? 30  ILE A HG23 6  
ATOM   3498  H  HD11 . ILE A 1 30 ? -1.594  7.318   5.291   1.00 0.00 ? 30  ILE A HD11 6  
ATOM   3499  H  HD12 . ILE A 1 30 ? -2.810  6.162   5.833   1.00 0.00 ? 30  ILE A HD12 6  
ATOM   3500  H  HD13 . ILE A 1 30 ? -1.461  5.619   4.836   1.00 0.00 ? 30  ILE A HD13 6  
ATOM   3501  N  N    . HIS A 1 31 ? -0.041  5.500   2.686   1.00 0.00 ? 31  HIS A N    6  
ATOM   3502  C  CA   . HIS A 1 31 ? 1.091   4.870   3.355   1.00 0.00 ? 31  HIS A CA   6  
ATOM   3503  C  C    . HIS A 1 31 ? 2.209   4.566   2.362   1.00 0.00 ? 31  HIS A C    6  
ATOM   3504  O  O    . HIS A 1 31 ? 3.350   4.994   2.545   1.00 0.00 ? 31  HIS A O    6  
ATOM   3505  C  CB   . HIS A 1 31 ? 0.647   3.582   4.050   1.00 0.00 ? 31  HIS A CB   6  
ATOM   3506  C  CG   . HIS A 1 31 ? 1.741   2.569   4.190   1.00 0.00 ? 31  HIS A CG   6  
ATOM   3507  N  ND1  . HIS A 1 31 ? 2.452   2.384   5.357   1.00 0.00 ? 31  HIS A ND1  6  
ATOM   3508  C  CD2  . HIS A 1 31 ? 2.245   1.681   3.301   1.00 0.00 ? 31  HIS A CD2  6  
ATOM   3509  C  CE1  . HIS A 1 31 ? 3.346   1.428   5.179   1.00 0.00 ? 31  HIS A CE1  6  
ATOM   3510  N  NE2  . HIS A 1 31 ? 3.240   0.984   3.940   1.00 0.00 ? 31  HIS A NE2  6  
ATOM   3511  H  H    . HIS A 1 31 ? -0.720  4.936   2.261   1.00 0.00 ? 31  HIS A H    6  
ATOM   3512  H  HA   . HIS A 1 31 ? 1.463   5.559   4.098   1.00 0.00 ? 31  HIS A HA   6  
ATOM   3513  H  HB2  . HIS A 1 31 ? 0.289   3.821   5.041   1.00 0.00 ? 31  HIS A HB2  6  
ATOM   3514  H  HB3  . HIS A 1 31 ? -0.153  3.131   3.482   1.00 0.00 ? 31  HIS A HB3  6  
ATOM   3515  H  HD1  . HIS A 1 31 ? 2.321   2.881   6.191   1.00 0.00 ? 31  HIS A HD1  6  
ATOM   3516  H  HD2  . HIS A 1 31 ? 1.923   1.545   2.277   1.00 0.00 ? 31  HIS A HD2  6  
ATOM   3517  H  HE1  . HIS A 1 31 ? 4.044   1.069   5.921   1.00 0.00 ? 31  HIS A HE1  6  
ATOM   3518  N  N    . THR A 1 32 ? 1.875   3.825   1.311   1.00 0.00 ? 32  THR A N    6  
ATOM   3519  C  CA   . THR A 1 32 ? 2.851   3.463   0.290   1.00 0.00 ? 32  THR A CA   6  
ATOM   3520  C  C    . THR A 1 32 ? 3.726   4.654   -0.082  1.00 0.00 ? 32  THR A C    6  
ATOM   3521  O  O    . THR A 1 32 ? 4.860   4.488   -0.530  1.00 0.00 ? 32  THR A O    6  
ATOM   3522  C  CB   . THR A 1 32 ? 2.163   2.929   -0.980  1.00 0.00 ? 32  THR A CB   6  
ATOM   3523  O  OG1  . THR A 1 32 ? 1.368   1.781   -0.662  1.00 0.00 ? 32  THR A OG1  6  
ATOM   3524  C  CG2  . THR A 1 32 ? 3.192   2.561   -2.039  1.00 0.00 ? 32  THR A CG2  6  
ATOM   3525  H  H    . THR A 1 32 ? 0.950   3.514   1.221   1.00 0.00 ? 32  THR A H    6  
ATOM   3526  H  HA   . THR A 1 32 ? 3.478   2.679   0.691   1.00 0.00 ? 32  THR A HA   6  
ATOM   3527  H  HB   . THR A 1 32 ? 1.521   3.703   -1.376  1.00 0.00 ? 32  THR A HB   6  
ATOM   3528  H  HG1  . THR A 1 32 ? 0.460   2.053   -0.507  1.00 0.00 ? 32  THR A HG1  6  
ATOM   3529  H  HG21 . THR A 1 32 ? 3.892   3.374   -2.157  1.00 0.00 ? 32  THR A HG21 6  
ATOM   3530  H  HG22 . THR A 1 32 ? 2.692   2.378   -2.979  1.00 0.00 ? 32  THR A HG22 6  
ATOM   3531  H  HG23 . THR A 1 32 ? 3.721   1.671   -1.733  1.00 0.00 ? 32  THR A HG23 6  
ATOM   3532  N  N    . ARG A 1 33 ? 3.191   5.856   0.107   1.00 0.00 ? 33  ARG A N    6  
ATOM   3533  C  CA   . ARG A 1 33 ? 3.924   7.076   -0.209  1.00 0.00 ? 33  ARG A CA   6  
ATOM   3534  C  C    . ARG A 1 33 ? 5.120   7.249   0.722   1.00 0.00 ? 33  ARG A C    6  
ATOM   3535  O  O    . ARG A 1 33 ? 6.203   7.650   0.293   1.00 0.00 ? 33  ARG A O    6  
ATOM   3536  C  CB   . ARG A 1 33 ? 3.002   8.292   -0.104  1.00 0.00 ? 33  ARG A CB   6  
ATOM   3537  C  CG   . ARG A 1 33 ? 2.120   8.282   1.134   1.00 0.00 ? 33  ARG A CG   6  
ATOM   3538  C  CD   . ARG A 1 33 ? 1.557   9.664   1.428   1.00 0.00 ? 33  ARG A CD   6  
ATOM   3539  N  NE   . ARG A 1 33 ? 2.554   10.545  2.030   1.00 0.00 ? 33  ARG A NE   6  
ATOM   3540  C  CZ   . ARG A 1 33 ? 2.854   10.539  3.324   1.00 0.00 ? 33  ARG A CZ   6  
ATOM   3541  N  NH1  . ARG A 1 33 ? 2.238   9.703   4.147   1.00 0.00 ? 33  ARG A NH1  6  
ATOM   3542  N  NH2  . ARG A 1 33 ? 3.774   11.371  3.796   1.00 0.00 ? 33  ARG A NH2  6  
ATOM   3543  H  H    . ARG A 1 33 ? 2.282   5.925   0.467   1.00 0.00 ? 33  ARG A H    6  
ATOM   3544  H  HA   . ARG A 1 33 ? 4.282   6.994   -1.224  1.00 0.00 ? 33  ARG A HA   6  
ATOM   3545  H  HB2  . ARG A 1 33 ? 3.606   9.187   -0.080  1.00 0.00 ? 33  ARG A HB2  6  
ATOM   3546  H  HB3  . ARG A 1 33 ? 2.364   8.321   -0.974  1.00 0.00 ? 33  ARG A HB3  6  
ATOM   3547  H  HG2  . ARG A 1 33 ? 1.299   7.598   0.974   1.00 0.00 ? 33  ARG A HG2  6  
ATOM   3548  H  HG3  . ARG A 1 33 ? 2.706   7.954   1.979   1.00 0.00 ? 33  ARG A HG3  6  
ATOM   3549  H  HD2  . ARG A 1 33 ? 1.214   10.103  0.503   1.00 0.00 ? 33  ARG A HD2  6  
ATOM   3550  H  HD3  . ARG A 1 33 ? 0.724   9.561   2.107   1.00 0.00 ? 33  ARG A HD3  6  
ATOM   3551  H  HE   . ARG A 1 33 ? 3.022   11.171  1.439   1.00 0.00 ? 33  ARG A HE   6  
ATOM   3552  H  HH11 . ARG A 1 33 ? 1.545   9.074   3.794   1.00 0.00 ? 33  ARG A HH11 6  
ATOM   3553  H  HH12 . ARG A 1 33 ? 2.467   9.699   5.121   1.00 0.00 ? 33  ARG A HH12 6  
ATOM   3554  H  HH21 . ARG A 1 33 ? 4.241   12.002  3.179   1.00 0.00 ? 33  ARG A HH21 6  
ATOM   3555  H  HH22 . ARG A 1 33 ? 3.999   11.366  4.770   1.00 0.00 ? 33  ARG A HH22 6  
ATOM   3556  N  N    . THR A 1 34 ? 4.917   6.945   2.001   1.00 0.00 ? 34  THR A N    6  
ATOM   3557  C  CA   . THR A 1 34 ? 5.977   7.068   2.993   1.00 0.00 ? 34  THR A CA   6  
ATOM   3558  C  C    . THR A 1 34 ? 7.250   6.370   2.528   1.00 0.00 ? 34  THR A C    6  
ATOM   3559  O  O    . THR A 1 34 ? 8.359   6.811   2.832   1.00 0.00 ? 34  THR A O    6  
ATOM   3560  C  CB   . THR A 1 34 ? 5.548   6.479   4.350   1.00 0.00 ? 34  THR A CB   6  
ATOM   3561  O  OG1  . THR A 1 34 ? 6.395   6.978   5.391   1.00 0.00 ? 34  THR A OG1  6  
ATOM   3562  C  CG2  . THR A 1 34 ? 5.609   4.959   4.323   1.00 0.00 ? 34  THR A CG2  6  
ATOM   3563  H  H    . THR A 1 34 ? 4.033   6.631   2.281   1.00 0.00 ? 34  THR A H    6  
ATOM   3564  H  HA   . THR A 1 34 ? 6.185   8.120   3.130   1.00 0.00 ? 34  THR A HA   6  
ATOM   3565  H  HB   . THR A 1 34 ? 4.529   6.780   4.550   1.00 0.00 ? 34  THR A HB   6  
ATOM   3566  H  HG1  . THR A 1 34 ? 6.061   6.687   6.243   1.00 0.00 ? 34  THR A HG1  6  
ATOM   3567  H  HG21 . THR A 1 34 ? 5.357   4.607   3.335   1.00 0.00 ? 34  THR A HG21 6  
ATOM   3568  H  HG22 . THR A 1 34 ? 4.906   4.558   5.038   1.00 0.00 ? 34  THR A HG22 6  
ATOM   3569  H  HG23 . THR A 1 34 ? 6.607   4.635   4.578   1.00 0.00 ? 34  THR A HG23 6  
ATOM   3570  N  N    . HIS A 1 35 ? 7.083   5.277   1.789   1.00 0.00 ? 35  HIS A N    6  
ATOM   3571  C  CA   . HIS A 1 35 ? 8.220   4.517   1.281   1.00 0.00 ? 35  HIS A CA   6  
ATOM   3572  C  C    . HIS A 1 35 ? 9.203   5.431   0.555   1.00 0.00 ? 35  HIS A C    6  
ATOM   3573  O  O    . HIS A 1 35 ? 10.355  5.063   0.324   1.00 0.00 ? 35  HIS A O    6  
ATOM   3574  C  CB   . HIS A 1 35 ? 7.741   3.412   0.339   1.00 0.00 ? 35  HIS A CB   6  
ATOM   3575  C  CG   . HIS A 1 35 ? 7.108   2.254   1.047   1.00 0.00 ? 35  HIS A CG   6  
ATOM   3576  N  ND1  . HIS A 1 35 ? 7.668   0.995   1.080   1.00 0.00 ? 35  HIS A ND1  6  
ATOM   3577  C  CD2  . HIS A 1 35 ? 5.956   2.171   1.753   1.00 0.00 ? 35  HIS A CD2  6  
ATOM   3578  C  CE1  . HIS A 1 35 ? 6.887   0.186   1.774   1.00 0.00 ? 35  HIS A CE1  6  
ATOM   3579  N  NE2  . HIS A 1 35 ? 5.842   0.875   2.194   1.00 0.00 ? 35  HIS A NE2  6  
ATOM   3580  H  H    . HIS A 1 35 ? 6.175   4.975   1.581   1.00 0.00 ? 35  HIS A H    6  
ATOM   3581  H  HA   . HIS A 1 35 ? 8.722   4.067   2.124   1.00 0.00 ? 35  HIS A HA   6  
ATOM   3582  H  HB2  . HIS A 1 35 ? 7.012   3.822   -0.344  1.00 0.00 ? 35  HIS A HB2  6  
ATOM   3583  H  HB3  . HIS A 1 35 ? 8.584   3.038   -0.224  1.00 0.00 ? 35  HIS A HB3  6  
ATOM   3584  H  HD1  . HIS A 1 35 ? 8.511   0.732   0.656   1.00 0.00 ? 35  HIS A HD1  6  
ATOM   3585  H  HD2  . HIS A 1 35 ? 5.256   2.974   1.936   1.00 0.00 ? 35  HIS A HD2  6  
ATOM   3586  H  HE1  . HIS A 1 35 ? 7.072   -0.860  1.966   1.00 0.00 ? 35  HIS A HE1  6  
ATOM   3587  N  N    . THR A 1 36 ? 8.740   6.624   0.196   1.00 0.00 ? 36  THR A N    6  
ATOM   3588  C  CA   . THR A 1 36 ? 9.577   7.589   -0.505  1.00 0.00 ? 36  THR A CA   6  
ATOM   3589  C  C    . THR A 1 36 ? 10.759  8.020   0.356   1.00 0.00 ? 36  THR A C    6  
ATOM   3590  O  O    . THR A 1 36 ? 11.901  8.034   -0.102  1.00 0.00 ? 36  THR A O    6  
ATOM   3591  C  CB   . THR A 1 36 ? 8.773   8.838   -0.914  1.00 0.00 ? 36  THR A CB   6  
ATOM   3592  O  OG1  . THR A 1 36 ? 7.731   8.472   -1.826  1.00 0.00 ? 36  THR A OG1  6  
ATOM   3593  C  CG2  . THR A 1 36 ? 9.678   9.876   -1.561  1.00 0.00 ? 36  THR A CG2  6  
ATOM   3594  H  H    . THR A 1 36 ? 7.813   6.860   0.408   1.00 0.00 ? 36  THR A H    6  
ATOM   3595  H  HA   . THR A 1 36 ? 9.951   7.117   -1.402  1.00 0.00 ? 36  THR A HA   6  
ATOM   3596  H  HB   . THR A 1 36 ? 8.331   9.269   -0.028  1.00 0.00 ? 36  THR A HB   6  
ATOM   3597  H  HG1  . THR A 1 36 ? 6.894   8.827   -1.514  1.00 0.00 ? 36  THR A HG1  6  
ATOM   3598  H  HG21 . THR A 1 36 ? 10.377  9.384   -2.220  1.00 0.00 ? 36  THR A HG21 6  
ATOM   3599  H  HG22 . THR A 1 36 ? 10.221  10.408  -0.794  1.00 0.00 ? 36  THR A HG22 6  
ATOM   3600  H  HG23 . THR A 1 36 ? 9.078   10.573  -2.127  1.00 0.00 ? 36  THR A HG23 6  
ATOM   3601  N  N    . GLY A 1 37 ? 10.478  8.371   1.607   1.00 0.00 ? 37  GLY A N    6  
ATOM   3602  C  CA   . GLY A 1 37 ? 11.529  8.796   2.513   1.00 0.00 ? 37  GLY A CA   6  
ATOM   3603  C  C    . GLY A 1 37 ? 11.912  7.716   3.505   1.00 0.00 ? 37  GLY A C    6  
ATOM   3604  O  O    . GLY A 1 37 ? 12.158  8.001   4.677   1.00 0.00 ? 37  GLY A O    6  
ATOM   3605  H  H    . GLY A 1 37 ? 9.549   8.340   1.918   1.00 0.00 ? 37  GLY A H    6  
ATOM   3606  H  HA2  . GLY A 1 37 ? 12.400  9.065   1.935   1.00 0.00 ? 37  GLY A HA2  6  
ATOM   3607  H  HA3  . GLY A 1 37 ? 11.189  9.665   3.057   1.00 0.00 ? 37  GLY A HA3  6  
ATOM   3608  N  N    . GLU A 1 38 ? 11.960  6.473   3.036   1.00 0.00 ? 38  GLU A N    6  
ATOM   3609  C  CA   . GLU A 1 38 ? 12.313  5.347   3.893   1.00 0.00 ? 38  GLU A CA   6  
ATOM   3610  C  C    . GLU A 1 38 ? 13.724  4.854   3.589   1.00 0.00 ? 38  GLU A C    6  
ATOM   3611  O  O    . GLU A 1 38 ? 14.612  4.917   4.440   1.00 0.00 ? 38  GLU A O    6  
ATOM   3612  C  CB   . GLU A 1 38 ? 11.311  4.205   3.710   1.00 0.00 ? 38  GLU A CB   6  
ATOM   3613  C  CG   . GLU A 1 38 ? 11.582  3.009   4.607   1.00 0.00 ? 38  GLU A CG   6  
ATOM   3614  C  CD   . GLU A 1 38 ? 10.332  2.200   4.894   1.00 0.00 ? 38  GLU A CD   6  
ATOM   3615  O  OE1  . GLU A 1 38 ? 9.232   2.792   4.909   1.00 0.00 ? 38  GLU A OE1  6  
ATOM   3616  O  OE2  . GLU A 1 38 ? 10.454  0.976   5.105   1.00 0.00 ? 38  GLU A OE2  6  
ATOM   3617  H  H    . GLU A 1 38 ? 11.752  6.310   2.093   1.00 0.00 ? 38  GLU A H    6  
ATOM   3618  H  HA   . GLU A 1 38 ? 12.275  5.686   4.917   1.00 0.00 ? 38  GLU A HA   6  
ATOM   3619  H  HB2  . GLU A 1 38 ? 10.319  4.574   3.926   1.00 0.00 ? 38  GLU A HB2  6  
ATOM   3620  H  HB3  . GLU A 1 38 ? 11.346  3.874   2.683   1.00 0.00 ? 38  GLU A HB3  6  
ATOM   3621  H  HG2  . GLU A 1 38 ? 12.303  2.368   4.122   1.00 0.00 ? 38  GLU A HG2  6  
ATOM   3622  H  HG3  . GLU A 1 38 ? 11.988  3.362   5.543   1.00 0.00 ? 38  GLU A HG3  6  
ATOM   3623  N  N    . SER A 1 39 ? 13.924  4.364   2.370   1.00 0.00 ? 39  SER A N    6  
ATOM   3624  C  CA   . SER A 1 39 ? 15.226  3.856   1.954   1.00 0.00 ? 39  SER A CA   6  
ATOM   3625  C  C    . SER A 1 39 ? 15.986  4.904   1.147   1.00 0.00 ? 39  SER A C    6  
ATOM   3626  O  O    . SER A 1 39 ? 17.136  5.221   1.446   1.00 0.00 ? 39  SER A O    6  
ATOM   3627  C  CB   . SER A 1 39 ? 15.059  2.580   1.126   1.00 0.00 ? 39  SER A CB   6  
ATOM   3628  O  OG   . SER A 1 39 ? 14.846  1.455   1.961   1.00 0.00 ? 39  SER A OG   6  
ATOM   3629  H  H    . SER A 1 39 ? 13.177  4.341   1.736   1.00 0.00 ? 39  SER A H    6  
ATOM   3630  H  HA   . SER A 1 39 ? 15.792  3.625   2.845   1.00 0.00 ? 39  SER A HA   6  
ATOM   3631  H  HB2  . SER A 1 39 ? 14.210  2.690   0.468   1.00 0.00 ? 39  SER A HB2  6  
ATOM   3632  H  HB3  . SER A 1 39 ? 15.951  2.416   0.539   1.00 0.00 ? 39  SER A HB3  6  
ATOM   3633  H  HG   . SER A 1 39 ? 15.003  1.700   2.875   1.00 0.00 ? 39  SER A HG   6  
ATOM   3634  N  N    . GLY A 1 40 ? 15.332  5.438   0.119   1.00 0.00 ? 40  GLY A N    6  
ATOM   3635  C  CA   . GLY A 1 40 ? 15.960  6.445   -0.717  1.00 0.00 ? 40  GLY A CA   6  
ATOM   3636  C  C    . GLY A 1 40 ? 14.953  7.235   -1.528  1.00 0.00 ? 40  GLY A C    6  
ATOM   3637  O  O    . GLY A 1 40 ? 13.825  6.797   -1.754  1.00 0.00 ? 40  GLY A O    6  
ATOM   3638  H  H    . GLY A 1 40 ? 14.417  5.147   -0.073  1.00 0.00 ? 40  GLY A H    6  
ATOM   3639  H  HA2  . GLY A 1 40 ? 16.514  7.125   -0.087  1.00 0.00 ? 40  GLY A HA2  6  
ATOM   3640  H  HA3  . GLY A 1 40 ? 16.647  5.957   -1.393  1.00 0.00 ? 40  GLY A HA3  6  
ATOM   3641  N  N    . PRO A 1 41 ? 15.360  8.431   -1.981  1.00 0.00 ? 41  PRO A N    6  
ATOM   3642  C  CA   . PRO A 1 41 ? 14.499  9.310   -2.778  1.00 0.00 ? 41  PRO A CA   6  
ATOM   3643  C  C    . PRO A 1 41 ? 14.243  8.758   -4.176  1.00 0.00 ? 41  PRO A C    6  
ATOM   3644  O  O    . PRO A 1 41 ? 15.179  8.434   -4.907  1.00 0.00 ? 41  PRO A O    6  
ATOM   3645  C  CB   . PRO A 1 41 ? 15.298  10.613  -2.855  1.00 0.00 ? 41  PRO A CB   6  
ATOM   3646  C  CG   . PRO A 1 41 ? 16.718  10.198  -2.678  1.00 0.00 ? 41  PRO A CG   6  
ATOM   3647  C  CD   . PRO A 1 41 ? 16.691  9.016   -1.750  1.00 0.00 ? 41  PRO A CD   6  
ATOM   3648  H  HA   . PRO A 1 41 ? 13.555  9.493   -2.286  1.00 0.00 ? 41  PRO A HA   6  
ATOM   3649  H  HB2  . PRO A 1 41 ? 15.138  11.080  -3.817  1.00 0.00 ? 41  PRO A HB2  6  
ATOM   3650  H  HB3  . PRO A 1 41 ? 14.981  11.281  -2.068  1.00 0.00 ? 41  PRO A HB3  6  
ATOM   3651  H  HG2  . PRO A 1 41 ? 17.140  9.918   -3.631  1.00 0.00 ? 41  PRO A HG2  6  
ATOM   3652  H  HG3  . PRO A 1 41 ? 17.284  11.007  -2.239  1.00 0.00 ? 41  PRO A HG3  6  
ATOM   3653  H  HD2  . PRO A 1 41 ? 17.471  8.315   -2.009  1.00 0.00 ? 41  PRO A HD2  6  
ATOM   3654  H  HD3  . PRO A 1 41 ? 16.797  9.339   -0.724  1.00 0.00 ? 41  PRO A HD3  6  
ATOM   3655  N  N    . SER A 1 42 ? 12.969  8.655   -4.542  1.00 0.00 ? 42  SER A N    6  
ATOM   3656  C  CA   . SER A 1 42 ? 12.590  8.139   -5.852  1.00 0.00 ? 42  SER A CA   6  
ATOM   3657  C  C    . SER A 1 42 ? 11.598  9.073   -6.538  1.00 0.00 ? 42  SER A C    6  
ATOM   3658  O  O    . SER A 1 42 ? 10.486  9.280   -6.051  1.00 0.00 ? 42  SER A O    6  
ATOM   3659  C  CB   . SER A 1 42 ? 11.983  6.741   -5.718  1.00 0.00 ? 42  SER A CB   6  
ATOM   3660  O  OG   . SER A 1 42 ? 12.994  5.751   -5.640  1.00 0.00 ? 42  SER A OG   6  
ATOM   3661  H  H    . SER A 1 42 ? 12.268  8.929   -3.915  1.00 0.00 ? 42  SER A H    6  
ATOM   3662  H  HA   . SER A 1 42 ? 13.484  8.077   -6.456  1.00 0.00 ? 42  SER A HA   6  
ATOM   3663  H  HB2  . SER A 1 42 ? 11.383  6.697   -4.822  1.00 0.00 ? 42  SER A HB2  6  
ATOM   3664  H  HB3  . SER A 1 42 ? 11.362  6.537   -6.578  1.00 0.00 ? 42  SER A HB3  6  
ATOM   3665  H  HG   . SER A 1 42 ? 13.727  6.082   -5.115  1.00 0.00 ? 42  SER A HG   6  
ATOM   3666  N  N    . SER A 1 43 ? 12.008  9.634   -7.670  1.00 0.00 ? 43  SER A N    6  
ATOM   3667  C  CA   . SER A 1 43 ? 11.158  10.550  -8.422  1.00 0.00 ? 43  SER A CA   6  
ATOM   3668  C  C    . SER A 1 43 ? 9.992   9.805   -9.065  1.00 0.00 ? 43  SER A C    6  
ATOM   3669  O  O    . SER A 1 43 ? 10.143  8.674   -9.526  1.00 0.00 ? 43  SER A O    6  
ATOM   3670  C  CB   . SER A 1 43 ? 11.973  11.271  -9.497  1.00 0.00 ? 43  SER A CB   6  
ATOM   3671  O  OG   . SER A 1 43 ? 12.615  12.418  -8.968  1.00 0.00 ? 43  SER A OG   6  
ATOM   3672  H  H    . SER A 1 43 ? 12.906  9.430   -8.007  1.00 0.00 ? 43  SER A H    6  
ATOM   3673  H  HA   . SER A 1 43 ? 10.765  11.280  -7.730  1.00 0.00 ? 43  SER A HA   6  
ATOM   3674  H  HB2  . SER A 1 43 ? 12.724  10.600  -9.886  1.00 0.00 ? 43  SER A HB2  6  
ATOM   3675  H  HB3  . SER A 1 43 ? 11.316  11.578  -10.298 1.00 0.00 ? 43  SER A HB3  6  
ATOM   3676  H  HG   . SER A 1 43 ? 13.477  12.520  -9.376  1.00 0.00 ? 43  SER A HG   6  
ATOM   3677  N  N    . GLY A 1 44 ? 8.829   10.448  -9.093  1.00 0.00 ? 44  GLY A N    6  
ATOM   3678  C  CA   . GLY A 1 44 ? 7.654   9.832   -9.681  1.00 0.00 ? 44  GLY A CA   6  
ATOM   3679  C  C    . GLY A 1 44 ? 7.085   10.645  -10.826 1.00 0.00 ? 44  GLY A C    6  
ATOM   3680  O  O    . GLY A 1 44 ? 7.592   11.733  -11.099 1.00 0.00 ? 44  GLY A O    6  
ATOM   3681  H  H    . GLY A 1 44 ? 8.768   11.348  -8.710  1.00 0.00 ? 44  GLY A H    6  
ATOM   3682  H  HA2  . GLY A 1 44 ? 7.920   8.851   -10.047 1.00 0.00 ? 44  GLY A HA2  6  
ATOM   3683  H  HA3  . GLY A 1 44 ? 6.897   9.727   -8.918  1.00 0.00 ? 44  GLY A HA3  6  
HETATM 3684  ZN ZN   . ZN  B 2 .  ? 4.521   -0.321  2.908   1.00 0.00 ? 181 ZN  A ZN   6  
ATOM   3685  N  N    . GLY A 1 1  ? -27.886 -14.000 -7.737  1.00 0.00 ? 1   GLY A N    7  
ATOM   3686  C  CA   . GLY A 1 1  ? -27.123 -14.070 -8.969  1.00 0.00 ? 1   GLY A CA   7  
ATOM   3687  C  C    . GLY A 1 1  ? -25.861 -13.232 -8.919  1.00 0.00 ? 1   GLY A C    7  
ATOM   3688  O  O    . GLY A 1 1  ? -25.760 -12.209 -9.596  1.00 0.00 ? 1   GLY A O    7  
ATOM   3689  H  H1   . GLY A 1 1  ? -28.008 -13.138 -7.287  1.00 0.00 ? 1   GLY A H1   7  
ATOM   3690  H  HA2  . GLY A 1 1  ? -26.853 -15.099 -9.155  1.00 0.00 ? 1   GLY A HA2  7  
ATOM   3691  H  HA3  . GLY A 1 1  ? -27.742 -13.719 -9.782  1.00 0.00 ? 1   GLY A HA3  7  
ATOM   3692  N  N    . SER A 1 2  ? -24.897 -13.665 -8.114  1.00 0.00 ? 2   SER A N    7  
ATOM   3693  C  CA   . SER A 1 2  ? -23.637 -12.944 -7.973  1.00 0.00 ? 2   SER A CA   7  
ATOM   3694  C  C    . SER A 1 2  ? -22.496 -13.710 -8.635  1.00 0.00 ? 2   SER A C    7  
ATOM   3695  O  O    . SER A 1 2  ? -21.866 -13.220 -9.572  1.00 0.00 ? 2   SER A O    7  
ATOM   3696  C  CB   . SER A 1 2  ? -23.320 -12.711 -6.495  1.00 0.00 ? 2   SER A CB   7  
ATOM   3697  O  OG   . SER A 1 2  ? -24.227 -11.788 -5.918  1.00 0.00 ? 2   SER A OG   7  
ATOM   3698  H  H    . SER A 1 2  ? -25.037 -14.487 -7.599  1.00 0.00 ? 2   SER A H    7  
ATOM   3699  H  HA   . SER A 1 2  ? -23.746 -11.988 -8.464  1.00 0.00 ? 2   SER A HA   7  
ATOM   3700  H  HB2  . SER A 1 2  ? -23.392 -13.648 -5.962  1.00 0.00 ? 2   SER A HB2  7  
ATOM   3701  H  HB3  . SER A 1 2  ? -22.317 -12.320 -6.402  1.00 0.00 ? 2   SER A HB3  7  
ATOM   3702  H  HG   . SER A 1 2  ? -24.593 -12.159 -5.112  1.00 0.00 ? 2   SER A HG   7  
ATOM   3703  N  N    . SER A 1 3  ? -22.237 -14.916 -8.141  1.00 0.00 ? 3   SER A N    7  
ATOM   3704  C  CA   . SER A 1 3  ? -21.169 -15.750 -8.681  1.00 0.00 ? 3   SER A CA   7  
ATOM   3705  C  C    . SER A 1 3  ? -19.829 -15.025 -8.618  1.00 0.00 ? 3   SER A C    7  
ATOM   3706  O  O    . SER A 1 3  ? -19.037 -15.077 -9.558  1.00 0.00 ? 3   SER A O    7  
ATOM   3707  C  CB   . SER A 1 3  ? -21.482 -16.143 -10.126 1.00 0.00 ? 3   SER A CB   7  
ATOM   3708  O  OG   . SER A 1 3  ? -20.843 -17.360 -10.473 1.00 0.00 ? 3   SER A OG   7  
ATOM   3709  H  H    . SER A 1 3  ? -22.774 -15.252 -7.393  1.00 0.00 ? 3   SER A H    7  
ATOM   3710  H  HA   . SER A 1 3  ? -21.110 -16.645 -8.079  1.00 0.00 ? 3   SER A HA   7  
ATOM   3711  H  HB2  . SER A 1 3  ? -22.548 -16.265 -10.241 1.00 0.00 ? 3   SER A HB2  7  
ATOM   3712  H  HB3  . SER A 1 3  ? -21.135 -15.365 -10.791 1.00 0.00 ? 3   SER A HB3  7  
ATOM   3713  H  HG   . SER A 1 3  ? -21.506 -18.040 -10.617 1.00 0.00 ? 3   SER A HG   7  
ATOM   3714  N  N    . GLY A 1 4  ? -19.581 -14.348 -7.501  1.00 0.00 ? 4   GLY A N    7  
ATOM   3715  C  CA   . GLY A 1 4  ? -18.336 -13.621 -7.335  1.00 0.00 ? 4   GLY A CA   7  
ATOM   3716  C  C    . GLY A 1 4  ? -17.992 -13.387 -5.877  1.00 0.00 ? 4   GLY A C    7  
ATOM   3717  O  O    . GLY A 1 4  ? -18.282 -14.222 -5.022  1.00 0.00 ? 4   GLY A O    7  
ATOM   3718  H  H    . GLY A 1 4  ? -20.249 -14.341 -6.784  1.00 0.00 ? 4   GLY A H    7  
ATOM   3719  H  HA2  . GLY A 1 4  ? -17.539 -14.184 -7.796  1.00 0.00 ? 4   GLY A HA2  7  
ATOM   3720  H  HA3  . GLY A 1 4  ? -18.422 -12.665 -7.830  1.00 0.00 ? 4   GLY A HA3  7  
ATOM   3721  N  N    . SER A 1 5  ? -17.368 -12.247 -5.594  1.00 0.00 ? 5   SER A N    7  
ATOM   3722  C  CA   . SER A 1 5  ? -16.979 -11.908 -4.230  1.00 0.00 ? 5   SER A CA   7  
ATOM   3723  C  C    . SER A 1 5  ? -16.515 -13.149 -3.473  1.00 0.00 ? 5   SER A C    7  
ATOM   3724  O  O    . SER A 1 5  ? -16.856 -13.341 -2.306  1.00 0.00 ? 5   SER A O    7  
ATOM   3725  C  CB   . SER A 1 5  ? -18.147 -11.253 -3.491  1.00 0.00 ? 5   SER A CB   7  
ATOM   3726  O  OG   . SER A 1 5  ? -18.556 -10.060 -4.139  1.00 0.00 ? 5   SER A OG   7  
ATOM   3727  H  H    . SER A 1 5  ? -17.164 -11.621 -6.320  1.00 0.00 ? 5   SER A H    7  
ATOM   3728  H  HA   . SER A 1 5  ? -16.159 -11.207 -4.284  1.00 0.00 ? 5   SER A HA   7  
ATOM   3729  H  HB2  . SER A 1 5  ? -18.982 -11.937 -3.463  1.00 0.00 ? 5   SER A HB2  7  
ATOM   3730  H  HB3  . SER A 1 5  ? -17.843 -11.014 -2.482  1.00 0.00 ? 5   SER A HB3  7  
ATOM   3731  H  HG   . SER A 1 5  ? -19.215 -10.268 -4.806  1.00 0.00 ? 5   SER A HG   7  
ATOM   3732  N  N    . SER A 1 6  ? -15.736 -13.988 -4.146  1.00 0.00 ? 6   SER A N    7  
ATOM   3733  C  CA   . SER A 1 6  ? -15.228 -15.213 -3.540  1.00 0.00 ? 6   SER A CA   7  
ATOM   3734  C  C    . SER A 1 6  ? -13.715 -15.140 -3.352  1.00 0.00 ? 6   SER A C    7  
ATOM   3735  O  O    . SER A 1 6  ? -13.210 -15.265 -2.237  1.00 0.00 ? 6   SER A O    7  
ATOM   3736  C  CB   . SER A 1 6  ? -15.587 -16.423 -4.405  1.00 0.00 ? 6   SER A CB   7  
ATOM   3737  O  OG   . SER A 1 6  ? -16.980 -16.684 -4.362  1.00 0.00 ? 6   SER A OG   7  
ATOM   3738  H  H    . SER A 1 6  ? -15.499 -13.780 -5.075  1.00 0.00 ? 6   SER A H    7  
ATOM   3739  H  HA   . SER A 1 6  ? -15.694 -15.322 -2.572  1.00 0.00 ? 6   SER A HA   7  
ATOM   3740  H  HB2  . SER A 1 6  ? -15.301 -16.229 -5.427  1.00 0.00 ? 6   SER A HB2  7  
ATOM   3741  H  HB3  . SER A 1 6  ? -15.059 -17.292 -4.041  1.00 0.00 ? 6   SER A HB3  7  
ATOM   3742  H  HG   . SER A 1 6  ? -17.458 -15.926 -4.705  1.00 0.00 ? 6   SER A HG   7  
ATOM   3743  N  N    . GLY A 1 7  ? -12.998 -14.936 -4.453  1.00 0.00 ? 7   GLY A N    7  
ATOM   3744  C  CA   . GLY A 1 7  ? -11.551 -14.849 -4.389  1.00 0.00 ? 7   GLY A CA   7  
ATOM   3745  C  C    . GLY A 1 7  ? -10.993 -13.782 -5.310  1.00 0.00 ? 7   GLY A C    7  
ATOM   3746  O  O    . GLY A 1 7  ? -11.053 -13.912 -6.533  1.00 0.00 ? 7   GLY A O    7  
ATOM   3747  H  H    . GLY A 1 7  ? -13.455 -14.843 -5.315  1.00 0.00 ? 7   GLY A H    7  
ATOM   3748  H  HA2  . GLY A 1 7  ? -11.259 -14.623 -3.374  1.00 0.00 ? 7   GLY A HA2  7  
ATOM   3749  H  HA3  . GLY A 1 7  ? -11.132 -15.804 -4.669  1.00 0.00 ? 7   GLY A HA3  7  
ATOM   3750  N  N    . THR A 1 8  ? -10.448 -12.721 -4.722  1.00 0.00 ? 8   THR A N    7  
ATOM   3751  C  CA   . THR A 1 8  ? -9.880  -11.625 -5.497  1.00 0.00 ? 8   THR A CA   7  
ATOM   3752  C  C    . THR A 1 8  ? -8.568  -12.039 -6.154  1.00 0.00 ? 8   THR A C    7  
ATOM   3753  O  O    . THR A 1 8  ? -8.362  -11.815 -7.346  1.00 0.00 ? 8   THR A O    7  
ATOM   3754  C  CB   . THR A 1 8  ? -9.632  -10.384 -4.618  1.00 0.00 ? 8   THR A CB   7  
ATOM   3755  O  OG1  . THR A 1 8  ? -8.725  -10.708 -3.558  1.00 0.00 ? 8   THR A OG1  7  
ATOM   3756  C  CG2  . THR A 1 8  ? -10.938 -9.865  -4.035  1.00 0.00 ? 8   THR A CG2  7  
ATOM   3757  H  H    . THR A 1 8  ? -10.430 -12.675 -3.743  1.00 0.00 ? 8   THR A H    7  
ATOM   3758  H  HA   . THR A 1 8  ? -10.589 -11.359 -6.267  1.00 0.00 ? 8   THR A HA   7  
ATOM   3759  H  HB   . THR A 1 8  ? -9.196  -9.609  -5.231  1.00 0.00 ? 8   THR A HB   7  
ATOM   3760  H  HG1  . THR A 1 8  ? -8.445  -9.901  -3.119  1.00 0.00 ? 8   THR A HG1  7  
ATOM   3761  H  HG21 . THR A 1 8  ? -10.770 -9.525  -3.024  1.00 0.00 ? 8   THR A HG21 7  
ATOM   3762  H  HG22 . THR A 1 8  ? -11.671 -10.658 -4.030  1.00 0.00 ? 8   THR A HG22 7  
ATOM   3763  H  HG23 . THR A 1 8  ? -11.299 -9.044  -4.635  1.00 0.00 ? 8   THR A HG23 7  
ATOM   3764  N  N    . GLY A 1 9  ? -7.683  -12.645 -5.368  1.00 0.00 ? 9   GLY A N    7  
ATOM   3765  C  CA   . GLY A 1 9  ? -6.402  -13.081 -5.891  1.00 0.00 ? 9   GLY A CA   7  
ATOM   3766  C  C    . GLY A 1 9  ? -5.233  -12.502 -5.120  1.00 0.00 ? 9   GLY A C    7  
ATOM   3767  O  O    . GLY A 1 9  ? -4.807  -13.064 -4.111  1.00 0.00 ? 9   GLY A O    7  
ATOM   3768  H  H    . GLY A 1 9  ? -7.902  -12.797 -4.424  1.00 0.00 ? 9   GLY A H    7  
ATOM   3769  H  HA2  . GLY A 1 9  ? -6.354  -14.158 -5.843  1.00 0.00 ? 9   GLY A HA2  7  
ATOM   3770  H  HA3  . GLY A 1 9  ? -6.324  -12.773 -6.924  1.00 0.00 ? 9   GLY A HA3  7  
ATOM   3771  N  N    . MET A 1 10 ? -4.711  -11.376 -5.595  1.00 0.00 ? 10  MET A N    7  
ATOM   3772  C  CA   . MET A 1 10 ? -3.584  -10.721 -4.943  1.00 0.00 ? 10  MET A CA   7  
ATOM   3773  C  C    . MET A 1 10 ? -4.037  -9.978  -3.690  1.00 0.00 ? 10  MET A C    7  
ATOM   3774  O  O    . MET A 1 10 ? -5.233  -9.863  -3.422  1.00 0.00 ? 10  MET A O    7  
ATOM   3775  C  CB   . MET A 1 10 ? -2.902  -9.749  -5.908  1.00 0.00 ? 10  MET A CB   7  
ATOM   3776  C  CG   . MET A 1 10 ? -2.122  -10.439 -7.015  1.00 0.00 ? 10  MET A CG   7  
ATOM   3777  S  SD   . MET A 1 10 ? -3.186  -11.054 -8.335  1.00 0.00 ? 10  MET A SD   7  
ATOM   3778  C  CE   . MET A 1 10 ? -2.025  -11.132 -9.696  1.00 0.00 ? 10  MET A CE   7  
ATOM   3779  H  H    . MET A 1 10 ? -5.094  -10.975 -6.403  1.00 0.00 ? 10  MET A H    7  
ATOM   3780  H  HA   . MET A 1 10 ? -2.877  -11.486 -4.657  1.00 0.00 ? 10  MET A HA   7  
ATOM   3781  H  HB2  . MET A 1 10 ? -3.657  -9.125  -6.363  1.00 0.00 ? 10  MET A HB2  7  
ATOM   3782  H  HB3  . MET A 1 10 ? -2.219  -9.126  -5.350  1.00 0.00 ? 10  MET A HB3  7  
ATOM   3783  H  HG2  . MET A 1 10 ? -1.421  -9.734  -7.437  1.00 0.00 ? 10  MET A HG2  7  
ATOM   3784  H  HG3  . MET A 1 10 ? -1.581  -11.271 -6.590  1.00 0.00 ? 10  MET A HG3  7  
ATOM   3785  H  HE1  . MET A 1 10 ? -1.685  -10.135 -9.937  1.00 0.00 ? 10  MET A HE1  7  
ATOM   3786  H  HE2  . MET A 1 10 ? -1.180  -11.743 -9.414  1.00 0.00 ? 10  MET A HE2  7  
ATOM   3787  H  HE3  . MET A 1 10 ? -2.510  -11.565 -10.558 1.00 0.00 ? 10  MET A HE3  7  
ATOM   3788  N  N    . LYS A 1 11 ? -3.074  -9.475  -2.924  1.00 0.00 ? 11  LYS A N    7  
ATOM   3789  C  CA   . LYS A 1 11 ? -3.373  -8.742  -1.700  1.00 0.00 ? 11  LYS A CA   7  
ATOM   3790  C  C    . LYS A 1 11 ? -4.341  -7.596  -1.975  1.00 0.00 ? 11  LYS A C    7  
ATOM   3791  O  O    . LYS A 1 11 ? -4.235  -6.889  -2.978  1.00 0.00 ? 11  LYS A O    7  
ATOM   3792  C  CB   . LYS A 1 11 ? -2.085  -8.199  -1.079  1.00 0.00 ? 11  LYS A CB   7  
ATOM   3793  C  CG   . LYS A 1 11 ? -1.238  -9.264  -0.405  1.00 0.00 ? 11  LYS A CG   7  
ATOM   3794  C  CD   . LYS A 1 11 ? -0.041  -8.657  0.307   1.00 0.00 ? 11  LYS A CD   7  
ATOM   3795  C  CE   . LYS A 1 11 ? 0.362   -9.480  1.522   1.00 0.00 ? 11  LYS A CE   7  
ATOM   3796  N  NZ   . LYS A 1 11 ? 1.589   -8.943  2.173   1.00 0.00 ? 11  LYS A NZ   7  
ATOM   3797  H  H    . LYS A 1 11 ? -2.138  -9.600  -3.190  1.00 0.00 ? 11  LYS A H    7  
ATOM   3798  H  HA   . LYS A 1 11 ? -3.835  -9.429  -1.007  1.00 0.00 ? 11  LYS A HA   7  
ATOM   3799  H  HB2  . LYS A 1 11 ? -1.493  -7.735  -1.854  1.00 0.00 ? 11  LYS A HB2  7  
ATOM   3800  H  HB3  . LYS A 1 11 ? -2.342  -7.453  -0.340  1.00 0.00 ? 11  LYS A HB3  7  
ATOM   3801  H  HG2  . LYS A 1 11 ? -1.844  -9.790  0.318   1.00 0.00 ? 11  LYS A HG2  7  
ATOM   3802  H  HG3  . LYS A 1 11 ? -0.885  -9.958  -1.155  1.00 0.00 ? 11  LYS A HG3  7  
ATOM   3803  H  HD2  . LYS A 1 11 ? 0.793   -8.616  -0.378  1.00 0.00 ? 11  LYS A HD2  7  
ATOM   3804  H  HD3  . LYS A 1 11 ? -0.294  -7.656  0.629   1.00 0.00 ? 11  LYS A HD3  7  
ATOM   3805  H  HE2  . LYS A 1 11 ? -0.449  -9.467  2.234   1.00 0.00 ? 11  LYS A HE2  7  
ATOM   3806  H  HE3  . LYS A 1 11 ? 0.547   -10.496 1.206   1.00 0.00 ? 11  LYS A HE3  7  
ATOM   3807  H  HZ1  . LYS A 1 11 ? 2.335   -9.667  2.181   1.00 0.00 ? 11  LYS A HZ1  7  
ATOM   3808  H  HZ2  . LYS A 1 11 ? 1.380   -8.666  3.154   1.00 0.00 ? 11  LYS A HZ2  7  
ATOM   3809  H  HZ3  . LYS A 1 11 ? 1.933   -8.110  1.655   1.00 0.00 ? 11  LYS A HZ3  7  
ATOM   3810  N  N    . PRO A 1 12 ? -5.306  -7.404  -1.064  1.00 0.00 ? 12  PRO A N    7  
ATOM   3811  C  CA   . PRO A 1 12 ? -6.310  -6.342  -1.186  1.00 0.00 ? 12  PRO A CA   7  
ATOM   3812  C  C    . PRO A 1 12 ? -5.712  -4.953  -0.989  1.00 0.00 ? 12  PRO A C    7  
ATOM   3813  O  O    . PRO A 1 12 ? -5.260  -4.320  -1.943  1.00 0.00 ? 12  PRO A O    7  
ATOM   3814  C  CB   . PRO A 1 12 ? -7.302  -6.661  -0.065  1.00 0.00 ? 12  PRO A CB   7  
ATOM   3815  C  CG   . PRO A 1 12 ? -6.507  -7.421  0.939   1.00 0.00 ? 12  PRO A CG   7  
ATOM   3816  C  CD   . PRO A 1 12 ? -5.492  -8.207  0.156   1.00 0.00 ? 12  PRO A CD   7  
ATOM   3817  H  HA   . PRO A 1 12 ? -6.816  -6.382  -2.140  1.00 0.00 ? 12  PRO A HA   7  
ATOM   3818  H  HB2  . PRO A 1 12 ? -7.688  -5.741  0.350   1.00 0.00 ? 12  PRO A HB2  7  
ATOM   3819  H  HB3  . PRO A 1 12 ? -8.114  -7.255  -0.456  1.00 0.00 ? 12  PRO A HB3  7  
ATOM   3820  H  HG2  . PRO A 1 12 ? -6.013  -6.736  1.611   1.00 0.00 ? 12  PRO A HG2  7  
ATOM   3821  H  HG3  . PRO A 1 12 ? -7.153  -8.089  1.490   1.00 0.00 ? 12  PRO A HG3  7  
ATOM   3822  H  HD2  . PRO A 1 12 ? -4.568  -8.288  0.709   1.00 0.00 ? 12  PRO A HD2  7  
ATOM   3823  H  HD3  . PRO A 1 12 ? -5.878  -9.187  -0.085  1.00 0.00 ? 12  PRO A HD3  7  
ATOM   3824  N  N    . TYR A 1 13 ? -5.711  -4.486  0.254   1.00 0.00 ? 13  TYR A N    7  
ATOM   3825  C  CA   . TYR A 1 13 ? -5.170  -3.171  0.576   1.00 0.00 ? 13  TYR A CA   7  
ATOM   3826  C  C    . TYR A 1 13 ? -3.841  -3.294  1.315   1.00 0.00 ? 13  TYR A C    7  
ATOM   3827  O  O    . TYR A 1 13 ? -3.291  -2.305  1.798   1.00 0.00 ? 13  TYR A O    7  
ATOM   3828  C  CB   . TYR A 1 13 ? -6.166  -2.380  1.426   1.00 0.00 ? 13  TYR A CB   7  
ATOM   3829  C  CG   . TYR A 1 13 ? -7.607  -2.780  1.199   1.00 0.00 ? 13  TYR A CG   7  
ATOM   3830  C  CD1  . TYR A 1 13 ? -8.120  -3.946  1.752   1.00 0.00 ? 13  TYR A CD1  7  
ATOM   3831  C  CD2  . TYR A 1 13 ? -8.455  -1.990  0.432   1.00 0.00 ? 13  TYR A CD2  7  
ATOM   3832  C  CE1  . TYR A 1 13 ? -9.435  -4.315  1.547   1.00 0.00 ? 13  TYR A CE1  7  
ATOM   3833  C  CE2  . TYR A 1 13 ? -9.772  -2.351  0.222   1.00 0.00 ? 13  TYR A CE2  7  
ATOM   3834  C  CZ   . TYR A 1 13 ? -10.257 -3.515  0.781   1.00 0.00 ? 13  TYR A CZ   7  
ATOM   3835  O  OH   . TYR A 1 13 ? -11.568 -3.879  0.576   1.00 0.00 ? 13  TYR A OH   7  
ATOM   3836  H  H    . TYR A 1 13 ? -6.085  -5.037  0.973   1.00 0.00 ? 13  TYR A H    7  
ATOM   3837  H  HA   . TYR A 1 13 ? -5.005  -2.643  -0.352  1.00 0.00 ? 13  TYR A HA   7  
ATOM   3838  H  HB2  . TYR A 1 13 ? -5.941  -2.534  2.470   1.00 0.00 ? 13  TYR A HB2  7  
ATOM   3839  H  HB3  . TYR A 1 13 ? -6.073  -1.329  1.193   1.00 0.00 ? 13  TYR A HB3  7  
ATOM   3840  H  HD1  . TYR A 1 13 ? -7.474  -4.571  2.352   1.00 0.00 ? 13  TYR A HD1  7  
ATOM   3841  H  HD2  . TYR A 1 13 ? -8.072  -1.079  -0.005  1.00 0.00 ? 13  TYR A HD2  7  
ATOM   3842  H  HE1  . TYR A 1 13 ? -9.816  -5.226  1.985   1.00 0.00 ? 13  TYR A HE1  7  
ATOM   3843  H  HE2  . TYR A 1 13 ? -10.416 -1.724  -0.377  1.00 0.00 ? 13  TYR A HE2  7  
ATOM   3844  H  HH   . TYR A 1 13 ? -11.939 -4.216  1.395   1.00 0.00 ? 13  TYR A HH   7  
ATOM   3845  N  N    . VAL A 1 14 ? -3.329  -4.519  1.398   1.00 0.00 ? 14  VAL A N    7  
ATOM   3846  C  CA   . VAL A 1 14 ? -2.064  -4.774  2.075   1.00 0.00 ? 14  VAL A CA   7  
ATOM   3847  C  C    . VAL A 1 14 ? -0.883  -4.329  1.220   1.00 0.00 ? 14  VAL A C    7  
ATOM   3848  O  O    . VAL A 1 14 ? -0.907  -4.455  -0.005  1.00 0.00 ? 14  VAL A O    7  
ATOM   3849  C  CB   . VAL A 1 14 ? -1.902  -6.267  2.417   1.00 0.00 ? 14  VAL A CB   7  
ATOM   3850  C  CG1  . VAL A 1 14 ? -0.583  -6.510  3.137   1.00 0.00 ? 14  VAL A CG1  7  
ATOM   3851  C  CG2  . VAL A 1 14 ? -3.074  -6.751  3.257   1.00 0.00 ? 14  VAL A CG2  7  
ATOM   3852  H  H    . VAL A 1 14 ? -3.814  -5.268  0.993   1.00 0.00 ? 14  VAL A H    7  
ATOM   3853  H  HA   . VAL A 1 14 ? -2.059  -4.212  2.998   1.00 0.00 ? 14  VAL A HA   7  
ATOM   3854  H  HB   . VAL A 1 14 ? -1.891  -6.828  1.495   1.00 0.00 ? 14  VAL A HB   7  
ATOM   3855  H  HG11 . VAL A 1 14 ? -0.272  -5.602  3.632   1.00 0.00 ? 14  VAL A HG11 7  
ATOM   3856  H  HG12 . VAL A 1 14 ? -0.711  -7.295  3.868   1.00 0.00 ? 14  VAL A HG12 7  
ATOM   3857  H  HG13 . VAL A 1 14 ? 0.169   -6.804  2.420   1.00 0.00 ? 14  VAL A HG13 7  
ATOM   3858  H  HG21 . VAL A 1 14 ? -2.718  -7.058  4.230   1.00 0.00 ? 14  VAL A HG21 7  
ATOM   3859  H  HG22 . VAL A 1 14 ? -3.789  -5.950  3.371   1.00 0.00 ? 14  VAL A HG22 7  
ATOM   3860  H  HG23 . VAL A 1 14 ? -3.547  -7.589  2.767   1.00 0.00 ? 14  VAL A HG23 7  
ATOM   3861  N  N    . CYS A 1 15 ? 0.150   -3.807  1.873   1.00 0.00 ? 15  CYS A N    7  
ATOM   3862  C  CA   . CYS A 1 15 ? 1.342   -3.343  1.173   1.00 0.00 ? 15  CYS A CA   7  
ATOM   3863  C  C    . CYS A 1 15 ? 2.117   -4.516  0.581   1.00 0.00 ? 15  CYS A C    7  
ATOM   3864  O  O    . CYS A 1 15 ? 2.575   -5.400  1.305   1.00 0.00 ? 15  CYS A O    7  
ATOM   3865  C  CB   . CYS A 1 15 ? 2.241   -2.551  2.125   1.00 0.00 ? 15  CYS A CB   7  
ATOM   3866  S  SG   . CYS A 1 15 ? 3.222   -1.249  1.311   1.00 0.00 ? 15  CYS A SG   7  
ATOM   3867  H  H    . CYS A 1 15 ? 0.110   -3.733  2.850   1.00 0.00 ? 15  CYS A H    7  
ATOM   3868  H  HA   . CYS A 1 15 ? 1.024   -2.695  0.370   1.00 0.00 ? 15  CYS A HA   7  
ATOM   3869  H  HB2  . CYS A 1 15 ? 1.628   -2.077  2.877   1.00 0.00 ? 15  CYS A HB2  7  
ATOM   3870  H  HB3  . CYS A 1 15 ? 2.930   -3.230  2.606   1.00 0.00 ? 15  CYS A HB3  7  
ATOM   3871  N  N    . ASN A 1 16 ? 2.261   -4.516  -0.740  1.00 0.00 ? 16  ASN A N    7  
ATOM   3872  C  CA   . ASN A 1 16 ? 2.981   -5.581  -1.430  1.00 0.00 ? 16  ASN A CA   7  
ATOM   3873  C  C    . ASN A 1 16 ? 4.482   -5.311  -1.430  1.00 0.00 ? 16  ASN A C    7  
ATOM   3874  O  O    . ASN A 1 16 ? 5.196   -5.718  -2.346  1.00 0.00 ? 16  ASN A O    7  
ATOM   3875  C  CB   . ASN A 1 16 ? 2.476   -5.717  -2.868  1.00 0.00 ? 16  ASN A CB   7  
ATOM   3876  C  CG   . ASN A 1 16 ? 0.982   -5.968  -2.935  1.00 0.00 ? 16  ASN A CG   7  
ATOM   3877  O  OD1  . ASN A 1 16 ? 0.522   -7.096  -2.754  1.00 0.00 ? 16  ASN A OD1  7  
ATOM   3878  N  ND2  . ASN A 1 16 ? 0.216   -4.915  -3.196  1.00 0.00 ? 16  ASN A ND2  7  
ATOM   3879  H  H    . ASN A 1 16 ? 1.874   -3.784  -1.264  1.00 0.00 ? 16  ASN A H    7  
ATOM   3880  H  HA   . ASN A 1 16 ? 2.792   -6.504  -0.903  1.00 0.00 ? 16  ASN A HA   7  
ATOM   3881  H  HB2  . ASN A 1 16 ? 2.692   -4.806  -3.407  1.00 0.00 ? 16  ASN A HB2  7  
ATOM   3882  H  HB3  . ASN A 1 16 ? 2.983   -6.542  -3.345  1.00 0.00 ? 16  ASN A HB3  7  
ATOM   3883  H  HD21 . ASN A 1 16 ? 0.652   -4.047  -3.329  1.00 0.00 ? 16  ASN A HD21 7  
ATOM   3884  H  HD22 . ASN A 1 16 ? -0.754  -5.049  -3.245  1.00 0.00 ? 16  ASN A HD22 7  
ATOM   3885  N  N    . GLU A 1 17 ? 4.954   -4.623  -0.395  1.00 0.00 ? 17  GLU A N    7  
ATOM   3886  C  CA   . GLU A 1 17 ? 6.371   -4.299  -0.276  1.00 0.00 ? 17  GLU A CA   7  
ATOM   3887  C  C    . GLU A 1 17 ? 6.881   -4.597  1.131   1.00 0.00 ? 17  GLU A C    7  
ATOM   3888  O  O    . GLU A 1 17 ? 8.005   -5.069  1.309   1.00 0.00 ? 17  GLU A O    7  
ATOM   3889  C  CB   . GLU A 1 17 ? 6.611   -2.827  -0.616  1.00 0.00 ? 17  GLU A CB   7  
ATOM   3890  C  CG   . GLU A 1 17 ? 5.964   -2.390  -1.920  1.00 0.00 ? 17  GLU A CG   7  
ATOM   3891  C  CD   . GLU A 1 17 ? 6.881   -2.565  -3.114  1.00 0.00 ? 17  GLU A CD   7  
ATOM   3892  O  OE1  . GLU A 1 17 ? 7.710   -3.499  -3.095  1.00 0.00 ? 17  GLU A OE1  7  
ATOM   3893  O  OE2  . GLU A 1 17 ? 6.770   -1.767  -4.069  1.00 0.00 ? 17  GLU A OE2  7  
ATOM   3894  H  H    . GLU A 1 17 ? 4.336   -4.326  0.304   1.00 0.00 ? 17  GLU A H    7  
ATOM   3895  H  HA   . GLU A 1 17 ? 6.912   -4.914  -0.980  1.00 0.00 ? 17  GLU A HA   7  
ATOM   3896  H  HB2  . GLU A 1 17 ? 6.214   -2.216  0.182   1.00 0.00 ? 17  GLU A HB2  7  
ATOM   3897  H  HB3  . GLU A 1 17 ? 7.675   -2.656  -0.692  1.00 0.00 ? 17  GLU A HB3  7  
ATOM   3898  H  HG2  . GLU A 1 17 ? 5.073   -2.979  -2.080  1.00 0.00 ? 17  GLU A HG2  7  
ATOM   3899  H  HG3  . GLU A 1 17 ? 5.694   -1.347  -1.841  1.00 0.00 ? 17  GLU A HG3  7  
ATOM   3900  N  N    . CYS A 1 18 ? 6.048   -4.317  2.127   1.00 0.00 ? 18  CYS A N    7  
ATOM   3901  C  CA   . CYS A 1 18 ? 6.413   -4.554  3.519   1.00 0.00 ? 18  CYS A CA   7  
ATOM   3902  C  C    . CYS A 1 18 ? 5.459   -5.551  4.169   1.00 0.00 ? 18  CYS A C    7  
ATOM   3903  O  O    . CYS A 1 18 ? 5.875   -6.400  4.957   1.00 0.00 ? 18  CYS A O    7  
ATOM   3904  C  CB   . CYS A 1 18 ? 6.404   -3.238  4.301   1.00 0.00 ? 18  CYS A CB   7  
ATOM   3905  S  SG   . CYS A 1 18 ? 4.796   -2.382  4.297   1.00 0.00 ? 18  CYS A SG   7  
ATOM   3906  H  H    . CYS A 1 18 ? 5.165   -3.942  1.922   1.00 0.00 ? 18  CYS A H    7  
ATOM   3907  H  HA   . CYS A 1 18 ? 7.411   -4.965  3.535   1.00 0.00 ? 18  CYS A HA   7  
ATOM   3908  H  HB2  . CYS A 1 18 ? 6.666   -3.438  5.329   1.00 0.00 ? 18  CYS A HB2  7  
ATOM   3909  H  HB3  . CYS A 1 18 ? 7.135   -2.569  3.872   1.00 0.00 ? 18  CYS A HB3  7  
ATOM   3910  N  N    . GLY A 1 19 ? 4.177   -5.442  3.833   1.00 0.00 ? 19  GLY A N    7  
ATOM   3911  C  CA   . GLY A 1 19 ? 3.184   -6.340  4.393   1.00 0.00 ? 19  GLY A CA   7  
ATOM   3912  C  C    . GLY A 1 19 ? 2.211   -5.628  5.312   1.00 0.00 ? 19  GLY A C    7  
ATOM   3913  O  O    . GLY A 1 19 ? 1.558   -6.257  6.145   1.00 0.00 ? 19  GLY A O    7  
ATOM   3914  H  H    . GLY A 1 19 ? 3.904   -4.745  3.200   1.00 0.00 ? 19  GLY A H    7  
ATOM   3915  H  HA2  . GLY A 1 19 ? 2.633   -6.797  3.586   1.00 0.00 ? 19  GLY A HA2  7  
ATOM   3916  H  HA3  . GLY A 1 19 ? 3.690   -7.113  4.954   1.00 0.00 ? 19  GLY A HA3  7  
ATOM   3917  N  N    . LYS A 1 20 ? 2.113   -4.311  5.162   1.00 0.00 ? 20  LYS A N    7  
ATOM   3918  C  CA   . LYS A 1 20 ? 1.213   -3.512  5.984   1.00 0.00 ? 20  LYS A CA   7  
ATOM   3919  C  C    . LYS A 1 20 ? -0.228  -3.649  5.504   1.00 0.00 ? 20  LYS A C    7  
ATOM   3920  O  O    . LYS A 1 20 ? -0.577  -3.188  4.418   1.00 0.00 ? 20  LYS A O    7  
ATOM   3921  C  CB   . LYS A 1 20 ? 1.634   -2.041  5.954   1.00 0.00 ? 20  LYS A CB   7  
ATOM   3922  C  CG   . LYS A 1 20 ? 1.326   -1.294  7.241   1.00 0.00 ? 20  LYS A CG   7  
ATOM   3923  C  CD   . LYS A 1 20 ? -0.152  -1.361  7.584   1.00 0.00 ? 20  LYS A CD   7  
ATOM   3924  C  CE   . LYS A 1 20 ? -0.547  -0.265  8.563   1.00 0.00 ? 20  LYS A CE   7  
ATOM   3925  N  NZ   . LYS A 1 20 ? -1.753  -0.635  9.353   1.00 0.00 ? 20  LYS A NZ   7  
ATOM   3926  H  H    . LYS A 1 20 ? 2.660   -3.866  4.480   1.00 0.00 ? 20  LYS A H    7  
ATOM   3927  H  HA   . LYS A 1 20 ? 1.279   -3.876  6.998   1.00 0.00 ? 20  LYS A HA   7  
ATOM   3928  H  HB2  . LYS A 1 20 ? 2.698   -1.986  5.776   1.00 0.00 ? 20  LYS A HB2  7  
ATOM   3929  H  HB3  . LYS A 1 20 ? 1.116   -1.547  5.144   1.00 0.00 ? 20  LYS A HB3  7  
ATOM   3930  H  HG2  . LYS A 1 20 ? 1.892   -1.736  8.047   1.00 0.00 ? 20  LYS A HG2  7  
ATOM   3931  H  HG3  . LYS A 1 20 ? 1.613   -0.259  7.123   1.00 0.00 ? 20  LYS A HG3  7  
ATOM   3932  H  HD2  . LYS A 1 20 ? -0.729  -1.244  6.679   1.00 0.00 ? 20  LYS A HD2  7  
ATOM   3933  H  HD3  . LYS A 1 20 ? -0.367  -2.322  8.029   1.00 0.00 ? 20  LYS A HD3  7  
ATOM   3934  H  HE2  . LYS A 1 20 ? 0.276   -0.090  9.238   1.00 0.00 ? 20  LYS A HE2  7  
ATOM   3935  H  HE3  . LYS A 1 20 ? -0.754  0.638   8.007   1.00 0.00 ? 20  LYS A HE3  7  
ATOM   3936  H  HZ1  . LYS A 1 20 ? -1.471  -1.109  10.235  1.00 0.00 ? 20  LYS A HZ1  7  
ATOM   3937  H  HZ2  . LYS A 1 20 ? -2.357  -1.279  8.803   1.00 0.00 ? 20  LYS A HZ2  7  
ATOM   3938  H  HZ3  . LYS A 1 20 ? -2.301  0.217   9.590   1.00 0.00 ? 20  LYS A HZ3  7  
ATOM   3939  N  N    . ALA A 1 21 ? -1.061  -4.285  6.322   1.00 0.00 ? 21  ALA A N    7  
ATOM   3940  C  CA   . ALA A 1 21 ? -2.465  -4.479  5.982   1.00 0.00 ? 21  ALA A CA   7  
ATOM   3941  C  C    . ALA A 1 21 ? -3.314  -3.309  6.467   1.00 0.00 ? 21  ALA A C    7  
ATOM   3942  O  O    . ALA A 1 21 ? -3.106  -2.789  7.563   1.00 0.00 ? 21  ALA A O    7  
ATOM   3943  C  CB   . ALA A 1 21 ? -2.976  -5.785  6.574   1.00 0.00 ? 21  ALA A CB   7  
ATOM   3944  H  H    . ALA A 1 21 ? -0.724  -4.630  7.175   1.00 0.00 ? 21  ALA A H    7  
ATOM   3945  H  HA   . ALA A 1 21 ? -2.542  -4.546  4.906   1.00 0.00 ? 21  ALA A HA   7  
ATOM   3946  H  HB1  . ALA A 1 21 ? -3.347  -5.606  7.572   1.00 0.00 ? 21  ALA A HB1  7  
ATOM   3947  H  HB2  . ALA A 1 21 ? -3.773  -6.171  5.956   1.00 0.00 ? 21  ALA A HB2  7  
ATOM   3948  H  HB3  . ALA A 1 21 ? -2.169  -6.502  6.612   1.00 0.00 ? 21  ALA A HB3  7  
ATOM   3949  N  N    . PHE A 1 22 ? -4.272  -2.897  5.642   1.00 0.00 ? 22  PHE A N    7  
ATOM   3950  C  CA   . PHE A 1 22 ? -5.152  -1.787  5.986   1.00 0.00 ? 22  PHE A CA   7  
ATOM   3951  C  C    . PHE A 1 22 ? -6.617  -2.182  5.821   1.00 0.00 ? 22  PHE A C    7  
ATOM   3952  O  O    . PHE A 1 22 ? -6.927  -3.313  5.448   1.00 0.00 ? 22  PHE A O    7  
ATOM   3953  C  CB   . PHE A 1 22 ? -4.839  -0.570  5.112   1.00 0.00 ? 22  PHE A CB   7  
ATOM   3954  C  CG   . PHE A 1 22 ? -3.395  -0.159  5.153   1.00 0.00 ? 22  PHE A CG   7  
ATOM   3955  C  CD1  . PHE A 1 22 ? -2.441  -0.857  4.430   1.00 0.00 ? 22  PHE A CD1  7  
ATOM   3956  C  CD2  . PHE A 1 22 ? -2.991  0.925   5.915   1.00 0.00 ? 22  PHE A CD2  7  
ATOM   3957  C  CE1  . PHE A 1 22 ? -1.111  -0.481  4.465   1.00 0.00 ? 22  PHE A CE1  7  
ATOM   3958  C  CE2  . PHE A 1 22 ? -1.663  1.306   5.953   1.00 0.00 ? 22  PHE A CE2  7  
ATOM   3959  C  CZ   . PHE A 1 22 ? -0.722  0.601   5.228   1.00 0.00 ? 22  PHE A CZ   7  
ATOM   3960  H  H    . PHE A 1 22 ? -4.389  -3.352  4.781   1.00 0.00 ? 22  PHE A H    7  
ATOM   3961  H  HA   . PHE A 1 22 ? -4.974  -1.532  7.020   1.00 0.00 ? 22  PHE A HA   7  
ATOM   3962  H  HB2  . PHE A 1 22 ? -5.089  -0.798  4.087   1.00 0.00 ? 22  PHE A HB2  7  
ATOM   3963  H  HB3  . PHE A 1 22 ? -5.433  0.267   5.447   1.00 0.00 ? 22  PHE A HB3  7  
ATOM   3964  H  HD1  . PHE A 1 22 ? -2.745  -1.705  3.832   1.00 0.00 ? 22  PHE A HD1  7  
ATOM   3965  H  HD2  . PHE A 1 22 ? -3.725  1.477   6.483   1.00 0.00 ? 22  PHE A HD2  7  
ATOM   3966  H  HE1  . PHE A 1 22 ? -0.379  -1.035  3.897   1.00 0.00 ? 22  PHE A HE1  7  
ATOM   3967  H  HE2  . PHE A 1 22 ? -1.360  2.153   6.552   1.00 0.00 ? 22  PHE A HE2  7  
ATOM   3968  H  HZ   . PHE A 1 22 ? 0.316   0.897   5.257   1.00 0.00 ? 22  PHE A HZ   7  
ATOM   3969  N  N    . ARG A 1 23 ? -7.512  -1.241  6.102   1.00 0.00 ? 23  ARG A N    7  
ATOM   3970  C  CA   . ARG A 1 23 ? -8.944  -1.490  5.987   1.00 0.00 ? 23  ARG A CA   7  
ATOM   3971  C  C    . ARG A 1 23 ? -9.462  -1.062  4.617   1.00 0.00 ? 23  ARG A C    7  
ATOM   3972  O  O    . ARG A 1 23 ? -10.306 -1.733  4.024   1.00 0.00 ? 23  ARG A O    7  
ATOM   3973  C  CB   . ARG A 1 23 ? -9.703  -0.746  7.087   1.00 0.00 ? 23  ARG A CB   7  
ATOM   3974  C  CG   . ARG A 1 23 ? -9.124  -0.956  8.476   1.00 0.00 ? 23  ARG A CG   7  
ATOM   3975  C  CD   . ARG A 1 23 ? -8.035  0.061   8.785   1.00 0.00 ? 23  ARG A CD   7  
ATOM   3976  N  NE   . ARG A 1 23 ? -7.775  0.165   10.218  1.00 0.00 ? 23  ARG A NE   7  
ATOM   3977  C  CZ   . ARG A 1 23 ? -8.475  0.943   11.037  1.00 0.00 ? 23  ARG A CZ   7  
ATOM   3978  N  NH1  . ARG A 1 23 ? -9.472  1.679   10.568  1.00 0.00 ? 23  ARG A NH1  7  
ATOM   3979  N  NH2  . ARG A 1 23 ? -8.177  0.984   12.330  1.00 0.00 ? 23  ARG A NH2  7  
ATOM   3980  H  H    . ARG A 1 23 ? -7.203  -0.358  6.395   1.00 0.00 ? 23  ARG A H    7  
ATOM   3981  H  HA   . ARG A 1 23 ? -9.107  -2.551  6.105   1.00 0.00 ? 23  ARG A HA   7  
ATOM   3982  H  HB2  . ARG A 1 23 ? -9.684  0.312   6.869   1.00 0.00 ? 23  ARG A HB2  7  
ATOM   3983  H  HB3  . ARG A 1 23 ? -10.728 -1.085  7.093   1.00 0.00 ? 23  ARG A HB3  7  
ATOM   3984  H  HG2  . ARG A 1 23 ? -9.914  -0.853  9.205   1.00 0.00 ? 23  ARG A HG2  7  
ATOM   3985  H  HG3  . ARG A 1 23 ? -8.704  -1.949  8.534   1.00 0.00 ? 23  ARG A HG3  7  
ATOM   3986  H  HD2  . ARG A 1 23 ? -7.127  -0.240  8.285   1.00 0.00 ? 23  ARG A HD2  7  
ATOM   3987  H  HD3  . ARG A 1 23 ? -8.347  1.026   8.414   1.00 0.00 ? 23  ARG A HD3  7  
ATOM   3988  H  HE   . ARG A 1 23 ? -7.042  -0.370  10.586  1.00 0.00 ? 23  ARG A HE   7  
ATOM   3989  H  HH11 . ARG A 1 23 ? -9.699  1.649   9.594   1.00 0.00 ? 23  ARG A HH11 7  
ATOM   3990  H  HH12 . ARG A 1 23 ? -9.998  2.262   11.187  1.00 0.00 ? 23  ARG A HH12 7  
ATOM   3991  H  HH21 . ARG A 1 23 ? -7.426  0.430   12.688  1.00 0.00 ? 23  ARG A HH21 7  
ATOM   3992  H  HH22 . ARG A 1 23 ? -8.704  1.569   12.946  1.00 0.00 ? 23  ARG A HH22 7  
ATOM   3993  N  N    . SER A 1 24 ? -8.951  0.060   4.121   1.00 0.00 ? 24  SER A N    7  
ATOM   3994  C  CA   . SER A 1 24 ? -9.364  0.580   2.823   1.00 0.00 ? 24  SER A CA   7  
ATOM   3995  C  C    . SER A 1 24 ? -8.164  0.747   1.897   1.00 0.00 ? 24  SER A C    7  
ATOM   3996  O  O    . SER A 1 24 ? -7.015  0.613   2.319   1.00 0.00 ? 24  SER A O    7  
ATOM   3997  C  CB   . SER A 1 24 ? -10.082 1.921   2.993   1.00 0.00 ? 24  SER A CB   7  
ATOM   3998  O  OG   . SER A 1 24 ? -9.296  2.828   3.748   1.00 0.00 ? 24  SER A OG   7  
ATOM   3999  H  H    . SER A 1 24 ? -8.281  0.551   4.642   1.00 0.00 ? 24  SER A H    7  
ATOM   4000  H  HA   . SER A 1 24 ? -10.048 -0.131  2.384   1.00 0.00 ? 24  SER A HA   7  
ATOM   4001  H  HB2  . SER A 1 24 ? -10.271 2.351   2.021   1.00 0.00 ? 24  SER A HB2  7  
ATOM   4002  H  HB3  . SER A 1 24 ? -11.020 1.762   3.505   1.00 0.00 ? 24  SER A HB3  7  
ATOM   4003  H  HG   . SER A 1 24 ? -8.368  2.600   3.657   1.00 0.00 ? 24  SER A HG   7  
ATOM   4004  N  N    . LYS A 1 25 ? -8.438  1.039   0.630   1.00 0.00 ? 25  LYS A N    7  
ATOM   4005  C  CA   . LYS A 1 25 ? -7.383  1.226   -0.359  1.00 0.00 ? 25  LYS A CA   7  
ATOM   4006  C  C    . LYS A 1 25 ? -6.698  2.576   -0.175  1.00 0.00 ? 25  LYS A C    7  
ATOM   4007  O  O    . LYS A 1 25 ? -5.496  2.710   -0.407  1.00 0.00 ? 25  LYS A O    7  
ATOM   4008  C  CB   . LYS A 1 25 ? -7.957  1.121   -1.774  1.00 0.00 ? 25  LYS A CB   7  
ATOM   4009  C  CG   . LYS A 1 25 ? -6.982  1.545   -2.858  1.00 0.00 ? 25  LYS A CG   7  
ATOM   4010  C  CD   . LYS A 1 25 ? -7.432  1.068   -4.229  1.00 0.00 ? 25  LYS A CD   7  
ATOM   4011  C  CE   . LYS A 1 25 ? -6.870  -0.307  -4.554  1.00 0.00 ? 25  LYS A CE   7  
ATOM   4012  N  NZ   . LYS A 1 25 ? -7.583  -0.943  -5.696  1.00 0.00 ? 25  LYS A NZ   7  
ATOM   4013  H  H    . LYS A 1 25 ? -9.374  1.133   0.353   1.00 0.00 ? 25  LYS A H    7  
ATOM   4014  H  HA   . LYS A 1 25 ? -6.653  0.443   -0.217  1.00 0.00 ? 25  LYS A HA   7  
ATOM   4015  H  HB2  . LYS A 1 25 ? -8.245  0.097   -1.957  1.00 0.00 ? 25  LYS A HB2  7  
ATOM   4016  H  HB3  . LYS A 1 25 ? -8.833  1.750   -1.841  1.00 0.00 ? 25  LYS A HB3  7  
ATOM   4017  H  HG2  . LYS A 1 25 ? -6.914  2.622   -2.868  1.00 0.00 ? 25  LYS A HG2  7  
ATOM   4018  H  HG3  . LYS A 1 25 ? -6.011  1.123   -2.641  1.00 0.00 ? 25  LYS A HG3  7  
ATOM   4019  H  HD2  . LYS A 1 25 ? -8.510  1.017   -4.247  1.00 0.00 ? 25  LYS A HD2  7  
ATOM   4020  H  HD3  . LYS A 1 25 ? -7.090  1.772   -4.975  1.00 0.00 ? 25  LYS A HD3  7  
ATOM   4021  H  HE2  . LYS A 1 25 ? -5.825  -0.205  -4.805  1.00 0.00 ? 25  LYS A HE2  7  
ATOM   4022  H  HE3  . LYS A 1 25 ? -6.970  -0.937  -3.682  1.00 0.00 ? 25  LYS A HE3  7  
ATOM   4023  H  HZ1  . LYS A 1 25 ? -8.555  -0.579  -5.757  1.00 0.00 ? 25  LYS A HZ1  7  
ATOM   4024  H  HZ2  . LYS A 1 25 ? -7.618  -1.974  -5.566  1.00 0.00 ? 25  LYS A HZ2  7  
ATOM   4025  H  HZ3  . LYS A 1 25 ? -7.089  -0.734  -6.587  1.00 0.00 ? 25  LYS A HZ3  7  
ATOM   4026  N  N    . SER A 1 26 ? -7.470  3.574   0.243   1.00 0.00 ? 26  SER A N    7  
ATOM   4027  C  CA   . SER A 1 26 ? -6.937  4.915   0.456   1.00 0.00 ? 26  SER A CA   7  
ATOM   4028  C  C    . SER A 1 26 ? -5.882  4.912   1.558   1.00 0.00 ? 26  SER A C    7  
ATOM   4029  O  O    . SER A 1 26 ? -4.915  5.672   1.508   1.00 0.00 ? 26  SER A O    7  
ATOM   4030  C  CB   . SER A 1 26 ? -8.065  5.884   0.816   1.00 0.00 ? 26  SER A CB   7  
ATOM   4031  O  OG   . SER A 1 26 ? -7.576  7.206   0.960   1.00 0.00 ? 26  SER A OG   7  
ATOM   4032  H  H    . SER A 1 26 ? -8.421  3.405   0.411   1.00 0.00 ? 26  SER A H    7  
ATOM   4033  H  HA   . SER A 1 26 ? -6.477  5.239   -0.466  1.00 0.00 ? 26  SER A HA   7  
ATOM   4034  H  HB2  . SER A 1 26 ? -8.810  5.871   0.035   1.00 0.00 ? 26  SER A HB2  7  
ATOM   4035  H  HB3  . SER A 1 26 ? -8.516  5.575   1.748   1.00 0.00 ? 26  SER A HB3  7  
ATOM   4036  H  HG   . SER A 1 26 ? -7.748  7.700   0.155   1.00 0.00 ? 26  SER A HG   7  
ATOM   4037  N  N    . TYR A 1 27 ? -6.076  4.052   2.551   1.00 0.00 ? 27  TYR A N    7  
ATOM   4038  C  CA   . TYR A 1 27 ? -5.144  3.951   3.668   1.00 0.00 ? 27  TYR A CA   7  
ATOM   4039  C  C    . TYR A 1 27 ? -3.791  3.423   3.201   1.00 0.00 ? 27  TYR A C    7  
ATOM   4040  O  O    . TYR A 1 27 ? -2.744  3.826   3.712   1.00 0.00 ? 27  TYR A O    7  
ATOM   4041  C  CB   . TYR A 1 27 ? -5.714  3.037   4.754   1.00 0.00 ? 27  TYR A CB   7  
ATOM   4042  C  CG   . TYR A 1 27 ? -6.526  3.771   5.797   1.00 0.00 ? 27  TYR A CG   7  
ATOM   4043  C  CD1  . TYR A 1 27 ? -6.069  4.960   6.352   1.00 0.00 ? 27  TYR A CD1  7  
ATOM   4044  C  CD2  . TYR A 1 27 ? -7.749  3.274   6.229   1.00 0.00 ? 27  TYR A CD2  7  
ATOM   4045  C  CE1  . TYR A 1 27 ? -6.807  5.633   7.307   1.00 0.00 ? 27  TYR A CE1  7  
ATOM   4046  C  CE2  . TYR A 1 27 ? -8.495  3.941   7.182   1.00 0.00 ? 27  TYR A CE2  7  
ATOM   4047  C  CZ   . TYR A 1 27 ? -8.020  5.120   7.718   1.00 0.00 ? 27  TYR A CZ   7  
ATOM   4048  O  OH   . TYR A 1 27 ? -8.759  5.787   8.668   1.00 0.00 ? 27  TYR A OH   7  
ATOM   4049  H  H    . TYR A 1 27 ? -6.866  3.473   2.535   1.00 0.00 ? 27  TYR A H    7  
ATOM   4050  H  HA   . TYR A 1 27 ? -5.009  4.941   4.078   1.00 0.00 ? 27  TYR A HA   7  
ATOM   4051  H  HB2  . TYR A 1 27 ? -6.353  2.299   4.295   1.00 0.00 ? 27  TYR A HB2  7  
ATOM   4052  H  HB3  . TYR A 1 27 ? -4.899  2.538   5.258   1.00 0.00 ? 27  TYR A HB3  7  
ATOM   4053  H  HD1  . TYR A 1 27 ? -5.119  5.359   6.028   1.00 0.00 ? 27  TYR A HD1  7  
ATOM   4054  H  HD2  . TYR A 1 27 ? -8.119  2.350   5.808   1.00 0.00 ? 27  TYR A HD2  7  
ATOM   4055  H  HE1  . TYR A 1 27 ? -6.436  6.556   7.726   1.00 0.00 ? 27  TYR A HE1  7  
ATOM   4056  H  HE2  . TYR A 1 27 ? -9.444  3.539   7.504   1.00 0.00 ? 27  TYR A HE2  7  
ATOM   4057  H  HH   . TYR A 1 27 ? -8.637  5.365   9.522   1.00 0.00 ? 27  TYR A HH   7  
ATOM   4058  N  N    . LEU A 1 28 ? -3.819  2.520   2.228   1.00 0.00 ? 28  LEU A N    7  
ATOM   4059  C  CA   . LEU A 1 28 ? -2.596  1.936   1.690   1.00 0.00 ? 28  LEU A CA   7  
ATOM   4060  C  C    . LEU A 1 28 ? -1.915  2.895   0.719   1.00 0.00 ? 28  LEU A C    7  
ATOM   4061  O  O    . LEU A 1 28 ? -0.693  2.883   0.572   1.00 0.00 ? 28  LEU A O    7  
ATOM   4062  C  CB   . LEU A 1 28 ? -2.905  0.614   0.986   1.00 0.00 ? 28  LEU A CB   7  
ATOM   4063  C  CG   . LEU A 1 28 ? -1.793  0.048   0.101   1.00 0.00 ? 28  LEU A CG   7  
ATOM   4064  C  CD1  . LEU A 1 28 ? -0.622  -0.420  0.950   1.00 0.00 ? 28  LEU A CD1  7  
ATOM   4065  C  CD2  . LEU A 1 28 ? -2.323  -1.092  -0.757  1.00 0.00 ? 28  LEU A CD2  7  
ATOM   4066  H  H    . LEU A 1 28 ? -4.683  2.239   1.861   1.00 0.00 ? 28  LEU A H    7  
ATOM   4067  H  HA   . LEU A 1 28 ? -1.928  1.746   2.517   1.00 0.00 ? 28  LEU A HA   7  
ATOM   4068  H  HB2  . LEU A 1 28 ? -3.129  -0.120  1.744   1.00 0.00 ? 28  LEU A HB2  7  
ATOM   4069  H  HB3  . LEU A 1 28 ? -3.777  0.766   0.366   1.00 0.00 ? 28  LEU A HB3  7  
ATOM   4070  H  HG   . LEU A 1 28 ? -1.436  0.827   -0.559  1.00 0.00 ? 28  LEU A HG   7  
ATOM   4071  H  HD11 . LEU A 1 28 ? 0.168   -0.778  0.307   1.00 0.00 ? 28  LEU A HD11 7  
ATOM   4072  H  HD12 . LEU A 1 28 ? -0.946  -1.219  1.601   1.00 0.00 ? 28  LEU A HD12 7  
ATOM   4073  H  HD13 . LEU A 1 28 ? -0.257  0.403   1.545   1.00 0.00 ? 28  LEU A HD13 7  
ATOM   4074  H  HD21 . LEU A 1 28 ? -2.197  -0.845  -1.801  1.00 0.00 ? 28  LEU A HD21 7  
ATOM   4075  H  HD22 . LEU A 1 28 ? -3.371  -1.244  -0.546  1.00 0.00 ? 28  LEU A HD22 7  
ATOM   4076  H  HD23 . LEU A 1 28 ? -1.775  -1.996  -0.532  1.00 0.00 ? 28  LEU A HD23 7  
ATOM   4077  N  N    . ILE A 1 29 ? -2.715  3.727   0.059   1.00 0.00 ? 29  ILE A N    7  
ATOM   4078  C  CA   . ILE A 1 29 ? -2.189  4.695   -0.895  1.00 0.00 ? 29  ILE A CA   7  
ATOM   4079  C  C    . ILE A 1 29 ? -1.428  5.809   -0.185  1.00 0.00 ? 29  ILE A C    7  
ATOM   4080  O  O    . ILE A 1 29 ? -0.393  6.272   -0.666  1.00 0.00 ? 29  ILE A O    7  
ATOM   4081  C  CB   . ILE A 1 29 ? -3.314  5.317   -1.744  1.00 0.00 ? 29  ILE A CB   7  
ATOM   4082  C  CG1  . ILE A 1 29 ? -3.983  4.246   -2.607  1.00 0.00 ? 29  ILE A CG1  7  
ATOM   4083  C  CG2  . ILE A 1 29 ? -2.764  6.438   -2.613  1.00 0.00 ? 29  ILE A CG2  7  
ATOM   4084  C  CD1  . ILE A 1 29 ? -5.402  4.588   -3.003  1.00 0.00 ? 29  ILE A CD1  7  
ATOM   4085  H  H    . ILE A 1 29 ? -3.681  3.689   0.219   1.00 0.00 ? 29  ILE A H    7  
ATOM   4086  H  HA   . ILE A 1 29 ? -1.511  4.176   -1.557  1.00 0.00 ? 29  ILE A HA   7  
ATOM   4087  H  HB   . ILE A 1 29 ? -4.048  5.740   -1.075  1.00 0.00 ? 29  ILE A HB   7  
ATOM   4088  H  HG12 . ILE A 1 29 ? -3.411  4.112   -3.512  1.00 0.00 ? 29  ILE A HG12 7  
ATOM   4089  H  HG13 . ILE A 1 29 ? -4.005  3.315   -2.060  1.00 0.00 ? 29  ILE A HG13 7  
ATOM   4090  H  HG21 . ILE A 1 29 ? -1.721  6.597   -2.379  1.00 0.00 ? 29  ILE A HG21 7  
ATOM   4091  H  HG22 . ILE A 1 29 ? -2.861  6.167   -3.653  1.00 0.00 ? 29  ILE A HG22 7  
ATOM   4092  H  HG23 . ILE A 1 29 ? -3.317  7.346   -2.423  1.00 0.00 ? 29  ILE A HG23 7  
ATOM   4093  H  HD11 . ILE A 1 29 ? -5.674  4.030   -3.888  1.00 0.00 ? 29  ILE A HD11 7  
ATOM   4094  H  HD12 . ILE A 1 29 ? -6.073  4.329   -2.197  1.00 0.00 ? 29  ILE A HD12 7  
ATOM   4095  H  HD13 . ILE A 1 29 ? -5.475  5.645   -3.208  1.00 0.00 ? 29  ILE A HD13 7  
ATOM   4096  N  N    . ILE A 1 30 ? -1.946  6.235   0.962   1.00 0.00 ? 30  ILE A N    7  
ATOM   4097  C  CA   . ILE A 1 30 ? -1.314  7.293   1.740   1.00 0.00 ? 30  ILE A CA   7  
ATOM   4098  C  C    . ILE A 1 30 ? -0.090  6.770   2.484   1.00 0.00 ? 30  ILE A C    7  
ATOM   4099  O  O    . ILE A 1 30 ? 0.749   7.547   2.944   1.00 0.00 ? 30  ILE A O    7  
ATOM   4100  C  CB   . ILE A 1 30 ? -2.295  7.908   2.755   1.00 0.00 ? 30  ILE A CB   7  
ATOM   4101  C  CG1  . ILE A 1 30 ? -2.723  6.859   3.784   1.00 0.00 ? 30  ILE A CG1  7  
ATOM   4102  C  CG2  . ILE A 1 30 ? -3.508  8.482   2.039   1.00 0.00 ? 30  ILE A CG2  7  
ATOM   4103  C  CD1  . ILE A 1 30 ? -3.037  7.440   5.145   1.00 0.00 ? 30  ILE A CD1  7  
ATOM   4104  H  H    . ILE A 1 30 ? -2.773  5.827   1.293   1.00 0.00 ? 30  ILE A H    7  
ATOM   4105  H  HA   . ILE A 1 30 ? -1.002  8.068   1.055   1.00 0.00 ? 30  ILE A HA   7  
ATOM   4106  H  HB   . ILE A 1 30 ? -1.791  8.716   3.264   1.00 0.00 ? 30  ILE A HB   7  
ATOM   4107  H  HG12 . ILE A 1 30 ? -3.607  6.354   3.427   1.00 0.00 ? 30  ILE A HG12 7  
ATOM   4108  H  HG13 . ILE A 1 30 ? -1.927  6.139   3.905   1.00 0.00 ? 30  ILE A HG13 7  
ATOM   4109  H  HG21 . ILE A 1 30 ? -4.033  7.688   1.529   1.00 0.00 ? 30  ILE A HG21 7  
ATOM   4110  H  HG22 . ILE A 1 30 ? -4.166  8.943   2.760   1.00 0.00 ? 30  ILE A HG22 7  
ATOM   4111  H  HG23 . ILE A 1 30 ? -3.186  9.220   1.320   1.00 0.00 ? 30  ILE A HG23 7  
ATOM   4112  H  HD11 . ILE A 1 30 ? -3.474  8.421   5.025   1.00 0.00 ? 30  ILE A HD11 7  
ATOM   4113  H  HD12 . ILE A 1 30 ? -3.735  6.796   5.659   1.00 0.00 ? 30  ILE A HD12 7  
ATOM   4114  H  HD13 . ILE A 1 30 ? -2.128  7.519   5.721   1.00 0.00 ? 30  ILE A HD13 7  
ATOM   4115  N  N    . HIS A 1 31 ? 0.008   5.450   2.599   1.00 0.00 ? 31  HIS A N    7  
ATOM   4116  C  CA   . HIS A 1 31 ? 1.132   4.823   3.286   1.00 0.00 ? 31  HIS A CA   7  
ATOM   4117  C  C    . HIS A 1 31 ? 2.223   4.429   2.295   1.00 0.00 ? 31  HIS A C    7  
ATOM   4118  O  O    . HIS A 1 31 ? 3.413   4.599   2.565   1.00 0.00 ? 31  HIS A O    7  
ATOM   4119  C  CB   . HIS A 1 31 ? 0.661   3.591   4.059   1.00 0.00 ? 31  HIS A CB   7  
ATOM   4120  C  CG   . HIS A 1 31 ? 1.713   2.534   4.201   1.00 0.00 ? 31  HIS A CG   7  
ATOM   4121  N  ND1  . HIS A 1 31 ? 2.238   2.153   5.417   1.00 0.00 ? 31  HIS A ND1  7  
ATOM   4122  C  CD2  . HIS A 1 31 ? 2.336   1.776   3.269   1.00 0.00 ? 31  HIS A CD2  7  
ATOM   4123  C  CE1  . HIS A 1 31 ? 3.140   1.207   5.228   1.00 0.00 ? 31  HIS A CE1  7  
ATOM   4124  N  NE2  . HIS A 1 31 ? 3.219   0.959   3.933   1.00 0.00 ? 31  HIS A NE2  7  
ATOM   4125  H  H    . HIS A 1 31 ? -0.692  4.884   2.212   1.00 0.00 ? 31  HIS A H    7  
ATOM   4126  H  HA   . HIS A 1 31 ? 1.537   5.541   3.982   1.00 0.00 ? 31  HIS A HA   7  
ATOM   4127  H  HB2  . HIS A 1 31 ? 0.358   3.891   5.051   1.00 0.00 ? 31  HIS A HB2  7  
ATOM   4128  H  HB3  . HIS A 1 31 ? -0.184  3.153   3.547   1.00 0.00 ? 31  HIS A HB3  7  
ATOM   4129  H  HD1  . HIS A 1 31 ? 1.987   2.522   6.290   1.00 0.00 ? 31  HIS A HD1  7  
ATOM   4130  H  HD2  . HIS A 1 31 ? 2.172   1.807   2.201   1.00 0.00 ? 31  HIS A HD2  7  
ATOM   4131  H  HE1  . HIS A 1 31 ? 3.715   0.718   6.000   1.00 0.00 ? 31  HIS A HE1  7  
ATOM   4132  N  N    . THR A 1 32 ? 1.811   3.902   1.146   1.00 0.00 ? 32  THR A N    7  
ATOM   4133  C  CA   . THR A 1 32 ? 2.753   3.482   0.116   1.00 0.00 ? 32  THR A CA   7  
ATOM   4134  C  C    . THR A 1 32 ? 3.631   4.645   -0.332  1.00 0.00 ? 32  THR A C    7  
ATOM   4135  O  O    . THR A 1 32 ? 4.774   4.448   -0.745  1.00 0.00 ? 32  THR A O    7  
ATOM   4136  C  CB   . THR A 1 32 ? 2.023   2.903   -1.110  1.00 0.00 ? 32  THR A CB   7  
ATOM   4137  O  OG1  . THR A 1 32 ? 2.904   2.048   -1.846  1.00 0.00 ? 32  THR A OG1  7  
ATOM   4138  C  CG2  . THR A 1 32 ? 1.517   4.017   -2.015  1.00 0.00 ? 32  THR A CG2  7  
ATOM   4139  H  H    . THR A 1 32 ? 0.850   3.792   0.990   1.00 0.00 ? 32  THR A H    7  
ATOM   4140  H  HA   . THR A 1 32 ? 3.381   2.709   0.534   1.00 0.00 ? 32  THR A HA   7  
ATOM   4141  H  HB   . THR A 1 32 ? 1.176   2.326   -0.767  1.00 0.00 ? 32  THR A HB   7  
ATOM   4142  H  HG1  . THR A 1 32 ? 3.815   2.288   -1.658  1.00 0.00 ? 32  THR A HG1  7  
ATOM   4143  H  HG21 . THR A 1 32 ? 0.788   4.609   -1.482  1.00 0.00 ? 32  THR A HG21 7  
ATOM   4144  H  HG22 . THR A 1 32 ? 1.059   3.587   -2.893  1.00 0.00 ? 32  THR A HG22 7  
ATOM   4145  H  HG23 . THR A 1 32 ? 2.344   4.645   -2.310  1.00 0.00 ? 32  THR A HG23 7  
ATOM   4146  N  N    . ARG A 1 33 ? 3.091   5.856   -0.247  1.00 0.00 ? 33  ARG A N    7  
ATOM   4147  C  CA   . ARG A 1 33 ? 3.826   7.050   -0.644  1.00 0.00 ? 33  ARG A CA   7  
ATOM   4148  C  C    . ARG A 1 33 ? 4.966   7.336   0.330   1.00 0.00 ? 33  ARG A C    7  
ATOM   4149  O  O    . ARG A 1 33 ? 6.052   7.753   -0.073  1.00 0.00 ? 33  ARG A O    7  
ATOM   4150  C  CB   . ARG A 1 33 ? 2.886   8.255   -0.714  1.00 0.00 ? 33  ARG A CB   7  
ATOM   4151  C  CG   . ARG A 1 33 ? 2.236   8.597   0.617   1.00 0.00 ? 33  ARG A CG   7  
ATOM   4152  C  CD   . ARG A 1 33 ? 1.030   9.505   0.430   1.00 0.00 ? 33  ARG A CD   7  
ATOM   4153  N  NE   . ARG A 1 33 ? 1.419   10.894  0.204   1.00 0.00 ? 33  ARG A NE   7  
ATOM   4154  C  CZ   . ARG A 1 33 ? 0.605   11.926  0.394   1.00 0.00 ? 33  ARG A CZ   7  
ATOM   4155  N  NH1  . ARG A 1 33 ? -0.637  11.726  0.812   1.00 0.00 ? 33  ARG A NH1  7  
ATOM   4156  N  NH2  . ARG A 1 33 ? 1.033   13.161  0.166   1.00 0.00 ? 33  ARG A NH2  7  
ATOM   4157  H  H    . ARG A 1 33 ? 2.175   5.949   0.090   1.00 0.00 ? 33  ARG A H    7  
ATOM   4158  H  HA   . ARG A 1 33 ? 4.243   6.873   -1.624  1.00 0.00 ? 33  ARG A HA   7  
ATOM   4159  H  HB2  . ARG A 1 33 ? 3.446   9.116   -1.048  1.00 0.00 ? 33  ARG A HB2  7  
ATOM   4160  H  HB3  . ARG A 1 33 ? 2.104   8.045   -1.428  1.00 0.00 ? 33  ARG A HB3  7  
ATOM   4161  H  HG2  . ARG A 1 33 ? 1.914   7.684   1.096   1.00 0.00 ? 33  ARG A HG2  7  
ATOM   4162  H  HG3  . ARG A 1 33 ? 2.960   9.099   1.242   1.00 0.00 ? 33  ARG A HG3  7  
ATOM   4163  H  HD2  . ARG A 1 33 ? 0.463   9.157   -0.420  1.00 0.00 ? 33  ARG A HD2  7  
ATOM   4164  H  HD3  . ARG A 1 33 ? 0.416   9.452   1.317   1.00 0.00 ? 33  ARG A HD3  7  
ATOM   4165  H  HE   . ARG A 1 33 ? 2.333   11.064  -0.106  1.00 0.00 ? 33  ARG A HE   7  
ATOM   4166  H  HH11 . ARG A 1 33 ? -0.962  10.797  0.985   1.00 0.00 ? 33  ARG A HH11 7  
ATOM   4167  H  HH12 . ARG A 1 33 ? -1.248  12.505  0.955   1.00 0.00 ? 33  ARG A HH12 7  
ATOM   4168  H  HH21 . ARG A 1 33 ? 1.969   13.316  -0.149  1.00 0.00 ? 33  ARG A HH21 7  
ATOM   4169  H  HH22 . ARG A 1 33 ? 0.420   13.937  0.309   1.00 0.00 ? 33  ARG A HH22 7  
ATOM   4170  N  N    . THR A 1 34 ? 4.709   7.111   1.615   1.00 0.00 ? 34  THR A N    7  
ATOM   4171  C  CA   . THR A 1 34 ? 5.711   7.346   2.647   1.00 0.00 ? 34  THR A CA   7  
ATOM   4172  C  C    . THR A 1 34 ? 6.971   6.529   2.386   1.00 0.00 ? 34  THR A C    7  
ATOM   4173  O  O    . THR A 1 34 ? 8.074   6.933   2.758   1.00 0.00 ? 34  THR A O    7  
ATOM   4174  C  CB   . THR A 1 34 ? 5.169   7.000   4.046   1.00 0.00 ? 34  THR A CB   7  
ATOM   4175  O  OG1  . THR A 1 34 ? 4.980   5.585   4.162   1.00 0.00 ? 34  THR A OG1  7  
ATOM   4176  C  CG2  . THR A 1 34 ? 3.852   7.715   4.309   1.00 0.00 ? 34  THR A CG2  7  
ATOM   4177  H  H    . THR A 1 34 ? 3.824   6.780   1.874   1.00 0.00 ? 34  THR A H    7  
ATOM   4178  H  HA   . THR A 1 34 ? 5.965   8.396   2.632   1.00 0.00 ? 34  THR A HA   7  
ATOM   4179  H  HB   . THR A 1 34 ? 5.889   7.321   4.785   1.00 0.00 ? 34  THR A HB   7  
ATOM   4180  H  HG1  . THR A 1 34 ? 5.764   5.130   3.844   1.00 0.00 ? 34  THR A HG1  7  
ATOM   4181  H  HG21 . THR A 1 34 ? 3.782   7.967   5.356   1.00 0.00 ? 34  THR A HG21 7  
ATOM   4182  H  HG22 . THR A 1 34 ? 3.030   7.068   4.039   1.00 0.00 ? 34  THR A HG22 7  
ATOM   4183  H  HG23 . THR A 1 34 ? 3.809   8.618   3.718   1.00 0.00 ? 34  THR A HG23 7  
ATOM   4184  N  N    . HIS A 1 35 ? 6.802   5.377   1.744   1.00 0.00 ? 35  HIS A N    7  
ATOM   4185  C  CA   . HIS A 1 35 ? 7.927   4.503   1.432   1.00 0.00 ? 35  HIS A CA   7  
ATOM   4186  C  C    . HIS A 1 35 ? 8.950   5.224   0.560   1.00 0.00 ? 35  HIS A C    7  
ATOM   4187  O  O    . HIS A 1 35 ? 10.135  4.889   0.568   1.00 0.00 ? 35  HIS A O    7  
ATOM   4188  C  CB   . HIS A 1 35 ? 7.437   3.239   0.725   1.00 0.00 ? 35  HIS A CB   7  
ATOM   4189  C  CG   . HIS A 1 35 ? 7.054   2.137   1.665   1.00 0.00 ? 35  HIS A CG   7  
ATOM   4190  N  ND1  . HIS A 1 35 ? 7.959   1.503   2.490   1.00 0.00 ? 35  HIS A ND1  7  
ATOM   4191  C  CD2  . HIS A 1 35 ? 5.855   1.558   1.909   1.00 0.00 ? 35  HIS A CD2  7  
ATOM   4192  C  CE1  . HIS A 1 35 ? 7.334   0.581   3.199   1.00 0.00 ? 35  HIS A CE1  7  
ATOM   4193  N  NE2  . HIS A 1 35 ? 6.055   0.594   2.866   1.00 0.00 ? 35  HIS A NE2  7  
ATOM   4194  H  H    . HIS A 1 35 ? 5.899   5.109   1.474   1.00 0.00 ? 35  HIS A H    7  
ATOM   4195  H  HA   . HIS A 1 35 ? 8.398   4.225   2.363   1.00 0.00 ? 35  HIS A HA   7  
ATOM   4196  H  HB2  . HIS A 1 35 ? 6.570   3.481   0.128   1.00 0.00 ? 35  HIS A HB2  7  
ATOM   4197  H  HB3  . HIS A 1 35 ? 8.220   2.868   0.080   1.00 0.00 ? 35  HIS A HB3  7  
ATOM   4198  H  HD1  . HIS A 1 35 ? 8.917   1.699   2.546   1.00 0.00 ? 35  HIS A HD1  7  
ATOM   4199  H  HD2  . HIS A 1 35 ? 4.914   1.807   1.438   1.00 0.00 ? 35  HIS A HD2  7  
ATOM   4200  H  HE1  . HIS A 1 35 ? 7.789   -0.073  3.928   1.00 0.00 ? 35  HIS A HE1  7  
ATOM   4201  N  N    . THR A 1 36 ? 8.484   6.216   -0.193  1.00 0.00 ? 36  THR A N    7  
ATOM   4202  C  CA   . THR A 1 36 ? 9.357   6.983   -1.072  1.00 0.00 ? 36  THR A CA   7  
ATOM   4203  C  C    . THR A 1 36 ? 10.296  7.878   -0.271  1.00 0.00 ? 36  THR A C    7  
ATOM   4204  O  O    . THR A 1 36 ? 11.487  7.965   -0.564  1.00 0.00 ? 36  THR A O    7  
ATOM   4205  C  CB   . THR A 1 36 ? 8.546   7.855   -2.049  1.00 0.00 ? 36  THR A CB   7  
ATOM   4206  O  OG1  . THR A 1 36 ? 7.756   7.023   -2.907  1.00 0.00 ? 36  THR A OG1  7  
ATOM   4207  C  CG2  . THR A 1 36 ? 9.466   8.729   -2.887  1.00 0.00 ? 36  THR A CG2  7  
ATOM   4208  H  H    . THR A 1 36 ? 7.530   6.435   -0.155  1.00 0.00 ? 36  THR A H    7  
ATOM   4209  H  HA   . THR A 1 36 ? 9.946   6.285   -1.649  1.00 0.00 ? 36  THR A HA   7  
ATOM   4210  H  HB   . THR A 1 36 ? 7.889   8.494   -1.477  1.00 0.00 ? 36  THR A HB   7  
ATOM   4211  H  HG1  . THR A 1 36 ? 7.253   6.401   -2.376  1.00 0.00 ? 36  THR A HG1  7  
ATOM   4212  H  HG21 . THR A 1 36 ? 10.096  9.316   -2.236  1.00 0.00 ? 36  THR A HG21 7  
ATOM   4213  H  HG22 . THR A 1 36 ? 8.873   9.387   -3.505  1.00 0.00 ? 36  THR A HG22 7  
ATOM   4214  H  HG23 . THR A 1 36 ? 10.082  8.103   -3.516  1.00 0.00 ? 36  THR A HG23 7  
ATOM   4215  N  N    . GLY A 1 37 ? 9.751   8.541   0.745   1.00 0.00 ? 37  GLY A N    7  
ATOM   4216  C  CA   . GLY A 1 37 ? 10.555  9.420   1.574   1.00 0.00 ? 37  GLY A CA   7  
ATOM   4217  C  C    . GLY A 1 37 ? 10.208  10.882  1.375   1.00 0.00 ? 37  GLY A C    7  
ATOM   4218  O  O    . GLY A 1 37 ? 11.093  11.735  1.325   1.00 0.00 ? 37  GLY A O    7  
ATOM   4219  H  H    . GLY A 1 37 ? 8.795   8.433   0.932   1.00 0.00 ? 37  GLY A H    7  
ATOM   4220  H  HA2  . GLY A 1 37 ? 10.400  9.161   2.610   1.00 0.00 ? 37  GLY A HA2  7  
ATOM   4221  H  HA3  . GLY A 1 37 ? 11.597  9.273   1.329   1.00 0.00 ? 37  GLY A HA3  7  
ATOM   4222  N  N    . GLU A 1 38 ? 8.915   11.171  1.260   1.00 0.00 ? 38  GLU A N    7  
ATOM   4223  C  CA   . GLU A 1 38 ? 8.454   12.541  1.063   1.00 0.00 ? 38  GLU A CA   7  
ATOM   4224  C  C    . GLU A 1 38 ? 7.847   13.100  2.346   1.00 0.00 ? 38  GLU A C    7  
ATOM   4225  O  O    . GLU A 1 38 ? 6.813   13.767  2.317   1.00 0.00 ? 38  GLU A O    7  
ATOM   4226  C  CB   . GLU A 1 38 ? 7.426   12.598  -0.068  1.00 0.00 ? 38  GLU A CB   7  
ATOM   4227  C  CG   . GLU A 1 38 ? 7.337   13.958  -0.742  1.00 0.00 ? 38  GLU A CG   7  
ATOM   4228  C  CD   . GLU A 1 38 ? 6.513   13.926  -2.014  1.00 0.00 ? 38  GLU A CD   7  
ATOM   4229  O  OE1  . GLU A 1 38 ? 5.692   12.997  -2.165  1.00 0.00 ? 38  GLU A OE1  7  
ATOM   4230  O  OE2  . GLU A 1 38 ? 6.688   14.829  -2.858  1.00 0.00 ? 38  GLU A OE2  7  
ATOM   4231  H  H    . GLU A 1 38 ? 8.257   10.447  1.308   1.00 0.00 ? 38  GLU A H    7  
ATOM   4232  H  HA   . GLU A 1 38 ? 9.308   13.142  0.792   1.00 0.00 ? 38  GLU A HA   7  
ATOM   4233  H  HB2  . GLU A 1 38 ? 7.689   11.865  -0.816  1.00 0.00 ? 38  GLU A HB2  7  
ATOM   4234  H  HB3  . GLU A 1 38 ? 6.453   12.355  0.333   1.00 0.00 ? 38  GLU A HB3  7  
ATOM   4235  H  HG2  . GLU A 1 38 ? 6.884   14.657  -0.055  1.00 0.00 ? 38  GLU A HG2  7  
ATOM   4236  H  HG3  . GLU A 1 38 ? 8.336   14.290  -0.986  1.00 0.00 ? 38  GLU A HG3  7  
ATOM   4237  N  N    . SER A 1 39 ? 8.497   12.822  3.472   1.00 0.00 ? 39  SER A N    7  
ATOM   4238  C  CA   . SER A 1 39 ? 8.019   13.293  4.767   1.00 0.00 ? 39  SER A CA   7  
ATOM   4239  C  C    . SER A 1 39 ? 8.305   14.782  4.942   1.00 0.00 ? 39  SER A C    7  
ATOM   4240  O  O    . SER A 1 39 ? 9.442   15.228  4.797   1.00 0.00 ? 39  SER A O    7  
ATOM   4241  C  CB   . SER A 1 39 ? 8.678   12.499  5.896   1.00 0.00 ? 39  SER A CB   7  
ATOM   4242  O  OG   . SER A 1 39 ? 10.016  12.917  6.101   1.00 0.00 ? 39  SER A OG   7  
ATOM   4243  H  H    . SER A 1 39 ? 9.316   12.285  3.430   1.00 0.00 ? 39  SER A H    7  
ATOM   4244  H  HA   . SER A 1 39 ? 6.951   13.137  4.803   1.00 0.00 ? 39  SER A HA   7  
ATOM   4245  H  HB2  . SER A 1 39 ? 8.123   12.650  6.810   1.00 0.00 ? 39  SER A HB2  7  
ATOM   4246  H  HB3  . SER A 1 39 ? 8.675   11.449  5.643   1.00 0.00 ? 39  SER A HB3  7  
ATOM   4247  H  HG   . SER A 1 39 ? 10.613  12.196  5.887   1.00 0.00 ? 39  SER A HG   7  
ATOM   4248  N  N    . GLY A 1 40 ? 7.262   15.545  5.256   1.00 0.00 ? 40  GLY A N    7  
ATOM   4249  C  CA   . GLY A 1 40 ? 7.421   16.975  5.447   1.00 0.00 ? 40  GLY A CA   7  
ATOM   4250  C  C    . GLY A 1 40 ? 6.220   17.761  4.959   1.00 0.00 ? 40  GLY A C    7  
ATOM   4251  O  O    . GLY A 1 40 ? 5.103   17.249  4.888   1.00 0.00 ? 40  GLY A O    7  
ATOM   4252  H  H    . GLY A 1 40 ? 6.379   15.134  5.360   1.00 0.00 ? 40  GLY A H    7  
ATOM   4253  H  HA2  . GLY A 1 40 ? 7.565   17.173  6.498   1.00 0.00 ? 40  GLY A HA2  7  
ATOM   4254  H  HA3  . GLY A 1 40 ? 8.296   17.304  4.906   1.00 0.00 ? 40  GLY A HA3  7  
ATOM   4255  N  N    . PRO A 1 41 ? 6.445   19.037  4.612   1.00 0.00 ? 41  PRO A N    7  
ATOM   4256  C  CA   . PRO A 1 41 ? 5.384   19.923  4.123   1.00 0.00 ? 41  PRO A CA   7  
ATOM   4257  C  C    . PRO A 1 41 ? 4.895   19.530  2.734   1.00 0.00 ? 41  PRO A C    7  
ATOM   4258  O  O    . PRO A 1 41 ? 4.042   20.201  2.153   1.00 0.00 ? 41  PRO A O    7  
ATOM   4259  C  CB   . PRO A 1 41 ? 6.060   21.297  4.084   1.00 0.00 ? 41  PRO A CB   7  
ATOM   4260  C  CG   . PRO A 1 41 ? 7.512   21.000  3.931   1.00 0.00 ? 41  PRO A CG   7  
ATOM   4261  C  CD   . PRO A 1 41 ? 7.752   19.714  4.671   1.00 0.00 ? 41  PRO A CD   7  
ATOM   4262  H  HA   . PRO A 1 41 ? 4.546   19.952  4.804   1.00 0.00 ? 41  PRO A HA   7  
ATOM   4263  H  HB2  . PRO A 1 41 ? 5.680   21.863  3.244   1.00 0.00 ? 41  PRO A HB2  7  
ATOM   4264  H  HB3  . PRO A 1 41 ? 5.860   21.827  5.003   1.00 0.00 ? 41  PRO A HB3  7  
ATOM   4265  H  HG2  . PRO A 1 41 ? 7.755   20.883  2.886   1.00 0.00 ? 41  PRO A HG2  7  
ATOM   4266  H  HG3  . PRO A 1 41 ? 8.096   21.797  4.367   1.00 0.00 ? 41  PRO A HG3  7  
ATOM   4267  H  HD2  . PRO A 1 41 ? 8.511   19.129  4.174   1.00 0.00 ? 41  PRO A HD2  7  
ATOM   4268  H  HD3  . PRO A 1 41 ? 8.036   19.914  5.694   1.00 0.00 ? 41  PRO A HD3  7  
ATOM   4269  N  N    . SER A 1 42 ? 5.440   18.438  2.207   1.00 0.00 ? 42  SER A N    7  
ATOM   4270  C  CA   . SER A 1 42 ? 5.061   17.957  0.883   1.00 0.00 ? 42  SER A CA   7  
ATOM   4271  C  C    . SER A 1 42 ? 3.554   18.072  0.675   1.00 0.00 ? 42  SER A C    7  
ATOM   4272  O  O    . SER A 1 42 ? 2.792   18.208  1.632   1.00 0.00 ? 42  SER A O    7  
ATOM   4273  C  CB   . SER A 1 42 ? 5.504   16.505  0.699   1.00 0.00 ? 42  SER A CB   7  
ATOM   4274  O  OG   . SER A 1 42 ? 4.675   15.622  1.436   1.00 0.00 ? 42  SER A OG   7  
ATOM   4275  H  H    . SER A 1 42 ? 6.115   17.946  2.719   1.00 0.00 ? 42  SER A H    7  
ATOM   4276  H  HA   . SER A 1 42 ? 5.562   18.573  0.151   1.00 0.00 ? 42  SER A HA   7  
ATOM   4277  H  HB2  . SER A 1 42 ? 5.447   16.243  -0.347  1.00 0.00 ? 42  SER A HB2  7  
ATOM   4278  H  HB3  . SER A 1 42 ? 6.522   16.395  1.043   1.00 0.00 ? 42  SER A HB3  7  
ATOM   4279  H  HG   . SER A 1 42 ? 5.072   14.748  1.451   1.00 0.00 ? 42  SER A HG   7  
ATOM   4280  N  N    . SER A 1 43 ? 3.131   18.016  -0.584  1.00 0.00 ? 43  SER A N    7  
ATOM   4281  C  CA   . SER A 1 43 ? 1.716   18.118  -0.920  1.00 0.00 ? 43  SER A CA   7  
ATOM   4282  C  C    . SER A 1 43 ? 1.445   17.546  -2.309  1.00 0.00 ? 43  SER A C    7  
ATOM   4283  O  O    . SER A 1 43 ? 2.311   17.570  -3.182  1.00 0.00 ? 43  SER A O    7  
ATOM   4284  C  CB   . SER A 1 43 ? 1.258   19.576  -0.858  1.00 0.00 ? 43  SER A CB   7  
ATOM   4285  O  OG   . SER A 1 43 ? -0.151  19.674  -0.974  1.00 0.00 ? 43  SER A OG   7  
ATOM   4286  H  H    . SER A 1 43 ? 3.787   17.907  -1.304  1.00 0.00 ? 43  SER A H    7  
ATOM   4287  H  HA   . SER A 1 43 ? 1.160   17.544  -0.193  1.00 0.00 ? 43  SER A HA   7  
ATOM   4288  H  HB2  . SER A 1 43 ? 1.561   20.006  0.084   1.00 0.00 ? 43  SER A HB2  7  
ATOM   4289  H  HB3  . SER A 1 43 ? 1.713   20.128  -1.668  1.00 0.00 ? 43  SER A HB3  7  
ATOM   4290  H  HG   . SER A 1 43 ? -0.487  18.912  -1.452  1.00 0.00 ? 43  SER A HG   7  
ATOM   4291  N  N    . GLY A 1 44 ? 0.234   17.033  -2.505  1.00 0.00 ? 44  GLY A N    7  
ATOM   4292  C  CA   . GLY A 1 44 ? -0.130  16.462  -3.789  1.00 0.00 ? 44  GLY A CA   7  
ATOM   4293  C  C    . GLY A 1 44 ? -1.516  15.848  -3.778  1.00 0.00 ? 44  GLY A C    7  
ATOM   4294  O  O    . GLY A 1 44 ? -1.732  14.845  -4.456  1.00 0.00 ? 44  GLY A O    7  
ATOM   4295  H  H    . GLY A 1 44 ? -0.416  17.041  -1.772  1.00 0.00 ? 44  GLY A H    7  
ATOM   4296  H  HA2  . GLY A 1 44 ? -0.098  17.239  -4.538  1.00 0.00 ? 44  GLY A HA2  7  
ATOM   4297  H  HA3  . GLY A 1 44 ? 0.588   15.697  -4.047  1.00 0.00 ? 44  GLY A HA3  7  
HETATM 4298  ZN ZN   . ZN  B 2 .  ? 4.529   -0.494  3.167   1.00 0.00 ? 181 ZN  A ZN   7  
ATOM   4299  N  N    . GLY A 1 1  ? -16.252 -33.413 -4.674  1.00 0.00 ? 1   GLY A N    8  
ATOM   4300  C  CA   . GLY A 1 1  ? -16.403 -32.542 -3.524  1.00 0.00 ? 1   GLY A CA   8  
ATOM   4301  C  C    . GLY A 1 1  ? -17.216 -31.302 -3.838  1.00 0.00 ? 1   GLY A C    8  
ATOM   4302  O  O    . GLY A 1 1  ? -16.659 -30.239 -4.115  1.00 0.00 ? 1   GLY A O    8  
ATOM   4303  H  H1   . GLY A 1 1  ? -15.731 -33.114 -5.448  1.00 0.00 ? 1   GLY A H1   8  
ATOM   4304  H  HA2  . GLY A 1 1  ? -16.892 -33.090 -2.732  1.00 0.00 ? 1   GLY A HA2  8  
ATOM   4305  H  HA3  . GLY A 1 1  ? -15.423 -32.239 -3.185  1.00 0.00 ? 1   GLY A HA3  8  
ATOM   4306  N  N    . SER A 1 2  ? -18.538 -31.437 -3.797  1.00 0.00 ? 2   SER A N    8  
ATOM   4307  C  CA   . SER A 1 2  ? -19.430 -30.320 -4.085  1.00 0.00 ? 2   SER A CA   8  
ATOM   4308  C  C    . SER A 1 2  ? -18.888 -29.024 -3.489  1.00 0.00 ? 2   SER A C    8  
ATOM   4309  O  O    . SER A 1 2  ? -18.891 -27.979 -4.140  1.00 0.00 ? 2   SER A O    8  
ATOM   4310  C  CB   . SER A 1 2  ? -20.829 -30.601 -3.534  1.00 0.00 ? 2   SER A CB   8  
ATOM   4311  O  OG   . SER A 1 2  ? -21.727 -29.556 -3.864  1.00 0.00 ? 2   SER A OG   8  
ATOM   4312  H  H    . SER A 1 2  ? -18.922 -32.310 -3.570  1.00 0.00 ? 2   SER A H    8  
ATOM   4313  H  HA   . SER A 1 2  ? -19.489 -30.211 -5.158  1.00 0.00 ? 2   SER A HA   8  
ATOM   4314  H  HB2  . SER A 1 2  ? -21.200 -31.524 -3.955  1.00 0.00 ? 2   SER A HB2  8  
ATOM   4315  H  HB3  . SER A 1 2  ? -20.778 -30.691 -2.459  1.00 0.00 ? 2   SER A HB3  8  
ATOM   4316  H  HG   . SER A 1 2  ? -21.477 -29.173 -4.708  1.00 0.00 ? 2   SER A HG   8  
ATOM   4317  N  N    . SER A 1 3  ? -18.422 -29.101 -2.247  1.00 0.00 ? 3   SER A N    8  
ATOM   4318  C  CA   . SER A 1 3  ? -17.880 -27.934 -1.560  1.00 0.00 ? 3   SER A CA   8  
ATOM   4319  C  C    . SER A 1 3  ? -16.939 -27.155 -2.474  1.00 0.00 ? 3   SER A C    8  
ATOM   4320  O  O    . SER A 1 3  ? -17.128 -25.962 -2.707  1.00 0.00 ? 3   SER A O    8  
ATOM   4321  C  CB   . SER A 1 3  ? -17.140 -28.361 -0.291  1.00 0.00 ? 3   SER A CB   8  
ATOM   4322  O  OG   . SER A 1 3  ? -17.109 -27.311 0.659   1.00 0.00 ? 3   SER A OG   8  
ATOM   4323  H  H    . SER A 1 3  ? -18.447 -29.962 -1.780  1.00 0.00 ? 3   SER A H    8  
ATOM   4324  H  HA   . SER A 1 3  ? -18.707 -27.296 -1.287  1.00 0.00 ? 3   SER A HA   8  
ATOM   4325  H  HB2  . SER A 1 3  ? -17.641 -29.211 0.146   1.00 0.00 ? 3   SER A HB2  8  
ATOM   4326  H  HB3  . SER A 1 3  ? -16.125 -28.632 -0.544  1.00 0.00 ? 3   SER A HB3  8  
ATOM   4327  H  HG   . SER A 1 3  ? -17.180 -26.467 0.207   1.00 0.00 ? 3   SER A HG   8  
ATOM   4328  N  N    . GLY A 1 4  ? -15.922 -27.840 -2.988  1.00 0.00 ? 4   GLY A N    8  
ATOM   4329  C  CA   . GLY A 1 4  ? -14.965 -27.197 -3.870  1.00 0.00 ? 4   GLY A CA   8  
ATOM   4330  C  C    . GLY A 1 4  ? -14.570 -25.815 -3.388  1.00 0.00 ? 4   GLY A C    8  
ATOM   4331  O  O    . GLY A 1 4  ? -15.188 -24.819 -3.764  1.00 0.00 ? 4   GLY A O    8  
ATOM   4332  H  H    . GLY A 1 4  ? -15.820 -28.789 -2.767  1.00 0.00 ? 4   GLY A H    8  
ATOM   4333  H  HA2  . GLY A 1 4  ? -14.080 -27.812 -3.933  1.00 0.00 ? 4   GLY A HA2  8  
ATOM   4334  H  HA3  . GLY A 1 4  ? -15.402 -27.111 -4.854  1.00 0.00 ? 4   GLY A HA3  8  
ATOM   4335  N  N    . SER A 1 5  ? -13.538 -25.754 -2.553  1.00 0.00 ? 5   SER A N    8  
ATOM   4336  C  CA   . SER A 1 5  ? -13.064 -24.485 -2.015  1.00 0.00 ? 5   SER A CA   8  
ATOM   4337  C  C    . SER A 1 5  ? -12.367 -23.663 -3.095  1.00 0.00 ? 5   SER A C    8  
ATOM   4338  O  O    . SER A 1 5  ? -11.250 -23.977 -3.505  1.00 0.00 ? 5   SER A O    8  
ATOM   4339  C  CB   . SER A 1 5  ? -12.108 -24.727 -0.845  1.00 0.00 ? 5   SER A CB   8  
ATOM   4340  O  OG   . SER A 1 5  ? -11.961 -23.560 -0.056  1.00 0.00 ? 5   SER A OG   8  
ATOM   4341  H  H    . SER A 1 5  ? -13.086 -26.584 -2.291  1.00 0.00 ? 5   SER A H    8  
ATOM   4342  H  HA   . SER A 1 5  ? -13.922 -23.935 -1.659  1.00 0.00 ? 5   SER A HA   8  
ATOM   4343  H  HB2  . SER A 1 5  ? -12.496 -25.520 -0.225  1.00 0.00 ? 5   SER A HB2  8  
ATOM   4344  H  HB3  . SER A 1 5  ? -11.139 -25.012 -1.230  1.00 0.00 ? 5   SER A HB3  8  
ATOM   4345  H  HG   . SER A 1 5  ? -12.384 -23.694 0.796   1.00 0.00 ? 5   SER A HG   8  
ATOM   4346  N  N    . SER A 1 6  ? -13.035 -22.608 -3.551  1.00 0.00 ? 6   SER A N    8  
ATOM   4347  C  CA   . SER A 1 6  ? -12.482 -21.742 -4.586  1.00 0.00 ? 6   SER A CA   8  
ATOM   4348  C  C    . SER A 1 6  ? -12.865 -20.286 -4.338  1.00 0.00 ? 6   SER A C    8  
ATOM   4349  O  O    . SER A 1 6  ? -13.850 -19.999 -3.659  1.00 0.00 ? 6   SER A O    8  
ATOM   4350  C  CB   . SER A 1 6  ? -12.974 -22.183 -5.966  1.00 0.00 ? 6   SER A CB   8  
ATOM   4351  O  OG   . SER A 1 6  ? -12.024 -21.871 -6.970  1.00 0.00 ? 6   SER A OG   8  
ATOM   4352  H  H    . SER A 1 6  ? -13.922 -22.409 -3.184  1.00 0.00 ? 6   SER A H    8  
ATOM   4353  H  HA   . SER A 1 6  ? -11.406 -21.830 -4.552  1.00 0.00 ? 6   SER A HA   8  
ATOM   4354  H  HB2  . SER A 1 6  ? -13.139 -23.250 -5.962  1.00 0.00 ? 6   SER A HB2  8  
ATOM   4355  H  HB3  . SER A 1 6  ? -13.901 -21.676 -6.193  1.00 0.00 ? 6   SER A HB3  8  
ATOM   4356  H  HG   . SER A 1 6  ? -11.148 -21.827 -6.579  1.00 0.00 ? 6   SER A HG   8  
ATOM   4357  N  N    . GLY A 1 7  ? -12.078 -19.371 -4.895  1.00 0.00 ? 7   GLY A N    8  
ATOM   4358  C  CA   . GLY A 1 7  ? -12.350 -17.956 -4.723  1.00 0.00 ? 7   GLY A CA   8  
ATOM   4359  C  C    . GLY A 1 7  ? -11.091 -17.149 -4.474  1.00 0.00 ? 7   GLY A C    8  
ATOM   4360  O  O    . GLY A 1 7  ? -10.324 -17.448 -3.559  1.00 0.00 ? 7   GLY A O    8  
ATOM   4361  H  H    . GLY A 1 7  ? -11.307 -19.658 -5.426  1.00 0.00 ? 7   GLY A H    8  
ATOM   4362  H  HA2  . GLY A 1 7  ? -12.834 -17.583 -5.614  1.00 0.00 ? 7   GLY A HA2  8  
ATOM   4363  H  HA3  . GLY A 1 7  ? -13.017 -17.828 -3.883  1.00 0.00 ? 7   GLY A HA3  8  
ATOM   4364  N  N    . THR A 1 8  ? -10.876 -16.123 -5.292  1.00 0.00 ? 8   THR A N    8  
ATOM   4365  C  CA   . THR A 1 8  ? -9.700  -15.273 -5.158  1.00 0.00 ? 8   THR A CA   8  
ATOM   4366  C  C    . THR A 1 8  ? -10.056 -13.941 -4.507  1.00 0.00 ? 8   THR A C    8  
ATOM   4367  O  O    . THR A 1 8  ? -11.028 -13.292 -4.889  1.00 0.00 ? 8   THR A O    8  
ATOM   4368  C  CB   . THR A 1 8  ? -9.043  -15.003 -6.525  1.00 0.00 ? 8   THR A CB   8  
ATOM   4369  O  OG1  . THR A 1 8  ? -8.840  -16.237 -7.223  1.00 0.00 ? 8   THR A OG1  8  
ATOM   4370  C  CG2  . THR A 1 8  ? -7.712  -14.287 -6.354  1.00 0.00 ? 8   THR A CG2  8  
ATOM   4371  H  H    . THR A 1 8  ? -11.524 -15.935 -6.002  1.00 0.00 ? 8   THR A H    8  
ATOM   4372  H  HA   . THR A 1 8  ? -8.985  -15.788 -4.534  1.00 0.00 ? 8   THR A HA   8  
ATOM   4373  H  HB   . THR A 1 8  ? -9.702  -14.374 -7.106  1.00 0.00 ? 8   THR A HB   8  
ATOM   4374  H  HG1  . THR A 1 8  ? -9.263  -16.191 -8.084  1.00 0.00 ? 8   THR A HG1  8  
ATOM   4375  H  HG21 . THR A 1 8  ? -7.500  -13.707 -7.239  1.00 0.00 ? 8   THR A HG21 8  
ATOM   4376  H  HG22 . THR A 1 8  ? -6.928  -15.014 -6.204  1.00 0.00 ? 8   THR A HG22 8  
ATOM   4377  H  HG23 . THR A 1 8  ? -7.764  -13.631 -5.497  1.00 0.00 ? 8   THR A HG23 8  
ATOM   4378  N  N    . GLY A 1 9  ? -9.260  -13.539 -3.520  1.00 0.00 ? 9   GLY A N    8  
ATOM   4379  C  CA   . GLY A 1 9  ? -9.508  -12.286 -2.831  1.00 0.00 ? 9   GLY A CA   8  
ATOM   4380  C  C    . GLY A 1 9  ? -8.595  -12.090 -1.637  1.00 0.00 ? 9   GLY A C    8  
ATOM   4381  O  O    . GLY A 1 9  ? -9.020  -12.237 -0.492  1.00 0.00 ? 9   GLY A O    8  
ATOM   4382  H  H    . GLY A 1 9  ? -8.499  -14.098 -3.257  1.00 0.00 ? 9   GLY A H    8  
ATOM   4383  H  HA2  . GLY A 1 9  ? -9.357  -11.472 -3.524  1.00 0.00 ? 9   GLY A HA2  8  
ATOM   4384  H  HA3  . GLY A 1 9  ? -10.533 -12.272 -2.491  1.00 0.00 ? 9   GLY A HA3  8  
ATOM   4385  N  N    . MET A 1 10 ? -7.336  -11.760 -1.905  1.00 0.00 ? 10  MET A N    8  
ATOM   4386  C  CA   . MET A 1 10 ? -6.360  -11.544 -0.842  1.00 0.00 ? 10  MET A CA   8  
ATOM   4387  C  C    . MET A 1 10 ? -5.318  -10.513 -1.263  1.00 0.00 ? 10  MET A C    8  
ATOM   4388  O  O    . MET A 1 10 ? -5.032  -10.352 -2.449  1.00 0.00 ? 10  MET A O    8  
ATOM   4389  C  CB   . MET A 1 10 ? -5.673  -12.862 -0.477  1.00 0.00 ? 10  MET A CB   8  
ATOM   4390  C  CG   . MET A 1 10 ? -5.124  -13.614 -1.678  1.00 0.00 ? 10  MET A CG   8  
ATOM   4391  S  SD   . MET A 1 10 ? -5.107  -15.400 -1.430  1.00 0.00 ? 10  MET A SD   8  
ATOM   4392  C  CE   . MET A 1 10 ? -4.163  -15.523 0.087   1.00 0.00 ? 10  MET A CE   8  
ATOM   4393  H  H    . MET A 1 10 ? -7.056  -11.657 -2.838  1.00 0.00 ? 10  MET A H    8  
ATOM   4394  H  HA   . MET A 1 10 ? -6.889  -11.173 0.022   1.00 0.00 ? 10  MET A HA   8  
ATOM   4395  H  HB2  . MET A 1 10 ? -4.854  -12.652 0.195   1.00 0.00 ? 10  MET A HB2  8  
ATOM   4396  H  HB3  . MET A 1 10 ? -6.386  -13.499 0.025   1.00 0.00 ? 10  MET A HB3  8  
ATOM   4397  H  HG2  . MET A 1 10 ? -5.738  -13.391 -2.538  1.00 0.00 ? 10  MET A HG2  8  
ATOM   4398  H  HG3  . MET A 1 10 ? -4.114  -13.281 -1.863  1.00 0.00 ? 10  MET A HG3  8  
ATOM   4399  H  HE1  . MET A 1 10 ? -4.101  -16.558 0.390   1.00 0.00 ? 10  MET A HE1  8  
ATOM   4400  H  HE2  . MET A 1 10 ? -3.168  -15.136 -0.076  1.00 0.00 ? 10  MET A HE2  8  
ATOM   4401  H  HE3  . MET A 1 10 ? -4.650  -14.949 0.861   1.00 0.00 ? 10  MET A HE3  8  
ATOM   4402  N  N    . LYS A 1 11 ? -4.752  -9.817  -0.282  1.00 0.00 ? 11  LYS A N    8  
ATOM   4403  C  CA   . LYS A 1 11 ? -3.740  -8.802  -0.550  1.00 0.00 ? 11  LYS A CA   8  
ATOM   4404  C  C    . LYS A 1 11 ? -4.300  -7.697  -1.440  1.00 0.00 ? 11  LYS A C    8  
ATOM   4405  O  O    . LYS A 1 11 ? -3.648  -7.229  -2.374  1.00 0.00 ? 11  LYS A O    8  
ATOM   4406  C  CB   . LYS A 1 11 ? -2.516  -9.435  -1.213  1.00 0.00 ? 11  LYS A CB   8  
ATOM   4407  C  CG   . LYS A 1 11 ? -2.278  -10.877 -0.800  1.00 0.00 ? 11  LYS A CG   8  
ATOM   4408  C  CD   . LYS A 1 11 ? -0.930  -11.382 -1.288  1.00 0.00 ? 11  LYS A CD   8  
ATOM   4409  C  CE   . LYS A 1 11 ? 0.212   -10.800 -0.470  1.00 0.00 ? 11  LYS A CE   8  
ATOM   4410  N  NZ   . LYS A 1 11 ? 0.287   -11.406 0.888   1.00 0.00 ? 11  LYS A NZ   8  
ATOM   4411  H  H    . LYS A 1 11 ? -5.022  -9.991  0.644   1.00 0.00 ? 11  LYS A H    8  
ATOM   4412  H  HA   . LYS A 1 11 ? -3.445  -8.371  0.395   1.00 0.00 ? 11  LYS A HA   8  
ATOM   4413  H  HB2  . LYS A 1 11 ? -2.647  -9.406  -2.285  1.00 0.00 ? 11  LYS A HB2  8  
ATOM   4414  H  HB3  . LYS A 1 11 ? -1.640  -8.858  -0.951  1.00 0.00 ? 11  LYS A HB3  8  
ATOM   4415  H  HG2  . LYS A 1 11 ? -2.306  -10.943 0.277   1.00 0.00 ? 11  LYS A HG2  8  
ATOM   4416  H  HG3  . LYS A 1 11 ? -3.058  -11.496 -1.222  1.00 0.00 ? 11  LYS A HG3  8  
ATOM   4417  H  HD2  . LYS A 1 11 ? -0.906  -12.458 -1.204  1.00 0.00 ? 11  LYS A HD2  8  
ATOM   4418  H  HD3  . LYS A 1 11 ? -0.802  -11.097 -2.323  1.00 0.00 ? 11  LYS A HD3  8  
ATOM   4419  H  HE2  . LYS A 1 11 ? 1.140   -10.985 -0.989  1.00 0.00 ? 11  LYS A HE2  8  
ATOM   4420  H  HE3  . LYS A 1 11 ? 0.061   -9.735  -0.372  1.00 0.00 ? 11  LYS A HE3  8  
ATOM   4421  H  HZ1  . LYS A 1 11 ? 0.260   -12.443 0.819   1.00 0.00 ? 11  LYS A HZ1  8  
ATOM   4422  H  HZ2  . LYS A 1 11 ? -0.517  -11.086 1.466   1.00 0.00 ? 11  LYS A HZ2  8  
ATOM   4423  H  HZ3  . LYS A 1 11 ? 1.171   -11.123 1.358   1.00 0.00 ? 11  LYS A HZ3  8  
ATOM   4424  N  N    . PRO A 1 12 ? -5.536  -7.268  -1.146  1.00 0.00 ? 12  PRO A N    8  
ATOM   4425  C  CA   . PRO A 1 12 ? -6.210  -6.211  -1.908  1.00 0.00 ? 12  PRO A CA   8  
ATOM   4426  C  C    . PRO A 1 12 ? -5.576  -4.843  -1.685  1.00 0.00 ? 12  PRO A C    8  
ATOM   4427  O  O    . PRO A 1 12 ? -5.212  -4.154  -2.638  1.00 0.00 ? 12  PRO A O    8  
ATOM   4428  C  CB   . PRO A 1 12 ? -7.639  -6.235  -1.359  1.00 0.00 ? 12  PRO A CB   8  
ATOM   4429  C  CG   . PRO A 1 12 ? -7.508  -6.797  0.014   1.00 0.00 ? 12  PRO A CG   8  
ATOM   4430  C  CD   . PRO A 1 12 ? -6.372  -7.781  -0.048  1.00 0.00 ? 12  PRO A CD   8  
ATOM   4431  H  HA   . PRO A 1 12 ? -6.224  -6.432  -2.965  1.00 0.00 ? 12  PRO A HA   8  
ATOM   4432  H  HB2  . PRO A 1 12 ? -8.035  -5.229  -1.339  1.00 0.00 ? 12  PRO A HB2  8  
ATOM   4433  H  HB3  . PRO A 1 12 ? -8.258  -6.860  -1.985  1.00 0.00 ? 12  PRO A HB3  8  
ATOM   4434  H  HG2  . PRO A 1 12 ? -7.283  -6.008  0.715   1.00 0.00 ? 12  PRO A HG2  8  
ATOM   4435  H  HG3  . PRO A 1 12 ? -8.423  -7.299  0.293   1.00 0.00 ? 12  PRO A HG3  8  
ATOM   4436  H  HD2  . PRO A 1 12 ? -5.825  -7.784  0.884   1.00 0.00 ? 12  PRO A HD2  8  
ATOM   4437  H  HD3  . PRO A 1 12 ? -6.741  -8.770  -0.274  1.00 0.00 ? 12  PRO A HD3  8  
ATOM   4438  N  N    . TYR A 1 13 ? -5.446  -4.455  -0.421  1.00 0.00 ? 13  TYR A N    8  
ATOM   4439  C  CA   . TYR A 1 13 ? -4.857  -3.166  -0.074  1.00 0.00 ? 13  TYR A CA   8  
ATOM   4440  C  C    . TYR A 1 13 ? -3.545  -3.353  0.681   1.00 0.00 ? 13  TYR A C    8  
ATOM   4441  O  O    . TYR A 1 13 ? -2.992  -2.402  1.234   1.00 0.00 ? 13  TYR A O    8  
ATOM   4442  C  CB   . TYR A 1 13 ? -5.834  -2.348  0.773   1.00 0.00 ? 13  TYR A CB   8  
ATOM   4443  C  CG   . TYR A 1 13 ? -7.284  -2.701  0.535   1.00 0.00 ? 13  TYR A CG   8  
ATOM   4444  C  CD1  . TYR A 1 13 ? -7.870  -3.784  1.178   1.00 0.00 ? 13  TYR A CD1  8  
ATOM   4445  C  CD2  . TYR A 1 13 ? -8.070  -1.950  -0.331  1.00 0.00 ? 13  TYR A CD2  8  
ATOM   4446  C  CE1  . TYR A 1 13 ? -9.195  -4.111  0.963   1.00 0.00 ? 13  TYR A CE1  8  
ATOM   4447  C  CE2  . TYR A 1 13 ? -9.396  -2.269  -0.551  1.00 0.00 ? 13  TYR A CE2  8  
ATOM   4448  C  CZ   . TYR A 1 13 ? -9.954  -3.350  0.098   1.00 0.00 ? 13  TYR A CZ   8  
ATOM   4449  O  OH   . TYR A 1 13 ? -11.275 -3.671  -0.117  1.00 0.00 ? 13  TYR A OH   8  
ATOM   4450  H  H    . TYR A 1 13 ? -5.755  -5.047  0.295   1.00 0.00 ? 13  TYR A H    8  
ATOM   4451  H  HA   . TYR A 1 13 ? -4.659  -2.634  -0.992  1.00 0.00 ? 13  TYR A HA   8  
ATOM   4452  H  HB2  . TYR A 1 13 ? -5.620  -2.513  1.817   1.00 0.00 ? 13  TYR A HB2  8  
ATOM   4453  H  HB3  . TYR A 1 13 ? -5.705  -1.300  0.545   1.00 0.00 ? 13  TYR A HB3  8  
ATOM   4454  H  HD1  . TYR A 1 13 ? -7.273  -4.378  1.855   1.00 0.00 ? 13  TYR A HD1  8  
ATOM   4455  H  HD2  . TYR A 1 13 ? -7.630  -1.104  -0.838  1.00 0.00 ? 13  TYR A HD2  8  
ATOM   4456  H  HE1  . TYR A 1 13 ? -9.633  -4.958  1.472   1.00 0.00 ? 13  TYR A HE1  8  
ATOM   4457  H  HE2  . TYR A 1 13 ? -9.990  -1.673  -1.228  1.00 0.00 ? 13  TYR A HE2  8  
ATOM   4458  H  HH   . TYR A 1 13 ? -11.665 -3.034  -0.720  1.00 0.00 ? 13  TYR A HH   8  
ATOM   4459  N  N    . VAL A 1 14 ? -3.050  -4.587  0.699   1.00 0.00 ? 14  VAL A N    8  
ATOM   4460  C  CA   . VAL A 1 14 ? -1.802  -4.900  1.384   1.00 0.00 ? 14  VAL A CA   8  
ATOM   4461  C  C    . VAL A 1 14 ? -0.599  -4.416  0.582   1.00 0.00 ? 14  VAL A C    8  
ATOM   4462  O  O    . VAL A 1 14 ? -0.514  -4.638  -0.626  1.00 0.00 ? 14  VAL A O    8  
ATOM   4463  C  CB   . VAL A 1 14 ? -1.663  -6.414  1.633   1.00 0.00 ? 14  VAL A CB   8  
ATOM   4464  C  CG1  . VAL A 1 14 ? -0.383  -6.714  2.398   1.00 0.00 ? 14  VAL A CG1  8  
ATOM   4465  C  CG2  . VAL A 1 14 ? -2.877  -6.943  2.381   1.00 0.00 ? 14  VAL A CG2  8  
ATOM   4466  H  H    . VAL A 1 14 ? -3.536  -5.303  0.240   1.00 0.00 ? 14  VAL A H    8  
ATOM   4467  H  HA   . VAL A 1 14 ? -1.810  -4.398  2.340   1.00 0.00 ? 14  VAL A HA   8  
ATOM   4468  H  HB   . VAL A 1 14 ? -1.610  -6.912  0.677   1.00 0.00 ? 14  VAL A HB   8  
ATOM   4469  H  HG11 . VAL A 1 14 ? 0.025   -7.656  2.062   1.00 0.00 ? 14  VAL A HG11 8  
ATOM   4470  H  HG12 . VAL A 1 14 ? 0.335   -5.926  2.223   1.00 0.00 ? 14  VAL A HG12 8  
ATOM   4471  H  HG13 . VAL A 1 14 ? -0.601  -6.774  3.455   1.00 0.00 ? 14  VAL A HG13 8  
ATOM   4472  H  HG21 . VAL A 1 14 ? -2.917  -8.018  2.288   1.00 0.00 ? 14  VAL A HG21 8  
ATOM   4473  H  HG22 . VAL A 1 14 ? -2.803  -6.674  3.424   1.00 0.00 ? 14  VAL A HG22 8  
ATOM   4474  H  HG23 . VAL A 1 14 ? -3.775  -6.513  1.961   1.00 0.00 ? 14  VAL A HG23 8  
ATOM   4475  N  N    . CYS A 1 15 ? 0.331   -3.753  1.262   1.00 0.00 ? 15  CYS A N    8  
ATOM   4476  C  CA   . CYS A 1 15 ? 1.530   -3.237  0.614   1.00 0.00 ? 15  CYS A CA   8  
ATOM   4477  C  C    . CYS A 1 15 ? 2.359   -4.372  0.020   1.00 0.00 ? 15  CYS A C    8  
ATOM   4478  O  O    . CYS A 1 15 ? 2.828   -5.254  0.739   1.00 0.00 ? 15  CYS A O    8  
ATOM   4479  C  CB   . CYS A 1 15 ? 2.374   -2.444  1.614   1.00 0.00 ? 15  CYS A CB   8  
ATOM   4480  S  SG   . CYS A 1 15 ? 3.340   -1.093  0.866   1.00 0.00 ? 15  CYS A SG   8  
ATOM   4481  H  H    . CYS A 1 15 ? 0.207   -3.607  2.224   1.00 0.00 ? 15  CYS A H    8  
ATOM   4482  H  HA   . CYS A 1 15 ? 1.220   -2.579  -0.183  1.00 0.00 ? 15  CYS A HA   8  
ATOM   4483  H  HB2  . CYS A 1 15 ? 1.722   -2.008  2.358   1.00 0.00 ? 15  CYS A HB2  8  
ATOM   4484  H  HB3  . CYS A 1 15 ? 3.067   -3.114  2.100   1.00 0.00 ? 15  CYS A HB3  8  
ATOM   4485  N  N    . ASN A 1 16 ? 2.536   -4.342  -1.297  1.00 0.00 ? 16  ASN A N    8  
ATOM   4486  C  CA   . ASN A 1 16 ? 3.308   -5.368  -1.988  1.00 0.00 ? 16  ASN A CA   8  
ATOM   4487  C  C    . ASN A 1 16 ? 4.801   -5.060  -1.926  1.00 0.00 ? 16  ASN A C    8  
ATOM   4488  O  O    . ASN A 1 16 ? 5.582   -5.566  -2.731  1.00 0.00 ? 16  ASN A O    8  
ATOM   4489  C  CB   . ASN A 1 16 ? 2.858   -5.478  -3.446  1.00 0.00 ? 16  ASN A CB   8  
ATOM   4490  C  CG   . ASN A 1 16 ? 1.355   -5.622  -3.579  1.00 0.00 ? 16  ASN A CG   8  
ATOM   4491  O  OD1  . ASN A 1 16 ? 0.605   -4.679  -3.323  1.00 0.00 ? 16  ASN A OD1  8  
ATOM   4492  N  ND2  . ASN A 1 16 ? 0.906   -6.806  -3.980  1.00 0.00 ? 16  ASN A ND2  8  
ATOM   4493  H  H    . ASN A 1 16 ? 2.137   -3.613  -1.816  1.00 0.00 ? 16  ASN A H    8  
ATOM   4494  H  HA   . ASN A 1 16 ? 3.125   -6.310  -1.493  1.00 0.00 ? 16  ASN A HA   8  
ATOM   4495  H  HB2  . ASN A 1 16 ? 3.164   -4.589  -3.979  1.00 0.00 ? 16  ASN A HB2  8  
ATOM   4496  H  HB3  . ASN A 1 16 ? 3.325   -6.341  -3.897  1.00 0.00 ? 16  ASN A HB3  8  
ATOM   4497  H  HD21 . ASN A 1 16 ? 1.562   -7.510  -4.165  1.00 0.00 ? 16  ASN A HD21 8  
ATOM   4498  H  HD22 . ASN A 1 16 ? -0.062  -6.926  -4.075  1.00 0.00 ? 16  ASN A HD22 8  
ATOM   4499  N  N    . GLU A 1 17 ? 5.188   -4.228  -0.965  1.00 0.00 ? 17  GLU A N    8  
ATOM   4500  C  CA   . GLU A 1 17 ? 6.587   -3.852  -0.798  1.00 0.00 ? 17  GLU A CA   8  
ATOM   4501  C  C    . GLU A 1 17 ? 7.086   -4.217  0.597   1.00 0.00 ? 17  GLU A C    8  
ATOM   4502  O  O    . GLU A 1 17 ? 8.228   -4.646  0.769   1.00 0.00 ? 17  GLU A O    8  
ATOM   4503  C  CB   . GLU A 1 17 ? 6.768   -2.352  -1.041  1.00 0.00 ? 17  GLU A CB   8  
ATOM   4504  C  CG   . GLU A 1 17 ? 6.156   -1.869  -2.345  1.00 0.00 ? 17  GLU A CG   8  
ATOM   4505  C  CD   . GLU A 1 17 ? 7.109   -1.991  -3.518  1.00 0.00 ? 17  GLU A CD   8  
ATOM   4506  O  OE1  . GLU A 1 17 ? 7.811   -3.020  -3.608  1.00 0.00 ? 17  GLU A OE1  8  
ATOM   4507  O  OE2  . GLU A 1 17 ? 7.153   -1.057  -4.346  1.00 0.00 ? 17  GLU A OE2  8  
ATOM   4508  H  H    . GLU A 1 17 ? 4.518   -3.857  -0.354  1.00 0.00 ? 17  GLU A H    8  
ATOM   4509  H  HA   . GLU A 1 17 ? 7.166   -4.398  -1.528  1.00 0.00 ? 17  GLU A HA   8  
ATOM   4510  H  HB2  . GLU A 1 17 ? 6.309   -1.810  -0.228  1.00 0.00 ? 17  GLU A HB2  8  
ATOM   4511  H  HB3  . GLU A 1 17 ? 7.825   -2.128  -1.059  1.00 0.00 ? 17  GLU A HB3  8  
ATOM   4512  H  HG2  . GLU A 1 17 ? 5.275   -2.456  -2.554  1.00 0.00 ? 17  GLU A HG2  8  
ATOM   4513  H  HG3  . GLU A 1 17 ? 5.877   -0.831  -2.233  1.00 0.00 ? 17  GLU A HG3  8  
ATOM   4514  N  N    . CYS A 1 18 ? 6.223   -4.042  1.592   1.00 0.00 ? 18  CYS A N    8  
ATOM   4515  C  CA   . CYS A 1 18 ? 6.574   -4.351  2.973   1.00 0.00 ? 18  CYS A CA   8  
ATOM   4516  C  C    . CYS A 1 18 ? 5.624   -5.394  3.555   1.00 0.00 ? 18  CYS A C    8  
ATOM   4517  O  O    . CYS A 1 18 ? 6.023   -6.225  4.370   1.00 0.00 ? 18  CYS A O    8  
ATOM   4518  C  CB   . CYS A 1 18 ? 6.539   -3.081  3.826   1.00 0.00 ? 18  CYS A CB   8  
ATOM   4519  S  SG   . CYS A 1 18 ? 4.924   -2.238  3.838   1.00 0.00 ? 18  CYS A SG   8  
ATOM   4520  H  H    . CYS A 1 18 ? 5.327   -3.697  1.393   1.00 0.00 ? 18  CYS A H    8  
ATOM   4521  H  HA   . CYS A 1 18 ? 7.576   -4.751  2.979   1.00 0.00 ? 18  CYS A HA   8  
ATOM   4522  H  HB2  . CYS A 1 18 ? 6.783   -3.336  4.847   1.00 0.00 ? 18  CYS A HB2  8  
ATOM   4523  H  HB3  . CYS A 1 18 ? 7.272   -2.384  3.449   1.00 0.00 ? 18  CYS A HB3  8  
ATOM   4524  N  N    . GLY A 1 19 ? 4.366   -5.344  3.130   1.00 0.00 ? 19  GLY A N    8  
ATOM   4525  C  CA   . GLY A 1 19 ? 3.379   -6.289  3.619   1.00 0.00 ? 19  GLY A CA   8  
ATOM   4526  C  C    . GLY A 1 19 ? 2.380   -5.649  4.562   1.00 0.00 ? 19  GLY A C    8  
ATOM   4527  O  O    . GLY A 1 19 ? 1.697   -6.340  5.318   1.00 0.00 ? 19  GLY A O    8  
ATOM   4528  H  H    . GLY A 1 19 ? 4.105   -4.659  2.479   1.00 0.00 ? 19  GLY A H    8  
ATOM   4529  H  HA2  . GLY A 1 19 ? 2.848   -6.707  2.777   1.00 0.00 ? 19  GLY A HA2  8  
ATOM   4530  H  HA3  . GLY A 1 19 ? 3.889   -7.086  4.141   1.00 0.00 ? 19  GLY A HA3  8  
ATOM   4531  N  N    . LYS A 1 20 ? 2.294   -4.324  4.519   1.00 0.00 ? 20  LYS A N    8  
ATOM   4532  C  CA   . LYS A 1 20 ? 1.371   -3.588  5.376   1.00 0.00 ? 20  LYS A CA   8  
ATOM   4533  C  C    . LYS A 1 20 ? -0.070  -3.779  4.914   1.00 0.00 ? 20  LYS A C    8  
ATOM   4534  O  O    . LYS A 1 20 ? -0.460  -3.296  3.852   1.00 0.00 ? 20  LYS A O    8  
ATOM   4535  C  CB   . LYS A 1 20 ? 1.724   -2.099  5.380   1.00 0.00 ? 20  LYS A CB   8  
ATOM   4536  C  CG   . LYS A 1 20 ? 1.262   -1.368  6.629   1.00 0.00 ? 20  LYS A CG   8  
ATOM   4537  C  CD   . LYS A 1 20 ? 2.063   -1.788  7.849   1.00 0.00 ? 20  LYS A CD   8  
ATOM   4538  C  CE   . LYS A 1 20 ? 1.501   -1.175  9.123   1.00 0.00 ? 20  LYS A CE   8  
ATOM   4539  N  NZ   . LYS A 1 20 ? 0.233   -1.833  9.543   1.00 0.00 ? 20  LYS A NZ   8  
ATOM   4540  H  H    . LYS A 1 20 ? 2.865   -3.828  3.895   1.00 0.00 ? 20  LYS A H    8  
ATOM   4541  H  HA   . LYS A 1 20 ? 1.470   -3.976  6.379   1.00 0.00 ? 20  LYS A HA   8  
ATOM   4542  H  HB2  . LYS A 1 20 ? 2.796   -1.995  5.303   1.00 0.00 ? 20  LYS A HB2  8  
ATOM   4543  H  HB3  . LYS A 1 20 ? 1.263   -1.630  4.523   1.00 0.00 ? 20  LYS A HB3  8  
ATOM   4544  H  HG2  . LYS A 1 20 ? 1.384   -0.306  6.479   1.00 0.00 ? 20  LYS A HG2  8  
ATOM   4545  H  HG3  . LYS A 1 20 ? 0.218   -1.592  6.800   1.00 0.00 ? 20  LYS A HG3  8  
ATOM   4546  H  HD2  . LYS A 1 20 ? 2.032   -2.864  7.938   1.00 0.00 ? 20  LYS A HD2  8  
ATOM   4547  H  HD3  . LYS A 1 20 ? 3.087   -1.464  7.726   1.00 0.00 ? 20  LYS A HD3  8  
ATOM   4548  H  HE2  . LYS A 1 20 ? 2.231   -1.282  9.911   1.00 0.00 ? 20  LYS A HE2  8  
ATOM   4549  H  HE3  . LYS A 1 20 ? 1.312   -0.126  8.949   1.00 0.00 ? 20  LYS A HE3  8  
ATOM   4550  H  HZ1  . LYS A 1 20 ? -0.558  -1.162  9.471   1.00 0.00 ? 20  LYS A HZ1  8  
ATOM   4551  H  HZ2  . LYS A 1 20 ? 0.310   -2.159  10.528  1.00 0.00 ? 20  LYS A HZ2  8  
ATOM   4552  H  HZ3  . LYS A 1 20 ? 0.037   -2.652  8.933   1.00 0.00 ? 20  LYS A HZ3  8  
ATOM   4553  N  N    . ALA A 1 21 ? -0.856  -4.486  5.720   1.00 0.00 ? 21  ALA A N    8  
ATOM   4554  C  CA   . ALA A 1 21 ? -2.254  -4.737  5.395   1.00 0.00 ? 21  ALA A CA   8  
ATOM   4555  C  C    . ALA A 1 21 ? -3.152  -3.634  5.944   1.00 0.00 ? 21  ALA A C    8  
ATOM   4556  O  O    . ALA A 1 21 ? -2.975  -3.180  7.075   1.00 0.00 ? 21  ALA A O    8  
ATOM   4557  C  CB   . ALA A 1 21 ? -2.687  -6.091  5.937   1.00 0.00 ? 21  ALA A CB   8  
ATOM   4558  H  H    . ALA A 1 21 ? -0.487  -4.845  6.553   1.00 0.00 ? 21  ALA A H    8  
ATOM   4559  H  HA   . ALA A 1 21 ? -2.348  -4.761  4.319   1.00 0.00 ? 21  ALA A HA   8  
ATOM   4560  H  HB1  . ALA A 1 21 ? -3.764  -6.165  5.904   1.00 0.00 ? 21  ALA A HB1  8  
ATOM   4561  H  HB2  . ALA A 1 21 ? -2.253  -6.875  5.334   1.00 0.00 ? 21  ALA A HB2  8  
ATOM   4562  H  HB3  . ALA A 1 21 ? -2.351  -6.194  6.958   1.00 0.00 ? 21  ALA A HB3  8  
ATOM   4563  N  N    . PHE A 1 22 ? -4.117  -3.205  5.136   1.00 0.00 ? 22  PHE A N    8  
ATOM   4564  C  CA   . PHE A 1 22 ? -5.042  -2.153  5.541   1.00 0.00 ? 22  PHE A CA   8  
ATOM   4565  C  C    . PHE A 1 22 ? -6.488  -2.584  5.315   1.00 0.00 ? 22  PHE A C    8  
ATOM   4566  O  O    . PHE A 1 22 ? -6.755  -3.723  4.931   1.00 0.00 ? 22  PHE A O    8  
ATOM   4567  C  CB   . PHE A 1 22 ? -4.754  -0.866  4.765   1.00 0.00 ? 22  PHE A CB   8  
ATOM   4568  C  CG   . PHE A 1 22 ? -3.337  -0.387  4.902   1.00 0.00 ? 22  PHE A CG   8  
ATOM   4569  C  CD1  . PHE A 1 22 ? -2.968  0.430   5.958   1.00 0.00 ? 22  PHE A CD1  8  
ATOM   4570  C  CD2  . PHE A 1 22 ? -2.375  -0.755  3.976   1.00 0.00 ? 22  PHE A CD2  8  
ATOM   4571  C  CE1  . PHE A 1 22 ? -1.664  0.873   6.086   1.00 0.00 ? 22  PHE A CE1  8  
ATOM   4572  C  CE2  . PHE A 1 22 ? -1.070  -0.316  4.099   1.00 0.00 ? 22  PHE A CE2  8  
ATOM   4573  C  CZ   . PHE A 1 22 ? -0.714  0.498   5.156   1.00 0.00 ? 22  PHE A CZ   8  
ATOM   4574  H  H    . PHE A 1 22 ? -4.208  -3.606  4.246   1.00 0.00 ? 22  PHE A H    8  
ATOM   4575  H  HA   . PHE A 1 22 ? -4.894  -1.970  6.594   1.00 0.00 ? 22  PHE A HA   8  
ATOM   4576  H  HB2  . PHE A 1 22 ? -4.947  -1.036  3.717   1.00 0.00 ? 22  PHE A HB2  8  
ATOM   4577  H  HB3  . PHE A 1 22 ? -5.406  -0.084  5.125   1.00 0.00 ? 22  PHE A HB3  8  
ATOM   4578  H  HD1  . PHE A 1 22 ? -3.709  0.723   6.687   1.00 0.00 ? 22  PHE A HD1  8  
ATOM   4579  H  HD2  . PHE A 1 22 ? -2.653  -1.393  3.148   1.00 0.00 ? 22  PHE A HD2  8  
ATOM   4580  H  HE1  . PHE A 1 22 ? -1.389  1.509   6.914   1.00 0.00 ? 22  PHE A HE1  8  
ATOM   4581  H  HE2  . PHE A 1 22 ? -0.330  -0.611  3.370   1.00 0.00 ? 22  PHE A HE2  8  
ATOM   4582  H  HZ   . PHE A 1 22 ? 0.304   0.843   5.254   1.00 0.00 ? 22  PHE A HZ   8  
ATOM   4583  N  N    . ARG A 1 23 ? -7.418  -1.666  5.557   1.00 0.00 ? 23  ARG A N    8  
ATOM   4584  C  CA   . ARG A 1 23 ? -8.837  -1.950  5.383   1.00 0.00 ? 23  ARG A CA   8  
ATOM   4585  C  C    . ARG A 1 23 ? -9.325  -1.464  4.022   1.00 0.00 ? 23  ARG A C    8  
ATOM   4586  O  O    . ARG A 1 23 ? -10.177 -2.093  3.395   1.00 0.00 ? 23  ARG A O    8  
ATOM   4587  C  CB   . ARG A 1 23 ? -9.652  -1.289  6.495   1.00 0.00 ? 23  ARG A CB   8  
ATOM   4588  C  CG   . ARG A 1 23 ? -9.455  -1.931  7.859   1.00 0.00 ? 23  ARG A CG   8  
ATOM   4589  C  CD   . ARG A 1 23 ? -10.201 -3.251  7.966   1.00 0.00 ? 23  ARG A CD   8  
ATOM   4590  N  NE   . ARG A 1 23 ? -11.632 -3.092  7.722   1.00 0.00 ? 23  ARG A NE   8  
ATOM   4591  C  CZ   . ARG A 1 23 ? -12.466 -4.112  7.546   1.00 0.00 ? 23  ARG A CZ   8  
ATOM   4592  N  NH1  . ARG A 1 23 ? -12.013 -5.357  7.588   1.00 0.00 ? 23  ARG A NH1  8  
ATOM   4593  N  NH2  . ARG A 1 23 ? -13.755 -3.886  7.329   1.00 0.00 ? 23  ARG A NH2  8  
ATOM   4594  H  H    . ARG A 1 23 ? -7.143  -0.775  5.862   1.00 0.00 ? 23  ARG A H    8  
ATOM   4595  H  HA   . ARG A 1 23 ? -8.970  -3.020  5.438   1.00 0.00 ? 23  ARG A HA   8  
ATOM   4596  H  HB2  . ARG A 1 23 ? -9.366  -0.250  6.567   1.00 0.00 ? 23  ARG A HB2  8  
ATOM   4597  H  HB3  . ARG A 1 23 ? -10.700 -1.349  6.241   1.00 0.00 ? 23  ARG A HB3  8  
ATOM   4598  H  HG2  . ARG A 1 23 ? -8.401  -2.112  8.012   1.00 0.00 ? 23  ARG A HG2  8  
ATOM   4599  H  HG3  . ARG A 1 23 ? -9.820  -1.257  8.620   1.00 0.00 ? 23  ARG A HG3  8  
ATOM   4600  H  HD2  . ARG A 1 23 ? -9.796  -3.939  7.239   1.00 0.00 ? 23  ARG A HD2  8  
ATOM   4601  H  HD3  . ARG A 1 23 ? -10.057 -3.651  8.959   1.00 0.00 ? 23  ARG A HD3  8  
ATOM   4602  H  HE   . ARG A 1 23 ? -11.989 -2.180  7.688   1.00 0.00 ? 23  ARG A HE   8  
ATOM   4603  H  HH11 . ARG A 1 23 ? -11.042 -5.530  7.752   1.00 0.00 ? 23  ARG A HH11 8  
ATOM   4604  H  HH12 . ARG A 1 23 ? -12.643 -6.123  7.456   1.00 0.00 ? 23  ARG A HH12 8  
ATOM   4605  H  HH21 . ARG A 1 23 ? -14.100 -2.949  7.298   1.00 0.00 ? 23  ARG A HH21 8  
ATOM   4606  H  HH22 . ARG A 1 23 ? -14.381 -4.654  7.197   1.00 0.00 ? 23  ARG A HH22 8  
ATOM   4607  N  N    . SER A 1 24 ? -8.780  -0.339  3.570   1.00 0.00 ? 24  SER A N    8  
ATOM   4608  C  CA   . SER A 1 24 ? -9.163  0.235   2.286   1.00 0.00 ? 24  SER A CA   8  
ATOM   4609  C  C    . SER A 1 24 ? -7.931  0.632   1.479   1.00 0.00 ? 24  SER A C    8  
ATOM   4610  O  O    . SER A 1 24 ? -6.816  0.669   2.001   1.00 0.00 ? 24  SER A O    8  
ATOM   4611  C  CB   . SER A 1 24 ? -10.063 1.454   2.496   1.00 0.00 ? 24  SER A CB   8  
ATOM   4612  O  OG   . SER A 1 24 ? -9.315  2.568   2.950   1.00 0.00 ? 24  SER A OG   8  
ATOM   4613  H  H    . SER A 1 24 ? -8.105  0.118   4.116   1.00 0.00 ? 24  SER A H    8  
ATOM   4614  H  HA   . SER A 1 24 ? -9.711  -0.516  1.737   1.00 0.00 ? 24  SER A HA   8  
ATOM   4615  H  HB2  . SER A 1 24 ? -10.539 1.712   1.562   1.00 0.00 ? 24  SER A HB2  8  
ATOM   4616  H  HB3  . SER A 1 24 ? -10.818 1.218   3.231   1.00 0.00 ? 24  SER A HB3  8  
ATOM   4617  H  HG   . SER A 1 24 ? -9.142  3.160   2.214   1.00 0.00 ? 24  SER A HG   8  
ATOM   4618  N  N    . LYS A 1 25 ? -8.139  0.928   0.200   1.00 0.00 ? 25  LYS A N    8  
ATOM   4619  C  CA   . LYS A 1 25 ? -7.047  1.324   -0.682  1.00 0.00 ? 25  LYS A CA   8  
ATOM   4620  C  C    . LYS A 1 25 ? -6.491  2.687   -0.282  1.00 0.00 ? 25  LYS A C    8  
ATOM   4621  O  O    . LYS A 1 25 ? -5.278  2.896   -0.278  1.00 0.00 ? 25  LYS A O    8  
ATOM   4622  C  CB   . LYS A 1 25 ? -7.526  1.363   -2.135  1.00 0.00 ? 25  LYS A CB   8  
ATOM   4623  C  CG   . LYS A 1 25 ? -6.399  1.275   -3.149  1.00 0.00 ? 25  LYS A CG   8  
ATOM   4624  C  CD   . LYS A 1 25 ? -6.928  1.016   -4.550  1.00 0.00 ? 25  LYS A CD   8  
ATOM   4625  C  CE   . LYS A 1 25 ? -7.432  2.295   -5.201  1.00 0.00 ? 25  LYS A CE   8  
ATOM   4626  N  NZ   . LYS A 1 25 ? -7.740  2.099   -6.644  1.00 0.00 ? 25  LYS A NZ   8  
ATOM   4627  H  H    . LYS A 1 25 ? -9.050  0.880   -0.159  1.00 0.00 ? 25  LYS A H    8  
ATOM   4628  H  HA   . LYS A 1 25 ? -6.263  0.588   -0.590  1.00 0.00 ? 25  LYS A HA   8  
ATOM   4629  H  HB2  . LYS A 1 25 ? -8.198  0.534   -2.302  1.00 0.00 ? 25  LYS A HB2  8  
ATOM   4630  H  HB3  . LYS A 1 25 ? -8.060  2.287   -2.300  1.00 0.00 ? 25  LYS A HB3  8  
ATOM   4631  H  HG2  . LYS A 1 25 ? -5.853  2.207   -3.149  1.00 0.00 ? 25  LYS A HG2  8  
ATOM   4632  H  HG3  . LYS A 1 25 ? -5.737  0.468   -2.869  1.00 0.00 ? 25  LYS A HG3  8  
ATOM   4633  H  HD2  . LYS A 1 25 ? -6.134  0.606   -5.155  1.00 0.00 ? 25  LYS A HD2  8  
ATOM   4634  H  HD3  . LYS A 1 25 ? -7.742  0.307   -4.492  1.00 0.00 ? 25  LYS A HD3  8  
ATOM   4635  H  HE2  . LYS A 1 25 ? -8.327  2.615   -4.690  1.00 0.00 ? 25  LYS A HE2  8  
ATOM   4636  H  HE3  . LYS A 1 25 ? -6.671  3.056   -5.104  1.00 0.00 ? 25  LYS A HE3  8  
ATOM   4637  H  HZ1  . LYS A 1 25 ? -7.517  2.962   -7.178  1.00 0.00 ? 25  LYS A HZ1  8  
ATOM   4638  H  HZ2  . LYS A 1 25 ? -8.749  1.878   -6.767  1.00 0.00 ? 25  LYS A HZ2  8  
ATOM   4639  H  HZ3  . LYS A 1 25 ? -7.177  1.312   -7.026  1.00 0.00 ? 25  LYS A HZ3  8  
ATOM   4640  N  N    . SER A 1 26 ? -7.386  3.610   0.056   1.00 0.00 ? 26  SER A N    8  
ATOM   4641  C  CA   . SER A 1 26 ? -6.985  4.954   0.456   1.00 0.00 ? 26  SER A CA   8  
ATOM   4642  C  C    . SER A 1 26 ? -5.956  4.901   1.581   1.00 0.00 ? 26  SER A C    8  
ATOM   4643  O  O    . SER A 1 26 ? -5.067  5.749   1.664   1.00 0.00 ? 26  SER A O    8  
ATOM   4644  C  CB   . SER A 1 26 ? -8.205  5.761   0.902   1.00 0.00 ? 26  SER A CB   8  
ATOM   4645  O  OG   . SER A 1 26 ? -8.005  7.148   0.686   1.00 0.00 ? 26  SER A OG   8  
ATOM   4646  H  H    . SER A 1 26 ? -8.339  3.382   0.033   1.00 0.00 ? 26  SER A H    8  
ATOM   4647  H  HA   . SER A 1 26 ? -6.539  5.435   -0.402  1.00 0.00 ? 26  SER A HA   8  
ATOM   4648  H  HB2  . SER A 1 26 ? -9.070  5.443   0.340   1.00 0.00 ? 26  SER A HB2  8  
ATOM   4649  H  HB3  . SER A 1 26 ? -8.378  5.594   1.955   1.00 0.00 ? 26  SER A HB3  8  
ATOM   4650  H  HG   . SER A 1 26 ? -7.068  7.349   0.742   1.00 0.00 ? 26  SER A HG   8  
ATOM   4651  N  N    . TYR A 1 27 ? -6.084  3.900   2.445   1.00 0.00 ? 27  TYR A N    8  
ATOM   4652  C  CA   . TYR A 1 27 ? -5.168  3.737   3.567   1.00 0.00 ? 27  TYR A CA   8  
ATOM   4653  C  C    . TYR A 1 27 ? -3.801  3.257   3.090   1.00 0.00 ? 27  TYR A C    8  
ATOM   4654  O  O    . TYR A 1 27 ? -2.767  3.650   3.632   1.00 0.00 ? 27  TYR A O    8  
ATOM   4655  C  CB   . TYR A 1 27 ? -5.743  2.748   4.582   1.00 0.00 ? 27  TYR A CB   8  
ATOM   4656  C  CG   . TYR A 1 27 ? -5.326  3.032   6.008   1.00 0.00 ? 27  TYR A CG   8  
ATOM   4657  C  CD1  . TYR A 1 27 ? -3.986  3.031   6.374   1.00 0.00 ? 27  TYR A CD1  8  
ATOM   4658  C  CD2  . TYR A 1 27 ? -6.273  3.300   6.989   1.00 0.00 ? 27  TYR A CD2  8  
ATOM   4659  C  CE1  . TYR A 1 27 ? -3.601  3.290   7.675   1.00 0.00 ? 27  TYR A CE1  8  
ATOM   4660  C  CE2  . TYR A 1 27 ? -5.897  3.561   8.292   1.00 0.00 ? 27  TYR A CE2  8  
ATOM   4661  C  CZ   . TYR A 1 27 ? -4.560  3.554   8.630   1.00 0.00 ? 27  TYR A CZ   8  
ATOM   4662  O  OH   . TYR A 1 27 ? -4.181  3.812   9.928   1.00 0.00 ? 27  TYR A OH   8  
ATOM   4663  H  H    . TYR A 1 27 ? -6.813  3.256   2.326   1.00 0.00 ? 27  TYR A H    8  
ATOM   4664  H  HA   . TYR A 1 27 ? -5.053  4.700   4.044   1.00 0.00 ? 27  TYR A HA   8  
ATOM   4665  H  HB2  . TYR A 1 27 ? -6.820  2.783   4.539   1.00 0.00 ? 27  TYR A HB2  8  
ATOM   4666  H  HB3  . TYR A 1 27 ? -5.410  1.751   4.331   1.00 0.00 ? 27  TYR A HB3  8  
ATOM   4667  H  HD1  . TYR A 1 27 ? -3.237  2.824   5.623   1.00 0.00 ? 27  TYR A HD1  8  
ATOM   4668  H  HD2  . TYR A 1 27 ? -7.320  3.304   6.720   1.00 0.00 ? 27  TYR A HD2  8  
ATOM   4669  H  HE1  . TYR A 1 27 ? -2.554  3.285   7.940   1.00 0.00 ? 27  TYR A HE1  8  
ATOM   4670  H  HE2  . TYR A 1 27 ? -6.648  3.767   9.040   1.00 0.00 ? 27  TYR A HE2  8  
ATOM   4671  H  HH   . TYR A 1 27 ? -4.904  4.240   10.393  1.00 0.00 ? 27  TYR A HH   8  
ATOM   4672  N  N    . LEU A 1 28 ? -3.804  2.406   2.070   1.00 0.00 ? 28  LEU A N    8  
ATOM   4673  C  CA   . LEU A 1 28 ? -2.564  1.871   1.517   1.00 0.00 ? 28  LEU A CA   8  
ATOM   4674  C  C    . LEU A 1 28 ? -1.865  2.908   0.644   1.00 0.00 ? 28  LEU A C    8  
ATOM   4675  O  O    . LEU A 1 28 ? -0.647  2.868   0.471   1.00 0.00 ? 28  LEU A O    8  
ATOM   4676  C  CB   . LEU A 1 28 ? -2.850  0.609   0.700   1.00 0.00 ? 28  LEU A CB   8  
ATOM   4677  C  CG   . LEU A 1 28 ? -1.768  0.197   -0.299  1.00 0.00 ? 28  LEU A CG   8  
ATOM   4678  C  CD1  . LEU A 1 28 ? -0.617  -0.493  0.416   1.00 0.00 ? 28  LEU A CD1  8  
ATOM   4679  C  CD2  . LEU A 1 28 ? -2.351  -0.709  -1.373  1.00 0.00 ? 28  LEU A CD2  8  
ATOM   4680  H  H    . LEU A 1 28 ? -4.659  2.129   1.680   1.00 0.00 ? 28  LEU A H    8  
ATOM   4681  H  HA   . LEU A 1 28 ? -1.916  1.616   2.342   1.00 0.00 ? 28  LEU A HA   8  
ATOM   4682  H  HB2  . LEU A 1 28 ? -2.990  -0.207  1.391   1.00 0.00 ? 28  LEU A HB2  8  
ATOM   4683  H  HB3  . LEU A 1 28 ? -3.765  0.774   0.149   1.00 0.00 ? 28  LEU A HB3  8  
ATOM   4684  H  HG   . LEU A 1 28 ? -1.378  1.082   -0.783  1.00 0.00 ? 28  LEU A HG   8  
ATOM   4685  H  HD11 . LEU A 1 28 ? 0.264   0.129   0.363   1.00 0.00 ? 28  LEU A HD11 8  
ATOM   4686  H  HD12 . LEU A 1 28 ? -0.416  -1.442  -0.059  1.00 0.00 ? 28  LEU A HD12 8  
ATOM   4687  H  HD13 . LEU A 1 28 ? -0.882  -0.657  1.450   1.00 0.00 ? 28  LEU A HD13 8  
ATOM   4688  H  HD21 . LEU A 1 28 ? -3.209  -0.230  -1.822  1.00 0.00 ? 28  LEU A HD21 8  
ATOM   4689  H  HD22 . LEU A 1 28 ? -2.654  -1.645  -0.928  1.00 0.00 ? 28  LEU A HD22 8  
ATOM   4690  H  HD23 . LEU A 1 28 ? -1.604  -0.895  -2.131  1.00 0.00 ? 28  LEU A HD23 8  
ATOM   4691  N  N    . ILE A 1 29 ? -2.644  3.836   0.099   1.00 0.00 ? 29  ILE A N    8  
ATOM   4692  C  CA   . ILE A 1 29 ? -2.099  4.886   -0.752  1.00 0.00 ? 29  ILE A CA   8  
ATOM   4693  C  C    . ILE A 1 29 ? -1.361  5.935   0.072   1.00 0.00 ? 29  ILE A C    8  
ATOM   4694  O  O    . ILE A 1 29 ? -0.247  6.335   -0.267  1.00 0.00 ? 29  ILE A O    8  
ATOM   4695  C  CB   . ILE A 1 29 ? -3.205  5.578   -1.571  1.00 0.00 ? 29  ILE A CB   8  
ATOM   4696  C  CG1  . ILE A 1 29 ? -3.841  4.588   -2.549  1.00 0.00 ? 29  ILE A CG1  8  
ATOM   4697  C  CG2  . ILE A 1 29 ? -2.639  6.778   -2.317  1.00 0.00 ? 29  ILE A CG2  8  
ATOM   4698  C  CD1  . ILE A 1 29 ? -5.262  4.942   -2.929  1.00 0.00 ? 29  ILE A CD1  8  
ATOM   4699  H  H    . ILE A 1 29 ? -3.608  3.815   0.274   1.00 0.00 ? 29  ILE A H    8  
ATOM   4700  H  HA   . ILE A 1 29 ? -1.402  4.429   -1.440  1.00 0.00 ? 29  ILE A HA   8  
ATOM   4701  H  HB   . ILE A 1 29 ? -3.960  5.933   -0.887  1.00 0.00 ? 29  ILE A HB   8  
ATOM   4702  H  HG12 . ILE A 1 29 ? -3.254  4.556   -3.453  1.00 0.00 ? 29  ILE A HG12 8  
ATOM   4703  H  HG13 . ILE A 1 29 ? -3.852  3.606   -2.098  1.00 0.00 ? 29  ILE A HG13 8  
ATOM   4704  H  HG21 . ILE A 1 29 ? -3.092  7.682   -1.939  1.00 0.00 ? 29  ILE A HG21 8  
ATOM   4705  H  HG22 . ILE A 1 29 ? -1.571  6.822   -2.170  1.00 0.00 ? 29  ILE A HG22 8  
ATOM   4706  H  HG23 . ILE A 1 29 ? -2.854  6.681   -3.371  1.00 0.00 ? 29  ILE A HG23 8  
ATOM   4707  H  HD11 . ILE A 1 29 ? -5.931  4.643   -2.135  1.00 0.00 ? 29  ILE A HD11 8  
ATOM   4708  H  HD12 . ILE A 1 29 ? -5.339  6.008   -3.081  1.00 0.00 ? 29  ILE A HD12 8  
ATOM   4709  H  HD13 . ILE A 1 29 ? -5.531  4.427   -3.838  1.00 0.00 ? 29  ILE A HD13 8  
ATOM   4710  N  N    . ILE A 1 30 ? -1.989  6.375   1.158   1.00 0.00 ? 30  ILE A N    8  
ATOM   4711  C  CA   . ILE A 1 30 ? -1.390  7.376   2.033   1.00 0.00 ? 30  ILE A CA   8  
ATOM   4712  C  C    . ILE A 1 30 ? -0.165  6.818   2.749   1.00 0.00 ? 30  ILE A C    8  
ATOM   4713  O  O    . ILE A 1 30 ? 0.632   7.567   3.314   1.00 0.00 ? 30  ILE A O    8  
ATOM   4714  C  CB   . ILE A 1 30 ? -2.398  7.881   3.082   1.00 0.00 ? 30  ILE A CB   8  
ATOM   4715  C  CG1  . ILE A 1 30 ? -2.888  6.720   3.950   1.00 0.00 ? 30  ILE A CG1  8  
ATOM   4716  C  CG2  . ILE A 1 30 ? -3.570  8.572   2.401   1.00 0.00 ? 30  ILE A CG2  8  
ATOM   4717  C  CD1  . ILE A 1 30 ? -1.983  6.420   5.124   1.00 0.00 ? 30  ILE A CD1  8  
ATOM   4718  H  H    . ILE A 1 30 ? -2.875  6.018   1.375   1.00 0.00 ? 30  ILE A H    8  
ATOM   4719  H  HA   . ILE A 1 30 ? -1.087  8.214   1.422   1.00 0.00 ? 30  ILE A HA   8  
ATOM   4720  H  HB   . ILE A 1 30 ? -1.899  8.604   3.709   1.00 0.00 ? 30  ILE A HB   8  
ATOM   4721  H  HG12 . ILE A 1 30 ? -3.866  6.957   4.339   1.00 0.00 ? 30  ILE A HG12 8  
ATOM   4722  H  HG13 . ILE A 1 30 ? -2.953  5.829   3.343   1.00 0.00 ? 30  ILE A HG13 8  
ATOM   4723  H  HG21 . ILE A 1 30 ? -3.378  8.644   1.341   1.00 0.00 ? 30  ILE A HG21 8  
ATOM   4724  H  HG22 . ILE A 1 30 ? -4.470  7.999   2.565   1.00 0.00 ? 30  ILE A HG22 8  
ATOM   4725  H  HG23 . ILE A 1 30 ? -3.693  9.562   2.813   1.00 0.00 ? 30  ILE A HG23 8  
ATOM   4726  H  HD11 . ILE A 1 30 ? -1.719  7.343   5.621   1.00 0.00 ? 30  ILE A HD11 8  
ATOM   4727  H  HD12 . ILE A 1 30 ? -2.497  5.773   5.820   1.00 0.00 ? 30  ILE A HD12 8  
ATOM   4728  H  HD13 . ILE A 1 30 ? -1.087  5.932   4.773   1.00 0.00 ? 30  ILE A HD13 8  
ATOM   4729  N  N    . HIS A 1 31 ? -0.020  5.497   2.719   1.00 0.00 ? 31  HIS A N    8  
ATOM   4730  C  CA   . HIS A 1 31 ? 1.111   4.837   3.363   1.00 0.00 ? 31  HIS A CA   8  
ATOM   4731  C  C    . HIS A 1 31 ? 2.243   4.603   2.367   1.00 0.00 ? 31  HIS A C    8  
ATOM   4732  O  O    . HIS A 1 31 ? 3.380   5.017   2.594   1.00 0.00 ? 31  HIS A O    8  
ATOM   4733  C  CB   . HIS A 1 31 ? 0.671   3.507   3.976   1.00 0.00 ? 31  HIS A CB   8  
ATOM   4734  C  CG   . HIS A 1 31 ? 1.776   2.501   4.079   1.00 0.00 ? 31  HIS A CG   8  
ATOM   4735  N  ND1  . HIS A 1 31 ? 2.503   2.298   5.233   1.00 0.00 ? 31  HIS A ND1  8  
ATOM   4736  C  CD2  . HIS A 1 31 ? 2.275   1.637   3.164   1.00 0.00 ? 31  HIS A CD2  8  
ATOM   4737  C  CE1  . HIS A 1 31 ? 3.403   1.354   5.023   1.00 0.00 ? 31  HIS A CE1  8  
ATOM   4738  N  NE2  . HIS A 1 31 ? 3.285   0.936   3.776   1.00 0.00 ? 31  HIS A NE2  8  
ATOM   4739  H  H    . HIS A 1 31 ? -0.688  4.953   2.253   1.00 0.00 ? 31  HIS A H    8  
ATOM   4740  H  HA   . HIS A 1 31 ? 1.468   5.485   4.149   1.00 0.00 ? 31  HIS A HA   8  
ATOM   4741  H  HB2  . HIS A 1 31 ? 0.291   3.685   4.971   1.00 0.00 ? 31  HIS A HB2  8  
ATOM   4742  H  HB3  . HIS A 1 31 ? -0.113  3.079   3.367   1.00 0.00 ? 31  HIS A HB3  8  
ATOM   4743  H  HD1  . HIS A 1 31 ? 2.379   2.775   6.079   1.00 0.00 ? 31  HIS A HD1  8  
ATOM   4744  H  HD2  . HIS A 1 31 ? 1.942   1.521   2.143   1.00 0.00 ? 31  HIS A HD2  8  
ATOM   4745  H  HE1  . HIS A 1 31 ? 4.113   0.985   5.748   1.00 0.00 ? 31  HIS A HE1  8  
ATOM   4746  N  N    . THR A 1 32 ? 1.924   3.935   1.263   1.00 0.00 ? 32  THR A N    8  
ATOM   4747  C  CA   . THR A 1 32 ? 2.913   3.643   0.233   1.00 0.00 ? 32  THR A CA   8  
ATOM   4748  C  C    . THR A 1 32 ? 3.770   4.868   -0.069  1.00 0.00 ? 32  THR A C    8  
ATOM   4749  O  O    . THR A 1 32 ? 4.874   4.749   -0.599  1.00 0.00 ? 32  THR A O    8  
ATOM   4750  C  CB   . THR A 1 32 ? 2.245   3.165   -1.069  1.00 0.00 ? 32  THR A CB   8  
ATOM   4751  O  OG1  . THR A 1 32 ? 3.218   2.553   -1.923  1.00 0.00 ? 32  THR A OG1  8  
ATOM   4752  C  CG2  . THR A 1 32 ? 1.583   4.325   -1.796  1.00 0.00 ? 32  THR A CG2  8  
ATOM   4753  H  H    . THR A 1 32 ? 1.001   3.631   1.139   1.00 0.00 ? 32  THR A H    8  
ATOM   4754  H  HA   . THR A 1 32 ? 3.551   2.851   0.598   1.00 0.00 ? 32  THR A HA   8  
ATOM   4755  H  HB   . THR A 1 32 ? 1.487   2.436   -0.820  1.00 0.00 ? 32  THR A HB   8  
ATOM   4756  H  HG1  . THR A 1 32 ? 4.088   2.630   -1.524  1.00 0.00 ? 32  THR A HG1  8  
ATOM   4757  H  HG21 . THR A 1 32 ? 1.326   4.022   -2.800  1.00 0.00 ? 32  THR A HG21 8  
ATOM   4758  H  HG22 . THR A 1 32 ? 2.266   5.161   -1.837  1.00 0.00 ? 32  THR A HG22 8  
ATOM   4759  H  HG23 . THR A 1 32 ? 0.688   4.617   -1.268  1.00 0.00 ? 32  THR A HG23 8  
ATOM   4760  N  N    . ARG A 1 33 ? 3.253   6.044   0.272   1.00 0.00 ? 33  ARG A N    8  
ATOM   4761  C  CA   . ARG A 1 33 ? 3.971   7.291   0.037   1.00 0.00 ? 33  ARG A CA   8  
ATOM   4762  C  C    . ARG A 1 33 ? 4.954   7.575   1.169   1.00 0.00 ? 33  ARG A C    8  
ATOM   4763  O  O    . ARG A 1 33 ? 6.039   8.112   0.944   1.00 0.00 ? 33  ARG A O    8  
ATOM   4764  C  CB   . ARG A 1 33 ? 2.986   8.453   -0.101  1.00 0.00 ? 33  ARG A CB   8  
ATOM   4765  C  CG   . ARG A 1 33 ? 2.101   8.650   1.120   1.00 0.00 ? 33  ARG A CG   8  
ATOM   4766  C  CD   . ARG A 1 33 ? 1.040   9.711   0.874   1.00 0.00 ? 33  ARG A CD   8  
ATOM   4767  N  NE   . ARG A 1 33 ? 1.603   11.059  0.875   1.00 0.00 ? 33  ARG A NE   8  
ATOM   4768  C  CZ   . ARG A 1 33 ? 2.151   11.628  -0.193  1.00 0.00 ? 33  ARG A CZ   8  
ATOM   4769  N  NH1  . ARG A 1 33 ? 2.208   10.970  -1.342  1.00 0.00 ? 33  ARG A NH1  8  
ATOM   4770  N  NH2  . ARG A 1 33 ? 2.642   12.858  -0.113  1.00 0.00 ? 33  ARG A NH2  8  
ATOM   4771  H  H    . ARG A 1 33 ? 2.368   6.074   0.692   1.00 0.00 ? 33  ARG A H    8  
ATOM   4772  H  HA   . ARG A 1 33 ? 4.522   7.187   -0.885  1.00 0.00 ? 33  ARG A HA   8  
ATOM   4773  H  HB2  . ARG A 1 33 ? 3.542   9.364   -0.265  1.00 0.00 ? 33  ARG A HB2  8  
ATOM   4774  H  HB3  . ARG A 1 33 ? 2.349   8.271   -0.954  1.00 0.00 ? 33  ARG A HB3  8  
ATOM   4775  H  HG2  . ARG A 1 33 ? 1.612   7.715   1.353   1.00 0.00 ? 33  ARG A HG2  8  
ATOM   4776  H  HG3  . ARG A 1 33 ? 2.717   8.955   1.953   1.00 0.00 ? 33  ARG A HG3  8  
ATOM   4777  H  HD2  . ARG A 1 33 ? 0.579   9.525   -0.085  1.00 0.00 ? 33  ARG A HD2  8  
ATOM   4778  H  HD3  . ARG A 1 33 ? 0.294   9.642   1.651   1.00 0.00 ? 33  ARG A HD3  8  
ATOM   4779  H  HE   . ARG A 1 33 ? 1.571   11.563  1.715   1.00 0.00 ? 33  ARG A HE   8  
ATOM   4780  H  HH11 . ARG A 1 33 ? 1.838   10.043  -1.406  1.00 0.00 ? 33  ARG A HH11 8  
ATOM   4781  H  HH12 . ARG A 1 33 ? 2.620   11.401  -2.146  1.00 0.00 ? 33  ARG A HH12 8  
ATOM   4782  H  HH21 . ARG A 1 33 ? 2.600   13.357  0.752   1.00 0.00 ? 33  ARG A HH21 8  
ATOM   4783  H  HH22 . ARG A 1 33 ? 3.053   13.285  -0.917  1.00 0.00 ? 33  ARG A HH22 8  
ATOM   4784  N  N    . THR A 1 34 ? 4.566   7.211   2.388   1.00 0.00 ? 34  THR A N    8  
ATOM   4785  C  CA   . THR A 1 34 ? 5.411   7.428   3.555   1.00 0.00 ? 34  THR A CA   8  
ATOM   4786  C  C    . THR A 1 34 ? 6.783   6.790   3.367   1.00 0.00 ? 34  THR A C    8  
ATOM   4787  O  O    . THR A 1 34 ? 7.783   7.279   3.892   1.00 0.00 ? 34  THR A O    8  
ATOM   4788  C  CB   . THR A 1 34 ? 4.763   6.858   4.831   1.00 0.00 ? 34  THR A CB   8  
ATOM   4789  O  OG1  . THR A 1 34 ? 5.228   7.576   5.979   1.00 0.00 ? 34  THR A OG1  8  
ATOM   4790  C  CG2  . THR A 1 34 ? 5.085   5.379   4.987   1.00 0.00 ? 34  THR A CG2  8  
ATOM   4791  H  H    . THR A 1 34 ? 3.690   6.788   2.503   1.00 0.00 ? 34  THR A H    8  
ATOM   4792  H  HA   . THR A 1 34 ? 5.534   8.493   3.684   1.00 0.00 ? 34  THR A HA   8  
ATOM   4793  H  HB   . THR A 1 34 ? 3.691   6.972   4.754   1.00 0.00 ? 34  THR A HB   8  
ATOM   4794  H  HG1  . THR A 1 34 ? 4.493   7.737   6.576   1.00 0.00 ? 34  THR A HG1  8  
ATOM   4795  H  HG21 . THR A 1 34 ? 6.081   5.268   5.387   1.00 0.00 ? 34  THR A HG21 8  
ATOM   4796  H  HG22 . THR A 1 34 ? 5.028   4.895   4.023   1.00 0.00 ? 34  THR A HG22 8  
ATOM   4797  H  HG23 . THR A 1 34 ? 4.373   4.925   5.661   1.00 0.00 ? 34  THR A HG23 8  
ATOM   4798  N  N    . HIS A 1 35 ? 6.823   5.696   2.613   1.00 0.00 ? 35  HIS A N    8  
ATOM   4799  C  CA   . HIS A 1 35 ? 8.074   4.992   2.354   1.00 0.00 ? 35  HIS A CA   8  
ATOM   4800  C  C    . HIS A 1 35 ? 9.173   5.968   1.946   1.00 0.00 ? 35  HIS A C    8  
ATOM   4801  O  O    . HIS A 1 35 ? 10.361  5.657   2.036   1.00 0.00 ? 35  HIS A O    8  
ATOM   4802  C  CB   . HIS A 1 35 ? 7.876   3.942   1.260   1.00 0.00 ? 35  HIS A CB   8  
ATOM   4803  C  CG   . HIS A 1 35 ? 7.362   2.632   1.773   1.00 0.00 ? 35  HIS A CG   8  
ATOM   4804  N  ND1  . HIS A 1 35 ? 7.978   1.927   2.786   1.00 0.00 ? 35  HIS A ND1  8  
ATOM   4805  C  CD2  . HIS A 1 35 ? 6.284   1.900   1.408   1.00 0.00 ? 35  HIS A CD2  8  
ATOM   4806  C  CE1  . HIS A 1 35 ? 7.301   0.817   3.021   1.00 0.00 ? 35  HIS A CE1  8  
ATOM   4807  N  NE2  . HIS A 1 35 ? 6.268   0.777   2.199   1.00 0.00 ? 35  HIS A NE2  8  
ATOM   4808  H  H    . HIS A 1 35 ? 5.992   5.355   2.222   1.00 0.00 ? 35  HIS A H    8  
ATOM   4809  H  HA   . HIS A 1 35 ? 8.371   4.497   3.266   1.00 0.00 ? 35  HIS A HA   8  
ATOM   4810  H  HB2  . HIS A 1 35 ? 7.166   4.316   0.537   1.00 0.00 ? 35  HIS A HB2  8  
ATOM   4811  H  HB3  . HIS A 1 35 ? 8.821   3.760   0.770   1.00 0.00 ? 35  HIS A HB3  8  
ATOM   4812  H  HD1  . HIS A 1 35 ? 8.790   2.199   3.261   1.00 0.00 ? 35  HIS A HD1  8  
ATOM   4813  H  HD2  . HIS A 1 35 ? 5.568   2.151   0.638   1.00 0.00 ? 35  HIS A HD2  8  
ATOM   4814  H  HE1  . HIS A 1 35 ? 7.549   0.070   3.760   1.00 0.00 ? 35  HIS A HE1  8  
ATOM   4815  N  N    . THR A 1 36 ? 8.768   7.152   1.495   1.00 0.00 ? 36  THR A N    8  
ATOM   4816  C  CA   . THR A 1 36 ? 9.718   8.173   1.071   1.00 0.00 ? 36  THR A CA   8  
ATOM   4817  C  C    . THR A 1 36 ? 9.958   9.194   2.177   1.00 0.00 ? 36  THR A C    8  
ATOM   4818  O  O    . THR A 1 36 ? 10.007  10.397  1.926   1.00 0.00 ? 36  THR A O    8  
ATOM   4819  C  CB   . THR A 1 36 ? 9.227   8.907   -0.191  1.00 0.00 ? 36  THR A CB   8  
ATOM   4820  O  OG1  . THR A 1 36 ? 7.921   9.450   0.035   1.00 0.00 ? 36  THR A OG1  8  
ATOM   4821  C  CG2  . THR A 1 36 ? 9.190   7.966   -1.385  1.00 0.00 ? 36  THR A CG2  8  
ATOM   4822  H  H    . THR A 1 36 ? 7.808   7.341   1.447   1.00 0.00 ? 36  THR A H    8  
ATOM   4823  H  HA   . THR A 1 36 ? 10.652  7.684   0.837   1.00 0.00 ? 36  THR A HA   8  
ATOM   4824  H  HB   . THR A 1 36 ? 9.911   9.715   -0.409  1.00 0.00 ? 36  THR A HB   8  
ATOM   4825  H  HG1  . THR A 1 36 ? 7.930   10.393  -0.149  1.00 0.00 ? 36  THR A HG1  8  
ATOM   4826  H  HG21 . THR A 1 36 ? 8.792   8.487   -2.242  1.00 0.00 ? 36  THR A HG21 8  
ATOM   4827  H  HG22 . THR A 1 36 ? 8.561   7.118   -1.156  1.00 0.00 ? 36  THR A HG22 8  
ATOM   4828  H  HG23 . THR A 1 36 ? 10.190  7.623   -1.604  1.00 0.00 ? 36  THR A HG23 8  
ATOM   4829  N  N    . GLY A 1 37 ? 10.109  8.705   3.405   1.00 0.00 ? 37  GLY A N    8  
ATOM   4830  C  CA   . GLY A 1 37 ? 10.343  9.589   4.532   1.00 0.00 ? 37  GLY A CA   8  
ATOM   4831  C  C    . GLY A 1 37 ? 11.326  9.009   5.529   1.00 0.00 ? 37  GLY A C    8  
ATOM   4832  O  O    . GLY A 1 37 ? 12.533  9.222   5.415   1.00 0.00 ? 37  GLY A O    8  
ATOM   4833  H  H    . GLY A 1 37 ? 10.060  7.737   3.546   1.00 0.00 ? 37  GLY A H    8  
ATOM   4834  H  HA2  . GLY A 1 37 ? 10.730  10.528  4.165   1.00 0.00 ? 37  GLY A HA2  8  
ATOM   4835  H  HA3  . GLY A 1 37 ? 9.404   9.770   5.034   1.00 0.00 ? 37  GLY A HA3  8  
ATOM   4836  N  N    . GLU A 1 38 ? 10.809  8.276   6.510   1.00 0.00 ? 38  GLU A N    8  
ATOM   4837  C  CA   . GLU A 1 38 ? 11.651  7.666   7.532   1.00 0.00 ? 38  GLU A CA   8  
ATOM   4838  C  C    . GLU A 1 38 ? 12.411  6.469   6.968   1.00 0.00 ? 38  GLU A C    8  
ATOM   4839  O  O    . GLU A 1 38 ? 11.822  5.428   6.676   1.00 0.00 ? 38  GLU A O    8  
ATOM   4840  C  CB   . GLU A 1 38 ? 10.803  7.228   8.728   1.00 0.00 ? 38  GLU A CB   8  
ATOM   4841  C  CG   . GLU A 1 38 ? 10.330  8.383   9.595   1.00 0.00 ? 38  GLU A CG   8  
ATOM   4842  C  CD   . GLU A 1 38 ? 9.283   7.962   10.607  1.00 0.00 ? 38  GLU A CD   8  
ATOM   4843  O  OE1  . GLU A 1 38 ? 8.188   7.535   10.187  1.00 0.00 ? 38  GLU A OE1  8  
ATOM   4844  O  OE2  . GLU A 1 38 ? 9.559   8.060   11.821  1.00 0.00 ? 38  GLU A OE2  8  
ATOM   4845  H  H    . GLU A 1 38 ? 9.839   8.142   6.547   1.00 0.00 ? 38  GLU A H    8  
ATOM   4846  H  HA   . GLU A 1 38 ? 12.364  8.407   7.860   1.00 0.00 ? 38  GLU A HA   8  
ATOM   4847  H  HB2  . GLU A 1 38 ? 9.934   6.699   8.364   1.00 0.00 ? 38  GLU A HB2  8  
ATOM   4848  H  HB3  . GLU A 1 38 ? 11.388  6.560   9.343   1.00 0.00 ? 38  GLU A HB3  8  
ATOM   4849  H  HG2  . GLU A 1 38 ? 11.179  8.789   10.125  1.00 0.00 ? 38  GLU A HG2  8  
ATOM   4850  H  HG3  . GLU A 1 38 ? 9.908   9.145   8.957   1.00 0.00 ? 38  GLU A HG3  8  
ATOM   4851  N  N    . SER A 1 39 ? 13.722  6.625   6.817   1.00 0.00 ? 39  SER A N    8  
ATOM   4852  C  CA   . SER A 1 39 ? 14.563  5.560   6.284   1.00 0.00 ? 39  SER A CA   8  
ATOM   4853  C  C    . SER A 1 39 ? 15.432  4.953   7.382   1.00 0.00 ? 39  SER A C    8  
ATOM   4854  O  O    . SER A 1 39 ? 16.591  5.329   7.551   1.00 0.00 ? 39  SER A O    8  
ATOM   4855  C  CB   . SER A 1 39 ? 15.447  6.095   5.156   1.00 0.00 ? 39  SER A CB   8  
ATOM   4856  O  OG   . SER A 1 39 ? 16.110  5.039   4.483   1.00 0.00 ? 39  SER A OG   8  
ATOM   4857  H  H    . SER A 1 39 ? 14.133  7.479   7.068   1.00 0.00 ? 39  SER A H    8  
ATOM   4858  H  HA   . SER A 1 39 ? 13.914  4.792   5.889   1.00 0.00 ? 39  SER A HA   8  
ATOM   4859  H  HB2  . SER A 1 39 ? 14.835  6.630   4.446   1.00 0.00 ? 39  SER A HB2  8  
ATOM   4860  H  HB3  . SER A 1 39 ? 16.188  6.764   5.569   1.00 0.00 ? 39  SER A HB3  8  
ATOM   4861  H  HG   . SER A 1 39 ? 16.643  5.398   3.770   1.00 0.00 ? 39  SER A HG   8  
ATOM   4862  N  N    . GLY A 1 40 ? 14.861  4.010   8.126   1.00 0.00 ? 40  GLY A N    8  
ATOM   4863  C  CA   . GLY A 1 40 ? 15.597  3.365   9.198   1.00 0.00 ? 40  GLY A CA   8  
ATOM   4864  C  C    . GLY A 1 40 ? 16.531  2.284   8.692   1.00 0.00 ? 40  GLY A C    8  
ATOM   4865  O  O    . GLY A 1 40 ? 17.753  2.386   8.808   1.00 0.00 ? 40  GLY A O    8  
ATOM   4866  H  H    . GLY A 1 40 ? 13.934  3.750   7.945   1.00 0.00 ? 40  GLY A H    8  
ATOM   4867  H  HA2  . GLY A 1 40 ? 16.176  4.111   9.722   1.00 0.00 ? 40  GLY A HA2  8  
ATOM   4868  H  HA3  . GLY A 1 40 ? 14.892  2.922   9.886   1.00 0.00 ? 40  GLY A HA3  8  
ATOM   4869  N  N    . PRO A 1 41 ? 15.954  1.219   8.117   1.00 0.00 ? 41  PRO A N    8  
ATOM   4870  C  CA   . PRO A 1 41 ? 16.725  0.093   7.582   1.00 0.00 ? 41  PRO A CA   8  
ATOM   4871  C  C    . PRO A 1 41 ? 17.505  0.470   6.327   1.00 0.00 ? 41  PRO A C    8  
ATOM   4872  O  O    . PRO A 1 41 ? 18.441  -0.226  5.933   1.00 0.00 ? 41  PRO A O    8  
ATOM   4873  C  CB   . PRO A 1 41 ? 15.652  -0.947  7.252   1.00 0.00 ? 41  PRO A CB   8  
ATOM   4874  C  CG   . PRO A 1 41 ? 14.412  -0.154  7.024   1.00 0.00 ? 41  PRO A CG   8  
ATOM   4875  C  CD   . PRO A 1 41 ? 14.504  1.031   7.946   1.00 0.00 ? 41  PRO A CD   8  
ATOM   4876  H  HA   . PRO A 1 41 ? 17.404  -0.309  8.319   1.00 0.00 ? 41  PRO A HA   8  
ATOM   4877  H  HB2  . PRO A 1 41 ? 15.940  -1.496  6.366   1.00 0.00 ? 41  PRO A HB2  8  
ATOM   4878  H  HB3  . PRO A 1 41 ? 15.538  -1.628  8.082   1.00 0.00 ? 41  PRO A HB3  8  
ATOM   4879  H  HG2  . PRO A 1 41 ? 14.369  0.174   5.996   1.00 0.00 ? 41  PRO A HG2  8  
ATOM   4880  H  HG3  . PRO A 1 41 ? 13.545  -0.750  7.265   1.00 0.00 ? 41  PRO A HG3  8  
ATOM   4881  H  HD2  . PRO A 1 41 ? 14.053  1.900   7.489   1.00 0.00 ? 41  PRO A HD2  8  
ATOM   4882  H  HD3  . PRO A 1 41 ? 14.029  0.810   8.891   1.00 0.00 ? 41  PRO A HD3  8  
ATOM   4883  N  N    . SER A 1 42 ? 17.115  1.577   5.703   1.00 0.00 ? 42  SER A N    8  
ATOM   4884  C  CA   . SER A 1 42 ? 17.776  2.045   4.490   1.00 0.00 ? 42  SER A CA   8  
ATOM   4885  C  C    . SER A 1 42 ? 18.398  3.421   4.707   1.00 0.00 ? 42  SER A C    8  
ATOM   4886  O  O    . SER A 1 42 ? 18.198  4.048   5.747   1.00 0.00 ? 42  SER A O    8  
ATOM   4887  C  CB   . SER A 1 42 ? 16.780  2.100   3.330   1.00 0.00 ? 42  SER A CB   8  
ATOM   4888  O  OG   . SER A 1 42 ? 17.446  2.014   2.082   1.00 0.00 ? 42  SER A OG   8  
ATOM   4889  H  H    . SER A 1 42 ? 16.362  2.090   6.066   1.00 0.00 ? 42  SER A H    8  
ATOM   4890  H  HA   . SER A 1 42 ? 18.560  1.342   4.248   1.00 0.00 ? 42  SER A HA   8  
ATOM   4891  H  HB2  . SER A 1 42 ? 16.089  1.275   3.413   1.00 0.00 ? 42  SER A HB2  8  
ATOM   4892  H  HB3  . SER A 1 42 ? 16.235  3.032   3.371   1.00 0.00 ? 42  SER A HB3  8  
ATOM   4893  H  HG   . SER A 1 42 ? 16.801  1.884   1.383   1.00 0.00 ? 42  SER A HG   8  
ATOM   4894  N  N    . SER A 1 43 ? 19.155  3.884   3.717   1.00 0.00 ? 43  SER A N    8  
ATOM   4895  C  CA   . SER A 1 43 ? 19.811  5.184   3.800   1.00 0.00 ? 43  SER A CA   8  
ATOM   4896  C  C    . SER A 1 43 ? 19.345  6.100   2.672   1.00 0.00 ? 43  SER A C    8  
ATOM   4897  O  O    . SER A 1 43 ? 18.977  7.250   2.904   1.00 0.00 ? 43  SER A O    8  
ATOM   4898  C  CB   . SER A 1 43 ? 21.330  5.016   3.742   1.00 0.00 ? 43  SER A CB   8  
ATOM   4899  O  OG   . SER A 1 43 ? 21.726  4.362   2.549   1.00 0.00 ? 43  SER A OG   8  
ATOM   4900  H  H    . SER A 1 43 ? 19.277  3.336   2.913   1.00 0.00 ? 43  SER A H    8  
ATOM   4901  H  HA   . SER A 1 43 ? 19.542  5.631   4.745   1.00 0.00 ? 43  SER A HA   8  
ATOM   4902  H  HB2  . SER A 1 43 ? 21.798  5.988   3.777   1.00 0.00 ? 43  SER A HB2  8  
ATOM   4903  H  HB3  . SER A 1 43 ? 21.657  4.428   4.587   1.00 0.00 ? 43  SER A HB3  8  
ATOM   4904  H  HG   . SER A 1 43 ? 22.188  4.982   1.981   1.00 0.00 ? 43  SER A HG   8  
ATOM   4905  N  N    . GLY A 1 44 ? 19.364  5.579   1.449   1.00 0.00 ? 44  GLY A N    8  
ATOM   4906  C  CA   . GLY A 1 44 ? 18.942  6.362   0.302   1.00 0.00 ? 44  GLY A CA   8  
ATOM   4907  C  C    . GLY A 1 44 ? 19.655  5.955   -0.972  1.00 0.00 ? 44  GLY A C    8  
ATOM   4908  O  O    . GLY A 1 44 ? 18.998  5.493   -1.904  1.00 0.00 ? 44  GLY A O    8  
ATOM   4909  H  H    . GLY A 1 44 ? 19.667  4.655   1.324   1.00 0.00 ? 44  GLY A H    8  
ATOM   4910  H  HA2  . GLY A 1 44 ? 17.879  6.234   0.164   1.00 0.00 ? 44  GLY A HA2  8  
ATOM   4911  H  HA3  . GLY A 1 44 ? 19.147  7.405   0.498   1.00 0.00 ? 44  GLY A HA3  8  
HETATM 4912  ZN ZN   . ZN  B 2 .  ? 4.594   -0.359  2.763   1.00 0.00 ? 181 ZN  A ZN   8  
ATOM   4913  N  N    . GLY A 1 1  ? -15.545 -27.003 -20.049 1.00 0.00 ? 1   GLY A N    9  
ATOM   4914  C  CA   . GLY A 1 1  ? -14.637 -28.108 -19.803 1.00 0.00 ? 1   GLY A CA   9  
ATOM   4915  C  C    . GLY A 1 1  ? -13.317 -27.653 -19.214 1.00 0.00 ? 1   GLY A C    9  
ATOM   4916  O  O    . GLY A 1 1  ? -13.263 -27.199 -18.071 1.00 0.00 ? 1   GLY A O    9  
ATOM   4917  H  H1   . GLY A 1 1  ? -16.014 -26.580 -19.299 1.00 0.00 ? 1   GLY A H1   9  
ATOM   4918  H  HA2  . GLY A 1 1  ? -15.106 -28.799 -19.119 1.00 0.00 ? 1   GLY A HA2  9  
ATOM   4919  H  HA3  . GLY A 1 1  ? -14.445 -28.616 -20.737 1.00 0.00 ? 1   GLY A HA3  9  
ATOM   4920  N  N    . SER A 1 2  ? -12.248 -27.777 -19.994 1.00 0.00 ? 2   SER A N    9  
ATOM   4921  C  CA   . SER A 1 2  ? -10.921 -27.380 -19.541 1.00 0.00 ? 2   SER A CA   9  
ATOM   4922  C  C    . SER A 1 2  ? -10.762 -25.863 -19.586 1.00 0.00 ? 2   SER A C    9  
ATOM   4923  O  O    . SER A 1 2  ? -10.735 -25.262 -20.660 1.00 0.00 ? 2   SER A O    9  
ATOM   4924  C  CB   . SER A 1 2  ? -9.845  -28.042 -20.403 1.00 0.00 ? 2   SER A CB   9  
ATOM   4925  O  OG   . SER A 1 2  ? -8.578  -27.986 -19.771 1.00 0.00 ? 2   SER A OG   9  
ATOM   4926  H  H    . SER A 1 2  ? -12.356 -28.146 -20.896 1.00 0.00 ? 2   SER A H    9  
ATOM   4927  H  HA   . SER A 1 2  ? -10.806 -27.712 -18.520 1.00 0.00 ? 2   SER A HA   9  
ATOM   4928  H  HB2  . SER A 1 2  ? -10.106 -29.077 -20.568 1.00 0.00 ? 2   SER A HB2  9  
ATOM   4929  H  HB3  . SER A 1 2  ? -9.783  -27.531 -21.353 1.00 0.00 ? 2   SER A HB3  9  
ATOM   4930  H  HG   . SER A 1 2  ? -8.014  -27.365 -20.238 1.00 0.00 ? 2   SER A HG   9  
ATOM   4931  N  N    . SER A 1 3  ? -10.657 -25.250 -18.411 1.00 0.00 ? 3   SER A N    9  
ATOM   4932  C  CA   . SER A 1 3  ? -10.505 -23.803 -18.314 1.00 0.00 ? 3   SER A CA   9  
ATOM   4933  C  C    . SER A 1 3  ? -9.706  -23.423 -17.071 1.00 0.00 ? 3   SER A C    9  
ATOM   4934  O  O    . SER A 1 3  ? -9.866  -24.023 -16.009 1.00 0.00 ? 3   SER A O    9  
ATOM   4935  C  CB   . SER A 1 3  ? -11.877 -23.126 -18.280 1.00 0.00 ? 3   SER A CB   9  
ATOM   4936  O  OG   . SER A 1 3  ? -11.753 -21.719 -18.389 1.00 0.00 ? 3   SER A OG   9  
ATOM   4937  H  H    . SER A 1 3  ? -10.686 -25.784 -17.589 1.00 0.00 ? 3   SER A H    9  
ATOM   4938  H  HA   . SER A 1 3  ? -9.969  -23.467 -19.189 1.00 0.00 ? 3   SER A HA   9  
ATOM   4939  H  HB2  . SER A 1 3  ? -12.474 -23.488 -19.103 1.00 0.00 ? 3   SER A HB2  9  
ATOM   4940  H  HB3  . SER A 1 3  ? -12.368 -23.361 -17.347 1.00 0.00 ? 3   SER A HB3  9  
ATOM   4941  H  HG   . SER A 1 3  ? -11.464 -21.490 -19.276 1.00 0.00 ? 3   SER A HG   9  
ATOM   4942  N  N    . GLY A 1 4  ? -8.845  -22.420 -17.213 1.00 0.00 ? 4   GLY A N    9  
ATOM   4943  C  CA   . GLY A 1 4  ? -8.033  -21.976 -16.095 1.00 0.00 ? 4   GLY A CA   9  
ATOM   4944  C  C    . GLY A 1 4  ? -8.675  -20.835 -15.330 1.00 0.00 ? 4   GLY A C    9  
ATOM   4945  O  O    . GLY A 1 4  ? -9.057  -19.823 -15.917 1.00 0.00 ? 4   GLY A O    9  
ATOM   4946  H  H    . GLY A 1 4  ? -8.760  -21.978 -18.084 1.00 0.00 ? 4   GLY A H    9  
ATOM   4947  H  HA2  . GLY A 1 4  ? -7.882  -22.806 -15.422 1.00 0.00 ? 4   GLY A HA2  9  
ATOM   4948  H  HA3  . GLY A 1 4  ? -7.074  -21.649 -16.469 1.00 0.00 ? 4   GLY A HA3  9  
ATOM   4949  N  N    . SER A 1 5  ? -8.794  -20.998 -14.016 1.00 0.00 ? 5   SER A N    9  
ATOM   4950  C  CA   . SER A 1 5  ? -9.398  -19.976 -13.171 1.00 0.00 ? 5   SER A CA   9  
ATOM   4951  C  C    . SER A 1 5  ? -8.674  -18.642 -13.329 1.00 0.00 ? 5   SER A C    9  
ATOM   4952  O  O    . SER A 1 5  ? -7.492  -18.601 -13.670 1.00 0.00 ? 5   SER A O    9  
ATOM   4953  C  CB   . SER A 1 5  ? -9.370  -20.414 -11.705 1.00 0.00 ? 5   SER A CB   9  
ATOM   4954  O  OG   . SER A 1 5  ? -9.992  -21.676 -11.538 1.00 0.00 ? 5   SER A OG   9  
ATOM   4955  H  H    . SER A 1 5  ? -8.469  -21.827 -13.607 1.00 0.00 ? 5   SER A H    9  
ATOM   4956  H  HA   . SER A 1 5  ? -10.425 -19.853 -13.481 1.00 0.00 ? 5   SER A HA   9  
ATOM   4957  H  HB2  . SER A 1 5  ? -8.346  -20.484 -11.373 1.00 0.00 ? 5   SER A HB2  9  
ATOM   4958  H  HB3  . SER A 1 5  ? -9.894  -19.684 -11.104 1.00 0.00 ? 5   SER A HB3  9  
ATOM   4959  H  HG   . SER A 1 5  ? -10.009 -21.904 -10.606 1.00 0.00 ? 5   SER A HG   9  
ATOM   4960  N  N    . SER A 1 6  ? -9.393  -17.552 -13.077 1.00 0.00 ? 6   SER A N    9  
ATOM   4961  C  CA   . SER A 1 6  ? -8.821  -16.216 -13.195 1.00 0.00 ? 6   SER A CA   9  
ATOM   4962  C  C    . SER A 1 6  ? -8.360  -15.701 -11.835 1.00 0.00 ? 6   SER A C    9  
ATOM   4963  O  O    . SER A 1 6  ? -9.120  -15.702 -10.868 1.00 0.00 ? 6   SER A O    9  
ATOM   4964  C  CB   . SER A 1 6  ? -9.845  -15.252 -13.798 1.00 0.00 ? 6   SER A CB   9  
ATOM   4965  O  OG   . SER A 1 6  ? -9.337  -13.929 -13.838 1.00 0.00 ? 6   SER A OG   9  
ATOM   4966  H  H    . SER A 1 6  ? -10.330 -17.650 -12.809 1.00 0.00 ? 6   SER A H    9  
ATOM   4967  H  HA   . SER A 1 6  ? -7.967  -16.278 -13.852 1.00 0.00 ? 6   SER A HA   9  
ATOM   4968  H  HB2  . SER A 1 6  ? -10.081 -15.565 -14.803 1.00 0.00 ? 6   SER A HB2  9  
ATOM   4969  H  HB3  . SER A 1 6  ? -10.742 -15.262 -13.196 1.00 0.00 ? 6   SER A HB3  9  
ATOM   4970  H  HG   . SER A 1 6  ? -9.986  -13.326 -13.470 1.00 0.00 ? 6   SER A HG   9  
ATOM   4971  N  N    . GLY A 1 7  ? -7.107  -15.261 -11.770 1.00 0.00 ? 7   GLY A N    9  
ATOM   4972  C  CA   . GLY A 1 7  ? -6.564  -14.749 -10.525 1.00 0.00 ? 7   GLY A CA   9  
ATOM   4973  C  C    . GLY A 1 7  ? -5.889  -13.402 -10.697 1.00 0.00 ? 7   GLY A C    9  
ATOM   4974  O  O    . GLY A 1 7  ? -4.767  -13.321 -11.199 1.00 0.00 ? 7   GLY A O    9  
ATOM   4975  H  H    . GLY A 1 7  ? -6.546  -15.284 -12.574 1.00 0.00 ? 7   GLY A H    9  
ATOM   4976  H  HA2  . GLY A 1 7  ? -7.366  -14.648 -9.809  1.00 0.00 ? 7   GLY A HA2  9  
ATOM   4977  H  HA3  . GLY A 1 7  ? -5.841  -15.455 -10.144 1.00 0.00 ? 7   GLY A HA3  9  
ATOM   4978  N  N    . THR A 1 8  ? -6.573  -12.341 -10.280 1.00 0.00 ? 8   THR A N    9  
ATOM   4979  C  CA   . THR A 1 8  ? -6.034  -10.992 -10.394 1.00 0.00 ? 8   THR A CA   9  
ATOM   4980  C  C    . THR A 1 8  ? -5.686  -10.422 -9.023  1.00 0.00 ? 8   THR A C    9  
ATOM   4981  O  O    . THR A 1 8  ? -6.562  -9.975  -8.285  1.00 0.00 ? 8   THR A O    9  
ATOM   4982  C  CB   . THR A 1 8  ? -7.029  -10.046 -11.092 1.00 0.00 ? 8   THR A CB   9  
ATOM   4983  O  OG1  . THR A 1 8  ? -7.442  -10.607 -12.343 1.00 0.00 ? 8   THR A OG1  9  
ATOM   4984  C  CG2  . THR A 1 8  ? -6.404  -8.679  -11.325 1.00 0.00 ? 8   THR A CG2  9  
ATOM   4985  H  H    . THR A 1 8  ? -7.462  -12.471 -9.889  1.00 0.00 ? 8   THR A H    9  
ATOM   4986  H  HA   . THR A 1 8  ? -5.136  -11.041 -10.992 1.00 0.00 ? 8   THR A HA   9  
ATOM   4987  H  HB   . THR A 1 8  ? -7.895  -9.926  -10.457 1.00 0.00 ? 8   THR A HB   9  
ATOM   4988  H  HG1  . THR A 1 8  ? -7.760  -9.907  -12.919 1.00 0.00 ? 8   THR A HG1  9  
ATOM   4989  H  HG21 . THR A 1 8  ? -6.496  -8.415  -12.368 1.00 0.00 ? 8   THR A HG21 9  
ATOM   4990  H  HG22 . THR A 1 8  ? -5.360  -8.709  -11.052 1.00 0.00 ? 8   THR A HG22 9  
ATOM   4991  H  HG23 . THR A 1 8  ? -6.913  -7.943  -10.721 1.00 0.00 ? 8   THR A HG23 9  
ATOM   4992  N  N    . GLY A 1 9  ? -4.399  -10.441 -8.689  1.00 0.00 ? 9   GLY A N    9  
ATOM   4993  C  CA   . GLY A 1 9  ? -3.958  -9.923  -7.407  1.00 0.00 ? 9   GLY A CA   9  
ATOM   4994  C  C    . GLY A 1 9  ? -4.320  -10.840 -6.255  1.00 0.00 ? 9   GLY A C    9  
ATOM   4995  O  O    . GLY A 1 9  ? -5.319  -11.557 -6.315  1.00 0.00 ? 9   GLY A O    9  
ATOM   4996  H  H    . GLY A 1 9  ? -3.744  -10.811 -9.318  1.00 0.00 ? 9   GLY A H    9  
ATOM   4997  H  HA2  . GLY A 1 9  ? -2.885  -9.799  -7.431  1.00 0.00 ? 9   GLY A HA2  9  
ATOM   4998  H  HA3  . GLY A 1 9  ? -4.418  -8.960  -7.244  1.00 0.00 ? 9   GLY A HA3  9  
ATOM   4999  N  N    . MET A 1 10 ? -3.507  -10.817 -5.205  1.00 0.00 ? 10  MET A N    9  
ATOM   5000  C  CA   . MET A 1 10 ? -3.747  -11.654 -4.035  1.00 0.00 ? 10  MET A CA   9  
ATOM   5001  C  C    . MET A 1 10 ? -4.103  -10.801 -2.821  1.00 0.00 ? 10  MET A C    9  
ATOM   5002  O  O    . MET A 1 10 ? -5.117  -11.032 -2.162  1.00 0.00 ? 10  MET A O    9  
ATOM   5003  C  CB   . MET A 1 10 ? -2.515  -12.507 -3.729  1.00 0.00 ? 10  MET A CB   9  
ATOM   5004  C  CG   . MET A 1 10 ? -2.393  -13.736 -4.615  1.00 0.00 ? 10  MET A CG   9  
ATOM   5005  S  SD   . MET A 1 10 ? -0.683  -14.267 -4.834  1.00 0.00 ? 10  MET A SD   9  
ATOM   5006  C  CE   . MET A 1 10 ? -0.902  -15.670 -5.926  1.00 0.00 ? 10  MET A CE   9  
ATOM   5007  H  H    . MET A 1 10 ? -2.726  -10.225 -5.216  1.00 0.00 ? 10  MET A H    9  
ATOM   5008  H  HA   . MET A 1 10 ? -4.579  -12.305 -4.258  1.00 0.00 ? 10  MET A HA   9  
ATOM   5009  H  HB2  . MET A 1 10 ? -1.631  -11.903 -3.864  1.00 0.00 ? 10  MET A HB2  9  
ATOM   5010  H  HB3  . MET A 1 10 ? -2.564  -12.835 -2.701  1.00 0.00 ? 10  MET A HB3  9  
ATOM   5011  H  HG2  . MET A 1 10 ? -2.950  -14.545 -4.166  1.00 0.00 ? 10  MET A HG2  9  
ATOM   5012  H  HG3  . MET A 1 10 ? -2.811  -13.507 -5.584  1.00 0.00 ? 10  MET A HG3  9  
ATOM   5013  H  HE1  . MET A 1 10 ? -0.674  -16.581 -5.391  1.00 0.00 ? 10  MET A HE1  9  
ATOM   5014  H  HE2  . MET A 1 10 ? -1.925  -15.702 -6.271  1.00 0.00 ? 10  MET A HE2  9  
ATOM   5015  H  HE3  . MET A 1 10 ? -0.239  -15.573 -6.773  1.00 0.00 ? 10  MET A HE3  9  
ATOM   5016  N  N    . LYS A 1 11 ? -3.262  -9.813  -2.531  1.00 0.00 ? 11  LYS A N    9  
ATOM   5017  C  CA   . LYS A 1 11 ? -3.488  -8.924  -1.397  1.00 0.00 ? 11  LYS A CA   9  
ATOM   5018  C  C    . LYS A 1 11 ? -4.414  -7.775  -1.782  1.00 0.00 ? 11  LYS A C    9  
ATOM   5019  O  O    . LYS A 1 11 ? -4.259  -7.146  -2.830  1.00 0.00 ? 11  LYS A O    9  
ATOM   5020  C  CB   . LYS A 1 11 ? -2.157  -8.371  -0.884  1.00 0.00 ? 11  LYS A CB   9  
ATOM   5021  C  CG   . LYS A 1 11 ? -1.530  -9.214  0.213   1.00 0.00 ? 11  LYS A CG   9  
ATOM   5022  C  CD   . LYS A 1 11 ? -0.602  -10.273 -0.359  1.00 0.00 ? 11  LYS A CD   9  
ATOM   5023  C  CE   . LYS A 1 11 ? 0.709   -9.666  -0.836  1.00 0.00 ? 11  LYS A CE   9  
ATOM   5024  N  NZ   . LYS A 1 11 ? 1.629   -10.698 -1.390  1.00 0.00 ? 11  LYS A NZ   9  
ATOM   5025  H  H    . LYS A 1 11 ? -2.471  -9.678  -3.094  1.00 0.00 ? 11  LYS A H    9  
ATOM   5026  H  HA   . LYS A 1 11 ? -3.955  -9.500  -0.612  1.00 0.00 ? 11  LYS A HA   9  
ATOM   5027  H  HB2  . LYS A 1 11 ? -1.462  -8.316  -1.709  1.00 0.00 ? 11  LYS A HB2  9  
ATOM   5028  H  HB3  . LYS A 1 11 ? -2.320  -7.376  -0.495  1.00 0.00 ? 11  LYS A HB3  9  
ATOM   5029  H  HG2  . LYS A 1 11 ? -0.963  -8.571  0.869   1.00 0.00 ? 11  LYS A HG2  9  
ATOM   5030  H  HG3  . LYS A 1 11 ? -2.315  -9.702  0.773   1.00 0.00 ? 11  LYS A HG3  9  
ATOM   5031  H  HD2  . LYS A 1 11 ? -0.389  -11.005 0.406   1.00 0.00 ? 11  LYS A HD2  9  
ATOM   5032  H  HD3  . LYS A 1 11 ? -1.091  -10.754 -1.195  1.00 0.00 ? 11  LYS A HD3  9  
ATOM   5033  H  HE2  . LYS A 1 11 ? 0.496   -8.938  -1.603  1.00 0.00 ? 11  LYS A HE2  9  
ATOM   5034  H  HE3  . LYS A 1 11 ? 1.190   -9.179  -0.001  1.00 0.00 ? 11  LYS A HE3  9  
ATOM   5035  H  HZ1  . LYS A 1 11 ? 1.136   -11.611 -1.469  1.00 0.00 ? 11  LYS A HZ1  9  
ATOM   5036  H  HZ2  . LYS A 1 11 ? 2.453   -10.814 -0.766  1.00 0.00 ? 11  LYS A HZ2  9  
ATOM   5037  H  HZ3  . LYS A 1 11 ? 1.960   -10.413 -2.334  1.00 0.00 ? 11  LYS A HZ3  9  
ATOM   5038  N  N    . PRO A 1 12 ? -5.398  -7.491  -0.917  1.00 0.00 ? 12  PRO A N    9  
ATOM   5039  C  CA   . PRO A 1 12 ? -6.367  -6.415  -1.145  1.00 0.00 ? 12  PRO A CA   9  
ATOM   5040  C  C    . PRO A 1 12 ? -5.734  -5.032  -1.029  1.00 0.00 ? 12  PRO A C    9  
ATOM   5041  O  O    . PRO A 1 12 ? -5.237  -4.482  -2.012  1.00 0.00 ? 12  PRO A O    9  
ATOM   5042  C  CB   . PRO A 1 12 ? -7.399  -6.625  -0.034  1.00 0.00 ? 12  PRO A CB   9  
ATOM   5043  C  CG   . PRO A 1 12 ? -6.654  -7.332  1.046   1.00 0.00 ? 12  PRO A CG   9  
ATOM   5044  C  CD   . PRO A 1 12 ? -5.642  -8.200  0.351   1.00 0.00 ? 12  PRO A CD   9  
ATOM   5045  H  HA   . PRO A 1 12 ? -6.847  -6.510  -2.107  1.00 0.00 ? 12  PRO A HA   9  
ATOM   5046  H  HB2  . PRO A 1 12 ? -7.769  -5.667  0.303   1.00 0.00 ? 12  PRO A HB2  9  
ATOM   5047  H  HB3  . PRO A 1 12 ? -8.217  -7.223  -0.406  1.00 0.00 ? 12  PRO A HB3  9  
ATOM   5048  H  HG2  . PRO A 1 12 ? -6.160  -6.614  1.682   1.00 0.00 ? 12  PRO A HG2  9  
ATOM   5049  H  HG3  . PRO A 1 12 ? -7.335  -7.940  1.623   1.00 0.00 ? 12  PRO A HG3  9  
ATOM   5050  H  HD2  . PRO A 1 12 ? -4.736  -8.265  0.936   1.00 0.00 ? 12  PRO A HD2  9  
ATOM   5051  H  HD3  . PRO A 1 12 ? -6.049  -9.184  0.170   1.00 0.00 ? 12  PRO A HD3  9  
ATOM   5052  N  N    . TYR A 1 13 ? -5.756  -4.475  0.176   1.00 0.00 ? 13  TYR A N    9  
ATOM   5053  C  CA   . TYR A 1 13 ? -5.186  -3.156  0.419   1.00 0.00 ? 13  TYR A CA   9  
ATOM   5054  C  C    . TYR A 1 13 ? -3.862  -3.264  1.169   1.00 0.00 ? 13  TYR A C    9  
ATOM   5055  O  O    . TYR A 1 13 ? -3.356  -2.277  1.705   1.00 0.00 ? 13  TYR A O    9  
ATOM   5056  C  CB   . TYR A 1 13 ? -6.167  -2.292  1.215   1.00 0.00 ? 13  TYR A CB   9  
ATOM   5057  C  CG   . TYR A 1 13 ? -7.616  -2.661  0.993   1.00 0.00 ? 13  TYR A CG   9  
ATOM   5058  C  CD1  . TYR A 1 13 ? -8.171  -3.779  1.605   1.00 0.00 ? 13  TYR A CD1  9  
ATOM   5059  C  CD2  . TYR A 1 13 ? -8.431  -1.891  0.173   1.00 0.00 ? 13  TYR A CD2  9  
ATOM   5060  C  CE1  . TYR A 1 13 ? -9.494  -4.120  1.404   1.00 0.00 ? 13  TYR A CE1  9  
ATOM   5061  C  CE2  . TYR A 1 13 ? -9.756  -2.224  -0.032  1.00 0.00 ? 13  TYR A CE2  9  
ATOM   5062  C  CZ   . TYR A 1 13 ? -10.283 -3.339  0.585   1.00 0.00 ? 13  TYR A CZ   9  
ATOM   5063  O  OH   . TYR A 1 13 ? -11.602 -3.675  0.384   1.00 0.00 ? 13  TYR A OH   9  
ATOM   5064  H  H    . TYR A 1 13 ? -6.167  -4.963  0.921   1.00 0.00 ? 13  TYR A H    9  
ATOM   5065  H  HA   . TYR A 1 13 ? -5.007  -2.690  -0.539  1.00 0.00 ? 13  TYR A HA   9  
ATOM   5066  H  HB2  . TYR A 1 13 ? -5.956  -2.397  2.268   1.00 0.00 ? 13  TYR A HB2  9  
ATOM   5067  H  HB3  . TYR A 1 13 ? -6.039  -1.258  0.929   1.00 0.00 ? 13  TYR A HB3  9  
ATOM   5068  H  HD1  . TYR A 1 13 ? -7.550  -4.388  2.246   1.00 0.00 ? 13  TYR A HD1  9  
ATOM   5069  H  HD2  . TYR A 1 13 ? -8.016  -1.018  -0.310  1.00 0.00 ? 13  TYR A HD2  9  
ATOM   5070  H  HE1  . TYR A 1 13 ? -9.907  -4.993  1.888   1.00 0.00 ? 13  TYR A HE1  9  
ATOM   5071  H  HE2  . TYR A 1 13 ? -10.375 -1.613  -0.674  1.00 0.00 ? 13  TYR A HE2  9  
ATOM   5072  H  HH   . TYR A 1 13 ? -12.025 -3.002  -0.156  1.00 0.00 ? 13  TYR A HH   9  
ATOM   5073  N  N    . VAL A 1 14 ? -3.305  -4.470  1.203   1.00 0.00 ? 14  VAL A N    9  
ATOM   5074  C  CA   . VAL A 1 14 ? -2.038  -4.709  1.885   1.00 0.00 ? 14  VAL A CA   9  
ATOM   5075  C  C    . VAL A 1 14 ? -0.864  -4.199  1.057   1.00 0.00 ? 14  VAL A C    9  
ATOM   5076  O  O    . VAL A 1 14 ? -0.885  -4.258  -0.173  1.00 0.00 ? 14  VAL A O    9  
ATOM   5077  C  CB   . VAL A 1 14 ? -1.833  -6.207  2.179   1.00 0.00 ? 14  VAL A CB   9  
ATOM   5078  C  CG1  . VAL A 1 14 ? -0.642  -6.411  3.103   1.00 0.00 ? 14  VAL A CG1  9  
ATOM   5079  C  CG2  . VAL A 1 14 ? -3.094  -6.809  2.779   1.00 0.00 ? 14  VAL A CG2  9  
ATOM   5080  H  H    . VAL A 1 14 ? -3.756  -5.217  0.757   1.00 0.00 ? 14  VAL A H    9  
ATOM   5081  H  HA   . VAL A 1 14 ? -2.061  -4.178  2.826   1.00 0.00 ? 14  VAL A HA   9  
ATOM   5082  H  HB   . VAL A 1 14 ? -1.627  -6.711  1.246   1.00 0.00 ? 14  VAL A HB   9  
ATOM   5083  H  HG11 . VAL A 1 14 ? -0.013  -5.534  3.078   1.00 0.00 ? 14  VAL A HG11 9  
ATOM   5084  H  HG12 . VAL A 1 14 ? -0.993  -6.576  4.111   1.00 0.00 ? 14  VAL A HG12 9  
ATOM   5085  H  HG13 . VAL A 1 14 ? -0.075  -7.270  2.774   1.00 0.00 ? 14  VAL A HG13 9  
ATOM   5086  H  HG21 . VAL A 1 14 ? -2.962  -6.935  3.843   1.00 0.00 ? 14  VAL A HG21 9  
ATOM   5087  H  HG22 . VAL A 1 14 ? -3.930  -6.151  2.594   1.00 0.00 ? 14  VAL A HG22 9  
ATOM   5088  H  HG23 . VAL A 1 14 ? -3.286  -7.770  2.325   1.00 0.00 ? 14  VAL A HG23 9  
ATOM   5089  N  N    . CYS A 1 15 ? 0.161   -3.699  1.740   1.00 0.00 ? 15  CYS A N    9  
ATOM   5090  C  CA   . CYS A 1 15 ? 1.346   -3.178  1.069   1.00 0.00 ? 15  CYS A CA   9  
ATOM   5091  C  C    . CYS A 1 15 ? 2.209   -4.314  0.530   1.00 0.00 ? 15  CYS A C    9  
ATOM   5092  O  O    . CYS A 1 15 ? 2.784   -5.088  1.295   1.00 0.00 ? 15  CYS A O    9  
ATOM   5093  C  CB   . CYS A 1 15 ? 2.163   -2.314  2.031   1.00 0.00 ? 15  CYS A CB   9  
ATOM   5094  S  SG   . CYS A 1 15 ? 3.091   -0.972  1.220   1.00 0.00 ? 15  CYS A SG   9  
ATOM   5095  H  H    . CYS A 1 15 ? 0.119   -3.679  2.720   1.00 0.00 ? 15  CYS A H    9  
ATOM   5096  H  HA   . CYS A 1 15 ? 1.017   -2.567  0.242   1.00 0.00 ? 15  CYS A HA   9  
ATOM   5097  H  HB2  . CYS A 1 15 ? 1.497   -1.862  2.752   1.00 0.00 ? 15  CYS A HB2  9  
ATOM   5098  H  HB3  . CYS A 1 15 ? 2.875   -2.940  2.549   1.00 0.00 ? 15  CYS A HB3  9  
ATOM   5099  N  N    . ASN A 1 16 ? 2.295   -4.408  -0.793  1.00 0.00 ? 16  ASN A N    9  
ATOM   5100  C  CA   . ASN A 1 16 ? 3.088   -5.449  -1.436  1.00 0.00 ? 16  ASN A CA   9  
ATOM   5101  C  C    . ASN A 1 16 ? 4.580   -5.170  -1.282  1.00 0.00 ? 16  ASN A C    9  
ATOM   5102  O  O    . ASN A 1 16 ? 5.416   -5.908  -1.803  1.00 0.00 ? 16  ASN A O    9  
ATOM   5103  C  CB   . ASN A 1 16 ? 2.727   -5.553  -2.919  1.00 0.00 ? 16  ASN A CB   9  
ATOM   5104  C  CG   . ASN A 1 16 ? 1.427   -6.299  -3.147  1.00 0.00 ? 16  ASN A CG   9  
ATOM   5105  O  OD1  . ASN A 1 16 ? 1.426   -7.499  -3.421  1.00 0.00 ? 16  ASN A OD1  9  
ATOM   5106  N  ND2  . ASN A 1 16 ? 0.310   -5.589  -3.034  1.00 0.00 ? 16  ASN A ND2  9  
ATOM   5107  H  H    . ASN A 1 16 ? 1.814   -3.761  -1.351  1.00 0.00 ? 16  ASN A H    9  
ATOM   5108  H  HA   . ASN A 1 16 ? 2.858   -6.387  -0.952  1.00 0.00 ? 16  ASN A HA   9  
ATOM   5109  H  HB2  . ASN A 1 16 ? 2.625   -4.558  -3.328  1.00 0.00 ? 16  ASN A HB2  9  
ATOM   5110  H  HB3  . ASN A 1 16 ? 3.516   -6.073  -3.440  1.00 0.00 ? 16  ASN A HB3  9  
ATOM   5111  H  HD21 . ASN A 1 16 ? 0.386   -4.637  -2.812  1.00 0.00 ? 16  ASN A HD21 9  
ATOM   5112  H  HD22 . ASN A 1 16 ? -0.545  -6.046  -3.175  1.00 0.00 ? 16  ASN A HD22 9  
ATOM   5113  N  N    . GLU A 1 17 ? 4.906   -4.100  -0.564  1.00 0.00 ? 17  GLU A N    9  
ATOM   5114  C  CA   . GLU A 1 17 ? 6.297   -3.723  -0.343  1.00 0.00 ? 17  GLU A CA   9  
ATOM   5115  C  C    . GLU A 1 17 ? 6.781   -4.207  1.021   1.00 0.00 ? 17  GLU A C    9  
ATOM   5116  O  O    . GLU A 1 17 ? 7.829   -4.844  1.130   1.00 0.00 ? 17  GLU A O    9  
ATOM   5117  C  CB   . GLU A 1 17 ? 6.460   -2.205  -0.445  1.00 0.00 ? 17  GLU A CB   9  
ATOM   5118  C  CG   . GLU A 1 17 ? 5.984   -1.629  -1.768  1.00 0.00 ? 17  GLU A CG   9  
ATOM   5119  C  CD   . GLU A 1 17 ? 6.746   -0.381  -2.169  1.00 0.00 ? 17  GLU A CD   9  
ATOM   5120  O  OE1  . GLU A 1 17 ? 7.991   -0.391  -2.079  1.00 0.00 ? 17  GLU A OE1  9  
ATOM   5121  O  OE2  . GLU A 1 17 ? 6.096   0.605   -2.574  1.00 0.00 ? 17  GLU A OE2  9  
ATOM   5122  H  H    . GLU A 1 17 ? 4.194   -3.550  -0.175  1.00 0.00 ? 17  GLU A H    9  
ATOM   5123  H  HA   . GLU A 1 17 ? 6.894   -4.192  -1.110  1.00 0.00 ? 17  GLU A HA   9  
ATOM   5124  H  HB2  . GLU A 1 17 ? 5.896   -1.740  0.350   1.00 0.00 ? 17  GLU A HB2  9  
ATOM   5125  H  HB3  . GLU A 1 17 ? 7.505   -1.959  -0.325  1.00 0.00 ? 17  GLU A HB3  9  
ATOM   5126  H  HG2  . GLU A 1 17 ? 6.114   -2.375  -2.538  1.00 0.00 ? 17  GLU A HG2  9  
ATOM   5127  H  HG3  . GLU A 1 17 ? 4.936   -1.382  -1.682  1.00 0.00 ? 17  GLU A HG3  9  
ATOM   5128  N  N    . CYS A 1 18 ? 6.011   -3.899  2.059   1.00 0.00 ? 18  CYS A N    9  
ATOM   5129  C  CA   . CYS A 1 18 ? 6.360   -4.301  3.416   1.00 0.00 ? 18  CYS A CA   9  
ATOM   5130  C  C    . CYS A 1 18 ? 5.373   -5.337  3.948   1.00 0.00 ? 18  CYS A C    9  
ATOM   5131  O  O    . CYS A 1 18 ? 5.740   -6.217  4.725   1.00 0.00 ? 18  CYS A O    9  
ATOM   5132  C  CB   . CYS A 1 18 ? 6.384   -3.082  4.341   1.00 0.00 ? 18  CYS A CB   9  
ATOM   5133  S  SG   . CYS A 1 18 ? 4.850   -2.098  4.314   1.00 0.00 ? 18  CYS A SG   9  
ATOM   5134  H  H    . CYS A 1 18 ? 5.187   -3.389  1.909   1.00 0.00 ? 18  CYS A H    9  
ATOM   5135  H  HA   . CYS A 1 18 ? 7.345   -4.741  3.390   1.00 0.00 ? 18  CYS A HA   9  
ATOM   5136  H  HB2  . CYS A 1 18 ? 6.543   -3.413  5.357   1.00 0.00 ? 18  CYS A HB2  9  
ATOM   5137  H  HB3  . CYS A 1 18 ? 7.196   -2.433  4.048   1.00 0.00 ? 18  CYS A HB3  9  
ATOM   5138  N  N    . GLY A 1 19 ? 4.119   -5.224  3.522   1.00 0.00 ? 19  GLY A N    9  
ATOM   5139  C  CA   . GLY A 1 19 ? 3.099   -6.157  3.964   1.00 0.00 ? 19  GLY A CA   9  
ATOM   5140  C  C    . GLY A 1 19 ? 2.084   -5.511  4.888   1.00 0.00 ? 19  GLY A C    9  
ATOM   5141  O  O    . GLY A 1 19 ? 1.269   -6.198  5.504   1.00 0.00 ? 19  GLY A O    9  
ATOM   5142  H  H    . GLY A 1 19 ? 3.884   -4.502  2.902   1.00 0.00 ? 19  GLY A H    9  
ATOM   5143  H  HA2  . GLY A 1 19 ? 2.585   -6.548  3.099   1.00 0.00 ? 19  GLY A HA2  9  
ATOM   5144  H  HA3  . GLY A 1 19 ? 3.576   -6.973  4.487   1.00 0.00 ? 19  GLY A HA3  9  
ATOM   5145  N  N    . LYS A 1 20 ? 2.135   -4.187  4.987   1.00 0.00 ? 20  LYS A N    9  
ATOM   5146  C  CA   . LYS A 1 20 ? 1.214   -3.448  5.842   1.00 0.00 ? 20  LYS A CA   9  
ATOM   5147  C  C    . LYS A 1 20 ? -0.223  -3.601  5.355   1.00 0.00 ? 20  LYS A C    9  
ATOM   5148  O  O    . LYS A 1 20 ? -0.575  -3.134  4.271   1.00 0.00 ? 20  LYS A O    9  
ATOM   5149  C  CB   . LYS A 1 20 ? 1.597   -1.966  5.877   1.00 0.00 ? 20  LYS A CB   9  
ATOM   5150  C  CG   . LYS A 1 20 ? 1.299   -1.293  7.205   1.00 0.00 ? 20  LYS A CG   9  
ATOM   5151  C  CD   . LYS A 1 20 ? -0.179  -1.368  7.550   1.00 0.00 ? 20  LYS A CD   9  
ATOM   5152  C  CE   . LYS A 1 20 ? -0.576  -0.284  8.540   1.00 0.00 ? 20  LYS A CE   9  
ATOM   5153  N  NZ   . LYS A 1 20 ? -1.861  -0.601  9.223   1.00 0.00 ? 20  LYS A NZ   9  
ATOM   5154  H  H    . LYS A 1 20 ? 2.808   -3.695  4.470   1.00 0.00 ? 20  LYS A H    9  
ATOM   5155  H  HA   . LYS A 1 20 ? 1.289   -3.854  6.839   1.00 0.00 ? 20  LYS A HA   9  
ATOM   5156  H  HB2  . LYS A 1 20 ? 2.655   -1.875  5.679   1.00 0.00 ? 20  LYS A HB2  9  
ATOM   5157  H  HB3  . LYS A 1 20 ? 1.049   -1.447  5.103   1.00 0.00 ? 20  LYS A HB3  9  
ATOM   5158  H  HG2  . LYS A 1 20 ? 1.865   -1.784  7.983   1.00 0.00 ? 20  LYS A HG2  9  
ATOM   5159  H  HG3  . LYS A 1 20 ? 1.593   -0.254  7.145   1.00 0.00 ? 20  LYS A HG3  9  
ATOM   5160  H  HD2  . LYS A 1 20 ? -0.757  -1.244  6.647   1.00 0.00 ? 20  LYS A HD2  9  
ATOM   5161  H  HD3  . LYS A 1 20 ? -0.389  -2.335  7.984   1.00 0.00 ? 20  LYS A HD3  9  
ATOM   5162  H  HE2  . LYS A 1 20 ? 0.202   -0.190  9.282   1.00 0.00 ? 20  LYS A HE2  9  
ATOM   5163  H  HE3  . LYS A 1 20 ? -0.681  0.650   8.008   1.00 0.00 ? 20  LYS A HE3  9  
ATOM   5164  H  HZ1  . LYS A 1 20 ? -1.685  -1.187  10.063  1.00 0.00 ? 20  LYS A HZ1  9  
ATOM   5165  H  HZ2  . LYS A 1 20 ? -2.490  -1.119  8.577   1.00 0.00 ? 20  LYS A HZ2  9  
ATOM   5166  H  HZ3  . LYS A 1 20 ? -2.334  0.277   9.519   1.00 0.00 ? 20  LYS A HZ3  9  
ATOM   5167  N  N    . ALA A 1 21 ? -1.050  -4.257  6.162   1.00 0.00 ? 21  ALA A N    9  
ATOM   5168  C  CA   . ALA A 1 21 ? -2.450  -4.468  5.815   1.00 0.00 ? 21  ALA A CA   9  
ATOM   5169  C  C    . ALA A 1 21 ? -3.318  -3.316  6.309   1.00 0.00 ? 21  ALA A C    9  
ATOM   5170  O  O    . ALA A 1 21 ? -3.098  -2.782  7.396   1.00 0.00 ? 21  ALA A O    9  
ATOM   5171  C  CB   . ALA A 1 21 ? -2.943  -5.788  6.389   1.00 0.00 ? 21  ALA A CB   9  
ATOM   5172  H  H    . ALA A 1 21 ? -0.711  -4.605  7.013   1.00 0.00 ? 21  ALA A H    9  
ATOM   5173  H  HA   . ALA A 1 21 ? -2.522  -4.523  4.738   1.00 0.00 ? 21  ALA A HA   9  
ATOM   5174  H  HB1  . ALA A 1 21 ? -3.948  -5.977  6.043   1.00 0.00 ? 21  ALA A HB1  9  
ATOM   5175  H  HB2  . ALA A 1 21 ? -2.293  -6.587  6.063   1.00 0.00 ? 21  ALA A HB2  9  
ATOM   5176  H  HB3  . ALA A 1 21 ? -2.936  -5.736  7.467   1.00 0.00 ? 21  ALA A HB3  9  
ATOM   5177  N  N    . PHE A 1 22 ? -4.306  -2.938  5.505   1.00 0.00 ? 22  PHE A N    9  
ATOM   5178  C  CA   . PHE A 1 22 ? -5.207  -1.848  5.860   1.00 0.00 ? 22  PHE A CA   9  
ATOM   5179  C  C    . PHE A 1 22 ? -6.663  -2.260  5.665   1.00 0.00 ? 22  PHE A C    9  
ATOM   5180  O  O    . PHE A 1 22 ? -6.956  -3.412  5.346   1.00 0.00 ? 22  PHE A O    9  
ATOM   5181  C  CB   . PHE A 1 22 ? -4.898  -0.608  5.019   1.00 0.00 ? 22  PHE A CB   9  
ATOM   5182  C  CG   . PHE A 1 22 ? -3.469  -0.158  5.116   1.00 0.00 ? 22  PHE A CG   9  
ATOM   5183  C  CD1  . PHE A 1 22 ? -2.481  -0.776  4.365   1.00 0.00 ? 22  PHE A CD1  9  
ATOM   5184  C  CD2  . PHE A 1 22 ? -3.112  0.883   5.958   1.00 0.00 ? 22  PHE A CD2  9  
ATOM   5185  C  CE1  . PHE A 1 22 ? -1.165  -0.364  4.452   1.00 0.00 ? 22  PHE A CE1  9  
ATOM   5186  C  CE2  . PHE A 1 22 ? -1.797  1.299   6.048   1.00 0.00 ? 22  PHE A CE2  9  
ATOM   5187  C  CZ   . PHE A 1 22 ? -0.822  0.674   5.295   1.00 0.00 ? 22  PHE A CZ   9  
ATOM   5188  H  H    . PHE A 1 22 ? -4.431  -3.403  4.651   1.00 0.00 ? 22  PHE A H    9  
ATOM   5189  H  HA   . PHE A 1 22 ? -5.048  -1.614  6.902   1.00 0.00 ? 22  PHE A HA   9  
ATOM   5190  H  HB2  . PHE A 1 22 ? -5.108  -0.824  3.982   1.00 0.00 ? 22  PHE A HB2  9  
ATOM   5191  H  HB3  . PHE A 1 22 ? -5.527  0.206   5.346   1.00 0.00 ? 22  PHE A HB3  9  
ATOM   5192  H  HD1  . PHE A 1 22 ? -2.749  -1.589  3.705   1.00 0.00 ? 22  PHE A HD1  9  
ATOM   5193  H  HD2  . PHE A 1 22 ? -3.873  1.372   6.548   1.00 0.00 ? 22  PHE A HD2  9  
ATOM   5194  H  HE1  . PHE A 1 22 ? -0.405  -0.855  3.862   1.00 0.00 ? 22  PHE A HE1  9  
ATOM   5195  H  HE2  . PHE A 1 22 ? -1.532  2.111   6.709   1.00 0.00 ? 22  PHE A HE2  9  
ATOM   5196  H  HZ   . PHE A 1 22 ? 0.206   0.998   5.364   1.00 0.00 ? 22  PHE A HZ   9  
ATOM   5197  N  N    . ARG A 1 23 ? -7.572  -1.310  5.858   1.00 0.00 ? 23  ARG A N    9  
ATOM   5198  C  CA   . ARG A 1 23 ? -8.997  -1.573  5.705   1.00 0.00 ? 23  ARG A CA   9  
ATOM   5199  C  C    . ARG A 1 23 ? -9.486  -1.138  4.327   1.00 0.00 ? 23  ARG A C    9  
ATOM   5200  O  O    . ARG A 1 23 ? -10.324 -1.801  3.716   1.00 0.00 ? 23  ARG A O    9  
ATOM   5201  C  CB   . ARG A 1 23 ? -9.791  -0.847  6.793   1.00 0.00 ? 23  ARG A CB   9  
ATOM   5202  C  CG   . ARG A 1 23 ? -11.133 -1.491  7.100   1.00 0.00 ? 23  ARG A CG   9  
ATOM   5203  C  CD   . ARG A 1 23 ? -11.835 -0.793  8.254   1.00 0.00 ? 23  ARG A CD   9  
ATOM   5204  N  NE   . ARG A 1 23 ? -11.357 -1.262  9.551   1.00 0.00 ? 23  ARG A NE   9  
ATOM   5205  C  CZ   . ARG A 1 23 ? -11.722 -2.418  10.095  1.00 0.00 ? 23  ARG A CZ   9  
ATOM   5206  N  NH1  . ARG A 1 23 ? -12.566 -3.217  9.457   1.00 0.00 ? 23  ARG A NH1  9  
ATOM   5207  N  NH2  . ARG A 1 23 ? -11.244 -2.776  11.280  1.00 0.00 ? 23  ARG A NH2  9  
ATOM   5208  H  H    . ARG A 1 23 ? -7.276  -0.410  6.111   1.00 0.00 ? 23  ARG A H    9  
ATOM   5209  H  HA   . ARG A 1 23 ? -9.151  -2.637  5.810   1.00 0.00 ? 23  ARG A HA   9  
ATOM   5210  H  HB2  . ARG A 1 23 ? -9.207  -0.833  7.701   1.00 0.00 ? 23  ARG A HB2  9  
ATOM   5211  H  HB3  . ARG A 1 23 ? -9.970  0.169   6.473   1.00 0.00 ? 23  ARG A HB3  9  
ATOM   5212  H  HG2  . ARG A 1 23 ? -11.760 -1.432  6.223   1.00 0.00 ? 23  ARG A HG2  9  
ATOM   5213  H  HG3  . ARG A 1 23 ? -10.972 -2.527  7.362   1.00 0.00 ? 23  ARG A HG3  9  
ATOM   5214  H  HD2  . ARG A 1 23 ? -11.655 0.269   8.178   1.00 0.00 ? 23  ARG A HD2  9  
ATOM   5215  H  HD3  . ARG A 1 23 ? -12.895 -0.984  8.181   1.00 0.00 ? 23  ARG A HD3  9  
ATOM   5216  H  HE   . ARG A 1 23 ? -10.733 -0.687  10.041  1.00 0.00 ? 23  ARG A HE   9  
ATOM   5217  H  HH11 . ARG A 1 23 ? -12.927 -2.951  8.563   1.00 0.00 ? 23  ARG A HH11 9  
ATOM   5218  H  HH12 . ARG A 1 23 ? -12.838 -4.088  9.868   1.00 0.00 ? 23  ARG A HH12 9  
ATOM   5219  H  HH21 . ARG A 1 23 ? -10.608 -2.176  11.764  1.00 0.00 ? 23  ARG A HH21 9  
ATOM   5220  H  HH22 . ARG A 1 23 ? -11.519 -3.646  11.688  1.00 0.00 ? 23  ARG A HH22 9  
ATOM   5221  N  N    . SER A 1 24 ? -8.956  -0.019  3.843   1.00 0.00 ? 24  SER A N    9  
ATOM   5222  C  CA   . SER A 1 24 ? -9.341  0.508   2.539   1.00 0.00 ? 24  SER A CA   9  
ATOM   5223  C  C    . SER A 1 24 ? -8.110  0.864   1.712   1.00 0.00 ? 24  SER A C    9  
ATOM   5224  O  O    . SER A 1 24 ? -6.990  0.892   2.223   1.00 0.00 ? 24  SER A O    9  
ATOM   5225  C  CB   . SER A 1 24 ? -10.231 1.741   2.706   1.00 0.00 ? 24  SER A CB   9  
ATOM   5226  O  OG   . SER A 1 24 ? -9.504  2.824   3.257   1.00 0.00 ? 24  SER A OG   9  
ATOM   5227  H  H    . SER A 1 24 ? -8.292  0.465   4.378   1.00 0.00 ? 24  SER A H    9  
ATOM   5228  H  HA   . SER A 1 24 ? -9.898  -0.260  2.023   1.00 0.00 ? 24  SER A HA   9  
ATOM   5229  H  HB2  . SER A 1 24 ? -10.618 2.035   1.742   1.00 0.00 ? 24  SER A HB2  9  
ATOM   5230  H  HB3  . SER A 1 24 ? -11.053 1.501   3.365   1.00 0.00 ? 24  SER A HB3  9  
ATOM   5231  H  HG   . SER A 1 24 ? -9.264  3.438   2.559   1.00 0.00 ? 24  SER A HG   9  
ATOM   5232  N  N    . LYS A 1 25 ? -8.325  1.136   0.429   1.00 0.00 ? 25  LYS A N    9  
ATOM   5233  C  CA   . LYS A 1 25 ? -7.235  1.491   -0.471  1.00 0.00 ? 25  LYS A CA   9  
ATOM   5234  C  C    . LYS A 1 25 ? -6.694  2.881   -0.148  1.00 0.00 ? 25  LYS A C    9  
ATOM   5235  O  O    . LYS A 1 25 ? -5.497  3.138   -0.282  1.00 0.00 ? 25  LYS A O    9  
ATOM   5236  C  CB   . LYS A 1 25 ? -7.710  1.443   -1.925  1.00 0.00 ? 25  LYS A CB   9  
ATOM   5237  C  CG   . LYS A 1 25 ? -7.576  0.071   -2.564  1.00 0.00 ? 25  LYS A CG   9  
ATOM   5238  C  CD   . LYS A 1 25 ? -7.624  0.155   -4.080  1.00 0.00 ? 25  LYS A CD   9  
ATOM   5239  C  CE   . LYS A 1 25 ? -9.003  0.570   -4.572  1.00 0.00 ? 25  LYS A CE   9  
ATOM   5240  N  NZ   . LYS A 1 25 ? -9.123  0.450   -6.051  1.00 0.00 ? 25  LYS A NZ   9  
ATOM   5241  H  H    . LYS A 1 25 ? -9.240  1.097   0.079   1.00 0.00 ? 25  LYS A H    9  
ATOM   5242  H  HA   . LYS A 1 25 ? -6.444  0.770   -0.336  1.00 0.00 ? 25  LYS A HA   9  
ATOM   5243  H  HB2  . LYS A 1 25 ? -8.750  1.733   -1.961  1.00 0.00 ? 25  LYS A HB2  9  
ATOM   5244  H  HB3  . LYS A 1 25 ? -7.129  2.146   -2.505  1.00 0.00 ? 25  LYS A HB3  9  
ATOM   5245  H  HG2  . LYS A 1 25 ? -6.632  -0.362  -2.268  1.00 0.00 ? 25  LYS A HG2  9  
ATOM   5246  H  HG3  . LYS A 1 25 ? -8.386  -0.556  -2.221  1.00 0.00 ? 25  LYS A HG3  9  
ATOM   5247  H  HD2  . LYS A 1 25 ? -6.901  0.884   -4.415  1.00 0.00 ? 25  LYS A HD2  9  
ATOM   5248  H  HD3  . LYS A 1 25 ? -7.380  -0.813  -4.494  1.00 0.00 ? 25  LYS A HD3  9  
ATOM   5249  H  HE2  . LYS A 1 25 ? -9.742  -0.064  -4.106  1.00 0.00 ? 25  LYS A HE2  9  
ATOM   5250  H  HE3  . LYS A 1 25 ? -9.178  1.597   -4.287  1.00 0.00 ? 25  LYS A HE3  9  
ATOM   5251  H  HZ1  . LYS A 1 25 ? -9.943  -0.141  -6.296  1.00 0.00 ? 25  LYS A HZ1  9  
ATOM   5252  H  HZ2  . LYS A 1 25 ? -8.264  0.015   -6.445  1.00 0.00 ? 25  LYS A HZ2  9  
ATOM   5253  H  HZ3  . LYS A 1 25 ? -9.248  1.391   -6.477  1.00 0.00 ? 25  LYS A HZ3  9  
ATOM   5254  N  N    . SER A 1 26 ? -7.582  3.772   0.279   1.00 0.00 ? 26  SER A N    9  
ATOM   5255  C  CA   . SER A 1 26 ? -7.194  5.136   0.619   1.00 0.00 ? 26  SER A CA   9  
ATOM   5256  C  C    . SER A 1 26 ? -6.171  5.143   1.751   1.00 0.00 ? 26  SER A C    9  
ATOM   5257  O  O    . SER A 1 26 ? -5.291  6.002   1.801   1.00 0.00 ? 26  SER A O    9  
ATOM   5258  C  CB   . SER A 1 26 ? -8.423  5.954   1.021   1.00 0.00 ? 26  SER A CB   9  
ATOM   5259  O  OG   . SER A 1 26 ? -8.244  7.326   0.716   1.00 0.00 ? 26  SER A OG   9  
ATOM   5260  H  H    . SER A 1 26 ? -8.522  3.507   0.365   1.00 0.00 ? 26  SER A H    9  
ATOM   5261  H  HA   . SER A 1 26 ? -6.747  5.581   -0.258  1.00 0.00 ? 26  SER A HA   9  
ATOM   5262  H  HB2  . SER A 1 26 ? -9.286  5.588   0.486   1.00 0.00 ? 26  SER A HB2  9  
ATOM   5263  H  HB3  . SER A 1 26 ? -8.588  5.851   2.084   1.00 0.00 ? 26  SER A HB3  9  
ATOM   5264  H  HG   . SER A 1 26 ? -9.051  7.677   0.333   1.00 0.00 ? 26  SER A HG   9  
ATOM   5265  N  N    . TYR A 1 27 ? -6.295  4.180   2.657   1.00 0.00 ? 27  TYR A N    9  
ATOM   5266  C  CA   . TYR A 1 27 ? -5.384  4.076   3.791   1.00 0.00 ? 27  TYR A CA   9  
ATOM   5267  C  C    . TYR A 1 27 ? -4.020  3.555   3.347   1.00 0.00 ? 27  TYR A C    9  
ATOM   5268  O  O    . TYR A 1 27 ? -2.981  4.036   3.801   1.00 0.00 ? 27  TYR A O    9  
ATOM   5269  C  CB   . TYR A 1 27 ? -5.971  3.155   4.861   1.00 0.00 ? 27  TYR A CB   9  
ATOM   5270  C  CG   . TYR A 1 27 ? -5.580  3.537   6.270   1.00 0.00 ? 27  TYR A CG   9  
ATOM   5271  C  CD1  . TYR A 1 27 ? -4.244  3.689   6.624   1.00 0.00 ? 27  TYR A CD1  9  
ATOM   5272  C  CD2  . TYR A 1 27 ? -6.544  3.745   7.248   1.00 0.00 ? 27  TYR A CD2  9  
ATOM   5273  C  CE1  . TYR A 1 27 ? -3.882  4.037   7.911   1.00 0.00 ? 27  TYR A CE1  9  
ATOM   5274  C  CE2  . TYR A 1 27 ? -6.191  4.095   8.537   1.00 0.00 ? 27  TYR A CE2  9  
ATOM   5275  C  CZ   . TYR A 1 27 ? -4.859  4.240   8.864   1.00 0.00 ? 27  TYR A CZ   9  
ATOM   5276  O  OH   . TYR A 1 27 ? -4.502  4.587   10.147  1.00 0.00 ? 27  TYR A OH   9  
ATOM   5277  H  H    . TYR A 1 27 ? -7.017  3.525   2.563   1.00 0.00 ? 27  TYR A H    9  
ATOM   5278  H  HA   . TYR A 1 27 ? -5.260  5.064   4.209   1.00 0.00 ? 27  TYR A HA   9  
ATOM   5279  H  HB2  . TYR A 1 27 ? -7.048  3.181   4.798   1.00 0.00 ? 27  TYR A HB2  9  
ATOM   5280  H  HB3  . TYR A 1 27 ? -5.630  2.145   4.684   1.00 0.00 ? 27  TYR A HB3  9  
ATOM   5281  H  HD1  . TYR A 1 27 ? -3.482  3.529   5.876   1.00 0.00 ? 27  TYR A HD1  9  
ATOM   5282  H  HD2  . TYR A 1 27 ? -7.587  3.631   6.989   1.00 0.00 ? 27  TYR A HD2  9  
ATOM   5283  H  HE1  . TYR A 1 27 ? -2.839  4.151   8.167   1.00 0.00 ? 27  TYR A HE1  9  
ATOM   5284  H  HE2  . TYR A 1 27 ? -6.955  4.254   9.283   1.00 0.00 ? 27  TYR A HE2  9  
ATOM   5285  H  HH   . TYR A 1 27 ? -5.132  5.225   10.492  1.00 0.00 ? 27  TYR A HH   9  
ATOM   5286  N  N    . LEU A 1 28 ? -4.032  2.568   2.458   1.00 0.00 ? 28  LEU A N    9  
ATOM   5287  C  CA   . LEU A 1 28 ? -2.797  1.980   1.951   1.00 0.00 ? 28  LEU A CA   9  
ATOM   5288  C  C    . LEU A 1 28 ? -2.091  2.936   0.995   1.00 0.00 ? 28  LEU A C    9  
ATOM   5289  O  O    . LEU A 1 28 ? -0.862  2.992   0.953   1.00 0.00 ? 28  LEU A O    9  
ATOM   5290  C  CB   . LEU A 1 28 ? -3.092  0.657   1.242   1.00 0.00 ? 28  LEU A CB   9  
ATOM   5291  C  CG   . LEU A 1 28 ? -1.990  0.125   0.326   1.00 0.00 ? 28  LEU A CG   9  
ATOM   5292  C  CD1  . LEU A 1 28 ? -0.828  -0.414  1.146   1.00 0.00 ? 28  LEU A CD1  9  
ATOM   5293  C  CD2  . LEU A 1 28 ? -2.537  -0.952  -0.599  1.00 0.00 ? 28  LEU A CD2  9  
ATOM   5294  H  H    . LEU A 1 28 ? -4.891  2.226   2.134   1.00 0.00 ? 28  LEU A H    9  
ATOM   5295  H  HA   . LEU A 1 28 ? -2.150  1.790   2.795   1.00 0.00 ? 28  LEU A HA   9  
ATOM   5296  H  HB2  . LEU A 1 28 ? -3.281  -0.089  1.999   1.00 0.00 ? 28  LEU A HB2  9  
ATOM   5297  H  HB3  . LEU A 1 28 ? -3.983  0.794   0.645   1.00 0.00 ? 28  LEU A HB3  9  
ATOM   5298  H  HG   . LEU A 1 28 ? -1.617  0.935   -0.286  1.00 0.00 ? 28  LEU A HG   9  
ATOM   5299  H  HD11 . LEU A 1 28 ? -0.830  0.051   2.121   1.00 0.00 ? 28  LEU A HD11 9  
ATOM   5300  H  HD12 . LEU A 1 28 ? 0.102   -0.192  0.643   1.00 0.00 ? 28  LEU A HD12 9  
ATOM   5301  H  HD13 . LEU A 1 28 ? -0.931  -1.483  1.256   1.00 0.00 ? 28  LEU A HD13 9  
ATOM   5302  H  HD21 . LEU A 1 28 ? -3.505  -1.273  -0.244  1.00 0.00 ? 28  LEU A HD21 9  
ATOM   5303  H  HD22 . LEU A 1 28 ? -1.861  -1.794  -0.610  1.00 0.00 ? 28  LEU A HD22 9  
ATOM   5304  H  HD23 . LEU A 1 28 ? -2.633  -0.554  -1.598  1.00 0.00 ? 28  LEU A HD23 9  
ATOM   5305  N  N    . ILE A 1 29 ? -2.876  3.687   0.230   1.00 0.00 ? 29  ILE A N    9  
ATOM   5306  C  CA   . ILE A 1 29 ? -2.326  4.643   -0.722  1.00 0.00 ? 29  ILE A CA   9  
ATOM   5307  C  C    . ILE A 1 29 ? -1.518  5.723   -0.012  1.00 0.00 ? 29  ILE A C    9  
ATOM   5308  O  O    . ILE A 1 29 ? -0.430  6.092   -0.457  1.00 0.00 ? 29  ILE A O    9  
ATOM   5309  C  CB   . ILE A 1 29 ? -3.437  5.311   -1.554  1.00 0.00 ? 29  ILE A CB   9  
ATOM   5310  C  CG1  . ILE A 1 29 ? -4.066  4.298   -2.513  1.00 0.00 ? 29  ILE A CG1  9  
ATOM   5311  C  CG2  . ILE A 1 29 ? -2.880  6.501   -2.322  1.00 0.00 ? 29  ILE A CG2  9  
ATOM   5312  C  CD1  . ILE A 1 29 ? -5.492  4.631   -2.893  1.00 0.00 ? 29  ILE A CD1  9  
ATOM   5313  H  H    . ILE A 1 29 ? -3.849  3.596   0.310   1.00 0.00 ? 29  ILE A H    9  
ATOM   5314  H  HA   . ILE A 1 29 ? -1.674  4.104   -1.396  1.00 0.00 ? 29  ILE A HA   9  
ATOM   5315  H  HB   . ILE A 1 29 ? -4.194  5.674   -0.877  1.00 0.00 ? 29  ILE A HB   9  
ATOM   5316  H  HG12 . ILE A 1 29 ? -3.482  4.259   -3.419  1.00 0.00 ? 29  ILE A HG12 9  
ATOM   5317  H  HG13 . ILE A 1 29 ? -4.065  3.324   -2.046  1.00 0.00 ? 29  ILE A HG13 9  
ATOM   5318  H  HG21 . ILE A 1 29 ? -3.152  6.415   -3.364  1.00 0.00 ? 29  ILE A HG21 9  
ATOM   5319  H  HG22 . ILE A 1 29 ? -3.290  7.414   -1.918  1.00 0.00 ? 29  ILE A HG22 9  
ATOM   5320  H  HG23 . ILE A 1 29 ? -1.804  6.517   -2.231  1.00 0.00 ? 29  ILE A HG23 9  
ATOM   5321  H  HD11 . ILE A 1 29 ? -5.986  3.739   -3.252  1.00 0.00 ? 29  ILE A HD11 9  
ATOM   5322  H  HD12 . ILE A 1 29 ? -6.017  5.008   -2.028  1.00 0.00 ? 29  ILE A HD12 9  
ATOM   5323  H  HD13 . ILE A 1 29 ? -5.492  5.380   -3.670  1.00 0.00 ? 29  ILE A HD13 9  
ATOM   5324  N  N    . ILE A 1 30 ? -2.056  6.227   1.093   1.00 0.00 ? 30  ILE A N    9  
ATOM   5325  C  CA   . ILE A 1 30 ? -1.384  7.263   1.867   1.00 0.00 ? 30  ILE A CA   9  
ATOM   5326  C  C    . ILE A 1 30 ? -0.160  6.705   2.586   1.00 0.00 ? 30  ILE A C    9  
ATOM   5327  O  O    . ILE A 1 30 ? 0.671   7.458   3.096   1.00 0.00 ? 30  ILE A O    9  
ATOM   5328  C  CB   . ILE A 1 30 ? -2.330  7.895   2.904   1.00 0.00 ? 30  ILE A CB   9  
ATOM   5329  C  CG1  . ILE A 1 30 ? -2.774  6.848   3.927   1.00 0.00 ? 30  ILE A CG1  9  
ATOM   5330  C  CG2  . ILE A 1 30 ? -3.537  8.513   2.212   1.00 0.00 ? 30  ILE A CG2  9  
ATOM   5331  C  CD1  . ILE A 1 30 ? -3.103  7.430   5.284   1.00 0.00 ? 30  ILE A CD1  9  
ATOM   5332  H  H    . ILE A 1 30 ? -2.926  5.892   1.397   1.00 0.00 ? 30  ILE A H    9  
ATOM   5333  H  HA   . ILE A 1 30 ? -1.065  8.035   1.182   1.00 0.00 ? 30  ILE A HA   9  
ATOM   5334  H  HB   . ILE A 1 30 ? -1.796  8.682   3.413   1.00 0.00 ? 30  ILE A HB   9  
ATOM   5335  H  HG12 . ILE A 1 30 ? -3.655  6.345   3.560   1.00 0.00 ? 30  ILE A HG12 9  
ATOM   5336  H  HG13 . ILE A 1 30 ? -1.981  6.126   4.059   1.00 0.00 ? 30  ILE A HG13 9  
ATOM   5337  H  HG21 . ILE A 1 30 ? -3.657  9.534   2.542   1.00 0.00 ? 30  ILE A HG21 9  
ATOM   5338  H  HG22 . ILE A 1 30 ? -3.386  8.496   1.144   1.00 0.00 ? 30  ILE A HG22 9  
ATOM   5339  H  HG23 . ILE A 1 30 ? -4.422  7.948   2.461   1.00 0.00 ? 30  ILE A HG23 9  
ATOM   5340  H  HD11 . ILE A 1 30 ? -2.341  7.142   5.994   1.00 0.00 ? 30  ILE A HD11 9  
ATOM   5341  H  HD12 . ILE A 1 30 ? -3.140  8.507   5.214   1.00 0.00 ? 30  ILE A HD12 9  
ATOM   5342  H  HD13 . ILE A 1 30 ? -4.061  7.057   5.613   1.00 0.00 ? 30  ILE A HD13 9  
ATOM   5343  N  N    . HIS A 1 31 ? -0.053  5.381   2.621   1.00 0.00 ? 31  HIS A N    9  
ATOM   5344  C  CA   . HIS A 1 31 ? 1.071   4.721   3.275   1.00 0.00 ? 31  HIS A CA   9  
ATOM   5345  C  C    . HIS A 1 31 ? 2.175   4.405   2.271   1.00 0.00 ? 31  HIS A C    9  
ATOM   5346  O  O    . HIS A 1 31 ? 3.332   4.777   2.465   1.00 0.00 ? 31  HIS A O    9  
ATOM   5347  C  CB   . HIS A 1 31 ? 0.607   3.437   3.962   1.00 0.00 ? 31  HIS A CB   9  
ATOM   5348  C  CG   . HIS A 1 31 ? 1.702   2.435   4.163   1.00 0.00 ? 31  HIS A CG   9  
ATOM   5349  N  ND1  . HIS A 1 31 ? 2.210   2.114   5.403   1.00 0.00 ? 31  HIS A ND1  9  
ATOM   5350  C  CD2  . HIS A 1 31 ? 2.385   1.680   3.271   1.00 0.00 ? 31  HIS A CD2  9  
ATOM   5351  C  CE1  . HIS A 1 31 ? 3.160   1.206   5.266   1.00 0.00 ? 31  HIS A CE1  9  
ATOM   5352  N  NE2  . HIS A 1 31 ? 3.286   0.925   3.981   1.00 0.00 ? 31  HIS A NE2  9  
ATOM   5353  H  H    . HIS A 1 31 ? -0.747  4.834   2.197   1.00 0.00 ? 31  HIS A H    9  
ATOM   5354  H  HA   . HIS A 1 31 ? 1.463   5.396   4.021   1.00 0.00 ? 31  HIS A HA   9  
ATOM   5355  H  HB2  . HIS A 1 31 ? 0.201   3.682   4.932   1.00 0.00 ? 31  HIS A HB2  9  
ATOM   5356  H  HB3  . HIS A 1 31 ? -0.163  2.973   3.362   1.00 0.00 ? 31  HIS A HB3  9  
ATOM   5357  H  HD1  . HIS A 1 31 ? 1.919   2.495   6.257   1.00 0.00 ? 31  HIS A HD1  9  
ATOM   5358  H  HD2  . HIS A 1 31 ? 2.249   1.673   2.198   1.00 0.00 ? 31  HIS A HD2  9  
ATOM   5359  H  HE1  . HIS A 1 31 ? 3.736   0.767   6.067   1.00 0.00 ? 31  HIS A HE1  9  
ATOM   5360  N  N    . THR A 1 32 ? 1.809   3.713   1.195   1.00 0.00 ? 32  THR A N    9  
ATOM   5361  C  CA   . THR A 1 32 ? 2.768   3.345   0.161   1.00 0.00 ? 32  THR A CA   9  
ATOM   5362  C  C    . THR A 1 32 ? 3.716   4.498   -0.145  1.00 0.00 ? 32  THR A C    9  
ATOM   5363  O  O    . THR A 1 32 ? 4.862   4.283   -0.543  1.00 0.00 ? 32  THR A O    9  
ATOM   5364  C  CB   . THR A 1 32 ? 2.058   2.920   -1.138  1.00 0.00 ? 32  THR A CB   9  
ATOM   5365  O  OG1  . THR A 1 32 ? 1.089   1.904   -0.856  1.00 0.00 ? 32  THR A OG1  9  
ATOM   5366  C  CG2  . THR A 1 32 ? 3.060   2.403   -2.158  1.00 0.00 ? 32  THR A CG2  9  
ATOM   5367  H  H    . THR A 1 32 ? 0.872   3.445   1.097   1.00 0.00 ? 32  THR A H    9  
ATOM   5368  H  HA   . THR A 1 32 ? 3.343   2.505   0.524   1.00 0.00 ? 32  THR A HA   9  
ATOM   5369  H  HB   . THR A 1 32 ? 1.555   3.781   -1.553  1.00 0.00 ? 32  THR A HB   9  
ATOM   5370  H  HG1  . THR A 1 32 ? 1.079   1.723   0.087   1.00 0.00 ? 32  THR A HG1  9  
ATOM   5371  H  HG21 . THR A 1 32 ? 3.098   1.325   -2.111  1.00 0.00 ? 32  THR A HG21 9  
ATOM   5372  H  HG22 . THR A 1 32 ? 4.038   2.807   -1.940  1.00 0.00 ? 32  THR A HG22 9  
ATOM   5373  H  HG23 . THR A 1 32 ? 2.757   2.710   -3.148  1.00 0.00 ? 32  THR A HG23 9  
ATOM   5374  N  N    . ARG A 1 33 ? 3.233   5.722   0.042   1.00 0.00 ? 33  ARG A N    9  
ATOM   5375  C  CA   . ARG A 1 33 ? 4.038   6.909   -0.215  1.00 0.00 ? 33  ARG A CA   9  
ATOM   5376  C  C    . ARG A 1 33 ? 5.239   6.966   0.724   1.00 0.00 ? 33  ARG A C    9  
ATOM   5377  O  O    . ARG A 1 33 ? 6.351   7.298   0.311   1.00 0.00 ? 33  ARG A O    9  
ATOM   5378  C  CB   . ARG A 1 33 ? 3.190   8.172   -0.052  1.00 0.00 ? 33  ARG A CB   9  
ATOM   5379  C  CG   . ARG A 1 33 ? 2.330   8.170   1.201   1.00 0.00 ? 33  ARG A CG   9  
ATOM   5380  C  CD   . ARG A 1 33 ? 1.752   9.549   1.482   1.00 0.00 ? 33  ARG A CD   9  
ATOM   5381  N  NE   . ARG A 1 33 ? 2.788   10.511  1.849   1.00 0.00 ? 33  ARG A NE   9  
ATOM   5382  C  CZ   . ARG A 1 33 ? 2.528   11.738  2.289   1.00 0.00 ? 33  ARG A CZ   9  
ATOM   5383  N  NH1  . ARG A 1 33 ? 1.274   12.148  2.416   1.00 0.00 ? 33  ARG A NH1  9  
ATOM   5384  N  NH2  . ARG A 1 33 ? 3.524   12.556  2.604   1.00 0.00 ? 33  ARG A NH2  9  
ATOM   5385  H  H    . ARG A 1 33 ? 2.312   5.829   0.361   1.00 0.00 ? 33  ARG A H    9  
ATOM   5386  H  HA   . ARG A 1 33 ? 4.394   6.855   -1.233  1.00 0.00 ? 33  ARG A HA   9  
ATOM   5387  H  HB2  . ARG A 1 33 ? 3.845   9.029   -0.011  1.00 0.00 ? 33  ARG A HB2  9  
ATOM   5388  H  HB3  . ARG A 1 33 ? 2.540   8.267   -0.909  1.00 0.00 ? 33  ARG A HB3  9  
ATOM   5389  H  HG2  . ARG A 1 33 ? 1.516   7.472   1.067   1.00 0.00 ? 33  ARG A HG2  9  
ATOM   5390  H  HG3  . ARG A 1 33 ? 2.935   7.865   2.041   1.00 0.00 ? 33  ARG A HG3  9  
ATOM   5391  H  HD2  . ARG A 1 33 ? 1.246   9.900   0.595   1.00 0.00 ? 33  ARG A HD2  9  
ATOM   5392  H  HD3  . ARG A 1 33 ? 1.044   9.469   2.293   1.00 0.00 ? 33  ARG A HD3  9  
ATOM   5393  H  HE   . ARG A 1 33 ? 3.721   10.228  1.763   1.00 0.00 ? 33  ARG A HE   9  
ATOM   5394  H  HH11 . ARG A 1 33 ? 0.521   11.534  2.181   1.00 0.00 ? 33  ARG A HH11 9  
ATOM   5395  H  HH12 . ARG A 1 33 ? 1.081   13.072  2.749   1.00 0.00 ? 33  ARG A HH12 9  
ATOM   5396  H  HH21 . ARG A 1 33 ? 4.471   12.249  2.510   1.00 0.00 ? 33  ARG A HH21 9  
ATOM   5397  H  HH22 . ARG A 1 33 ? 3.328   13.478  2.935   1.00 0.00 ? 33  ARG A HH22 9  
ATOM   5398  N  N    . THR A 1 34 ? 5.008   6.640   1.992   1.00 0.00 ? 34  THR A N    9  
ATOM   5399  C  CA   . THR A 1 34 ? 6.069   6.655   2.991   1.00 0.00 ? 34  THR A CA   9  
ATOM   5400  C  C    . THR A 1 34 ? 7.333   5.987   2.461   1.00 0.00 ? 34  THR A C    9  
ATOM   5401  O  O    . THR A 1 34 ? 8.435   6.251   2.942   1.00 0.00 ? 34  THR A O    9  
ATOM   5402  C  CB   . THR A 1 34 ? 5.632   5.946   4.287   1.00 0.00 ? 34  THR A CB   9  
ATOM   5403  O  OG1  . THR A 1 34 ? 6.510   6.302   5.361   1.00 0.00 ? 34  THR A OG1  9  
ATOM   5404  C  CG2  . THR A 1 34 ? 5.633   4.436   4.104   1.00 0.00 ? 34  THR A CG2  9  
ATOM   5405  H  H    . THR A 1 34 ? 4.101   6.384   2.261   1.00 0.00 ? 34  THR A H    9  
ATOM   5406  H  HA   . THR A 1 34 ? 6.291   7.686   3.227   1.00 0.00 ? 34  THR A HA   9  
ATOM   5407  H  HB   . THR A 1 34 ? 4.628   6.264   4.532   1.00 0.00 ? 34  THR A HB   9  
ATOM   5408  H  HG1  . THR A 1 34 ? 7.334   5.817   5.275   1.00 0.00 ? 34  THR A HG1  9  
ATOM   5409  H  HG21 . THR A 1 34 ? 4.924   3.991   4.786   1.00 0.00 ? 34  THR A HG21 9  
ATOM   5410  H  HG22 . THR A 1 34 ? 6.620   4.049   4.308   1.00 0.00 ? 34  THR A HG22 9  
ATOM   5411  H  HG23 . THR A 1 34 ? 5.355   4.196   3.088   1.00 0.00 ? 34  THR A HG23 9  
ATOM   5412  N  N    . HIS A 1 35 ? 7.166   5.120   1.468   1.00 0.00 ? 35  HIS A N    9  
ATOM   5413  C  CA   . HIS A 1 35 ? 8.294   4.414   0.871   1.00 0.00 ? 35  HIS A CA   9  
ATOM   5414  C  C    . HIS A 1 35 ? 9.012   5.297   -0.145  1.00 0.00 ? 35  HIS A C    9  
ATOM   5415  O  O    . HIS A 1 35 ? 9.805   4.814   -0.954  1.00 0.00 ? 35  HIS A O    9  
ATOM   5416  C  CB   . HIS A 1 35 ? 7.819   3.126   0.198   1.00 0.00 ? 35  HIS A CB   9  
ATOM   5417  C  CG   . HIS A 1 35 ? 7.226   2.135   1.153   1.00 0.00 ? 35  HIS A CG   9  
ATOM   5418  N  ND1  . HIS A 1 35 ? 7.930   1.062   1.657   1.00 0.00 ? 35  HIS A ND1  9  
ATOM   5419  C  CD2  . HIS A 1 35 ? 5.989   2.061   1.696   1.00 0.00 ? 35  HIS A CD2  9  
ATOM   5420  C  CE1  . HIS A 1 35 ? 7.150   0.369   2.468   1.00 0.00 ? 35  HIS A CE1  9  
ATOM   5421  N  NE2  . HIS A 1 35 ? 5.967   0.955   2.509   1.00 0.00 ? 35  HIS A NE2  9  
ATOM   5422  H  H    . HIS A 1 35 ? 6.262   4.951   1.127   1.00 0.00 ? 35  HIS A H    9  
ATOM   5423  H  HA   . HIS A 1 35 ? 8.984   4.163   1.662   1.00 0.00 ? 35  HIS A HA   9  
ATOM   5424  H  HB2  . HIS A 1 35 ? 7.067   3.368   -0.538  1.00 0.00 ? 35  HIS A HB2  9  
ATOM   5425  H  HB3  . HIS A 1 35 ? 8.658   2.653   -0.293  1.00 0.00 ? 35  HIS A HB3  9  
ATOM   5426  H  HD1  . HIS A 1 35 ? 8.861   0.840   1.450   1.00 0.00 ? 35  HIS A HD1  9  
ATOM   5427  H  HD2  . HIS A 1 35 ? 5.169   2.744   1.522   1.00 0.00 ? 35  HIS A HD2  9  
ATOM   5428  H  HE1  . HIS A 1 35 ? 7.432   -0.523  3.006   1.00 0.00 ? 35  HIS A HE1  9  
ATOM   5429  N  N    . THR A 1 36 ? 8.729   6.596   -0.098  1.00 0.00 ? 36  THR A N    9  
ATOM   5430  C  CA   . THR A 1 36 ? 9.345   7.546   -1.015  1.00 0.00 ? 36  THR A CA   9  
ATOM   5431  C  C    . THR A 1 36 ? 10.576  8.193   -0.390  1.00 0.00 ? 36  THR A C    9  
ATOM   5432  O  O    . THR A 1 36 ? 11.588  8.399   -1.059  1.00 0.00 ? 36  THR A O    9  
ATOM   5433  C  CB   . THR A 1 36 ? 8.354   8.649   -1.430  1.00 0.00 ? 36  THR A CB   9  
ATOM   5434  O  OG1  . THR A 1 36 ? 7.365   8.112   -2.315  1.00 0.00 ? 36  THR A OG1  9  
ATOM   5435  C  CG2  . THR A 1 36 ? 9.079   9.800   -2.112  1.00 0.00 ? 36  THR A CG2  9  
ATOM   5436  H  H    . THR A 1 36 ? 8.089   6.920   0.569   1.00 0.00 ? 36  THR A H    9  
ATOM   5437  H  HA   . THR A 1 36 ? 9.644   7.007   -1.902  1.00 0.00 ? 36  THR A HA   9  
ATOM   5438  H  HB   . THR A 1 36 ? 7.866   9.026   -0.543  1.00 0.00 ? 36  THR A HB   9  
ATOM   5439  H  HG1  . THR A 1 36 ? 6.865   7.430   -1.860  1.00 0.00 ? 36  THR A HG1  9  
ATOM   5440  H  HG21 . THR A 1 36 ? 9.689   9.415   -2.915  1.00 0.00 ? 36  THR A HG21 9  
ATOM   5441  H  HG22 . THR A 1 36 ? 9.708   10.305  -1.394  1.00 0.00 ? 36  THR A HG22 9  
ATOM   5442  H  HG23 . THR A 1 36 ? 8.356   10.496  -2.510  1.00 0.00 ? 36  THR A HG23 9  
ATOM   5443  N  N    . GLY A 1 37 ? 10.483  8.512   0.897   1.00 0.00 ? 37  GLY A N    9  
ATOM   5444  C  CA   . GLY A 1 37 ? 11.596  9.132   1.591   1.00 0.00 ? 37  GLY A CA   9  
ATOM   5445  C  C    . GLY A 1 37 ? 12.088  8.300   2.758   1.00 0.00 ? 37  GLY A C    9  
ATOM   5446  O  O    . GLY A 1 37 ? 11.794  8.605   3.913   1.00 0.00 ? 37  GLY A O    9  
ATOM   5447  H  H    . GLY A 1 37 ? 9.651   8.324   1.380   1.00 0.00 ? 37  GLY A H    9  
ATOM   5448  H  HA2  . GLY A 1 37 ? 12.409  9.270   0.893   1.00 0.00 ? 37  GLY A HA2  9  
ATOM   5449  H  HA3  . GLY A 1 37 ? 11.283  10.098  1.959   1.00 0.00 ? 37  GLY A HA3  9  
ATOM   5450  N  N    . GLU A 1 38 ? 12.839  7.244   2.456   1.00 0.00 ? 38  GLU A N    9  
ATOM   5451  C  CA   . GLU A 1 38 ? 13.370  6.364   3.491   1.00 0.00 ? 38  GLU A CA   9  
ATOM   5452  C  C    . GLU A 1 38 ? 14.768  6.804   3.913   1.00 0.00 ? 38  GLU A C    9  
ATOM   5453  O  O    . GLU A 1 38 ? 15.662  6.954   3.080   1.00 0.00 ? 38  GLU A O    9  
ATOM   5454  C  CB   . GLU A 1 38 ? 13.407  4.919   2.992   1.00 0.00 ? 38  GLU A CB   9  
ATOM   5455  C  CG   . GLU A 1 38 ? 13.341  3.888   4.107   1.00 0.00 ? 38  GLU A CG   9  
ATOM   5456  C  CD   . GLU A 1 38 ? 14.442  4.069   5.134   1.00 0.00 ? 38  GLU A CD   9  
ATOM   5457  O  OE1  . GLU A 1 38 ? 15.554  3.545   4.911   1.00 0.00 ? 38  GLU A OE1  9  
ATOM   5458  O  OE2  . GLU A 1 38 ? 14.191  4.734   6.160   1.00 0.00 ? 38  GLU A OE2  9  
ATOM   5459  H  H    . GLU A 1 38 ? 13.039  7.053   1.516   1.00 0.00 ? 38  GLU A H    9  
ATOM   5460  H  HA   . GLU A 1 38 ? 12.713  6.424   4.346   1.00 0.00 ? 38  GLU A HA   9  
ATOM   5461  H  HB2  . GLU A 1 38 ? 12.569  4.757   2.330   1.00 0.00 ? 38  GLU A HB2  9  
ATOM   5462  H  HB3  . GLU A 1 38 ? 14.323  4.764   2.441   1.00 0.00 ? 38  GLU A HB3  9  
ATOM   5463  H  HG2  . GLU A 1 38 ? 12.387  3.976   4.605   1.00 0.00 ? 38  GLU A HG2  9  
ATOM   5464  H  HG3  . GLU A 1 38 ? 13.431  2.902   3.674   1.00 0.00 ? 38  GLU A HG3  9  
ATOM   5465  N  N    . SER A 1 39 ? 14.950  7.010   5.214   1.00 0.00 ? 39  SER A N    9  
ATOM   5466  C  CA   . SER A 1 39 ? 16.238  7.437   5.748   1.00 0.00 ? 39  SER A CA   9  
ATOM   5467  C  C    . SER A 1 39 ? 17.386  6.819   4.956   1.00 0.00 ? 39  SER A C    9  
ATOM   5468  O  O    . SER A 1 39 ? 18.205  7.528   4.372   1.00 0.00 ? 39  SER A O    9  
ATOM   5469  C  CB   . SER A 1 39 ? 16.356  7.051   7.224   1.00 0.00 ? 39  SER A CB   9  
ATOM   5470  O  OG   . SER A 1 39 ? 17.380  7.791   7.865   1.00 0.00 ? 39  SER A OG   9  
ATOM   5471  H  H    . SER A 1 39 ? 14.199  6.873   5.829   1.00 0.00 ? 39  SER A H    9  
ATOM   5472  H  HA   . SER A 1 39 ? 16.293  8.512   5.661   1.00 0.00 ? 39  SER A HA   9  
ATOM   5473  H  HB2  . SER A 1 39 ? 15.419  7.250   7.721   1.00 0.00 ? 39  SER A HB2  9  
ATOM   5474  H  HB3  . SER A 1 39 ? 16.587  5.998   7.300   1.00 0.00 ? 39  SER A HB3  9  
ATOM   5475  H  HG   . SER A 1 39 ? 17.104  8.706   7.956   1.00 0.00 ? 39  SER A HG   9  
ATOM   5476  N  N    . GLY A 1 40 ? 17.439  5.490   4.941   1.00 0.00 ? 40  GLY A N    9  
ATOM   5477  C  CA   . GLY A 1 40 ? 18.490  4.798   4.218   1.00 0.00 ? 40  GLY A CA   9  
ATOM   5478  C  C    . GLY A 1 40 ? 18.034  4.309   2.858   1.00 0.00 ? 40  GLY A C    9  
ATOM   5479  O  O    . GLY A 1 40 ? 16.849  4.353   2.525   1.00 0.00 ? 40  GLY A O    9  
ATOM   5480  H  H    . GLY A 1 40 ? 16.759  4.976   5.425   1.00 0.00 ? 40  GLY A H    9  
ATOM   5481  H  HA2  . GLY A 1 40 ? 19.325  5.470   4.087   1.00 0.00 ? 40  GLY A HA2  9  
ATOM   5482  H  HA3  . GLY A 1 40 ? 18.814  3.949   4.803   1.00 0.00 ? 40  GLY A HA3  9  
ATOM   5483  N  N    . PRO A 1 41 ? 18.988  3.833   2.045   1.00 0.00 ? 41  PRO A N    9  
ATOM   5484  C  CA   . PRO A 1 41 ? 18.702  3.326   0.700   1.00 0.00 ? 41  PRO A CA   9  
ATOM   5485  C  C    . PRO A 1 41 ? 17.932  2.011   0.728   1.00 0.00 ? 41  PRO A C    9  
ATOM   5486  O  O    . PRO A 1 41 ? 17.894  1.324   1.749   1.00 0.00 ? 41  PRO A O    9  
ATOM   5487  C  CB   . PRO A 1 41 ? 20.093  3.119   0.095   1.00 0.00 ? 41  PRO A CB   9  
ATOM   5488  C  CG   . PRO A 1 41 ? 20.988  2.910   1.268   1.00 0.00 ? 41  PRO A CG   9  
ATOM   5489  C  CD   . PRO A 1 41 ? 20.421  3.752   2.377   1.00 0.00 ? 41  PRO A CD   9  
ATOM   5490  H  HA   . PRO A 1 41 ? 18.156  4.049   0.111   1.00 0.00 ? 41  PRO A HA   9  
ATOM   5491  H  HB2  . PRO A 1 41 ? 20.081  2.254   -0.553  1.00 0.00 ? 41  PRO A HB2  9  
ATOM   5492  H  HB3  . PRO A 1 41 ? 20.378  3.995   -0.468  1.00 0.00 ? 41  PRO A HB3  9  
ATOM   5493  H  HG2  . PRO A 1 41 ? 20.987  1.868   1.549   1.00 0.00 ? 41  PRO A HG2  9  
ATOM   5494  H  HG3  . PRO A 1 41 ? 21.990  3.234   1.026   1.00 0.00 ? 41  PRO A HG3  9  
ATOM   5495  H  HD2  . PRO A 1 41 ? 20.568  3.268   3.331   1.00 0.00 ? 41  PRO A HD2  9  
ATOM   5496  H  HD3  . PRO A 1 41 ? 20.872  4.733   2.375   1.00 0.00 ? 41  PRO A HD3  9  
ATOM   5497  N  N    . SER A 1 42 ? 17.319  1.665   -0.400  1.00 0.00 ? 42  SER A N    9  
ATOM   5498  C  CA   . SER A 1 42 ? 16.547  0.432   -0.504  1.00 0.00 ? 42  SER A CA   9  
ATOM   5499  C  C    . SER A 1 42 ? 17.449  -0.789  -0.350  1.00 0.00 ? 42  SER A C    9  
ATOM   5500  O  O    . SER A 1 42 ? 18.255  -1.093  -1.229  1.00 0.00 ? 42  SER A O    9  
ATOM   5501  C  CB   . SER A 1 42 ? 15.816  0.374   -1.847  1.00 0.00 ? 42  SER A CB   9  
ATOM   5502  O  OG   . SER A 1 42 ? 16.735  0.336   -2.926  1.00 0.00 ? 42  SER A OG   9  
ATOM   5503  H  H    . SER A 1 42 ? 17.387  2.254   -1.181  1.00 0.00 ? 42  SER A H    9  
ATOM   5504  H  HA   . SER A 1 42 ? 15.818  0.430   0.293   1.00 0.00 ? 42  SER A HA   9  
ATOM   5505  H  HB2  . SER A 1 42 ? 15.202  -0.512  -1.882  1.00 0.00 ? 42  SER A HB2  9  
ATOM   5506  H  HB3  . SER A 1 42 ? 15.192  1.250   -1.952  1.00 0.00 ? 42  SER A HB3  9  
ATOM   5507  H  HG   . SER A 1 42 ? 17.430  0.981   -2.777  1.00 0.00 ? 42  SER A HG   9  
ATOM   5508  N  N    . SER A 1 43 ? 17.306  -1.484  0.774   1.00 0.00 ? 43  SER A N    9  
ATOM   5509  C  CA   . SER A 1 43 ? 18.110  -2.670  1.046   1.00 0.00 ? 43  SER A CA   9  
ATOM   5510  C  C    . SER A 1 43 ? 17.288  -3.940  0.853   1.00 0.00 ? 43  SER A C    9  
ATOM   5511  O  O    . SER A 1 43 ? 16.063  -3.890  0.751   1.00 0.00 ? 43  SER A O    9  
ATOM   5512  C  CB   . SER A 1 43 ? 18.664  -2.620  2.471   1.00 0.00 ? 43  SER A CB   9  
ATOM   5513  O  OG   . SER A 1 43 ? 17.619  -2.500  3.421   1.00 0.00 ? 43  SER A OG   9  
ATOM   5514  H  H    . SER A 1 43 ? 16.646  -1.191  1.437   1.00 0.00 ? 43  SER A H    9  
ATOM   5515  H  HA   . SER A 1 43 ? 18.935  -2.679  0.349   1.00 0.00 ? 43  SER A HA   9  
ATOM   5516  H  HB2  . SER A 1 43 ? 19.215  -3.526  2.673   1.00 0.00 ? 43  SER A HB2  9  
ATOM   5517  H  HB3  . SER A 1 43 ? 19.323  -1.769  2.569   1.00 0.00 ? 43  SER A HB3  9  
ATOM   5518  H  HG   . SER A 1 43 ? 17.640  -1.623  3.811   1.00 0.00 ? 43  SER A HG   9  
ATOM   5519  N  N    . GLY A 1 44 ? 17.972  -5.079  0.802   1.00 0.00 ? 44  GLY A N    9  
ATOM   5520  C  CA   . GLY A 1 44 ? 17.290  -6.347  0.621   1.00 0.00 ? 44  GLY A CA   9  
ATOM   5521  C  C    . GLY A 1 44 ? 16.967  -6.629  -0.833  1.00 0.00 ? 44  GLY A C    9  
ATOM   5522  O  O    . GLY A 1 44 ? 16.396  -5.766  -1.498  1.00 0.00 ? 44  GLY A O    9  
ATOM   5523  H  H    . GLY A 1 44 ? 18.948  -5.058  0.889   1.00 0.00 ? 44  GLY A H    9  
ATOM   5524  H  HA2  . GLY A 1 44 ? 17.918  -7.139  1.000   1.00 0.00 ? 44  GLY A HA2  9  
ATOM   5525  H  HA3  . GLY A 1 44 ? 16.369  -6.331  1.185   1.00 0.00 ? 44  GLY A HA3  9  
HETATM 5526  ZN ZN   . ZN  B 2 .  ? 4.594   -0.380  2.984   1.00 0.00 ? 181 ZN  A ZN   9  
ATOM   5527  N  N    . GLY A 1 1  ? 12.577  -30.630 -7.024  1.00 0.00 ? 1   GLY A N    10 
ATOM   5528  C  CA   . GLY A 1 1  ? 12.042  -29.303 -7.267  1.00 0.00 ? 1   GLY A CA   10 
ATOM   5529  C  C    . GLY A 1 1  ? 10.687  -29.096 -6.620  1.00 0.00 ? 1   GLY A C    10 
ATOM   5530  O  O    . GLY A 1 1  ? 9.675   -29.596 -7.110  1.00 0.00 ? 1   GLY A O    10 
ATOM   5531  H  H1   . GLY A 1 1  ? 12.006  -31.321 -6.628  1.00 0.00 ? 1   GLY A H1   10 
ATOM   5532  H  HA2  . GLY A 1 1  ? 12.732  -28.571 -6.875  1.00 0.00 ? 1   GLY A HA2  10 
ATOM   5533  H  HA3  . GLY A 1 1  ? 11.945  -29.156 -8.333  1.00 0.00 ? 1   GLY A HA3  10 
ATOM   5534  N  N    . SER A 1 2  ? 10.667  -28.358 -5.515  1.00 0.00 ? 2   SER A N    10 
ATOM   5535  C  CA   . SER A 1 2  ? 9.427   -28.091 -4.796  1.00 0.00 ? 2   SER A CA   10 
ATOM   5536  C  C    . SER A 1 2  ? 8.728   -26.857 -5.359  1.00 0.00 ? 2   SER A C    10 
ATOM   5537  O  O    . SER A 1 2  ? 8.214   -26.026 -4.610  1.00 0.00 ? 2   SER A O    10 
ATOM   5538  C  CB   . SER A 1 2  ? 9.709   -27.895 -3.305  1.00 0.00 ? 2   SER A CB   10 
ATOM   5539  O  OG   . SER A 1 2  ? 9.664   -29.130 -2.611  1.00 0.00 ? 2   SER A OG   10 
ATOM   5540  H  H    . SER A 1 2  ? 11.508  -27.986 -5.173  1.00 0.00 ? 2   SER A H    10 
ATOM   5541  H  HA   . SER A 1 2  ? 8.780   -28.946 -4.922  1.00 0.00 ? 2   SER A HA   10 
ATOM   5542  H  HB2  . SER A 1 2  ? 10.689  -27.461 -3.180  1.00 0.00 ? 2   SER A HB2  10 
ATOM   5543  H  HB3  . SER A 1 2  ? 8.966   -27.233 -2.885  1.00 0.00 ? 2   SER A HB3  10 
ATOM   5544  H  HG   . SER A 1 2  ? 9.176   -29.020 -1.792  1.00 0.00 ? 2   SER A HG   10 
ATOM   5545  N  N    . SER A 1 3  ? 8.713   -26.746 -6.683  1.00 0.00 ? 3   SER A N    10 
ATOM   5546  C  CA   . SER A 1 3  ? 8.081   -25.612 -7.348  1.00 0.00 ? 3   SER A CA   10 
ATOM   5547  C  C    . SER A 1 3  ? 7.026   -26.086 -8.343  1.00 0.00 ? 3   SER A C    10 
ATOM   5548  O  O    . SER A 1 3  ? 7.264   -27.002 -9.129  1.00 0.00 ? 3   SER A O    10 
ATOM   5549  C  CB   . SER A 1 3  ? 9.132   -24.764 -8.066  1.00 0.00 ? 3   SER A CB   10 
ATOM   5550  O  OG   . SER A 1 3  ? 9.785   -25.510 -9.078  1.00 0.00 ? 3   SER A OG   10 
ATOM   5551  H  H    . SER A 1 3  ? 9.140   -27.441 -7.226  1.00 0.00 ? 3   SER A H    10 
ATOM   5552  H  HA   . SER A 1 3  ? 7.600   -25.010 -6.591  1.00 0.00 ? 3   SER A HA   10 
ATOM   5553  H  HB2  . SER A 1 3  ? 8.653   -23.909 -8.519  1.00 0.00 ? 3   SER A HB2  10 
ATOM   5554  H  HB3  . SER A 1 3  ? 9.868   -24.427 -7.351  1.00 0.00 ? 3   SER A HB3  10 
ATOM   5555  H  HG   . SER A 1 3  ? 9.273   -25.468 -9.889  1.00 0.00 ? 3   SER A HG   10 
ATOM   5556  N  N    . GLY A 1 4  ? 5.857   -25.453 -8.303  1.00 0.00 ? 4   GLY A N    10 
ATOM   5557  C  CA   . GLY A 1 4  ? 4.782   -25.822 -9.206  1.00 0.00 ? 4   GLY A CA   10 
ATOM   5558  C  C    . GLY A 1 4  ? 3.443   -25.261 -8.772  1.00 0.00 ? 4   GLY A C    10 
ATOM   5559  O  O    . GLY A 1 4  ? 2.597   -25.988 -8.250  1.00 0.00 ? 4   GLY A O    10 
ATOM   5560  H  H    . GLY A 1 4  ? 5.724   -24.729 -7.656  1.00 0.00 ? 4   GLY A H    10 
ATOM   5561  H  HA2  . GLY A 1 4  ? 5.013   -25.453 -10.194 1.00 0.00 ? 4   GLY A HA2  10 
ATOM   5562  H  HA3  . GLY A 1 4  ? 4.713   -26.900 -9.243  1.00 0.00 ? 4   GLY A HA3  10 
ATOM   5563  N  N    . SER A 1 5  ? 3.248   -23.964 -8.987  1.00 0.00 ? 5   SER A N    10 
ATOM   5564  C  CA   . SER A 1 5  ? 2.004   -23.304 -8.610  1.00 0.00 ? 5   SER A CA   10 
ATOM   5565  C  C    . SER A 1 5  ? 1.971   -21.869 -9.127  1.00 0.00 ? 5   SER A C    10 
ATOM   5566  O  O    . SER A 1 5  ? 2.656   -20.992 -8.600  1.00 0.00 ? 5   SER A O    10 
ATOM   5567  C  CB   . SER A 1 5  ? 1.837   -23.314 -7.089  1.00 0.00 ? 5   SER A CB   10 
ATOM   5568  O  OG   . SER A 1 5  ? 0.468   -23.313 -6.726  1.00 0.00 ? 5   SER A OG   10 
ATOM   5569  H  H    . SER A 1 5  ? 3.961   -23.438 -9.408  1.00 0.00 ? 5   SER A H    10 
ATOM   5570  H  HA   . SER A 1 5  ? 1.189   -23.854 -9.056  1.00 0.00 ? 5   SER A HA   10 
ATOM   5571  H  HB2  . SER A 1 5  ? 2.304   -24.199 -6.684  1.00 0.00 ? 5   SER A HB2  10 
ATOM   5572  H  HB3  . SER A 1 5  ? 2.309   -22.436 -6.672  1.00 0.00 ? 5   SER A HB3  10 
ATOM   5573  H  HG   . SER A 1 5  ? -0.051  -22.925 -7.435  1.00 0.00 ? 5   SER A HG   10 
ATOM   5574  N  N    . SER A 1 6  ? 1.170   -21.638 -10.162 1.00 0.00 ? 6   SER A N    10 
ATOM   5575  C  CA   . SER A 1 6  ? 1.050   -20.311 -10.754 1.00 0.00 ? 6   SER A CA   10 
ATOM   5576  C  C    . SER A 1 6  ? -0.409  -19.868 -10.803 1.00 0.00 ? 6   SER A C    10 
ATOM   5577  O  O    . SER A 1 6  ? -1.093  -20.056 -11.808 1.00 0.00 ? 6   SER A O    10 
ATOM   5578  C  CB   . SER A 1 6  ? 1.645   -20.302 -12.163 1.00 0.00 ? 6   SER A CB   10 
ATOM   5579  O  OG   . SER A 1 6  ? 1.271   -19.131 -12.868 1.00 0.00 ? 6   SER A OG   10 
ATOM   5580  H  H    . SER A 1 6  ? 0.649   -22.378 -10.538 1.00 0.00 ? 6   SER A H    10 
ATOM   5581  H  HA   . SER A 1 6  ? 1.603   -19.620 -10.135 1.00 0.00 ? 6   SER A HA   10 
ATOM   5582  H  HB2  . SER A 1 6  ? 2.722   -20.339 -12.097 1.00 0.00 ? 6   SER A HB2  10 
ATOM   5583  H  HB3  . SER A 1 6  ? 1.288   -21.164 -12.707 1.00 0.00 ? 6   SER A HB3  10 
ATOM   5584  H  HG   . SER A 1 6  ? 0.320   -19.124 -12.996 1.00 0.00 ? 6   SER A HG   10 
ATOM   5585  N  N    . GLY A 1 7  ? -0.880  -19.277 -9.709  1.00 0.00 ? 7   GLY A N    10 
ATOM   5586  C  CA   . GLY A 1 7  ? -2.254  -18.817 -9.647  1.00 0.00 ? 7   GLY A CA   10 
ATOM   5587  C  C    . GLY A 1 7  ? -2.714  -18.554 -8.226  1.00 0.00 ? 7   GLY A C    10 
ATOM   5588  O  O    . GLY A 1 7  ? -3.845  -18.877 -7.861  1.00 0.00 ? 7   GLY A O    10 
ATOM   5589  H  H    . GLY A 1 7  ? -0.288  -19.154 -8.937  1.00 0.00 ? 7   GLY A H    10 
ATOM   5590  H  HA2  . GLY A 1 7  ? -2.343  -17.905 -10.217 1.00 0.00 ? 7   GLY A HA2  10 
ATOM   5591  H  HA3  . GLY A 1 7  ? -2.894  -19.568 -10.086 1.00 0.00 ? 7   GLY A HA3  10 
ATOM   5592  N  N    . THR A 1 8  ? -1.835  -17.966 -7.421  1.00 0.00 ? 8   THR A N    10 
ATOM   5593  C  CA   . THR A 1 8  ? -2.155  -17.662 -6.032  1.00 0.00 ? 8   THR A CA   10 
ATOM   5594  C  C    . THR A 1 8  ? -1.243  -16.570 -5.483  1.00 0.00 ? 8   THR A C    10 
ATOM   5595  O  O    . THR A 1 8  ? -0.021  -16.710 -5.485  1.00 0.00 ? 8   THR A O    10 
ATOM   5596  C  CB   . THR A 1 8  ? -2.034  -18.912 -5.141  1.00 0.00 ? 8   THR A CB   10 
ATOM   5597  O  OG1  . THR A 1 8  ? -2.539  -18.631 -3.831  1.00 0.00 ? 8   THR A OG1  10 
ATOM   5598  C  CG2  . THR A 1 8  ? -0.586  -19.369 -5.044  1.00 0.00 ? 8   THR A CG2  10 
ATOM   5599  H  H    . THR A 1 8  ? -0.950  -17.732 -7.770  1.00 0.00 ? 8   THR A H    10 
ATOM   5600  H  HA   . THR A 1 8  ? -3.178  -17.316 -5.993  1.00 0.00 ? 8   THR A HA   10 
ATOM   5601  H  HB   . THR A 1 8  ? -2.618  -19.708 -5.581  1.00 0.00 ? 8   THR A HB   10 
ATOM   5602  H  HG1  . THR A 1 8  ? -3.491  -18.515 -3.873  1.00 0.00 ? 8   THR A HG1  10 
ATOM   5603  H  HG21 . THR A 1 8  ? -0.077  -19.150 -5.970  1.00 0.00 ? 8   THR A HG21 10 
ATOM   5604  H  HG22 . THR A 1 8  ? -0.556  -20.433 -4.861  1.00 0.00 ? 8   THR A HG22 10 
ATOM   5605  H  HG23 . THR A 1 8  ? -0.098  -18.850 -4.233  1.00 0.00 ? 8   THR A HG23 10 
ATOM   5606  N  N    . GLY A 1 9  ? -1.846  -15.482 -5.013  1.00 0.00 ? 9   GLY A N    10 
ATOM   5607  C  CA   . GLY A 1 9  ? -1.072  -14.383 -4.467  1.00 0.00 ? 9   GLY A CA   10 
ATOM   5608  C  C    . GLY A 1 9  ? -1.668  -13.031 -4.804  1.00 0.00 ? 9   GLY A C    10 
ATOM   5609  O  O    . GLY A 1 9  ? -1.120  -12.289 -5.619  1.00 0.00 ? 9   GLY A O    10 
ATOM   5610  H  H    . GLY A 1 9  ? -2.825  -15.426 -5.037  1.00 0.00 ? 9   GLY A H    10 
ATOM   5611  H  HA2  . GLY A 1 9  ? -1.027  -14.487 -3.393  1.00 0.00 ? 9   GLY A HA2  10 
ATOM   5612  H  HA3  . GLY A 1 9  ? -0.070  -14.431 -4.866  1.00 0.00 ? 9   GLY A HA3  10 
ATOM   5613  N  N    . MET A 1 10 ? -2.796  -12.710 -4.177  1.00 0.00 ? 10  MET A N    10 
ATOM   5614  C  CA   . MET A 1 10 ? -3.467  -11.437 -4.417  1.00 0.00 ? 10  MET A CA   10 
ATOM   5615  C  C    . MET A 1 10 ? -3.981  -10.840 -3.111  1.00 0.00 ? 10  MET A C    10 
ATOM   5616  O  O    . MET A 1 10 ? -4.857  -11.408 -2.458  1.00 0.00 ? 10  MET A O    10 
ATOM   5617  C  CB   . MET A 1 10 ? -4.626  -11.624 -5.397  1.00 0.00 ? 10  MET A CB   10 
ATOM   5618  C  CG   . MET A 1 10 ? -4.180  -11.819 -6.837  1.00 0.00 ? 10  MET A CG   10 
ATOM   5619  S  SD   . MET A 1 10 ? -5.540  -11.672 -8.011  1.00 0.00 ? 10  MET A SD   10 
ATOM   5620  C  CE   . MET A 1 10 ? -5.381  -13.214 -8.909  1.00 0.00 ? 10  MET A CE   10 
ATOM   5621  H  H    . MET A 1 10 ? -3.185  -13.342 -3.538  1.00 0.00 ? 10  MET A H    10 
ATOM   5622  H  HA   . MET A 1 10 ? -2.747  -10.760 -4.850  1.00 0.00 ? 10  MET A HA   10 
ATOM   5623  H  HB2  . MET A 1 10 ? -5.198  -12.491 -5.099  1.00 0.00 ? 10  MET A HB2  10 
ATOM   5624  H  HB3  . MET A 1 10 ? -5.262  -10.752 -5.355  1.00 0.00 ? 10  MET A HB3  10 
ATOM   5625  H  HG2  . MET A 1 10 ? -3.437  -11.073 -7.074  1.00 0.00 ? 10  MET A HG2  10 
ATOM   5626  H  HG3  . MET A 1 10 ? -3.743  -12.802 -6.933  1.00 0.00 ? 10  MET A HG3  10 
ATOM   5627  H  HE1  . MET A 1 10 ? -4.568  -13.136 -9.616  1.00 0.00 ? 10  MET A HE1  10 
ATOM   5628  H  HE2  . MET A 1 10 ? -5.178  -14.015 -8.214  1.00 0.00 ? 10  MET A HE2  10 
ATOM   5629  H  HE3  . MET A 1 10 ? -6.300  -13.419 -9.437  1.00 0.00 ? 10  MET A HE3  10 
ATOM   5630  N  N    . LYS A 1 11 ? -3.430  -9.691  -2.734  1.00 0.00 ? 11  LYS A N    10 
ATOM   5631  C  CA   . LYS A 1 11 ? -3.833  -9.015  -1.506  1.00 0.00 ? 11  LYS A CA   10 
ATOM   5632  C  C    . LYS A 1 11 ? -4.767  -7.848  -1.809  1.00 0.00 ? 11  LYS A C    10 
ATOM   5633  O  O    . LYS A 1 11 ? -4.699  -7.225  -2.869  1.00 0.00 ? 11  LYS A O    10 
ATOM   5634  C  CB   . LYS A 1 11 ? -2.602  -8.513  -0.748  1.00 0.00 ? 11  LYS A CB   10 
ATOM   5635  C  CG   . LYS A 1 11 ? -2.056  -9.514  0.256   1.00 0.00 ? 11  LYS A CG   10 
ATOM   5636  C  CD   . LYS A 1 11 ? -1.089  -10.487 -0.397  1.00 0.00 ? 11  LYS A CD   10 
ATOM   5637  C  CE   . LYS A 1 11 ? 0.256   -9.834  -0.678  1.00 0.00 ? 11  LYS A CE   10 
ATOM   5638  N  NZ   . LYS A 1 11 ? 1.197   -9.988  0.465   1.00 0.00 ? 11  LYS A NZ   10 
ATOM   5639  H  H    . LYS A 1 11 ? -2.736  -9.286  -3.296  1.00 0.00 ? 11  LYS A H    10 
ATOM   5640  H  HA   . LYS A 1 11 ? -4.357  -9.730  -0.891  1.00 0.00 ? 11  LYS A HA   10 
ATOM   5641  H  HB2  . LYS A 1 11 ? -1.822  -8.288  -1.461  1.00 0.00 ? 11  LYS A HB2  10 
ATOM   5642  H  HB3  . LYS A 1 11 ? -2.864  -7.609  -0.218  1.00 0.00 ? 11  LYS A HB3  10 
ATOM   5643  H  HG2  . LYS A 1 11 ? -1.538  -8.979  1.038   1.00 0.00 ? 11  LYS A HG2  10 
ATOM   5644  H  HG3  . LYS A 1 11 ? -2.880  -10.069 0.681   1.00 0.00 ? 11  LYS A HG3  10 
ATOM   5645  H  HD2  . LYS A 1 11 ? -0.936  -11.327 0.264   1.00 0.00 ? 11  LYS A HD2  10 
ATOM   5646  H  HD3  . LYS A 1 11 ? -1.514  -10.833 -1.329  1.00 0.00 ? 11  LYS A HD3  10 
ATOM   5647  H  HE2  . LYS A 1 11 ? 0.688   -10.293 -1.554  1.00 0.00 ? 11  LYS A HE2  10 
ATOM   5648  H  HE3  . LYS A 1 11 ? 0.097   -8.782  -0.864  1.00 0.00 ? 11  LYS A HE3  10 
ATOM   5649  H  HZ1  . LYS A 1 11 ? 1.957   -10.653 0.215   1.00 0.00 ? 11  LYS A HZ1  10 
ATOM   5650  H  HZ2  . LYS A 1 11 ? 0.691   -10.352 1.298   1.00 0.00 ? 11  LYS A HZ2  10 
ATOM   5651  H  HZ3  . LYS A 1 11 ? 1.621   -9.069  0.706   1.00 0.00 ? 11  LYS A HZ3  10 
ATOM   5652  N  N    . PRO A 1 12 ? -5.661  -7.542  -0.857  1.00 0.00 ? 12  PRO A N    10 
ATOM   5653  C  CA   . PRO A 1 12 ? -6.624  -6.446  -0.998  1.00 0.00 ? 12  PRO A CA   10 
ATOM   5654  C  C    . PRO A 1 12 ? -5.956  -5.076  -0.949  1.00 0.00 ? 12  PRO A C    10 
ATOM   5655  O  O    . PRO A 1 12 ? -5.546  -4.537  -1.977  1.00 0.00 ? 12  PRO A O    10 
ATOM   5656  C  CB   . PRO A 1 12 ? -7.552  -6.632  0.205   1.00 0.00 ? 12  PRO A CB   10 
ATOM   5657  C  CG   . PRO A 1 12 ? -6.724  -7.351  1.214   1.00 0.00 ? 12  PRO A CG   10 
ATOM   5658  C  CD   . PRO A 1 12 ? -5.799  -8.241  0.432   1.00 0.00 ? 12  PRO A CD   10 
ATOM   5659  H  HA   . PRO A 1 12 ? -7.194  -6.534  -1.911  1.00 0.00 ? 12  PRO A HA   10 
ATOM   5660  H  HB2  . PRO A 1 12 ? -7.870  -5.665  0.570   1.00 0.00 ? 12  PRO A HB2  10 
ATOM   5661  H  HB3  . PRO A 1 12 ? -8.413  -7.214  -0.086  1.00 0.00 ? 12  PRO A HB3  10 
ATOM   5662  H  HG2  . PRO A 1 12 ? -6.158  -6.641  1.797   1.00 0.00 ? 12  PRO A HG2  10 
ATOM   5663  H  HG3  . PRO A 1 12 ? -7.360  -7.943  1.855   1.00 0.00 ? 12  PRO A HG3  10 
ATOM   5664  H  HD2  . PRO A 1 12 ? -4.844  -8.324  0.930   1.00 0.00 ? 12  PRO A HD2  10 
ATOM   5665  H  HD3  . PRO A 1 12 ? -6.241  -9.217  0.294   1.00 0.00 ? 12  PRO A HD3  10 
ATOM   5666  N  N    . TYR A 1 13 ? -5.849  -4.518  0.252   1.00 0.00 ? 13  TYR A N    10 
ATOM   5667  C  CA   . TYR A 1 13 ? -5.232  -3.210  0.434   1.00 0.00 ? 13  TYR A CA   10 
ATOM   5668  C  C    . TYR A 1 13 ? -3.890  -3.336  1.149   1.00 0.00 ? 13  TYR A C    10 
ATOM   5669  O  O    . TYR A 1 13 ? -3.334  -2.348  1.630   1.00 0.00 ? 13  TYR A O    10 
ATOM   5670  C  CB   . TYR A 1 13 ? -6.161  -2.291  1.229   1.00 0.00 ? 13  TYR A CB   10 
ATOM   5671  C  CG   . TYR A 1 13 ? -7.625  -2.641  1.087   1.00 0.00 ? 13  TYR A CG   10 
ATOM   5672  C  CD1  . TYR A 1 13 ? -8.167  -3.730  1.757   1.00 0.00 ? 13  TYR A CD1  10 
ATOM   5673  C  CD2  . TYR A 1 13 ? -8.466  -1.881  0.283   1.00 0.00 ? 13  TYR A CD2  10 
ATOM   5674  C  CE1  . TYR A 1 13 ? -9.504  -4.054  1.630   1.00 0.00 ? 13  TYR A CE1  10 
ATOM   5675  C  CE2  . TYR A 1 13 ? -9.805  -2.197  0.151   1.00 0.00 ? 13  TYR A CE2  10 
ATOM   5676  C  CZ   . TYR A 1 13 ? -10.319 -3.284  0.826   1.00 0.00 ? 13  TYR A CZ   10 
ATOM   5677  O  OH   . TYR A 1 13 ? -11.651 -3.603  0.698   1.00 0.00 ? 13  TYR A OH   10 
ATOM   5678  H  H    . TYR A 1 13 ? -6.194  -4.997  1.034   1.00 0.00 ? 13  TYR A H    10 
ATOM   5679  H  HA   . TYR A 1 13 ? -5.067  -2.781  -0.544  1.00 0.00 ? 13  TYR A HA   10 
ATOM   5680  H  HB2  . TYR A 1 13 ? -5.906  -2.350  2.275   1.00 0.00 ? 13  TYR A HB2  10 
ATOM   5681  H  HB3  . TYR A 1 13 ? -6.028  -1.274  0.888   1.00 0.00 ? 13  TYR A HB3  10 
ATOM   5682  H  HD1  . TYR A 1 13 ? -7.526  -4.331  2.387   1.00 0.00 ? 13  TYR A HD1  10 
ATOM   5683  H  HD2  . TYR A 1 13 ? -8.061  -1.030  -0.245  1.00 0.00 ? 13  TYR A HD2  10 
ATOM   5684  H  HE1  . TYR A 1 13 ? -9.907  -4.905  2.159   1.00 0.00 ? 13  TYR A HE1  10 
ATOM   5685  H  HE2  . TYR A 1 13 ? -10.443 -1.595  -0.479  1.00 0.00 ? 13  TYR A HE2  10 
ATOM   5686  H  HH   . TYR A 1 13 ? -11.942 -3.409  -0.197  1.00 0.00 ? 13  TYR A HH   10 
ATOM   5687  N  N    . VAL A 1 14 ? -3.374  -4.559  1.214   1.00 0.00 ? 14  VAL A N    10 
ATOM   5688  C  CA   . VAL A 1 14 ? -2.096  -4.816  1.868   1.00 0.00 ? 14  VAL A CA   10 
ATOM   5689  C  C    . VAL A 1 14 ? -0.931  -4.357  0.998   1.00 0.00 ? 14  VAL A C    10 
ATOM   5690  O  O    . VAL A 1 14 ? -0.916  -4.588  -0.211  1.00 0.00 ? 14  VAL A O    10 
ATOM   5691  C  CB   . VAL A 1 14 ? -1.922  -6.312  2.192   1.00 0.00 ? 14  VAL A CB   10 
ATOM   5692  C  CG1  . VAL A 1 14 ? -0.678  -6.534  3.039   1.00 0.00 ? 14  VAL A CG1  10 
ATOM   5693  C  CG2  . VAL A 1 14 ? -3.159  -6.851  2.895   1.00 0.00 ? 14  VAL A CG2  10 
ATOM   5694  H  H    . VAL A 1 14 ? -3.864  -5.306  0.813   1.00 0.00 ? 14  VAL A H    10 
ATOM   5695  H  HA   . VAL A 1 14 ? -2.079  -4.264  2.797   1.00 0.00 ? 14  VAL A HA   10 
ATOM   5696  H  HB   . VAL A 1 14 ? -1.799  -6.849  1.263   1.00 0.00 ? 14  VAL A HB   10 
ATOM   5697  H  HG11 . VAL A 1 14 ? -0.040  -5.664  2.975   1.00 0.00 ? 14  VAL A HG11 10 
ATOM   5698  H  HG12 . VAL A 1 14 ? -0.966  -6.696  4.067   1.00 0.00 ? 14  VAL A HG12 10 
ATOM   5699  H  HG13 . VAL A 1 14 ? -0.144  -7.399  2.673   1.00 0.00 ? 14  VAL A HG13 10 
ATOM   5700  H  HG21 . VAL A 1 14 ? -2.889  -7.205  3.879   1.00 0.00 ? 14  VAL A HG21 10 
ATOM   5701  H  HG22 . VAL A 1 14 ? -3.894  -6.065  2.983   1.00 0.00 ? 14  VAL A HG22 10 
ATOM   5702  H  HG23 . VAL A 1 14 ? -3.572  -7.668  2.320   1.00 0.00 ? 14  VAL A HG23 10 
ATOM   5703  N  N    . CYS A 1 15 ? 0.044   -3.704  1.621   1.00 0.00 ? 15  CYS A N    10 
ATOM   5704  C  CA   . CYS A 1 15 ? 1.215   -3.212  0.905   1.00 0.00 ? 15  CYS A CA   10 
ATOM   5705  C  C    . CYS A 1 15 ? 1.993   -4.365  0.278   1.00 0.00 ? 15  CYS A C    10 
ATOM   5706  O  O    . CYS A 1 15 ? 2.458   -5.265  0.975   1.00 0.00 ? 15  CYS A O    10 
ATOM   5707  C  CB   . CYS A 1 15 ? 2.123   -2.424  1.851   1.00 0.00 ? 15  CYS A CB   10 
ATOM   5708  S  SG   . CYS A 1 15 ? 3.068   -1.094  1.039   1.00 0.00 ? 15  CYS A SG   10 
ATOM   5709  H  H    . CYS A 1 15 ? -0.024  -3.550  2.588   1.00 0.00 ? 15  CYS A H    10 
ATOM   5710  H  HA   . CYS A 1 15 ? 0.872   -2.556  0.120   1.00 0.00 ? 15  CYS A HA   10 
ATOM   5711  H  HB2  . CYS A 1 15 ? 1.519   -1.971  2.624   1.00 0.00 ? 15  CYS A HB2  10 
ATOM   5712  H  HB3  . CYS A 1 15 ? 2.831   -3.101  2.305   1.00 0.00 ? 15  CYS A HB3  10 
ATOM   5713  N  N    . ASN A 1 16 ? 2.131   -4.328  -1.044  1.00 0.00 ? 16  ASN A N    10 
ATOM   5714  C  CA   . ASN A 1 16 ? 2.853   -5.370  -1.766  1.00 0.00 ? 16  ASN A CA   10 
ATOM   5715  C  C    . ASN A 1 16 ? 4.353   -5.092  -1.765  1.00 0.00 ? 16  ASN A C    10 
ATOM   5716  O  O    . ASN A 1 16 ? 5.065   -5.476  -2.693  1.00 0.00 ? 16  ASN A O    10 
ATOM   5717  C  CB   . ASN A 1 16 ? 2.342   -5.470  -3.205  1.00 0.00 ? 16  ASN A CB   10 
ATOM   5718  C  CG   . ASN A 1 16 ? 0.882   -5.876  -3.273  1.00 0.00 ? 16  ASN A CG   10 
ATOM   5719  O  OD1  . ASN A 1 16 ? 0.516   -6.984  -2.882  1.00 0.00 ? 16  ASN A OD1  10 
ATOM   5720  N  ND2  . ASN A 1 16 ? 0.041   -4.978  -3.772  1.00 0.00 ? 16  ASN A ND2  10 
ATOM   5721  H  H    . ASN A 1 16 ? 1.738   -3.584  -1.545  1.00 0.00 ? 16  ASN A H    10 
ATOM   5722  H  HA   . ASN A 1 16 ? 2.672   -6.308  -1.263  1.00 0.00 ? 16  ASN A HA   10 
ATOM   5723  H  HB2  . ASN A 1 16 ? 2.451   -4.509  -3.686  1.00 0.00 ? 16  ASN A HB2  10 
ATOM   5724  H  HB3  . ASN A 1 16 ? 2.927   -6.204  -3.738  1.00 0.00 ? 16  ASN A HB3  10 
ATOM   5725  H  HD21 . ASN A 1 16 ? 0.404   -4.115  -4.064  1.00 0.00 ? 16  ASN A HD21 10 
ATOM   5726  H  HD22 . ASN A 1 16 ? -0.908  -5.214  -3.827  1.00 0.00 ? 16  ASN A HD22 10 
ATOM   5727  N  N    . GLU A 1 17 ? 4.825   -4.423  -0.718  1.00 0.00 ? 17  GLU A N    10 
ATOM   5728  C  CA   . GLU A 1 17 ? 6.241   -4.094  -0.597  1.00 0.00 ? 17  GLU A CA   10 
ATOM   5729  C  C    . GLU A 1 17 ? 6.766   -4.450  0.791   1.00 0.00 ? 17  GLU A C    10 
ATOM   5730  O  O    . GLU A 1 17 ? 7.866   -4.985  0.932   1.00 0.00 ? 17  GLU A O    10 
ATOM   5731  C  CB   . GLU A 1 17 ? 6.467   -2.606  -0.874  1.00 0.00 ? 17  GLU A CB   10 
ATOM   5732  C  CG   . GLU A 1 17 ? 5.806   -2.118  -2.152  1.00 0.00 ? 17  GLU A CG   10 
ATOM   5733  C  CD   . GLU A 1 17 ? 6.709   -2.247  -3.363  1.00 0.00 ? 17  GLU A CD   10 
ATOM   5734  O  OE1  . GLU A 1 17 ? 6.810   -3.364  -3.912  1.00 0.00 ? 17  GLU A OE1  10 
ATOM   5735  O  OE2  . GLU A 1 17 ? 7.316   -1.231  -3.761  1.00 0.00 ? 17  GLU A OE2  10 
ATOM   5736  H  H    . GLU A 1 17 ? 4.207   -4.144  -0.010  1.00 0.00 ? 17  GLU A H    10 
ATOM   5737  H  HA   . GLU A 1 17 ? 6.779   -4.673  -1.332  1.00 0.00 ? 17  GLU A HA   10 
ATOM   5738  H  HB2  . GLU A 1 17 ? 6.072   -2.034  -0.047  1.00 0.00 ? 17  GLU A HB2  10 
ATOM   5739  H  HB3  . GLU A 1 17 ? 7.529   -2.424  -0.951  1.00 0.00 ? 17  GLU A HB3  10 
ATOM   5740  H  HG2  . GLU A 1 17 ? 4.912   -2.699  -2.325  1.00 0.00 ? 17  GLU A HG2  10 
ATOM   5741  H  HG3  . GLU A 1 17 ? 5.539   -1.078  -2.030  1.00 0.00 ? 17  GLU A HG3  10 
ATOM   5742  N  N    . CYS A 1 18 ? 5.972   -4.148  1.812   1.00 0.00 ? 18  CYS A N    10 
ATOM   5743  C  CA   . CYS A 1 18 ? 6.355   -4.434  3.190   1.00 0.00 ? 18  CYS A CA   10 
ATOM   5744  C  C    . CYS A 1 18 ? 5.404   -5.449  3.819   1.00 0.00 ? 18  CYS A C    10 
ATOM   5745  O  O    . CYS A 1 18 ? 5.829   -6.340  4.553   1.00 0.00 ? 18  CYS A O    10 
ATOM   5746  C  CB   . CYS A 1 18 ? 6.364   -3.147  4.016   1.00 0.00 ? 18  CYS A CB   10 
ATOM   5747  S  SG   . CYS A 1 18 ? 4.760   -2.284  4.067   1.00 0.00 ? 18  CYS A SG   10 
ATOM   5748  H  H    . CYS A 1 18 ? 5.106   -3.722  1.636   1.00 0.00 ? 18  CYS A H    10 
ATOM   5749  H  HA   . CYS A 1 18 ? 7.350   -4.851  3.178   1.00 0.00 ? 18  CYS A HA   10 
ATOM   5750  H  HB2  . CYS A 1 18 ? 6.641   -3.383  5.033   1.00 0.00 ? 18  CYS A HB2  10 
ATOM   5751  H  HB3  . CYS A 1 18 ? 7.091   -2.466  3.600   1.00 0.00 ? 18  CYS A HB3  10 
ATOM   5752  N  N    . GLY A 1 19 ? 4.116   -5.306  3.525   1.00 0.00 ? 19  GLY A N    10 
ATOM   5753  C  CA   . GLY A 1 19 ? 3.125   -6.217  4.069   1.00 0.00 ? 19  GLY A CA   10 
ATOM   5754  C  C    . GLY A 1 19 ? 2.140   -5.521  4.987   1.00 0.00 ? 19  GLY A C    10 
ATOM   5755  O  O    . GLY A 1 19 ? 1.421   -6.170  5.746   1.00 0.00 ? 19  GLY A O    10 
ATOM   5756  H  H    . GLY A 1 19 ? 3.835   -4.577  2.933   1.00 0.00 ? 19  GLY A H    10 
ATOM   5757  H  HA2  . GLY A 1 19 ? 2.583   -6.671  3.254   1.00 0.00 ? 19  GLY A HA2  10 
ATOM   5758  H  HA3  . GLY A 1 19 ? 3.633   -6.991  4.626   1.00 0.00 ? 19  GLY A HA3  10 
ATOM   5759  N  N    . LYS A 1 20 ? 2.106   -4.194  4.919   1.00 0.00 ? 20  LYS A N    10 
ATOM   5760  C  CA   . LYS A 1 20 ? 1.202   -3.408  5.750   1.00 0.00 ? 20  LYS A CA   10 
ATOM   5761  C  C    . LYS A 1 20 ? -0.243  -3.575  5.291   1.00 0.00 ? 20  LYS A C    10 
ATOM   5762  O  O    . LYS A 1 20 ? -0.620  -3.113  4.215   1.00 0.00 ? 20  LYS A O    10 
ATOM   5763  C  CB   . LYS A 1 20 ? 1.594   -1.929  5.707   1.00 0.00 ? 20  LYS A CB   10 
ATOM   5764  C  CG   . LYS A 1 20 ? 1.081   -1.129  6.891   1.00 0.00 ? 20  LYS A CG   10 
ATOM   5765  C  CD   . LYS A 1 20 ? 2.083   -1.120  8.034   1.00 0.00 ? 20  LYS A CD   10 
ATOM   5766  C  CE   . LYS A 1 20 ? 1.752   -0.042  9.056   1.00 0.00 ? 20  LYS A CE   10 
ATOM   5767  N  NZ   . LYS A 1 20 ? 1.769   1.319   8.452   1.00 0.00 ? 20  LYS A NZ   10 
ATOM   5768  H  H    . LYS A 1 20 ? 2.704   -3.732  4.293   1.00 0.00 ? 20  LYS A H    10 
ATOM   5769  H  HA   . LYS A 1 20 ? 1.289   -3.765  6.764   1.00 0.00 ? 20  LYS A HA   10 
ATOM   5770  H  HB2  . LYS A 1 20 ? 2.671   -1.854  5.688   1.00 0.00 ? 20  LYS A HB2  10 
ATOM   5771  H  HB3  . LYS A 1 20 ? 1.196   -1.490  4.803   1.00 0.00 ? 20  LYS A HB3  10 
ATOM   5772  H  HG2  . LYS A 1 20 ? 0.900   -0.112  6.577   1.00 0.00 ? 20  LYS A HG2  10 
ATOM   5773  H  HG3  . LYS A 1 20 ? 0.157   -1.570  7.238   1.00 0.00 ? 20  LYS A HG3  10 
ATOM   5774  H  HD2  . LYS A 1 20 ? 2.066   -2.082  8.524   1.00 0.00 ? 20  LYS A HD2  10 
ATOM   5775  H  HD3  . LYS A 1 20 ? 3.069   -0.934  7.634   1.00 0.00 ? 20  LYS A HD3  10 
ATOM   5776  H  HE2  . LYS A 1 20 ? 0.770   -0.236  9.459   1.00 0.00 ? 20  LYS A HE2  10 
ATOM   5777  H  HE3  . LYS A 1 20 ? 2.482   -0.084  9.851   1.00 0.00 ? 20  LYS A HE3  10 
ATOM   5778  H  HZ1  . LYS A 1 20 ? 0.865   1.801   8.633   1.00 0.00 ? 20  LYS A HZ1  10 
ATOM   5779  H  HZ2  . LYS A 1 20 ? 1.915   1.252   7.424   1.00 0.00 ? 20  LYS A HZ2  10 
ATOM   5780  H  HZ3  . LYS A 1 20 ? 2.539   1.883   8.864   1.00 0.00 ? 20  LYS A HZ3  10 
ATOM   5781  N  N    . ALA A 1 21 ? -1.047  -4.238  6.116   1.00 0.00 ? 21  ALA A N    10 
ATOM   5782  C  CA   . ALA A 1 21 ? -2.451  -4.463  5.796   1.00 0.00 ? 21  ALA A CA   10 
ATOM   5783  C  C    . ALA A 1 21 ? -3.322  -3.326  6.318   1.00 0.00 ? 21  ALA A C    10 
ATOM   5784  O  O    . ALA A 1 21 ? -3.237  -2.951  7.487   1.00 0.00 ? 21  ALA A O    10 
ATOM   5785  C  CB   . ALA A 1 21 ? -2.917  -5.793  6.370   1.00 0.00 ? 21  ALA A CB   10 
ATOM   5786  H  H    . ALA A 1 21 ? -0.688  -4.582  6.960   1.00 0.00 ? 21  ALA A H    10 
ATOM   5787  H  HA   . ALA A 1 21 ? -2.545  -4.511  4.720   1.00 0.00 ? 21  ALA A HA   10 
ATOM   5788  H  HB1  . ALA A 1 21 ? -3.490  -5.616  7.268   1.00 0.00 ? 21  ALA A HB1  10 
ATOM   5789  H  HB2  . ALA A 1 21 ? -3.533  -6.302  5.643   1.00 0.00 ? 21  ALA A HB2  10 
ATOM   5790  H  HB3  . ALA A 1 21 ? -2.058  -6.404  6.605   1.00 0.00 ? 21  ALA A HB3  10 
ATOM   5791  N  N    . PHE A 1 22 ? -4.160  -2.779  5.443   1.00 0.00 ? 22  PHE A N    10 
ATOM   5792  C  CA   . PHE A 1 22 ? -5.046  -1.682  5.815   1.00 0.00 ? 22  PHE A CA   10 
ATOM   5793  C  C    . PHE A 1 22 ? -6.509  -2.089  5.662   1.00 0.00 ? 22  PHE A C    10 
ATOM   5794  O  O    . PHE A 1 22 ? -6.813  -3.205  5.242   1.00 0.00 ? 22  PHE A O    10 
ATOM   5795  C  CB   . PHE A 1 22 ? -4.755  -0.449  4.957   1.00 0.00 ? 22  PHE A CB   10 
ATOM   5796  C  CG   . PHE A 1 22 ? -3.314  -0.028  4.983   1.00 0.00 ? 22  PHE A CG   10 
ATOM   5797  C  CD1  . PHE A 1 22 ? -2.380  -0.656  4.175   1.00 0.00 ? 22  PHE A CD1  10 
ATOM   5798  C  CD2  . PHE A 1 22 ? -2.892  0.996   5.817   1.00 0.00 ? 22  PHE A CD2  10 
ATOM   5799  C  CE1  . PHE A 1 22 ? -1.053  -0.270  4.196   1.00 0.00 ? 22  PHE A CE1  10 
ATOM   5800  C  CE2  . PHE A 1 22 ? -1.566  1.386   5.841   1.00 0.00 ? 22  PHE A CE2  10 
ATOM   5801  C  CZ   . PHE A 1 22 ? -0.645  0.751   5.031   1.00 0.00 ? 22  PHE A CZ   10 
ATOM   5802  H  H    . PHE A 1 22 ? -4.183  -3.121  4.524   1.00 0.00 ? 22  PHE A H    10 
ATOM   5803  H  HA   . PHE A 1 22 ? -4.858  -1.442  6.851   1.00 0.00 ? 22  PHE A HA   10 
ATOM   5804  H  HB2  . PHE A 1 22 ? -5.020  -0.662  3.933   1.00 0.00 ? 22  PHE A HB2  10 
ATOM   5805  H  HB3  . PHE A 1 22 ? -5.350  0.377   5.315   1.00 0.00 ? 22  PHE A HB3  10 
ATOM   5806  H  HD1  . PHE A 1 22 ? -2.698  -1.456  3.520   1.00 0.00 ? 22  PHE A HD1  10 
ATOM   5807  H  HD2  . PHE A 1 22 ? -3.611  1.492   6.452   1.00 0.00 ? 22  PHE A HD2  10 
ATOM   5808  H  HE1  . PHE A 1 22 ? -0.336  -0.769  3.560   1.00 0.00 ? 22  PHE A HE1  10 
ATOM   5809  H  HE2  . PHE A 1 22 ? -1.251  2.185   6.496   1.00 0.00 ? 22  PHE A HE2  10 
ATOM   5810  H  HZ   . PHE A 1 22 ? 0.391   1.055   5.048   1.00 0.00 ? 22  PHE A HZ   10 
ATOM   5811  N  N    . ARG A 1 23 ? -7.410  -1.174  6.007   1.00 0.00 ? 23  ARG A N    10 
ATOM   5812  C  CA   . ARG A 1 23 ? -8.841  -1.437  5.909   1.00 0.00 ? 23  ARG A CA   10 
ATOM   5813  C  C    . ARG A 1 23 ? -9.381  -1.008  4.548   1.00 0.00 ? 23  ARG A C    10 
ATOM   5814  O  O    . ARG A 1 23 ? -10.315 -1.613  4.021   1.00 0.00 ? 23  ARG A O    10 
ATOM   5815  C  CB   . ARG A 1 23 ? -9.592  -0.705  7.022   1.00 0.00 ? 23  ARG A CB   10 
ATOM   5816  C  CG   . ARG A 1 23 ? -11.018 -1.194  7.218   1.00 0.00 ? 23  ARG A CG   10 
ATOM   5817  C  CD   . ARG A 1 23 ? -11.053 -2.537  7.930   1.00 0.00 ? 23  ARG A CD   10 
ATOM   5818  N  NE   . ARG A 1 23 ? -12.238 -3.314  7.575   1.00 0.00 ? 23  ARG A NE   10 
ATOM   5819  C  CZ   . ARG A 1 23 ? -12.706 -4.317  8.309   1.00 0.00 ? 23  ARG A CZ   10 
ATOM   5820  N  NH1  . ARG A 1 23 ? -12.092 -4.664  9.432   1.00 0.00 ? 23  ARG A NH1  10 
ATOM   5821  N  NH2  . ARG A 1 23 ? -13.791 -4.976  7.920   1.00 0.00 ? 23  ARG A NH2  10 
ATOM   5822  H  H    . ARG A 1 23 ? -7.106  -0.303  6.335   1.00 0.00 ? 23  ARG A H    10 
ATOM   5823  H  HA   . ARG A 1 23 ? -8.992  -2.500  6.024   1.00 0.00 ? 23  ARG A HA   10 
ATOM   5824  H  HB2  . ARG A 1 23 ? -9.058  -0.840  7.951   1.00 0.00 ? 23  ARG A HB2  10 
ATOM   5825  H  HB3  . ARG A 1 23 ? -9.625  0.348   6.785   1.00 0.00 ? 23  ARG A HB3  10 
ATOM   5826  H  HG2  . ARG A 1 23 ? -11.559 -0.471  7.811   1.00 0.00 ? 23  ARG A HG2  10 
ATOM   5827  H  HG3  . ARG A 1 23 ? -11.490 -1.295  6.252   1.00 0.00 ? 23  ARG A HG3  10 
ATOM   5828  H  HD2  . ARG A 1 23 ? -10.172 -3.098  7.656   1.00 0.00 ? 23  ARG A HD2  10 
ATOM   5829  H  HD3  . ARG A 1 23 ? -11.053 -2.365  8.996   1.00 0.00 ? 23  ARG A HD3  10 
ATOM   5830  H  HE   . ARG A 1 23 ? -12.707 -3.074  6.749   1.00 0.00 ? 23  ARG A HE   10 
ATOM   5831  H  HH11 . ARG A 1 23 ? -11.276 -4.169  9.728   1.00 0.00 ? 23  ARG A HH11 10 
ATOM   5832  H  HH12 . ARG A 1 23 ? -12.448 -5.420  9.983   1.00 0.00 ? 23  ARG A HH12 10 
ATOM   5833  H  HH21 . ARG A 1 23 ? -14.256 -4.717  7.075   1.00 0.00 ? 23  ARG A HH21 10 
ATOM   5834  H  HH22 . ARG A 1 23 ? -14.142 -5.731  8.473   1.00 0.00 ? 23  ARG A HH22 10 
ATOM   5835  N  N    . SER A 1 24 ? -8.788  0.040   3.985   1.00 0.00 ? 24  SER A N    10 
ATOM   5836  C  CA   . SER A 1 24 ? -9.212  0.553   2.688   1.00 0.00 ? 24  SER A CA   10 
ATOM   5837  C  C    . SER A 1 24 ? -8.006  0.901   1.821   1.00 0.00 ? 24  SER A C    10 
ATOM   5838  O  O    . SER A 1 24 ? -6.883  1.012   2.313   1.00 0.00 ? 24  SER A O    10 
ATOM   5839  C  CB   . SER A 1 24 ? -10.098 1.787   2.869   1.00 0.00 ? 24  SER A CB   10 
ATOM   5840  O  OG   . SER A 1 24 ? -9.352  2.881   3.373   1.00 0.00 ? 24  SER A OG   10 
ATOM   5841  H  H    . SER A 1 24 ? -8.048  0.480   4.455   1.00 0.00 ? 24  SER A H    10 
ATOM   5842  H  HA   . SER A 1 24 ? -9.783  -0.221  2.196   1.00 0.00 ? 24  SER A HA   10 
ATOM   5843  H  HB2  . SER A 1 24 ? -10.523 2.065   1.917   1.00 0.00 ? 24  SER A HB2  10 
ATOM   5844  H  HB3  . SER A 1 24 ? -10.892 1.557   3.565   1.00 0.00 ? 24  SER A HB3  10 
ATOM   5845  H  HG   . SER A 1 24 ? -9.942  3.617   3.549   1.00 0.00 ? 24  SER A HG   10 
ATOM   5846  N  N    . LYS A 1 25 ? -8.247  1.073   0.526   1.00 0.00 ? 25  LYS A N    10 
ATOM   5847  C  CA   . LYS A 1 25 ? -7.183  1.411   -0.413  1.00 0.00 ? 25  LYS A CA   10 
ATOM   5848  C  C    . LYS A 1 25 ? -6.591  2.780   -0.095  1.00 0.00 ? 25  LYS A C    10 
ATOM   5849  O  O    . LYS A 1 25 ? -5.372  2.942   -0.040  1.00 0.00 ? 25  LYS A O    10 
ATOM   5850  C  CB   . LYS A 1 25 ? -7.716  1.395   -1.847  1.00 0.00 ? 25  LYS A CB   10 
ATOM   5851  C  CG   . LYS A 1 25 ? -7.685  0.020   -2.492  1.00 0.00 ? 25  LYS A CG   10 
ATOM   5852  C  CD   . LYS A 1 25 ? -7.777  0.112   -4.006  1.00 0.00 ? 25  LYS A CD   10 
ATOM   5853  C  CE   . LYS A 1 25 ? -9.118  0.677   -4.449  1.00 0.00 ? 25  LYS A CE   10 
ATOM   5854  N  NZ   . LYS A 1 25 ? -9.161  0.917   -5.918  1.00 0.00 ? 25  LYS A NZ   10 
ATOM   5855  H  H    . LYS A 1 25 ? -9.163  0.972   0.192   1.00 0.00 ? 25  LYS A H    10 
ATOM   5856  H  HA   . LYS A 1 25 ? -6.408  0.666   -0.317  1.00 0.00 ? 25  LYS A HA   10 
ATOM   5857  H  HB2  . LYS A 1 25 ? -8.738  1.744   -1.843  1.00 0.00 ? 25  LYS A HB2  10 
ATOM   5858  H  HB3  . LYS A 1 25 ? -7.118  2.065   -2.448  1.00 0.00 ? 25  LYS A HB3  10 
ATOM   5859  H  HG2  . LYS A 1 25 ? -6.760  -0.471  -2.228  1.00 0.00 ? 25  LYS A HG2  10 
ATOM   5860  H  HG3  . LYS A 1 25 ? -8.520  -0.559  -2.124  1.00 0.00 ? 25  LYS A HG3  10 
ATOM   5861  H  HD2  . LYS A 1 25 ? -6.991  0.757   -4.368  1.00 0.00 ? 25  LYS A HD2  10 
ATOM   5862  H  HD3  . LYS A 1 25 ? -7.656  -0.877  -4.426  1.00 0.00 ? 25  LYS A HD3  10 
ATOM   5863  H  HE2  . LYS A 1 25 ? -9.895  -0.025  -4.185  1.00 0.00 ? 25  LYS A HE2  10 
ATOM   5864  H  HE3  . LYS A 1 25 ? -9.288  1.611   -3.935  1.00 0.00 ? 25  LYS A HE3  10 
ATOM   5865  H  HZ1  . LYS A 1 25 ? -8.490  1.667   -6.177  1.00 0.00 ? 25  LYS A HZ1  10 
ATOM   5866  H  HZ2  . LYS A 1 25 ? -10.118 1.208   -6.204  1.00 0.00 ? 25  LYS A HZ2  10 
ATOM   5867  H  HZ3  . LYS A 1 25 ? -8.908  0.048   -6.430  1.00 0.00 ? 25  LYS A HZ3  10 
ATOM   5868  N  N    . SER A 1 26 ? -7.461  3.762   0.116   1.00 0.00 ? 26  SER A N    10 
ATOM   5869  C  CA   . SER A 1 26 ? -7.024  5.118   0.427   1.00 0.00 ? 26  SER A CA   10 
ATOM   5870  C  C    . SER A 1 26 ? -6.092  5.125   1.635   1.00 0.00 ? 26  SER A C    10 
ATOM   5871  O  O    . SER A 1 26 ? -5.206  5.973   1.745   1.00 0.00 ? 26  SER A O    10 
ATOM   5872  C  CB   . SER A 1 26 ? -8.232  6.017   0.696   1.00 0.00 ? 26  SER A CB   10 
ATOM   5873  O  OG   . SER A 1 26 ? -8.896  6.353   -0.510  1.00 0.00 ? 26  SER A OG   10 
ATOM   5874  H  H    . SER A 1 26 ? -8.421  3.570   0.059   1.00 0.00 ? 26  SER A H    10 
ATOM   5875  H  HA   . SER A 1 26 ? -6.487  5.497   -0.429  1.00 0.00 ? 26  SER A HA   10 
ATOM   5876  H  HB2  . SER A 1 26 ? -8.925  5.501   1.342   1.00 0.00 ? 26  SER A HB2  10 
ATOM   5877  H  HB3  . SER A 1 26 ? -7.901  6.926   1.176   1.00 0.00 ? 26  SER A HB3  10 
ATOM   5878  H  HG   . SER A 1 26 ? -9.061  5.555   -1.018  1.00 0.00 ? 26  SER A HG   10 
ATOM   5879  N  N    . TYR A 1 27 ? -6.298  4.173   2.538   1.00 0.00 ? 27  TYR A N    10 
ATOM   5880  C  CA   . TYR A 1 27 ? -5.479  4.070   3.740   1.00 0.00 ? 27  TYR A CA   10 
ATOM   5881  C  C    . TYR A 1 27 ? -4.105  3.492   3.415   1.00 0.00 ? 27  TYR A C    10 
ATOM   5882  O  O    . TYR A 1 27 ? -3.114  3.808   4.074   1.00 0.00 ? 27  TYR A O    10 
ATOM   5883  C  CB   . TYR A 1 27 ? -6.177  3.197   4.785   1.00 0.00 ? 27  TYR A CB   10 
ATOM   5884  C  CG   . TYR A 1 27 ? -5.867  3.594   6.210   1.00 0.00 ? 27  TYR A CG   10 
ATOM   5885  C  CD1  . TYR A 1 27 ? -5.880  4.928   6.599   1.00 0.00 ? 27  TYR A CD1  10 
ATOM   5886  C  CD2  . TYR A 1 27 ? -5.562  2.636   7.169   1.00 0.00 ? 27  TYR A CD2  10 
ATOM   5887  C  CE1  . TYR A 1 27 ? -5.596  5.296   7.901   1.00 0.00 ? 27  TYR A CE1  10 
ATOM   5888  C  CE2  . TYR A 1 27 ? -5.279  2.994   8.473   1.00 0.00 ? 27  TYR A CE2  10 
ATOM   5889  C  CZ   . TYR A 1 27 ? -5.297  4.325   8.834   1.00 0.00 ? 27  TYR A CZ   10 
ATOM   5890  O  OH   . TYR A 1 27 ? -5.015  4.687   10.131  1.00 0.00 ? 27  TYR A OH   10 
ATOM   5891  H  H    . TYR A 1 27 ? -7.020  3.525   2.395   1.00 0.00 ? 27  TYR A H    10 
ATOM   5892  H  HA   . TYR A 1 27 ? -5.353  5.064   4.142   1.00 0.00 ? 27  TYR A HA   10 
ATOM   5893  H  HB2  . TYR A 1 27 ? -7.245  3.267   4.647   1.00 0.00 ? 27  TYR A HB2  10 
ATOM   5894  H  HB3  . TYR A 1 27 ? -5.868  2.171   4.651   1.00 0.00 ? 27  TYR A HB3  10 
ATOM   5895  H  HD1  . TYR A 1 27 ? -6.115  5.686   5.866   1.00 0.00 ? 27  TYR A HD1  10 
ATOM   5896  H  HD2  . TYR A 1 27 ? -5.549  1.594   6.883   1.00 0.00 ? 27  TYR A HD2  10 
ATOM   5897  H  HE1  . TYR A 1 27 ? -5.611  6.338   8.183   1.00 0.00 ? 27  TYR A HE1  10 
ATOM   5898  H  HE2  . TYR A 1 27 ? -5.044  2.234   9.204   1.00 0.00 ? 27  TYR A HE2  10 
ATOM   5899  H  HH   . TYR A 1 27 ? -5.009  3.904   10.687  1.00 0.00 ? 27  TYR A HH   10 
ATOM   5900  N  N    . LEU A 1 28 ? -4.054  2.645   2.393   1.00 0.00 ? 28  LEU A N    10 
ATOM   5901  C  CA   . LEU A 1 28 ? -2.802  2.022   1.978   1.00 0.00 ? 28  LEU A CA   10 
ATOM   5902  C  C    . LEU A 1 28 ? -2.019  2.942   1.047   1.00 0.00 ? 28  LEU A C    10 
ATOM   5903  O  O    . LEU A 1 28 ? -0.789  2.980   1.086   1.00 0.00 ? 28  LEU A O    10 
ATOM   5904  C  CB   . LEU A 1 28 ? -3.079  0.689   1.281   1.00 0.00 ? 28  LEU A CB   10 
ATOM   5905  C  CG   . LEU A 1 28 ? -1.987  0.185   0.336   1.00 0.00 ? 28  LEU A CG   10 
ATOM   5906  C  CD1  . LEU A 1 28 ? -0.861  -0.469  1.121   1.00 0.00 ? 28  LEU A CD1  10 
ATOM   5907  C  CD2  . LEU A 1 28 ? -2.568  -0.788  -0.679  1.00 0.00 ? 28  LEU A CD2  10 
ATOM   5908  H  H    . LEU A 1 28 ? -4.877  2.432   1.906   1.00 0.00 ? 28  LEU A H    10 
ATOM   5909  H  HA   . LEU A 1 28 ? -2.212  1.840   2.864   1.00 0.00 ? 28  LEU A HA   10 
ATOM   5910  H  HB2  . LEU A 1 28 ? -3.225  -0.059  2.045   1.00 0.00 ? 28  LEU A HB2  10 
ATOM   5911  H  HB3  . LEU A 1 28 ? -3.989  0.798   0.709   1.00 0.00 ? 28  LEU A HB3  10 
ATOM   5912  H  HG   . LEU A 1 28 ? -1.572  1.025   -0.204  1.00 0.00 ? 28  LEU A HG   10 
ATOM   5913  H  HD11 . LEU A 1 28 ? -0.465  0.234   1.838   1.00 0.00 ? 28  LEU A HD11 10 
ATOM   5914  H  HD12 . LEU A 1 28 ? -0.078  -0.772  0.443   1.00 0.00 ? 28  LEU A HD12 10 
ATOM   5915  H  HD13 . LEU A 1 28 ? -1.242  -1.337  1.641   1.00 0.00 ? 28  LEU A HD13 10 
ATOM   5916  H  HD21 . LEU A 1 28 ? -3.451  -1.252  -0.268  1.00 0.00 ? 28  LEU A HD21 10 
ATOM   5917  H  HD22 . LEU A 1 28 ? -1.835  -1.547  -0.909  1.00 0.00 ? 28  LEU A HD22 10 
ATOM   5918  H  HD23 . LEU A 1 28 ? -2.827  -0.254  -1.582  1.00 0.00 ? 28  LEU A HD23 10 
ATOM   5919  N  N    . ILE A 1 29 ? -2.740  3.683   0.213   1.00 0.00 ? 29  ILE A N    10 
ATOM   5920  C  CA   . ILE A 1 29 ? -2.112  4.606   -0.726  1.00 0.00 ? 29  ILE A CA   10 
ATOM   5921  C  C    . ILE A 1 29 ? -1.363  5.712   0.009   1.00 0.00 ? 29  ILE A C    10 
ATOM   5922  O  O    . ILE A 1 29 ? -0.245  6.071   -0.363  1.00 0.00 ? 29  ILE A O    10 
ATOM   5923  C  CB   . ILE A 1 29 ? -3.151  5.243   -1.668  1.00 0.00 ? 29  ILE A CB   10 
ATOM   5924  C  CG1  . ILE A 1 29 ? -3.823  4.168   -2.524  1.00 0.00 ? 29  ILE A CG1  10 
ATOM   5925  C  CG2  . ILE A 1 29 ? -2.491  6.294   -2.549  1.00 0.00 ? 29  ILE A CG2  10 
ATOM   5926  C  CD1  . ILE A 1 29 ? -5.248  4.503   -2.906  1.00 0.00 ? 29  ILE A CD1  10 
ATOM   5927  H  H    . ILE A 1 29 ? -3.716  3.609   0.229   1.00 0.00 ? 29  ILE A H    10 
ATOM   5928  H  HA   . ILE A 1 29 ? -1.409  4.045   -1.324  1.00 0.00 ? 29  ILE A HA   10 
ATOM   5929  H  HB   . ILE A 1 29 ? -3.899  5.733   -1.064  1.00 0.00 ? 29  ILE A HB   10 
ATOM   5930  H  HG12 . ILE A 1 29 ? -3.259  4.035   -3.433  1.00 0.00 ? 29  ILE A HG12 10 
ATOM   5931  H  HG13 . ILE A 1 29 ? -3.836  3.237   -1.974  1.00 0.00 ? 29  ILE A HG13 10 
ATOM   5932  H  HG21 . ILE A 1 29 ? -2.928  7.260   -2.345  1.00 0.00 ? 29  ILE A HG21 10 
ATOM   5933  H  HG22 . ILE A 1 29 ? -1.433  6.327   -2.339  1.00 0.00 ? 29  ILE A HG22 10 
ATOM   5934  H  HG23 . ILE A 1 29 ? -2.645  6.041   -3.587  1.00 0.00 ? 29  ILE A HG23 10 
ATOM   5935  H  HD11 . ILE A 1 29 ? -5.282  4.797   -3.945  1.00 0.00 ? 29  ILE A HD11 10 
ATOM   5936  H  HD12 . ILE A 1 29 ? -5.874  3.635   -2.758  1.00 0.00 ? 29  ILE A HD12 10 
ATOM   5937  H  HD13 . ILE A 1 29 ? -5.604  5.315   -2.291  1.00 0.00 ? 29  ILE A HD13 10 
ATOM   5938  N  N    . ILE A 1 30 ? -1.984  6.246   1.055   1.00 0.00 ? 30  ILE A N    10 
ATOM   5939  C  CA   . ILE A 1 30 ? -1.374  7.309   1.844   1.00 0.00 ? 30  ILE A CA   10 
ATOM   5940  C  C    . ILE A 1 30 ? -0.101  6.824   2.529   1.00 0.00 ? 30  ILE A C    10 
ATOM   5941  O  O    . ILE A 1 30 ? 0.733   7.625   2.954   1.00 0.00 ? 30  ILE A O    10 
ATOM   5942  C  CB   . ILE A 1 30 ? -2.345  7.846   2.912   1.00 0.00 ? 30  ILE A CB   10 
ATOM   5943  C  CG1  . ILE A 1 30 ? -2.817  6.710   3.821   1.00 0.00 ? 30  ILE A CG1  10 
ATOM   5944  C  CG2  . ILE A 1 30 ? -3.533  8.531   2.251   1.00 0.00 ? 30  ILE A CG2  10 
ATOM   5945  C  CD1  . ILE A 1 30 ? -3.166  7.162   5.222   1.00 0.00 ? 30  ILE A CD1  10 
ATOM   5946  H  H    . ILE A 1 30 ? -2.873  5.917   1.302   1.00 0.00 ? 30  ILE A H    10 
ATOM   5947  H  HA   . ILE A 1 30 ? -1.123  8.119   1.174   1.00 0.00 ? 30  ILE A HA   10 
ATOM   5948  H  HB   . ILE A 1 30 ? -1.822  8.580   3.506   1.00 0.00 ? 30  ILE A HB   10 
ATOM   5949  H  HG12 . ILE A 1 30 ? -3.695  6.254   3.392   1.00 0.00 ? 30  ILE A HG12 10 
ATOM   5950  H  HG13 . ILE A 1 30 ? -2.033  5.970   3.896   1.00 0.00 ? 30  ILE A HG13 10 
ATOM   5951  H  HG21 . ILE A 1 30 ? -3.337  8.650   1.196   1.00 0.00 ? 30  ILE A HG21 10 
ATOM   5952  H  HG22 . ILE A 1 30 ? -4.417  7.926   2.386   1.00 0.00 ? 30  ILE A HG22 10 
ATOM   5953  H  HG23 . ILE A 1 30 ? -3.686  9.500   2.701   1.00 0.00 ? 30  ILE A HG23 10 
ATOM   5954  H  HD11 . ILE A 1 30 ? -2.408  6.817   5.911   1.00 0.00 ? 30  ILE A HD11 10 
ATOM   5955  H  HD12 . ILE A 1 30 ? -3.213  8.241   5.251   1.00 0.00 ? 30  ILE A HD12 10 
ATOM   5956  H  HD13 . ILE A 1 30 ? -4.123  6.751   5.505   1.00 0.00 ? 30  ILE A HD13 10 
ATOM   5957  N  N    . HIS A 1 31 ? 0.044   5.507   2.632   1.00 0.00 ? 31  HIS A N    10 
ATOM   5958  C  CA   . HIS A 1 31 ? 1.218   4.914   3.264   1.00 0.00 ? 31  HIS A CA   10 
ATOM   5959  C  C    . HIS A 1 31 ? 2.281   4.575   2.224   1.00 0.00 ? 31  HIS A C    10 
ATOM   5960  O  O    . HIS A 1 31 ? 3.432   4.999   2.336   1.00 0.00 ? 31  HIS A O    10 
ATOM   5961  C  CB   . HIS A 1 31 ? 0.825   3.655   4.038   1.00 0.00 ? 31  HIS A CB   10 
ATOM   5962  C  CG   . HIS A 1 31 ? 1.928   2.647   4.142   1.00 0.00 ? 31  HIS A CG   10 
ATOM   5963  N  ND1  . HIS A 1 31 ? 2.588   2.372   5.321   1.00 0.00 ? 31  HIS A ND1  10 
ATOM   5964  C  CD2  . HIS A 1 31 ? 2.486   1.845   3.205   1.00 0.00 ? 31  HIS A CD2  10 
ATOM   5965  C  CE1  . HIS A 1 31 ? 3.505   1.446   5.105   1.00 0.00 ? 31  HIS A CE1  10 
ATOM   5966  N  NE2  . HIS A 1 31 ? 3.463   1.109   3.828   1.00 0.00 ? 31  HIS A NE2  10 
ATOM   5967  H  H    . HIS A 1 31 ? -0.654  4.920   2.275   1.00 0.00 ? 31  HIS A H    10 
ATOM   5968  H  HA   . HIS A 1 31 ? 1.624   5.637   3.954   1.00 0.00 ? 31  HIS A HA   10 
ATOM   5969  H  HB2  . HIS A 1 31 ? 0.534   3.932   5.040   1.00 0.00 ? 31  HIS A HB2  10 
ATOM   5970  H  HB3  . HIS A 1 31 ? -0.012  3.182   3.543   1.00 0.00 ? 31  HIS A HB3  10 
ATOM   5971  H  HD1  . HIS A 1 31 ? 2.411   2.795   6.187   1.00 0.00 ? 31  HIS A HD1  10 
ATOM   5972  H  HD2  . HIS A 1 31 ? 2.214   1.793   2.160   1.00 0.00 ? 31  HIS A HD2  10 
ATOM   5973  H  HE1  . HIS A 1 31 ? 4.174   1.034   5.845   1.00 0.00 ? 31  HIS A HE1  10 
ATOM   5974  N  N    . THR A 1 32 ? 1.890   3.807   1.212   1.00 0.00 ? 32  THR A N    10 
ATOM   5975  C  CA   . THR A 1 32 ? 2.809   3.410   0.153   1.00 0.00 ? 32  THR A CA   10 
ATOM   5976  C  C    . THR A 1 32 ? 3.717   4.566   -0.249  1.00 0.00 ? 32  THR A C    10 
ATOM   5977  O  O    . THR A 1 32 ? 4.813   4.356   -0.769  1.00 0.00 ? 32  THR A O    10 
ATOM   5978  C  CB   . THR A 1 32 ? 2.051   2.909   -1.091  1.00 0.00 ? 32  THR A CB   10 
ATOM   5979  O  OG1  . THR A 1 32 ? 1.150   1.859   -0.726  1.00 0.00 ? 32  THR A OG1  10 
ATOM   5980  C  CG2  . THR A 1 32 ? 3.021   2.407   -2.150  1.00 0.00 ? 32  THR A CG2  10 
ATOM   5981  H  H    . THR A 1 32 ? 0.959   3.501   1.178   1.00 0.00 ? 32  THR A H    10 
ATOM   5982  H  HA   . THR A 1 32 ? 3.419   2.600   0.528   1.00 0.00 ? 32  THR A HA   10 
ATOM   5983  H  HB   . THR A 1 32 ? 1.485   3.732   -1.504  1.00 0.00 ? 32  THR A HB   10 
ATOM   5984  H  HG1  . THR A 1 32 ? 0.530   1.705   -1.443  1.00 0.00 ? 32  THR A HG1  10 
ATOM   5985  H  HG21 . THR A 1 32 ? 2.683   1.452   -2.523  1.00 0.00 ? 32  THR A HG21 10 
ATOM   5986  H  HG22 . THR A 1 32 ? 4.003   2.296   -1.714  1.00 0.00 ? 32  THR A HG22 10 
ATOM   5987  H  HG23 . THR A 1 32 ? 3.066   3.116   -2.963  1.00 0.00 ? 32  THR A HG23 10 
ATOM   5988  N  N    . ARG A 1 33 ? 3.254   5.788   -0.006  1.00 0.00 ? 33  ARG A N    10 
ATOM   5989  C  CA   . ARG A 1 33 ? 4.024   6.978   -0.345  1.00 0.00 ? 33  ARG A CA   10 
ATOM   5990  C  C    . ARG A 1 33 ? 5.148   7.203   0.663   1.00 0.00 ? 33  ARG A C    10 
ATOM   5991  O  O    . ARG A 1 33 ? 6.269   7.554   0.293   1.00 0.00 ? 33  ARG A O    10 
ATOM   5992  C  CB   . ARG A 1 33 ? 3.113   8.206   -0.391  1.00 0.00 ? 33  ARG A CB   10 
ATOM   5993  C  CG   . ARG A 1 33 ? 2.247   8.369   0.848   1.00 0.00 ? 33  ARG A CG   10 
ATOM   5994  C  CD   . ARG A 1 33 ? 1.419   9.642   0.786   1.00 0.00 ? 33  ARG A CD   10 
ATOM   5995  N  NE   . ARG A 1 33 ? 0.509   9.648   -0.357  1.00 0.00 ? 33  ARG A NE   10 
ATOM   5996  C  CZ   . ARG A 1 33 ? -0.044  10.751  -0.850  1.00 0.00 ? 33  ARG A CZ   10 
ATOM   5997  N  NH1  . ARG A 1 33 ? 0.219   11.930  -0.304  1.00 0.00 ? 33  ARG A NH1  10 
ATOM   5998  N  NH2  . ARG A 1 33 ? -0.862  10.675  -1.892  1.00 0.00 ? 33  ARG A NH2  10 
ATOM   5999  H  H    . ARG A 1 33 ? 2.372   5.892   0.410   1.00 0.00 ? 33  ARG A H    10 
ATOM   6000  H  HA   . ARG A 1 33 ? 4.458   6.827   -1.322  1.00 0.00 ? 33  ARG A HA   10 
ATOM   6001  H  HB2  . ARG A 1 33 ? 3.724   9.091   -0.494  1.00 0.00 ? 33  ARG A HB2  10 
ATOM   6002  H  HB3  . ARG A 1 33 ? 2.463   8.125   -1.249  1.00 0.00 ? 33  ARG A HB3  10 
ATOM   6003  H  HG2  . ARG A 1 33 ? 1.580   7.522   0.924   1.00 0.00 ? 33  ARG A HG2  10 
ATOM   6004  H  HG3  . ARG A 1 33 ? 2.885   8.406   1.719   1.00 0.00 ? 33  ARG A HG3  10 
ATOM   6005  H  HD2  . ARG A 1 33 ? 0.841   9.725   1.694   1.00 0.00 ? 33  ARG A HD2  10 
ATOM   6006  H  HD3  . ARG A 1 33 ? 2.087   10.487  0.706   1.00 0.00 ? 33  ARG A HD3  10 
ATOM   6007  H  HE   . ARG A 1 33 ? 0.301   8.788   -0.775  1.00 0.00 ? 33  ARG A HE   10 
ATOM   6008  H  HH11 . ARG A 1 33 ? 0.836   11.990  0.481   1.00 0.00 ? 33  ARG A HH11 10 
ATOM   6009  H  HH12 . ARG A 1 33 ? -0.198  12.758  -0.678  1.00 0.00 ? 33  ARG A HH12 10 
ATOM   6010  H  HH21 . ARG A 1 33 ? -1.063  9.788   -2.306  1.00 0.00 ? 33  ARG A HH21 10 
ATOM   6011  H  HH22 . ARG A 1 33 ? -1.278  11.505  -2.262  1.00 0.00 ? 33  ARG A HH22 10 
ATOM   6012  N  N    . THR A 1 34 ? 4.840   7.000   1.940   1.00 0.00 ? 34  THR A N    10 
ATOM   6013  C  CA   . THR A 1 34 ? 5.822   7.182   3.002   1.00 0.00 ? 34  THR A CA   10 
ATOM   6014  C  C    . THR A 1 34 ? 7.119   6.447   2.682   1.00 0.00 ? 34  THR A C    10 
ATOM   6015  O  O    . THR A 1 34 ? 8.205   6.895   3.053   1.00 0.00 ? 34  THR A O    10 
ATOM   6016  C  CB   . THR A 1 34 ? 5.284   6.684   4.356   1.00 0.00 ? 34  THR A CB   10 
ATOM   6017  O  OG1  . THR A 1 34 ? 5.984   7.326   5.428   1.00 0.00 ? 34  THR A OG1  10 
ATOM   6018  C  CG2  . THR A 1 34 ? 5.436   5.175   4.478   1.00 0.00 ? 34  THR A CG2  10 
ATOM   6019  H  H    . THR A 1 34 ? 3.930   6.721   2.173   1.00 0.00 ? 34  THR A H    10 
ATOM   6020  H  HA   . THR A 1 34 ? 6.029   8.238   3.087   1.00 0.00 ? 34  THR A HA   10 
ATOM   6021  H  HB   . THR A 1 34 ? 4.234   6.931   4.422   1.00 0.00 ? 34  THR A HB   10 
ATOM   6022  H  HG1  . THR A 1 34 ? 6.865   6.953   5.504   1.00 0.00 ? 34  THR A HG1  10 
ATOM   6023  H  HG21 . THR A 1 34 ? 4.721   4.798   5.193   1.00 0.00 ? 34  THR A HG21 10 
ATOM   6024  H  HG22 . THR A 1 34 ? 6.436   4.939   4.810   1.00 0.00 ? 34  THR A HG22 10 
ATOM   6025  H  HG23 . THR A 1 34 ? 5.259   4.717   3.516   1.00 0.00 ? 34  THR A HG23 10 
ATOM   6026  N  N    . HIS A 1 35 ? 7.000   5.318   1.992   1.00 0.00 ? 35  HIS A N    10 
ATOM   6027  C  CA   . HIS A 1 35 ? 8.164   4.522   1.621   1.00 0.00 ? 35  HIS A CA   10 
ATOM   6028  C  C    . HIS A 1 35 ? 9.242   5.397   0.988   1.00 0.00 ? 35  HIS A C    10 
ATOM   6029  O  O    . HIS A 1 35 ? 10.410  5.012   0.919   1.00 0.00 ? 35  HIS A O    10 
ATOM   6030  C  CB   . HIS A 1 35 ? 7.761   3.409   0.652   1.00 0.00 ? 35  HIS A CB   10 
ATOM   6031  C  CG   . HIS A 1 35 ? 7.277   2.167   1.335   1.00 0.00 ? 35  HIS A CG   10 
ATOM   6032  N  ND1  . HIS A 1 35 ? 8.119   1.146   1.724   1.00 0.00 ? 35  HIS A ND1  10 
ATOM   6033  C  CD2  . HIS A 1 35 ? 6.031   1.785   1.699   1.00 0.00 ? 35  HIS A CD2  10 
ATOM   6034  C  CE1  . HIS A 1 35 ? 7.411   0.189   2.297   1.00 0.00 ? 35  HIS A CE1  10 
ATOM   6035  N  NE2  . HIS A 1 35 ? 6.141   0.552   2.295   1.00 0.00 ? 35  HIS A NE2  10 
ATOM   6036  H  H    . HIS A 1 35 ? 6.108   5.013   1.725   1.00 0.00 ? 35  HIS A H    10 
ATOM   6037  H  HA   . HIS A 1 35 ? 8.562   4.077   2.520   1.00 0.00 ? 35  HIS A HA   10 
ATOM   6038  H  HB2  . HIS A 1 35 ? 6.966   3.767   0.014   1.00 0.00 ? 35  HIS A HB2  10 
ATOM   6039  H  HB3  . HIS A 1 35 ? 8.613   3.144   0.043   1.00 0.00 ? 35  HIS A HB3  10 
ATOM   6040  H  HD1  . HIS A 1 35 ? 9.090   1.125   1.598   1.00 0.00 ? 35  HIS A HD1  10 
ATOM   6041  H  HD2  . HIS A 1 35 ? 5.119   2.345   1.549   1.00 0.00 ? 35  HIS A HD2  10 
ATOM   6042  H  HE1  . HIS A 1 35 ? 7.802   -0.733  2.698   1.00 0.00 ? 35  HIS A HE1  10 
ATOM   6043  N  N    . THR A 1 36 ? 8.842   6.578   0.526   1.00 0.00 ? 36  THR A N    10 
ATOM   6044  C  CA   . THR A 1 36 ? 9.773   7.507   -0.103  1.00 0.00 ? 36  THR A CA   10 
ATOM   6045  C  C    . THR A 1 36 ? 9.894   8.794   0.705   1.00 0.00 ? 36  THR A C    10 
ATOM   6046  O  O    . THR A 1 36 ? 9.964   9.887   0.143   1.00 0.00 ? 36  THR A O    10 
ATOM   6047  C  CB   . THR A 1 36 ? 9.335   7.855   -1.538  1.00 0.00 ? 36  THR A CB   10 
ATOM   6048  O  OG1  . THR A 1 36 ? 8.040   8.465   -1.522  1.00 0.00 ? 36  THR A OG1  10 
ATOM   6049  C  CG2  . THR A 1 36 ? 9.303   6.609   -2.411  1.00 0.00 ? 36  THR A CG2  10 
ATOM   6050  H  H    . THR A 1 36 ? 7.899   6.828   0.610   1.00 0.00 ? 36  THR A H    10 
ATOM   6051  H  HA   . THR A 1 36 ? 10.741  7.030   -0.150  1.00 0.00 ? 36  THR A HA   10 
ATOM   6052  H  HB   . THR A 1 36 ? 10.048  8.551   -1.957  1.00 0.00 ? 36  THR A HB   10 
ATOM   6053  H  HG1  . THR A 1 36 ? 7.403   7.854   -1.145  1.00 0.00 ? 36  THR A HG1  10 
ATOM   6054  H  HG21 . THR A 1 36 ? 9.263   5.732   -1.783  1.00 0.00 ? 36  THR A HG21 10 
ATOM   6055  H  HG22 . THR A 1 36 ? 10.193  6.574   -3.022  1.00 0.00 ? 36  THR A HG22 10 
ATOM   6056  H  HG23 . THR A 1 36 ? 8.430   6.637   -3.046  1.00 0.00 ? 36  THR A HG23 10 
ATOM   6057  N  N    . GLY A 1 37 ? 9.920   8.658   2.027   1.00 0.00 ? 37  GLY A N    10 
ATOM   6058  C  CA   . GLY A 1 37 ? 10.034  9.818   2.891   1.00 0.00 ? 37  GLY A CA   10 
ATOM   6059  C  C    . GLY A 1 37 ? 11.412  9.948   3.508   1.00 0.00 ? 37  GLY A C    10 
ATOM   6060  O  O    . GLY A 1 37 ? 11.957  11.048  3.598   1.00 0.00 ? 37  GLY A O    10 
ATOM   6061  H  H    . GLY A 1 37 ? 9.860   7.761   2.419   1.00 0.00 ? 37  GLY A H    10 
ATOM   6062  H  HA2  . GLY A 1 37 ? 9.824   10.706  2.312   1.00 0.00 ? 37  GLY A HA2  10 
ATOM   6063  H  HA3  . GLY A 1 37 ? 9.304   9.736   3.683   1.00 0.00 ? 37  GLY A HA3  10 
ATOM   6064  N  N    . GLU A 1 38 ? 11.976  8.823   3.936   1.00 0.00 ? 38  GLU A N    10 
ATOM   6065  C  CA   . GLU A 1 38 ? 13.298  8.818   4.551   1.00 0.00 ? 38  GLU A CA   10 
ATOM   6066  C  C    . GLU A 1 38 ? 14.316  9.520   3.657   1.00 0.00 ? 38  GLU A C    10 
ATOM   6067  O  O    . GLU A 1 38 ? 14.435  9.212   2.472   1.00 0.00 ? 38  GLU A O    10 
ATOM   6068  C  CB   . GLU A 1 38 ? 13.750  7.383   4.828   1.00 0.00 ? 38  GLU A CB   10 
ATOM   6069  C  CG   . GLU A 1 38 ? 15.179  7.282   5.335   1.00 0.00 ? 38  GLU A CG   10 
ATOM   6070  C  CD   . GLU A 1 38 ? 15.322  7.745   6.772   1.00 0.00 ? 38  GLU A CD   10 
ATOM   6071  O  OE1  . GLU A 1 38 ? 15.159  6.908   7.684   1.00 0.00 ? 38  GLU A OE1  10 
ATOM   6072  O  OE2  . GLU A 1 38 ? 15.596  8.945   6.985   1.00 0.00 ? 38  GLU A OE2  10 
ATOM   6073  H  H    . GLU A 1 38 ? 11.491  7.977   3.837   1.00 0.00 ? 38  GLU A H    10 
ATOM   6074  H  HA   . GLU A 1 38 ? 13.231  9.351   5.487   1.00 0.00 ? 38  GLU A HA   10 
ATOM   6075  H  HB2  . GLU A 1 38 ? 13.095  6.948   5.568   1.00 0.00 ? 38  GLU A HB2  10 
ATOM   6076  H  HB3  . GLU A 1 38 ? 13.675  6.812   3.914   1.00 0.00 ? 38  GLU A HB3  10 
ATOM   6077  H  HG2  . GLU A 1 38 ? 15.498  6.252   5.272   1.00 0.00 ? 38  GLU A HG2  10 
ATOM   6078  H  HG3  . GLU A 1 38 ? 15.813  7.893   4.710   1.00 0.00 ? 38  GLU A HG3  10 
ATOM   6079  N  N    . SER A 1 39 ? 15.048  10.467  4.235   1.00 0.00 ? 39  SER A N    10 
ATOM   6080  C  CA   . SER A 1 39 ? 16.053  11.217  3.491   1.00 0.00 ? 39  SER A CA   10 
ATOM   6081  C  C    . SER A 1 39 ? 17.298  11.450  4.342   1.00 0.00 ? 39  SER A C    10 
ATOM   6082  O  O    . SER A 1 39 ? 17.282  12.245  5.281   1.00 0.00 ? 39  SER A O    10 
ATOM   6083  C  CB   . SER A 1 39 ? 15.480  12.558  3.028   1.00 0.00 ? 39  SER A CB   10 
ATOM   6084  O  OG   . SER A 1 39 ? 16.283  13.132  2.011   1.00 0.00 ? 39  SER A OG   10 
ATOM   6085  H  H    . SER A 1 39 ? 14.907  10.668  5.184   1.00 0.00 ? 39  SER A H    10 
ATOM   6086  H  HA   . SER A 1 39 ? 16.328  10.634  2.625   1.00 0.00 ? 39  SER A HA   10 
ATOM   6087  H  HB2  . SER A 1 39 ? 14.484  12.406  2.640   1.00 0.00 ? 39  SER A HB2  10 
ATOM   6088  H  HB3  . SER A 1 39 ? 15.441  13.238  3.866   1.00 0.00 ? 39  SER A HB3  10 
ATOM   6089  H  HG   . SER A 1 39 ? 16.954  13.691  2.410   1.00 0.00 ? 39  SER A HG   10 
ATOM   6090  N  N    . GLY A 1 40 ? 18.377  10.750  4.006   1.00 0.00 ? 40  GLY A N    10 
ATOM   6091  C  CA   . GLY A 1 40 ? 19.615  10.893  4.749   1.00 0.00 ? 40  GLY A CA   10 
ATOM   6092  C  C    . GLY A 1 40 ? 20.118  9.573   5.299   1.00 0.00 ? 40  GLY A C    10 
ATOM   6093  O  O    . GLY A 1 40 ? 19.365  8.610   5.445   1.00 0.00 ? 40  GLY A O    10 
ATOM   6094  H  H    . GLY A 1 40 ? 18.331  10.130  3.248   1.00 0.00 ? 40  GLY A H    10 
ATOM   6095  H  HA2  . GLY A 1 40 ? 20.368  11.309  4.096   1.00 0.00 ? 40  GLY A HA2  10 
ATOM   6096  H  HA3  . GLY A 1 40 ? 19.452  11.574  5.572   1.00 0.00 ? 40  GLY A HA3  10 
ATOM   6097  N  N    . PRO A 1 41 ? 21.421  9.516   5.613   1.00 0.00 ? 41  PRO A N    10 
ATOM   6098  C  CA   . PRO A 1 41 ? 22.053  8.309   6.154   1.00 0.00 ? 41  PRO A CA   10 
ATOM   6099  C  C    . PRO A 1 41 ? 21.596  8.003   7.576   1.00 0.00 ? 41  PRO A C    10 
ATOM   6100  O  O    . PRO A 1 41 ? 21.484  8.902   8.409   1.00 0.00 ? 41  PRO A O    10 
ATOM   6101  C  CB   . PRO A 1 41 ? 23.545  8.650   6.133   1.00 0.00 ? 41  PRO A CB   10 
ATOM   6102  C  CG   . PRO A 1 41 ? 23.594  10.137  6.200   1.00 0.00 ? 41  PRO A CG   10 
ATOM   6103  C  CD   . PRO A 1 41 ? 22.377  10.626  5.465   1.00 0.00 ? 41  PRO A CD   10 
ATOM   6104  H  HA   . PRO A 1 41 ? 21.869  7.450   5.525   1.00 0.00 ? 41  PRO A HA   10 
ATOM   6105  H  HB2  . PRO A 1 41 ? 24.032  8.199   6.986   1.00 0.00 ? 41  PRO A HB2  10 
ATOM   6106  H  HB3  . PRO A 1 41 ? 23.989  8.281   5.221   1.00 0.00 ? 41  PRO A HB3  10 
ATOM   6107  H  HG2  . PRO A 1 41 ? 23.565  10.460  7.230   1.00 0.00 ? 41  PRO A HG2  10 
ATOM   6108  H  HG3  . PRO A 1 41 ? 24.492  10.497  5.719   1.00 0.00 ? 41  PRO A HG3  10 
ATOM   6109  H  HD2  . PRO A 1 41 ? 21.996  11.527  5.923   1.00 0.00 ? 41  PRO A HD2  10 
ATOM   6110  H  HD3  . PRO A 1 41 ? 22.609  10.798  4.424   1.00 0.00 ? 41  PRO A HD3  10 
ATOM   6111  N  N    . SER A 1 42 ? 21.334  6.728   7.847   1.00 0.00 ? 42  SER A N    10 
ATOM   6112  C  CA   . SER A 1 42 ? 20.886  6.305   9.168   1.00 0.00 ? 42  SER A CA   10 
ATOM   6113  C  C    . SER A 1 42 ? 22.014  6.422   10.188  1.00 0.00 ? 42  SER A C    10 
ATOM   6114  O  O    . SER A 1 42 ? 21.815  6.919   11.297  1.00 0.00 ? 42  SER A O    10 
ATOM   6115  C  CB   . SER A 1 42 ? 20.376  4.863   9.119   1.00 0.00 ? 42  SER A CB   10 
ATOM   6116  O  OG   . SER A 1 42 ? 21.337  4.002   8.534   1.00 0.00 ? 42  SER A OG   10 
ATOM   6117  H  H    . SER A 1 42 ? 21.442  6.058   7.141   1.00 0.00 ? 42  SER A H    10 
ATOM   6118  H  HA   . SER A 1 42 ? 20.076  6.953   9.468   1.00 0.00 ? 42  SER A HA   10 
ATOM   6119  H  HB2  . SER A 1 42 ? 20.169  4.523   10.122  1.00 0.00 ? 42  SER A HB2  10 
ATOM   6120  H  HB3  . SER A 1 42 ? 19.470  4.824   8.531   1.00 0.00 ? 42  SER A HB3  10 
ATOM   6121  H  HG   . SER A 1 42 ? 21.356  4.141   7.585   1.00 0.00 ? 42  SER A HG   10 
ATOM   6122  N  N    . SER A 1 43 ? 23.200  5.961   9.805   1.00 0.00 ? 43  SER A N    10 
ATOM   6123  C  CA   . SER A 1 43 ? 24.361  6.010   10.686  1.00 0.00 ? 43  SER A CA   10 
ATOM   6124  C  C    . SER A 1 43 ? 24.905  7.432   10.789  1.00 0.00 ? 43  SER A C    10 
ATOM   6125  O  O    . SER A 1 43 ? 25.018  8.139   9.789   1.00 0.00 ? 43  SER A O    10 
ATOM   6126  C  CB   . SER A 1 43 ? 25.455  5.069   10.177  1.00 0.00 ? 43  SER A CB   10 
ATOM   6127  O  OG   . SER A 1 43 ? 24.944  3.766   9.957   1.00 0.00 ? 43  SER A OG   10 
ATOM   6128  H  H    . SER A 1 43 ? 23.296  5.576   8.909   1.00 0.00 ? 43  SER A H    10 
ATOM   6129  H  HA   . SER A 1 43 ? 24.047  5.686   11.667  1.00 0.00 ? 43  SER A HA   10 
ATOM   6130  H  HB2  . SER A 1 43 ? 25.850  5.450   9.248   1.00 0.00 ? 43  SER A HB2  10 
ATOM   6131  H  HB3  . SER A 1 43 ? 26.247  5.013   10.910  1.00 0.00 ? 43  SER A HB3  10 
ATOM   6132  H  HG   . SER A 1 43 ? 24.534  3.725   9.090   1.00 0.00 ? 43  SER A HG   10 
ATOM   6133  N  N    . GLY A 1 44 ? 25.241  7.844   12.008  1.00 0.00 ? 44  GLY A N    10 
ATOM   6134  C  CA   . GLY A 1 44 ? 25.769  9.179   12.221  1.00 0.00 ? 44  GLY A CA   10 
ATOM   6135  C  C    . GLY A 1 44 ? 27.214  9.307   11.783  1.00 0.00 ? 44  GLY A C    10 
ATOM   6136  O  O    . GLY A 1 44 ? 27.498  10.086  10.875  1.00 0.00 ? 44  GLY A O    10 
ATOM   6137  H  H    . GLY A 1 44 ? 25.129  7.236   12.769  1.00 0.00 ? 44  GLY A H    10 
ATOM   6138  H  HA2  . GLY A 1 44 ? 25.170  9.884   11.663  1.00 0.00 ? 44  GLY A HA2  10 
ATOM   6139  H  HA3  . GLY A 1 44 ? 25.701  9.417   13.272  1.00 0.00 ? 44  GLY A HA3  10 
HETATM 6140  ZN ZN   . ZN  B 2 .  ? 4.487   -0.422  2.841   1.00 0.00 ? 181 ZN  A ZN   10 
ATOM   6141  N  N    . GLY A 1 1  ? -4.150  -36.149 -0.586  1.00 0.00 ? 1   GLY A N    11 
ATOM   6142  C  CA   . GLY A 1 1  ? -4.526  -35.375 0.584   1.00 0.00 ? 1   GLY A CA   11 
ATOM   6143  C  C    . GLY A 1 1  ? -4.858  -33.936 0.244   1.00 0.00 ? 1   GLY A C    11 
ATOM   6144  O  O    . GLY A 1 1  ? -5.145  -33.613 -0.908  1.00 0.00 ? 1   GLY A O    11 
ATOM   6145  H  H1   . GLY A 1 1  ? -4.796  -36.764 -0.992  1.00 0.00 ? 1   GLY A H1   11 
ATOM   6146  H  HA2  . GLY A 1 1  ? -5.388  -35.834 1.044   1.00 0.00 ? 1   GLY A HA2  11 
ATOM   6147  H  HA3  . GLY A 1 1  ? -3.706  -35.387 1.287   1.00 0.00 ? 1   GLY A HA3  11 
ATOM   6148  N  N    . SER A 1 2  ? -4.821  -33.069 1.251   1.00 0.00 ? 2   SER A N    11 
ATOM   6149  C  CA   . SER A 1 2  ? -5.126  -31.656 1.055   1.00 0.00 ? 2   SER A CA   11 
ATOM   6150  C  C    . SER A 1 2  ? -4.179  -30.778 1.867   1.00 0.00 ? 2   SER A C    11 
ATOM   6151  O  O    . SER A 1 2  ? -4.153  -30.845 3.095   1.00 0.00 ? 2   SER A O    11 
ATOM   6152  C  CB   . SER A 1 2  ? -6.575  -31.366 1.451   1.00 0.00 ? 2   SER A CB   11 
ATOM   6153  O  OG   . SER A 1 2  ? -7.028  -30.152 0.876   1.00 0.00 ? 2   SER A OG   11 
ATOM   6154  H  H    . SER A 1 2  ? -4.585  -33.387 2.148   1.00 0.00 ? 2   SER A H    11 
ATOM   6155  H  HA   . SER A 1 2  ? -4.997  -31.432 0.006   1.00 0.00 ? 2   SER A HA   11 
ATOM   6156  H  HB2  . SER A 1 2  ? -7.208  -32.170 1.108   1.00 0.00 ? 2   SER A HB2  11 
ATOM   6157  H  HB3  . SER A 1 2  ? -6.642  -31.289 2.527   1.00 0.00 ? 2   SER A HB3  11 
ATOM   6158  H  HG   . SER A 1 2  ? -7.599  -30.345 0.130   1.00 0.00 ? 2   SER A HG   11 
ATOM   6159  N  N    . SER A 1 3  ? -3.403  -29.954 1.170   1.00 0.00 ? 3   SER A N    11 
ATOM   6160  C  CA   . SER A 1 3  ? -2.451  -29.065 1.825   1.00 0.00 ? 3   SER A CA   11 
ATOM   6161  C  C    . SER A 1 3  ? -2.762  -27.606 1.504   1.00 0.00 ? 3   SER A C    11 
ATOM   6162  O  O    . SER A 1 3  ? -2.491  -27.129 0.403   1.00 0.00 ? 3   SER A O    11 
ATOM   6163  C  CB   . SER A 1 3  ? -1.023  -29.401 1.389   1.00 0.00 ? 3   SER A CB   11 
ATOM   6164  O  OG   . SER A 1 3  ? -0.072  -28.815 2.261   1.00 0.00 ? 3   SER A OG   11 
ATOM   6165  H  H    . SER A 1 3  ? -3.470  -29.947 0.192   1.00 0.00 ? 3   SER A H    11 
ATOM   6166  H  HA   . SER A 1 3  ? -2.537  -29.213 2.890   1.00 0.00 ? 3   SER A HA   11 
ATOM   6167  H  HB2  . SER A 1 3  ? -0.890  -30.472 1.397   1.00 0.00 ? 3   SER A HB2  11 
ATOM   6168  H  HB3  . SER A 1 3  ? -0.857  -29.025 0.389   1.00 0.00 ? 3   SER A HB3  11 
ATOM   6169  H  HG   . SER A 1 3  ? -0.469  -28.685 3.126   1.00 0.00 ? 3   SER A HG   11 
ATOM   6170  N  N    . GLY A 1 4  ? -3.334  -26.902 2.477   1.00 0.00 ? 4   GLY A N    11 
ATOM   6171  C  CA   . GLY A 1 4  ? -3.674  -25.505 2.280   1.00 0.00 ? 4   GLY A CA   11 
ATOM   6172  C  C    . GLY A 1 4  ? -5.170  -25.263 2.300   1.00 0.00 ? 4   GLY A C    11 
ATOM   6173  O  O    . GLY A 1 4  ? -5.773  -24.977 1.266   1.00 0.00 ? 4   GLY A O    11 
ATOM   6174  H  H    . GLY A 1 4  ? -3.527  -27.335 3.334   1.00 0.00 ? 4   GLY A H    11 
ATOM   6175  H  HA2  . GLY A 1 4  ? -3.214  -24.920 3.063   1.00 0.00 ? 4   GLY A HA2  11 
ATOM   6176  H  HA3  . GLY A 1 4  ? -3.281  -25.182 1.327   1.00 0.00 ? 4   GLY A HA3  11 
ATOM   6177  N  N    . SER A 1 5  ? -5.771  -25.381 3.480   1.00 0.00 ? 5   SER A N    11 
ATOM   6178  C  CA   . SER A 1 5  ? -7.207  -25.179 3.629   1.00 0.00 ? 5   SER A CA   11 
ATOM   6179  C  C    . SER A 1 5  ? -7.622  -23.811 3.094   1.00 0.00 ? 5   SER A C    11 
ATOM   6180  O  O    . SER A 1 5  ? -8.575  -23.697 2.324   1.00 0.00 ? 5   SER A O    11 
ATOM   6181  C  CB   . SER A 1 5  ? -7.612  -25.308 5.099   1.00 0.00 ? 5   SER A CB   11 
ATOM   6182  O  OG   . SER A 1 5  ? -9.001  -25.088 5.267   1.00 0.00 ? 5   SER A OG   11 
ATOM   6183  H  H    . SER A 1 5  ? -5.236  -25.611 4.268   1.00 0.00 ? 5   SER A H    11 
ATOM   6184  H  HA   . SER A 1 5  ? -7.711  -25.944 3.057   1.00 0.00 ? 5   SER A HA   11 
ATOM   6185  H  HB2  . SER A 1 5  ? -7.372  -26.300 5.450   1.00 0.00 ? 5   SER A HB2  11 
ATOM   6186  H  HB3  . SER A 1 5  ? -7.070  -24.578 5.684   1.00 0.00 ? 5   SER A HB3  11 
ATOM   6187  H  HG   . SER A 1 5  ? -9.312  -24.477 4.595   1.00 0.00 ? 5   SER A HG   11 
ATOM   6188  N  N    . SER A 1 6  ? -6.898  -22.776 3.509   1.00 0.00 ? 6   SER A N    11 
ATOM   6189  C  CA   . SER A 1 6  ? -7.192  -21.415 3.075   1.00 0.00 ? 6   SER A CA   11 
ATOM   6190  C  C    . SER A 1 6  ? -6.047  -20.852 2.240   1.00 0.00 ? 6   SER A C    11 
ATOM   6191  O  O    . SER A 1 6  ? -4.955  -20.604 2.749   1.00 0.00 ? 6   SER A O    11 
ATOM   6192  C  CB   . SER A 1 6  ? -7.445  -20.515 4.287   1.00 0.00 ? 6   SER A CB   11 
ATOM   6193  O  OG   . SER A 1 6  ? -8.737  -20.736 4.825   1.00 0.00 ? 6   SER A OG   11 
ATOM   6194  H  H    . SER A 1 6  ? -6.150  -22.932 4.123   1.00 0.00 ? 6   SER A H    11 
ATOM   6195  H  HA   . SER A 1 6  ? -8.084  -21.446 2.468   1.00 0.00 ? 6   SER A HA   11 
ATOM   6196  H  HB2  . SER A 1 6  ? -6.710  -20.726 5.048   1.00 0.00 ? 6   SER A HB2  11 
ATOM   6197  H  HB3  . SER A 1 6  ? -7.365  -19.481 3.985   1.00 0.00 ? 6   SER A HB3  11 
ATOM   6198  H  HG   . SER A 1 6  ? -9.318  -21.071 4.137   1.00 0.00 ? 6   SER A HG   11 
ATOM   6199  N  N    . GLY A 1 7  ? -6.305  -20.653 0.951   1.00 0.00 ? 7   GLY A N    11 
ATOM   6200  C  CA   . GLY A 1 7  ? -5.288  -20.121 0.063   1.00 0.00 ? 7   GLY A CA   11 
ATOM   6201  C  C    . GLY A 1 7  ? -5.610  -18.719 -0.415  1.00 0.00 ? 7   GLY A C    11 
ATOM   6202  O  O    . GLY A 1 7  ? -6.746  -18.258 -0.291  1.00 0.00 ? 7   GLY A O    11 
ATOM   6203  H  H    . GLY A 1 7  ? -7.195  -20.869 0.599   1.00 0.00 ? 7   GLY A H    11 
ATOM   6204  H  HA2  . GLY A 1 7  ? -4.343  -20.103 0.586   1.00 0.00 ? 7   GLY A HA2  11 
ATOM   6205  H  HA3  . GLY A 1 7  ? -5.200  -20.770 -0.795  1.00 0.00 ? 7   GLY A HA3  11 
ATOM   6206  N  N    . THR A 1 8  ? -4.609  -18.036 -0.961  1.00 0.00 ? 8   THR A N    11 
ATOM   6207  C  CA   . THR A 1 8  ? -4.791  -16.678 -1.456  1.00 0.00 ? 8   THR A CA   11 
ATOM   6208  C  C    . THR A 1 8  ? -3.575  -16.215 -2.251  1.00 0.00 ? 8   THR A C    11 
ATOM   6209  O  O    . THR A 1 8  ? -2.442  -16.581 -1.941  1.00 0.00 ? 8   THR A O    11 
ATOM   6210  C  CB   . THR A 1 8  ? -5.043  -15.688 -0.303  1.00 0.00 ? 8   THR A CB   11 
ATOM   6211  O  OG1  . THR A 1 8  ? -5.247  -14.370 -0.824  1.00 0.00 ? 8   THR A OG1  11 
ATOM   6212  C  CG2  . THR A 1 8  ? -3.872  -15.680 0.668   1.00 0.00 ? 8   THR A CG2  11 
ATOM   6213  H  H    . THR A 1 8  ? -3.727  -18.458 -1.031  1.00 0.00 ? 8   THR A H    11 
ATOM   6214  H  HA   . THR A 1 8  ? -5.656  -16.672 -2.104  1.00 0.00 ? 8   THR A HA   11 
ATOM   6215  H  HB   . THR A 1 8  ? -5.931  -15.998 0.229   1.00 0.00 ? 8   THR A HB   11 
ATOM   6216  H  HG1  . THR A 1 8  ? -5.567  -14.429 -1.728  1.00 0.00 ? 8   THR A HG1  11 
ATOM   6217  H  HG21 . THR A 1 8  ? -3.506  -14.670 0.781   1.00 0.00 ? 8   THR A HG21 11 
ATOM   6218  H  HG22 . THR A 1 8  ? -3.081  -16.308 0.285   1.00 0.00 ? 8   THR A HG22 11 
ATOM   6219  H  HG23 . THR A 1 8  ? -4.197  -16.055 1.627   1.00 0.00 ? 8   THR A HG23 11 
ATOM   6220  N  N    . GLY A 1 9  ? -3.818  -15.407 -3.279  1.00 0.00 ? 9   GLY A N    11 
ATOM   6221  C  CA   . GLY A 1 9  ? -2.732  -14.907 -4.102  1.00 0.00 ? 9   GLY A CA   11 
ATOM   6222  C  C    . GLY A 1 9  ? -2.441  -13.441 -3.849  1.00 0.00 ? 9   GLY A C    11 
ATOM   6223  O  O    . GLY A 1 9  ? -1.545  -13.104 -3.076  1.00 0.00 ? 9   GLY A O    11 
ATOM   6224  H  H    . GLY A 1 9  ? -4.742  -15.148 -3.479  1.00 0.00 ? 9   GLY A H    11 
ATOM   6225  H  HA2  . GLY A 1 9  ? -1.842  -15.482 -3.893  1.00 0.00 ? 9   GLY A HA2  11 
ATOM   6226  H  HA3  . GLY A 1 9  ? -2.996  -15.035 -5.142  1.00 0.00 ? 9   GLY A HA3  11 
ATOM   6227  N  N    . MET A 1 10 ? -3.198  -12.567 -4.505  1.00 0.00 ? 10  MET A N    11 
ATOM   6228  C  CA   . MET A 1 10 ? -3.015  -11.129 -4.347  1.00 0.00 ? 10  MET A CA   11 
ATOM   6229  C  C    . MET A 1 10 ? -3.825  -10.604 -3.166  1.00 0.00 ? 10  MET A C    11 
ATOM   6230  O  O    . MET A 1 10 ? -4.960  -11.027 -2.941  1.00 0.00 ? 10  MET A O    11 
ATOM   6231  C  CB   . MET A 1 10 ? -3.426  -10.398 -5.627  1.00 0.00 ? 10  MET A CB   11 
ATOM   6232  C  CG   . MET A 1 10 ? -2.500  -10.665 -6.803  1.00 0.00 ? 10  MET A CG   11 
ATOM   6233  S  SD   . MET A 1 10 ? -2.868  -9.622  -8.227  1.00 0.00 ? 10  MET A SD   11 
ATOM   6234  C  CE   . MET A 1 10 ? -3.533  -10.831 -9.369  1.00 0.00 ? 10  MET A CE   11 
ATOM   6235  H  H    . MET A 1 10 ? -3.897  -12.897 -5.108  1.00 0.00 ? 10  MET A H    11 
ATOM   6236  H  HA   . MET A 1 10 ? -1.968  -10.947 -4.159  1.00 0.00 ? 10  MET A HA   11 
ATOM   6237  H  HB2  . MET A 1 10 ? -4.422  -10.710 -5.902  1.00 0.00 ? 10  MET A HB2  11 
ATOM   6238  H  HB3  . MET A 1 10 ? -3.430  -9.335  -5.435  1.00 0.00 ? 10  MET A HB3  11 
ATOM   6239  H  HG2  . MET A 1 10 ? -1.482  -10.479 -6.492  1.00 0.00 ? 10  MET A HG2  11 
ATOM   6240  H  HG3  . MET A 1 10 ? -2.602  -11.700 -7.095  1.00 0.00 ? 10  MET A HG3  11 
ATOM   6241  H  HE1  . MET A 1 10 ? -2.723  -11.293 -9.915  1.00 0.00 ? 10  MET A HE1  11 
ATOM   6242  H  HE2  . MET A 1 10 ? -4.073  -11.587 -8.819  1.00 0.00 ? 10  MET A HE2  11 
ATOM   6243  H  HE3  . MET A 1 10 ? -4.202  -10.342 -10.061 1.00 0.00 ? 10  MET A HE3  11 
ATOM   6244  N  N    . LYS A 1 11 ? -3.236  -9.682  -2.413  1.00 0.00 ? 11  LYS A N    11 
ATOM   6245  C  CA   . LYS A 1 11 ? -3.903  -9.098  -1.255  1.00 0.00 ? 11  LYS A CA   11 
ATOM   6246  C  C    . LYS A 1 11 ? -4.778  -7.919  -1.668  1.00 0.00 ? 11  LYS A C    11 
ATOM   6247  O  O    . LYS A 1 11 ? -4.636  -7.361  -2.756  1.00 0.00 ? 11  LYS A O    11 
ATOM   6248  C  CB   . LYS A 1 11 ? -2.870  -8.643  -0.222  1.00 0.00 ? 11  LYS A CB   11 
ATOM   6249  C  CG   . LYS A 1 11 ? -2.554  -9.695  0.828   1.00 0.00 ? 11  LYS A CG   11 
ATOM   6250  C  CD   . LYS A 1 11 ? -1.093  -9.649  1.242   1.00 0.00 ? 11  LYS A CD   11 
ATOM   6251  C  CE   . LYS A 1 11 ? -0.209  -10.386 0.248   1.00 0.00 ? 11  LYS A CE   11 
ATOM   6252  N  NZ   . LYS A 1 11 ? -0.178  -11.851 0.511   1.00 0.00 ? 11  LYS A NZ   11 
ATOM   6253  H  H    . LYS A 1 11 ? -2.330  -9.385  -2.643  1.00 0.00 ? 11  LYS A H    11 
ATOM   6254  H  HA   . LYS A 1 11 ? -4.529  -9.859  -0.814  1.00 0.00 ? 11  LYS A HA   11 
ATOM   6255  H  HB2  . LYS A 1 11 ? -1.953  -8.390  -0.734  1.00 0.00 ? 11  LYS A HB2  11 
ATOM   6256  H  HB3  . LYS A 1 11 ? -3.245  -7.764  0.282   1.00 0.00 ? 11  LYS A HB3  11 
ATOM   6257  H  HG2  . LYS A 1 11 ? -3.170  -9.519  1.697   1.00 0.00 ? 11  LYS A HG2  11 
ATOM   6258  H  HG3  . LYS A 1 11 ? -2.774  -10.673 0.421   1.00 0.00 ? 11  LYS A HG3  11 
ATOM   6259  H  HD2  . LYS A 1 11 ? -0.775  -8.619  1.295   1.00 0.00 ? 11  LYS A HD2  11 
ATOM   6260  H  HD3  . LYS A 1 11 ? -0.989  -10.111 2.214   1.00 0.00 ? 11  LYS A HD3  11 
ATOM   6261  H  HE2  . LYS A 1 11 ? -0.589  -10.215 -0.748  1.00 0.00 ? 11  LYS A HE2  11 
ATOM   6262  H  HE3  . LYS A 1 11 ? 0.796   -9.994  0.321   1.00 0.00 ? 11  LYS A HE3  11 
ATOM   6263  H  HZ1  . LYS A 1 11 ? 0.616   -12.085 1.140   1.00 0.00 ? 11  LYS A HZ1  11 
ATOM   6264  H  HZ2  . LYS A 1 11 ? -0.065  -12.372 -0.382  1.00 0.00 ? 11  LYS A HZ2  11 
ATOM   6265  H  HZ3  . LYS A 1 11 ? -1.065  -12.151 0.964   1.00 0.00 ? 11  LYS A HZ3  11 
ATOM   6266  N  N    . PRO A 1 12 ? -5.703  -7.528  -0.779  1.00 0.00 ? 12  PRO A N    11 
ATOM   6267  C  CA   . PRO A 1 12 ? -6.618  -6.410  -1.029  1.00 0.00 ? 12  PRO A CA   11 
ATOM   6268  C  C    . PRO A 1 12 ? -5.902  -5.063  -1.023  1.00 0.00 ? 12  PRO A C    11 
ATOM   6269  O  O    . PRO A 1 12 ? -5.421  -4.601  -2.058  1.00 0.00 ? 12  PRO A O    11 
ATOM   6270  C  CB   . PRO A 1 12 ? -7.607  -6.494  0.136   1.00 0.00 ? 12  PRO A CB   11 
ATOM   6271  C  CG   . PRO A 1 12 ? -6.855  -7.182  1.223   1.00 0.00 ? 12  PRO A CG   11 
ATOM   6272  C  CD   . PRO A 1 12 ? -5.928  -8.147  0.538   1.00 0.00 ? 12  PRO A CD   11 
ATOM   6273  H  HA   . PRO A 1 12 ? -7.147  -6.531  -1.962  1.00 0.00 ? 12  PRO A HA   11 
ATOM   6274  H  HB2  . PRO A 1 12 ? -7.906  -5.498  0.431   1.00 0.00 ? 12  PRO A HB2  11 
ATOM   6275  H  HB3  . PRO A 1 12 ? -8.475  -7.062  -0.164  1.00 0.00 ? 12  PRO A HB3  11 
ATOM   6276  H  HG2  . PRO A 1 12 ? -6.291  -6.460  1.793   1.00 0.00 ? 12  PRO A HG2  11 
ATOM   6277  H  HG3  . PRO A 1 12 ? -7.542  -7.714  1.864   1.00 0.00 ? 12  PRO A HG3  11 
ATOM   6278  H  HD2  . PRO A 1 12 ? -5.001  -8.234  1.086   1.00 0.00 ? 12  PRO A HD2  11 
ATOM   6279  H  HD3  . PRO A 1 12 ? -6.398  -9.113  0.434   1.00 0.00 ? 12  PRO A HD3  11 
ATOM   6280  N  N    . TYR A 1 13 ? -5.835  -4.439  0.147   1.00 0.00 ? 13  TYR A N    11 
ATOM   6281  C  CA   . TYR A 1 13 ? -5.180  -3.144  0.286   1.00 0.00 ? 13  TYR A CA   11 
ATOM   6282  C  C    . TYR A 1 13 ? -3.857  -3.281  1.034   1.00 0.00 ? 13  TYR A C    11 
ATOM   6283  O  O    . TYR A 1 13 ? -3.297  -2.295  1.515   1.00 0.00 ? 13  TYR A O    11 
ATOM   6284  C  CB   . TYR A 1 13 ? -6.094  -2.162  1.021   1.00 0.00 ? 13  TYR A CB   11 
ATOM   6285  C  CG   . TYR A 1 13 ? -7.566  -2.468  0.858   1.00 0.00 ? 13  TYR A CG   11 
ATOM   6286  C  CD1  . TYR A 1 13 ? -8.164  -3.502  1.567   1.00 0.00 ? 13  TYR A CD1  11 
ATOM   6287  C  CD2  . TYR A 1 13 ? -8.359  -1.721  -0.005  1.00 0.00 ? 13  TYR A CD2  11 
ATOM   6288  C  CE1  . TYR A 1 13 ? -9.508  -3.785  1.420   1.00 0.00 ? 13  TYR A CE1  11 
ATOM   6289  C  CE2  . TYR A 1 13 ? -9.704  -1.995  -0.157  1.00 0.00 ? 13  TYR A CE2  11 
ATOM   6290  C  CZ   . TYR A 1 13 ? -10.274 -3.029  0.557   1.00 0.00 ? 13  TYR A CZ   11 
ATOM   6291  O  OH   . TYR A 1 13 ? -11.614 -3.307  0.409   1.00 0.00 ? 13  TYR A OH   11 
ATOM   6292  H  H    . TYR A 1 13 ? -6.238  -4.858  0.937   1.00 0.00 ? 13  TYR A H    11 
ATOM   6293  H  HA   . TYR A 1 13 ? -4.983  -2.764  -0.705  1.00 0.00 ? 13  TYR A HA   11 
ATOM   6294  H  HB2  . TYR A 1 13 ? -5.866  -2.188  2.075   1.00 0.00 ? 13  TYR A HB2  11 
ATOM   6295  H  HB3  . TYR A 1 13 ? -5.918  -1.166  0.644   1.00 0.00 ? 13  TYR A HB3  11 
ATOM   6296  H  HD1  . TYR A 1 13 ? -7.561  -4.092  2.242   1.00 0.00 ? 13  TYR A HD1  11 
ATOM   6297  H  HD2  . TYR A 1 13 ? -7.910  -0.912  -0.563  1.00 0.00 ? 13  TYR A HD2  11 
ATOM   6298  H  HE1  . TYR A 1 13 ? -9.955  -4.594  1.979   1.00 0.00 ? 13  TYR A HE1  11 
ATOM   6299  H  HE2  . TYR A 1 13 ? -10.305 -1.404  -0.832  1.00 0.00 ? 13  TYR A HE2  11 
ATOM   6300  H  HH   . TYR A 1 13 ? -11.837 -4.087  0.922   1.00 0.00 ? 13  TYR A HH   11 
ATOM   6301  N  N    . VAL A 1 14 ? -3.361  -4.511  1.127   1.00 0.00 ? 14  VAL A N    11 
ATOM   6302  C  CA   . VAL A 1 14 ? -2.103  -4.778  1.813   1.00 0.00 ? 14  VAL A CA   11 
ATOM   6303  C  C    . VAL A 1 14 ? -0.912  -4.355  0.962   1.00 0.00 ? 14  VAL A C    11 
ATOM   6304  O  O    . VAL A 1 14 ? -0.900  -4.556  -0.253  1.00 0.00 ? 14  VAL A O    11 
ATOM   6305  C  CB   . VAL A 1 14 ? -1.963  -6.271  2.167   1.00 0.00 ? 14  VAL A CB   11 
ATOM   6306  C  CG1  . VAL A 1 14 ? -0.764  -6.495  3.076   1.00 0.00 ? 14  VAL A CG1  11 
ATOM   6307  C  CG2  . VAL A 1 14 ? -3.239  -6.786  2.817   1.00 0.00 ? 14  VAL A CG2  11 
ATOM   6308  H  H    . VAL A 1 14 ? -3.854  -5.256  0.723   1.00 0.00 ? 14  VAL A H    11 
ATOM   6309  H  HA   . VAL A 1 14 ? -2.097  -4.210  2.732   1.00 0.00 ? 14  VAL A HA   11 
ATOM   6310  H  HB   . VAL A 1 14 ? -1.802  -6.823  1.253   1.00 0.00 ? 14  VAL A HB   11 
ATOM   6311  H  HG11 . VAL A 1 14 ? -1.089  -6.495  4.106   1.00 0.00 ? 14  VAL A HG11 11 
ATOM   6312  H  HG12 . VAL A 1 14 ? -0.306  -7.444  2.841   1.00 0.00 ? 14  VAL A HG12 11 
ATOM   6313  H  HG13 . VAL A 1 14 ? -0.047  -5.702  2.925   1.00 0.00 ? 14  VAL A HG13 11 
ATOM   6314  H  HG21 . VAL A 1 14 ? -3.515  -6.136  3.633   1.00 0.00 ? 14  VAL A HG21 11 
ATOM   6315  H  HG22 . VAL A 1 14 ? -4.033  -6.804  2.086   1.00 0.00 ? 14  VAL A HG22 11 
ATOM   6316  H  HG23 . VAL A 1 14 ? -3.074  -7.785  3.193   1.00 0.00 ? 14  VAL A HG23 11 
ATOM   6317  N  N    . CYS A 1 15 ? 0.091   -3.769  1.607   1.00 0.00 ? 15  CYS A N    11 
ATOM   6318  C  CA   . CYS A 1 15 ? 1.289   -3.316  0.910   1.00 0.00 ? 15  CYS A CA   11 
ATOM   6319  C  C    . CYS A 1 15 ? 2.121   -4.503  0.434   1.00 0.00 ? 15  CYS A C    11 
ATOM   6320  O  O    . CYS A 1 15 ? 2.727   -5.212  1.236   1.00 0.00 ? 15  CYS A O    11 
ATOM   6321  C  CB   . CYS A 1 15 ? 2.130   -2.424  1.825   1.00 0.00 ? 15  CYS A CB   11 
ATOM   6322  S  SG   . CYS A 1 15 ? 3.092   -1.152  0.944   1.00 0.00 ? 15  CYS A SG   11 
ATOM   6323  H  H    . CYS A 1 15 ? 0.024   -3.636  2.577   1.00 0.00 ? 15  CYS A H    11 
ATOM   6324  H  HA   . CYS A 1 15 ? 0.977   -2.743  0.051   1.00 0.00 ? 15  CYS A HA   11 
ATOM   6325  H  HB2  . CYS A 1 15 ? 1.477   -1.918  2.521   1.00 0.00 ? 15  CYS A HB2  11 
ATOM   6326  H  HB3  . CYS A 1 15 ? 2.826   -3.040  2.376   1.00 0.00 ? 15  CYS A HB3  11 
ATOM   6327  N  N    . ASN A 1 16 ? 2.146   -4.712  -0.879  1.00 0.00 ? 16  ASN A N    11 
ATOM   6328  C  CA   . ASN A 1 16 ? 2.904   -5.813  -1.463  1.00 0.00 ? 16  ASN A CA   11 
ATOM   6329  C  C    . ASN A 1 16 ? 4.404   -5.548  -1.376  1.00 0.00 ? 16  ASN A C    11 
ATOM   6330  O  O    . ASN A 1 16 ? 5.214   -6.368  -1.805  1.00 0.00 ? 16  ASN A O    11 
ATOM   6331  C  CB   . ASN A 1 16 ? 2.496   -6.022  -2.923  1.00 0.00 ? 16  ASN A CB   11 
ATOM   6332  C  CG   . ASN A 1 16 ? 1.332   -6.984  -3.066  1.00 0.00 ? 16  ASN A CG   11 
ATOM   6333  O  OD1  . ASN A 1 16 ? 1.454   -8.171  -2.765  1.00 0.00 ? 16  ASN A OD1  11 
ATOM   6334  N  ND2  . ASN A 1 16 ? 0.197   -6.474  -3.529  1.00 0.00 ? 16  ASN A ND2  11 
ATOM   6335  H  H    . ASN A 1 16 ? 1.642   -4.113  -1.468  1.00 0.00 ? 16  ASN A H    11 
ATOM   6336  H  HA   . ASN A 1 16 ? 2.675   -6.707  -0.903  1.00 0.00 ? 16  ASN A HA   11 
ATOM   6337  H  HB2  . ASN A 1 16 ? 2.207   -5.072  -3.349  1.00 0.00 ? 16  ASN A HB2  11 
ATOM   6338  H  HB3  . ASN A 1 16 ? 3.336   -6.417  -3.473  1.00 0.00 ? 16  ASN A HB3  11 
ATOM   6339  H  HD21 . ASN A 1 16 ? 0.173   -5.519  -3.749  1.00 0.00 ? 16  ASN A HD21 11 
ATOM   6340  H  HD22 . ASN A 1 16 ? -0.572  -7.073  -3.631  1.00 0.00 ? 16  ASN A HD22 11 
ATOM   6341  N  N    . GLU A 1 17 ? 4.764   -4.397  -0.816  1.00 0.00 ? 17  GLU A N    11 
ATOM   6342  C  CA   . GLU A 1 17 ? 6.166   -4.024  -0.673  1.00 0.00 ? 17  GLU A CA   11 
ATOM   6343  C  C    . GLU A 1 17 ? 6.690   -4.400  0.710   1.00 0.00 ? 17  GLU A C    11 
ATOM   6344  O  O    . GLU A 1 17 ? 7.797   -4.923  0.847   1.00 0.00 ? 17  GLU A O    11 
ATOM   6345  C  CB   . GLU A 1 17 ? 6.345   -2.523  -0.907  1.00 0.00 ? 17  GLU A CB   11 
ATOM   6346  C  CG   . GLU A 1 17 ? 5.760   -2.038  -2.223  1.00 0.00 ? 17  GLU A CG   11 
ATOM   6347  C  CD   . GLU A 1 17 ? 6.380   -0.736  -2.693  1.00 0.00 ? 17  GLU A CD   11 
ATOM   6348  O  OE1  . GLU A 1 17 ? 7.508   -0.425  -2.258  1.00 0.00 ? 17  GLU A OE1  11 
ATOM   6349  O  OE2  . GLU A 1 17 ? 5.736   -0.029  -3.496  1.00 0.00 ? 17  GLU A OE2  11 
ATOM   6350  H  H    . GLU A 1 17 ? 4.071   -3.784  -0.493  1.00 0.00 ? 17  GLU A H    11 
ATOM   6351  H  HA   . GLU A 1 17 ? 6.731   -4.564  -1.417  1.00 0.00 ? 17  GLU A HA   11 
ATOM   6352  H  HB2  . GLU A 1 17 ? 5.863   -1.985  -0.103  1.00 0.00 ? 17  GLU A HB2  11 
ATOM   6353  H  HB3  . GLU A 1 17 ? 7.400   -2.293  -0.900  1.00 0.00 ? 17  GLU A HB3  11 
ATOM   6354  H  HG2  . GLU A 1 17 ? 5.930   -2.792  -2.977  1.00 0.00 ? 17  GLU A HG2  11 
ATOM   6355  H  HG3  . GLU A 1 17 ? 4.698   -1.889  -2.098  1.00 0.00 ? 17  GLU A HG3  11 
ATOM   6356  N  N    . CYS A 1 18 ? 5.888   -4.129  1.734   1.00 0.00 ? 18  CYS A N    11 
ATOM   6357  C  CA   . CYS A 1 18 ? 6.269   -4.437  3.107   1.00 0.00 ? 18  CYS A CA   11 
ATOM   6358  C  C    . CYS A 1 18 ? 5.293   -5.429  3.733   1.00 0.00 ? 18  CYS A C    11 
ATOM   6359  O  O    . CYS A 1 18 ? 5.678   -6.264  4.550   1.00 0.00 ? 18  CYS A O    11 
ATOM   6360  C  CB   . CYS A 1 18 ? 6.319   -3.157  3.944   1.00 0.00 ? 18  CYS A CB   11 
ATOM   6361  S  SG   . CYS A 1 18 ? 4.776   -2.191  3.918   1.00 0.00 ? 18  CYS A SG   11 
ATOM   6362  H  H    . CYS A 1 18 ? 5.017   -3.712  1.562   1.00 0.00 ? 18  CYS A H    11 
ATOM   6363  H  HA   . CYS A 1 18 ? 7.252   -4.883  3.087   1.00 0.00 ? 18  CYS A HA   11 
ATOM   6364  H  HB2  . CYS A 1 18 ? 6.526   -3.417  4.972   1.00 0.00 ? 18  CYS A HB2  11 
ATOM   6365  H  HB3  . CYS A 1 18 ? 7.111   -2.524  3.572   1.00 0.00 ? 18  CYS A HB3  11 
ATOM   6366  N  N    . GLY A 1 19 ? 4.025   -5.330  3.344   1.00 0.00 ? 19  GLY A N    11 
ATOM   6367  C  CA   . GLY A 1 19 ? 3.014   -6.224  3.876   1.00 0.00 ? 19  GLY A CA   11 
ATOM   6368  C  C    . GLY A 1 19 ? 2.028   -5.511  4.781   1.00 0.00 ? 19  GLY A C    11 
ATOM   6369  O  O    . GLY A 1 19 ? 1.198   -6.147  5.431   1.00 0.00 ? 19  GLY A O    11 
ATOM   6370  H  H    . GLY A 1 19 ? 3.775   -4.644  2.689   1.00 0.00 ? 19  GLY A H    11 
ATOM   6371  H  HA2  . GLY A 1 19 ? 2.474   -6.669  3.054   1.00 0.00 ? 19  GLY A HA2  11 
ATOM   6372  H  HA3  . GLY A 1 19 ? 3.501   -7.006  4.439   1.00 0.00 ? 19  GLY A HA3  11 
ATOM   6373  N  N    . LYS A 1 20 ? 2.120   -4.186  4.825   1.00 0.00 ? 20  LYS A N    11 
ATOM   6374  C  CA   . LYS A 1 20 ? 1.231   -3.385  5.658   1.00 0.00 ? 20  LYS A CA   11 
ATOM   6375  C  C    . LYS A 1 20 ? -0.220  -3.546  5.215   1.00 0.00 ? 20  LYS A C    11 
ATOM   6376  O  O    . LYS A 1 20 ? -0.609  -3.073  4.148   1.00 0.00 ? 20  LYS A O    11 
ATOM   6377  C  CB   . LYS A 1 20 ? 1.633   -1.910  5.597   1.00 0.00 ? 20  LYS A CB   11 
ATOM   6378  C  CG   . LYS A 1 20 ? 1.109   -1.087  6.762   1.00 0.00 ? 20  LYS A CG   11 
ATOM   6379  C  CD   . LYS A 1 20 ? 2.092   -1.073  7.920   1.00 0.00 ? 20  LYS A CD   11 
ATOM   6380  C  CE   . LYS A 1 20 ? 1.773   0.039   8.908   1.00 0.00 ? 20  LYS A CE   11 
ATOM   6381  N  NZ   . LYS A 1 20 ? 2.019   1.387   8.324   1.00 0.00 ? 20  LYS A NZ   11 
ATOM   6382  H  H    . LYS A 1 20 ? 2.803   -3.736  4.284   1.00 0.00 ? 20  LYS A H    11 
ATOM   6383  H  HA   . LYS A 1 20 ? 1.325   -3.733  6.675   1.00 0.00 ? 20  LYS A HA   11 
ATOM   6384  H  HB2  . LYS A 1 20 ? 2.711   -1.843  5.592   1.00 0.00 ? 20  LYS A HB2  11 
ATOM   6385  H  HB3  . LYS A 1 20 ? 1.250   -1.482  4.681   1.00 0.00 ? 20  LYS A HB3  11 
ATOM   6386  H  HG2  . LYS A 1 20 ? 0.946   -0.073  6.430   1.00 0.00 ? 20  LYS A HG2  11 
ATOM   6387  H  HG3  . LYS A 1 20 ? 0.175   -1.513  7.099   1.00 0.00 ? 20  LYS A HG3  11 
ATOM   6388  H  HD2  . LYS A 1 20 ? 2.043   -2.021  8.435   1.00 0.00 ? 20  LYS A HD2  11 
ATOM   6389  H  HD3  . LYS A 1 20 ? 3.090   -0.923  7.533   1.00 0.00 ? 20  LYS A HD3  11 
ATOM   6390  H  HE2  . LYS A 1 20 ? 0.735   -0.037  9.193   1.00 0.00 ? 20  LYS A HE2  11 
ATOM   6391  H  HE3  . LYS A 1 20 ? 2.396   -0.084  9.782   1.00 0.00 ? 20  LYS A HE3  11 
ATOM   6392  H  HZ1  . LYS A 1 20 ? 1.571   2.118   8.912   1.00 0.00 ? 20  LYS A HZ1  11 
ATOM   6393  H  HZ2  . LYS A 1 20 ? 1.622   1.437   7.364   1.00 0.00 ? 20  LYS A HZ2  11 
ATOM   6394  H  HZ3  . LYS A 1 20 ? 3.040   1.574   8.275   1.00 0.00 ? 20  LYS A HZ3  11 
ATOM   6395  N  N    . ALA A 1 21 ? -1.016  -4.214  6.043   1.00 0.00 ? 21  ALA A N    11 
ATOM   6396  C  CA   . ALA A 1 21 ? -2.424  -4.434  5.739   1.00 0.00 ? 21  ALA A CA   11 
ATOM   6397  C  C    . ALA A 1 21 ? -3.286  -3.297  6.277   1.00 0.00 ? 21  ALA A C    11 
ATOM   6398  O  O    . ALA A 1 21 ? -3.190  -2.932  7.449   1.00 0.00 ? 21  ALA A O    11 
ATOM   6399  C  CB   . ALA A 1 21 ? -2.887  -5.765  6.311   1.00 0.00 ? 21  ALA A CB   11 
ATOM   6400  H  H    . ALA A 1 21 ? -0.647  -4.567  6.880   1.00 0.00 ? 21  ALA A H    11 
ATOM   6401  H  HA   . ALA A 1 21 ? -2.531  -4.475  4.664   1.00 0.00 ? 21  ALA A HA   11 
ATOM   6402  H  HB1  . ALA A 1 21 ? -2.803  -6.531  5.554   1.00 0.00 ? 21  ALA A HB1  11 
ATOM   6403  H  HB2  . ALA A 1 21 ? -2.269  -6.027  7.157   1.00 0.00 ? 21  ALA A HB2  11 
ATOM   6404  H  HB3  . ALA A 1 21 ? -3.916  -5.683  6.627   1.00 0.00 ? 21  ALA A HB3  11 
ATOM   6405  N  N    . PHE A 1 22 ? -4.128  -2.739  5.414   1.00 0.00 ? 22  PHE A N    11 
ATOM   6406  C  CA   . PHE A 1 22 ? -5.006  -1.641  5.803   1.00 0.00 ? 22  PHE A CA   11 
ATOM   6407  C  C    . PHE A 1 22 ? -6.472  -2.045  5.673   1.00 0.00 ? 22  PHE A C    11 
ATOM   6408  O  O    . PHE A 1 22 ? -6.788  -3.122  5.166   1.00 0.00 ? 22  PHE A O    11 
ATOM   6409  C  CB   . PHE A 1 22 ? -4.728  -0.407  4.942   1.00 0.00 ? 22  PHE A CB   11 
ATOM   6410  C  CG   . PHE A 1 22 ? -3.278  -0.018  4.903   1.00 0.00 ? 22  PHE A CG   11 
ATOM   6411  C  CD1  . PHE A 1 22 ? -2.383  -0.705  4.099   1.00 0.00 ? 22  PHE A CD1  11 
ATOM   6412  C  CD2  . PHE A 1 22 ? -2.809  1.035   5.673   1.00 0.00 ? 22  PHE A CD2  11 
ATOM   6413  C  CE1  . PHE A 1 22 ? -1.048  -0.349  4.061   1.00 0.00 ? 22  PHE A CE1  11 
ATOM   6414  C  CE2  . PHE A 1 22 ? -1.475  1.395   5.639   1.00 0.00 ? 22  PHE A CE2  11 
ATOM   6415  C  CZ   . PHE A 1 22 ? -0.594  0.702   4.833   1.00 0.00 ? 22  PHE A CZ   11 
ATOM   6416  H  H    . PHE A 1 22 ? -4.160  -3.073  4.493   1.00 0.00 ? 22  PHE A H    11 
ATOM   6417  H  HA   . PHE A 1 22 ? -4.801  -1.403  6.835   1.00 0.00 ? 22  PHE A HA   11 
ATOM   6418  H  HB2  . PHE A 1 22 ? -5.045  -0.605  3.929   1.00 0.00 ? 22  PHE A HB2  11 
ATOM   6419  H  HB3  . PHE A 1 22 ? -5.287  0.429   5.333   1.00 0.00 ? 22  PHE A HB3  11 
ATOM   6420  H  HD1  . PHE A 1 22 ? -2.738  -1.528  3.494   1.00 0.00 ? 22  PHE A HD1  11 
ATOM   6421  H  HD2  . PHE A 1 22 ? -3.497  1.577   6.304   1.00 0.00 ? 22  PHE A HD2  11 
ATOM   6422  H  HE1  . PHE A 1 22 ? -0.362  -0.894  3.429   1.00 0.00 ? 22  PHE A HE1  11 
ATOM   6423  H  HE2  . PHE A 1 22 ? -1.122  2.217   6.243   1.00 0.00 ? 22  PHE A HE2  11 
ATOM   6424  H  HZ   . PHE A 1 22 ? 0.449   0.982   4.804   1.00 0.00 ? 22  PHE A HZ   11 
ATOM   6425  N  N    . ARG A 1 23 ? -7.363  -1.174  6.136   1.00 0.00 ? 23  ARG A N    11 
ATOM   6426  C  CA   . ARG A 1 23 ? -8.795  -1.440  6.074   1.00 0.00 ? 23  ARG A CA   11 
ATOM   6427  C  C    . ARG A 1 23 ? -9.366  -1.033  4.719   1.00 0.00 ? 23  ARG A C    11 
ATOM   6428  O  O    . ARG A 1 23 ? -10.327 -1.630  4.234   1.00 0.00 ? 23  ARG A O    11 
ATOM   6429  C  CB   . ARG A 1 23 ? -9.523  -0.691  7.192   1.00 0.00 ? 23  ARG A CB   11 
ATOM   6430  C  CG   . ARG A 1 23 ? -11.029 -0.899  7.184   1.00 0.00 ? 23  ARG A CG   11 
ATOM   6431  C  CD   . ARG A 1 23 ? -11.418 -2.183  7.899   1.00 0.00 ? 23  ARG A CD   11 
ATOM   6432  N  NE   . ARG A 1 23 ? -12.801 -2.564  7.626   1.00 0.00 ? 23  ARG A NE   11 
ATOM   6433  C  CZ   . ARG A 1 23 ? -13.502 -3.389  8.396   1.00 0.00 ? 23  ARG A CZ   11 
ATOM   6434  N  NH1  . ARG A 1 23 ? -12.952 -3.916  9.482   1.00 0.00 ? 23  ARG A NH1  11 
ATOM   6435  N  NH2  . ARG A 1 23 ? -14.756 -3.688  8.082   1.00 0.00 ? 23  ARG A NH2  11 
ATOM   6436  H  H    . ARG A 1 23 ? -7.050  -0.333  6.529   1.00 0.00 ? 23  ARG A H    11 
ATOM   6437  H  HA   . ARG A 1 23 ? -8.942  -2.501  6.209   1.00 0.00 ? 23  ARG A HA   11 
ATOM   6438  H  HB2  . ARG A 1 23 ? -9.141  -1.028  8.144   1.00 0.00 ? 23  ARG A HB2  11 
ATOM   6439  H  HB3  . ARG A 1 23 ? -9.327  0.365   7.087   1.00 0.00 ? 23  ARG A HB3  11 
ATOM   6440  H  HG2  . ARG A 1 23 ? -11.501 -0.065  7.682   1.00 0.00 ? 23  ARG A HG2  11 
ATOM   6441  H  HG3  . ARG A 1 23 ? -11.370 -0.949  6.160   1.00 0.00 ? 23  ARG A HG3  11 
ATOM   6442  H  HD2  . ARG A 1 23 ? -10.764 -2.976  7.568   1.00 0.00 ? 23  ARG A HD2  11 
ATOM   6443  H  HD3  . ARG A 1 23 ? -11.297 -2.038  8.962   1.00 0.00 ? 23  ARG A HD3  11 
ATOM   6444  H  HE   . ARG A 1 23 ? -13.227 -2.186  6.829   1.00 0.00 ? 23  ARG A HE   11 
ATOM   6445  H  HH11 . ARG A 1 23 ? -12.007 -3.692  9.721   1.00 0.00 ? 23  ARG A HH11 11 
ATOM   6446  H  HH12 . ARG A 1 23 ? -13.482 -4.536  10.061  1.00 0.00 ? 23  ARG A HH12 11 
ATOM   6447  H  HH21 . ARG A 1 23 ? -15.174 -3.292  7.265   1.00 0.00 ? 23  ARG A HH21 11 
ATOM   6448  H  HH22 . ARG A 1 23 ? -15.282 -4.308  8.662   1.00 0.00 ? 23  ARG A HH22 11 
ATOM   6449  N  N    . SER A 1 24 ? -8.767  -0.013  4.113   1.00 0.00 ? 24  SER A N    11 
ATOM   6450  C  CA   . SER A 1 24 ? -9.218  0.477   2.815   1.00 0.00 ? 24  SER A CA   11 
ATOM   6451  C  C    . SER A 1 24 ? -8.031  0.760   1.899   1.00 0.00 ? 24  SER A C    11 
ATOM   6452  O  O    . SER A 1 24 ? -6.876  0.677   2.316   1.00 0.00 ? 24  SER A O    11 
ATOM   6453  C  CB   . SER A 1 24 ? -10.057 1.744   2.989   1.00 0.00 ? 24  SER A CB   11 
ATOM   6454  O  OG   . SER A 1 24 ? -11.083 1.549   3.947   1.00 0.00 ? 24  SER A OG   11 
ATOM   6455  H  H    . SER A 1 24 ? -8.005  0.422   4.550   1.00 0.00 ? 24  SER A H    11 
ATOM   6456  H  HA   . SER A 1 24 ? -9.829  -0.291  2.365   1.00 0.00 ? 24  SER A HA   11 
ATOM   6457  H  HB2  . SER A 1 24 ? -9.421  2.551   3.318   1.00 0.00 ? 24  SER A HB2  11 
ATOM   6458  H  HB3  . SER A 1 24 ? -10.510 2.005   2.043   1.00 0.00 ? 24  SER A HB3  11 
ATOM   6459  H  HG   . SER A 1 24 ? -11.826 1.104   3.535   1.00 0.00 ? 24  SER A HG   11 
ATOM   6460  N  N    . LYS A 1 25 ? -8.325  1.096   0.648   1.00 0.00 ? 25  LYS A N    11 
ATOM   6461  C  CA   . LYS A 1 25 ? -7.285  1.394   -0.329  1.00 0.00 ? 25  LYS A CA   11 
ATOM   6462  C  C    . LYS A 1 25 ? -6.669  2.765   -0.068  1.00 0.00 ? 25  LYS A C    11 
ATOM   6463  O  O    . LYS A 1 25 ? -5.449  2.923   -0.093  1.00 0.00 ? 25  LYS A O    11 
ATOM   6464  C  CB   . LYS A 1 25 ? -7.858  1.342   -1.747  1.00 0.00 ? 25  LYS A CB   11 
ATOM   6465  C  CG   . LYS A 1 25 ? -6.815  1.060   -2.815  1.00 0.00 ? 25  LYS A CG   11 
ATOM   6466  C  CD   . LYS A 1 25 ? -7.431  0.391   -4.033  1.00 0.00 ? 25  LYS A CD   11 
ATOM   6467  C  CE   . LYS A 1 25 ? -8.072  1.409   -4.963  1.00 0.00 ? 25  LYS A CE   11 
ATOM   6468  N  NZ   . LYS A 1 25 ? -9.003  0.767   -5.932  1.00 0.00 ? 25  LYS A NZ   11 
ATOM   6469  H  H    . LYS A 1 25 ? -9.266  1.146   0.375   1.00 0.00 ? 25  LYS A H    11 
ATOM   6470  H  HA   . LYS A 1 25 ? -6.515  0.643   -0.234  1.00 0.00 ? 25  LYS A HA   11 
ATOM   6471  H  HB2  . LYS A 1 25 ? -8.608  0.566   -1.791  1.00 0.00 ? 25  LYS A HB2  11 
ATOM   6472  H  HB3  . LYS A 1 25 ? -8.322  2.292   -1.970  1.00 0.00 ? 25  LYS A HB3  11 
ATOM   6473  H  HG2  . LYS A 1 25 ? -6.364  1.992   -3.120  1.00 0.00 ? 25  LYS A HG2  11 
ATOM   6474  H  HG3  . LYS A 1 25 ? -6.058  0.408   -2.402  1.00 0.00 ? 25  LYS A HG3  11 
ATOM   6475  H  HD2  . LYS A 1 25 ? -6.659  -0.137  -4.572  1.00 0.00 ? 25  LYS A HD2  11 
ATOM   6476  H  HD3  . LYS A 1 25 ? -8.186  -0.309  -3.705  1.00 0.00 ? 25  LYS A HD3  11 
ATOM   6477  H  HE2  . LYS A 1 25 ? -8.621  2.124   -4.370  1.00 0.00 ? 25  LYS A HE2  11 
ATOM   6478  H  HE3  . LYS A 1 25 ? -7.292  1.918   -5.510  1.00 0.00 ? 25  LYS A HE3  11 
ATOM   6479  H  HZ1  . LYS A 1 25 ? -9.271  1.444   -6.674  1.00 0.00 ? 25  LYS A HZ1  11 
ATOM   6480  H  HZ2  . LYS A 1 25 ? -9.863  0.446   -5.442  1.00 0.00 ? 25  LYS A HZ2  11 
ATOM   6481  H  HZ3  . LYS A 1 25 ? -8.545  -0.054  -6.377  1.00 0.00 ? 25  LYS A HZ3  11 
ATOM   6482  N  N    . SER A 1 26 ? -7.522  3.753   0.183   1.00 0.00 ? 26  SER A N    11 
ATOM   6483  C  CA   . SER A 1 26 ? -7.062  5.112   0.446   1.00 0.00 ? 26  SER A CA   11 
ATOM   6484  C  C    . SER A 1 26 ? -6.097  5.139   1.628   1.00 0.00 ? 26  SER A C    11 
ATOM   6485  O  O    . SER A 1 26 ? -5.210  5.989   1.700   1.00 0.00 ? 26  SER A O    11 
ATOM   6486  C  CB   . SER A 1 26 ? -8.252  6.031   0.723   1.00 0.00 ? 26  SER A CB   11 
ATOM   6487  O  OG   . SER A 1 26 ? -8.725  5.868   2.049   1.00 0.00 ? 26  SER A OG   11 
ATOM   6488  H  H    . SER A 1 26 ? -8.484  3.564   0.188   1.00 0.00 ? 26  SER A H    11 
ATOM   6489  H  HA   . SER A 1 26 ? -6.544  5.463   -0.434  1.00 0.00 ? 26  SER A HA   11 
ATOM   6490  H  HB2  . SER A 1 26 ? -7.950  7.058   0.586   1.00 0.00 ? 26  SER A HB2  11 
ATOM   6491  H  HB3  . SER A 1 26 ? -9.053  5.796   0.037   1.00 0.00 ? 26  SER A HB3  11 
ATOM   6492  H  HG   . SER A 1 26 ? -9.467  6.457   2.200   1.00 0.00 ? 26  SER A HG   11 
ATOM   6493  N  N    . TYR A 1 27 ? -6.278  4.202   2.552   1.00 0.00 ? 27  TYR A N    11 
ATOM   6494  C  CA   . TYR A 1 27 ? -5.427  4.119   3.733   1.00 0.00 ? 27  TYR A CA   11 
ATOM   6495  C  C    . TYR A 1 27 ? -4.064  3.528   3.381   1.00 0.00 ? 27  TYR A C    11 
ATOM   6496  O  O    . TYR A 1 27 ? -3.057  3.839   4.018   1.00 0.00 ? 27  TYR A O    11 
ATOM   6497  C  CB   . TYR A 1 27 ? -6.099  3.270   4.814   1.00 0.00 ? 27  TYR A CB   11 
ATOM   6498  C  CG   . TYR A 1 27 ? -5.729  3.679   6.222   1.00 0.00 ? 27  TYR A CG   11 
ATOM   6499  C  CD1  . TYR A 1 27 ? -5.717  5.017   6.597   1.00 0.00 ? 27  TYR A CD1  11 
ATOM   6500  C  CD2  . TYR A 1 27 ? -5.393  2.727   7.176   1.00 0.00 ? 27  TYR A CD2  11 
ATOM   6501  C  CE1  . TYR A 1 27 ? -5.379  5.394   7.882   1.00 0.00 ? 27  TYR A CE1  11 
ATOM   6502  C  CE2  . TYR A 1 27 ? -5.055  3.096   8.464   1.00 0.00 ? 27  TYR A CE2  11 
ATOM   6503  C  CZ   . TYR A 1 27 ? -5.049  4.430   8.812   1.00 0.00 ? 27  TYR A CZ   11 
ATOM   6504  O  OH   . TYR A 1 27 ? -4.713  4.803   10.094  1.00 0.00 ? 27  TYR A OH   11 
ATOM   6505  H  H    . TYR A 1 27 ? -7.002  3.551   2.439   1.00 0.00 ? 27  TYR A H    11 
ATOM   6506  H  HA   . TYR A 1 27 ? -5.286  5.120   4.111   1.00 0.00 ? 27  TYR A HA   11 
ATOM   6507  H  HB2  . TYR A 1 27 ? -7.170  3.356   4.715   1.00 0.00 ? 27  TYR A HB2  11 
ATOM   6508  H  HB3  . TYR A 1 27 ? -5.812  2.237   4.681   1.00 0.00 ? 27  TYR A HB3  11 
ATOM   6509  H  HD1  . TYR A 1 27 ? -5.976  5.769   5.867   1.00 0.00 ? 27  TYR A HD1  11 
ATOM   6510  H  HD2  . TYR A 1 27 ? -5.398  1.682   6.901   1.00 0.00 ? 27  TYR A HD2  11 
ATOM   6511  H  HE1  . TYR A 1 27 ? -5.374  6.439   8.155   1.00 0.00 ? 27  TYR A HE1  11 
ATOM   6512  H  HE2  . TYR A 1 27 ? -4.796  2.341   9.193   1.00 0.00 ? 27  TYR A HE2  11 
ATOM   6513  H  HH   . TYR A 1 27 ? -4.672  4.023   10.653  1.00 0.00 ? 27  TYR A HH   11 
ATOM   6514  N  N    . LEU A 1 28 ? -4.041  2.676   2.363   1.00 0.00 ? 28  LEU A N    11 
ATOM   6515  C  CA   . LEU A 1 28 ? -2.803  2.041   1.925   1.00 0.00 ? 28  LEU A CA   11 
ATOM   6516  C  C    . LEU A 1 28 ? -2.029  2.954   0.979   1.00 0.00 ? 28  LEU A C    11 
ATOM   6517  O  O    . LEU A 1 28 ? -0.798  2.993   1.009   1.00 0.00 ? 28  LEU A O    11 
ATOM   6518  C  CB   . LEU A 1 28 ? -3.107  0.711   1.233   1.00 0.00 ? 28  LEU A CB   11 
ATOM   6519  C  CG   . LEU A 1 28 ? -2.071  0.233   0.214   1.00 0.00 ? 28  LEU A CG   11 
ATOM   6520  C  CD1  . LEU A 1 28 ? -0.792  -0.197  0.914   1.00 0.00 ? 28  LEU A CD1  11 
ATOM   6521  C  CD2  . LEU A 1 28 ? -2.633  -0.908  -0.622  1.00 0.00 ? 28  LEU A CD2  11 
ATOM   6522  H  H    . LEU A 1 28 ? -4.876  2.467   1.895   1.00 0.00 ? 28  LEU A H    11 
ATOM   6523  H  HA   . LEU A 1 28 ? -2.199  1.853   2.800   1.00 0.00 ? 28  LEU A HA   11 
ATOM   6524  H  HB2  . LEU A 1 28 ? -3.192  -0.047  1.996   1.00 0.00 ? 28  LEU A HB2  11 
ATOM   6525  H  HB3  . LEU A 1 28 ? -4.053  0.813   0.721   1.00 0.00 ? 28  LEU A HB3  11 
ATOM   6526  H  HG   . LEU A 1 28 ? -1.828  1.049   -0.453  1.00 0.00 ? 28  LEU A HG   11 
ATOM   6527  H  HD11 . LEU A 1 28 ? 0.015   -0.236  0.198   1.00 0.00 ? 28  LEU A HD11 11 
ATOM   6528  H  HD12 . LEU A 1 28 ? -0.932  -1.174  1.352   1.00 0.00 ? 28  LEU A HD12 11 
ATOM   6529  H  HD13 . LEU A 1 28 ? -0.550  0.513   1.691   1.00 0.00 ? 28  LEU A HD13 11 
ATOM   6530  H  HD21 . LEU A 1 28 ? -2.033  -1.793  -0.473  1.00 0.00 ? 28  LEU A HD21 11 
ATOM   6531  H  HD22 . LEU A 1 28 ? -2.614  -0.631  -1.666  1.00 0.00 ? 28  LEU A HD22 11 
ATOM   6532  H  HD23 . LEU A 1 28 ? -3.652  -1.107  -0.322  1.00 0.00 ? 28  LEU A HD23 11 
ATOM   6533  N  N    . ILE A 1 29 ? -2.757  3.686   0.144   1.00 0.00 ? 29  ILE A N    11 
ATOM   6534  C  CA   . ILE A 1 29 ? -2.138  4.601   -0.807  1.00 0.00 ? 29  ILE A CA   11 
ATOM   6535  C  C    . ILE A 1 29 ? -1.378  5.711   -0.088  1.00 0.00 ? 29  ILE A C    11 
ATOM   6536  O  O    . ILE A 1 29 ? -0.266  6.069   -0.478  1.00 0.00 ? 29  ILE A O    11 
ATOM   6537  C  CB   . ILE A 1 29 ? -3.185  5.234   -1.743  1.00 0.00 ? 29  ILE A CB   11 
ATOM   6538  C  CG1  . ILE A 1 29 ? -3.847  4.158   -2.605  1.00 0.00 ? 29  ILE A CG1  11 
ATOM   6539  C  CG2  . ILE A 1 29 ? -2.539  6.299   -2.617  1.00 0.00 ? 29  ILE A CG2  11 
ATOM   6540  C  CD1  . ILE A 1 29 ? -5.273  4.485   -2.989  1.00 0.00 ? 29  ILE A CD1  11 
ATOM   6541  H  H    . ILE A 1 29 ? -3.733  3.611   0.168   1.00 0.00 ? 29  ILE A H    11 
ATOM   6542  H  HA   . ILE A 1 29 ? -1.442  4.035   -1.410  1.00 0.00 ? 29  ILE A HA   11 
ATOM   6543  H  HB   . ILE A 1 29 ? -3.937  5.711   -1.133  1.00 0.00 ? 29  ILE A HB   11 
ATOM   6544  H  HG12 . ILE A 1 29 ? -3.280  4.035   -3.514  1.00 0.00 ? 29  ILE A HG12 11 
ATOM   6545  H  HG13 . ILE A 1 29 ? -3.855  3.225   -2.060  1.00 0.00 ? 29  ILE A HG13 11 
ATOM   6546  H  HG21 . ILE A 1 29 ? -3.059  7.236   -2.486  1.00 0.00 ? 29  ILE A HG21 11 
ATOM   6547  H  HG22 . ILE A 1 29 ? -1.505  6.419   -2.332  1.00 0.00 ? 29  ILE A HG22 11 
ATOM   6548  H  HG23 . ILE A 1 29 ? -2.595  5.997   -3.652  1.00 0.00 ? 29  ILE A HG23 11 
ATOM   6549  H  HD11 . ILE A 1 29 ? -5.904  4.426   -2.113  1.00 0.00 ? 29  ILE A HD11 11 
ATOM   6550  H  HD12 . ILE A 1 29 ? -5.317  5.484   -3.397  1.00 0.00 ? 29  ILE A HD12 11 
ATOM   6551  H  HD13 . ILE A 1 29 ? -5.619  3.778   -3.728  1.00 0.00 ? 29  ILE A HD13 11 
ATOM   6552  N  N    . ILE A 1 30 ? -1.984  6.249   0.965   1.00 0.00 ? 30  ILE A N    11 
ATOM   6553  C  CA   . ILE A 1 30 ? -1.363  7.316   1.740   1.00 0.00 ? 30  ILE A CA   11 
ATOM   6554  C  C    . ILE A 1 30 ? -0.071  6.838   2.396   1.00 0.00 ? 30  ILE A C    11 
ATOM   6555  O  O    . ILE A 1 30 ? 0.786   7.643   2.762   1.00 0.00 ? 30  ILE A O    11 
ATOM   6556  C  CB   . ILE A 1 30 ? -2.313  7.846   2.830   1.00 0.00 ? 30  ILE A CB   11 
ATOM   6557  C  CG1  . ILE A 1 30 ? -2.752  6.707   3.752   1.00 0.00 ? 30  ILE A CG1  11 
ATOM   6558  C  CG2  . ILE A 1 30 ? -3.522  8.518   2.197   1.00 0.00 ? 30  ILE A CG2  11 
ATOM   6559  C  CD1  . ILE A 1 30 ? -3.120  7.166   5.146   1.00 0.00 ? 30  ILE A CD1  11 
ATOM   6560  H  H    . ILE A 1 30 ? -2.869  5.921   1.226   1.00 0.00 ? 30  ILE A H    11 
ATOM   6561  H  HA   . ILE A 1 30 ? -1.133  8.127   1.065   1.00 0.00 ? 30  ILE A HA   11 
ATOM   6562  H  HB   . ILE A 1 30 ? -1.783  8.585   3.410   1.00 0.00 ? 30  ILE A HB   11 
ATOM   6563  H  HG12 . ILE A 1 30 ? -3.615  6.219   3.326   1.00 0.00 ? 30  ILE A HG12 11 
ATOM   6564  H  HG13 . ILE A 1 30 ? -1.946  5.993   3.839   1.00 0.00 ? 30  ILE A HG13 11 
ATOM   6565  H  HG21 . ILE A 1 30 ? -4.403  7.921   2.380   1.00 0.00 ? 30  ILE A HG21 11 
ATOM   6566  H  HG22 . ILE A 1 30 ? -3.656  9.498   2.630   1.00 0.00 ? 30  ILE A HG22 11 
ATOM   6567  H  HG23 . ILE A 1 30 ? -3.366  8.613   1.133   1.00 0.00 ? 30  ILE A HG23 11 
ATOM   6568  H  HD11 . ILE A 1 30 ? -4.069  6.732   5.429   1.00 0.00 ? 30  ILE A HD11 11 
ATOM   6569  H  HD12 . ILE A 1 30 ? -2.359  6.847   5.843   1.00 0.00 ? 30  ILE A HD12 11 
ATOM   6570  H  HD13 . ILE A 1 30 ? -3.198  8.242   5.163   1.00 0.00 ? 30  ILE A HD13 11 
ATOM   6571  N  N    . HIS A 1 31 ? 0.062   5.523   2.540   1.00 0.00 ? 31  HIS A N    11 
ATOM   6572  C  CA   . HIS A 1 31 ? 1.251   4.938   3.149   1.00 0.00 ? 31  HIS A CA   11 
ATOM   6573  C  C    . HIS A 1 31 ? 2.283   4.573   2.086   1.00 0.00 ? 31  HIS A C    11 
ATOM   6574  O  O    . HIS A 1 31 ? 3.466   4.884   2.222   1.00 0.00 ? 31  HIS A O    11 
ATOM   6575  C  CB   . HIS A 1 31 ? 0.875   3.697   3.959   1.00 0.00 ? 31  HIS A CB   11 
ATOM   6576  C  CG   . HIS A 1 31 ? 1.963   2.668   4.018   1.00 0.00 ? 31  HIS A CG   11 
ATOM   6577  N  ND1  . HIS A 1 31 ? 2.649   2.365   5.175   1.00 0.00 ? 31  HIS A ND1  11 
ATOM   6578  C  CD2  . HIS A 1 31 ? 2.480   1.871   3.055   1.00 0.00 ? 31  HIS A CD2  11 
ATOM   6579  C  CE1  . HIS A 1 31 ? 3.543   1.426   4.920   1.00 0.00 ? 31  HIS A CE1  11 
ATOM   6580  N  NE2  . HIS A 1 31 ? 3.461   1.108   3.640   1.00 0.00 ? 31  HIS A NE2  11 
ATOM   6581  H  H    . HIS A 1 31 ? -0.656  4.934   2.228   1.00 0.00 ? 31  HIS A H    11 
ATOM   6582  H  HA   . HIS A 1 31 ? 1.680   5.673   3.812   1.00 0.00 ? 31  HIS A HA   11 
ATOM   6583  H  HB2  . HIS A 1 31 ? 0.644   3.992   4.972   1.00 0.00 ? 31  HIS A HB2  11 
ATOM   6584  H  HB3  . HIS A 1 31 ? 0.005   3.235   3.516   1.00 0.00 ? 31  HIS A HB3  11 
ATOM   6585  H  HD1  . HIS A 1 31 ? 2.504   2.777   6.051   1.00 0.00 ? 31  HIS A HD1  11 
ATOM   6586  H  HD2  . HIS A 1 31 ? 2.178   1.839   2.017   1.00 0.00 ? 31  HIS A HD2  11 
ATOM   6587  H  HE1  . HIS A 1 31 ? 4.225   0.991   5.635   1.00 0.00 ? 31  HIS A HE1  11 
ATOM   6588  N  N    . THR A 1 32 ? 1.826   3.911   1.028   1.00 0.00 ? 32  THR A N    11 
ATOM   6589  C  CA   . THR A 1 32 ? 2.709   3.502   -0.057  1.00 0.00 ? 32  THR A CA   11 
ATOM   6590  C  C    . THR A 1 32 ? 3.717   4.597   -0.388  1.00 0.00 ? 32  THR A C    11 
ATOM   6591  O  O    . THR A 1 32 ? 4.801   4.321   -0.903  1.00 0.00 ? 32  THR A O    11 
ATOM   6592  C  CB   . THR A 1 32 ? 1.913   3.153   -1.329  1.00 0.00 ? 32  THR A CB   11 
ATOM   6593  O  OG1  . THR A 1 32 ? 2.729   2.389   -2.224  1.00 0.00 ? 32  THR A OG1  11 
ATOM   6594  C  CG2  . THR A 1 32 ? 1.429   4.414   -2.028  1.00 0.00 ? 32  THR A CG2  11 
ATOM   6595  H  H    . THR A 1 32 ? 0.872   3.692   0.977   1.00 0.00 ? 32  THR A H    11 
ATOM   6596  H  HA   . THR A 1 32 ? 3.243   2.619   0.262   1.00 0.00 ? 32  THR A HA   11 
ATOM   6597  H  HB   . THR A 1 32 ? 1.053   2.563   -1.046  1.00 0.00 ? 32  THR A HB   11 
ATOM   6598  H  HG1  . THR A 1 32 ? 3.648   2.455   -1.954  1.00 0.00 ? 32  THR A HG1  11 
ATOM   6599  H  HG21 . THR A 1 32 ? 1.989   4.558   -2.939  1.00 0.00 ? 32  THR A HG21 11 
ATOM   6600  H  HG22 . THR A 1 32 ? 1.574   5.264   -1.378  1.00 0.00 ? 32  THR A HG22 11 
ATOM   6601  H  HG23 . THR A 1 32 ? 0.379   4.316   -2.262  1.00 0.00 ? 32  THR A HG23 11 
ATOM   6602  N  N    . ARG A 1 33 ? 3.354   5.840   -0.088  1.00 0.00 ? 33  ARG A N    11 
ATOM   6603  C  CA   . ARG A 1 33 ? 4.227   6.976   -0.354  1.00 0.00 ? 33  ARG A CA   11 
ATOM   6604  C  C    . ARG A 1 33 ? 5.234   7.165   0.778   1.00 0.00 ? 33  ARG A C    11 
ATOM   6605  O  O    . ARG A 1 33 ? 6.398   7.490   0.541   1.00 0.00 ? 33  ARG A O    11 
ATOM   6606  C  CB   . ARG A 1 33 ? 3.401   8.251   -0.534  1.00 0.00 ? 33  ARG A CB   11 
ATOM   6607  C  CG   . ARG A 1 33 ? 2.446   8.525   0.617   1.00 0.00 ? 33  ARG A CG   11 
ATOM   6608  C  CD   . ARG A 1 33 ? 1.675   9.818   0.405   1.00 0.00 ? 33  ARG A CD   11 
ATOM   6609  N  NE   . ARG A 1 33 ? 2.451   10.990  0.800   1.00 0.00 ? 33  ARG A NE   11 
ATOM   6610  C  CZ   . ARG A 1 33 ? 3.288   11.626  -0.012  1.00 0.00 ? 33  ARG A CZ   11 
ATOM   6611  N  NH1  . ARG A 1 33 ? 3.456   11.204  -1.258  1.00 0.00 ? 33  ARG A NH1  11 
ATOM   6612  N  NH2  . ARG A 1 33 ? 3.959   12.685  0.421   1.00 0.00 ? 33  ARG A NH2  11 
ATOM   6613  H  H    . ARG A 1 33 ? 2.477   5.996   0.321   1.00 0.00 ? 33  ARG A H    11 
ATOM   6614  H  HA   . ARG A 1 33 ? 4.765   6.775   -1.268  1.00 0.00 ? 33  ARG A HA   11 
ATOM   6615  H  HB2  . ARG A 1 33 ? 4.072   9.092   -0.623  1.00 0.00 ? 33  ARG A HB2  11 
ATOM   6616  H  HB3  . ARG A 1 33 ? 2.822   8.164   -1.440  1.00 0.00 ? 33  ARG A HB3  11 
ATOM   6617  H  HG2  . ARG A 1 33 ? 1.744   7.708   0.693   1.00 0.00 ? 33  ARG A HG2  11 
ATOM   6618  H  HG3  . ARG A 1 33 ? 3.014   8.601   1.533   1.00 0.00 ? 33  ARG A HG3  11 
ATOM   6619  H  HD2  . ARG A 1 33 ? 1.421   9.903   -0.642  1.00 0.00 ? 33  ARG A HD2  11 
ATOM   6620  H  HD3  . ARG A 1 33 ? 0.770   9.782   0.992   1.00 0.00 ? 33  ARG A HD3  11 
ATOM   6621  H  HE   . ARG A 1 33 ? 2.342   11.318  1.717   1.00 0.00 ? 33  ARG A HE   11 
ATOM   6622  H  HH11 . ARG A 1 33 ? 2.951   10.407  -1.588  1.00 0.00 ? 33  ARG A HH11 11 
ATOM   6623  H  HH12 . ARG A 1 33 ? 4.087   11.685  -1.868  1.00 0.00 ? 33  ARG A HH12 11 
ATOM   6624  H  HH21 . ARG A 1 33 ? 3.835   13.006  1.360   1.00 0.00 ? 33  ARG A HH21 11 
ATOM   6625  H  HH22 . ARG A 1 33 ? 4.589   13.162  -0.190  1.00 0.00 ? 33  ARG A HH22 11 
ATOM   6626  N  N    . THR A 1 34 ? 4.777   6.960   2.009   1.00 0.00 ? 34  THR A N    11 
ATOM   6627  C  CA   . THR A 1 34 ? 5.636   7.109   3.178   1.00 0.00 ? 34  THR A CA   11 
ATOM   6628  C  C    . THR A 1 34 ? 6.956   6.371   2.987   1.00 0.00 ? 34  THR A C    11 
ATOM   6629  O  O    . THR A 1 34 ? 7.951   6.680   3.644   1.00 0.00 ? 34  THR A O    11 
ATOM   6630  C  CB   . THR A 1 34 ? 4.947   6.584   4.452   1.00 0.00 ? 34  THR A CB   11 
ATOM   6631  O  OG1  . THR A 1 34 ? 5.620   7.083   5.613   1.00 0.00 ? 34  THR A OG1  11 
ATOM   6632  C  CG2  . THR A 1 34 ? 4.941   5.063   4.477   1.00 0.00 ? 34  THR A CG2  11 
ATOM   6633  H  H    . THR A 1 34 ? 3.840   6.702   2.134   1.00 0.00 ? 34  THR A H    11 
ATOM   6634  H  HA   . THR A 1 34 ? 5.838   8.162   3.311   1.00 0.00 ? 34  THR A HA   11 
ATOM   6635  H  HB   . THR A 1 34 ? 3.924   6.933   4.460   1.00 0.00 ? 34  THR A HB   11 
ATOM   6636  H  HG1  . THR A 1 34 ? 5.436   8.020   5.712   1.00 0.00 ? 34  THR A HG1  11 
ATOM   6637  H  HG21 . THR A 1 34 ? 3.937   4.710   4.658   1.00 0.00 ? 34  THR A HG21 11 
ATOM   6638  H  HG22 . THR A 1 34 ? 5.593   4.713   5.264   1.00 0.00 ? 34  THR A HG22 11 
ATOM   6639  H  HG23 . THR A 1 34 ? 5.289   4.686   3.526   1.00 0.00 ? 34  THR A HG23 11 
ATOM   6640  N  N    . HIS A 1 35 ? 6.959   5.396   2.084   1.00 0.00 ? 35  HIS A N    11 
ATOM   6641  C  CA   . HIS A 1 35 ? 8.159   4.615   1.806   1.00 0.00 ? 35  HIS A CA   11 
ATOM   6642  C  C    . HIS A 1 35 ? 9.307   5.520   1.369   1.00 0.00 ? 35  HIS A C    11 
ATOM   6643  O  O    . HIS A 1 35 ? 10.459  5.090   1.299   1.00 0.00 ? 35  HIS A O    11 
ATOM   6644  C  CB   . HIS A 1 35 ? 7.876   3.572   0.725   1.00 0.00 ? 35  HIS A CB   11 
ATOM   6645  C  CG   . HIS A 1 35 ? 7.275   2.307   1.255   1.00 0.00 ? 35  HIS A CG   11 
ATOM   6646  N  ND1  . HIS A 1 35 ? 7.999   1.369   1.961   1.00 0.00 ? 35  HIS A ND1  11 
ATOM   6647  C  CD2  . HIS A 1 35 ? 6.011   1.828   1.182   1.00 0.00 ? 35  HIS A CD2  11 
ATOM   6648  C  CE1  . HIS A 1 35 ? 7.206   0.366   2.296   1.00 0.00 ? 35  HIS A CE1  11 
ATOM   6649  N  NE2  . HIS A 1 35 ? 5.995   0.621   1.836   1.00 0.00 ? 35  HIS A NE2  11 
ATOM   6650  H  H    . HIS A 1 35 ? 6.135   5.198   1.593   1.00 0.00 ? 35  HIS A H    11 
ATOM   6651  H  HA   . HIS A 1 35 ? 8.443   4.109   2.716   1.00 0.00 ? 35  HIS A HA   11 
ATOM   6652  H  HB2  . HIS A 1 35 ? 7.188   3.989   0.004   1.00 0.00 ? 35  HIS A HB2  11 
ATOM   6653  H  HB3  . HIS A 1 35 ? 8.801   3.318   0.227   1.00 0.00 ? 35  HIS A HB3  11 
ATOM   6654  H  HD1  . HIS A 1 35 ? 8.951   1.428   2.181   1.00 0.00 ? 35  HIS A HD1  11 
ATOM   6655  H  HD2  . HIS A 1 35 ? 5.171   2.306   0.698   1.00 0.00 ? 35  HIS A HD2  11 
ATOM   6656  H  HE1  . HIS A 1 35 ? 7.498   -0.511  2.853   1.00 0.00 ? 35  HIS A HE1  11 
ATOM   6657  N  N    . THR A 1 36 ? 8.985   6.776   1.074   1.00 0.00 ? 36  THR A N    11 
ATOM   6658  C  CA   . THR A 1 36 ? 9.988   7.741   0.642   1.00 0.00 ? 36  THR A CA   11 
ATOM   6659  C  C    . THR A 1 36 ? 10.441  8.621   1.802   1.00 0.00 ? 36  THR A C    11 
ATOM   6660  O  O    . THR A 1 36 ? 10.678  9.816   1.631   1.00 0.00 ? 36  THR A O    11 
ATOM   6661  C  CB   . THR A 1 36 ? 9.454   8.638   -0.490  1.00 0.00 ? 36  THR A CB   11 
ATOM   6662  O  OG1  . THR A 1 36 ? 10.531  9.368   -1.087  1.00 0.00 ? 36  THR A OG1  11 
ATOM   6663  C  CG2  . THR A 1 36 ? 8.407   9.608   0.037   1.00 0.00 ? 36  THR A CG2  11 
ATOM   6664  H  H    . THR A 1 36 ? 8.050   7.059   1.150   1.00 0.00 ? 36  THR A H    11 
ATOM   6665  H  HA   . THR A 1 36 ? 10.839  7.191   0.266   1.00 0.00 ? 36  THR A HA   11 
ATOM   6666  H  HB   . THR A 1 36 ? 8.995   8.010   -1.241  1.00 0.00 ? 36  THR A HB   11 
ATOM   6667  H  HG1  . THR A 1 36 ? 10.992  8.804   -1.712  1.00 0.00 ? 36  THR A HG1  11 
ATOM   6668  H  HG21 . THR A 1 36 ? 7.858   9.143   0.842   1.00 0.00 ? 36  THR A HG21 11 
ATOM   6669  H  HG22 . THR A 1 36 ? 7.726   9.870   -0.759  1.00 0.00 ? 36  THR A HG22 11 
ATOM   6670  H  HG23 . THR A 1 36 ? 8.895   10.500  0.402   1.00 0.00 ? 36  THR A HG23 11 
ATOM   6671  N  N    . GLY A 1 37 ? 10.559  8.021   2.982   1.00 0.00 ? 37  GLY A N    11 
ATOM   6672  C  CA   . GLY A 1 37 ? 10.984  8.766   4.153   1.00 0.00 ? 37  GLY A CA   11 
ATOM   6673  C  C    . GLY A 1 37 ? 11.418  7.862   5.290   1.00 0.00 ? 37  GLY A C    11 
ATOM   6674  O  O    . GLY A 1 37 ? 12.554  7.942   5.756   1.00 0.00 ? 37  GLY A O    11 
ATOM   6675  H  H    . GLY A 1 37 ? 10.357  7.065   3.059   1.00 0.00 ? 37  GLY A H    11 
ATOM   6676  H  HA2  . GLY A 1 37 ? 11.810  9.405   3.880   1.00 0.00 ? 37  GLY A HA2  11 
ATOM   6677  H  HA3  . GLY A 1 37 ? 10.163  9.381   4.492   1.00 0.00 ? 37  GLY A HA3  11 
ATOM   6678  N  N    . GLU A 1 38 ? 10.510  7.000   5.738   1.00 0.00 ? 38  GLU A N    11 
ATOM   6679  C  CA   . GLU A 1 38 ? 10.806  6.079   6.829   1.00 0.00 ? 38  GLU A CA   11 
ATOM   6680  C  C    . GLU A 1 38 ? 10.706  4.630   6.361   1.00 0.00 ? 38  GLU A C    11 
ATOM   6681  O  O    . GLU A 1 38 ? 9.613   4.121   6.112   1.00 0.00 ? 38  GLU A O    11 
ATOM   6682  C  CB   . GLU A 1 38 ? 9.848   6.315   7.999   1.00 0.00 ? 38  GLU A CB   11 
ATOM   6683  C  CG   . GLU A 1 38 ? 10.063  5.363   9.164   1.00 0.00 ? 38  GLU A CG   11 
ATOM   6684  C  CD   . GLU A 1 38 ? 8.903   5.364   10.140  1.00 0.00 ? 38  GLU A CD   11 
ATOM   6685  O  OE1  . GLU A 1 38 ? 8.290   6.434   10.333  1.00 0.00 ? 38  GLU A OE1  11 
ATOM   6686  O  OE2  . GLU A 1 38 ? 8.607   4.293   10.710  1.00 0.00 ? 38  GLU A OE2  11 
ATOM   6687  H  H    . GLU A 1 38 ? 9.621   6.984   5.326   1.00 0.00 ? 38  GLU A H    11 
ATOM   6688  H  HA   . GLU A 1 38 ? 11.816  6.269   7.159   1.00 0.00 ? 38  GLU A HA   11 
ATOM   6689  H  HB2  . GLU A 1 38 ? 9.979   7.326   8.357   1.00 0.00 ? 38  GLU A HB2  11 
ATOM   6690  H  HB3  . GLU A 1 38 ? 8.834   6.196   7.647   1.00 0.00 ? 38  GLU A HB3  11 
ATOM   6691  H  HG2  . GLU A 1 38 ? 10.187  4.363   8.776   1.00 0.00 ? 38  GLU A HG2  11 
ATOM   6692  H  HG3  . GLU A 1 38 ? 10.959  5.657   9.692   1.00 0.00 ? 38  GLU A HG3  11 
ATOM   6693  N  N    . SER A 1 39 ? 11.855  3.972   6.241   1.00 0.00 ? 39  SER A N    11 
ATOM   6694  C  CA   . SER A 1 39 ? 11.898  2.584   5.798   1.00 0.00 ? 39  SER A CA   11 
ATOM   6695  C  C    . SER A 1 39 ? 11.338  1.654   6.870   1.00 0.00 ? 39  SER A C    11 
ATOM   6696  O  O    . SER A 1 39 ? 10.571  0.738   6.574   1.00 0.00 ? 39  SER A O    11 
ATOM   6697  C  CB   . SER A 1 39 ? 13.333  2.180   5.456   1.00 0.00 ? 39  SER A CB   11 
ATOM   6698  O  OG   . SER A 1 39 ? 13.633  2.462   4.100   1.00 0.00 ? 39  SER A OG   11 
ATOM   6699  H  H    . SER A 1 39 ? 12.693  4.433   6.454   1.00 0.00 ? 39  SER A H    11 
ATOM   6700  H  HA   . SER A 1 39 ? 11.288  2.500   4.911   1.00 0.00 ? 39  SER A HA   11 
ATOM   6701  H  HB2  . SER A 1 39 ? 14.018  2.728   6.085   1.00 0.00 ? 39  SER A HB2  11 
ATOM   6702  H  HB3  . SER A 1 39 ? 13.457  1.120   5.628   1.00 0.00 ? 39  SER A HB3  11 
ATOM   6703  H  HG   . SER A 1 39 ? 14.526  2.169   3.902   1.00 0.00 ? 39  SER A HG   11 
ATOM   6704  N  N    . GLY A 1 40 ? 11.727  1.897   8.118   1.00 0.00 ? 40  GLY A N    11 
ATOM   6705  C  CA   . GLY A 1 40 ? 11.255  1.074   9.216   1.00 0.00 ? 40  GLY A CA   11 
ATOM   6706  C  C    . GLY A 1 40 ? 11.445  1.740   10.564  1.00 0.00 ? 40  GLY A C    11 
ATOM   6707  O  O    . GLY A 1 40 ? 11.686  2.944   10.657  1.00 0.00 ? 40  GLY A O    11 
ATOM   6708  H  H    . GLY A 1 40 ? 12.340  2.641   8.295   1.00 0.00 ? 40  GLY A H    11 
ATOM   6709  H  HA2  . GLY A 1 40 ? 10.205  0.869   9.072   1.00 0.00 ? 40  GLY A HA2  11 
ATOM   6710  H  HA3  . GLY A 1 40 ? 11.798  0.140   9.210   1.00 0.00 ? 40  GLY A HA3  11 
ATOM   6711  N  N    . PRO A 1 41 ? 11.334  0.948   11.641  1.00 0.00 ? 41  PRO A N    11 
ATOM   6712  C  CA   . PRO A 1 41 ? 11.491  1.448   13.010  1.00 0.00 ? 41  PRO A CA   11 
ATOM   6713  C  C    . PRO A 1 41 ? 12.931  1.838   13.324  1.00 0.00 ? 41  PRO A C    11 
ATOM   6714  O  O    . PRO A 1 41 ? 13.873  1.187   12.873  1.00 0.00 ? 41  PRO A O    11 
ATOM   6715  C  CB   . PRO A 1 41 ? 11.060  0.259   13.873  1.00 0.00 ? 41  PRO A CB   11 
ATOM   6716  C  CG   . PRO A 1 41 ? 11.304  -0.937  13.020  1.00 0.00 ? 41  PRO A CG   11 
ATOM   6717  C  CD   . PRO A 1 41 ? 11.049  -0.496  11.605  1.00 0.00 ? 41  PRO A CD   11 
ATOM   6718  H  HA   . PRO A 1 41 ? 10.841  2.289   13.202  1.00 0.00 ? 41  PRO A HA   11 
ATOM   6719  H  HB2  . PRO A 1 41 ? 11.655  0.231   14.775  1.00 0.00 ? 41  PRO A HB2  11 
ATOM   6720  H  HB3  . PRO A 1 41 ? 10.015  0.355   14.128  1.00 0.00 ? 41  PRO A HB3  11 
ATOM   6721  H  HG2  . PRO A 1 41 ? 12.327  -1.265  13.131  1.00 0.00 ? 41  PRO A HG2  11 
ATOM   6722  H  HG3  . PRO A 1 41 ? 10.623  -1.729  13.294  1.00 0.00 ? 41  PRO A HG3  11 
ATOM   6723  H  HD2  . PRO A 1 41 ? 11.716  -1.004  10.925  1.00 0.00 ? 41  PRO A HD2  11 
ATOM   6724  H  HD3  . PRO A 1 41 ? 10.019  -0.678  11.333  1.00 0.00 ? 41  PRO A HD3  11 
ATOM   6725  N  N    . SER A 1 42 ? 13.095  2.905   14.099  1.00 0.00 ? 42  SER A N    11 
ATOM   6726  C  CA   . SER A 1 42 ? 14.422  3.384   14.470  1.00 0.00 ? 42  SER A CA   11 
ATOM   6727  C  C    . SER A 1 42 ? 14.846  2.817   15.821  1.00 0.00 ? 42  SER A C    11 
ATOM   6728  O  O    . SER A 1 42 ? 14.007  2.445   16.642  1.00 0.00 ? 42  SER A O    11 
ATOM   6729  C  CB   . SER A 1 42 ? 14.440  4.913   14.519  1.00 0.00 ? 42  SER A CB   11 
ATOM   6730  O  OG   . SER A 1 42 ? 15.766  5.410   14.467  1.00 0.00 ? 42  SER A OG   11 
ATOM   6731  H  H    . SER A 1 42 ? 12.305  3.383   14.428  1.00 0.00 ? 42  SER A H    11 
ATOM   6732  H  HA   . SER A 1 42 ? 15.118  3.048   13.717  1.00 0.00 ? 42  SER A HA   11 
ATOM   6733  H  HB2  . SER A 1 42 ? 13.889  5.304   13.677  1.00 0.00 ? 42  SER A HB2  11 
ATOM   6734  H  HB3  . SER A 1 42 ? 13.978  5.247   15.437  1.00 0.00 ? 42  SER A HB3  11 
ATOM   6735  H  HG   . SER A 1 42 ? 16.177  5.140   13.642  1.00 0.00 ? 42  SER A HG   11 
ATOM   6736  N  N    . SER A 1 43 ? 16.155  2.753   16.044  1.00 0.00 ? 43  SER A N    11 
ATOM   6737  C  CA   . SER A 1 43 ? 16.693  2.227   17.294  1.00 0.00 ? 43  SER A CA   11 
ATOM   6738  C  C    . SER A 1 43 ? 17.830  3.104   17.807  1.00 0.00 ? 43  SER A C    11 
ATOM   6739  O  O    . SER A 1 43 ? 18.469  3.824   17.040  1.00 0.00 ? 43  SER A O    11 
ATOM   6740  C  CB   . SER A 1 43 ? 17.188  0.792   17.097  1.00 0.00 ? 43  SER A CB   11 
ATOM   6741  O  OG   . SER A 1 43 ? 16.103  -0.116  17.020  1.00 0.00 ? 43  SER A OG   11 
ATOM   6742  H  H    . SER A 1 43 ? 16.773  3.064   15.351  1.00 0.00 ? 43  SER A H    11 
ATOM   6743  H  HA   . SER A 1 43 ? 15.896  2.226   18.023  1.00 0.00 ? 43  SER A HA   11 
ATOM   6744  H  HB2  . SER A 1 43 ? 17.756  0.733   16.181  1.00 0.00 ? 43  SER A HB2  11 
ATOM   6745  H  HB3  . SER A 1 43 ? 17.817  0.514   17.930  1.00 0.00 ? 43  SER A HB3  11 
ATOM   6746  H  HG   . SER A 1 43 ? 16.352  -0.948  17.428  1.00 0.00 ? 43  SER A HG   11 
ATOM   6747  N  N    . GLY A 1 44 ? 18.078  3.037   19.112  1.00 0.00 ? 44  GLY A N    11 
ATOM   6748  C  CA   . GLY A 1 44 ? 19.139  3.829   19.707  1.00 0.00 ? 44  GLY A CA   11 
ATOM   6749  C  C    . GLY A 1 44 ? 18.804  5.307   19.749  1.00 0.00 ? 44  GLY A C    11 
ATOM   6750  O  O    . GLY A 1 44 ? 17.680  5.657   20.104  1.00 0.00 ? 44  GLY A O    11 
ATOM   6751  H  H    . GLY A 1 44 ? 17.537  2.445   19.675  1.00 0.00 ? 44  GLY A H    11 
ATOM   6752  H  HA2  . GLY A 1 44 ? 19.311  3.481   20.714  1.00 0.00 ? 44  GLY A HA2  11 
ATOM   6753  H  HA3  . GLY A 1 44 ? 20.042  3.693   19.130  1.00 0.00 ? 44  GLY A HA3  11 
HETATM 6754  ZN ZN   . ZN  B 2 .  ? 4.554   -0.403  2.676   1.00 0.00 ? 181 ZN  A ZN   11 
ATOM   6755  N  N    . GLY A 1 1  ? 0.169   -33.858 -0.763  1.00 0.00 ? 1   GLY A N    12 
ATOM   6756  C  CA   . GLY A 1 1  ? 0.295   -32.771 -1.716  1.00 0.00 ? 1   GLY A CA   12 
ATOM   6757  C  C    . GLY A 1 1  ? 0.705   -31.468 -1.059  1.00 0.00 ? 1   GLY A C    12 
ATOM   6758  O  O    . GLY A 1 1  ? -0.108  -30.555 -0.915  1.00 0.00 ? 1   GLY A O    12 
ATOM   6759  H  H1   . GLY A 1 1  ? 0.238   -34.787 -1.069  1.00 0.00 ? 1   GLY A H1   12 
ATOM   6760  H  HA2  . GLY A 1 1  ? 1.036   -33.039 -2.454  1.00 0.00 ? 1   GLY A HA2  12 
ATOM   6761  H  HA3  . GLY A 1 1  ? -0.655  -32.629 -2.210  1.00 0.00 ? 1   GLY A HA3  12 
ATOM   6762  N  N    . SER A 1 2  ? 1.969   -31.381 -0.658  1.00 0.00 ? 2   SER A N    12 
ATOM   6763  C  CA   . SER A 1 2  ? 2.484   -30.182 -0.007  1.00 0.00 ? 2   SER A CA   12 
ATOM   6764  C  C    . SER A 1 2  ? 2.866   -29.125 -1.040  1.00 0.00 ? 2   SER A C    12 
ATOM   6765  O  O    . SER A 1 2  ? 4.009   -29.068 -1.493  1.00 0.00 ? 2   SER A O    12 
ATOM   6766  C  CB   . SER A 1 2  ? 3.698   -30.527 0.858   1.00 0.00 ? 2   SER A CB   12 
ATOM   6767  O  OG   . SER A 1 2  ? 3.303   -30.875 2.174   1.00 0.00 ? 2   SER A OG   12 
ATOM   6768  H  H    . SER A 1 2  ? 2.569   -32.143 -0.801  1.00 0.00 ? 2   SER A H    12 
ATOM   6769  H  HA   . SER A 1 2  ? 1.703   -29.786 0.624   1.00 0.00 ? 2   SER A HA   12 
ATOM   6770  H  HB2  . SER A 1 2  ? 4.223   -31.363 0.421   1.00 0.00 ? 2   SER A HB2  12 
ATOM   6771  H  HB3  . SER A 1 2  ? 4.357   -29.673 0.906   1.00 0.00 ? 2   SER A HB3  12 
ATOM   6772  H  HG   . SER A 1 2  ? 4.083   -31.024 2.714   1.00 0.00 ? 2   SER A HG   12 
ATOM   6773  N  N    . SER A 1 3  ? 1.900   -28.290 -1.407  1.00 0.00 ? 3   SER A N    12 
ATOM   6774  C  CA   . SER A 1 3  ? 2.131   -27.237 -2.388  1.00 0.00 ? 3   SER A CA   12 
ATOM   6775  C  C    . SER A 1 3  ? 1.687   -25.882 -1.846  1.00 0.00 ? 3   SER A C    12 
ATOM   6776  O  O    . SER A 1 3  ? 2.425   -24.900 -1.917  1.00 0.00 ? 3   SER A O    12 
ATOM   6777  C  CB   . SER A 1 3  ? 1.386   -27.548 -3.688  1.00 0.00 ? 3   SER A CB   12 
ATOM   6778  O  OG   . SER A 1 3  ? 2.017   -28.599 -4.398  1.00 0.00 ? 3   SER A OG   12 
ATOM   6779  H  H    . SER A 1 3  ? 1.008   -28.386 -1.010  1.00 0.00 ? 3   SER A H    12 
ATOM   6780  H  HA   . SER A 1 3  ? 3.191   -27.200 -2.591  1.00 0.00 ? 3   SER A HA   12 
ATOM   6781  H  HB2  . SER A 1 3  ? 0.374   -27.843 -3.457  1.00 0.00 ? 3   SER A HB2  12 
ATOM   6782  H  HB3  . SER A 1 3  ? 1.372   -26.666 -4.311  1.00 0.00 ? 3   SER A HB3  12 
ATOM   6783  H  HG   . SER A 1 3  ? 2.814   -28.867 -3.934  1.00 0.00 ? 3   SER A HG   12 
ATOM   6784  N  N    . GLY A 1 4  ? 0.474   -25.837 -1.304  1.00 0.00 ? 4   GLY A N    12 
ATOM   6785  C  CA   . GLY A 1 4  ? -0.049  -24.598 -0.758  1.00 0.00 ? 4   GLY A CA   12 
ATOM   6786  C  C    . GLY A 1 4  ? -1.530  -24.684 -0.442  1.00 0.00 ? 4   GLY A C    12 
ATOM   6787  O  O    . GLY A 1 4  ? -2.340  -24.996 -1.314  1.00 0.00 ? 4   GLY A O    12 
ATOM   6788  H  H    . GLY A 1 4  ? -0.071  -26.652 -1.275  1.00 0.00 ? 4   GLY A H    12 
ATOM   6789  H  HA2  . GLY A 1 4  ? 0.488   -24.362 0.148   1.00 0.00 ? 4   GLY A HA2  12 
ATOM   6790  H  HA3  . GLY A 1 4  ? 0.109   -23.807 -1.475  1.00 0.00 ? 4   GLY A HA3  12 
ATOM   6791  N  N    . SER A 1 5  ? -1.883  -24.406 0.809   1.00 0.00 ? 5   SER A N    12 
ATOM   6792  C  CA   . SER A 1 5  ? -3.276  -24.458 1.239   1.00 0.00 ? 5   SER A CA   12 
ATOM   6793  C  C    . SER A 1 5  ? -3.997  -23.156 0.903   1.00 0.00 ? 5   SER A C    12 
ATOM   6794  O  O    . SER A 1 5  ? -4.768  -22.636 1.709   1.00 0.00 ? 5   SER A O    12 
ATOM   6795  C  CB   . SER A 1 5  ? -3.357  -24.727 2.743   1.00 0.00 ? 5   SER A CB   12 
ATOM   6796  O  OG   . SER A 1 5  ? -2.610  -23.770 3.473   1.00 0.00 ? 5   SER A OG   12 
ATOM   6797  H  H    . SER A 1 5  ? -1.191  -24.163 1.458   1.00 0.00 ? 5   SER A H    12 
ATOM   6798  H  HA   . SER A 1 5  ? -3.756  -25.269 0.710   1.00 0.00 ? 5   SER A HA   12 
ATOM   6799  H  HB2  . SER A 1 5  ? -4.388  -24.679 3.059   1.00 0.00 ? 5   SER A HB2  12 
ATOM   6800  H  HB3  . SER A 1 5  ? -2.962  -25.711 2.952   1.00 0.00 ? 5   SER A HB3  12 
ATOM   6801  H  HG   . SER A 1 5  ? -3.195  -23.073 3.780   1.00 0.00 ? 5   SER A HG   12 
ATOM   6802  N  N    . SER A 1 6  ? -3.740  -22.636 -0.292  1.00 0.00 ? 6   SER A N    12 
ATOM   6803  C  CA   . SER A 1 6  ? -4.361  -21.393 -0.734  1.00 0.00 ? 6   SER A CA   12 
ATOM   6804  C  C    . SER A 1 6  ? -4.009  -21.097 -2.189  1.00 0.00 ? 6   SER A C    12 
ATOM   6805  O  O    . SER A 1 6  ? -2.924  -21.437 -2.659  1.00 0.00 ? 6   SER A O    12 
ATOM   6806  C  CB   . SER A 1 6  ? -3.915  -20.231 0.156   1.00 0.00 ? 6   SER A CB   12 
ATOM   6807  O  OG   . SER A 1 6  ? -4.274  -18.984 -0.415  1.00 0.00 ? 6   SER A OG   12 
ATOM   6808  H  H    . SER A 1 6  ? -3.115  -23.098 -0.890  1.00 0.00 ? 6   SER A H    12 
ATOM   6809  H  HA   . SER A 1 6  ? -5.431  -21.509 -0.651  1.00 0.00 ? 6   SER A HA   12 
ATOM   6810  H  HB2  . SER A 1 6  ? -4.388  -20.319 1.122   1.00 0.00 ? 6   SER A HB2  12 
ATOM   6811  H  HB3  . SER A 1 6  ? -2.842  -20.263 0.275   1.00 0.00 ? 6   SER A HB3  12 
ATOM   6812  H  HG   . SER A 1 6  ? -4.995  -19.112 -1.037  1.00 0.00 ? 6   SER A HG   12 
ATOM   6813  N  N    . GLY A 1 7  ? -4.937  -20.462 -2.898  1.00 0.00 ? 7   GLY A N    12 
ATOM   6814  C  CA   . GLY A 1 7  ? -4.708  -20.131 -4.293  1.00 0.00 ? 7   GLY A CA   12 
ATOM   6815  C  C    . GLY A 1 7  ? -3.460  -19.293 -4.492  1.00 0.00 ? 7   GLY A C    12 
ATOM   6816  O  O    . GLY A 1 7  ? -2.343  -19.776 -4.308  1.00 0.00 ? 7   GLY A O    12 
ATOM   6817  H  H    . GLY A 1 7  ? -5.784  -20.215 -2.471  1.00 0.00 ? 7   GLY A H    12 
ATOM   6818  H  HA2  . GLY A 1 7  ? -4.609  -21.046 -4.857  1.00 0.00 ? 7   GLY A HA2  12 
ATOM   6819  H  HA3  . GLY A 1 7  ? -5.560  -19.581 -4.665  1.00 0.00 ? 7   GLY A HA3  12 
ATOM   6820  N  N    . THR A 1 8  ? -3.650  -18.033 -4.872  1.00 0.00 ? 8   THR A N    12 
ATOM   6821  C  CA   . THR A 1 8  ? -2.531  -17.128 -5.100  1.00 0.00 ? 8   THR A CA   12 
ATOM   6822  C  C    . THR A 1 8  ? -2.257  -16.271 -3.869  1.00 0.00 ? 8   THR A C    12 
ATOM   6823  O  O    . THR A 1 8  ? -1.128  -16.205 -3.385  1.00 0.00 ? 8   THR A O    12 
ATOM   6824  C  CB   . THR A 1 8  ? -2.792  -16.205 -6.306  1.00 0.00 ? 8   THR A CB   12 
ATOM   6825  O  OG1  . THR A 1 8  ? -4.003  -15.468 -6.106  1.00 0.00 ? 8   THR A OG1  12 
ATOM   6826  C  CG2  . THR A 1 8  ? -2.889  -17.010 -7.593  1.00 0.00 ? 8   THR A CG2  12 
ATOM   6827  H  H    . THR A 1 8  ? -4.564  -17.707 -5.003  1.00 0.00 ? 8   THR A H    12 
ATOM   6828  H  HA   . THR A 1 8  ? -1.656  -17.725 -5.313  1.00 0.00 ? 8   THR A HA   12 
ATOM   6829  H  HB   . THR A 1 8  ? -1.967  -15.512 -6.394  1.00 0.00 ? 8   THR A HB   12 
ATOM   6830  H  HG1  . THR A 1 8  ? -3.876  -14.560 -6.392  1.00 0.00 ? 8   THR A HG1  12 
ATOM   6831  H  HG21 . THR A 1 8  ? -1.948  -17.505 -7.779  1.00 0.00 ? 8   THR A HG21 12 
ATOM   6832  H  HG22 . THR A 1 8  ? -3.117  -16.349 -8.415  1.00 0.00 ? 8   THR A HG22 12 
ATOM   6833  H  HG23 . THR A 1 8  ? -3.671  -17.749 -7.497  1.00 0.00 ? 8   THR A HG23 12 
ATOM   6834  N  N    . GLY A 1 9  ? -3.299  -15.616 -3.366  1.00 0.00 ? 9   GLY A N    12 
ATOM   6835  C  CA   . GLY A 1 9  ? -3.150  -14.773 -2.194  1.00 0.00 ? 9   GLY A CA   12 
ATOM   6836  C  C    . GLY A 1 9  ? -4.225  -13.708 -2.105  1.00 0.00 ? 9   GLY A C    12 
ATOM   6837  O  O    . GLY A 1 9  ? -4.734  -13.244 -3.125  1.00 0.00 ? 9   GLY A O    12 
ATOM   6838  H  H    . GLY A 1 9  ? -4.177  -15.707 -3.793  1.00 0.00 ? 9   GLY A H    12 
ATOM   6839  H  HA2  . GLY A 1 9  ? -3.197  -15.392 -1.310  1.00 0.00 ? 9   GLY A HA2  12 
ATOM   6840  H  HA3  . GLY A 1 9  ? -2.184  -14.291 -2.233  1.00 0.00 ? 9   GLY A HA3  12 
ATOM   6841  N  N    . MET A 1 10 ? -4.572  -13.321 -0.883  1.00 0.00 ? 10  MET A N    12 
ATOM   6842  C  CA   . MET A 1 10 ? -5.595  -12.304 -0.665  1.00 0.00 ? 10  MET A CA   12 
ATOM   6843  C  C    . MET A 1 10 ? -4.967  -10.990 -0.210  1.00 0.00 ? 10  MET A C    12 
ATOM   6844  O  O    . MET A 1 10 ? -4.744  -10.776 0.981   1.00 0.00 ? 10  MET A O    12 
ATOM   6845  C  CB   . MET A 1 10 ? -6.610  -12.784 0.374   1.00 0.00 ? 10  MET A CB   12 
ATOM   6846  C  CG   . MET A 1 10 ? -7.591  -13.812 -0.166  1.00 0.00 ? 10  MET A CG   12 
ATOM   6847  S  SD   . MET A 1 10 ? -8.935  -13.062 -1.106  1.00 0.00 ? 10  MET A SD   12 
ATOM   6848  C  CE   . MET A 1 10 ? -10.232 -14.275 -0.869  1.00 0.00 ? 10  MET A CE   12 
ATOM   6849  H  H    . MET A 1 10 ? -4.131  -13.727 -0.108  1.00 0.00 ? 10  MET A H    12 
ATOM   6850  H  HA   . MET A 1 10 ? -6.104  -12.140 -1.603  1.00 0.00 ? 10  MET A HA   12 
ATOM   6851  H  HB2  . MET A 1 10 ? -6.077  -13.227 1.202   1.00 0.00 ? 10  MET A HB2  12 
ATOM   6852  H  HB3  . MET A 1 10 ? -7.172  -11.934 0.731   1.00 0.00 ? 10  MET A HB3  12 
ATOM   6853  H  HG2  . MET A 1 10 ? -7.059  -14.496 -0.809  1.00 0.00 ? 10  MET A HG2  12 
ATOM   6854  H  HG3  . MET A 1 10 ? -8.012  -14.357 0.666   1.00 0.00 ? 10  MET A HG3  12 
ATOM   6855  H  HE1  . MET A 1 10 ? -10.980 -14.156 -1.639  1.00 0.00 ? 10  MET A HE1  12 
ATOM   6856  H  HE2  . MET A 1 10 ? -9.811  -15.268 -0.925  1.00 0.00 ? 10  MET A HE2  12 
ATOM   6857  H  HE3  . MET A 1 10 ? -10.686 -14.131 0.100   1.00 0.00 ? 10  MET A HE3  12 
ATOM   6858  N  N    . LYS A 1 11 ? -4.684  -10.112 -1.167  1.00 0.00 ? 11  LYS A N    12 
ATOM   6859  C  CA   . LYS A 1 11 ? -4.082  -8.819  -0.865  1.00 0.00 ? 11  LYS A CA   12 
ATOM   6860  C  C    . LYS A 1 11 ? -4.806  -7.697  -1.603  1.00 0.00 ? 11  LYS A C    12 
ATOM   6861  O  O    . LYS A 1 11 ? -4.365  -7.226  -2.652  1.00 0.00 ? 11  LYS A O    12 
ATOM   6862  C  CB   . LYS A 1 11 ? -2.600  -8.821  -1.247  1.00 0.00 ? 11  LYS A CB   12 
ATOM   6863  C  CG   . LYS A 1 11 ? -1.716  -9.543  -0.245  1.00 0.00 ? 11  LYS A CG   12 
ATOM   6864  C  CD   . LYS A 1 11 ? -0.381  -9.932  -0.858  1.00 0.00 ? 11  LYS A CD   12 
ATOM   6865  C  CE   . LYS A 1 11 ? 0.489   -8.711  -1.118  1.00 0.00 ? 11  LYS A CE   12 
ATOM   6866  N  NZ   . LYS A 1 11 ? 1.925   -9.076  -1.273  1.00 0.00 ? 11  LYS A NZ   12 
ATOM   6867  H  H    . LYS A 1 11 ? -4.885  -10.340 -2.099  1.00 0.00 ? 11  LYS A H    12 
ATOM   6868  H  HA   . LYS A 1 11 ? -4.172  -8.651  0.197   1.00 0.00 ? 11  LYS A HA   12 
ATOM   6869  H  HB2  . LYS A 1 11 ? -2.488  -9.303  -2.207  1.00 0.00 ? 11  LYS A HB2  12 
ATOM   6870  H  HB3  . LYS A 1 11 ? -2.259  -7.799  -1.324  1.00 0.00 ? 11  LYS A HB3  12 
ATOM   6871  H  HG2  . LYS A 1 11 ? -1.536  -8.893  0.598   1.00 0.00 ? 11  LYS A HG2  12 
ATOM   6872  H  HG3  . LYS A 1 11 ? -2.222  -10.438 0.090   1.00 0.00 ? 11  LYS A HG3  12 
ATOM   6873  H  HD2  . LYS A 1 11 ? 0.139   -10.592 -0.179  1.00 0.00 ? 11  LYS A HD2  12 
ATOM   6874  H  HD3  . LYS A 1 11 ? -0.559  -10.442 -1.794  1.00 0.00 ? 11  LYS A HD3  12 
ATOM   6875  H  HE2  . LYS A 1 11 ? 0.150   -8.229  -2.022  1.00 0.00 ? 11  LYS A HE2  12 
ATOM   6876  H  HE3  . LYS A 1 11 ? 0.388   -8.029  -0.287  1.00 0.00 ? 11  LYS A HE3  12 
ATOM   6877  H  HZ1  . LYS A 1 11 ? 2.044   -10.105 -1.180  1.00 0.00 ? 11  LYS A HZ1  12 
ATOM   6878  H  HZ2  . LYS A 1 11 ? 2.494   -8.604  -0.542  1.00 0.00 ? 11  LYS A HZ2  12 
ATOM   6879  H  HZ3  . LYS A 1 11 ? 2.269   -8.782  -2.209  1.00 0.00 ? 11  LYS A HZ3  12 
ATOM   6880  N  N    . PRO A 1 12 ? -5.943  -7.257  -1.044  1.00 0.00 ? 12  PRO A N    12 
ATOM   6881  C  CA   . PRO A 1 12 ? -6.750  -6.184  -1.632  1.00 0.00 ? 12  PRO A CA   12 
ATOM   6882  C  C    . PRO A 1 12 ? -6.064  -4.825  -1.540  1.00 0.00 ? 12  PRO A C    12 
ATOM   6883  O  O    . PRO A 1 12 ? -5.888  -4.138  -2.546  1.00 0.00 ? 12  PRO A O    12 
ATOM   6884  C  CB   . PRO A 1 12 ? -8.026  -6.196  -0.786  1.00 0.00 ? 12  PRO A CB   12 
ATOM   6885  C  CG   . PRO A 1 12 ? -7.609  -6.777  0.521   1.00 0.00 ? 12  PRO A CG   12 
ATOM   6886  C  CD   . PRO A 1 12 ? -6.527  -7.773  0.205   1.00 0.00 ? 12  PRO A CD   12 
ATOM   6887  H  HA   . PRO A 1 12 ? -6.997  -6.392  -2.662  1.00 0.00 ? 12  PRO A HA   12 
ATOM   6888  H  HB2  . PRO A 1 12 ? -8.395  -5.187  -0.672  1.00 0.00 ? 12  PRO A HB2  12 
ATOM   6889  H  HB3  . PRO A 1 12 ? -8.775  -6.807  -1.268  1.00 0.00 ? 12  PRO A HB3  12 
ATOM   6890  H  HG2  . PRO A 1 12 ? -7.226  -5.998  1.163   1.00 0.00 ? 12  PRO A HG2  12 
ATOM   6891  H  HG3  . PRO A 1 12 ? -8.448  -7.271  0.987   1.00 0.00 ? 12  PRO A HG3  12 
ATOM   6892  H  HD2  . PRO A 1 12 ? -5.792  -7.794  0.995   1.00 0.00 ? 12  PRO A HD2  12 
ATOM   6893  H  HD3  . PRO A 1 12 ? -6.951  -8.755  0.055   1.00 0.00 ? 12  PRO A HD3  12 
ATOM   6894  N  N    . TYR A 1 13 ? -5.677  -4.444  -0.327  1.00 0.00 ? 13  TYR A N    12 
ATOM   6895  C  CA   . TYR A 1 13 ? -5.012  -3.166  -0.104  1.00 0.00 ? 13  TYR A CA   12 
ATOM   6896  C  C    . TYR A 1 13 ? -3.691  -3.362  0.633   1.00 0.00 ? 13  TYR A C    12 
ATOM   6897  O  O    . TYR A 1 13 ? -3.140  -2.421  1.206   1.00 0.00 ? 13  TYR A O    12 
ATOM   6898  C  CB   . TYR A 1 13 ? -5.919  -2.227  0.692   1.00 0.00 ? 13  TYR A CB   12 
ATOM   6899  C  CG   . TYR A 1 13 ? -7.388  -2.565  0.581   1.00 0.00 ? 13  TYR A CG   12 
ATOM   6900  C  CD1  . TYR A 1 13 ? -7.938  -3.611  1.312   1.00 0.00 ? 13  TYR A CD1  12 
ATOM   6901  C  CD2  . TYR A 1 13 ? -8.227  -1.839  -0.255  1.00 0.00 ? 13  TYR A CD2  12 
ATOM   6902  C  CE1  . TYR A 1 13 ? -9.280  -3.924  1.212   1.00 0.00 ? 13  TYR A CE1  12 
ATOM   6903  C  CE2  . TYR A 1 13 ? -9.570  -2.144  -0.360  1.00 0.00 ? 13  TYR A CE2  12 
ATOM   6904  C  CZ   . TYR A 1 13 ? -10.092 -3.187  0.375   1.00 0.00 ? 13  TYR A CZ   12 
ATOM   6905  O  OH   . TYR A 1 13 ? -11.429 -3.495  0.274   1.00 0.00 ? 13  TYR A OH   12 
ATOM   6906  H  H    . TYR A 1 13 ? -5.845  -5.035  0.436   1.00 0.00 ? 13  TYR A H    12 
ATOM   6907  H  HA   . TYR A 1 13 ? -4.811  -2.724  -1.069  1.00 0.00 ? 13  TYR A HA   12 
ATOM   6908  H  HB2  . TYR A 1 13 ? -5.647  -2.273  1.735   1.00 0.00 ? 13  TYR A HB2  12 
ATOM   6909  H  HB3  . TYR A 1 13 ? -5.783  -1.217  0.334   1.00 0.00 ? 13  TYR A HB3  12 
ATOM   6910  H  HD1  . TYR A 1 13 ? -7.299  -4.185  1.967   1.00 0.00 ? 13  TYR A HD1  12 
ATOM   6911  H  HD2  . TYR A 1 13 ? -7.816  -1.021  -0.830  1.00 0.00 ? 13  TYR A HD2  12 
ATOM   6912  H  HE1  . TYR A 1 13 ? -9.689  -4.741  1.788   1.00 0.00 ? 13  TYR A HE1  12 
ATOM   6913  H  HE2  . TYR A 1 13 ? -10.207 -1.567  -1.016  1.00 0.00 ? 13  TYR A HE2  12 
ATOM   6914  H  HH   . TYR A 1 13 ? -11.899 -3.130  1.027   1.00 0.00 ? 13  TYR A HH   12 
ATOM   6915  N  N    . VAL A 1 14 ? -3.186  -4.591  0.614   1.00 0.00 ? 14  VAL A N    12 
ATOM   6916  C  CA   . VAL A 1 14 ? -1.929  -4.912  1.279   1.00 0.00 ? 14  VAL A CA   12 
ATOM   6917  C  C    . VAL A 1 14 ? -0.737  -4.403  0.475   1.00 0.00 ? 14  VAL A C    12 
ATOM   6918  O  O    . VAL A 1 14 ? -0.679  -4.570  -0.743  1.00 0.00 ? 14  VAL A O    12 
ATOM   6919  C  CB   . VAL A 1 14 ? -1.779  -6.430  1.494   1.00 0.00 ? 14  VAL A CB   12 
ATOM   6920  C  CG1  . VAL A 1 14 ? -0.429  -6.750  2.117   1.00 0.00 ? 14  VAL A CG1  12 
ATOM   6921  C  CG2  . VAL A 1 14 ? -2.913  -6.960  2.358   1.00 0.00 ? 14  VAL A CG2  12 
ATOM   6922  H  H    . VAL A 1 14 ? -3.671  -5.299  0.141   1.00 0.00 ? 14  VAL A H    12 
ATOM   6923  H  HA   . VAL A 1 14 ? -1.930  -4.431  2.246   1.00 0.00 ? 14  VAL A HA   12 
ATOM   6924  H  HB   . VAL A 1 14 ? -1.830  -6.916  0.531   1.00 0.00 ? 14  VAL A HB   12 
ATOM   6925  H  HG11 . VAL A 1 14 ? -0.130  -7.749  1.834   1.00 0.00 ? 14  VAL A HG11 12 
ATOM   6926  H  HG12 . VAL A 1 14 ? 0.307   -6.040  1.768   1.00 0.00 ? 14  VAL A HG12 12 
ATOM   6927  H  HG13 . VAL A 1 14 ? -0.505  -6.690  3.192   1.00 0.00 ? 14  VAL A HG13 12 
ATOM   6928  H  HG21 . VAL A 1 14 ? -3.492  -7.675  1.793   1.00 0.00 ? 14  VAL A HG21 12 
ATOM   6929  H  HG22 . VAL A 1 14 ? -2.503  -7.439  3.234   1.00 0.00 ? 14  VAL A HG22 12 
ATOM   6930  H  HG23 . VAL A 1 14 ? -3.549  -6.140  2.660   1.00 0.00 ? 14  VAL A HG23 12 
ATOM   6931  N  N    . CYS A 1 15 ? 0.213   -3.782  1.166   1.00 0.00 ? 15  CYS A N    12 
ATOM   6932  C  CA   . CYS A 1 15 ? 1.405   -3.249  0.518   1.00 0.00 ? 15  CYS A CA   12 
ATOM   6933  C  C    . CYS A 1 15 ? 2.281   -4.375  -0.024  1.00 0.00 ? 15  CYS A C    12 
ATOM   6934  O  O    . CYS A 1 15 ? 2.887   -5.125  0.740   1.00 0.00 ? 15  CYS A O    12 
ATOM   6935  C  CB   . CYS A 1 15 ? 2.206   -2.393  1.501   1.00 0.00 ? 15  CYS A CB   12 
ATOM   6936  S  SG   . CYS A 1 15 ? 3.140   -1.039  0.719   1.00 0.00 ? 15  CYS A SG   12 
ATOM   6937  H  H    . CYS A 1 15 ? 0.111   -3.680  2.136   1.00 0.00 ? 15  CYS A H    12 
ATOM   6938  H  HA   . CYS A 1 15 ? 1.086   -2.629  -0.307  1.00 0.00 ? 15  CYS A HA   12 
ATOM   6939  H  HB2  . CYS A 1 15 ? 1.529   -1.953  2.218   1.00 0.00 ? 15  CYS A HB2  12 
ATOM   6940  H  HB3  . CYS A 1 15 ? 2.913   -3.023  2.022   1.00 0.00 ? 15  CYS A HB3  12 
ATOM   6941  N  N    . ASN A 1 16 ? 2.341   -4.486  -1.347  1.00 0.00 ? 16  ASN A N    12 
ATOM   6942  C  CA   . ASN A 1 16 ? 3.142   -5.521  -1.991  1.00 0.00 ? 16  ASN A CA   12 
ATOM   6943  C  C    . ASN A 1 16 ? 4.631   -5.270  -1.774  1.00 0.00 ? 16  ASN A C    12 
ATOM   6944  O  O    . ASN A 1 16 ? 5.469   -6.088  -2.153  1.00 0.00 ? 16  ASN A O    12 
ATOM   6945  C  CB   . ASN A 1 16 ? 2.835   -5.573  -3.489  1.00 0.00 ? 16  ASN A CB   12 
ATOM   6946  C  CG   . ASN A 1 16 ? 1.348   -5.508  -3.778  1.00 0.00 ? 16  ASN A CG   12 
ATOM   6947  O  OD1  . ASN A 1 16 ? 0.668   -4.561  -3.383  1.00 0.00 ? 16  ASN A OD1  12 
ATOM   6948  N  ND2  . ASN A 1 16 ? 0.836   -6.519  -4.470  1.00 0.00 ? 16  ASN A ND2  12 
ATOM   6949  H  H    . ASN A 1 16 ? 1.835   -3.858  -1.903  1.00 0.00 ? 16  ASN A H    12 
ATOM   6950  H  HA   . ASN A 1 16 ? 2.879   -6.468  -1.546  1.00 0.00 ? 16  ASN A HA   12 
ATOM   6951  H  HB2  . ASN A 1 16 ? 3.314   -4.736  -3.978  1.00 0.00 ? 16  ASN A HB2  12 
ATOM   6952  H  HB3  . ASN A 1 16 ? 3.224   -6.493  -3.899  1.00 0.00 ? 16  ASN A HB3  12 
ATOM   6953  H  HD21 . ASN A 1 16 ? 1.437   -7.240  -4.752  1.00 0.00 ? 16  ASN A HD21 12 
ATOM   6954  H  HD22 . ASN A 1 16 ? -0.123  -6.502  -4.672  1.00 0.00 ? 16  ASN A HD22 12 
ATOM   6955  N  N    . GLU A 1 17 ? 4.952   -4.136  -1.160  1.00 0.00 ? 17  GLU A N    12 
ATOM   6956  C  CA   . GLU A 1 17 ? 6.340   -3.778  -0.892  1.00 0.00 ? 17  GLU A CA   12 
ATOM   6957  C  C    . GLU A 1 17 ? 6.792   -4.326  0.458   1.00 0.00 ? 17  GLU A C    12 
ATOM   6958  O  O    . GLU A 1 17 ? 7.772   -5.067  0.543   1.00 0.00 ? 17  GLU A O    12 
ATOM   6959  C  CB   . GLU A 1 17 ? 6.513   -2.258  -0.922  1.00 0.00 ? 17  GLU A CB   12 
ATOM   6960  C  CG   . GLU A 1 17 ? 6.069   -1.620  -2.228  1.00 0.00 ? 17  GLU A CG   12 
ATOM   6961  C  CD   . GLU A 1 17 ? 7.077   -1.815  -3.344  1.00 0.00 ? 17  GLU A CD   12 
ATOM   6962  O  OE1  . GLU A 1 17 ? 8.259   -1.466  -3.143  1.00 0.00 ? 17  GLU A OE1  12 
ATOM   6963  O  OE2  . GLU A 1 17 ? 6.684   -2.316  -4.418  1.00 0.00 ? 17  GLU A OE2  12 
ATOM   6964  H  H    . GLU A 1 17 ? 4.238   -3.524  -0.881  1.00 0.00 ? 17  GLU A H    12 
ATOM   6965  H  HA   . GLU A 1 17 ? 6.950   -4.216  -1.668  1.00 0.00 ? 17  GLU A HA   12 
ATOM   6966  H  HB2  . GLU A 1 17 ? 5.935   -1.826  -0.119  1.00 0.00 ? 17  GLU A HB2  12 
ATOM   6967  H  HB3  . GLU A 1 17 ? 7.556   -2.024  -0.768  1.00 0.00 ? 17  GLU A HB3  12 
ATOM   6968  H  HG2  . GLU A 1 17 ? 5.131   -2.063  -2.529  1.00 0.00 ? 17  GLU A HG2  12 
ATOM   6969  H  HG3  . GLU A 1 17 ? 5.931   -0.561  -2.068  1.00 0.00 ? 17  GLU A HG3  12 
ATOM   6970  N  N    . CYS A 1 18 ? 6.072   -3.956  1.511   1.00 0.00 ? 18  CYS A N    12 
ATOM   6971  C  CA   . CYS A 1 18 ? 6.397   -4.409  2.858   1.00 0.00 ? 18  CYS A CA   12 
ATOM   6972  C  C    . CYS A 1 18 ? 5.382   -5.437  3.347   1.00 0.00 ? 18  CYS A C    12 
ATOM   6973  O  O    . CYS A 1 18 ? 5.708   -6.318  4.142   1.00 0.00 ? 18  CYS A O    12 
ATOM   6974  C  CB   . CYS A 1 18 ? 6.441   -3.221  3.821   1.00 0.00 ? 18  CYS A CB   12 
ATOM   6975  S  SG   . CYS A 1 18 ? 4.950   -2.174  3.779   1.00 0.00 ? 18  CYS A SG   12 
ATOM   6976  H  H    . CYS A 1 18 ? 5.301   -3.364  1.380   1.00 0.00 ? 18  CYS A H    12 
ATOM   6977  H  HA   . CYS A 1 18 ? 7.372   -4.871  2.827   1.00 0.00 ? 18  CYS A HA   12 
ATOM   6978  H  HB2  . CYS A 1 18 ? 6.554   -3.589  4.831   1.00 0.00 ? 18  CYS A HB2  12 
ATOM   6979  H  HB3  . CYS A 1 18 ? 7.288   -2.598  3.575   1.00 0.00 ? 18  CYS A HB3  12 
ATOM   6980  N  N    . GLY A 1 19 ? 4.148   -5.318  2.866   1.00 0.00 ? 19  GLY A N    12 
ATOM   6981  C  CA   . GLY A 1 19 ? 3.103   -6.243  3.265   1.00 0.00 ? 19  GLY A CA   12 
ATOM   6982  C  C    . GLY A 1 19 ? 2.062   -5.593  4.154   1.00 0.00 ? 19  GLY A C    12 
ATOM   6983  O  O    . GLY A 1 19 ? 1.125   -6.250  4.608   1.00 0.00 ? 19  GLY A O    12 
ATOM   6984  H  H    . GLY A 1 19 ? 3.945   -4.595  2.235   1.00 0.00 ? 19  GLY A H    12 
ATOM   6985  H  HA2  . GLY A 1 19 ? 2.618   -6.624  2.379   1.00 0.00 ? 19  GLY A HA2  12 
ATOM   6986  H  HA3  . GLY A 1 19 ? 3.553   -7.066  3.800   1.00 0.00 ? 19  GLY A HA3  12 
ATOM   6987  N  N    . LYS A 1 20 ? 2.225   -4.298  4.406   1.00 0.00 ? 20  LYS A N    12 
ATOM   6988  C  CA   . LYS A 1 20 ? 1.293   -3.558  5.247   1.00 0.00 ? 20  LYS A CA   12 
ATOM   6989  C  C    . LYS A 1 20 ? -0.146  -3.785  4.794   1.00 0.00 ? 20  LYS A C    12 
ATOM   6990  O  O    . LYS A 1 20 ? -0.564  -3.286  3.750   1.00 0.00 ? 20  LYS A O    12 
ATOM   6991  C  CB   . LYS A 1 20 ? 1.620   -2.064  5.214   1.00 0.00 ? 20  LYS A CB   12 
ATOM   6992  C  CG   . LYS A 1 20 ? 1.290   -1.340  6.508   1.00 0.00 ? 20  LYS A CG   12 
ATOM   6993  C  CD   . LYS A 1 20 ? 2.208   -1.773  7.638   1.00 0.00 ? 20  LYS A CD   12 
ATOM   6994  C  CE   . LYS A 1 20 ? 3.665   -1.477  7.317   1.00 0.00 ? 20  LYS A CE   12 
ATOM   6995  N  NZ   . LYS A 1 20 ? 4.532   -1.584  8.523   1.00 0.00 ? 20  LYS A NZ   12 
ATOM   6996  H  H    . LYS A 1 20 ? 2.993   -3.829  4.015   1.00 0.00 ? 20  LYS A H    12 
ATOM   6997  H  HA   . LYS A 1 20 ? 1.400   -3.919  6.259   1.00 0.00 ? 20  LYS A HA   12 
ATOM   6998  H  HB2  . LYS A 1 20 ? 2.674   -1.942  5.017   1.00 0.00 ? 20  LYS A HB2  12 
ATOM   6999  H  HB3  . LYS A 1 20 ? 1.057   -1.602  4.415   1.00 0.00 ? 20  LYS A HB3  12 
ATOM   7000  H  HG2  . LYS A 1 20 ? 1.402   -0.277  6.354   1.00 0.00 ? 20  LYS A HG2  12 
ATOM   7001  H  HG3  . LYS A 1 20 ? 0.268   -1.560  6.782   1.00 0.00 ? 20  LYS A HG3  12 
ATOM   7002  H  HD2  . LYS A 1 20 ? 1.935   -1.240  8.537   1.00 0.00 ? 20  LYS A HD2  12 
ATOM   7003  H  HD3  . LYS A 1 20 ? 2.092   -2.835  7.798   1.00 0.00 ? 20  LYS A HD3  12 
ATOM   7004  H  HE2  . LYS A 1 20 ? 4.007   -2.182  6.575   1.00 0.00 ? 20  LYS A HE2  12 
ATOM   7005  H  HE3  . LYS A 1 20 ? 3.737   -0.475  6.921   1.00 0.00 ? 20  LYS A HE3  12 
ATOM   7006  H  HZ1  . LYS A 1 20 ? 5.103   -0.722  8.631   1.00 0.00 ? 20  LYS A HZ1  12 
ATOM   7007  H  HZ2  . LYS A 1 20 ? 5.170   -2.401  8.433   1.00 0.00 ? 20  LYS A HZ2  12 
ATOM   7008  H  HZ3  . LYS A 1 20 ? 3.947   -1.708  9.374   1.00 0.00 ? 20  LYS A HZ3  12 
ATOM   7009  N  N    . ALA A 1 21 ? -0.900  -4.539  5.587   1.00 0.00 ? 21  ALA A N    12 
ATOM   7010  C  CA   . ALA A 1 21 ? -2.293  -4.828  5.269   1.00 0.00 ? 21  ALA A CA   12 
ATOM   7011  C  C    . ALA A 1 21 ? -3.222  -3.777  5.866   1.00 0.00 ? 21  ALA A C    12 
ATOM   7012  O  O    . ALA A 1 21 ? -3.249  -3.577  7.081   1.00 0.00 ? 21  ALA A O    12 
ATOM   7013  C  CB   . ALA A 1 21 ? -2.671  -6.215  5.768   1.00 0.00 ? 21  ALA A CB   12 
ATOM   7014  H  H    . ALA A 1 21 ? -0.510  -4.909  6.406   1.00 0.00 ? 21  ALA A H    12 
ATOM   7015  H  HA   . ALA A 1 21 ? -2.398  -4.819  4.194   1.00 0.00 ? 21  ALA A HA   12 
ATOM   7016  H  HB1  . ALA A 1 21 ? -1.940  -6.932  5.426   1.00 0.00 ? 21  ALA A HB1  12 
ATOM   7017  H  HB2  . ALA A 1 21 ? -2.696  -6.213  6.848   1.00 0.00 ? 21  ALA A HB2  12 
ATOM   7018  H  HB3  . ALA A 1 21 ? -3.645  -6.482  5.385   1.00 0.00 ? 21  ALA A HB3  12 
ATOM   7019  N  N    . PHE A 1 22 ? -3.981  -3.108  5.005   1.00 0.00 ? 22  PHE A N    12 
ATOM   7020  C  CA   . PHE A 1 22 ? -4.911  -2.075  5.448   1.00 0.00 ? 22  PHE A CA   12 
ATOM   7021  C  C    . PHE A 1 22 ? -6.356  -2.511  5.222   1.00 0.00 ? 22  PHE A C    12 
ATOM   7022  O  O    . PHE A 1 22 ? -6.614  -3.598  4.704   1.00 0.00 ? 22  PHE A O    12 
ATOM   7023  C  CB   . PHE A 1 22 ? -4.640  -0.764  4.708   1.00 0.00 ? 22  PHE A CB   12 
ATOM   7024  C  CG   . PHE A 1 22 ? -3.210  -0.312  4.791   1.00 0.00 ? 22  PHE A CG   12 
ATOM   7025  C  CD1  . PHE A 1 22 ? -2.277  -0.748  3.865   1.00 0.00 ? 22  PHE A CD1  12 
ATOM   7026  C  CD2  . PHE A 1 22 ? -2.800  0.548   5.797   1.00 0.00 ? 22  PHE A CD2  12 
ATOM   7027  C  CE1  . PHE A 1 22 ? -0.960  -0.334  3.939   1.00 0.00 ? 22  PHE A CE1  12 
ATOM   7028  C  CE2  . PHE A 1 22 ? -1.484  0.966   5.876   1.00 0.00 ? 22  PHE A CE2  12 
ATOM   7029  C  CZ   . PHE A 1 22 ? -0.563  0.523   4.947   1.00 0.00 ? 22  PHE A CZ   12 
ATOM   7030  H  H    . PHE A 1 22 ? -3.914  -3.313  4.049   1.00 0.00 ? 22  PHE A H    12 
ATOM   7031  H  HA   . PHE A 1 22 ? -4.755  -1.921  6.505   1.00 0.00 ? 22  PHE A HA   12 
ATOM   7032  H  HB2  . PHE A 1 22 ? -4.887  -0.891  3.664   1.00 0.00 ? 22  PHE A HB2  12 
ATOM   7033  H  HB3  . PHE A 1 22 ? -5.260  0.013   5.128   1.00 0.00 ? 22  PHE A HB3  12 
ATOM   7034  H  HD1  . PHE A 1 22 ? -2.586  -1.420  3.077   1.00 0.00 ? 22  PHE A HD1  12 
ATOM   7035  H  HD2  . PHE A 1 22 ? -3.518  0.895   6.525   1.00 0.00 ? 22  PHE A HD2  12 
ATOM   7036  H  HE1  . PHE A 1 22 ? -0.243  -0.683  3.211   1.00 0.00 ? 22  PHE A HE1  12 
ATOM   7037  H  HE2  . PHE A 1 22 ? -1.177  1.636   6.664   1.00 0.00 ? 22  PHE A HE2  12 
ATOM   7038  H  HZ   . PHE A 1 22 ? 0.465   0.849   5.006   1.00 0.00 ? 22  PHE A HZ   12 
ATOM   7039  N  N    . ARG A 1 23 ? -7.294  -1.656  5.616   1.00 0.00 ? 23  ARG A N    12 
ATOM   7040  C  CA   . ARG A 1 23 ? -8.712  -1.953  5.458   1.00 0.00 ? 23  ARG A CA   12 
ATOM   7041  C  C    . ARG A 1 23 ? -9.211  -1.510  4.086   1.00 0.00 ? 23  ARG A C    12 
ATOM   7042  O  O    . ARG A 1 23 ? -9.978  -2.219  3.435   1.00 0.00 ? 23  ARG A O    12 
ATOM   7043  C  CB   . ARG A 1 23 ? -9.524  -1.261  6.555   1.00 0.00 ? 23  ARG A CB   12 
ATOM   7044  C  CG   . ARG A 1 23 ? -9.147  -1.701  7.961   1.00 0.00 ? 23  ARG A CG   12 
ATOM   7045  C  CD   . ARG A 1 23 ? -9.558  -3.142  8.223   1.00 0.00 ? 23  ARG A CD   12 
ATOM   7046  N  NE   . ARG A 1 23 ? -9.613  -3.444  9.650   1.00 0.00 ? 23  ARG A NE   12 
ATOM   7047  C  CZ   . ARG A 1 23 ? -10.568 -2.999  10.460  1.00 0.00 ? 23  ARG A CZ   12 
ATOM   7048  N  NH1  . ARG A 1 23 ? -11.542 -2.235  9.984   1.00 0.00 ? 23  ARG A NH1  12 
ATOM   7049  N  NH2  . ARG A 1 23 ? -10.549 -3.317  11.748  1.00 0.00 ? 23  ARG A NH2  12 
ATOM   7050  H  H    . ARG A 1 23 ? -7.025  -0.805  6.022   1.00 0.00 ? 23  ARG A H    12 
ATOM   7051  H  HA   . ARG A 1 23 ? -8.840  -3.021  5.547   1.00 0.00 ? 23  ARG A HA   12 
ATOM   7052  H  HB2  . ARG A 1 23 ? -9.371  -0.195  6.483   1.00 0.00 ? 23  ARG A HB2  12 
ATOM   7053  H  HB3  . ARG A 1 23 ? -10.571 -1.478  6.402   1.00 0.00 ? 23  ARG A HB3  12 
ATOM   7054  H  HG2  . ARG A 1 23 ? -8.077  -1.617  8.080   1.00 0.00 ? 23  ARG A HG2  12 
ATOM   7055  H  HG3  . ARG A 1 23 ? -9.643  -1.059  8.674   1.00 0.00 ? 23  ARG A HG3  12 
ATOM   7056  H  HD2  . ARG A 1 23 ? -10.534 -3.308  7.791   1.00 0.00 ? 23  ARG A HD2  12 
ATOM   7057  H  HD3  . ARG A 1 23 ? -8.841  -3.797  7.752   1.00 0.00 ? 23  ARG A HD3  12 
ATOM   7058  H  HE   . ARG A 1 23 ? -8.903  -4.007  10.023  1.00 0.00 ? 23  ARG A HE   12 
ATOM   7059  H  HH11 . ARG A 1 23 ? -11.559 -1.994  9.014   1.00 0.00 ? 23  ARG A HH11 12 
ATOM   7060  H  HH12 . ARG A 1 23 ? -12.260 -1.902  10.596  1.00 0.00 ? 23  ARG A HH12 12 
ATOM   7061  H  HH21 . ARG A 1 23 ? -9.817  -3.893  12.110  1.00 0.00 ? 23  ARG A HH21 12 
ATOM   7062  H  HH22 . ARG A 1 23 ? -11.268 -2.981  12.356  1.00 0.00 ? 23  ARG A HH22 12 
ATOM   7063  N  N    . SER A 1 24 ? -8.771  -0.333  3.653   1.00 0.00 ? 24  SER A N    12 
ATOM   7064  C  CA   . SER A 1 24 ? -9.176  0.207   2.360   1.00 0.00 ? 24  SER A CA   12 
ATOM   7065  C  C    . SER A 1 24 ? -7.959  0.612   1.535   1.00 0.00 ? 24  SER A C    12 
ATOM   7066  O  O    . SER A 1 24 ? -6.839  0.665   2.044   1.00 0.00 ? 24  SER A O    12 
ATOM   7067  C  CB   . SER A 1 24 ? -10.100 1.411   2.553   1.00 0.00 ? 24  SER A CB   12 
ATOM   7068  O  OG   . SER A 1 24 ? -10.937 1.597   1.426   1.00 0.00 ? 24  SER A OG   12 
ATOM   7069  H  H    . SER A 1 24 ? -8.161  0.186   4.218   1.00 0.00 ? 24  SER A H    12 
ATOM   7070  H  HA   . SER A 1 24 ? -9.713  -0.567  1.832   1.00 0.00 ? 24  SER A HA   12 
ATOM   7071  H  HB2  . SER A 1 24 ? -10.718 1.252   3.424   1.00 0.00 ? 24  SER A HB2  12 
ATOM   7072  H  HB3  . SER A 1 24 ? -9.502  2.300   2.694   1.00 0.00 ? 24  SER A HB3  12 
ATOM   7073  H  HG   . SER A 1 24 ? -10.421 1.951   0.698   1.00 0.00 ? 24  SER A HG   12 
ATOM   7074  N  N    . LYS A 1 25 ? -8.186  0.897   0.257   1.00 0.00 ? 25  LYS A N    12 
ATOM   7075  C  CA   . LYS A 1 25 ? -7.110  1.299   -0.641  1.00 0.00 ? 25  LYS A CA   12 
ATOM   7076  C  C    . LYS A 1 25 ? -6.603  2.695   -0.292  1.00 0.00 ? 25  LYS A C    12 
ATOM   7077  O  O    . LYS A 1 25 ? -5.406  2.969   -0.375  1.00 0.00 ? 25  LYS A O    12 
ATOM   7078  C  CB   . LYS A 1 25 ? -7.592  1.268   -2.093  1.00 0.00 ? 25  LYS A CB   12 
ATOM   7079  C  CG   . LYS A 1 25 ? -6.502  0.907   -3.088  1.00 0.00 ? 25  LYS A CG   12 
ATOM   7080  C  CD   . LYS A 1 25 ? -5.691  2.127   -3.492  1.00 0.00 ? 25  LYS A CD   12 
ATOM   7081  C  CE   . LYS A 1 25 ? -6.454  3.003   -4.474  1.00 0.00 ? 25  LYS A CE   12 
ATOM   7082  N  NZ   . LYS A 1 25 ? -5.536  3.789   -5.345  1.00 0.00 ? 25  LYS A NZ   12 
ATOM   7083  H  H    . LYS A 1 25 ? -9.101  0.836   -0.090  1.00 0.00 ? 25  LYS A H    12 
ATOM   7084  H  HA   . LYS A 1 25 ? -6.300  0.595   -0.524  1.00 0.00 ? 25  LYS A HA   12 
ATOM   7085  H  HB2  . LYS A 1 25 ? -8.386  0.540   -2.181  1.00 0.00 ? 25  LYS A HB2  12 
ATOM   7086  H  HB3  . LYS A 1 25 ? -7.979  2.243   -2.352  1.00 0.00 ? 25  LYS A HB3  12 
ATOM   7087  H  HG2  . LYS A 1 25 ? -5.841  0.182   -2.637  1.00 0.00 ? 25  LYS A HG2  12 
ATOM   7088  H  HG3  . LYS A 1 25 ? -6.959  0.481   -3.970  1.00 0.00 ? 25  LYS A HG3  12 
ATOM   7089  H  HD2  . LYS A 1 25 ? -5.465  2.707   -2.610  1.00 0.00 ? 25  LYS A HD2  12 
ATOM   7090  H  HD3  . LYS A 1 25 ? -4.771  1.799   -3.955  1.00 0.00 ? 25  LYS A HD3  12 
ATOM   7091  H  HE2  . LYS A 1 25 ? -7.072  2.372   -5.094  1.00 0.00 ? 25  LYS A HE2  12 
ATOM   7092  H  HE3  . LYS A 1 25 ? -7.079  3.685   -3.917  1.00 0.00 ? 25  LYS A HE3  12 
ATOM   7093  H  HZ1  . LYS A 1 25 ? -4.572  3.771   -4.956  1.00 0.00 ? 25  LYS A HZ1  12 
ATOM   7094  H  HZ2  . LYS A 1 25 ? -5.857  4.776   -5.402  1.00 0.00 ? 25  LYS A HZ2  12 
ATOM   7095  H  HZ3  . LYS A 1 25 ? -5.521  3.385   -6.303  1.00 0.00 ? 25  LYS A HZ3  12 
ATOM   7096  N  N    . SER A 1 26 ? -7.522  3.572   0.100   1.00 0.00 ? 26  SER A N    12 
ATOM   7097  C  CA   . SER A 1 26 ? -7.167  4.940   0.459   1.00 0.00 ? 26  SER A CA   12 
ATOM   7098  C  C    . SER A 1 26 ? -6.127  4.957   1.575   1.00 0.00 ? 26  SER A C    12 
ATOM   7099  O  O    . SER A 1 26 ? -5.327  5.887   1.680   1.00 0.00 ? 26  SER A O    12 
ATOM   7100  C  CB   . SER A 1 26 ? -8.413  5.714   0.896   1.00 0.00 ? 26  SER A CB   12 
ATOM   7101  O  OG   . SER A 1 26 ? -8.145  7.102   0.987   1.00 0.00 ? 26  SER A OG   12 
ATOM   7102  H  H    . SER A 1 26 ? -8.460  3.293   0.146   1.00 0.00 ? 26  SER A H    12 
ATOM   7103  H  HA   . SER A 1 26 ? -6.747  5.414   -0.415  1.00 0.00 ? 26  SER A HA   12 
ATOM   7104  H  HB2  . SER A 1 26 ? -9.201  5.559   0.175   1.00 0.00 ? 26  SER A HB2  12 
ATOM   7105  H  HB3  . SER A 1 26 ? -8.734  5.357   1.863   1.00 0.00 ? 26  SER A HB3  12 
ATOM   7106  H  HG   . SER A 1 26 ? -8.897  7.597   0.652   1.00 0.00 ? 26  SER A HG   12 
ATOM   7107  N  N    . TYR A 1 27 ? -6.145  3.921   2.407   1.00 0.00 ? 27  TYR A N    12 
ATOM   7108  C  CA   . TYR A 1 27 ? -5.206  3.817   3.518   1.00 0.00 ? 27  TYR A CA   12 
ATOM   7109  C  C    . TYR A 1 27 ? -3.817  3.427   3.022   1.00 0.00 ? 27  TYR A C    12 
ATOM   7110  O  O    . TYR A 1 27 ? -2.806  3.928   3.514   1.00 0.00 ? 27  TYR A O    12 
ATOM   7111  C  CB   . TYR A 1 27 ? -5.703  2.791   4.538   1.00 0.00 ? 27  TYR A CB   12 
ATOM   7112  C  CG   . TYR A 1 27 ? -5.271  3.090   5.956   1.00 0.00 ? 27  TYR A CG   12 
ATOM   7113  C  CD1  . TYR A 1 27 ? -3.926  3.195   6.286   1.00 0.00 ? 27  TYR A CD1  12 
ATOM   7114  C  CD2  . TYR A 1 27 ? -6.209  3.265   6.966   1.00 0.00 ? 27  TYR A CD2  12 
ATOM   7115  C  CE1  . TYR A 1 27 ? -3.527  3.467   7.580   1.00 0.00 ? 27  TYR A CE1  12 
ATOM   7116  C  CE2  . TYR A 1 27 ? -5.819  3.539   8.263   1.00 0.00 ? 27  TYR A CE2  12 
ATOM   7117  C  CZ   . TYR A 1 27 ? -4.477  3.639   8.565   1.00 0.00 ? 27  TYR A CZ   12 
ATOM   7118  O  OH   . TYR A 1 27 ? -4.085  3.910   9.856   1.00 0.00 ? 27  TYR A OH   12 
ATOM   7119  H  H    . TYR A 1 27 ? -6.807  3.211   2.273   1.00 0.00 ? 27  TYR A H    12 
ATOM   7120  H  HA   . TYR A 1 27 ? -5.147  4.784   3.994   1.00 0.00 ? 27  TYR A HA   12 
ATOM   7121  H  HB2  . TYR A 1 27 ? -6.781  2.767   4.518   1.00 0.00 ? 27  TYR A HB2  12 
ATOM   7122  H  HB3  . TYR A 1 27 ? -5.320  1.816   4.273   1.00 0.00 ? 27  TYR A HB3  12 
ATOM   7123  H  HD1  . TYR A 1 27 ? -3.183  3.060   5.512   1.00 0.00 ? 27  TYR A HD1  12 
ATOM   7124  H  HD2  . TYR A 1 27 ? -7.260  3.186   6.726   1.00 0.00 ? 27  TYR A HD2  12 
ATOM   7125  H  HE1  . TYR A 1 27 ? -2.476  3.546   7.817   1.00 0.00 ? 27  TYR A HE1  12 
ATOM   7126  H  HE2  . TYR A 1 27 ? -6.563  3.673   9.034   1.00 0.00 ? 27  TYR A HE2  12 
ATOM   7127  H  HH   . TYR A 1 27 ? -3.940  4.854   9.954   1.00 0.00 ? 27  TYR A HH   12 
ATOM   7128  N  N    . LEU A 1 28 ? -3.777  2.528   2.044   1.00 0.00 ? 28  LEU A N    12 
ATOM   7129  C  CA   . LEU A 1 28 ? -2.513  2.070   1.479   1.00 0.00 ? 28  LEU A CA   12 
ATOM   7130  C  C    . LEU A 1 28 ? -1.841  3.178   0.674   1.00 0.00 ? 28  LEU A C    12 
ATOM   7131  O  O    . LEU A 1 28 ? -0.615  3.227   0.569   1.00 0.00 ? 28  LEU A O    12 
ATOM   7132  C  CB   . LEU A 1 28 ? -2.743  0.847   0.589   1.00 0.00 ? 28  LEU A CB   12 
ATOM   7133  C  CG   . LEU A 1 28 ? -1.612  0.499   -0.380  1.00 0.00 ? 28  LEU A CG   12 
ATOM   7134  C  CD1  . LEU A 1 28 ? -0.385  0.021   0.381   1.00 0.00 ? 28  LEU A CD1  12 
ATOM   7135  C  CD2  . LEU A 1 28 ? -2.069  -0.557  -1.376  1.00 0.00 ? 28  LEU A CD2  12 
ATOM   7136  H  H    . LEU A 1 28 ? -4.616  2.165   1.693   1.00 0.00 ? 28  LEU A H    12 
ATOM   7137  H  HA   . LEU A 1 28 ? -1.865  1.792   2.297   1.00 0.00 ? 28  LEU A HA   12 
ATOM   7138  H  HB2  . LEU A 1 28 ? -2.900  -0.005  1.233   1.00 0.00 ? 28  LEU A HB2  12 
ATOM   7139  H  HB3  . LEU A 1 28 ? -3.636  1.026   0.007   1.00 0.00 ? 28  LEU A HB3  12 
ATOM   7140  H  HG   . LEU A 1 28 ? -1.336  1.385   -0.934  1.00 0.00 ? 28  LEU A HG   12 
ATOM   7141  H  HD11 . LEU A 1 28 ? -0.494  -1.026  0.618   1.00 0.00 ? 28  LEU A HD11 12 
ATOM   7142  H  HD12 . LEU A 1 28 ? -0.284  0.589   1.294   1.00 0.00 ? 28  LEU A HD12 12 
ATOM   7143  H  HD13 . LEU A 1 28 ? 0.494   0.163   -0.230  1.00 0.00 ? 28  LEU A HD13 12 
ATOM   7144  H  HD21 . LEU A 1 28 ? -1.291  -1.295  -1.500  1.00 0.00 ? 28  LEU A HD21 12 
ATOM   7145  H  HD22 . LEU A 1 28 ? -2.277  -0.088  -2.327  1.00 0.00 ? 28  LEU A HD22 12 
ATOM   7146  H  HD23 . LEU A 1 28 ? -2.965  -1.036  -1.007  1.00 0.00 ? 28  LEU A HD23 12 
ATOM   7147  N  N    . ILE A 1 29 ? -2.652  4.067   0.111   1.00 0.00 ? 29  ILE A N    12 
ATOM   7148  C  CA   . ILE A 1 29 ? -2.136  5.177   -0.681  1.00 0.00 ? 29  ILE A CA   12 
ATOM   7149  C  C    . ILE A 1 29 ? -1.404  6.186   0.198   1.00 0.00 ? 29  ILE A C    12 
ATOM   7150  O  O    . ILE A 1 29 ? -0.368  6.725   -0.190  1.00 0.00 ? 29  ILE A O    12 
ATOM   7151  C  CB   . ILE A 1 29 ? -3.265  5.899   -1.441  1.00 0.00 ? 29  ILE A CB   12 
ATOM   7152  C  CG1  . ILE A 1 29 ? -4.029  4.909   -2.322  1.00 0.00 ? 29  ILE A CG1  12 
ATOM   7153  C  CG2  . ILE A 1 29 ? -2.696  7.034   -2.279  1.00 0.00 ? 29  ILE A CG2  12 
ATOM   7154  C  CD1  . ILE A 1 29 ? -5.445  5.344   -2.631  1.00 0.00 ? 29  ILE A CD1  12 
ATOM   7155  H  H    . ILE A 1 29 ? -3.620  3.975   0.231   1.00 0.00 ? 29  ILE A H    12 
ATOM   7156  H  HA   . ILE A 1 29 ? -1.441  4.775   -1.404  1.00 0.00 ? 29  ILE A HA   12 
ATOM   7157  H  HB   . ILE A 1 29 ? -3.943  6.323   -0.716  1.00 0.00 ? 29  ILE A HB   12 
ATOM   7158  H  HG12 . ILE A 1 29 ? -3.507  4.793   -3.259  1.00 0.00 ? 29  ILE A HG12 12 
ATOM   7159  H  HG13 . ILE A 1 29 ? -4.077  3.954   -1.820  1.00 0.00 ? 29  ILE A HG13 12 
ATOM   7160  H  HG21 . ILE A 1 29 ? -3.031  7.980   -1.878  1.00 0.00 ? 29  ILE A HG21 12 
ATOM   7161  H  HG22 . ILE A 1 29 ? -1.618  6.995   -2.254  1.00 0.00 ? 29  ILE A HG22 12 
ATOM   7162  H  HG23 . ILE A 1 29 ? -3.037  6.935   -3.299  1.00 0.00 ? 29  ILE A HG23 12 
ATOM   7163  H  HD11 . ILE A 1 29 ? -5.671  6.248   -2.084  1.00 0.00 ? 29  ILE A HD11 12 
ATOM   7164  H  HD12 . ILE A 1 29 ? -5.541  5.532   -3.690  1.00 0.00 ? 29  ILE A HD12 12 
ATOM   7165  H  HD13 . ILE A 1 29 ? -6.133  4.566   -2.338  1.00 0.00 ? 29  ILE A HD13 12 
ATOM   7166  N  N    . ILE A 1 30 ? -1.950  6.434   1.384   1.00 0.00 ? 30  ILE A N    12 
ATOM   7167  C  CA   . ILE A 1 30 ? -1.348  7.376   2.319   1.00 0.00 ? 30  ILE A CA   12 
ATOM   7168  C  C    . ILE A 1 30 ? -0.092  6.791   2.956   1.00 0.00 ? 30  ILE A C    12 
ATOM   7169  O  O    . ILE A 1 30 ? 0.690   7.506   3.584   1.00 0.00 ? 30  ILE A O    12 
ATOM   7170  C  CB   . ILE A 1 30 ? -2.335  7.775   3.432   1.00 0.00 ? 30  ILE A CB   12 
ATOM   7171  C  CG1  . ILE A 1 30 ? -2.727  6.549   4.260   1.00 0.00 ? 30  ILE A CG1  12 
ATOM   7172  C  CG2  . ILE A 1 30 ? -3.570  8.432   2.833   1.00 0.00 ? 30  ILE A CG2  12 
ATOM   7173  C  CD1  . ILE A 1 30 ? -3.099  6.879   5.688   1.00 0.00 ? 30  ILE A CD1  12 
ATOM   7174  H  H    . ILE A 1 30 ? -2.777  5.973   1.636   1.00 0.00 ? 30  ILE A H    12 
ATOM   7175  H  HA   . ILE A 1 30 ? -1.078  8.266   1.769   1.00 0.00 ? 30  ILE A HA   12 
ATOM   7176  H  HB   . ILE A 1 30 ? -1.850  8.494   4.073   1.00 0.00 ? 30  ILE A HB   12 
ATOM   7177  H  HG12 . ILE A 1 30 ? -3.574  6.067   3.800   1.00 0.00 ? 30  ILE A HG12 12 
ATOM   7178  H  HG13 . ILE A 1 30 ? -1.895  5.860   4.284   1.00 0.00 ? 30  ILE A HG13 12 
ATOM   7179  H  HG21 . ILE A 1 30 ? -4.394  8.349   3.526   1.00 0.00 ? 30  ILE A HG21 12 
ATOM   7180  H  HG22 . ILE A 1 30 ? -3.365  9.475   2.642   1.00 0.00 ? 30  ILE A HG22 12 
ATOM   7181  H  HG23 . ILE A 1 30 ? -3.827  7.940   1.907   1.00 0.00 ? 30  ILE A HG23 12 
ATOM   7182  H  HD11 . ILE A 1 30 ? -2.252  6.692   6.333   1.00 0.00 ? 30  ILE A HD11 12 
ATOM   7183  H  HD12 . ILE A 1 30 ? -3.379  7.920   5.757   1.00 0.00 ? 30  ILE A HD12 12 
ATOM   7184  H  HD13 . ILE A 1 30 ? -3.929  6.261   5.997   1.00 0.00 ? 30  ILE A HD13 12 
ATOM   7185  N  N    . HIS A 1 31 ? 0.097   5.486   2.788   1.00 0.00 ? 31  HIS A N    12 
ATOM   7186  C  CA   . HIS A 1 31 ? 1.260   4.804   3.344   1.00 0.00 ? 31  HIS A CA   12 
ATOM   7187  C  C    . HIS A 1 31 ? 2.386   4.723   2.317   1.00 0.00 ? 31  HIS A C    12 
ATOM   7188  O  O    . HIS A 1 31 ? 3.548   4.982   2.631   1.00 0.00 ? 31  HIS A O    12 
ATOM   7189  C  CB   . HIS A 1 31 ? 0.879   3.399   3.812   1.00 0.00 ? 31  HIS A CB   12 
ATOM   7190  C  CG   . HIS A 1 31 ? 2.018   2.427   3.779   1.00 0.00 ? 31  HIS A CG   12 
ATOM   7191  N  ND1  . HIS A 1 31 ? 2.599   1.909   4.917   1.00 0.00 ? 31  HIS A ND1  12 
ATOM   7192  C  CD2  . HIS A 1 31 ? 2.682   1.877   2.736   1.00 0.00 ? 31  HIS A CD2  12 
ATOM   7193  C  CE1  . HIS A 1 31 ? 3.572   1.084   4.576   1.00 0.00 ? 31  HIS A CE1  12 
ATOM   7194  N  NE2  . HIS A 1 31 ? 3.643   1.046   3.257   1.00 0.00 ? 31  HIS A NE2  12 
ATOM   7195  H  H    . HIS A 1 31 ? -0.561  4.970   2.278   1.00 0.00 ? 31  HIS A H    12 
ATOM   7196  H  HA   . HIS A 1 31 ? 1.605   5.375   4.193   1.00 0.00 ? 31  HIS A HA   12 
ATOM   7197  H  HB2  . HIS A 1 31 ? 0.517   3.451   4.828   1.00 0.00 ? 31  HIS A HB2  12 
ATOM   7198  H  HB3  . HIS A 1 31 ? 0.095   3.015   3.175   1.00 0.00 ? 31  HIS A HB3  12 
ATOM   7199  H  HD1  . HIS A 1 31 ? 2.338   2.117   5.838   1.00 0.00 ? 31  HIS A HD1  12 
ATOM   7200  H  HD2  . HIS A 1 31 ? 2.492   2.057   1.687   1.00 0.00 ? 31  HIS A HD2  12 
ATOM   7201  H  HE1  . HIS A 1 31 ? 4.203   0.533   5.257   1.00 0.00 ? 31  HIS A HE1  12 
ATOM   7202  N  N    . THR A 1 32 ? 2.033   4.360   1.088   1.00 0.00 ? 32  THR A N    12 
ATOM   7203  C  CA   . THR A 1 32 ? 3.013   4.243   0.015   1.00 0.00 ? 32  THR A CA   12 
ATOM   7204  C  C    . THR A 1 32 ? 3.878   5.495   -0.079  1.00 0.00 ? 32  THR A C    12 
ATOM   7205  O  O    . THR A 1 32 ? 4.965   5.468   -0.657  1.00 0.00 ? 32  THR A O    12 
ATOM   7206  C  CB   . THR A 1 32 ? 2.331   4.002   -1.345  1.00 0.00 ? 32  THR A CB   12 
ATOM   7207  O  OG1  . THR A 1 32 ? 3.310   3.650   -2.329  1.00 0.00 ? 32  THR A OG1  12 
ATOM   7208  C  CG2  . THR A 1 32 ? 1.572   5.240   -1.798  1.00 0.00 ? 32  THR A CG2  12 
ATOM   7209  H  H    . THR A 1 32 ? 1.091   4.167   0.899   1.00 0.00 ? 32  THR A H    12 
ATOM   7210  H  HA   . THR A 1 32 ? 3.646   3.395   0.232   1.00 0.00 ? 32  THR A HA   12 
ATOM   7211  H  HB   . THR A 1 32 ? 1.629   3.187   -1.239  1.00 0.00 ? 32  THR A HB   12 
ATOM   7212  H  HG1  . THR A 1 32 ? 3.942   3.036   -1.946  1.00 0.00 ? 32  THR A HG1  12 
ATOM   7213  H  HG21 . THR A 1 32 ? 1.946   6.104   -1.269  1.00 0.00 ? 32  THR A HG21 12 
ATOM   7214  H  HG22 . THR A 1 32 ? 0.521   5.116   -1.586  1.00 0.00 ? 32  THR A HG22 12 
ATOM   7215  H  HG23 . THR A 1 32 ? 1.712   5.380   -2.859  1.00 0.00 ? 32  THR A HG23 12 
ATOM   7216  N  N    . ARG A 1 33 ? 3.390   6.590   0.494   1.00 0.00 ? 33  ARG A N    12 
ATOM   7217  C  CA   . ARG A 1 33 ? 4.119   7.853   0.474   1.00 0.00 ? 33  ARG A CA   12 
ATOM   7218  C  C    . ARG A 1 33 ? 5.163   7.894   1.586   1.00 0.00 ? 33  ARG A C    12 
ATOM   7219  O  O    . ARG A 1 33 ? 6.205   8.537   1.451   1.00 0.00 ? 33  ARG A O    12 
ATOM   7220  C  CB   . ARG A 1 33 ? 3.151   9.028   0.624   1.00 0.00 ? 33  ARG A CB   12 
ATOM   7221  C  CG   . ARG A 1 33 ? 2.091   8.811   1.692   1.00 0.00 ? 33  ARG A CG   12 
ATOM   7222  C  CD   . ARG A 1 33 ? 1.634   10.129  2.299   1.00 0.00 ? 33  ARG A CD   12 
ATOM   7223  N  NE   . ARG A 1 33 ? 1.169   11.068  1.281   1.00 0.00 ? 33  ARG A NE   12 
ATOM   7224  C  CZ   . ARG A 1 33 ? 0.387   12.108  1.544   1.00 0.00 ? 33  ARG A CZ   12 
ATOM   7225  N  NH1  . ARG A 1 33 ? -0.016  12.342  2.786   1.00 0.00 ? 33  ARG A NH1  12 
ATOM   7226  N  NH2  . ARG A 1 33 ? 0.005   12.918  0.565   1.00 0.00 ? 33  ARG A NH2  12 
ATOM   7227  H  H    . ARG A 1 33 ? 2.518   6.549   0.939   1.00 0.00 ? 33  ARG A H    12 
ATOM   7228  H  HA   . ARG A 1 33 ? 4.621   7.931   -0.479  1.00 0.00 ? 33  ARG A HA   12 
ATOM   7229  H  HB2  . ARG A 1 33 ? 3.714   9.912   0.882   1.00 0.00 ? 33  ARG A HB2  12 
ATOM   7230  H  HB3  . ARG A 1 33 ? 2.652   9.190   -0.320  1.00 0.00 ? 33  ARG A HB3  12 
ATOM   7231  H  HG2  . ARG A 1 33 ? 1.239   8.319   1.246   1.00 0.00 ? 33  ARG A HG2  12 
ATOM   7232  H  HG3  . ARG A 1 33 ? 2.502   8.188   2.472   1.00 0.00 ? 33  ARG A HG3  12 
ATOM   7233  H  HD2  . ARG A 1 33 ? 0.827   9.931   2.988   1.00 0.00 ? 33  ARG A HD2  12 
ATOM   7234  H  HD3  . ARG A 1 33 ? 2.463   10.570  2.831   1.00 0.00 ? 33  ARG A HD3  12 
ATOM   7235  H  HE   . ARG A 1 33 ? 1.455   10.914  0.357   1.00 0.00 ? 33  ARG A HE   12 
ATOM   7236  H  HH11 . ARG A 1 33 ? 0.270   11.734  3.526   1.00 0.00 ? 33  ARG A HH11 12 
ATOM   7237  H  HH12 . ARG A 1 33 ? -0.605  13.127  2.981   1.00 0.00 ? 33  ARG A HH12 12 
ATOM   7238  H  HH21 . ARG A 1 33 ? 0.307   12.745  -0.372  1.00 0.00 ? 33  ARG A HH21 12 
ATOM   7239  H  HH22 . ARG A 1 33 ? -0.584  13.700  0.764   1.00 0.00 ? 33  ARG A HH22 12 
ATOM   7240  N  N    . THR A 1 34 ? 4.877   7.205   2.686   1.00 0.00 ? 34  THR A N    12 
ATOM   7241  C  CA   . THR A 1 34 ? 5.789   7.164   3.822   1.00 0.00 ? 34  THR A CA   12 
ATOM   7242  C  C    . THR A 1 34 ? 7.079   6.433   3.465   1.00 0.00 ? 34  THR A C    12 
ATOM   7243  O  O    . THR A 1 34 ? 8.127   6.675   4.064   1.00 0.00 ? 34  THR A O    12 
ATOM   7244  C  CB   . THR A 1 34 ? 5.142   6.476   5.038   1.00 0.00 ? 34  THR A CB   12 
ATOM   7245  O  OG1  . THR A 1 34 ? 4.860   5.106   4.733   1.00 0.00 ? 34  THR A OG1  12 
ATOM   7246  C  CG2  . THR A 1 34 ? 3.858   7.186   5.442   1.00 0.00 ? 34  THR A CG2  12 
ATOM   7247  H  H    . THR A 1 34 ? 4.031   6.712   2.733   1.00 0.00 ? 34  THR A H    12 
ATOM   7248  H  HA   . THR A 1 34 ? 6.027   8.182   4.095   1.00 0.00 ? 34  THR A HA   12 
ATOM   7249  H  HB   . THR A 1 34 ? 5.834   6.518   5.867   1.00 0.00 ? 34  THR A HB   12 
ATOM   7250  H  HG1  . THR A 1 34 ? 5.639   4.572   4.908   1.00 0.00 ? 34  THR A HG1  12 
ATOM   7251  H  HG21 . THR A 1 34 ? 3.898   7.432   6.492   1.00 0.00 ? 34  THR A HG21 12 
ATOM   7252  H  HG22 . THR A 1 34 ? 3.015   6.538   5.256   1.00 0.00 ? 34  THR A HG22 12 
ATOM   7253  H  HG23 . THR A 1 34 ? 3.750   8.092   4.863   1.00 0.00 ? 34  THR A HG23 12 
ATOM   7254  N  N    . HIS A 1 35 ? 6.995   5.538   2.486   1.00 0.00 ? 35  HIS A N    12 
ATOM   7255  C  CA   . HIS A 1 35 ? 8.157   4.772   2.049   1.00 0.00 ? 35  HIS A CA   12 
ATOM   7256  C  C    . HIS A 1 35 ? 9.297   5.700   1.642   1.00 0.00 ? 35  HIS A C    12 
ATOM   7257  O  O    . HIS A 1 35 ? 10.472  5.349   1.763   1.00 0.00 ? 35  HIS A O    12 
ATOM   7258  C  CB   . HIS A 1 35 ? 7.783   3.861   0.879   1.00 0.00 ? 35  HIS A CB   12 
ATOM   7259  C  CG   . HIS A 1 35 ? 7.309   2.506   1.304   1.00 0.00 ? 35  HIS A CG   12 
ATOM   7260  N  ND1  . HIS A 1 35 ? 8.092   1.624   2.019   1.00 0.00 ? 35  HIS A ND1  12 
ATOM   7261  C  CD2  . HIS A 1 35 ? 6.122   1.882   1.112   1.00 0.00 ? 35  HIS A CD2  12 
ATOM   7262  C  CE1  . HIS A 1 35 ? 7.409   0.517   2.246   1.00 0.00 ? 35  HIS A CE1  12 
ATOM   7263  N  NE2  . HIS A 1 35 ? 6.210   0.648   1.707   1.00 0.00 ? 35  HIS A NE2  12 
ATOM   7264  H  H    . HIS A 1 35 ? 6.132   5.390   2.047   1.00 0.00 ? 35  HIS A H    12 
ATOM   7265  H  HA   . HIS A 1 35 ? 8.483   4.163   2.878   1.00 0.00 ? 35  HIS A HA   12 
ATOM   7266  H  HB2  . HIS A 1 35 ? 6.992   4.325   0.309   1.00 0.00 ? 35  HIS A HB2  12 
ATOM   7267  H  HB3  . HIS A 1 35 ? 8.647   3.728   0.245   1.00 0.00 ? 35  HIS A HB3  12 
ATOM   7268  H  HD1  . HIS A 1 35 ? 9.012   1.785   2.313   1.00 0.00 ? 35  HIS A HD1  12 
ATOM   7269  H  HD2  . HIS A 1 35 ? 5.265   2.281   0.588   1.00 0.00 ? 35  HIS A HD2  12 
ATOM   7270  H  HE1  . HIS A 1 35 ? 7.768   -0.349  2.783   1.00 0.00 ? 35  HIS A HE1  12 
ATOM   7271  N  N    . THR A 1 36 ? 8.945   6.887   1.158   1.00 0.00 ? 36  THR A N    12 
ATOM   7272  C  CA   . THR A 1 36 ? 9.938   7.865   0.732   1.00 0.00 ? 36  THR A CA   12 
ATOM   7273  C  C    . THR A 1 36 ? 10.858  8.252   1.884   1.00 0.00 ? 36  THR A C    12 
ATOM   7274  O  O    . THR A 1 36 ? 12.081  8.225   1.751   1.00 0.00 ? 36  THR A O    12 
ATOM   7275  C  CB   . THR A 1 36 ? 9.271   9.136   0.172   1.00 0.00 ? 36  THR A CB   12 
ATOM   7276  O  OG1  . THR A 1 36 ? 8.170   8.780   -0.671  1.00 0.00 ? 36  THR A OG1  12 
ATOM   7277  C  CG2  . THR A 1 36 ? 10.271  9.969   -0.615  1.00 0.00 ? 36  THR A CG2  12 
ATOM   7278  H  H    . THR A 1 36 ? 7.993   7.109   1.086   1.00 0.00 ? 36  THR A H    12 
ATOM   7279  H  HA   . THR A 1 36 ? 10.529  7.418   -0.054  1.00 0.00 ? 36  THR A HA   12 
ATOM   7280  H  HB   . THR A 1 36 ? 8.905   9.726   1.000   1.00 0.00 ? 36  THR A HB   12 
ATOM   7281  H  HG1  . THR A 1 36 ? 8.050   9.456   -1.343  1.00 0.00 ? 36  THR A HG1  12 
ATOM   7282  H  HG21 . THR A 1 36 ? 10.122  9.806   -1.672  1.00 0.00 ? 36  THR A HG21 12 
ATOM   7283  H  HG22 . THR A 1 36 ? 11.275  9.678   -0.344  1.00 0.00 ? 36  THR A HG22 12 
ATOM   7284  H  HG23 . THR A 1 36 ? 10.125  11.015  -0.388  1.00 0.00 ? 36  THR A HG23 12 
ATOM   7285  N  N    . GLY A 1 37 ? 10.261  8.612   3.016   1.00 0.00 ? 37  GLY A N    12 
ATOM   7286  C  CA   . GLY A 1 37 ? 11.043  9.000   4.176   1.00 0.00 ? 37  GLY A CA   12 
ATOM   7287  C  C    . GLY A 1 37 ? 10.850  10.458  4.544   1.00 0.00 ? 37  GLY A C    12 
ATOM   7288  O  O    . GLY A 1 37 ? 11.814  11.220  4.609   1.00 0.00 ? 37  GLY A O    12 
ATOM   7289  H  H    . GLY A 1 37 ? 9.282   8.615   3.065   1.00 0.00 ? 37  GLY A H    12 
ATOM   7290  H  HA2  . GLY A 1 37 ? 10.752  8.386   5.015   1.00 0.00 ? 37  GLY A HA2  12 
ATOM   7291  H  HA3  . GLY A 1 37 ? 12.089  8.830   3.964   1.00 0.00 ? 37  GLY A HA3  12 
ATOM   7292  N  N    . GLU A 1 38 ? 9.602   10.846  4.784   1.00 0.00 ? 38  GLU A N    12 
ATOM   7293  C  CA   . GLU A 1 38 ? 9.287   12.223  5.146   1.00 0.00 ? 38  GLU A CA   12 
ATOM   7294  C  C    . GLU A 1 38 ? 10.073  12.655  6.379   1.00 0.00 ? 38  GLU A C    12 
ATOM   7295  O  O    . GLU A 1 38 ? 10.595  13.769  6.437   1.00 0.00 ? 38  GLU A O    12 
ATOM   7296  C  CB   . GLU A 1 38 ? 7.786   12.375  5.405   1.00 0.00 ? 38  GLU A CB   12 
ATOM   7297  C  CG   . GLU A 1 38 ? 7.285   11.551  6.579   1.00 0.00 ? 38  GLU A CG   12 
ATOM   7298  C  CD   . GLU A 1 38 ? 5.812   11.776  6.863   1.00 0.00 ? 38  GLU A CD   12 
ATOM   7299  O  OE1  . GLU A 1 38 ? 5.066   12.089  5.911   1.00 0.00 ? 38  GLU A OE1  12 
ATOM   7300  O  OE2  . GLU A 1 38 ? 5.406   11.640  8.036   1.00 0.00 ? 38  GLU A OE2  12 
ATOM   7301  H  H    . GLU A 1 38 ? 8.876   10.191  4.716   1.00 0.00 ? 38  GLU A H    12 
ATOM   7302  H  HA   . GLU A 1 38 ? 9.565   12.855  4.316   1.00 0.00 ? 38  GLU A HA   12 
ATOM   7303  H  HB2  . GLU A 1 38 ? 7.571   13.415  5.603   1.00 0.00 ? 38  GLU A HB2  12 
ATOM   7304  H  HB3  . GLU A 1 38 ? 7.248   12.067  4.520   1.00 0.00 ? 38  GLU A HB3  12 
ATOM   7305  H  HG2  . GLU A 1 38 ? 7.437   10.505  6.359   1.00 0.00 ? 38  GLU A HG2  12 
ATOM   7306  H  HG3  . GLU A 1 38 ? 7.851   11.819  7.458   1.00 0.00 ? 38  GLU A HG3  12 
ATOM   7307  N  N    . SER A 1 39 ? 10.153  11.767  7.365   1.00 0.00 ? 39  SER A N    12 
ATOM   7308  C  CA   . SER A 1 39 ? 10.872  12.057  8.600   1.00 0.00 ? 39  SER A CA   12 
ATOM   7309  C  C    . SER A 1 39 ? 12.362  11.767  8.442   1.00 0.00 ? 39  SER A C    12 
ATOM   7310  O  O    . SER A 1 39 ? 13.034  11.378  9.396   1.00 0.00 ? 39  SER A O    12 
ATOM   7311  C  CB   . SER A 1 39 ? 10.300  11.232  9.754   1.00 0.00 ? 39  SER A CB   12 
ATOM   7312  O  OG   . SER A 1 39 ? 10.972  11.518  10.968  1.00 0.00 ? 39  SER A OG   12 
ATOM   7313  H  H    . SER A 1 39 ? 9.716   10.896  7.259   1.00 0.00 ? 39  SER A H    12 
ATOM   7314  H  HA   . SER A 1 39 ? 10.743  13.106  8.820   1.00 0.00 ? 39  SER A HA   12 
ATOM   7315  H  HB2  . SER A 1 39 ? 9.252   11.463  9.873   1.00 0.00 ? 39  SER A HB2  12 
ATOM   7316  H  HB3  . SER A 1 39 ? 10.414  10.181  9.532   1.00 0.00 ? 39  SER A HB3  12 
ATOM   7317  H  HG   . SER A 1 39 ? 11.295  10.702  11.356  1.00 0.00 ? 39  SER A HG   12 
ATOM   7318  N  N    . GLY A 1 40 ? 12.871  11.961  7.229   1.00 0.00 ? 40  GLY A N    12 
ATOM   7319  C  CA   . GLY A 1 40 ? 14.277  11.716  6.967   1.00 0.00 ? 40  GLY A CA   12 
ATOM   7320  C  C    . GLY A 1 40 ? 14.681  10.285  7.262   1.00 0.00 ? 40  GLY A C    12 
ATOM   7321  O  O    . GLY A 1 40 ? 13.843  9.388   7.355   1.00 0.00 ? 40  GLY A O    12 
ATOM   7322  H  H    . GLY A 1 40 ? 12.287  12.273  6.506   1.00 0.00 ? 40  GLY A H    12 
ATOM   7323  H  HA2  . GLY A 1 40 ? 14.481  11.930  5.929   1.00 0.00 ? 40  GLY A HA2  12 
ATOM   7324  H  HA3  . GLY A 1 40 ? 14.867  12.378  7.584   1.00 0.00 ? 40  GLY A HA3  12 
ATOM   7325  N  N    . PRO A 1 41 ? 15.994  10.056  7.412   1.00 0.00 ? 41  PRO A N    12 
ATOM   7326  C  CA   . PRO A 1 41 ? 16.537  8.725   7.699   1.00 0.00 ? 41  PRO A CA   12 
ATOM   7327  C  C    . PRO A 1 41 ? 16.194  8.249   9.106   1.00 0.00 ? 41  PRO A C    12 
ATOM   7328  O  O    . PRO A 1 41 ? 16.617  7.173   9.529   1.00 0.00 ? 41  PRO A O    12 
ATOM   7329  C  CB   . PRO A 1 41 ? 18.049  8.920   7.555   1.00 0.00 ? 41  PRO A CB   12 
ATOM   7330  C  CG   . PRO A 1 41 ? 18.271  10.368  7.827   1.00 0.00 ? 41  PRO A CG   12 
ATOM   7331  C  CD   . PRO A 1 41 ? 17.049  11.078  7.314   1.00 0.00 ? 41  PRO A CD   12 
ATOM   7332  H  HA   . PRO A 1 41 ? 16.197  7.994   6.980   1.00 0.00 ? 41  PRO A HA   12 
ATOM   7333  H  HB2  . PRO A 1 41 ? 18.565  8.298   8.273   1.00 0.00 ? 41  PRO A HB2  12 
ATOM   7334  H  HB3  . PRO A 1 41 ? 18.356  8.655   6.554   1.00 0.00 ? 41  PRO A HB3  12 
ATOM   7335  H  HG2  . PRO A 1 41 ? 18.381  10.529  8.888   1.00 0.00 ? 41  PRO A HG2  12 
ATOM   7336  H  HG3  . PRO A 1 41 ? 19.151  10.709  7.301   1.00 0.00 ? 41  PRO A HG3  12 
ATOM   7337  H  HD2  . PRO A 1 41 ? 16.819  11.930  7.936   1.00 0.00 ? 41  PRO A HD2  12 
ATOM   7338  H  HD3  . PRO A 1 41 ? 17.194  11.385  6.289   1.00 0.00 ? 41  PRO A HD3  12 
ATOM   7339  N  N    . SER A 1 42 ? 15.423  9.058   9.828   1.00 0.00 ? 42  SER A N    12 
ATOM   7340  C  CA   . SER A 1 42 ? 15.025  8.720   11.189  1.00 0.00 ? 42  SER A CA   12 
ATOM   7341  C  C    . SER A 1 42 ? 16.206  8.846   12.147  1.00 0.00 ? 42  SER A C    12 
ATOM   7342  O  O    . SER A 1 42 ? 16.360  8.045   13.069  1.00 0.00 ? 42  SER A O    12 
ATOM   7343  C  CB   . SER A 1 42 ? 14.461  7.299   11.241  1.00 0.00 ? 42  SER A CB   12 
ATOM   7344  O  OG   . SER A 1 42 ? 15.479  6.357   11.532  1.00 0.00 ? 42  SER A OG   12 
ATOM   7345  H  H    . SER A 1 42 ? 15.118  9.902   9.435   1.00 0.00 ? 42  SER A H    12 
ATOM   7346  H  HA   . SER A 1 42 ? 14.256  9.415   11.492  1.00 0.00 ? 42  SER A HA   12 
ATOM   7347  H  HB2  . SER A 1 42 ? 13.705  7.243   12.009  1.00 0.00 ? 42  SER A HB2  12 
ATOM   7348  H  HB3  . SER A 1 42 ? 14.023  7.054   10.285  1.00 0.00 ? 42  SER A HB3  12 
ATOM   7349  H  HG   . SER A 1 42 ? 16.325  6.695   11.230  1.00 0.00 ? 42  SER A HG   12 
ATOM   7350  N  N    . SER A 1 43 ? 17.038  9.858   11.922  1.00 0.00 ? 43  SER A N    12 
ATOM   7351  C  CA   . SER A 1 43 ? 18.208  10.088  12.762  1.00 0.00 ? 43  SER A CA   12 
ATOM   7352  C  C    . SER A 1 43 ? 18.080  11.405  13.521  1.00 0.00 ? 43  SER A C    12 
ATOM   7353  O  O    . SER A 1 43 ? 17.543  12.384  13.004  1.00 0.00 ? 43  SER A O    12 
ATOM   7354  C  CB   . SER A 1 43 ? 19.479  10.098  11.910  1.00 0.00 ? 43  SER A CB   12 
ATOM   7355  O  OG   . SER A 1 43 ? 19.439  11.135  10.946  1.00 0.00 ? 43  SER A OG   12 
ATOM   7356  H  H    . SER A 1 43 ? 16.862  10.463  11.171  1.00 0.00 ? 43  SER A H    12 
ATOM   7357  H  HA   . SER A 1 43 ? 18.268  9.279   13.474  1.00 0.00 ? 43  SER A HA   12 
ATOM   7358  H  HB2  . SER A 1 43 ? 20.335  10.250  12.549  1.00 0.00 ? 43  SER A HB2  12 
ATOM   7359  H  HB3  . SER A 1 43 ? 19.574  9.151   11.399  1.00 0.00 ? 43  SER A HB3  12 
ATOM   7360  H  HG   . SER A 1 43 ? 18.526  11.325  10.717  1.00 0.00 ? 43  SER A HG   12 
ATOM   7361  N  N    . GLY A 1 44 ? 18.580  11.421  14.753  1.00 0.00 ? 44  GLY A N    12 
ATOM   7362  C  CA   . GLY A 1 44 ? 18.513  12.622  15.565  1.00 0.00 ? 44  GLY A CA   12 
ATOM   7363  C  C    . GLY A 1 44 ? 19.134  12.431  16.935  1.00 0.00 ? 44  GLY A C    12 
ATOM   7364  O  O    . GLY A 1 44 ? 19.782  13.351  17.432  1.00 0.00 ? 44  GLY A O    12 
ATOM   7365  H  H    . GLY A 1 44 ? 18.998  10.611  15.114  1.00 0.00 ? 44  GLY A H    12 
ATOM   7366  H  HA2  . GLY A 1 44 ? 19.032  13.419  15.054  1.00 0.00 ? 44  GLY A HA2  12 
ATOM   7367  H  HA3  . GLY A 1 44 ? 17.477  12.902  15.689  1.00 0.00 ? 44  GLY A HA3  12 
HETATM 7368  ZN ZN   . ZN  B 2 .  ? 4.760   -0.500  2.379   1.00 0.00 ? 181 ZN  A ZN   12 
ATOM   7369  N  N    . GLY A 1 1  ? 1.647   -27.763 -14.365 1.00 0.00 ? 1   GLY A N    13 
ATOM   7370  C  CA   . GLY A 1 1  ? 1.326   -27.054 -15.590 1.00 0.00 ? 1   GLY A CA   13 
ATOM   7371  C  C    . GLY A 1 1  ? 0.851   -25.638 -15.332 1.00 0.00 ? 1   GLY A C    13 
ATOM   7372  O  O    . GLY A 1 1  ? -0.347  -25.361 -15.372 1.00 0.00 ? 1   GLY A O    13 
ATOM   7373  H  H1   . GLY A 1 1  ? 0.955   -27.900 -13.684 1.00 0.00 ? 1   GLY A H1   13 
ATOM   7374  H  HA2  . GLY A 1 1  ? 2.206   -27.020 -16.214 1.00 0.00 ? 1   GLY A HA2  13 
ATOM   7375  H  HA3  . GLY A 1 1  ? 0.548   -27.593 -16.111 1.00 0.00 ? 1   GLY A HA3  13 
ATOM   7376  N  N    . SER A 1 2  ? 1.793   -24.739 -15.064 1.00 0.00 ? 2   SER A N    13 
ATOM   7377  C  CA   . SER A 1 2  ? 1.464   -23.345 -14.793 1.00 0.00 ? 2   SER A CA   13 
ATOM   7378  C  C    . SER A 1 2  ? 1.794   -22.465 -15.995 1.00 0.00 ? 2   SER A C    13 
ATOM   7379  O  O    . SER A 1 2  ? 2.846   -21.827 -16.041 1.00 0.00 ? 2   SER A O    13 
ATOM   7380  C  CB   . SER A 1 2  ? 2.224   -22.850 -13.561 1.00 0.00 ? 2   SER A CB   13 
ATOM   7381  O  OG   . SER A 1 2  ? 1.757   -21.576 -13.151 1.00 0.00 ? 2   SER A OG   13 
ATOM   7382  H  H    . SER A 1 2  ? 2.732   -25.022 -15.046 1.00 0.00 ? 2   SER A H    13 
ATOM   7383  H  HA   . SER A 1 2  ? 0.404   -23.286 -14.599 1.00 0.00 ? 2   SER A HA   13 
ATOM   7384  H  HB2  . SER A 1 2  ? 2.084   -23.549 -12.750 1.00 0.00 ? 2   SER A HB2  13 
ATOM   7385  H  HB3  . SER A 1 2  ? 3.276   -22.776 -13.796 1.00 0.00 ? 2   SER A HB3  13 
ATOM   7386  H  HG   . SER A 1 2  ? 2.098   -20.904 -13.745 1.00 0.00 ? 2   SER A HG   13 
ATOM   7387  N  N    . SER A 1 3  ? 0.888   -22.437 -16.967 1.00 0.00 ? 3   SER A N    13 
ATOM   7388  C  CA   . SER A 1 3  ? 1.083   -21.639 -18.172 1.00 0.00 ? 3   SER A CA   13 
ATOM   7389  C  C    . SER A 1 3  ? 0.536   -20.228 -17.983 1.00 0.00 ? 3   SER A C    13 
ATOM   7390  O  O    . SER A 1 3  ? -0.079  -19.663 -18.886 1.00 0.00 ? 3   SER A O    13 
ATOM   7391  C  CB   . SER A 1 3  ? 0.401   -22.307 -19.367 1.00 0.00 ? 3   SER A CB   13 
ATOM   7392  O  OG   . SER A 1 3  ? 1.070   -23.501 -19.735 1.00 0.00 ? 3   SER A OG   13 
ATOM   7393  H  H    . SER A 1 3  ? 0.069   -22.968 -16.872 1.00 0.00 ? 3   SER A H    13 
ATOM   7394  H  HA   . SER A 1 3  ? 2.144   -21.579 -18.361 1.00 0.00 ? 3   SER A HA   13 
ATOM   7395  H  HB2  . SER A 1 3  ? -0.620  -22.546 -19.109 1.00 0.00 ? 3   SER A HB2  13 
ATOM   7396  H  HB3  . SER A 1 3  ? 0.410   -21.630 -20.208 1.00 0.00 ? 3   SER A HB3  13 
ATOM   7397  H  HG   . SER A 1 3  ? 1.057   -24.116 -18.998 1.00 0.00 ? 3   SER A HG   13 
ATOM   7398  N  N    . GLY A 1 4  ? 0.766   -19.664 -16.801 1.00 0.00 ? 4   GLY A N    13 
ATOM   7399  C  CA   . GLY A 1 4  ? 0.290   -18.323 -16.514 1.00 0.00 ? 4   GLY A CA   13 
ATOM   7400  C  C    . GLY A 1 4  ? -0.547  -18.263 -15.252 1.00 0.00 ? 4   GLY A C    13 
ATOM   7401  O  O    . GLY A 1 4  ? -1.632  -17.681 -15.245 1.00 0.00 ? 4   GLY A O    13 
ATOM   7402  H  H    . GLY A 1 4  ? 1.262   -20.162 -16.119 1.00 0.00 ? 4   GLY A H    13 
ATOM   7403  H  HA2  . GLY A 1 4  ? 1.140   -17.667 -16.401 1.00 0.00 ? 4   GLY A HA2  13 
ATOM   7404  H  HA3  . GLY A 1 4  ? -0.308  -17.980 -17.345 1.00 0.00 ? 4   GLY A HA3  13 
ATOM   7405  N  N    . SER A 1 5  ? -0.044  -18.867 -14.180 1.00 0.00 ? 5   SER A N    13 
ATOM   7406  C  CA   . SER A 1 5  ? -0.756  -18.885 -12.907 1.00 0.00 ? 5   SER A CA   13 
ATOM   7407  C  C    . SER A 1 5  ? 0.123   -18.339 -11.786 1.00 0.00 ? 5   SER A C    13 
ATOM   7408  O  O    . SER A 1 5  ? 0.779   -19.097 -11.072 1.00 0.00 ? 5   SER A O    13 
ATOM   7409  C  CB   . SER A 1 5  ? -1.207  -20.308 -12.571 1.00 0.00 ? 5   SER A CB   13 
ATOM   7410  O  OG   . SER A 1 5  ? -1.926  -20.883 -13.648 1.00 0.00 ? 5   SER A OG   13 
ATOM   7411  H  H    . SER A 1 5  ? 0.826   -19.314 -14.248 1.00 0.00 ? 5   SER A H    13 
ATOM   7412  H  HA   . SER A 1 5  ? -1.627  -18.254 -13.006 1.00 0.00 ? 5   SER A HA   13 
ATOM   7413  H  HB2  . SER A 1 5  ? -0.340  -20.918 -12.366 1.00 0.00 ? 5   SER A HB2  13 
ATOM   7414  H  HB3  . SER A 1 5  ? -1.844  -20.283 -11.699 1.00 0.00 ? 5   SER A HB3  13 
ATOM   7415  H  HG   . SER A 1 5  ? -2.668  -21.386 -13.305 1.00 0.00 ? 5   SER A HG   13 
ATOM   7416  N  N    . SER A 1 6  ? 0.130   -17.018 -11.638 1.00 0.00 ? 6   SER A N    13 
ATOM   7417  C  CA   . SER A 1 6  ? 0.931   -16.368 -10.607 1.00 0.00 ? 6   SER A CA   13 
ATOM   7418  C  C    . SER A 1 6  ? 0.342   -16.622 -9.222  1.00 0.00 ? 6   SER A C    13 
ATOM   7419  O  O    . SER A 1 6  ? -0.789  -16.233 -8.935  1.00 0.00 ? 6   SER A O    13 
ATOM   7420  C  CB   . SER A 1 6  ? 1.015   -14.864 -10.870 1.00 0.00 ? 6   SER A CB   13 
ATOM   7421  O  OG   . SER A 1 6  ? 1.967   -14.250 -10.018 1.00 0.00 ? 6   SER A OG   13 
ATOM   7422  H  H    . SER A 1 6  ? -0.414  -16.467 -12.239 1.00 0.00 ? 6   SER A H    13 
ATOM   7423  H  HA   . SER A 1 6  ? 1.925   -16.788 -10.645 1.00 0.00 ? 6   SER A HA   13 
ATOM   7424  H  HB2  . SER A 1 6  ? 1.307   -14.696 -11.895 1.00 0.00 ? 6   SER A HB2  13 
ATOM   7425  H  HB3  . SER A 1 6  ? 0.049   -14.415 -10.692 1.00 0.00 ? 6   SER A HB3  13 
ATOM   7426  H  HG   . SER A 1 6  ? 2.651   -13.834 -10.548 1.00 0.00 ? 6   SER A HG   13 
ATOM   7427  N  N    . GLY A 1 7  ? 1.120   -17.279 -8.367  1.00 0.00 ? 7   GLY A N    13 
ATOM   7428  C  CA   . GLY A 1 7  ? 0.660   -17.575 -7.023  1.00 0.00 ? 7   GLY A CA   13 
ATOM   7429  C  C    . GLY A 1 7  ? 1.138   -16.554 -6.009  1.00 0.00 ? 7   GLY A C    13 
ATOM   7430  O  O    . GLY A 1 7  ? 2.276   -16.615 -5.543  1.00 0.00 ? 7   GLY A O    13 
ATOM   7431  H  H    . GLY A 1 7  ? 2.013   -17.565 -8.651  1.00 0.00 ? 7   GLY A H    13 
ATOM   7432  H  HA2  . GLY A 1 7  ? -0.420  -17.592 -7.019  1.00 0.00 ? 7   GLY A HA2  13 
ATOM   7433  H  HA3  . GLY A 1 7  ? 1.027   -18.549 -6.735  1.00 0.00 ? 7   GLY A HA3  13 
ATOM   7434  N  N    . THR A 1 8  ? 0.266   -15.609 -5.667  1.00 0.00 ? 8   THR A N    13 
ATOM   7435  C  CA   . THR A 1 8  ? 0.606   -14.569 -4.704  1.00 0.00 ? 8   THR A CA   13 
ATOM   7436  C  C    . THR A 1 8  ? -0.299  -14.636 -3.480  1.00 0.00 ? 8   THR A C    13 
ATOM   7437  O  O    . THR A 1 8  ? 0.176   -14.713 -2.348  1.00 0.00 ? 8   THR A O    13 
ATOM   7438  C  CB   . THR A 1 8  ? 0.498   -13.166 -5.332  1.00 0.00 ? 8   THR A CB   13 
ATOM   7439  O  OG1  . THR A 1 8  ? 1.257   -13.113 -6.545  1.00 0.00 ? 8   THR A OG1  13 
ATOM   7440  C  CG2  . THR A 1 8  ? 0.999   -12.102 -4.367  1.00 0.00 ? 8   THR A CG2  13 
ATOM   7441  H  H    . THR A 1 8  ? -0.625  -15.614 -6.073  1.00 0.00 ? 8   THR A H    13 
ATOM   7442  H  HA   . THR A 1 8  ? 1.629   -14.724 -4.393  1.00 0.00 ? 8   THR A HA   13 
ATOM   7443  H  HB   . THR A 1 8  ? -0.540  -12.968 -5.556  1.00 0.00 ? 8   THR A HB   13 
ATOM   7444  H  HG1  . THR A 1 8  ? 0.663   -13.181 -7.297  1.00 0.00 ? 8   THR A HG1  13 
ATOM   7445  H  HG21 . THR A 1 8  ? 0.205   -11.828 -3.690  1.00 0.00 ? 8   THR A HG21 13 
ATOM   7446  H  HG22 . THR A 1 8  ? 1.314   -11.231 -4.924  1.00 0.00 ? 8   THR A HG22 13 
ATOM   7447  H  HG23 . THR A 1 8  ? 1.835   -12.491 -3.805  1.00 0.00 ? 8   THR A HG23 13 
ATOM   7448  N  N    . GLY A 1 9  ? -1.608  -14.608 -3.714  1.00 0.00 ? 9   GLY A N    13 
ATOM   7449  C  CA   . GLY A 1 9  ? -2.559  -14.667 -2.620  1.00 0.00 ? 9   GLY A CA   13 
ATOM   7450  C  C    . GLY A 1 9  ? -3.512  -13.488 -2.615  1.00 0.00 ? 9   GLY A C    13 
ATOM   7451  O  O    . GLY A 1 9  ? -3.429  -12.611 -3.475  1.00 0.00 ? 9   GLY A O    13 
ATOM   7452  H  H    . GLY A 1 9  ? -1.930  -14.546 -4.638  1.00 0.00 ? 9   GLY A H    13 
ATOM   7453  H  HA2  . GLY A 1 9  ? -3.132  -15.579 -2.704  1.00 0.00 ? 9   GLY A HA2  13 
ATOM   7454  H  HA3  . GLY A 1 9  ? -2.016  -14.679 -1.686  1.00 0.00 ? 9   GLY A HA3  13 
ATOM   7455  N  N    . MET A 1 10 ? -4.420  -13.467 -1.645  1.00 0.00 ? 10  MET A N    13 
ATOM   7456  C  CA   . MET A 1 10 ? -5.393  -12.386 -1.533  1.00 0.00 ? 10  MET A CA   13 
ATOM   7457  C  C    . MET A 1 10 ? -4.737  -11.117 -0.998  1.00 0.00 ? 10  MET A C    13 
ATOM   7458  O  O    . MET A 1 10 ? -4.629  -10.926 0.214   1.00 0.00 ? 10  MET A O    13 
ATOM   7459  C  CB   . MET A 1 10 ? -6.547  -12.803 -0.619  1.00 0.00 ? 10  MET A CB   13 
ATOM   7460  C  CG   . MET A 1 10 ? -7.459  -13.853 -1.232  1.00 0.00 ? 10  MET A CG   13 
ATOM   7461  S  SD   . MET A 1 10 ? -8.286  -14.865 0.010   1.00 0.00 ? 10  MET A SD   13 
ATOM   7462  C  CE   . MET A 1 10 ? -9.836  -13.984 0.187   1.00 0.00 ? 10  MET A CE   13 
ATOM   7463  H  H    . MET A 1 10 ? -4.437  -14.194 -0.989  1.00 0.00 ? 10  MET A H    13 
ATOM   7464  H  HA   . MET A 1 10 ? -5.782  -12.187 -2.521  1.00 0.00 ? 10  MET A HA   13 
ATOM   7465  H  HB2  . MET A 1 10 ? -6.139  -13.202 0.297   1.00 0.00 ? 10  MET A HB2  13 
ATOM   7466  H  HB3  . MET A 1 10 ? -7.142  -11.931 -0.390  1.00 0.00 ? 10  MET A HB3  13 
ATOM   7467  H  HG2  . MET A 1 10 ? -8.210  -13.356 -1.828  1.00 0.00 ? 10  MET A HG2  13 
ATOM   7468  H  HG3  . MET A 1 10 ? -6.868  -14.497 -1.866  1.00 0.00 ? 10  MET A HG3  13 
ATOM   7469  H  HE1  . MET A 1 10 ? -9.921  -13.606 1.196   1.00 0.00 ? 10  MET A HE1  13 
ATOM   7470  H  HE2  . MET A 1 10 ? -9.863  -13.159 -0.510  1.00 0.00 ? 10  MET A HE2  13 
ATOM   7471  H  HE3  . MET A 1 10 ? -10.656 -14.655 -0.017  1.00 0.00 ? 10  MET A HE3  13 
ATOM   7472  N  N    . LYS A 1 11 ? -4.300  -10.253 -1.907  1.00 0.00 ? 11  LYS A N    13 
ATOM   7473  C  CA   . LYS A 1 11 ? -3.656  -9.002  -1.527  1.00 0.00 ? 11  LYS A CA   13 
ATOM   7474  C  C    . LYS A 1 11 ? -4.484  -7.803  -1.980  1.00 0.00 ? 11  LYS A C    13 
ATOM   7475  O  O    . LYS A 1 11 ? -4.240  -7.212  -3.032  1.00 0.00 ? 11  LYS A O    13 
ATOM   7476  C  CB   . LYS A 1 11 ? -2.252  -8.923  -2.132  1.00 0.00 ? 11  LYS A CB   13 
ATOM   7477  C  CG   . LYS A 1 11 ? -1.167  -9.477  -1.225  1.00 0.00 ? 11  LYS A CG   13 
ATOM   7478  C  CD   . LYS A 1 11 ? 0.204   -9.382  -1.874  1.00 0.00 ? 11  LYS A CD   13 
ATOM   7479  C  CE   . LYS A 1 11 ? 1.300   -9.196  -0.836  1.00 0.00 ? 11  LYS A CE   13 
ATOM   7480  N  NZ   . LYS A 1 11 ? 1.853   -10.499 -0.374  1.00 0.00 ? 11  LYS A NZ   13 
ATOM   7481  H  H    . LYS A 1 11 ? -4.416  -10.462 -2.859  1.00 0.00 ? 11  LYS A H    13 
ATOM   7482  H  HA   . LYS A 1 11 ? -3.576  -8.983  -0.451  1.00 0.00 ? 11  LYS A HA   13 
ATOM   7483  H  HB2  . LYS A 1 11 ? -2.240  -9.481  -3.056  1.00 0.00 ? 11  LYS A HB2  13 
ATOM   7484  H  HB3  . LYS A 1 11 ? -2.022  -7.888  -2.344  1.00 0.00 ? 11  LYS A HB3  13 
ATOM   7485  H  HG2  . LYS A 1 11 ? -1.157  -8.912  -0.305  1.00 0.00 ? 11  LYS A HG2  13 
ATOM   7486  H  HG3  . LYS A 1 11 ? -1.384  -10.514 -1.012  1.00 0.00 ? 11  LYS A HG3  13 
ATOM   7487  H  HD2  . LYS A 1 11 ? 0.396   -10.291 -2.424  1.00 0.00 ? 11  LYS A HD2  13 
ATOM   7488  H  HD3  . LYS A 1 11 ? 0.214   -8.540  -2.552  1.00 0.00 ? 11  LYS A HD3  13 
ATOM   7489  H  HE2  . LYS A 1 11 ? 2.096   -8.612  -1.273  1.00 0.00 ? 11  LYS A HE2  13 
ATOM   7490  H  HE3  . LYS A 1 11 ? 0.889   -8.667  0.011   1.00 0.00 ? 11  LYS A HE3  13 
ATOM   7491  H  HZ1  . LYS A 1 11 ? 2.840   -10.381 -0.070  1.00 0.00 ? 11  LYS A HZ1  13 
ATOM   7492  H  HZ2  . LYS A 1 11 ? 1.820   -11.195 -1.146  1.00 0.00 ? 11  LYS A HZ2  13 
ATOM   7493  H  HZ3  . LYS A 1 11 ? 1.295   -10.859 0.427   1.00 0.00 ? 11  LYS A HZ3  13 
ATOM   7494  N  N    . PRO A 1 12 ? -5.486  -7.435  -1.168  1.00 0.00 ? 12  PRO A N    13 
ATOM   7495  C  CA   . PRO A 1 12 ? -6.369  -6.303  -1.464  1.00 0.00 ? 12  PRO A CA   13 
ATOM   7496  C  C    . PRO A 1 12 ? -5.651  -4.962  -1.348  1.00 0.00 ? 12  PRO A C    13 
ATOM   7497  O  O    . PRO A 1 12 ? -5.072  -4.472  -2.317  1.00 0.00 ? 12  PRO A O    13 
ATOM   7498  C  CB   . PRO A 1 12 ? -7.462  -6.418  -0.399  1.00 0.00 ? 12  PRO A CB   13 
ATOM   7499  C  CG   . PRO A 1 12 ? -6.817  -7.146  0.730   1.00 0.00 ? 12  PRO A CG   13 
ATOM   7500  C  CD   . PRO A 1 12 ? -5.834  -8.095  0.102   1.00 0.00 ? 12  PRO A CD   13 
ATOM   7501  H  HA   . PRO A 1 12 ? -6.810  -6.390  -2.446  1.00 0.00 ? 12  PRO A HA   13 
ATOM   7502  H  HB2  . PRO A 1 12 ? -7.783  -5.430  -0.100  1.00 0.00 ? 12  PRO A HB2  13 
ATOM   7503  H  HB3  . PRO A 1 12 ? -8.301  -6.970  -0.796  1.00 0.00 ? 12  PRO A HB3  13 
ATOM   7504  H  HG2  . PRO A 1 12 ? -6.305  -6.447  1.373   1.00 0.00 ? 12  PRO A HG2  13 
ATOM   7505  H  HG3  . PRO A 1 12 ? -7.563  -7.694  1.287   1.00 0.00 ? 12  PRO A HG3  13 
ATOM   7506  H  HD2  . PRO A 1 12 ? -4.963  -8.206  0.730   1.00 0.00 ? 12  PRO A HD2  13 
ATOM   7507  H  HD3  . PRO A 1 12 ? -6.297  -9.054  -0.077  1.00 0.00 ? 12  PRO A HD3  13 
ATOM   7508  N  N    . TYR A 1 13 ? -5.694  -4.375  -0.157  1.00 0.00 ? 13  TYR A N    13 
ATOM   7509  C  CA   . TYR A 1 13 ? -5.049  -3.090  0.085   1.00 0.00 ? 13  TYR A CA   13 
ATOM   7510  C  C    . TYR A 1 13 ? -3.725  -3.274  0.820   1.00 0.00 ? 13  TYR A C    13 
ATOM   7511  O  O    . TYR A 1 13 ? -3.189  -2.332  1.404   1.00 0.00 ? 13  TYR A O    13 
ATOM   7512  C  CB   . TYR A 1 13 ? -5.972  -2.177  0.894   1.00 0.00 ? 13  TYR A CB   13 
ATOM   7513  C  CG   . TYR A 1 13 ? -7.442  -2.443  0.662   1.00 0.00 ? 13  TYR A CG   13 
ATOM   7514  C  CD1  . TYR A 1 13 ? -8.072  -3.533  1.249   1.00 0.00 ? 13  TYR A CD1  13 
ATOM   7515  C  CD2  . TYR A 1 13 ? -8.202  -1.602  -0.143  1.00 0.00 ? 13  TYR A CD2  13 
ATOM   7516  C  CE1  . TYR A 1 13 ? -9.415  -3.780  1.039   1.00 0.00 ? 13  TYR A CE1  13 
ATOM   7517  C  CE2  . TYR A 1 13 ? -9.545  -1.841  -0.357  1.00 0.00 ? 13  TYR A CE2  13 
ATOM   7518  C  CZ   . TYR A 1 13 ? -10.147 -2.931  0.235   1.00 0.00 ? 13  TYR A CZ   13 
ATOM   7519  O  OH   . TYR A 1 13 ? -11.486 -3.173  0.025   1.00 0.00 ? 13  TYR A OH   13 
ATOM   7520  H  H    . TYR A 1 13 ? -6.172  -4.815  0.577   1.00 0.00 ? 13  TYR A H    13 
ATOM   7521  H  HA   . TYR A 1 13 ? -4.855  -2.631  -0.874  1.00 0.00 ? 13  TYR A HA   13 
ATOM   7522  H  HB2  . TYR A 1 13 ? -5.772  -2.315  1.945   1.00 0.00 ? 13  TYR A HB2  13 
ATOM   7523  H  HB3  . TYR A 1 13 ? -5.774  -1.149  0.627   1.00 0.00 ? 13  TYR A HB3  13 
ATOM   7524  H  HD1  . TYR A 1 13 ? -7.496  -4.196  1.878   1.00 0.00 ? 13  TYR A HD1  13 
ATOM   7525  H  HD2  . TYR A 1 13 ? -7.727  -0.749  -0.606  1.00 0.00 ? 13  TYR A HD2  13 
ATOM   7526  H  HE1  . TYR A 1 13 ? -9.887  -4.634  1.503   1.00 0.00 ? 13  TYR A HE1  13 
ATOM   7527  H  HE2  . TYR A 1 13 ? -10.119 -1.176  -0.986  1.00 0.00 ? 13  TYR A HE2  13 
ATOM   7528  H  HH   . TYR A 1 13 ? -11.819 -3.751  0.716   1.00 0.00 ? 13  TYR A HH   13 
ATOM   7529  N  N    . VAL A 1 14 ? -3.202  -4.496  0.786   1.00 0.00 ? 14  VAL A N    13 
ATOM   7530  C  CA   . VAL A 1 14 ? -1.940  -4.806  1.447   1.00 0.00 ? 14  VAL A CA   13 
ATOM   7531  C  C    . VAL A 1 14 ? -0.757  -4.266  0.652   1.00 0.00 ? 14  VAL A C    13 
ATOM   7532  O  O    . VAL A 1 14 ? -0.689  -4.425  -0.567  1.00 0.00 ? 14  VAL A O    13 
ATOM   7533  C  CB   . VAL A 1 14 ? -1.766  -6.324  1.640   1.00 0.00 ? 14  VAL A CB   13 
ATOM   7534  C  CG1  . VAL A 1 14 ? -0.430  -6.628  2.301   1.00 0.00 ? 14  VAL A CG1  13 
ATOM   7535  C  CG2  . VAL A 1 14 ? -2.916  -6.893  2.456   1.00 0.00 ? 14  VAL A CG2  13 
ATOM   7536  H  H    . VAL A 1 14 ? -3.676  -5.206  0.304   1.00 0.00 ? 14  VAL A H    13 
ATOM   7537  H  HA   . VAL A 1 14 ? -1.950  -4.339  2.421   1.00 0.00 ? 14  VAL A HA   13 
ATOM   7538  H  HB   . VAL A 1 14 ? -1.775  -6.793  0.667   1.00 0.00 ? 14  VAL A HB   13 
ATOM   7539  H  HG11 . VAL A 1 14 ? -0.588  -6.846  3.347   1.00 0.00 ? 14  VAL A HG11 13 
ATOM   7540  H  HG12 . VAL A 1 14 ? 0.025   -7.481  1.819   1.00 0.00 ? 14  VAL A HG12 13 
ATOM   7541  H  HG13 . VAL A 1 14 ? 0.221   -5.772  2.208   1.00 0.00 ? 14  VAL A HG13 13 
ATOM   7542  H  HG21 . VAL A 1 14 ? -3.791  -6.985  1.830   1.00 0.00 ? 14  VAL A HG21 13 
ATOM   7543  H  HG22 . VAL A 1 14 ? -2.641  -7.865  2.836   1.00 0.00 ? 14  VAL A HG22 13 
ATOM   7544  H  HG23 . VAL A 1 14 ? -3.133  -6.232  3.283   1.00 0.00 ? 14  VAL A HG23 13 
ATOM   7545  N  N    . CYS A 1 15 ? 0.176   -3.627  1.350   1.00 0.00 ? 15  CYS A N    13 
ATOM   7546  C  CA   . CYS A 1 15 ? 1.358   -3.063  0.711   1.00 0.00 ? 15  CYS A CA   13 
ATOM   7547  C  C    . CYS A 1 15 ? 2.193   -4.156  0.050   1.00 0.00 ? 15  CYS A C    13 
ATOM   7548  O  O    . CYS A 1 15 ? 2.653   -5.086  0.712   1.00 0.00 ? 15  CYS A O    13 
ATOM   7549  C  CB   . CYS A 1 15 ? 2.207   -2.307  1.736   1.00 0.00 ? 15  CYS A CB   13 
ATOM   7550  S  SG   . CYS A 1 15 ? 3.145   -0.910  1.039   1.00 0.00 ? 15  CYS A SG   13 
ATOM   7551  H  H    . CYS A 1 15 ? 0.066   -3.532  2.320   1.00 0.00 ? 15  CYS A H    13 
ATOM   7552  H  HA   . CYS A 1 15 ? 1.027   -2.372  -0.049  1.00 0.00 ? 15  CYS A HA   13 
ATOM   7553  H  HB2  . CYS A 1 15 ? 1.560   -1.915  2.507   1.00 0.00 ? 15  CYS A HB2  13 
ATOM   7554  H  HB3  . CYS A 1 15 ? 2.915   -2.991  2.179   1.00 0.00 ? 15  CYS A HB3  13 
ATOM   7555  N  N    . ASN A 1 16 ? 2.385   -4.036  -1.260  1.00 0.00 ? 16  ASN A N    13 
ATOM   7556  C  CA   . ASN A 1 16 ? 3.165   -5.014  -2.010  1.00 0.00 ? 16  ASN A CA   13 
ATOM   7557  C  C    . ASN A 1 16 ? 4.655   -4.696  -1.934  1.00 0.00 ? 16  ASN A C    13 
ATOM   7558  O  O    . ASN A 1 16 ? 5.413   -5.004  -2.854  1.00 0.00 ? 16  ASN A O    13 
ATOM   7559  C  CB   . ASN A 1 16 ? 2.712   -5.045  -3.471  1.00 0.00 ? 16  ASN A CB   13 
ATOM   7560  C  CG   . ASN A 1 16 ? 1.284   -5.532  -3.624  1.00 0.00 ? 16  ASN A CG   13 
ATOM   7561  O  OD1  . ASN A 1 16 ? 0.406   -5.171  -2.841  1.00 0.00 ? 16  ASN A OD1  13 
ATOM   7562  N  ND2  . ASN A 1 16 ? 1.046   -6.357  -4.637  1.00 0.00 ? 16  ASN A ND2  13 
ATOM   7563  H  H    . ASN A 1 16 ? 1.994   -3.273  -1.733  1.00 0.00 ? 16  ASN A H    13 
ATOM   7564  H  HA   . ASN A 1 16 ? 2.993   -5.984  -1.569  1.00 0.00 ? 16  ASN A HA   13 
ATOM   7565  H  HB2  . ASN A 1 16 ? 2.778   -4.048  -3.883  1.00 0.00 ? 16  ASN A HB2  13 
ATOM   7566  H  HB3  . ASN A 1 16 ? 3.360   -5.704  -4.030  1.00 0.00 ? 16  ASN A HB3  13 
ATOM   7567  H  HD21 . ASN A 1 16 ? 1.794   -6.602  -5.221  1.00 0.00 ? 16  ASN A HD21 13 
ATOM   7568  H  HD22 . ASN A 1 16 ? 0.132   -6.687  -4.760  1.00 0.00 ? 16  ASN A HD22 13 
ATOM   7569  N  N    . GLU A 1 17 ? 5.067   -4.078  -0.832  1.00 0.00 ? 17  GLU A N    13 
ATOM   7570  C  CA   . GLU A 1 17 ? 6.467   -3.719  -0.637  1.00 0.00 ? 17  GLU A CA   13 
ATOM   7571  C  C    . GLU A 1 17 ? 6.952   -4.149  0.745   1.00 0.00 ? 17  GLU A C    13 
ATOM   7572  O  O    . GLU A 1 17 ? 8.055   -4.676  0.892   1.00 0.00 ? 17  GLU A O    13 
ATOM   7573  C  CB   . GLU A 1 17 ? 6.658   -2.210  -0.809  1.00 0.00 ? 17  GLU A CB   13 
ATOM   7574  C  CG   . GLU A 1 17 ? 6.056   -1.664  -2.093  1.00 0.00 ? 17  GLU A CG   13 
ATOM   7575  C  CD   . GLU A 1 17 ? 7.035   -1.682  -3.250  1.00 0.00 ? 17  GLU A CD   13 
ATOM   7576  O  OE1  . GLU A 1 17 ? 8.049   -0.957  -3.180  1.00 0.00 ? 17  GLU A OE1  13 
ATOM   7577  O  OE2  . GLU A 1 17 ? 6.787   -2.421  -4.226  1.00 0.00 ? 17  GLU A OE2  13 
ATOM   7578  H  H    . GLU A 1 17 ? 4.415   -3.859  -0.134  1.00 0.00 ? 17  GLU A H    13 
ATOM   7579  H  HA   . GLU A 1 17 ? 7.049   -4.234  -1.386  1.00 0.00 ? 17  GLU A HA   13 
ATOM   7580  H  HB2  . GLU A 1 17 ? 6.196   -1.703  0.026   1.00 0.00 ? 17  GLU A HB2  13 
ATOM   7581  H  HB3  . GLU A 1 17 ? 7.715   -1.992  -0.811  1.00 0.00 ? 17  GLU A HB3  13 
ATOM   7582  H  HG2  . GLU A 1 17 ? 5.198   -2.263  -2.357  1.00 0.00 ? 17  GLU A HG2  13 
ATOM   7583  H  HG3  . GLU A 1 17 ? 5.742   -0.644  -1.922  1.00 0.00 ? 17  GLU A HG3  13 
ATOM   7584  N  N    . CYS A 1 18 ? 6.120   -3.920  1.755   1.00 0.00 ? 18  CYS A N    13 
ATOM   7585  C  CA   . CYS A 1 18 ? 6.462   -4.283  3.125   1.00 0.00 ? 18  CYS A CA   13 
ATOM   7586  C  C    . CYS A 1 18 ? 5.514   -5.354  3.658   1.00 0.00 ? 18  CYS A C    13 
ATOM   7587  O  O    . CYS A 1 18 ? 5.933   -6.280  4.351   1.00 0.00 ? 18  CYS A O    13 
ATOM   7588  C  CB   . CYS A 1 18 ? 6.413   -3.049  4.028   1.00 0.00 ? 18  CYS A CB   13 
ATOM   7589  S  SG   . CYS A 1 18 ? 4.817   -2.170  4.002   1.00 0.00 ? 18  CYS A SG   13 
ATOM   7590  H  H    . CYS A 1 18 ? 5.253   -3.497  1.575   1.00 0.00 ? 18  CYS A H    13 
ATOM   7591  H  HA   . CYS A 1 18 ? 7.466   -4.677  3.123   1.00 0.00 ? 18  CYS A HA   13 
ATOM   7592  H  HB2  . CYS A 1 18 ? 6.603   -3.351  5.048   1.00 0.00 ? 18  CYS A HB2  13 
ATOM   7593  H  HB3  . CYS A 1 18 ? 7.177   -2.353  3.716   1.00 0.00 ? 18  CYS A HB3  13 
ATOM   7594  N  N    . GLY A 1 19 ? 4.233   -5.220  3.327   1.00 0.00 ? 19  GLY A N    13 
ATOM   7595  C  CA   . GLY A 1 19 ? 3.246   -6.183  3.780   1.00 0.00 ? 19  GLY A CA   13 
ATOM   7596  C  C    . GLY A 1 19 ? 2.211   -5.564  4.698   1.00 0.00 ? 19  GLY A C    13 
ATOM   7597  O  O    . GLY A 1 19 ? 1.477   -6.274  5.386   1.00 0.00 ? 19  GLY A O    13 
ATOM   7598  H  H    . GLY A 1 19 ? 3.956   -4.462  2.772   1.00 0.00 ? 19  GLY A H    13 
ATOM   7599  H  HA2  . GLY A 1 19 ? 2.745   -6.600  2.919   1.00 0.00 ? 19  GLY A HA2  13 
ATOM   7600  H  HA3  . GLY A 1 19 ? 3.751   -6.977  4.310   1.00 0.00 ? 19  GLY A HA3  13 
ATOM   7601  N  N    . LYS A 1 20 ? 2.153   -4.237  4.712   1.00 0.00 ? 20  LYS A N    13 
ATOM   7602  C  CA   . LYS A 1 20 ? 1.201   -3.521  5.553   1.00 0.00 ? 20  LYS A CA   13 
ATOM   7603  C  C    . LYS A 1 20 ? -0.222  -3.691  5.030   1.00 0.00 ? 20  LYS A C    13 
ATOM   7604  O  O    . LYS A 1 20 ? -0.566  -3.184  3.963   1.00 0.00 ? 20  LYS A O    13 
ATOM   7605  C  CB   . LYS A 1 20 ? 1.559   -2.034  5.613   1.00 0.00 ? 20  LYS A CB   13 
ATOM   7606  C  CG   . LYS A 1 20 ? 1.031   -1.331  6.851   1.00 0.00 ? 20  LYS A CG   13 
ATOM   7607  C  CD   . LYS A 1 20 ? 1.717   -1.830  8.112   1.00 0.00 ? 20  LYS A CD   13 
ATOM   7608  C  CE   . LYS A 1 20 ? 1.589   -0.829  9.249   1.00 0.00 ? 20  LYS A CE   13 
ATOM   7609  N  NZ   . LYS A 1 20 ? 2.527   0.317   9.088   1.00 0.00 ? 20  LYS A NZ   13 
ATOM   7610  H  H    . LYS A 1 20 ? 2.765   -3.726  4.141   1.00 0.00 ? 20  LYS A H    13 
ATOM   7611  H  HA   . LYS A 1 20 ? 1.258   -3.937  6.547   1.00 0.00 ? 20  LYS A HA   13 
ATOM   7612  H  HB2  . LYS A 1 20 ? 2.635   -1.935  5.599   1.00 0.00 ? 20  LYS A HB2  13 
ATOM   7613  H  HB3  . LYS A 1 20 ? 1.150   -1.542  4.743   1.00 0.00 ? 20  LYS A HB3  13 
ATOM   7614  H  HG2  . LYS A 1 20 ? 1.207   -0.270  6.754   1.00 0.00 ? 20  LYS A HG2  13 
ATOM   7615  H  HG3  . LYS A 1 20 ? -0.031  -1.516  6.933   1.00 0.00 ? 20  LYS A HG3  13 
ATOM   7616  H  HD2  . LYS A 1 20 ? 1.262   -2.761  8.414   1.00 0.00 ? 20  LYS A HD2  13 
ATOM   7617  H  HD3  . LYS A 1 20 ? 2.765   -1.990  7.901   1.00 0.00 ? 20  LYS A HD3  13 
ATOM   7618  H  HE2  . LYS A 1 20 ? 0.577   -0.454  9.270   1.00 0.00 ? 20  LYS A HE2  13 
ATOM   7619  H  HE3  . LYS A 1 20 ? 1.806   -1.332  10.180  1.00 0.00 ? 20  LYS A HE3  13 
ATOM   7620  H  HZ1  . LYS A 1 20 ? 2.947   0.304   8.137   1.00 0.00 ? 20  LYS A HZ1  13 
ATOM   7621  H  HZ2  . LYS A 1 20 ? 3.289   0.257   9.794   1.00 0.00 ? 20  LYS A HZ2  13 
ATOM   7622  H  HZ3  . LYS A 1 20 ? 2.019   1.215   9.219   1.00 0.00 ? 20  LYS A HZ3  13 
ATOM   7623  N  N    . ALA A 1 21 ? -1.046  -4.405  5.790   1.00 0.00 ? 21  ALA A N    13 
ATOM   7624  C  CA   . ALA A 1 21 ? -2.432  -4.638  5.405   1.00 0.00 ? 21  ALA A CA   13 
ATOM   7625  C  C    . ALA A 1 21 ? -3.344  -3.543  5.946   1.00 0.00 ? 21  ALA A C    13 
ATOM   7626  O  O    . ALA A 1 21 ? -3.165  -3.071  7.069   1.00 0.00 ? 21  ALA A O    13 
ATOM   7627  C  CB   . ALA A 1 21 ? -2.894  -6.003  5.895   1.00 0.00 ? 21  ALA A CB   13 
ATOM   7628  H  H    . ALA A 1 21 ? -0.713  -4.784  6.630   1.00 0.00 ? 21  ALA A H    13 
ATOM   7629  H  HA   . ALA A 1 21 ? -2.483  -4.635  4.325   1.00 0.00 ? 21  ALA A HA   13 
ATOM   7630  H  HB1  . ALA A 1 21 ? -3.627  -6.401  5.211   1.00 0.00 ? 21  ALA A HB1  13 
ATOM   7631  H  HB2  . ALA A 1 21 ? -2.047  -6.671  5.946   1.00 0.00 ? 21  ALA A HB2  13 
ATOM   7632  H  HB3  . ALA A 1 21 ? -3.334  -5.902  6.876   1.00 0.00 ? 21  ALA A HB3  13 
ATOM   7633  N  N    . PHE A 1 22 ? -4.321  -3.141  5.140   1.00 0.00 ? 22  PHE A N    13 
ATOM   7634  C  CA   . PHE A 1 22 ? -5.261  -2.099  5.538   1.00 0.00 ? 22  PHE A CA   13 
ATOM   7635  C  C    . PHE A 1 22 ? -6.697  -2.519  5.240   1.00 0.00 ? 22  PHE A C    13 
ATOM   7636  O  O    . PHE A 1 22 ? -6.950  -3.647  4.817   1.00 0.00 ? 22  PHE A O    13 
ATOM   7637  C  CB   . PHE A 1 22 ? -4.939  -0.790  4.814   1.00 0.00 ? 22  PHE A CB   13 
ATOM   7638  C  CG   . PHE A 1 22 ? -3.527  -0.322  5.019   1.00 0.00 ? 22  PHE A CG   13 
ATOM   7639  C  CD1  . PHE A 1 22 ? -3.206  0.511   6.079   1.00 0.00 ? 22  PHE A CD1  13 
ATOM   7640  C  CD2  . PHE A 1 22 ? -2.520  -0.716  4.153   1.00 0.00 ? 22  PHE A CD2  13 
ATOM   7641  C  CE1  . PHE A 1 22 ? -1.907  0.943   6.270   1.00 0.00 ? 22  PHE A CE1  13 
ATOM   7642  C  CE2  . PHE A 1 22 ? -1.219  -0.287  4.339   1.00 0.00 ? 22  PHE A CE2  13 
ATOM   7643  C  CZ   . PHE A 1 22 ? -0.912  0.543   5.399   1.00 0.00 ? 22  PHE A CZ   13 
ATOM   7644  H  H    . PHE A 1 22 ? -4.413  -3.555  4.256   1.00 0.00 ? 22  PHE A H    13 
ATOM   7645  H  HA   . PHE A 1 22 ? -5.155  -1.948  6.601   1.00 0.00 ? 22  PHE A HA   13 
ATOM   7646  H  HB2  . PHE A 1 22 ? -5.092  -0.926  3.754   1.00 0.00 ? 22  PHE A HB2  13 
ATOM   7647  H  HB3  . PHE A 1 22 ? -5.602  -0.017  5.173   1.00 0.00 ? 22  PHE A HB3  13 
ATOM   7648  H  HD1  . PHE A 1 22 ? -3.983  0.824   6.761   1.00 0.00 ? 22  PHE A HD1  13 
ATOM   7649  H  HD2  . PHE A 1 22 ? -2.759  -1.366  3.323   1.00 0.00 ? 22  PHE A HD2  13 
ATOM   7650  H  HE1  . PHE A 1 22 ? -1.670  1.592   7.100   1.00 0.00 ? 22  PHE A HE1  13 
ATOM   7651  H  HE2  . PHE A 1 22 ? -0.444  -0.603  3.656   1.00 0.00 ? 22  PHE A HE2  13 
ATOM   7652  H  HZ   . PHE A 1 22 ? 0.103   0.879   5.546   1.00 0.00 ? 22  PHE A HZ   13 
ATOM   7653  N  N    . ARG A 1 23 ? -7.634  -1.603  5.466   1.00 0.00 ? 23  ARG A N    13 
ATOM   7654  C  CA   . ARG A 1 23 ? -9.045  -1.878  5.224   1.00 0.00 ? 23  ARG A CA   13 
ATOM   7655  C  C    . ARG A 1 23 ? -9.462  -1.397  3.837   1.00 0.00 ? 23  ARG A C    13 
ATOM   7656  O  O    . ARG A 1 23 ? -10.226 -2.067  3.141   1.00 0.00 ? 23  ARG A O    13 
ATOM   7657  C  CB   . ARG A 1 23 ? -9.908  -1.203  6.291   1.00 0.00 ? 23  ARG A CB   13 
ATOM   7658  C  CG   . ARG A 1 23 ? -11.300 -1.800  6.416   1.00 0.00 ? 23  ARG A CG   13 
ATOM   7659  C  CD   . ARG A 1 23 ? -11.996 -1.331  7.684   1.00 0.00 ? 23  ARG A CD   13 
ATOM   7660  N  NE   . ARG A 1 23 ? -13.003 -2.286  8.141   1.00 0.00 ? 23  ARG A NE   13 
ATOM   7661  C  CZ   . ARG A 1 23 ? -12.724 -3.346  8.891   1.00 0.00 ? 23  ARG A CZ   13 
ATOM   7662  N  NH1  . ARG A 1 23 ? -11.475 -3.586  9.267   1.00 0.00 ? 23  ARG A NH1  13 
ATOM   7663  N  NH2  . ARG A 1 23 ? -13.695 -4.169  9.266   1.00 0.00 ? 23  ARG A NH2  13 
ATOM   7664  H  H    . ARG A 1 23 ? -7.370  -0.722  5.804   1.00 0.00 ? 23  ARG A H    13 
ATOM   7665  H  HA   . ARG A 1 23 ? -9.189  -2.947  5.280   1.00 0.00 ? 23  ARG A HA   13 
ATOM   7666  H  HB2  . ARG A 1 23 ? -9.415  -1.294  7.248   1.00 0.00 ? 23  ARG A HB2  13 
ATOM   7667  H  HB3  . ARG A 1 23 ? -10.009 -0.156  6.045   1.00 0.00 ? 23  ARG A HB3  13 
ATOM   7668  H  HG2  . ARG A 1 23 ? -11.890 -1.496  5.563   1.00 0.00 ? 23  ARG A HG2  13 
ATOM   7669  H  HG3  . ARG A 1 23 ? -11.220 -2.876  6.436   1.00 0.00 ? 23  ARG A HG3  13 
ATOM   7670  H  HD2  . ARG A 1 23 ? -11.255 -1.206  8.460   1.00 0.00 ? 23  ARG A HD2  13 
ATOM   7671  H  HD3  . ARG A 1 23 ? -12.474 -0.384  7.488   1.00 0.00 ? 23  ARG A HD3  13 
ATOM   7672  H  HE   . ARG A 1 23 ? -13.932 -2.127  7.874   1.00 0.00 ? 23  ARG A HE   13 
ATOM   7673  H  HH11 . ARG A 1 23 ? -10.742 -2.968  8.986   1.00 0.00 ? 23  ARG A HH11 13 
ATOM   7674  H  HH12 . ARG A 1 23 ? -11.268 -4.385  9.833   1.00 0.00 ? 23  ARG A HH12 13 
ATOM   7675  H  HH21 . ARG A 1 23 ? -14.637 -3.991  8.984   1.00 0.00 ? 23  ARG A HH21 13 
ATOM   7676  H  HH22 . ARG A 1 23 ? -13.484 -4.966  9.830   1.00 0.00 ? 23  ARG A HH22 13 
ATOM   7677  N  N    . SER A 1 24 ? -8.957  -0.233  3.443   1.00 0.00 ? 24  SER A N    13 
ATOM   7678  C  CA   . SER A 1 24 ? -9.281  0.340   2.142   1.00 0.00 ? 24  SER A CA   13 
ATOM   7679  C  C    . SER A 1 24 ? -8.019  0.819   1.430   1.00 0.00 ? 24  SER A C    13 
ATOM   7680  O  O    . SER A 1 24 ? -6.916  0.734   1.971   1.00 0.00 ? 24  SER A O    13 
ATOM   7681  C  CB   . SER A 1 24 ? -10.261 1.503   2.303   1.00 0.00 ? 24  SER A CB   13 
ATOM   7682  O  OG   . SER A 1 24 ? -10.929 1.779   1.084   1.00 0.00 ? 24  SER A OG   13 
ATOM   7683  H  H    . SER A 1 24 ? -8.354  0.254   4.044   1.00 0.00 ? 24  SER A H    13 
ATOM   7684  H  HA   . SER A 1 24 ? -9.745  -0.432  1.546   1.00 0.00 ? 24  SER A HA   13 
ATOM   7685  H  HB2  . SER A 1 24 ? -10.996 1.250   3.052   1.00 0.00 ? 24  SER A HB2  13 
ATOM   7686  H  HB3  . SER A 1 24 ? -9.721  2.386   2.611   1.00 0.00 ? 24  SER A HB3  13 
ATOM   7687  H  HG   . SER A 1 24 ? -11.877 1.692   1.211   1.00 0.00 ? 24  SER A HG   13 
ATOM   7688  N  N    . LYS A 1 25 ? -8.189  1.321   0.212   1.00 0.00 ? 25  LYS A N    13 
ATOM   7689  C  CA   . LYS A 1 25 ? -7.067  1.816   -0.576  1.00 0.00 ? 25  LYS A CA   13 
ATOM   7690  C  C    . LYS A 1 25 ? -6.511  3.106   0.018   1.00 0.00 ? 25  LYS A C    13 
ATOM   7691  O  O    . LYS A 1 25 ? -5.309  3.222   0.258   1.00 0.00 ? 25  LYS A O    13 
ATOM   7692  C  CB   . LYS A 1 25 ? -7.499  2.054   -2.025  1.00 0.00 ? 25  LYS A CB   13 
ATOM   7693  C  CG   . LYS A 1 25 ? -7.311  0.843   -2.922  1.00 0.00 ? 25  LYS A CG   13 
ATOM   7694  C  CD   . LYS A 1 25 ? -5.840  0.533   -3.141  1.00 0.00 ? 25  LYS A CD   13 
ATOM   7695  C  CE   . LYS A 1 25 ? -5.293  1.259   -4.360  1.00 0.00 ? 25  LYS A CE   13 
ATOM   7696  N  NZ   . LYS A 1 25 ? -3.884  0.873   -4.650  1.00 0.00 ? 25  LYS A NZ   13 
ATOM   7697  H  H    . LYS A 1 25 ? -9.093  1.362   -0.166  1.00 0.00 ? 25  LYS A H    13 
ATOM   7698  H  HA   . LYS A 1 25 ? -6.293  1.063   -0.559  1.00 0.00 ? 25  LYS A HA   13 
ATOM   7699  H  HB2  . LYS A 1 25 ? -8.544  2.325   -2.036  1.00 0.00 ? 25  LYS A HB2  13 
ATOM   7700  H  HB3  . LYS A 1 25 ? -6.920  2.870   -2.431  1.00 0.00 ? 25  LYS A HB3  13 
ATOM   7701  H  HG2  . LYS A 1 25 ? -7.783  -0.012  -2.462  1.00 0.00 ? 25  LYS A HG2  13 
ATOM   7702  H  HG3  . LYS A 1 25 ? -7.774  1.040   -3.879  1.00 0.00 ? 25  LYS A HG3  13 
ATOM   7703  H  HD2  . LYS A 1 25 ? -5.282  0.845   -2.270  1.00 0.00 ? 25  LYS A HD2  13 
ATOM   7704  H  HD3  . LYS A 1 25 ? -5.722  -0.532  -3.283  1.00 0.00 ? 25  LYS A HD3  13 
ATOM   7705  H  HE2  . LYS A 1 25 ? -5.906  1.016   -5.213  1.00 0.00 ? 25  LYS A HE2  13 
ATOM   7706  H  HE3  . LYS A 1 25 ? -5.335  2.323   -4.178  1.00 0.00 ? 25  LYS A HE3  13 
ATOM   7707  H  HZ1  . LYS A 1 25 ? -3.462  1.540   -5.326  1.00 0.00 ? 25  LYS A HZ1  13 
ATOM   7708  H  HZ2  . LYS A 1 25 ? -3.853  -0.084  -5.058  1.00 0.00 ? 25  LYS A HZ2  13 
ATOM   7709  H  HZ3  . LYS A 1 25 ? -3.324  0.881   -3.774  1.00 0.00 ? 25  LYS A HZ3  13 
ATOM   7710  N  N    . SER A 1 26 ? -7.393  4.072   0.254   1.00 0.00 ? 26  SER A N    13 
ATOM   7711  C  CA   . SER A 1 26 ? -6.990  5.354   0.818   1.00 0.00 ? 26  SER A CA   13 
ATOM   7712  C  C    . SER A 1 26 ? -6.006  5.157   1.967   1.00 0.00 ? 26  SER A C    13 
ATOM   7713  O  O    . SER A 1 26 ? -5.183  6.028   2.251   1.00 0.00 ? 26  SER A O    13 
ATOM   7714  C  CB   . SER A 1 26 ? -8.215  6.128   1.308   1.00 0.00 ? 26  SER A CB   13 
ATOM   7715  O  OG   . SER A 1 26 ? -8.706  5.589   2.524   1.00 0.00 ? 26  SER A OG   13 
ATOM   7716  H  H    . SER A 1 26 ? -8.337  3.918   0.041   1.00 0.00 ? 26  SER A H    13 
ATOM   7717  H  HA   . SER A 1 26 ? -6.505  5.922   0.038   1.00 0.00 ? 26  SER A HA   13 
ATOM   7718  H  HB2  . SER A 1 26 ? -7.945  7.160   1.469   1.00 0.00 ? 26  SER A HB2  13 
ATOM   7719  H  HB3  . SER A 1 26 ? -8.995  6.071   0.562   1.00 0.00 ? 26  SER A HB3  13 
ATOM   7720  H  HG   . SER A 1 26 ? -8.455  4.665   2.588   1.00 0.00 ? 26  SER A HG   13 
ATOM   7721  N  N    . TYR A 1 27 ? -6.096  4.006   2.624   1.00 0.00 ? 27  TYR A N    13 
ATOM   7722  C  CA   . TYR A 1 27 ? -5.216  3.694   3.744   1.00 0.00 ? 27  TYR A CA   13 
ATOM   7723  C  C    . TYR A 1 27 ? -3.860  3.201   3.250   1.00 0.00 ? 27  TYR A C    13 
ATOM   7724  O  O    . TYR A 1 27 ? -2.821  3.517   3.832   1.00 0.00 ? 27  TYR A O    13 
ATOM   7725  C  CB   . TYR A 1 27 ? -5.858  2.638   4.645   1.00 0.00 ? 27  TYR A CB   13 
ATOM   7726  C  CG   . TYR A 1 27 ? -6.709  3.222   5.751   1.00 0.00 ? 27  TYR A CG   13 
ATOM   7727  C  CD1  . TYR A 1 27 ? -6.208  4.207   6.593   1.00 0.00 ? 27  TYR A CD1  13 
ATOM   7728  C  CD2  . TYR A 1 27 ? -8.013  2.788   5.954   1.00 0.00 ? 27  TYR A CD2  13 
ATOM   7729  C  CE1  . TYR A 1 27 ? -6.981  4.743   7.605   1.00 0.00 ? 27  TYR A CE1  13 
ATOM   7730  C  CE2  . TYR A 1 27 ? -8.794  3.319   6.962   1.00 0.00 ? 27  TYR A CE2  13 
ATOM   7731  C  CZ   . TYR A 1 27 ? -8.273  4.296   7.785   1.00 0.00 ? 27  TYR A CZ   13 
ATOM   7732  O  OH   . TYR A 1 27 ? -9.047  4.826   8.792   1.00 0.00 ? 27  TYR A OH   13 
ATOM   7733  H  H    . TYR A 1 27 ? -6.772  3.352   2.351   1.00 0.00 ? 27  TYR A H    13 
ATOM   7734  H  HA   . TYR A 1 27 ? -5.071  4.600   4.314   1.00 0.00 ? 27  TYR A HA   13 
ATOM   7735  H  HB2  . TYR A 1 27 ? -6.488  1.998   4.047   1.00 0.00 ? 27  TYR A HB2  13 
ATOM   7736  H  HB3  . TYR A 1 27 ? -5.081  2.045   5.103   1.00 0.00 ? 27  TYR A HB3  13 
ATOM   7737  H  HD1  . TYR A 1 27 ? -5.195  4.555   6.449   1.00 0.00 ? 27  TYR A HD1  13 
ATOM   7738  H  HD2  . TYR A 1 27 ? -8.417  2.022   5.308   1.00 0.00 ? 27  TYR A HD2  13 
ATOM   7739  H  HE1  . TYR A 1 27 ? -6.574  5.508   8.249   1.00 0.00 ? 27  TYR A HE1  13 
ATOM   7740  H  HE2  . TYR A 1 27 ? -9.806  2.969   7.104   1.00 0.00 ? 27  TYR A HE2  13 
ATOM   7741  H  HH   . TYR A 1 27 ? -8.868  4.361   9.612   1.00 0.00 ? 27  TYR A HH   13 
ATOM   7742  N  N    . LEU A 1 28 ? -3.877  2.424   2.172   1.00 0.00 ? 28  LEU A N    13 
ATOM   7743  C  CA   . LEU A 1 28 ? -2.649  1.886   1.597   1.00 0.00 ? 28  LEU A CA   13 
ATOM   7744  C  C    . LEU A 1 28 ? -1.889  2.964   0.830   1.00 0.00 ? 28  LEU A C    13 
ATOM   7745  O  O    . LEU A 1 28 ? -0.658  2.972   0.807   1.00 0.00 ? 28  LEU A O    13 
ATOM   7746  C  CB   . LEU A 1 28 ? -2.968  0.713   0.670   1.00 0.00 ? 28  LEU A CB   13 
ATOM   7747  C  CG   . LEU A 1 28 ? -1.845  0.275   -0.271  1.00 0.00 ? 28  LEU A CG   13 
ATOM   7748  C  CD1  . LEU A 1 28 ? -0.710  -0.363  0.515   1.00 0.00 ? 28  LEU A CD1  13 
ATOM   7749  C  CD2  . LEU A 1 28 ? -2.375  -0.687  -1.324  1.00 0.00 ? 28  LEU A CD2  13 
ATOM   7750  H  H    . LEU A 1 28 ? -4.735  2.207   1.753   1.00 0.00 ? 28  LEU A H    13 
ATOM   7751  H  HA   . LEU A 1 28 ? -2.030  1.535   2.409   1.00 0.00 ? 28  LEU A HA   13 
ATOM   7752  H  HB2  . LEU A 1 28 ? -3.232  -0.133  1.286   1.00 0.00 ? 28  LEU A HB2  13 
ATOM   7753  H  HB3  . LEU A 1 28 ? -3.818  0.993   0.064   1.00 0.00 ? 28  LEU A HB3  13 
ATOM   7754  H  HG   . LEU A 1 28 ? -1.450  1.145   -0.779  1.00 0.00 ? 28  LEU A HG   13 
ATOM   7755  H  HD11 . LEU A 1 28 ? -0.568  0.171   1.442   1.00 0.00 ? 28  LEU A HD11 13 
ATOM   7756  H  HD12 . LEU A 1 28 ? 0.199   -0.321  -0.067  1.00 0.00 ? 28  LEU A HD12 13 
ATOM   7757  H  HD13 . LEU A 1 28 ? -0.954  -1.394  0.726   1.00 0.00 ? 28  LEU A HD13 13 
ATOM   7758  H  HD21 . LEU A 1 28 ? -1.855  -1.630  -1.244  1.00 0.00 ? 28  LEU A HD21 13 
ATOM   7759  H  HD22 . LEU A 1 28 ? -2.214  -0.269  -2.306  1.00 0.00 ? 28  LEU A HD22 13 
ATOM   7760  H  HD23 . LEU A 1 28 ? -3.432  -0.844  -1.168  1.00 0.00 ? 28  LEU A HD23 13 
ATOM   7761  N  N    . ILE A 1 29 ? -2.631  3.872   0.205   1.00 0.00 ? 29  ILE A N    13 
ATOM   7762  C  CA   . ILE A 1 29 ? -2.027  4.956   -0.560  1.00 0.00 ? 29  ILE A CA   13 
ATOM   7763  C  C    . ILE A 1 29 ? -1.292  5.930   0.354   1.00 0.00 ? 29  ILE A C    13 
ATOM   7764  O  O    . ILE A 1 29 ? -0.144  6.292   0.097   1.00 0.00 ? 29  ILE A O    13 
ATOM   7765  C  CB   . ILE A 1 29 ? -3.083  5.728   -1.372  1.00 0.00 ? 29  ILE A CB   13 
ATOM   7766  C  CG1  . ILE A 1 29 ? -3.810  4.784   -2.332  1.00 0.00 ? 29  ILE A CG1  13 
ATOM   7767  C  CG2  . ILE A 1 29 ? -2.432  6.871   -2.137  1.00 0.00 ? 29  ILE A CG2  13 
ATOM   7768  C  CD1  . ILE A 1 29 ? -5.237  5.196   -2.619  1.00 0.00 ? 29  ILE A CD1  13 
ATOM   7769  H  H    . ILE A 1 29 ? -3.607  3.812   0.261   1.00 0.00 ? 29  ILE A H    13 
ATOM   7770  H  HA   . ILE A 1 29 ? -1.318  4.521   -1.250  1.00 0.00 ? 29  ILE A HA   13 
ATOM   7771  H  HB   . ILE A 1 29 ? -3.798  6.149   -0.683  1.00 0.00 ? 29  ILE A HB   13 
ATOM   7772  H  HG12 . ILE A 1 29 ? -3.279  4.755   -3.270  1.00 0.00 ? 29  ILE A HG12 13 
ATOM   7773  H  HG13 . ILE A 1 29 ? -3.830  3.792   -1.903  1.00 0.00 ? 29  ILE A HG13 13 
ATOM   7774  H  HG21 . ILE A 1 29 ? -2.278  6.575   -3.164  1.00 0.00 ? 29  ILE A HG21 13 
ATOM   7775  H  HG22 . ILE A 1 29 ? -3.075  7.737   -2.105  1.00 0.00 ? 29  ILE A HG22 13 
ATOM   7776  H  HG23 . ILE A 1 29 ? -1.481  7.111   -1.684  1.00 0.00 ? 29  ILE A HG23 13 
ATOM   7777  H  HD11 . ILE A 1 29 ? -5.808  5.181   -1.702  1.00 0.00 ? 29  ILE A HD11 13 
ATOM   7778  H  HD12 . ILE A 1 29 ? -5.248  6.194   -3.032  1.00 0.00 ? 29  ILE A HD12 13 
ATOM   7779  H  HD13 . ILE A 1 29 ? -5.676  4.508   -3.326  1.00 0.00 ? 29  ILE A HD13 13 
ATOM   7780  N  N    . ILE A 1 30 ? -1.961  6.350   1.422   1.00 0.00 ? 30  ILE A N    13 
ATOM   7781  C  CA   . ILE A 1 30 ? -1.370  7.281   2.376   1.00 0.00 ? 30  ILE A CA   13 
ATOM   7782  C  C    . ILE A 1 30 ? -0.158  6.665   3.066   1.00 0.00 ? 30  ILE A C    13 
ATOM   7783  O  O    . ILE A 1 30 ? 0.676   7.374   3.630   1.00 0.00 ? 30  ILE A O    13 
ATOM   7784  C  CB   . ILE A 1 30 ? -2.391  7.714   3.446   1.00 0.00 ? 30  ILE A CB   13 
ATOM   7785  C  CG1  . ILE A 1 30 ? -3.002  6.487   4.125   1.00 0.00 ? 30  ILE A CG1  13 
ATOM   7786  C  CG2  . ILE A 1 30 ? -3.477  8.577   2.822   1.00 0.00 ? 30  ILE A CG2  13 
ATOM   7787  C  CD1  . ILE A 1 30 ? -2.241  6.034   5.352   1.00 0.00 ? 30  ILE A CD1  13 
ATOM   7788  H  H    . ILE A 1 30 ? -2.873  6.026   1.573   1.00 0.00 ? 30  ILE A H    13 
ATOM   7789  H  HA   . ILE A 1 30 ? -1.054  8.159   1.832   1.00 0.00 ? 30  ILE A HA   13 
ATOM   7790  H  HB   . ILE A 1 30 ? -1.874  8.306   4.185   1.00 0.00 ? 30  ILE A HB   13 
ATOM   7791  H  HG12 . ILE A 1 30 ? -4.011  6.716   4.428   1.00 0.00 ? 30  ILE A HG12 13 
ATOM   7792  H  HG13 . ILE A 1 30 ? -3.019  5.667   3.422   1.00 0.00 ? 30  ILE A HG13 13 
ATOM   7793  H  HG21 . ILE A 1 30 ? -4.051  9.053   3.604   1.00 0.00 ? 30  ILE A HG21 13 
ATOM   7794  H  HG22 . ILE A 1 30 ? -3.023  9.333   2.199   1.00 0.00 ? 30  ILE A HG22 13 
ATOM   7795  H  HG23 . ILE A 1 30 ? -4.128  7.959   2.223   1.00 0.00 ? 30  ILE A HG23 13 
ATOM   7796  H  HD11 . ILE A 1 30 ? -1.741  5.099   5.140   1.00 0.00 ? 30  ILE A HD11 13 
ATOM   7797  H  HD12 . ILE A 1 30 ? -1.507  6.781   5.617   1.00 0.00 ? 30  ILE A HD12 13 
ATOM   7798  H  HD13 . ILE A 1 30 ? -2.928  5.896   6.172   1.00 0.00 ? 30  ILE A HD13 13 
ATOM   7799  N  N    . HIS A 1 31 ? -0.065  5.340   3.016   1.00 0.00 ? 31  HIS A N    13 
ATOM   7800  C  CA   . HIS A 1 31 ? 1.048   4.628   3.634   1.00 0.00 ? 31  HIS A CA   13 
ATOM   7801  C  C    . HIS A 1 31 ? 2.154   4.361   2.617   1.00 0.00 ? 31  HIS A C    13 
ATOM   7802  O  O    . HIS A 1 31 ? 3.339   4.380   2.953   1.00 0.00 ? 31  HIS A O    13 
ATOM   7803  C  CB   . HIS A 1 31 ? 0.564   3.308   4.237   1.00 0.00 ? 31  HIS A CB   13 
ATOM   7804  C  CG   . HIS A 1 31 ? 1.631   2.260   4.318   1.00 0.00 ? 31  HIS A CG   13 
ATOM   7805  N  ND1  . HIS A 1 31 ? 2.272   1.928   5.493   1.00 0.00 ? 31  HIS A ND1  13 
ATOM   7806  C  CD2  . HIS A 1 31 ? 2.168   1.467   3.361   1.00 0.00 ? 31  HIS A CD2  13 
ATOM   7807  C  CE1  . HIS A 1 31 ? 3.158   0.977   5.255   1.00 0.00 ? 31  HIS A CE1  13 
ATOM   7808  N  NE2  . HIS A 1 31 ? 3.114   0.679   3.969   1.00 0.00 ? 31  HIS A NE2  13 
ATOM   7809  H  H    . HIS A 1 31 ? -0.760  4.829   2.551   1.00 0.00 ? 31  HIS A H    13 
ATOM   7810  H  HA   . HIS A 1 31 ? 1.443   5.250   4.422   1.00 0.00 ? 31  HIS A HA   13 
ATOM   7811  H  HB2  . HIS A 1 31 ? 0.201   3.490   5.238   1.00 0.00 ? 31  HIS A HB2  13 
ATOM   7812  H  HB3  . HIS A 1 31 ? -0.241  2.917   3.632   1.00 0.00 ? 31  HIS A HB3  13 
ATOM   7813  H  HD1  . HIS A 1 31 ? 2.103   2.330   6.370   1.00 0.00 ? 31  HIS A HD1  13 
ATOM   7814  H  HD2  . HIS A 1 31 ? 1.902   1.456   2.313   1.00 0.00 ? 31  HIS A HD2  13 
ATOM   7815  H  HE1  . HIS A 1 31 ? 3.807   0.520   5.987   1.00 0.00 ? 31  HIS A HE1  13 
ATOM   7816  N  N    . THR A 1 32 ? 1.760   4.111   1.373   1.00 0.00 ? 32  THR A N    13 
ATOM   7817  C  CA   . THR A 1 32 ? 2.717   3.838   0.308   1.00 0.00 ? 32  THR A CA   13 
ATOM   7818  C  C    . THR A 1 32 ? 3.555   5.071   -0.007  1.00 0.00 ? 32  THR A C    13 
ATOM   7819  O  O    . THR A 1 32 ? 4.558   4.987   -0.716  1.00 0.00 ? 32  THR A O    13 
ATOM   7820  C  CB   . THR A 1 32 ? 2.009   3.371   -0.978  1.00 0.00 ? 32  THR A CB   13 
ATOM   7821  O  OG1  . THR A 1 32 ? 1.167   2.248   -0.693  1.00 0.00 ? 32  THR A OG1  13 
ATOM   7822  C  CG2  . THR A 1 32 ? 3.023   2.992   -2.047  1.00 0.00 ? 32  THR A CG2  13 
ATOM   7823  H  H    . THR A 1 32 ? 0.802   4.109   1.167   1.00 0.00 ? 32  THR A H    13 
ATOM   7824  H  HA   . THR A 1 32 ? 3.371   3.045   0.642   1.00 0.00 ? 32  THR A HA   13 
ATOM   7825  H  HB   . THR A 1 32 ? 1.400   4.182   -1.351  1.00 0.00 ? 32  THR A HB   13 
ATOM   7826  H  HG1  . THR A 1 32 ? 1.042   2.174   0.256   1.00 0.00 ? 32  THR A HG1  13 
ATOM   7827  H  HG21 . THR A 1 32 ? 2.839   1.980   -2.374  1.00 0.00 ? 32  THR A HG21 13 
ATOM   7828  H  HG22 . THR A 1 32 ? 4.020   3.062   -1.638  1.00 0.00 ? 32  THR A HG22 13 
ATOM   7829  H  HG23 . THR A 1 32 ? 2.929   3.665   -2.886  1.00 0.00 ? 32  THR A HG23 13 
ATOM   7830  N  N    . ARG A 1 33 ? 3.139   6.216   0.525   1.00 0.00 ? 33  ARG A N    13 
ATOM   7831  C  CA   . ARG A 1 33 ? 3.852   7.467   0.300   1.00 0.00 ? 33  ARG A CA   13 
ATOM   7832  C  C    . ARG A 1 33 ? 5.062   7.577   1.224   1.00 0.00 ? 33  ARG A C    13 
ATOM   7833  O  O    . ARG A 1 33 ? 6.001   8.325   0.950   1.00 0.00 ? 33  ARG A O    13 
ATOM   7834  C  CB   . ARG A 1 33 ? 2.918   8.658   0.521   1.00 0.00 ? 33  ARG A CB   13 
ATOM   7835  C  CG   . ARG A 1 33 ? 2.033   8.519   1.749   1.00 0.00 ? 33  ARG A CG   13 
ATOM   7836  C  CD   . ARG A 1 33 ? 1.731   9.872   2.374   1.00 0.00 ? 33  ARG A CD   13 
ATOM   7837  N  NE   . ARG A 1 33 ? 0.668   9.788   3.373   1.00 0.00 ? 33  ARG A NE   13 
ATOM   7838  C  CZ   . ARG A 1 33 ? 0.523   10.659  4.365   1.00 0.00 ? 33  ARG A CZ   13 
ATOM   7839  N  NH1  . ARG A 1 33 ? 1.367   11.674  4.491   1.00 0.00 ? 33  ARG A NH1  13 
ATOM   7840  N  NH2  . ARG A 1 33 ? -0.470  10.515  5.235   1.00 0.00 ? 33  ARG A NH2  13 
ATOM   7841  H  H    . ARG A 1 33 ? 2.332   6.219   1.082   1.00 0.00 ? 33  ARG A H    13 
ATOM   7842  H  HA   . ARG A 1 33 ? 4.195   7.475   -0.724  1.00 0.00 ? 33  ARG A HA   13 
ATOM   7843  H  HB2  . ARG A 1 33 ? 3.514   9.552   0.634   1.00 0.00 ? 33  ARG A HB2  13 
ATOM   7844  H  HB3  . ARG A 1 33 ? 2.282   8.766   -0.344  1.00 0.00 ? 33  ARG A HB3  13 
ATOM   7845  H  HG2  . ARG A 1 33 ? 1.103   8.053   1.460   1.00 0.00 ? 33  ARG A HG2  13 
ATOM   7846  H  HG3  . ARG A 1 33 ? 2.538   7.901   2.476   1.00 0.00 ? 33  ARG A HG3  13 
ATOM   7847  H  HD2  . ARG A 1 33 ? 2.627   10.244  2.847   1.00 0.00 ? 33  ARG A HD2  13 
ATOM   7848  H  HD3  . ARG A 1 33 ? 1.426   10.554  1.594   1.00 0.00 ? 33  ARG A HD3  13 
ATOM   7849  H  HE   . ARG A 1 33 ? 0.033   9.046   3.299   1.00 0.00 ? 33  ARG A HE   13 
ATOM   7850  H  HH11 . ARG A 1 33 ? 2.114   11.785  3.837   1.00 0.00 ? 33  ARG A HH11 13 
ATOM   7851  H  HH12 . ARG A 1 33 ? 1.254   12.328  5.238   1.00 0.00 ? 33  ARG A HH12 13 
ATOM   7852  H  HH21 . ARG A 1 33 ? -1.108  9.752   5.143   1.00 0.00 ? 33  ARG A HH21 13 
ATOM   7853  H  HH22 . ARG A 1 33 ? -0.578  11.171  5.981   1.00 0.00 ? 33  ARG A HH22 13 
ATOM   7854  N  N    . THR A 1 34 ? 5.031   6.828   2.322   1.00 0.00 ? 34  THR A N    13 
ATOM   7855  C  CA   . THR A 1 34 ? 6.123   6.843   3.288   1.00 0.00 ? 34  THR A CA   13 
ATOM   7856  C  C    . THR A 1 34 ? 7.372   6.183   2.715   1.00 0.00 ? 34  THR A C    13 
ATOM   7857  O  O    . THR A 1 34 ? 8.487   6.441   3.170   1.00 0.00 ? 34  THR A O    13 
ATOM   7858  C  CB   . THR A 1 34 ? 5.729   6.124   4.592   1.00 0.00 ? 34  THR A CB   13 
ATOM   7859  O  OG1  . THR A 1 34 ? 6.562   6.570   5.668   1.00 0.00 ? 34  THR A OG1  13 
ATOM   7860  C  CG2  . THR A 1 34 ? 5.853   4.616   4.438   1.00 0.00 ? 34  THR A CG2  13 
ATOM   7861  H  H    . THR A 1 34 ? 4.255   6.253   2.486   1.00 0.00 ? 34  THR A H    13 
ATOM   7862  H  HA   . THR A 1 34 ? 6.347   7.873   3.523   1.00 0.00 ? 34  THR A HA   13 
ATOM   7863  H  HB   . THR A 1 34 ? 4.700   6.364   4.821   1.00 0.00 ? 34  THR A HB   13 
ATOM   7864  H  HG1  . THR A 1 34 ? 6.033   7.063   6.300   1.00 0.00 ? 34  THR A HG1  13 
ATOM   7865  H  HG21 . THR A 1 34 ? 5.474   4.321   3.472   1.00 0.00 ? 34  THR A HG21 13 
ATOM   7866  H  HG22 . THR A 1 34 ? 5.283   4.126   5.213   1.00 0.00 ? 34  THR A HG22 13 
ATOM   7867  H  HG23 . THR A 1 34 ? 6.892   4.330   4.520   1.00 0.00 ? 34  THR A HG23 13 
ATOM   7868  N  N    . HIS A 1 35 ? 7.179   5.330   1.714   1.00 0.00 ? 35  HIS A N    13 
ATOM   7869  C  CA   . HIS A 1 35 ? 8.292   4.634   1.078   1.00 0.00 ? 35  HIS A CA   13 
ATOM   7870  C  C    . HIS A 1 35 ? 9.075   5.577   0.169   1.00 0.00 ? 35  HIS A C    13 
ATOM   7871  O  O    . HIS A 1 35 ? 10.000  5.160   -0.528  1.00 0.00 ? 35  HIS A O    13 
ATOM   7872  C  CB   . HIS A 1 35 ? 7.780   3.439   0.272   1.00 0.00 ? 35  HIS A CB   13 
ATOM   7873  C  CG   . HIS A 1 35 ? 7.285   2.311   1.124   1.00 0.00 ? 35  HIS A CG   13 
ATOM   7874  N  ND1  . HIS A 1 35 ? 8.102   1.298   1.580   1.00 0.00 ? 35  HIS A ND1  13 
ATOM   7875  C  CD2  . HIS A 1 35 ? 6.049   2.041   1.603   1.00 0.00 ? 35  HIS A CD2  13 
ATOM   7876  C  CE1  . HIS A 1 35 ? 7.388   0.452   2.301   1.00 0.00 ? 35  HIS A CE1  13 
ATOM   7877  N  NE2  . HIS A 1 35 ? 6.139   0.880   2.332   1.00 0.00 ? 35  HIS A NE2  13 
ATOM   7878  H  H    . HIS A 1 35 ? 6.268   5.166   1.395   1.00 0.00 ? 35  HIS A H    13 
ATOM   7879  H  HA   . HIS A 1 35 ? 8.949   4.277   1.856   1.00 0.00 ? 35  HIS A HA   13 
ATOM   7880  H  HB2  . HIS A 1 35 ? 6.965   3.762   -0.358  1.00 0.00 ? 35  HIS A HB2  13 
ATOM   7881  H  HB3  . HIS A 1 35 ? 8.581   3.062   -0.348  1.00 0.00 ? 35  HIS A HB3  13 
ATOM   7882  H  HD1  . HIS A 1 35 ? 9.060   1.211   1.399   1.00 0.00 ? 35  HIS A HD1  13 
ATOM   7883  H  HD2  . HIS A 1 35 ? 5.155   2.628   1.443   1.00 0.00 ? 35  HIS A HD2  13 
ATOM   7884  H  HE1  . HIS A 1 35 ? 7.762   -0.438  2.785   1.00 0.00 ? 35  HIS A HE1  13 
ATOM   7885  N  N    . THR A 1 36 ? 8.698   6.852   0.181   1.00 0.00 ? 36  THR A N    13 
ATOM   7886  C  CA   . THR A 1 36 ? 9.363   7.854   -0.642  1.00 0.00 ? 36  THR A CA   13 
ATOM   7887  C  C    . THR A 1 36 ? 9.663   7.310   -2.034  1.00 0.00 ? 36  THR A C    13 
ATOM   7888  O  O    . THR A 1 36 ? 10.752  7.513   -2.569  1.00 0.00 ? 36  THR A O    13 
ATOM   7889  C  CB   . THR A 1 36 ? 10.677  8.331   0.004   1.00 0.00 ? 36  THR A CB   13 
ATOM   7890  O  OG1  . THR A 1 36 ? 10.572  8.265   1.431   1.00 0.00 ? 36  THR A OG1  13 
ATOM   7891  C  CG2  . THR A 1 36 ? 11.003  9.754   -0.420  1.00 0.00 ? 36  THR A CG2  13 
ATOM   7892  H  H    . THR A 1 36 ? 7.953   7.124   0.758   1.00 0.00 ? 36  THR A H    13 
ATOM   7893  H  HA   . THR A 1 36 ? 8.701   8.703   -0.733  1.00 0.00 ? 36  THR A HA   13 
ATOM   7894  H  HB   . THR A 1 36 ? 11.477  7.681   -0.321  1.00 0.00 ? 36  THR A HB   13 
ATOM   7895  H  HG1  . THR A 1 36 ? 11.164  7.586   1.764   1.00 0.00 ? 36  THR A HG1  13 
ATOM   7896  H  HG21 . THR A 1 36 ? 10.094  10.334  -0.465  1.00 0.00 ? 36  THR A HG21 13 
ATOM   7897  H  HG22 . THR A 1 36 ? 11.470  9.741   -1.394  1.00 0.00 ? 36  THR A HG22 13 
ATOM   7898  H  HG23 . THR A 1 36 ? 11.678  10.198  0.297   1.00 0.00 ? 36  THR A HG23 13 
ATOM   7899  N  N    . GLY A 1 37 ? 8.688   6.618   -2.617  1.00 0.00 ? 37  GLY A N    13 
ATOM   7900  C  CA   . GLY A 1 37 ? 8.868   6.056   -3.943  1.00 0.00 ? 37  GLY A CA   13 
ATOM   7901  C  C    . GLY A 1 37 ? 7.638   6.217   -4.813  1.00 0.00 ? 37  GLY A C    13 
ATOM   7902  O  O    . GLY A 1 37 ? 7.130   5.243   -5.368  1.00 0.00 ? 37  GLY A O    13 
ATOM   7903  H  H    . GLY A 1 37 ? 7.841   6.488   -2.143  1.00 0.00 ? 37  GLY A H    13 
ATOM   7904  H  HA2  . GLY A 1 37 ? 9.702   6.549   -4.421  1.00 0.00 ? 37  GLY A HA2  13 
ATOM   7905  H  HA3  . GLY A 1 37 ? 9.092   5.003   -3.848  1.00 0.00 ? 37  GLY A HA3  13 
ATOM   7906  N  N    . GLU A 1 38 ? 7.156   7.451   -4.931  1.00 0.00 ? 38  GLU A N    13 
ATOM   7907  C  CA   . GLU A 1 38 ? 5.975   7.735   -5.738  1.00 0.00 ? 38  GLU A CA   13 
ATOM   7908  C  C    . GLU A 1 38 ? 6.060   7.035   -7.092  1.00 0.00 ? 38  GLU A C    13 
ATOM   7909  O  O    . GLU A 1 38 ? 7.101   7.054   -7.748  1.00 0.00 ? 38  GLU A O    13 
ATOM   7910  C  CB   . GLU A 1 38 ? 5.819   9.243   -5.941  1.00 0.00 ? 38  GLU A CB   13 
ATOM   7911  C  CG   . GLU A 1 38 ? 7.043   9.905   -6.551  1.00 0.00 ? 38  GLU A CG   13 
ATOM   7912  C  CD   . GLU A 1 38 ? 6.807   11.363  -6.895  1.00 0.00 ? 38  GLU A CD   13 
ATOM   7913  O  OE1  . GLU A 1 38 ? 6.619   12.170  -5.961  1.00 0.00 ? 38  GLU A OE1  13 
ATOM   7914  O  OE2  . GLU A 1 38 ? 6.810   11.697  -8.099  1.00 0.00 ? 38  GLU A OE2  13 
ATOM   7915  H  H    . GLU A 1 38 ? 7.605   8.186   -4.465  1.00 0.00 ? 38  GLU A H    13 
ATOM   7916  H  HA   . GLU A 1 38 ? 5.113   7.361   -5.207  1.00 0.00 ? 38  GLU A HA   13 
ATOM   7917  H  HB2  . GLU A 1 38 ? 4.976   9.422   -6.592  1.00 0.00 ? 38  GLU A HB2  13 
ATOM   7918  H  HB3  . GLU A 1 38 ? 5.627   9.704   -4.983  1.00 0.00 ? 38  GLU A HB3  13 
ATOM   7919  H  HG2  . GLU A 1 38 ? 7.858   9.846   -5.845  1.00 0.00 ? 38  GLU A HG2  13 
ATOM   7920  H  HG3  . GLU A 1 38 ? 7.311   9.376   -7.453  1.00 0.00 ? 38  GLU A HG3  13 
ATOM   7921  N  N    . SER A 1 39 ? 4.957   6.418   -7.503  1.00 0.00 ? 39  SER A N    13 
ATOM   7922  C  CA   . SER A 1 39 ? 4.907   5.708   -8.775  1.00 0.00 ? 39  SER A CA   13 
ATOM   7923  C  C    . SER A 1 39 ? 5.011   6.682   -9.945  1.00 0.00 ? 39  SER A C    13 
ATOM   7924  O  O    . SER A 1 39 ? 5.759   6.452   -10.895 1.00 0.00 ? 39  SER A O    13 
ATOM   7925  C  CB   . SER A 1 39 ? 3.612   4.901   -8.883  1.00 0.00 ? 39  SER A CB   13 
ATOM   7926  O  OG   . SER A 1 39 ? 3.733   3.868   -9.845  1.00 0.00 ? 39  SER A OG   13 
ATOM   7927  H  H    . SER A 1 39 ? 4.158   6.438   -6.935  1.00 0.00 ? 39  SER A H    13 
ATOM   7928  H  HA   . SER A 1 39 ? 5.747   5.031   -8.811  1.00 0.00 ? 39  SER A HA   13 
ATOM   7929  H  HB2  . SER A 1 39 ? 3.386   4.459   -7.925  1.00 0.00 ? 39  SER A HB2  13 
ATOM   7930  H  HB3  . SER A 1 39 ? 2.805   5.557   -9.176  1.00 0.00 ? 39  SER A HB3  13 
ATOM   7931  H  HG   . SER A 1 39 ? 3.150   3.142   -9.611  1.00 0.00 ? 39  SER A HG   13 
ATOM   7932  N  N    . GLY A 1 40 ? 4.254   7.773   -9.868  1.00 0.00 ? 40  GLY A N    13 
ATOM   7933  C  CA   . GLY A 1 40 ? 4.275   8.766   -10.926 1.00 0.00 ? 40  GLY A CA   13 
ATOM   7934  C  C    . GLY A 1 40 ? 2.907   8.988   -11.540 1.00 0.00 ? 40  GLY A C    13 
ATOM   7935  O  O    . GLY A 1 40 ? 2.156   8.046   -11.793 1.00 0.00 ? 40  GLY A O    13 
ATOM   7936  H  H    . GLY A 1 40 ? 3.677   7.903   -9.087  1.00 0.00 ? 40  GLY A H    13 
ATOM   7937  H  HA2  . GLY A 1 40 ? 4.632   9.700   -10.520 1.00 0.00 ? 40  GLY A HA2  13 
ATOM   7938  H  HA3  . GLY A 1 40 ? 4.954   8.438   -11.699 1.00 0.00 ? 40  GLY A HA3  13 
ATOM   7939  N  N    . PRO A 1 41 ? 2.564   10.261  -11.786 1.00 0.00 ? 41  PRO A N    13 
ATOM   7940  C  CA   . PRO A 1 41 ? 1.275   10.634  -12.376 1.00 0.00 ? 41  PRO A CA   13 
ATOM   7941  C  C    . PRO A 1 41 ? 1.164   10.218  -13.838 1.00 0.00 ? 41  PRO A C    13 
ATOM   7942  O  O    . PRO A 1 41 ? 0.107   9.778   -14.290 1.00 0.00 ? 41  PRO A O    13 
ATOM   7943  C  CB   . PRO A 1 41 ? 1.256   12.160  -12.251 1.00 0.00 ? 41  PRO A CB   13 
ATOM   7944  C  CG   . PRO A 1 41 ? 2.692   12.555  -12.211 1.00 0.00 ? 41  PRO A CG   13 
ATOM   7945  C  CD   . PRO A 1 41 ? 3.410   11.435  -11.510 1.00 0.00 ? 41  PRO A CD   13 
ATOM   7946  H  HA   . PRO A 1 41 ? 0.449   10.216  -11.820 1.00 0.00 ? 41  PRO A HA   13 
ATOM   7947  H  HB2  . PRO A 1 41 ? 0.751   12.587  -13.106 1.00 0.00 ? 41  PRO A HB2  13 
ATOM   7948  H  HB3  . PRO A 1 41 ? 0.743   12.444  -11.344 1.00 0.00 ? 41  PRO A HB3  13 
ATOM   7949  H  HG2  . PRO A 1 41 ? 3.069   12.671  -13.216 1.00 0.00 ? 41  PRO A HG2  13 
ATOM   7950  H  HG3  . PRO A 1 41 ? 2.804   13.475  -11.658 1.00 0.00 ? 41  PRO A HG3  13 
ATOM   7951  H  HD2  . PRO A 1 41 ? 4.399   11.304  -11.923 1.00 0.00 ? 41  PRO A HD2  13 
ATOM   7952  H  HD3  . PRO A 1 41 ? 3.465   11.628  -10.448 1.00 0.00 ? 41  PRO A HD3  13 
ATOM   7953  N  N    . SER A 1 42 ? 2.262   10.360  -14.574 1.00 0.00 ? 42  SER A N    13 
ATOM   7954  C  CA   . SER A 1 42 ? 2.286   10.002  -15.987 1.00 0.00 ? 42  SER A CA   13 
ATOM   7955  C  C    . SER A 1 42 ? 1.058   10.548  -16.708 1.00 0.00 ? 42  SER A C    13 
ATOM   7956  O  O    . SER A 1 42 ? 0.467   9.873   -17.551 1.00 0.00 ? 42  SER A O    13 
ATOM   7957  C  CB   . SER A 1 42 ? 2.352   8.482   -16.149 1.00 0.00 ? 42  SER A CB   13 
ATOM   7958  O  OG   . SER A 1 42 ? 3.693   8.024   -16.126 1.00 0.00 ? 42  SER A OG   13 
ATOM   7959  H  H    . SER A 1 42 ? 3.074   10.717  -14.157 1.00 0.00 ? 42  SER A H    13 
ATOM   7960  H  HA   . SER A 1 42 ? 3.171   10.440  -16.425 1.00 0.00 ? 42  SER A HA   13 
ATOM   7961  H  HB2  . SER A 1 42 ? 1.811   8.013   -15.341 1.00 0.00 ? 42  SER A HB2  13 
ATOM   7962  H  HB3  . SER A 1 42 ? 1.905   8.203   -17.092 1.00 0.00 ? 42  SER A HB3  13 
ATOM   7963  H  HG   . SER A 1 42 ? 4.284   8.770   -16.007 1.00 0.00 ? 42  SER A HG   13 
ATOM   7964  N  N    . SER A 1 43 ? 0.679   11.777  -16.370 1.00 0.00 ? 43  SER A N    13 
ATOM   7965  C  CA   . SER A 1 43 ? -0.481  12.414  -16.981 1.00 0.00 ? 43  SER A CA   13 
ATOM   7966  C  C    . SER A 1 43 ? -0.094  13.118  -18.278 1.00 0.00 ? 43  SER A C    13 
ATOM   7967  O  O    . SER A 1 43 ? -0.549  14.227  -18.556 1.00 0.00 ? 43  SER A O    13 
ATOM   7968  C  CB   . SER A 1 43 ? -1.108  13.418  -16.011 1.00 0.00 ? 43  SER A CB   13 
ATOM   7969  O  OG   . SER A 1 43 ? -0.312  14.584  -15.898 1.00 0.00 ? 43  SER A OG   13 
ATOM   7970  H  H    . SER A 1 43 ? 1.191   12.265  -15.691 1.00 0.00 ? 43  SER A H    13 
ATOM   7971  H  HA   . SER A 1 43 ? -1.203  11.644  -17.205 1.00 0.00 ? 43  SER A HA   13 
ATOM   7972  H  HB2  . SER A 1 43 ? -2.087  13.698  -16.369 1.00 0.00 ? 43  SER A HB2  13 
ATOM   7973  H  HB3  . SER A 1 43 ? -1.199  12.962  -15.035 1.00 0.00 ? 43  SER A HB3  13 
ATOM   7974  H  HG   . SER A 1 43 ? 0.495   14.472  -16.407 1.00 0.00 ? 43  SER A HG   13 
ATOM   7975  N  N    . GLY A 1 44 ? 0.750   12.463  -19.070 1.00 0.00 ? 44  GLY A N    13 
ATOM   7976  C  CA   . GLY A 1 44 ? 1.185   13.040  -20.329 1.00 0.00 ? 44  GLY A CA   13 
ATOM   7977  C  C    . GLY A 1 44 ? 0.151   12.884  -21.426 1.00 0.00 ? 44  GLY A C    13 
ATOM   7978  O  O    . GLY A 1 44 ? 0.404   13.308  -22.553 1.00 0.00 ? 44  GLY A O    13 
ATOM   7979  H  H    . GLY A 1 44 ? 1.080   11.581  -18.798 1.00 0.00 ? 44  GLY A H    13 
ATOM   7980  H  HA2  . GLY A 1 44 ? 1.382   14.091  -20.181 1.00 0.00 ? 44  GLY A HA2  13 
ATOM   7981  H  HA3  . GLY A 1 44 ? 2.098   12.553  -20.639 1.00 0.00 ? 44  GLY A HA3  13 
HETATM 7982  ZN ZN   . ZN  B 2 .  ? 4.547   -0.312  2.868   1.00 0.00 ? 181 ZN  A ZN   13 
ATOM   7983  N  N    . GLY A 1 1  ? -2.806  -13.503 -17.445 1.00 0.00 ? 1   GLY A N    14 
ATOM   7984  C  CA   . GLY A 1 1  ? -3.101  -14.832 -16.943 1.00 0.00 ? 1   GLY A CA   14 
ATOM   7985  C  C    . GLY A 1 1  ? -4.364  -14.868 -16.106 1.00 0.00 ? 1   GLY A C    14 
ATOM   7986  O  O    . GLY A 1 1  ? -5.056  -13.859 -15.970 1.00 0.00 ? 1   GLY A O    14 
ATOM   7987  H  H1   . GLY A 1 1  ? -2.238  -13.395 -18.237 1.00 0.00 ? 1   GLY A H1   14 
ATOM   7988  H  HA2  . GLY A 1 1  ? -3.218  -15.504 -17.781 1.00 0.00 ? 1   GLY A HA2  14 
ATOM   7989  H  HA3  . GLY A 1 1  ? -2.272  -15.168 -16.338 1.00 0.00 ? 1   GLY A HA3  14 
ATOM   7990  N  N    . SER A 1 2  ? -4.667  -16.034 -15.544 1.00 0.00 ? 2   SER A N    14 
ATOM   7991  C  CA   . SER A 1 2  ? -5.858  -16.199 -14.720 1.00 0.00 ? 2   SER A CA   14 
ATOM   7992  C  C    . SER A 1 2  ? -5.535  -15.974 -13.246 1.00 0.00 ? 2   SER A C    14 
ATOM   7993  O  O    . SER A 1 2  ? -4.495  -16.412 -12.753 1.00 0.00 ? 2   SER A O    14 
ATOM   7994  C  CB   . SER A 1 2  ? -6.450  -17.596 -14.916 1.00 0.00 ? 2   SER A CB   14 
ATOM   7995  O  OG   . SER A 1 2  ? -7.727  -17.698 -14.310 1.00 0.00 ? 2   SER A OG   14 
ATOM   7996  H  H    . SER A 1 2  ? -4.075  -16.802 -15.690 1.00 0.00 ? 2   SER A H    14 
ATOM   7997  H  HA   . SER A 1 2  ? -6.583  -15.463 -15.034 1.00 0.00 ? 2   SER A HA   14 
ATOM   7998  H  HB2  . SER A 1 2  ? -6.549  -17.798 -15.971 1.00 0.00 ? 2   SER A HB2  14 
ATOM   7999  H  HB3  . SER A 1 2  ? -5.793  -18.328 -14.469 1.00 0.00 ? 2   SER A HB3  14 
ATOM   8000  H  HG   . SER A 1 2  ? -8.290  -18.266 -14.842 1.00 0.00 ? 2   SER A HG   14 
ATOM   8001  N  N    . SER A 1 3  ? -6.433  -15.287 -12.547 1.00 0.00 ? 3   SER A N    14 
ATOM   8002  C  CA   . SER A 1 3  ? -6.243  -15.000 -11.130 1.00 0.00 ? 3   SER A CA   14 
ATOM   8003  C  C    . SER A 1 3  ? -6.877  -16.085 -10.266 1.00 0.00 ? 3   SER A C    14 
ATOM   8004  O  O    . SER A 1 3  ? -7.860  -16.712 -10.659 1.00 0.00 ? 3   SER A O    14 
ATOM   8005  C  CB   . SER A 1 3  ? -6.844  -13.637 -10.780 1.00 0.00 ? 3   SER A CB   14 
ATOM   8006  O  OG   . SER A 1 3  ? -6.298  -13.134 -9.573  1.00 0.00 ? 3   SER A OG   14 
ATOM   8007  H  H    . SER A 1 3  ? -7.242  -14.965 -12.997 1.00 0.00 ? 3   SER A H    14 
ATOM   8008  H  HA   . SER A 1 3  ? -5.181  -14.976 -10.937 1.00 0.00 ? 3   SER A HA   14 
ATOM   8009  H  HB2  . SER A 1 3  ? -6.632  -12.938 -11.575 1.00 0.00 ? 3   SER A HB2  14 
ATOM   8010  H  HB3  . SER A 1 3  ? -7.913  -13.737 -10.664 1.00 0.00 ? 3   SER A HB3  14 
ATOM   8011  H  HG   . SER A 1 3  ? -6.153  -12.189 -9.655  1.00 0.00 ? 3   SER A HG   14 
ATOM   8012  N  N    . GLY A 1 4  ? -6.306  -16.301 -9.084  1.00 0.00 ? 4   GLY A N    14 
ATOM   8013  C  CA   . GLY A 1 4  ? -6.827  -17.311 -8.182  1.00 0.00 ? 4   GLY A CA   14 
ATOM   8014  C  C    . GLY A 1 4  ? -5.729  -18.117 -7.517  1.00 0.00 ? 4   GLY A C    14 
ATOM   8015  O  O    . GLY A 1 4  ? -4.803  -17.554 -6.933  1.00 0.00 ? 4   GLY A O    14 
ATOM   8016  H  H    . GLY A 1 4  ? -5.524  -15.770 -8.824  1.00 0.00 ? 4   GLY A H    14 
ATOM   8017  H  HA2  . GLY A 1 4  ? -7.416  -16.825 -7.418  1.00 0.00 ? 4   GLY A HA2  14 
ATOM   8018  H  HA3  . GLY A 1 4  ? -7.463  -17.982 -8.740  1.00 0.00 ? 4   GLY A HA3  14 
ATOM   8019  N  N    . SER A 1 5  ? -5.833  -19.439 -7.605  1.00 0.00 ? 5   SER A N    14 
ATOM   8020  C  CA   . SER A 1 5  ? -4.843  -20.325 -7.002  1.00 0.00 ? 5   SER A CA   14 
ATOM   8021  C  C    . SER A 1 5  ? -3.431  -19.786 -7.215  1.00 0.00 ? 5   SER A C    14 
ATOM   8022  O  O    . SER A 1 5  ? -2.625  -19.744 -6.286  1.00 0.00 ? 5   SER A O    14 
ATOM   8023  C  CB   . SER A 1 5  ? -4.959  -21.731 -7.592  1.00 0.00 ? 5   SER A CB   14 
ATOM   8024  O  OG   . SER A 1 5  ? -4.820  -21.705 -9.002  1.00 0.00 ? 5   SER A OG   14 
ATOM   8025  H  H    . SER A 1 5  ? -6.594  -19.828 -8.084  1.00 0.00 ? 5   SER A H    14 
ATOM   8026  H  HA   . SER A 1 5  ? -5.042  -20.371 -5.941  1.00 0.00 ? 5   SER A HA   14 
ATOM   8027  H  HB2  . SER A 1 5  ? -4.185  -22.358 -7.178  1.00 0.00 ? 5   SER A HB2  14 
ATOM   8028  H  HB3  . SER A 1 5  ? -5.927  -22.143 -7.345  1.00 0.00 ? 5   SER A HB3  14 
ATOM   8029  H  HG   . SER A 1 5  ? -4.231  -22.411 -9.279  1.00 0.00 ? 5   SER A HG   14 
ATOM   8030  N  N    . SER A 1 6  ? -3.141  -19.376 -8.445  1.00 0.00 ? 6   SER A N    14 
ATOM   8031  C  CA   . SER A 1 6  ? -1.825  -18.844 -8.782  1.00 0.00 ? 6   SER A CA   14 
ATOM   8032  C  C    . SER A 1 6  ? -1.950  -17.509 -9.511  1.00 0.00 ? 6   SER A C    14 
ATOM   8033  O  O    . SER A 1 6  ? -2.918  -17.271 -10.232 1.00 0.00 ? 6   SER A O    14 
ATOM   8034  C  CB   . SER A 1 6  ? -1.056  -19.841 -9.650  1.00 0.00 ? 6   SER A CB   14 
ATOM   8035  O  OG   . SER A 1 6  ? 0.320   -19.506 -9.713  1.00 0.00 ? 6   SER A OG   14 
ATOM   8036  H  H    . SER A 1 6  ? -3.826  -19.435 -9.143  1.00 0.00 ? 6   SER A H    14 
ATOM   8037  H  HA   . SER A 1 6  ? -1.284  -18.688 -7.861  1.00 0.00 ? 6   SER A HA   14 
ATOM   8038  H  HB2  . SER A 1 6  ? -1.154  -20.831 -9.229  1.00 0.00 ? 6   SER A HB2  14 
ATOM   8039  H  HB3  . SER A 1 6  ? -1.463  -19.833 -10.651 1.00 0.00 ? 6   SER A HB3  14 
ATOM   8040  H  HG   . SER A 1 6  ? 0.414   -18.560 -9.846  1.00 0.00 ? 6   SER A HG   14 
ATOM   8041  N  N    . GLY A 1 7  ? -0.962  -16.641 -9.316  1.00 0.00 ? 7   GLY A N    14 
ATOM   8042  C  CA   . GLY A 1 7  ? -0.979  -15.341 -9.961  1.00 0.00 ? 7   GLY A CA   14 
ATOM   8043  C  C    . GLY A 1 7  ? -0.998  -14.200 -8.963  1.00 0.00 ? 7   GLY A C    14 
ATOM   8044  O  O    . GLY A 1 7  ? -1.578  -14.317 -7.883  1.00 0.00 ? 7   GLY A O    14 
ATOM   8045  H  H    . GLY A 1 7  ? -0.215  -16.885 -8.730  1.00 0.00 ? 7   GLY A H    14 
ATOM   8046  H  HA2  . GLY A 1 7  ? -0.101  -15.248 -10.582 1.00 0.00 ? 7   GLY A HA2  14 
ATOM   8047  H  HA3  . GLY A 1 7  ? -1.858  -15.273 -10.584 1.00 0.00 ? 7   GLY A HA3  14 
ATOM   8048  N  N    . THR A 1 8  ? -0.360  -13.090 -9.323  1.00 0.00 ? 8   THR A N    14 
ATOM   8049  C  CA   . THR A 1 8  ? -0.303  -11.924 -8.451  1.00 0.00 ? 8   THR A CA   14 
ATOM   8050  C  C    . THR A 1 8  ? -1.654  -11.222 -8.382  1.00 0.00 ? 8   THR A C    14 
ATOM   8051  O  O    . THR A 1 8  ? -2.396  -11.184 -9.363  1.00 0.00 ? 8   THR A O    14 
ATOM   8052  C  CB   . THR A 1 8  ? 0.761   -10.917 -8.928  1.00 0.00 ? 8   THR A CB   14 
ATOM   8053  O  OG1  . THR A 1 8  ? 0.945   -9.895  -7.942  1.00 0.00 ? 8   THR A OG1  14 
ATOM   8054  C  CG2  . THR A 1 8  ? 0.355   -10.286 -10.251 1.00 0.00 ? 8   THR A CG2  14 
ATOM   8055  H  H    . THR A 1 8  ? 0.083   -13.057 -10.197 1.00 0.00 ? 8   THR A H    14 
ATOM   8056  H  HA   . THR A 1 8  ? -0.031  -12.261 -7.461  1.00 0.00 ? 8   THR A HA   14 
ATOM   8057  H  HB   . THR A 1 8  ? 1.695   -11.443 -9.068  1.00 0.00 ? 8   THR A HB   14 
ATOM   8058  H  HG1  . THR A 1 8  ? 1.884   -9.768  -7.783  1.00 0.00 ? 8   THR A HG1  14 
ATOM   8059  H  HG21 . THR A 1 8  ? -0.264  -10.977 -10.804 1.00 0.00 ? 8   THR A HG21 14 
ATOM   8060  H  HG22 . THR A 1 8  ? 1.240   -10.056 -10.827 1.00 0.00 ? 8   THR A HG22 14 
ATOM   8061  H  HG23 . THR A 1 8  ? -0.198  -9.379  -10.062 1.00 0.00 ? 8   THR A HG23 14 
ATOM   8062  N  N    . GLY A 1 9  ? -1.969  -10.667 -7.215  1.00 0.00 ? 9   GLY A N    14 
ATOM   8063  C  CA   . GLY A 1 9  ? -3.231  -9.973  -7.041  1.00 0.00 ? 9   GLY A CA   14 
ATOM   8064  C  C    . GLY A 1 9  ? -4.140  -10.666 -6.044  1.00 0.00 ? 9   GLY A C    14 
ATOM   8065  O  O    . GLY A 1 9  ? -5.344  -10.784 -6.270  1.00 0.00 ? 9   GLY A O    14 
ATOM   8066  H  H    . GLY A 1 9  ? -1.338  -10.729 -6.468  1.00 0.00 ? 9   GLY A H    14 
ATOM   8067  H  HA2  . GLY A 1 9  ? -3.033  -8.970  -6.695  1.00 0.00 ? 9   GLY A HA2  14 
ATOM   8068  H  HA3  . GLY A 1 9  ? -3.736  -9.922  -7.994  1.00 0.00 ? 9   GLY A HA3  14 
ATOM   8069  N  N    . MET A 1 10 ? -3.562  -11.125 -4.939  1.00 0.00 ? 10  MET A N    14 
ATOM   8070  C  CA   . MET A 1 10 ? -4.329  -11.810 -3.904  1.00 0.00 ? 10  MET A CA   14 
ATOM   8071  C  C    . MET A 1 10 ? -4.635  -10.870 -2.743  1.00 0.00 ? 10  MET A C    14 
ATOM   8072  O  O    . MET A 1 10 ? -5.745  -10.864 -2.211  1.00 0.00 ? 10  MET A O    14 
ATOM   8073  C  CB   . MET A 1 10 ? -3.563  -13.033 -3.398  1.00 0.00 ? 10  MET A CB   14 
ATOM   8074  C  CG   . MET A 1 10 ? -4.463  -14.131 -2.853  1.00 0.00 ? 10  MET A CG   14 
ATOM   8075  S  SD   . MET A 1 10 ? -5.639  -14.737 -4.078  1.00 0.00 ? 10  MET A SD   14 
ATOM   8076  C  CE   . MET A 1 10 ? -7.070  -15.050 -3.047  1.00 0.00 ? 10  MET A CE   14 
ATOM   8077  H  H    . MET A 1 10 ? -2.598  -11.000 -4.815  1.00 0.00 ? 10  MET A H    14 
ATOM   8078  H  HA   . MET A 1 10 ? -5.260  -12.136 -4.343  1.00 0.00 ? 10  MET A HA   14 
ATOM   8079  H  HB2  . MET A 1 10 ? -2.984  -13.443 -4.212  1.00 0.00 ? 10  MET A HB2  14 
ATOM   8080  H  HB3  . MET A 1 10 ? -2.893  -12.724 -2.610  1.00 0.00 ? 10  MET A HB3  14 
ATOM   8081  H  HG2  . MET A 1 10 ? -3.846  -14.956 -2.529  1.00 0.00 ? 10  MET A HG2  14 
ATOM   8082  H  HG3  . MET A 1 10 ? -5.011  -13.741 -2.009  1.00 0.00 ? 10  MET A HG3  14 
ATOM   8083  H  HE1  . MET A 1 10 ? -7.968  -14.794 -3.591  1.00 0.00 ? 10  MET A HE1  14 
ATOM   8084  H  HE2  . MET A 1 10 ? -7.098  -16.095 -2.777  1.00 0.00 ? 10  MET A HE2  14 
ATOM   8085  H  HE3  . MET A 1 10 ? -7.007  -14.448 -2.153  1.00 0.00 ? 10  MET A HE3  14 
ATOM   8086  N  N    . LYS A 1 11 ? -3.643  -10.076 -2.353  1.00 0.00 ? 11  LYS A N    14 
ATOM   8087  C  CA   . LYS A 1 11 ? -3.806  -9.131  -1.254  1.00 0.00 ? 11  LYS A CA   14 
ATOM   8088  C  C    . LYS A 1 11 ? -4.710  -7.973  -1.663  1.00 0.00 ? 11  LYS A C    14 
ATOM   8089  O  O    . LYS A 1 11 ? -4.577  -7.401  -2.745  1.00 0.00 ? 11  LYS A O    14 
ATOM   8090  C  CB   . LYS A 1 11 ? -2.443  -8.596  -0.809  1.00 0.00 ? 11  LYS A CB   14 
ATOM   8091  C  CG   . LYS A 1 11 ? -1.799  -9.415  0.295   1.00 0.00 ? 11  LYS A CG   14 
ATOM   8092  C  CD   . LYS A 1 11 ? -0.990  -10.572 -0.267  1.00 0.00 ? 11  LYS A CD   14 
ATOM   8093  C  CE   . LYS A 1 11 ? 0.335   -10.097 -0.845  1.00 0.00 ? 11  LYS A CE   14 
ATOM   8094  N  NZ   . LYS A 1 11 ? 0.999   -11.156 -1.653  1.00 0.00 ? 11  LYS A NZ   14 
ATOM   8095  H  H    . LYS A 1 11 ? -2.780  -10.127 -2.816  1.00 0.00 ? 11  LYS A H    14 
ATOM   8096  H  HA   . LYS A 1 11 ? -4.263  -9.656  -0.430  1.00 0.00 ? 11  LYS A HA   14 
ATOM   8097  H  HB2  . LYS A 1 11 ? -1.777  -8.589  -1.659  1.00 0.00 ? 11  LYS A HB2  14 
ATOM   8098  H  HB3  . LYS A 1 11 ? -2.567  -7.583  -0.452  1.00 0.00 ? 11  LYS A HB3  14 
ATOM   8099  H  HG2  . LYS A 1 11 ? -1.143  -8.777  0.869   1.00 0.00 ? 11  LYS A HG2  14 
ATOM   8100  H  HG3  . LYS A 1 11 ? -2.574  -9.808  0.938   1.00 0.00 ? 11  LYS A HG3  14 
ATOM   8101  H  HD2  . LYS A 1 11 ? -0.792  -11.280 0.523   1.00 0.00 ? 11  LYS A HD2  14 
ATOM   8102  H  HD3  . LYS A 1 11 ? -1.562  -11.053 -1.049  1.00 0.00 ? 11  LYS A HD3  14 
ATOM   8103  H  HE2  . LYS A 1 11 ? 0.152   -9.238  -1.472  1.00 0.00 ? 11  LYS A HE2  14 
ATOM   8104  H  HE3  . LYS A 1 11 ? 0.986   -9.815  -0.031  1.00 0.00 ? 11  LYS A HE3  14 
ATOM   8105  H  HZ1  . LYS A 1 11 ? 2.012   -11.198 -1.425  1.00 0.00 ? 11  LYS A HZ1  14 
ATOM   8106  H  HZ2  . LYS A 1 11 ? 0.891   -10.951 -2.668  1.00 0.00 ? 11  LYS A HZ2  14 
ATOM   8107  H  HZ3  . LYS A 1 11 ? 0.570   -12.082 -1.451  1.00 0.00 ? 11  LYS A HZ3  14 
ATOM   8108  N  N    . PRO A 1 12 ? -5.653  -7.616  -0.777  1.00 0.00 ? 12  PRO A N    14 
ATOM   8109  C  CA   . PRO A 1 12 ? -6.596  -6.522  -1.023  1.00 0.00 ? 12  PRO A CA   14 
ATOM   8110  C  C    . PRO A 1 12 ? -5.918  -5.156  -1.000  1.00 0.00 ? 12  PRO A C    14 
ATOM   8111  O  O    . PRO A 1 12 ? -5.443  -4.671  -2.027  1.00 0.00 ? 12  PRO A O    14 
ATOM   8112  C  CB   . PRO A 1 12 ? -7.591  -6.644  0.134   1.00 0.00 ? 12  PRO A CB   14 
ATOM   8113  C  CG   . PRO A 1 12 ? -6.828  -7.321  1.220   1.00 0.00 ? 12  PRO A CG   14 
ATOM   8114  C  CD   . PRO A 1 12 ? -5.869  -8.253  0.533   1.00 0.00 ? 12  PRO A CD   14 
ATOM   8115  H  HA   . PRO A 1 12 ? -7.115  -6.649  -1.962  1.00 0.00 ? 12  PRO A HA   14 
ATOM   8116  H  HB2  . PRO A 1 12 ? -7.920  -5.659  0.435   1.00 0.00 ? 12  PRO A HB2  14 
ATOM   8117  H  HB3  . PRO A 1 12 ? -8.440  -7.234  -0.178  1.00 0.00 ? 12  PRO A HB3  14 
ATOM   8118  H  HG2  . PRO A 1 12 ? -6.288  -6.589  1.800   1.00 0.00 ? 12  PRO A HG2  14 
ATOM   8119  H  HG3  . PRO A 1 12 ? -7.504  -7.878  1.851   1.00 0.00 ? 12  PRO A HG3  14 
ATOM   8120  H  HD2  . PRO A 1 12 ? -4.944  -8.319  1.087   1.00 0.00 ? 12  PRO A HD2  14 
ATOM   8121  H  HD3  . PRO A 1 12 ? -6.312  -9.232  0.416   1.00 0.00 ? 12  PRO A HD3  14 
ATOM   8122  N  N    . TYR A 1 13 ? -5.877  -4.541  0.177   1.00 0.00 ? 13  TYR A N    14 
ATOM   8123  C  CA   . TYR A 1 13 ? -5.258  -3.230  0.332   1.00 0.00 ? 13  TYR A CA   14 
ATOM   8124  C  C    . TYR A 1 13 ? -3.928  -3.339  1.071   1.00 0.00 ? 13  TYR A C    14 
ATOM   8125  O  O    . TYR A 1 13 ? -3.405  -2.348  1.583   1.00 0.00 ? 13  TYR A O    14 
ATOM   8126  C  CB   . TYR A 1 13 ? -6.197  -2.286  1.086   1.00 0.00 ? 13  TYR A CB   14 
ATOM   8127  C  CG   . TYR A 1 13 ? -7.661  -2.628  0.920   1.00 0.00 ? 13  TYR A CG   14 
ATOM   8128  C  CD1  . TYR A 1 13 ? -8.229  -3.691  1.612   1.00 0.00 ? 13  TYR A CD1  14 
ATOM   8129  C  CD2  . TYR A 1 13 ? -8.476  -1.888  0.073   1.00 0.00 ? 13  TYR A CD2  14 
ATOM   8130  C  CE1  . TYR A 1 13 ? -9.565  -4.008  1.462   1.00 0.00 ? 13  TYR A CE1  14 
ATOM   8131  C  CE2  . TYR A 1 13 ? -9.814  -2.196  -0.081  1.00 0.00 ? 13  TYR A CE2  14 
ATOM   8132  C  CZ   . TYR A 1 13 ? -10.353 -3.257  0.615   1.00 0.00 ? 13  TYR A CZ   14 
ATOM   8133  O  OH   . TYR A 1 13 ? -11.685 -3.569  0.465   1.00 0.00 ? 13  TYR A OH   14 
ATOM   8134  H  H    . TYR A 1 13 ? -6.273  -4.978  0.959   1.00 0.00 ? 13  TYR A H    14 
ATOM   8135  H  HA   . TYR A 1 13 ? -5.077  -2.829  -0.654  1.00 0.00 ? 13  TYR A HA   14 
ATOM   8136  H  HB2  . TYR A 1 13 ? -5.966  -2.324  2.139   1.00 0.00 ? 13  TYR A HB2  14 
ATOM   8137  H  HB3  . TYR A 1 13 ? -6.049  -1.279  0.726   1.00 0.00 ? 13  TYR A HB3  14 
ATOM   8138  H  HD1  . TYR A 1 13 ? -7.609  -4.277  2.275   1.00 0.00 ? 13  TYR A HD1  14 
ATOM   8139  H  HD2  . TYR A 1 13 ? -8.050  -1.057  -0.471  1.00 0.00 ? 13  TYR A HD2  14 
ATOM   8140  H  HE1  . TYR A 1 13 ? -9.988  -4.838  2.008   1.00 0.00 ? 13  TYR A HE1  14 
ATOM   8141  H  HE2  . TYR A 1 13 ? -10.431 -1.609  -0.745  1.00 0.00 ? 13  TYR A HE2  14 
ATOM   8142  H  HH   . TYR A 1 13 ? -12.181 -3.221  1.210   1.00 0.00 ? 13  TYR A HH   14 
ATOM   8143  N  N    . VAL A 1 14 ? -3.385  -4.551  1.123   1.00 0.00 ? 14  VAL A N    14 
ATOM   8144  C  CA   . VAL A 1 14 ? -2.115  -4.792  1.798   1.00 0.00 ? 14  VAL A CA   14 
ATOM   8145  C  C    . VAL A 1 14 ? -0.945  -4.287  0.961   1.00 0.00 ? 14  VAL A C    14 
ATOM   8146  O  O    . VAL A 1 14 ? -0.959  -4.379  -0.267  1.00 0.00 ? 14  VAL A O    14 
ATOM   8147  C  CB   . VAL A 1 14 ? -1.912  -6.290  2.094   1.00 0.00 ? 14  VAL A CB   14 
ATOM   8148  C  CG1  . VAL A 1 14 ? -0.717  -6.495  3.012   1.00 0.00 ? 14  VAL A CG1  14 
ATOM   8149  C  CG2  . VAL A 1 14 ? -3.172  -6.887  2.703   1.00 0.00 ? 14  VAL A CG2  14 
ATOM   8150  H  H    . VAL A 1 14 ? -3.850  -5.301  0.697   1.00 0.00 ? 14  VAL A H    14 
ATOM   8151  H  HA   . VAL A 1 14 ? -2.130  -4.259  2.737   1.00 0.00 ? 14  VAL A HA   14 
ATOM   8152  H  HB   . VAL A 1 14 ? -1.713  -6.797  1.161   1.00 0.00 ? 14  VAL A HB   14 
ATOM   8153  H  HG11 . VAL A 1 14 ? -0.030  -5.669  2.898   1.00 0.00 ? 14  VAL A HG11 14 
ATOM   8154  H  HG12 . VAL A 1 14 ? -1.054  -6.546  4.037   1.00 0.00 ? 14  VAL A HG12 14 
ATOM   8155  H  HG13 . VAL A 1 14 ? -0.217  -7.417  2.751   1.00 0.00 ? 14  VAL A HG13 14 
ATOM   8156  H  HG21 . VAL A 1 14 ? -3.982  -6.820  1.993   1.00 0.00 ? 14  VAL A HG21 14 
ATOM   8157  H  HG22 . VAL A 1 14 ? -2.994  -7.923  2.950   1.00 0.00 ? 14  VAL A HG22 14 
ATOM   8158  H  HG23 . VAL A 1 14 ? -3.432  -6.343  3.599   1.00 0.00 ? 14  VAL A HG23 14 
ATOM   8159  N  N    . CYS A 1 15 ? 0.070   -3.754  1.634   1.00 0.00 ? 15  CYS A N    14 
ATOM   8160  C  CA   . CYS A 1 15 ? 1.250   -3.234  0.954   1.00 0.00 ? 15  CYS A CA   14 
ATOM   8161  C  C    . CYS A 1 15 ? 2.044   -4.363  0.304   1.00 0.00 ? 15  CYS A C    14 
ATOM   8162  O  O    . CYS A 1 15 ? 2.494   -5.288  0.978   1.00 0.00 ? 15  CYS A O    14 
ATOM   8163  C  CB   . CYS A 1 15 ? 2.138   -2.473  1.940   1.00 0.00 ? 15  CYS A CB   14 
ATOM   8164  S  SG   . CYS A 1 15 ? 3.090   -1.114  1.187   1.00 0.00 ? 15  CYS A SG   14 
ATOM   8165  H  H    . CYS A 1 15 ? 0.023   -3.709  2.613   1.00 0.00 ? 15  CYS A H    14 
ATOM   8166  H  HA   . CYS A 1 15 ? 0.917   -2.555  0.184   1.00 0.00 ? 15  CYS A HA   14 
ATOM   8167  H  HB2  . CYS A 1 15 ? 1.519   -2.048  2.717   1.00 0.00 ? 15  CYS A HB2  14 
ATOM   8168  H  HB3  . CYS A 1 15 ? 2.842   -3.161  2.384   1.00 0.00 ? 15  CYS A HB3  14 
ATOM   8169  N  N    . ASN A 1 16 ? 2.213   -4.279  -1.012  1.00 0.00 ? 16  ASN A N    14 
ATOM   8170  C  CA   . ASN A 1 16 ? 2.953   -5.293  -1.754  1.00 0.00 ? 16  ASN A CA   14 
ATOM   8171  C  C    . ASN A 1 16 ? 4.452   -5.012  -1.712  1.00 0.00 ? 16  ASN A C    14 
ATOM   8172  O  O    . ASN A 1 16 ? 5.179   -5.332  -2.651  1.00 0.00 ? 16  ASN A O    14 
ATOM   8173  C  CB   . ASN A 1 16 ? 2.473   -5.343  -3.206  1.00 0.00 ? 16  ASN A CB   14 
ATOM   8174  C  CG   . ASN A 1 16 ? 1.105   -5.983  -3.341  1.00 0.00 ? 16  ASN A CG   14 
ATOM   8175  O  OD1  . ASN A 1 16 ? 0.118   -5.484  -2.800  1.00 0.00 ? 16  ASN A OD1  14 
ATOM   8176  N  ND2  . ASN A 1 16 ? 1.040   -7.095  -4.065  1.00 0.00 ? 16  ASN A ND2  14 
ATOM   8177  H  H    . ASN A 1 16 ? 1.831   -3.517  -1.495  1.00 0.00 ? 16  ASN A H    14 
ATOM   8178  H  HA   . ASN A 1 16 ? 2.764   -6.248  -1.289  1.00 0.00 ? 16  ASN A HA   14 
ATOM   8179  H  HB2  . ASN A 1 16 ? 2.418   -4.337  -3.596  1.00 0.00 ? 16  ASN A HB2  14 
ATOM   8180  H  HB3  . ASN A 1 16 ? 3.177   -5.914  -3.793  1.00 0.00 ? 16  ASN A HB3  14 
ATOM   8181  H  HD21 . ASN A 1 16 ? 1.867   -7.435  -4.466  1.00 0.00 ? 16  ASN A HD21 14 
ATOM   8182  H  HD22 . ASN A 1 16 ? 0.168   -7.529  -4.169  1.00 0.00 ? 16  ASN A HD22 14 
ATOM   8183  N  N    . GLU A 1 17 ? 4.906   -4.413  -0.615  1.00 0.00 ? 17  GLU A N    14 
ATOM   8184  C  CA   . GLU A 1 17 ? 6.318   -4.090  -0.451  1.00 0.00 ? 17  GLU A CA   14 
ATOM   8185  C  C    . GLU A 1 17 ? 6.806   -4.476  0.942   1.00 0.00 ? 17  GLU A C    14 
ATOM   8186  O  O    . GLU A 1 17 ? 7.885   -5.048  1.098   1.00 0.00 ? 17  GLU A O    14 
ATOM   8187  C  CB   . GLU A 1 17 ? 6.553   -2.597  -0.691  1.00 0.00 ? 17  GLU A CB   14 
ATOM   8188  C  CG   . GLU A 1 17 ? 5.950   -2.086  -1.988  1.00 0.00 ? 17  GLU A CG   14 
ATOM   8189  C  CD   . GLU A 1 17 ? 6.537   -0.756  -2.420  1.00 0.00 ? 17  GLU A CD   14 
ATOM   8190  O  OE1  . GLU A 1 17 ? 7.007   -0.003  -1.543  1.00 0.00 ? 17  GLU A OE1  14 
ATOM   8191  O  OE2  . GLU A 1 17 ? 6.525   -0.469  -3.636  1.00 0.00 ? 17  GLU A OE2  14 
ATOM   8192  H  H    . GLU A 1 17 ? 4.276   -4.183  0.099   1.00 0.00 ? 17  GLU A H    14 
ATOM   8193  H  HA   . GLU A 1 17 ? 6.875   -4.655  -1.184  1.00 0.00 ? 17  GLU A HA   14 
ATOM   8194  H  HB2  . GLU A 1 17 ? 6.121   -2.041  0.128   1.00 0.00 ? 17  GLU A HB2  14 
ATOM   8195  H  HB3  . GLU A 1 17 ? 7.617   -2.413  -0.716  1.00 0.00 ? 17  GLU A HB3  14 
ATOM   8196  H  HG2  . GLU A 1 17 ? 6.132   -2.812  -2.766  1.00 0.00 ? 17  GLU A HG2  14 
ATOM   8197  H  HG3  . GLU A 1 17 ? 4.885   -1.966  -1.852  1.00 0.00 ? 17  GLU A HG3  14 
ATOM   8198  N  N    . CYS A 1 18 ? 6.004   -4.159  1.953   1.00 0.00 ? 18  CYS A N    14 
ATOM   8199  C  CA   . CYS A 1 18 ? 6.353   -4.470  3.333   1.00 0.00 ? 18  CYS A CA   14 
ATOM   8200  C  C    . CYS A 1 18 ? 5.399   -5.510  3.914   1.00 0.00 ? 18  CYS A C    14 
ATOM   8201  O  O    . CYS A 1 18 ? 5.810   -6.398  4.660   1.00 0.00 ? 18  CYS A O    14 
ATOM   8202  C  CB   . CYS A 1 18 ? 6.322   -3.201  4.188   1.00 0.00 ? 18  CYS A CB   14 
ATOM   8203  S  SG   . CYS A 1 18 ? 4.748   -2.289  4.108   1.00 0.00 ? 18  CYS A SG   14 
ATOM   8204  H  H    . CYS A 1 18 ? 5.156   -3.703  1.765   1.00 0.00 ? 18  CYS A H    14 
ATOM   8205  H  HA   . CYS A 1 18 ? 7.353   -4.874  3.340   1.00 0.00 ? 18  CYS A HA   14 
ATOM   8206  H  HB2  . CYS A 1 18 ? 6.495   -3.468  5.221   1.00 0.00 ? 18  CYS A HB2  14 
ATOM   8207  H  HB3  . CYS A 1 18 ? 7.106   -2.535  3.858   1.00 0.00 ? 18  CYS A HB3  14 
ATOM   8208  N  N    . GLY A 1 19 ? 4.121   -5.394  3.565   1.00 0.00 ? 19  GLY A N    14 
ATOM   8209  C  CA   . GLY A 1 19 ? 3.129   -6.330  4.059   1.00 0.00 ? 19  GLY A CA   14 
ATOM   8210  C  C    . GLY A 1 19 ? 2.123   -5.674  4.984   1.00 0.00 ? 19  GLY A C    14 
ATOM   8211  O  O    . GLY A 1 19 ? 1.416   -6.354  5.728   1.00 0.00 ? 19  GLY A O    14 
ATOM   8212  H  H    . GLY A 1 19 ? 3.850   -4.666  2.966   1.00 0.00 ? 19  GLY A H    14 
ATOM   8213  H  HA2  . GLY A 1 19 ? 2.603   -6.758  3.219   1.00 0.00 ? 19  GLY A HA2  14 
ATOM   8214  H  HA3  . GLY A 1 19 ? 3.632   -7.120  4.597   1.00 0.00 ? 19  GLY A HA3  14 
ATOM   8215  N  N    . LYS A 1 20 ? 2.059   -4.348  4.941   1.00 0.00 ? 20  LYS A N    14 
ATOM   8216  C  CA   . LYS A 1 20 ? 1.134   -3.598  5.782   1.00 0.00 ? 20  LYS A CA   14 
ATOM   8217  C  C    . LYS A 1 20 ? -0.300  -3.753  5.285   1.00 0.00 ? 20  LYS A C    14 
ATOM   8218  O  O    . LYS A 1 20 ? -0.650  -3.266  4.210   1.00 0.00 ? 20  LYS A O    14 
ATOM   8219  C  CB   . LYS A 1 20 ? 1.519   -2.117  5.806   1.00 0.00 ? 20  LYS A CB   14 
ATOM   8220  C  CG   . LYS A 1 20 ? 0.901   -1.346  6.960   1.00 0.00 ? 20  LYS A CG   14 
ATOM   8221  C  CD   . LYS A 1 20 ? 1.760   -1.432  8.211   1.00 0.00 ? 20  LYS A CD   14 
ATOM   8222  C  CE   . LYS A 1 20 ? 1.371   -0.370  9.227   1.00 0.00 ? 20  LYS A CE   14 
ATOM   8223  N  NZ   . LYS A 1 20 ? 1.620   1.006   8.715   1.00 0.00 ? 20  LYS A NZ   14 
ATOM   8224  H  H    . LYS A 1 20 ? 2.649   -3.861  4.327   1.00 0.00 ? 20  LYS A H    14 
ATOM   8225  H  HA   . LYS A 1 20 ? 1.200   -3.995  6.784   1.00 0.00 ? 20  LYS A HA   14 
ATOM   8226  H  HB2  . LYS A 1 20 ? 2.594   -2.038  5.882   1.00 0.00 ? 20  LYS A HB2  14 
ATOM   8227  H  HB3  . LYS A 1 20 ? 1.198   -1.659  4.881   1.00 0.00 ? 20  LYS A HB3  14 
ATOM   8228  H  HG2  . LYS A 1 20 ? 0.801   -0.309  6.675   1.00 0.00 ? 20  LYS A HG2  14 
ATOM   8229  H  HG3  . LYS A 1 20 ? -0.074  -1.758  7.174   1.00 0.00 ? 20  LYS A HG3  14 
ATOM   8230  H  HD2  . LYS A 1 20 ? 1.632   -2.406  8.658   1.00 0.00 ? 20  LYS A HD2  14 
ATOM   8231  H  HD3  . LYS A 1 20 ? 2.796   -1.293  7.936   1.00 0.00 ? 20  LYS A HD3  14 
ATOM   8232  H  HE2  . LYS A 1 20 ? 0.321   -0.475  9.455   1.00 0.00 ? 20  LYS A HE2  14 
ATOM   8233  H  HE3  . LYS A 1 20 ? 1.951   -0.520  10.126  1.00 0.00 ? 20  LYS A HE3  14 
ATOM   8234  H  HZ1  . LYS A 1 20 ? 1.014   1.196   7.891   1.00 0.00 ? 20  LYS A HZ1  14 
ATOM   8235  H  HZ2  . LYS A 1 20 ? 2.615   1.106   8.430   1.00 0.00 ? 20  LYS A HZ2  14 
ATOM   8236  H  HZ3  . LYS A 1 20 ? 1.411   1.706   9.454   1.00 0.00 ? 20  LYS A HZ3  14 
ATOM   8237  N  N    . ALA A 1 21 ? -1.125  -4.432  6.075   1.00 0.00 ? 21  ALA A N    14 
ATOM   8238  C  CA   . ALA A 1 21 ? -2.522  -4.647  5.717   1.00 0.00 ? 21  ALA A CA   14 
ATOM   8239  C  C    . ALA A 1 21 ? -3.403  -3.518  6.239   1.00 0.00 ? 21  ALA A C    14 
ATOM   8240  O  O    . ALA A 1 21 ? -3.414  -3.228  7.435   1.00 0.00 ? 21  ALA A O    14 
ATOM   8241  C  CB   . ALA A 1 21 ? -3.004  -5.987  6.253   1.00 0.00 ? 21  ALA A CB   14 
ATOM   8242  H  H    . ALA A 1 21 ? -0.787  -4.796  6.920   1.00 0.00 ? 21  ALA A H    14 
ATOM   8243  H  HA   . ALA A 1 21 ? -2.589  -4.674  4.638   1.00 0.00 ? 21  ALA A HA   14 
ATOM   8244  H  HB1  . ALA A 1 21 ? -3.456  -5.844  7.224   1.00 0.00 ? 21  ALA A HB1  14 
ATOM   8245  H  HB2  . ALA A 1 21 ? -3.733  -6.404  5.574   1.00 0.00 ? 21  ALA A HB2  14 
ATOM   8246  H  HB3  . ALA A 1 21 ? -2.166  -6.662  6.342   1.00 0.00 ? 21  ALA A HB3  14 
ATOM   8247  N  N    . PHE A 1 22 ? -4.140  -2.882  5.334   1.00 0.00 ? 22  PHE A N    14 
ATOM   8248  C  CA   . PHE A 1 22 ? -5.023  -1.782  5.703   1.00 0.00 ? 22  PHE A CA   14 
ATOM   8249  C  C    . PHE A 1 22 ? -6.485  -2.162  5.486   1.00 0.00 ? 22  PHE A C    14 
ATOM   8250  O  O    . PHE A 1 22 ? -6.787  -3.169  4.844   1.00 0.00 ? 22  PHE A O    14 
ATOM   8251  C  CB   . PHE A 1 22 ? -4.683  -0.531  4.890   1.00 0.00 ? 22  PHE A CB   14 
ATOM   8252  C  CG   . PHE A 1 22 ? -3.220  -0.193  4.896   1.00 0.00 ? 22  PHE A CG   14 
ATOM   8253  C  CD1  . PHE A 1 22 ? -2.321  -0.936  4.149   1.00 0.00 ? 22  PHE A CD1  14 
ATOM   8254  C  CD2  . PHE A 1 22 ? -2.744  0.869   5.648   1.00 0.00 ? 22  PHE A CD2  14 
ATOM   8255  C  CE1  . PHE A 1 22 ? -0.973  -0.627  4.151   1.00 0.00 ? 22  PHE A CE1  14 
ATOM   8256  C  CE2  . PHE A 1 22 ? -1.398  1.184   5.654   1.00 0.00 ? 22  PHE A CE2  14 
ATOM   8257  C  CZ   . PHE A 1 22 ? -0.512  0.434   4.906   1.00 0.00 ? 22  PHE A CZ   14 
ATOM   8258  H  H    . PHE A 1 22 ? -4.088  -3.159  4.395   1.00 0.00 ? 22  PHE A H    14 
ATOM   8259  H  HA   . PHE A 1 22 ? -4.871  -1.573  6.751   1.00 0.00 ? 22  PHE A HA   14 
ATOM   8260  H  HB2  . PHE A 1 22 ? -4.984  -0.685  3.865   1.00 0.00 ? 22  PHE A HB2  14 
ATOM   8261  H  HB3  . PHE A 1 22 ? -5.222  0.311   5.297   1.00 0.00 ? 22  PHE A HB3  14 
ATOM   8262  H  HD1  . PHE A 1 22 ? -2.681  -1.767  3.558   1.00 0.00 ? 22  PHE A HD1  14 
ATOM   8263  H  HD2  . PHE A 1 22 ? -3.436  1.456   6.235   1.00 0.00 ? 22  PHE A HD2  14 
ATOM   8264  H  HE1  . PHE A 1 22 ? -0.283  -1.215  3.565   1.00 0.00 ? 22  PHE A HE1  14 
ATOM   8265  H  HE2  . PHE A 1 22 ? -1.040  2.013   6.245   1.00 0.00 ? 22  PHE A HE2  14 
ATOM   8266  H  HZ   . PHE A 1 22 ? 0.540   0.678   4.908   1.00 0.00 ? 22  PHE A HZ   14 
ATOM   8267  N  N    . ARG A 1 23 ? -7.388  -1.350  6.025   1.00 0.00 ? 23  ARG A N    14 
ATOM   8268  C  CA   . ARG A 1 23 ? -8.818  -1.601  5.892   1.00 0.00 ? 23  ARG A CA   14 
ATOM   8269  C  C    . ARG A 1 23 ? -9.318  -1.177  4.514   1.00 0.00 ? 23  ARG A C    14 
ATOM   8270  O  O    . ARG A 1 23 ? -10.174 -1.837  3.923   1.00 0.00 ? 23  ARG A O    14 
ATOM   8271  C  CB   . ARG A 1 23 ? -9.592  -0.854  6.979   1.00 0.00 ? 23  ARG A CB   14 
ATOM   8272  C  CG   . ARG A 1 23 ? -9.412  -1.442  8.369   1.00 0.00 ? 23  ARG A CG   14 
ATOM   8273  C  CD   . ARG A 1 23 ? -9.705  -0.415  9.451   1.00 0.00 ? 23  ARG A CD   14 
ATOM   8274  N  NE   . ARG A 1 23 ? -9.068  -0.760  10.719  1.00 0.00 ? 23  ARG A NE   14 
ATOM   8275  C  CZ   . ARG A 1 23 ? -9.580  -1.626  11.587  1.00 0.00 ? 23  ARG A CZ   14 
ATOM   8276  N  NH1  . ARG A 1 23 ? -10.730 -2.231  11.325  1.00 0.00 ? 23  ARG A NH1  14 
ATOM   8277  N  NH2  . ARG A 1 23 ? -8.941  -1.888  12.720  1.00 0.00 ? 23  ARG A NH2  14 
ATOM   8278  H  H    . ARG A 1 23 ? -7.086  -0.563  6.525   1.00 0.00 ? 23  ARG A H    14 
ATOM   8279  H  HA   . ARG A 1 23 ? -8.981  -2.662  6.010   1.00 0.00 ? 23  ARG A HA   14 
ATOM   8280  H  HB2  . ARG A 1 23 ? -9.258  0.173   7.001   1.00 0.00 ? 23  ARG A HB2  14 
ATOM   8281  H  HB3  . ARG A 1 23 ? -10.644 -0.877  6.735   1.00 0.00 ? 23  ARG A HB3  14 
ATOM   8282  H  HG2  . ARG A 1 23 ? -10.089 -2.276  8.487   1.00 0.00 ? 23  ARG A HG2  14 
ATOM   8283  H  HG3  . ARG A 1 23 ? -8.394  -1.785  8.475   1.00 0.00 ? 23  ARG A HG3  14 
ATOM   8284  H  HD2  . ARG A 1 23 ? -9.337  0.546   9.125   1.00 0.00 ? 23  ARG A HD2  14 
ATOM   8285  H  HD3  . ARG A 1 23 ? -10.773 -0.361  9.598   1.00 0.00 ? 23  ARG A HD3  14 
ATOM   8286  H  HE   . ARG A 1 23 ? -8.217  -0.324  10.934  1.00 0.00 ? 23  ARG A HE   14 
ATOM   8287  H  HH11 . ARG A 1 23 ? -11.213 -2.037  10.471  1.00 0.00 ? 23  ARG A HH11 14 
ATOM   8288  H  HH12 . ARG A 1 23 ? -11.113 -2.884  11.979  1.00 0.00 ? 23  ARG A HH12 14 
ATOM   8289  H  HH21 . ARG A 1 23 ? -8.074  -1.433  12.922  1.00 0.00 ? 23  ARG A HH21 14 
ATOM   8290  H  HH22 . ARG A 1 23 ? -9.327  -2.539  13.373  1.00 0.00 ? 23  ARG A HH22 14 
ATOM   8291  N  N    . SER A 1 24 ? -8.779  -0.073  4.008   1.00 0.00 ? 24  SER A N    14 
ATOM   8292  C  CA   . SER A 1 24 ? -9.174  0.442   2.702   1.00 0.00 ? 24  SER A CA   14 
ATOM   8293  C  C    . SER A 1 24 ? -7.950  0.720   1.835   1.00 0.00 ? 24  SER A C    14 
ATOM   8294  O  O    . SER A 1 24 ? -6.815  0.674   2.310   1.00 0.00 ? 24  SER A O    14 
ATOM   8295  C  CB   . SER A 1 24 ? -10.001 1.719   2.862   1.00 0.00 ? 24  SER A CB   14 
ATOM   8296  O  OG   . SER A 1 24 ? -11.251 1.444   3.471   1.00 0.00 ? 24  SER A OG   14 
ATOM   8297  H  H    . SER A 1 24 ? -8.102  0.409   4.527   1.00 0.00 ? 24  SER A H    14 
ATOM   8298  H  HA   . SER A 1 24 ? -9.779  -0.311  2.218   1.00 0.00 ? 24  SER A HA   14 
ATOM   8299  H  HB2  . SER A 1 24 ? -9.460  2.420   3.478   1.00 0.00 ? 24  SER A HB2  14 
ATOM   8300  H  HB3  . SER A 1 24 ? -10.176 2.155   1.889   1.00 0.00 ? 24  SER A HB3  14 
ATOM   8301  H  HG   . SER A 1 24 ? -11.223 1.711   4.393   1.00 0.00 ? 24  SER A HG   14 
ATOM   8302  N  N    . LYS A 1 25 ? -8.189  1.010   0.561   1.00 0.00 ? 25  LYS A N    14 
ATOM   8303  C  CA   . LYS A 1 25 ? -7.108  1.298   -0.375  1.00 0.00 ? 25  LYS A CA   14 
ATOM   8304  C  C    . LYS A 1 25 ? -6.504  2.672   -0.103  1.00 0.00 ? 25  LYS A C    14 
ATOM   8305  O  O    . LYS A 1 25 ? -5.285  2.839   -0.119  1.00 0.00 ? 25  LYS A O    14 
ATOM   8306  C  CB   . LYS A 1 25 ? -7.620  1.230   -1.815  1.00 0.00 ? 25  LYS A CB   14 
ATOM   8307  C  CG   . LYS A 1 25 ? -6.517  1.063   -2.846  1.00 0.00 ? 25  LYS A CG   14 
ATOM   8308  C  CD   . LYS A 1 25 ? -7.041  0.435   -4.127  1.00 0.00 ? 25  LYS A CD   14 
ATOM   8309  C  CE   . LYS A 1 25 ? -7.796  1.447   -4.975  1.00 0.00 ? 25  LYS A CE   14 
ATOM   8310  N  NZ   . LYS A 1 25 ? -8.564  0.790   -6.069  1.00 0.00 ? 25  LYS A NZ   14 
ATOM   8311  H  H    . LYS A 1 25 ? -9.116  1.032   0.241   1.00 0.00 ? 25  LYS A H    14 
ATOM   8312  H  HA   . LYS A 1 25 ? -6.343  0.549   -0.238  1.00 0.00 ? 25  LYS A HA   14 
ATOM   8313  H  HB2  . LYS A 1 25 ? -8.297  0.393   -1.904  1.00 0.00 ? 25  LYS A HB2  14 
ATOM   8314  H  HB3  . LYS A 1 25 ? -8.157  2.141   -2.037  1.00 0.00 ? 25  LYS A HB3  14 
ATOM   8315  H  HG2  . LYS A 1 25 ? -6.103  2.033   -3.077  1.00 0.00 ? 25  LYS A HG2  14 
ATOM   8316  H  HG3  . LYS A 1 25 ? -5.745  0.429   -2.434  1.00 0.00 ? 25  LYS A HG3  14 
ATOM   8317  H  HD2  . LYS A 1 25 ? -6.208  0.054   -4.698  1.00 0.00 ? 25  LYS A HD2  14 
ATOM   8318  H  HD3  . LYS A 1 25 ? -7.707  -0.377  -3.872  1.00 0.00 ? 25  LYS A HD3  14 
ATOM   8319  H  HE2  . LYS A 1 25 ? -8.481  1.989   -4.341  1.00 0.00 ? 25  LYS A HE2  14 
ATOM   8320  H  HE3  . LYS A 1 25 ? -7.086  2.135   -5.408  1.00 0.00 ? 25  LYS A HE3  14 
ATOM   8321  H  HZ1  . LYS A 1 25 ? -9.555  1.106   -6.051  1.00 0.00 ? 25  LYS A HZ1  14 
ATOM   8322  H  HZ2  . LYS A 1 25 ? -8.539  -0.243  -5.952  1.00 0.00 ? 25  LYS A HZ2  14 
ATOM   8323  H  HZ3  . LYS A 1 25 ? -8.151  1.033   -6.992  1.00 0.00 ? 25  LYS A HZ3  14 
ATOM   8324  N  N    . SER A 1 26 ? -7.366  3.653   0.148   1.00 0.00 ? 26  SER A N    14 
ATOM   8325  C  CA   . SER A 1 26 ? -6.918  5.013   0.421   1.00 0.00 ? 26  SER A CA   14 
ATOM   8326  C  C    . SER A 1 26 ? -5.962  5.041   1.609   1.00 0.00 ? 26  SER A C    14 
ATOM   8327  O  O    . SER A 1 26 ? -5.056  5.873   1.672   1.00 0.00 ? 26  SER A O    14 
ATOM   8328  C  CB   . SER A 1 26 ? -8.117  5.922   0.695   1.00 0.00 ? 26  SER A CB   14 
ATOM   8329  O  OG   . SER A 1 26 ? -9.078  5.826   -0.342  1.00 0.00 ? 26  SER A OG   14 
ATOM   8330  H  H    . SER A 1 26 ? -8.327  3.456   0.146   1.00 0.00 ? 26  SER A H    14 
ATOM   8331  H  HA   . SER A 1 26 ? -6.397  5.372   -0.454  1.00 0.00 ? 26  SER A HA   14 
ATOM   8332  H  HB2  . SER A 1 26 ? -8.580  5.632   1.626   1.00 0.00 ? 26  SER A HB2  14 
ATOM   8333  H  HB3  . SER A 1 26 ? -7.780  6.947   0.764   1.00 0.00 ? 26  SER A HB3  14 
ATOM   8334  H  HG   . SER A 1 26 ? -9.462  6.691   -0.504  1.00 0.00 ? 26  SER A HG   14 
ATOM   8335  N  N    . TYR A 1 27 ? -6.170  4.127   2.550   1.00 0.00 ? 27  TYR A N    14 
ATOM   8336  C  CA   . TYR A 1 27 ? -5.329  4.048   3.739   1.00 0.00 ? 27  TYR A CA   14 
ATOM   8337  C  C    . TYR A 1 27 ? -3.949  3.496   3.394   1.00 0.00 ? 27  TYR A C    14 
ATOM   8338  O  O    . TYR A 1 27 ? -2.953  3.837   4.033   1.00 0.00 ? 27  TYR A O    14 
ATOM   8339  C  CB   . TYR A 1 27 ? -5.992  3.169   4.800   1.00 0.00 ? 27  TYR A CB   14 
ATOM   8340  C  CG   . TYR A 1 27 ? -5.659  3.576   6.218   1.00 0.00 ? 27  TYR A CG   14 
ATOM   8341  C  CD1  . TYR A 1 27 ? -5.678  4.911   6.601   1.00 0.00 ? 27  TYR A CD1  14 
ATOM   8342  C  CD2  . TYR A 1 27 ? -5.326  2.625   7.175   1.00 0.00 ? 27  TYR A CD2  14 
ATOM   8343  C  CE1  . TYR A 1 27 ? -5.373  5.288   7.895   1.00 0.00 ? 27  TYR A CE1  14 
ATOM   8344  C  CE2  . TYR A 1 27 ? -5.021  2.992   8.471   1.00 0.00 ? 27  TYR A CE2  14 
ATOM   8345  C  CZ   . TYR A 1 27 ? -5.046  4.324   8.826   1.00 0.00 ? 27  TYR A CZ   14 
ATOM   8346  O  OH   . TYR A 1 27 ? -4.743  4.695   10.116  1.00 0.00 ? 27  TYR A OH   14 
ATOM   8347  H  H    . TYR A 1 27 ? -6.908  3.492   2.444   1.00 0.00 ? 27  TYR A H    14 
ATOM   8348  H  HA   . TYR A 1 27 ? -5.216  5.048   4.132   1.00 0.00 ? 27  TYR A HA   14 
ATOM   8349  H  HB2  . TYR A 1 27 ? -7.063  3.221   4.684   1.00 0.00 ? 27  TYR A HB2  14 
ATOM   8350  H  HB3  . TYR A 1 27 ? -5.669  2.147   4.664   1.00 0.00 ? 27  TYR A HB3  14 
ATOM   8351  H  HD1  . TYR A 1 27 ? -5.935  5.663   5.869   1.00 0.00 ? 27  TYR A HD1  14 
ATOM   8352  H  HD2  . TYR A 1 27 ? -5.307  1.582   6.893   1.00 0.00 ? 27  TYR A HD2  14 
ATOM   8353  H  HE1  . TYR A 1 27 ? -5.393  6.331   8.173   1.00 0.00 ? 27  TYR A HE1  14 
ATOM   8354  H  HE2  . TYR A 1 27 ? -4.765  2.238   9.201   1.00 0.00 ? 27  TYR A HE2  14 
ATOM   8355  H  HH   . TYR A 1 27 ? -5.064  5.586   10.277  1.00 0.00 ? 27  TYR A HH   14 
ATOM   8356  N  N    . LEU A 1 28 ? -3.898  2.642   2.378   1.00 0.00 ? 28  LEU A N    14 
ATOM   8357  C  CA   . LEU A 1 28 ? -2.641  2.041   1.945   1.00 0.00 ? 28  LEU A CA   14 
ATOM   8358  C  C    . LEU A 1 28 ? -1.919  2.947   0.952   1.00 0.00 ? 28  LEU A C    14 
ATOM   8359  O  O    . LEU A 1 28 ? -0.689  3.008   0.935   1.00 0.00 ? 28  LEU A O    14 
ATOM   8360  C  CB   . LEU A 1 28 ? -2.898  0.673   1.311   1.00 0.00 ? 28  LEU A CB   14 
ATOM   8361  C  CG   . LEU A 1 28 ? -1.798  0.142   0.392   1.00 0.00 ? 28  LEU A CG   14 
ATOM   8362  C  CD1  . LEU A 1 28 ? -0.603  -0.328  1.206   1.00 0.00 ? 28  LEU A CD1  14 
ATOM   8363  C  CD2  . LEU A 1 28 ? -2.330  -0.987  -0.479  1.00 0.00 ? 28  LEU A CD2  14 
ATOM   8364  H  H    . LEU A 1 28 ? -4.725  2.409   1.906   1.00 0.00 ? 28  LEU A H    14 
ATOM   8365  H  HA   . LEU A 1 28 ? -2.018  1.914   2.817   1.00 0.00 ? 28  LEU A HA   14 
ATOM   8366  H  HB2  . LEU A 1 28 ? -3.035  -0.040  2.109   1.00 0.00 ? 28  LEU A HB2  14 
ATOM   8367  H  HB3  . LEU A 1 28 ? -3.809  0.743   0.734   1.00 0.00 ? 28  LEU A HB3  14 
ATOM   8368  H  HG   . LEU A 1 28 ? -1.466  0.939   -0.259  1.00 0.00 ? 28  LEU A HG   14 
ATOM   8369  H  HD11 . LEU A 1 28 ? -0.770  -1.341  1.539   1.00 0.00 ? 28  LEU A HD11 14 
ATOM   8370  H  HD12 . LEU A 1 28 ? -0.474  0.317   2.062   1.00 0.00 ? 28  LEU A HD12 14 
ATOM   8371  H  HD13 . LEU A 1 28 ? 0.286   -0.292  0.593   1.00 0.00 ? 28  LEU A HD13 14 
ATOM   8372  H  HD21 . LEU A 1 28 ? -3.374  -1.150  -0.259  1.00 0.00 ? 28  LEU A HD21 14 
ATOM   8373  H  HD22 . LEU A 1 28 ? -1.774  -1.890  -0.276  1.00 0.00 ? 28  LEU A HD22 14 
ATOM   8374  H  HD23 . LEU A 1 28 ? -2.217  -0.722  -1.520  1.00 0.00 ? 28  LEU A HD23 14 
ATOM   8375  N  N    . ILE A 1 29 ? -2.690  3.648   0.129   1.00 0.00 ? 29  ILE A N    14 
ATOM   8376  C  CA   . ILE A 1 29 ? -2.124  4.552   -0.864  1.00 0.00 ? 29  ILE A CA   14 
ATOM   8377  C  C    . ILE A 1 29 ? -1.359  5.691   -0.197  1.00 0.00 ? 29  ILE A C    14 
ATOM   8378  O  O    . ILE A 1 29 ? -0.330  6.141   -0.703  1.00 0.00 ? 29  ILE A O    14 
ATOM   8379  C  CB   . ILE A 1 29 ? -3.216  5.145   -1.773  1.00 0.00 ? 29  ILE A CB   14 
ATOM   8380  C  CG1  . ILE A 1 29 ? -3.977  4.028   -2.489  1.00 0.00 ? 29  ILE A CG1  14 
ATOM   8381  C  CG2  . ILE A 1 29 ? -2.602  6.105   -2.782  1.00 0.00 ? 29  ILE A CG2  14 
ATOM   8382  C  CD1  . ILE A 1 29 ? -5.414  4.380   -2.802  1.00 0.00 ? 29  ILE A CD1  14 
ATOM   8383  H  H    . ILE A 1 29 ? -3.664  3.556   0.191   1.00 0.00 ? 29  ILE A H    14 
ATOM   8384  H  HA   . ILE A 1 29 ? -1.440  3.985   -1.479  1.00 0.00 ? 29  ILE A HA   14 
ATOM   8385  H  HB   . ILE A 1 29 ? -3.904  5.702   -1.156  1.00 0.00 ? 29  ILE A HB   14 
ATOM   8386  H  HG12 . ILE A 1 29 ? -3.481  3.801   -3.420  1.00 0.00 ? 29  ILE A HG12 14 
ATOM   8387  H  HG13 . ILE A 1 29 ? -3.979  3.146   -1.864  1.00 0.00 ? 29  ILE A HG13 14 
ATOM   8388  H  HG21 . ILE A 1 29 ? -1.705  6.539   -2.365  1.00 0.00 ? 29  ILE A HG21 14 
ATOM   8389  H  HG22 . ILE A 1 29 ? -2.354  5.568   -3.685  1.00 0.00 ? 29  ILE A HG22 14 
ATOM   8390  H  HG23 . ILE A 1 29 ? -3.308  6.888   -3.010  1.00 0.00 ? 29  ILE A HG23 14 
ATOM   8391  H  HD11 . ILE A 1 29 ? -5.509  5.452   -2.901  1.00 0.00 ? 29  ILE A HD11 14 
ATOM   8392  H  HD12 . ILE A 1 29 ? -5.708  3.907   -3.728  1.00 0.00 ? 29  ILE A HD12 14 
ATOM   8393  H  HD13 . ILE A 1 29 ? -6.053  4.035   -2.003  1.00 0.00 ? 29  ILE A HD13 14 
ATOM   8394  N  N    . ILE A 1 30 ? -1.867  6.151   0.941   1.00 0.00 ? 30  ILE A N    14 
ATOM   8395  C  CA   . ILE A 1 30 ? -1.230  7.235   1.678   1.00 0.00 ? 30  ILE A CA   14 
ATOM   8396  C  C    . ILE A 1 30 ? -0.013  6.735   2.449   1.00 0.00 ? 30  ILE A C    14 
ATOM   8397  O  O    . ILE A 1 30 ? 0.795   7.526   2.937   1.00 0.00 ? 30  ILE A O    14 
ATOM   8398  C  CB   . ILE A 1 30 ? -2.211  7.898   2.663   1.00 0.00 ? 30  ILE A CB   14 
ATOM   8399  C  CG1  . ILE A 1 30 ? -2.701  6.878   3.693   1.00 0.00 ? 30  ILE A CG1  14 
ATOM   8400  C  CG2  . ILE A 1 30 ? -3.385  8.507   1.912   1.00 0.00 ? 30  ILE A CG2  14 
ATOM   8401  C  CD1  . ILE A 1 30 ? -1.844  6.816   4.938   1.00 0.00 ? 30  ILE A CD1  14 
ATOM   8402  H  H    . ILE A 1 30 ? -2.689  5.751   1.293   1.00 0.00 ? 30  ILE A H    14 
ATOM   8403  H  HA   . ILE A 1 30 ? -0.910  7.980   0.964   1.00 0.00 ? 30  ILE A HA   14 
ATOM   8404  H  HB   . ILE A 1 30 ? -1.690  8.693   3.174   1.00 0.00 ? 30  ILE A HB   14 
ATOM   8405  H  HG12 . ILE A 1 30 ? -3.705  7.134   3.994   1.00 0.00 ? 30  ILE A HG12 14 
ATOM   8406  H  HG13 . ILE A 1 30 ? -2.704  5.896   3.242   1.00 0.00 ? 30  ILE A HG13 14 
ATOM   8407  H  HG21 . ILE A 1 30 ? -3.029  9.295   1.265   1.00 0.00 ? 30  ILE A HG21 14 
ATOM   8408  H  HG22 . ILE A 1 30 ? -3.867  7.745   1.318   1.00 0.00 ? 30  ILE A HG22 14 
ATOM   8409  H  HG23 . ILE A 1 30 ? -4.093  8.914   2.619   1.00 0.00 ? 30  ILE A HG23 14 
ATOM   8410  H  HD11 . ILE A 1 30 ? -0.809  6.687   4.656   1.00 0.00 ? 30  ILE A HD11 14 
ATOM   8411  H  HD12 . ILE A 1 30 ? -1.952  7.735   5.495   1.00 0.00 ? 30  ILE A HD12 14 
ATOM   8412  H  HD13 . ILE A 1 30 ? -2.157  5.984   5.550   1.00 0.00 ? 30  ILE A HD13 14 
ATOM   8413  N  N    . HIS A 1 31 ? 0.113   5.415   2.554   1.00 0.00 ? 31  HIS A N    14 
ATOM   8414  C  CA   . HIS A 1 31 ? 1.233   4.809   3.264   1.00 0.00 ? 31  HIS A CA   14 
ATOM   8415  C  C    . HIS A 1 31 ? 2.360   4.454   2.298   1.00 0.00 ? 31  HIS A C    14 
ATOM   8416  O  O    . HIS A 1 31 ? 3.539   4.552   2.640   1.00 0.00 ? 31  HIS A O    14 
ATOM   8417  C  CB   . HIS A 1 31 ? 0.773   3.557   4.011   1.00 0.00 ? 31  HIS A CB   14 
ATOM   8418  C  CG   . HIS A 1 31 ? 1.855   2.538   4.196   1.00 0.00 ? 31  HIS A CG   14 
ATOM   8419  N  ND1  . HIS A 1 31 ? 2.353   2.184   5.432   1.00 0.00 ? 31  HIS A ND1  14 
ATOM   8420  C  CD2  . HIS A 1 31 ? 2.534   1.793   3.291   1.00 0.00 ? 31  HIS A CD2  14 
ATOM   8421  C  CE1  . HIS A 1 31 ? 3.292   1.268   5.280   1.00 0.00 ? 31  HIS A CE1  14 
ATOM   8422  N  NE2  . HIS A 1 31 ? 3.421   1.013   3.990   1.00 0.00 ? 31  HIS A NE2  14 
ATOM   8423  H  H    . HIS A 1 31 ? -0.564  4.837   2.144   1.00 0.00 ? 31  HIS A H    14 
ATOM   8424  H  HA   . HIS A 1 31 ? 1.602   5.529   3.979   1.00 0.00 ? 31  HIS A HA   14 
ATOM   8425  H  HB2  . HIS A 1 31 ? 0.415   3.841   4.990   1.00 0.00 ? 31  HIS A HB2  14 
ATOM   8426  H  HB3  . HIS A 1 31 ? -0.032  3.092   3.460   1.00 0.00 ? 31  HIS A HB3  14 
ATOM   8427  H  HD1  . HIS A 1 31 ? 2.062   2.551   6.292   1.00 0.00 ? 31  HIS A HD1  14 
ATOM   8428  H  HD2  . HIS A 1 31 ? 2.402   1.810   2.218   1.00 0.00 ? 31  HIS A HD2  14 
ATOM   8429  H  HE1  . HIS A 1 31 ? 3.859   0.805   6.074   1.00 0.00 ? 31  HIS A HE1  14 
ATOM   8430  N  N    . THR A 1 32 ? 1.989   4.040   1.090   1.00 0.00 ? 32  THR A N    14 
ATOM   8431  C  CA   . THR A 1 32 ? 2.968   3.668   0.076   1.00 0.00 ? 32  THR A CA   14 
ATOM   8432  C  C    . THR A 1 32 ? 3.839   4.858   -0.310  1.00 0.00 ? 32  THR A C    14 
ATOM   8433  O  O    . THR A 1 32 ? 4.961   4.689   -0.787  1.00 0.00 ? 32  THR A O    14 
ATOM   8434  C  CB   . THR A 1 32 ? 2.284   3.116   -1.189  1.00 0.00 ? 32  THR A CB   14 
ATOM   8435  O  OG1  . THR A 1 32 ? 3.261   2.536   -2.060  1.00 0.00 ? 32  THR A OG1  14 
ATOM   8436  C  CG2  . THR A 1 32 ? 1.532   4.216   -1.922  1.00 0.00 ? 32  THR A CG2  14 
ATOM   8437  H  H    . THR A 1 32 ? 1.034   3.983   0.878   1.00 0.00 ? 32  THR A H    14 
ATOM   8438  H  HA   . THR A 1 32 ? 3.597   2.892   0.488   1.00 0.00 ? 32  THR A HA   14 
ATOM   8439  H  HB   . THR A 1 32 ? 1.578   2.353   -0.893  1.00 0.00 ? 32  THR A HB   14 
ATOM   8440  H  HG1  . THR A 1 32 ? 4.119   2.544   -1.629  1.00 0.00 ? 32  THR A HG1  14 
ATOM   8441  H  HG21 . THR A 1 32 ? 1.485   3.980   -2.974  1.00 0.00 ? 32  THR A HG21 14 
ATOM   8442  H  HG22 . THR A 1 32 ? 2.047   5.156   -1.787  1.00 0.00 ? 32  THR A HG22 14 
ATOM   8443  H  HG23 . THR A 1 32 ? 0.531   4.294   -1.525  1.00 0.00 ? 32  THR A HG23 14 
ATOM   8444  N  N    . ARG A 1 33 ? 3.315   6.062   -0.098  1.00 0.00 ? 33  ARG A N    14 
ATOM   8445  C  CA   . ARG A 1 33 ? 4.046   7.280   -0.425  1.00 0.00 ? 33  ARG A CA   14 
ATOM   8446  C  C    . ARG A 1 33 ? 5.147   7.545   0.598   1.00 0.00 ? 33  ARG A C    14 
ATOM   8447  O  O    . ARG A 1 33 ? 6.272   7.895   0.240   1.00 0.00 ? 33  ARG A O    14 
ATOM   8448  C  CB   . ARG A 1 33 ? 3.090   8.474   -0.482  1.00 0.00 ? 33  ARG A CB   14 
ATOM   8449  C  CG   . ARG A 1 33 ? 2.258   8.648   0.778   1.00 0.00 ? 33  ARG A CG   14 
ATOM   8450  C  CD   . ARG A 1 33 ? 1.303   9.825   0.656   1.00 0.00 ? 33  ARG A CD   14 
ATOM   8451  N  NE   . ARG A 1 33 ? 2.011   11.088  0.464   1.00 0.00 ? 33  ARG A NE   14 
ATOM   8452  C  CZ   . ARG A 1 33 ? 1.467   12.278  0.691   1.00 0.00 ? 33  ARG A CZ   14 
ATOM   8453  N  NH1  . ARG A 1 33 ? 0.214   12.367  1.117   1.00 0.00 ? 33  ARG A NH1  14 
ATOM   8454  N  NH2  . ARG A 1 33 ? 2.176   13.382  0.493   1.00 0.00 ? 33  ARG A NH2  14 
ATOM   8455  H  H    . ARG A 1 33 ? 2.416   6.132   0.285   1.00 0.00 ? 33  ARG A H    14 
ATOM   8456  H  HA   . ARG A 1 33 ? 4.498   7.146   -1.396  1.00 0.00 ? 33  ARG A HA   14 
ATOM   8457  H  HB2  . ARG A 1 33 ? 3.666   9.374   -0.634  1.00 0.00 ? 33  ARG A HB2  14 
ATOM   8458  H  HB3  . ARG A 1 33 ? 2.417   8.340   -1.316  1.00 0.00 ? 33  ARG A HB3  14 
ATOM   8459  H  HG2  . ARG A 1 33 ? 1.685   7.749   0.947   1.00 0.00 ? 33  ARG A HG2  14 
ATOM   8460  H  HG3  . ARG A 1 33 ? 2.920   8.818   1.614   1.00 0.00 ? 33  ARG A HG3  14 
ATOM   8461  H  HD2  . ARG A 1 33 ? 0.652   9.657   -0.188  1.00 0.00 ? 33  ARG A HD2  14 
ATOM   8462  H  HD3  . ARG A 1 33 ? 0.713   9.887   1.558   1.00 0.00 ? 33  ARG A HD3  14 
ATOM   8463  H  HE   . ARG A 1 33 ? 2.938   11.045  0.150   1.00 0.00 ? 33  ARG A HE   14 
ATOM   8464  H  HH11 . ARG A 1 33 ? -0.322  11.537  1.268   1.00 0.00 ? 33  ARG A HH11 14 
ATOM   8465  H  HH12 . ARG A 1 33 ? -0.193  13.264  1.288   1.00 0.00 ? 33  ARG A HH12 14 
ATOM   8466  H  HH21 . ARG A 1 33 ? 3.120   13.318  0.172   1.00 0.00 ? 33  ARG A HH21 14 
ATOM   8467  H  HH22 . ARG A 1 33 ? 1.765   14.277  0.664   1.00 0.00 ? 33  ARG A HH22 14 
ATOM   8468  N  N    . THR A 1 34 ? 4.814   7.377   1.875   1.00 0.00 ? 34  THR A N    14 
ATOM   8469  C  CA   . THR A 1 34 ? 5.773   7.599   2.950   1.00 0.00 ? 34  THR A CA   14 
ATOM   8470  C  C    . THR A 1 34 ? 7.043   6.785   2.731   1.00 0.00 ? 34  THR A C    14 
ATOM   8471  O  O    . THR A 1 34 ? 8.131   7.192   3.139   1.00 0.00 ? 34  THR A O    14 
ATOM   8472  C  CB   . THR A 1 34 ? 5.173   7.234   4.321   1.00 0.00 ? 34  THR A CB   14 
ATOM   8473  O  OG1  . THR A 1 34 ? 4.940   5.823   4.394   1.00 0.00 ? 34  THR A OG1  14 
ATOM   8474  C  CG2  . THR A 1 34 ? 3.869   7.982   4.558   1.00 0.00 ? 34  THR A CG2  14 
ATOM   8475  H  H    . THR A 1 34 ? 3.902   7.097   2.097   1.00 0.00 ? 34  THR A H    14 
ATOM   8476  H  HA   . THR A 1 34 ? 6.026   8.649   2.959   1.00 0.00 ? 34  THR A HA   14 
ATOM   8477  H  HB   . THR A 1 34 ? 5.877   7.516   5.091   1.00 0.00 ? 34  THR A HB   14 
ATOM   8478  H  HG1  . THR A 1 34 ? 4.798   5.476   3.510   1.00 0.00 ? 34  THR A HG1  14 
ATOM   8479  H  HG21 . THR A 1 34 ? 3.307   8.023   3.637   1.00 0.00 ? 34  THR A HG21 14 
ATOM   8480  H  HG22 . THR A 1 34 ? 4.085   8.986   4.892   1.00 0.00 ? 34  THR A HG22 14 
ATOM   8481  H  HG23 . THR A 1 34 ? 3.291   7.468   5.311   1.00 0.00 ? 34  THR A HG23 14 
ATOM   8482  N  N    . HIS A 1 35 ? 6.898   5.633   2.084   1.00 0.00 ? 35  HIS A N    14 
ATOM   8483  C  CA   . HIS A 1 35 ? 8.035   4.762   1.809   1.00 0.00 ? 35  HIS A CA   14 
ATOM   8484  C  C    . HIS A 1 35 ? 9.207   5.560   1.246   1.00 0.00 ? 35  HIS A C    14 
ATOM   8485  O  O    . HIS A 1 35 ? 10.369  5.238   1.496   1.00 0.00 ? 35  HIS A O    14 
ATOM   8486  C  CB   . HIS A 1 35 ? 7.635   3.659   0.829   1.00 0.00 ? 35  HIS A CB   14 
ATOM   8487  C  CG   . HIS A 1 35 ? 7.143   2.413   1.497   1.00 0.00 ? 35  HIS A CG   14 
ATOM   8488  N  ND1  . HIS A 1 35 ? 7.960   1.341   1.786   1.00 0.00 ? 35  HIS A ND1  14 
ATOM   8489  C  CD2  . HIS A 1 35 ? 5.908   2.072   1.935   1.00 0.00 ? 35  HIS A CD2  14 
ATOM   8490  C  CE1  . HIS A 1 35 ? 7.249   0.393   2.372   1.00 0.00 ? 35  HIS A CE1  14 
ATOM   8491  N  NE2  . HIS A 1 35 ? 6.001   0.812   2.474   1.00 0.00 ? 35  HIS A NE2  14 
ATOM   8492  H  H    . HIS A 1 35 ? 6.005   5.362   1.784   1.00 0.00 ? 35  HIS A H    14 
ATOM   8493  H  HA   . HIS A 1 35 ? 8.339   4.310   2.741   1.00 0.00 ? 35  HIS A HA   14 
ATOM   8494  H  HB2  . HIS A 1 35 ? 6.846   4.025   0.188   1.00 0.00 ? 35  HIS A HB2  14 
ATOM   8495  H  HB3  . HIS A 1 35 ? 8.491   3.396   0.224   1.00 0.00 ? 35  HIS A HB3  14 
ATOM   8496  H  HD1  . HIS A 1 35 ? 8.918   1.282   1.590   1.00 0.00 ? 35  HIS A HD1  14 
ATOM   8497  H  HD2  . HIS A 1 35 ? 5.015   2.677   1.872   1.00 0.00 ? 35  HIS A HD2  14 
ATOM   8498  H  HE1  . HIS A 1 35 ? 7.624   -0.561  2.710   1.00 0.00 ? 35  HIS A HE1  14 
ATOM   8499  N  N    . THR A 1 36 ? 8.894   6.602   0.482   1.00 0.00 ? 36  THR A N    14 
ATOM   8500  C  CA   . THR A 1 36 ? 9.920   7.445   -0.119  1.00 0.00 ? 36  THR A CA   14 
ATOM   8501  C  C    . THR A 1 36 ? 11.045  7.731   0.870   1.00 0.00 ? 36  THR A C    14 
ATOM   8502  O  O    . THR A 1 36 ? 12.223  7.678   0.518   1.00 0.00 ? 36  THR A O    14 
ATOM   8503  C  CB   . THR A 1 36 ? 9.333   8.781   -0.611  1.00 0.00 ? 36  THR A CB   14 
ATOM   8504  O  OG1  . THR A 1 36 ? 8.105   8.548   -1.310  1.00 0.00 ? 36  THR A OG1  14 
ATOM   8505  C  CG2  . THR A 1 36 ? 10.314  9.500   -1.524  1.00 0.00 ? 36  THR A CG2  14 
ATOM   8506  H  H    . THR A 1 36 ? 7.950   6.808   0.319   1.00 0.00 ? 36  THR A H    14 
ATOM   8507  H  HA   . THR A 1 36 ? 10.328  6.919   -0.970  1.00 0.00 ? 36  THR A HA   14 
ATOM   8508  H  HB   . THR A 1 36 ? 9.137   9.408   0.247   1.00 0.00 ? 36  THR A HB   14 
ATOM   8509  H  HG1  . THR A 1 36 ? 7.390   9.005   -0.862  1.00 0.00 ? 36  THR A HG1  14 
ATOM   8510  H  HG21 . THR A 1 36 ? 11.314  9.143   -1.329  1.00 0.00 ? 36  THR A HG21 14 
ATOM   8511  H  HG22 . THR A 1 36 ? 10.269  10.562  -1.337  1.00 0.00 ? 36  THR A HG22 14 
ATOM   8512  H  HG23 . THR A 1 36 ? 10.057  9.304   -2.555  1.00 0.00 ? 36  THR A HG23 14 
ATOM   8513  N  N    . GLY A 1 37 ? 10.674  8.034   2.110   1.00 0.00 ? 37  GLY A N    14 
ATOM   8514  C  CA   . GLY A 1 37 ? 11.664  8.323   3.131   1.00 0.00 ? 37  GLY A CA   14 
ATOM   8515  C  C    . GLY A 1 37 ? 12.716  7.237   3.243   1.00 0.00 ? 37  GLY A C    14 
ATOM   8516  O  O    . GLY A 1 37 ? 13.872  7.444   2.876   1.00 0.00 ? 37  GLY A O    14 
ATOM   8517  H  H    . GLY A 1 37 ? 9.720   8.061   2.334   1.00 0.00 ? 37  GLY A H    14 
ATOM   8518  H  HA2  . GLY A 1 37 ? 12.150  9.257   2.891   1.00 0.00 ? 37  GLY A HA2  14 
ATOM   8519  H  HA3  . GLY A 1 37 ? 11.164  8.423   4.083   1.00 0.00 ? 37  GLY A HA3  14 
ATOM   8520  N  N    . GLU A 1 38 ? 12.314  6.077   3.754   1.00 0.00 ? 38  GLU A N    14 
ATOM   8521  C  CA   . GLU A 1 38 ? 13.232  4.956   3.916   1.00 0.00 ? 38  GLU A CA   14 
ATOM   8522  C  C    . GLU A 1 38 ? 13.670  4.411   2.559   1.00 0.00 ? 38  GLU A C    14 
ATOM   8523  O  O    . GLU A 1 38 ? 13.075  3.469   2.035   1.00 0.00 ? 38  GLU A O    14 
ATOM   8524  C  CB   . GLU A 1 38 ? 12.574  3.844   4.736   1.00 0.00 ? 38  GLU A CB   14 
ATOM   8525  C  CG   . GLU A 1 38 ? 12.805  3.974   6.232   1.00 0.00 ? 38  GLU A CG   14 
ATOM   8526  C  CD   . GLU A 1 38 ? 14.103  3.329   6.680   1.00 0.00 ? 38  GLU A CD   14 
ATOM   8527  O  OE1  . GLU A 1 38 ? 14.197  2.086   6.628   1.00 0.00 ? 38  GLU A OE1  14 
ATOM   8528  O  OE2  . GLU A 1 38 ? 15.024  4.071   7.083   1.00 0.00 ? 38  GLU A OE2  14 
ATOM   8529  H  H    . GLU A 1 38 ? 11.379  5.973   4.028   1.00 0.00 ? 38  GLU A H    14 
ATOM   8530  H  HA   . GLU A 1 38 ? 14.102  5.313   4.444   1.00 0.00 ? 38  GLU A HA   14 
ATOM   8531  H  HB2  . GLU A 1 38 ? 11.510  3.860   4.553   1.00 0.00 ? 38  GLU A HB2  14 
ATOM   8532  H  HB3  . GLU A 1 38 ? 12.971  2.893   4.413   1.00 0.00 ? 38  GLU A HB3  14 
ATOM   8533  H  HG2  . GLU A 1 38 ? 12.834  5.022   6.489   1.00 0.00 ? 38  GLU A HG2  14 
ATOM   8534  H  HG3  . GLU A 1 38 ? 11.986  3.499   6.752   1.00 0.00 ? 38  GLU A HG3  14 
ATOM   8535  N  N    . SER A 1 39 ? 14.714  5.011   1.996   1.00 0.00 ? 39  SER A N    14 
ATOM   8536  C  CA   . SER A 1 39 ? 15.229  4.590   0.699   1.00 0.00 ? 39  SER A CA   14 
ATOM   8537  C  C    . SER A 1 39 ? 16.552  3.846   0.855   1.00 0.00 ? 39  SER A C    14 
ATOM   8538  O  O    . SER A 1 39 ? 17.584  4.447   1.152   1.00 0.00 ? 39  SER A O    14 
ATOM   8539  C  CB   . SER A 1 39 ? 15.418  5.801   -0.217  1.00 0.00 ? 39  SER A CB   14 
ATOM   8540  O  OG   . SER A 1 39 ? 14.221  6.106   -0.913  1.00 0.00 ? 39  SER A OG   14 
ATOM   8541  H  H    . SER A 1 39 ? 15.146  5.757   2.463   1.00 0.00 ? 39  SER A H    14 
ATOM   8542  H  HA   . SER A 1 39 ? 14.505  3.923   0.255   1.00 0.00 ? 39  SER A HA   14 
ATOM   8543  H  HB2  . SER A 1 39 ? 15.702  6.657   0.376   1.00 0.00 ? 39  SER A HB2  14 
ATOM   8544  H  HB3  . SER A 1 39 ? 16.194  5.588   -0.937  1.00 0.00 ? 39  SER A HB3  14 
ATOM   8545  H  HG   . SER A 1 39 ? 13.831  6.903   -0.546  1.00 0.00 ? 39  SER A HG   14 
ATOM   8546  N  N    . GLY A 1 40 ? 16.513  2.533   0.653   1.00 0.00 ? 40  GLY A N    14 
ATOM   8547  C  CA   . GLY A 1 40 ? 17.714  1.727   0.776   1.00 0.00 ? 40  GLY A CA   14 
ATOM   8548  C  C    . GLY A 1 40 ? 18.372  1.459   -0.563  1.00 0.00 ? 40  GLY A C    14 
ATOM   8549  O  O    . GLY A 1 40 ? 19.349  2.106   -0.940  1.00 0.00 ? 40  GLY A O    14 
ATOM   8550  H  H    . GLY A 1 40 ? 15.662  2.107   0.418   1.00 0.00 ? 40  GLY A H    14 
ATOM   8551  H  HA2  . GLY A 1 40 ? 18.416  2.243   1.414   1.00 0.00 ? 40  GLY A HA2  14 
ATOM   8552  H  HA3  . GLY A 1 40 ? 17.455  0.783   1.232   1.00 0.00 ? 40  GLY A HA3  14 
ATOM   8553  N  N    . PRO A 1 41 ? 17.833  0.481   -1.307  1.00 0.00 ? 41  PRO A N    14 
ATOM   8554  C  CA   . PRO A 1 41 ? 18.359  0.106   -2.622  1.00 0.00 ? 41  PRO A CA   14 
ATOM   8555  C  C    . PRO A 1 41 ? 18.107  1.179   -3.675  1.00 0.00 ? 41  PRO A C    14 
ATOM   8556  O  O    . PRO A 1 41 ? 18.442  1.004   -4.847  1.00 0.00 ? 41  PRO A O    14 
ATOM   8557  C  CB   . PRO A 1 41 ? 17.583  -1.170  -2.963  1.00 0.00 ? 41  PRO A CB   14 
ATOM   8558  C  CG   . PRO A 1 41 ? 16.316  -1.061  -2.187  1.00 0.00 ? 41  PRO A CG   14 
ATOM   8559  C  CD   . PRO A 1 41 ? 16.667  -0.332  -0.920  1.00 0.00 ? 41  PRO A CD   14 
ATOM   8560  H  HA   . PRO A 1 41 ? 19.415  -0.114  -2.579  1.00 0.00 ? 41  PRO A HA   14 
ATOM   8561  H  HB2  . PRO A 1 41 ? 17.395  -1.206  -4.027  1.00 0.00 ? 41  PRO A HB2  14 
ATOM   8562  H  HB3  . PRO A 1 41 ? 18.157  -2.034  -2.664  1.00 0.00 ? 41  PRO A HB3  14 
ATOM   8563  H  HG2  . PRO A 1 41 ? 15.586  -0.502  -2.752  1.00 0.00 ? 41  PRO A HG2  14 
ATOM   8564  H  HG3  . PRO A 1 41 ? 15.941  -2.048  -1.959  1.00 0.00 ? 41  PRO A HG3  14 
ATOM   8565  H  HD2  . PRO A 1 41 ? 15.846  0.295   -0.606  1.00 0.00 ? 41  PRO A HD2  14 
ATOM   8566  H  HD3  . PRO A 1 41 ? 16.929  -1.033  -0.141  1.00 0.00 ? 41  PRO A HD3  14 
ATOM   8567  N  N    . SER A 1 42 ? 17.516  2.291   -3.251  1.00 0.00 ? 42  SER A N    14 
ATOM   8568  C  CA   . SER A 1 42 ? 17.216  3.393   -4.158  1.00 0.00 ? 42  SER A CA   14 
ATOM   8569  C  C    . SER A 1 42 ? 16.757  2.868   -5.515  1.00 0.00 ? 42  SER A C    14 
ATOM   8570  O  O    . SER A 1 42 ? 17.154  3.385   -6.560  1.00 0.00 ? 42  SER A O    14 
ATOM   8571  C  CB   . SER A 1 42 ? 18.446  4.286   -4.333  1.00 0.00 ? 42  SER A CB   14 
ATOM   8572  O  OG   . SER A 1 42 ? 18.874  4.815   -3.090  1.00 0.00 ? 42  SER A OG   14 
ATOM   8573  H  H    . SER A 1 42 ? 17.273  2.372   -2.304  1.00 0.00 ? 42  SER A H    14 
ATOM   8574  H  HA   . SER A 1 42 ? 16.419  3.975   -3.721  1.00 0.00 ? 42  SER A HA   14 
ATOM   8575  H  HB2  . SER A 1 42 ? 19.251  3.707   -4.760  1.00 0.00 ? 42  SER A HB2  14 
ATOM   8576  H  HB3  . SER A 1 42 ? 18.202  5.105   -4.995  1.00 0.00 ? 42  SER A HB3  14 
ATOM   8577  H  HG   . SER A 1 42 ? 18.262  4.546   -2.401  1.00 0.00 ? 42  SER A HG   14 
ATOM   8578  N  N    . SER A 1 43 ? 15.917  1.839   -5.491  1.00 0.00 ? 43  SER A N    14 
ATOM   8579  C  CA   . SER A 1 43 ? 15.406  1.241   -6.719  1.00 0.00 ? 43  SER A CA   14 
ATOM   8580  C  C    . SER A 1 43 ? 14.107  1.915   -7.152  1.00 0.00 ? 43  SER A C    14 
ATOM   8581  O  O    . SER A 1 43 ? 13.346  2.411   -6.323  1.00 0.00 ? 43  SER A O    14 
ATOM   8582  C  CB   . SER A 1 43 ? 15.174  -0.259  -6.523  1.00 0.00 ? 43  SER A CB   14 
ATOM   8583  O  OG   . SER A 1 43 ? 14.809  -0.882  -7.742  1.00 0.00 ? 43  SER A OG   14 
ATOM   8584  H  H    . SER A 1 43 ? 15.637  1.471   -4.627  1.00 0.00 ? 43  SER A H    14 
ATOM   8585  H  HA   . SER A 1 43 ? 16.147  1.384   -7.491  1.00 0.00 ? 43  SER A HA   14 
ATOM   8586  H  HB2  . SER A 1 43 ? 16.080  -0.716  -6.156  1.00 0.00 ? 43  SER A HB2  14 
ATOM   8587  H  HB3  . SER A 1 43 ? 14.380  -0.407  -5.805  1.00 0.00 ? 43  SER A HB3  14 
ATOM   8588  H  HG   . SER A 1 43 ? 15.071  -0.324  -8.478  1.00 0.00 ? 43  SER A HG   14 
ATOM   8589  N  N    . GLY A 1 44 ? 13.862  1.929   -8.459  1.00 0.00 ? 44  GLY A N    14 
ATOM   8590  C  CA   . GLY A 1 44 ? 12.656  2.545   -8.981  1.00 0.00 ? 44  GLY A CA   14 
ATOM   8591  C  C    . GLY A 1 44 ? 12.913  3.349   -10.240 1.00 0.00 ? 44  GLY A C    14 
ATOM   8592  O  O    . GLY A 1 44 ? 13.915  4.060   -10.302 1.00 0.00 ? 44  GLY A O    14 
ATOM   8593  H  H    . GLY A 1 44 ? 14.505  1.518   -9.073  1.00 0.00 ? 44  GLY A H    14 
ATOM   8594  H  HA2  . GLY A 1 44 ? 11.936  1.771   -9.201  1.00 0.00 ? 44  GLY A HA2  14 
ATOM   8595  H  HA3  . GLY A 1 44 ? 12.245  3.201   -8.227  1.00 0.00 ? 44  GLY A HA3  14 
HETATM 8596  ZN ZN   . ZN  B 2 .  ? 4.542   -0.436  2.960   1.00 0.00 ? 181 ZN  A ZN   14 
ATOM   8597  N  N    . GLY A 1 1  ? -8.234  -30.065 17.183  1.00 0.00 ? 1   GLY A N    15 
ATOM   8598  C  CA   . GLY A 1 1  ? -8.963  -29.765 15.965  1.00 0.00 ? 1   GLY A CA   15 
ATOM   8599  C  C    . GLY A 1 1  ? -8.119  -29.959 14.721  1.00 0.00 ? 1   GLY A C    15 
ATOM   8600  O  O    . GLY A 1 1  ? -7.077  -29.322 14.563  1.00 0.00 ? 1   GLY A O    15 
ATOM   8601  H  H1   . GLY A 1 1  ? -8.510  -29.657 18.031  1.00 0.00 ? 1   GLY A H1   15 
ATOM   8602  H  HA2  . GLY A 1 1  ? -9.826  -30.410 15.906  1.00 0.00 ? 1   GLY A HA2  15 
ATOM   8603  H  HA3  . GLY A 1 1  ? -9.296  -28.738 16.002  1.00 0.00 ? 1   GLY A HA3  15 
ATOM   8604  N  N    . SER A 1 2  ? -8.567  -30.844 13.836  1.00 0.00 ? 2   SER A N    15 
ATOM   8605  C  CA   . SER A 1 2  ? -7.842  -31.126 12.603  1.00 0.00 ? 2   SER A CA   15 
ATOM   8606  C  C    . SER A 1 2  ? -7.908  -29.936 11.650  1.00 0.00 ? 2   SER A C    15 
ATOM   8607  O  O    . SER A 1 2  ? -8.849  -29.143 11.694  1.00 0.00 ? 2   SER A O    15 
ATOM   8608  C  CB   . SER A 1 2  ? -8.415  -32.370 11.922  1.00 0.00 ? 2   SER A CB   15 
ATOM   8609  O  OG   . SER A 1 2  ? -7.537  -32.854 10.921  1.00 0.00 ? 2   SER A OG   15 
ATOM   8610  H  H    . SER A 1 2  ? -9.403  -31.321 14.019  1.00 0.00 ? 2   SER A H    15 
ATOM   8611  H  HA   . SER A 1 2  ? -6.809  -31.310 12.859  1.00 0.00 ? 2   SER A HA   15 
ATOM   8612  H  HB2  . SER A 1 2  ? -8.563  -33.145 12.659  1.00 0.00 ? 2   SER A HB2  15 
ATOM   8613  H  HB3  . SER A 1 2  ? -9.362  -32.123 11.465  1.00 0.00 ? 2   SER A HB3  15 
ATOM   8614  H  HG   . SER A 1 2  ? -8.048  -33.200 10.186  1.00 0.00 ? 2   SER A HG   15 
ATOM   8615  N  N    . SER A 1 3  ? -6.901  -29.817 10.790  1.00 0.00 ? 3   SER A N    15 
ATOM   8616  C  CA   . SER A 1 3  ? -6.842  -28.722 9.829   1.00 0.00 ? 3   SER A CA   15 
ATOM   8617  C  C    . SER A 1 3  ? -5.706  -28.935 8.833   1.00 0.00 ? 3   SER A C    15 
ATOM   8618  O  O    . SER A 1 3  ? -4.596  -29.309 9.209   1.00 0.00 ? 3   SER A O    15 
ATOM   8619  C  CB   . SER A 1 3  ? -6.655  -27.388 10.555  1.00 0.00 ? 3   SER A CB   15 
ATOM   8620  O  OG   . SER A 1 3  ? -6.933  -26.297 9.695   1.00 0.00 ? 3   SER A OG   15 
ATOM   8621  H  H    . SER A 1 3  ? -6.180  -30.481 10.805  1.00 0.00 ? 3   SER A H    15 
ATOM   8622  H  HA   . SER A 1 3  ? -7.778  -28.702 9.292   1.00 0.00 ? 3   SER A HA   15 
ATOM   8623  H  HB2  . SER A 1 3  ? -7.324  -27.344 11.400  1.00 0.00 ? 3   SER A HB2  15 
ATOM   8624  H  HB3  . SER A 1 3  ? -5.634  -27.309 10.899  1.00 0.00 ? 3   SER A HB3  15 
ATOM   8625  H  HG   . SER A 1 3  ? -6.759  -26.552 8.786   1.00 0.00 ? 3   SER A HG   15 
ATOM   8626  N  N    . GLY A 1 4  ? -5.994  -28.694 7.557   1.00 0.00 ? 4   GLY A N    15 
ATOM   8627  C  CA   . GLY A 1 4  ? -4.988  -28.865 6.525   1.00 0.00 ? 4   GLY A CA   15 
ATOM   8628  C  C    . GLY A 1 4  ? -4.336  -27.555 6.128   1.00 0.00 ? 4   GLY A C    15 
ATOM   8629  O  O    . GLY A 1 4  ? -3.256  -27.220 6.614   1.00 0.00 ? 4   GLY A O    15 
ATOM   8630  H  H    . GLY A 1 4  ? -6.896  -28.398 7.315   1.00 0.00 ? 4   GLY A H    15 
ATOM   8631  H  HA2  . GLY A 1 4  ? -4.227  -29.539 6.888   1.00 0.00 ? 4   GLY A HA2  15 
ATOM   8632  H  HA3  . GLY A 1 4  ? -5.454  -29.300 5.653   1.00 0.00 ? 4   GLY A HA3  15 
ATOM   8633  N  N    . SER A 1 5  ? -4.993  -26.814 5.242   1.00 0.00 ? 5   SER A N    15 
ATOM   8634  C  CA   . SER A 1 5  ? -4.468  -25.536 4.776   1.00 0.00 ? 5   SER A CA   15 
ATOM   8635  C  C    . SER A 1 5  ? -5.602  -24.580 4.419   1.00 0.00 ? 5   SER A C    15 
ATOM   8636  O  O    . SER A 1 5  ? -6.317  -24.786 3.439   1.00 0.00 ? 5   SER A O    15 
ATOM   8637  C  CB   . SER A 1 5  ? -3.561  -25.745 3.562   1.00 0.00 ? 5   SER A CB   15 
ATOM   8638  O  OG   . SER A 1 5  ? -3.154  -24.505 3.010   1.00 0.00 ? 5   SER A OG   15 
ATOM   8639  H  H    . SER A 1 5  ? -5.850  -27.135 4.892   1.00 0.00 ? 5   SER A H    15 
ATOM   8640  H  HA   . SER A 1 5  ? -3.887  -25.104 5.578   1.00 0.00 ? 5   SER A HA   15 
ATOM   8641  H  HB2  . SER A 1 5  ? -2.684  -26.297 3.862   1.00 0.00 ? 5   SER A HB2  15 
ATOM   8642  H  HB3  . SER A 1 5  ? -4.097  -26.303 2.808   1.00 0.00 ? 5   SER A HB3  15 
ATOM   8643  H  HG   . SER A 1 5  ? -2.394  -24.174 3.493   1.00 0.00 ? 5   SER A HG   15 
ATOM   8644  N  N    . SER A 1 6  ? -5.760  -23.533 5.223   1.00 0.00 ? 6   SER A N    15 
ATOM   8645  C  CA   . SER A 1 6  ? -6.809  -22.546 4.995   1.00 0.00 ? 6   SER A CA   15 
ATOM   8646  C  C    . SER A 1 6  ? -6.218  -21.146 4.860   1.00 0.00 ? 6   SER A C    15 
ATOM   8647  O  O    . SER A 1 6  ? -5.529  -20.661 5.756   1.00 0.00 ? 6   SER A O    15 
ATOM   8648  C  CB   . SER A 1 6  ? -7.823  -22.575 6.141   1.00 0.00 ? 6   SER A CB   15 
ATOM   8649  O  OG   . SER A 1 6  ? -8.625  -23.742 6.083   1.00 0.00 ? 6   SER A OG   15 
ATOM   8650  H  H    . SER A 1 6  ? -5.158  -23.423 5.988   1.00 0.00 ? 6   SER A H    15 
ATOM   8651  H  HA   . SER A 1 6  ? -7.312  -22.803 4.075   1.00 0.00 ? 6   SER A HA   15 
ATOM   8652  H  HB2  . SER A 1 6  ? -7.297  -22.560 7.084   1.00 0.00 ? 6   SER A HB2  15 
ATOM   8653  H  HB3  . SER A 1 6  ? -8.464  -21.708 6.073   1.00 0.00 ? 6   SER A HB3  15 
ATOM   8654  H  HG   . SER A 1 6  ? -9.123  -23.748 5.262   1.00 0.00 ? 6   SER A HG   15 
ATOM   8655  N  N    . GLY A 1 7  ? -6.494  -20.501 3.730   1.00 0.00 ? 7   GLY A N    15 
ATOM   8656  C  CA   . GLY A 1 7  ? -5.982  -19.163 3.496   1.00 0.00 ? 7   GLY A CA   15 
ATOM   8657  C  C    . GLY A 1 7  ? -5.489  -18.972 2.075   1.00 0.00 ? 7   GLY A C    15 
ATOM   8658  O  O    . GLY A 1 7  ? -4.300  -19.133 1.795   1.00 0.00 ? 7   GLY A O    15 
ATOM   8659  H  H    . GLY A 1 7  ? -7.049  -20.937 3.050   1.00 0.00 ? 7   GLY A H    15 
ATOM   8660  H  HA2  . GLY A 1 7  ? -6.768  -18.450 3.692   1.00 0.00 ? 7   GLY A HA2  15 
ATOM   8661  H  HA3  . GLY A 1 7  ? -5.164  -18.979 4.177   1.00 0.00 ? 7   GLY A HA3  15 
ATOM   8662  N  N    . THR A 1 8  ? -6.403  -18.627 1.174   1.00 0.00 ? 8   THR A N    15 
ATOM   8663  C  CA   . THR A 1 8  ? -6.055  -18.416 -0.226  1.00 0.00 ? 8   THR A CA   15 
ATOM   8664  C  C    . THR A 1 8  ? -4.844  -17.500 -0.359  1.00 0.00 ? 8   THR A C    15 
ATOM   8665  O  O    . THR A 1 8  ? -3.880  -17.827 -1.050  1.00 0.00 ? 8   THR A O    15 
ATOM   8666  C  CB   . THR A 1 8  ? -7.233  -17.809 -1.012  1.00 0.00 ? 8   THR A CB   15 
ATOM   8667  O  OG1  . THR A 1 8  ? -8.414  -18.593 -0.808  1.00 0.00 ? 8   THR A OG1  15 
ATOM   8668  C  CG2  . THR A 1 8  ? -6.913  -17.741 -2.498  1.00 0.00 ? 8   THR A CG2  15 
ATOM   8669  H  H    . THR A 1 8  ? -7.334  -18.513 1.458   1.00 0.00 ? 8   THR A H    15 
ATOM   8670  H  HA   . THR A 1 8  ? -5.818  -19.377 -0.659  1.00 0.00 ? 8   THR A HA   15 
ATOM   8671  H  HB   . THR A 1 8  ? -7.408  -16.806 -0.650  1.00 0.00 ? 8   THR A HB   15 
ATOM   8672  H  HG1  . THR A 1 8  ? -9.147  -18.196 -1.284  1.00 0.00 ? 8   THR A HG1  15 
ATOM   8673  H  HG21 . THR A 1 8  ? -7.577  -18.399 -3.039  1.00 0.00 ? 8   THR A HG21 15 
ATOM   8674  H  HG22 . THR A 1 8  ? -5.891  -18.048 -2.661  1.00 0.00 ? 8   THR A HG22 15 
ATOM   8675  H  HG23 . THR A 1 8  ? -7.046  -16.728 -2.848  1.00 0.00 ? 8   THR A HG23 15 
ATOM   8676  N  N    . GLY A 1 9  ? -4.900  -16.351 0.307   1.00 0.00 ? 9   GLY A N    15 
ATOM   8677  C  CA   . GLY A 1 9  ? -3.801  -15.406 0.250   1.00 0.00 ? 9   GLY A CA   15 
ATOM   8678  C  C    . GLY A 1 9  ? -4.039  -14.300 -0.758  1.00 0.00 ? 9   GLY A C    15 
ATOM   8679  O  O    . GLY A 1 9  ? -3.498  -14.331 -1.863  1.00 0.00 ? 9   GLY A O    15 
ATOM   8680  H  H    . GLY A 1 9  ? -5.695  -16.144 0.842   1.00 0.00 ? 9   GLY A H    15 
ATOM   8681  H  HA2  . GLY A 1 9  ? -3.667  -14.966 1.227   1.00 0.00 ? 9   GLY A HA2  15 
ATOM   8682  H  HA3  . GLY A 1 9  ? -2.899  -15.936 -0.021  1.00 0.00 ? 9   GLY A HA3  15 
ATOM   8683  N  N    . MET A 1 10 ? -4.853  -13.320 -0.378  1.00 0.00 ? 10  MET A N    15 
ATOM   8684  C  CA   . MET A 1 10 ? -5.162  -12.199 -1.259  1.00 0.00 ? 10  MET A CA   15 
ATOM   8685  C  C    . MET A 1 10 ? -4.671  -10.885 -0.659  1.00 0.00 ? 10  MET A C    15 
ATOM   8686  O  O    . MET A 1 10 ? -4.623  -10.727 0.561   1.00 0.00 ? 10  MET A O    15 
ATOM   8687  C  CB   . MET A 1 10 ? -6.669  -12.125 -1.515  1.00 0.00 ? 10  MET A CB   15 
ATOM   8688  C  CG   . MET A 1 10 ? -7.042  -11.241 -2.694  1.00 0.00 ? 10  MET A CG   15 
ATOM   8689  S  SD   . MET A 1 10 ? -8.602  -11.723 -3.457  1.00 0.00 ? 10  MET A SD   15 
ATOM   8690  C  CE   . MET A 1 10 ? -9.710  -10.497 -2.765  1.00 0.00 ? 10  MET A CE   15 
ATOM   8691  H  H    . MET A 1 10 ? -5.255  -13.351 0.515   1.00 0.00 ? 10  MET A H    15 
ATOM   8692  H  HA   . MET A 1 10 ? -4.654  -12.365 -2.197  1.00 0.00 ? 10  MET A HA   15 
ATOM   8693  H  HB2  . MET A 1 10 ? -7.039  -13.120 -1.707  1.00 0.00 ? 10  MET A HB2  15 
ATOM   8694  H  HB3  . MET A 1 10 ? -7.153  -11.734 -0.632  1.00 0.00 ? 10  MET A HB3  15 
ATOM   8695  H  HG2  . MET A 1 10 ? -7.126  -10.221 -2.349  1.00 0.00 ? 10  MET A HG2  15 
ATOM   8696  H  HG3  . MET A 1 10 ? -6.259  -11.304 -3.435  1.00 0.00 ? 10  MET A HG3  15 
ATOM   8697  H  HE1  . MET A 1 10 ? -9.465  -9.524  -3.166  1.00 0.00 ? 10  MET A HE1  15 
ATOM   8698  H  HE2  . MET A 1 10 ? -10.729 -10.747 -3.023  1.00 0.00 ? 10  MET A HE2  15 
ATOM   8699  H  HE3  . MET A 1 10 ? -9.604  -10.482 -1.691  1.00 0.00 ? 10  MET A HE3  15 
ATOM   8700  N  N    . LYS A 1 11 ? -4.306  -9.945  -1.524  1.00 0.00 ? 11  LYS A N    15 
ATOM   8701  C  CA   . LYS A 1 11 ? -3.819  -8.644  -1.081  1.00 0.00 ? 11  LYS A CA   15 
ATOM   8702  C  C    . LYS A 1 11 ? -4.557  -7.515  -1.794  1.00 0.00 ? 11  LYS A C    15 
ATOM   8703  O  O    . LYS A 1 11 ? -4.093  -6.977  -2.799  1.00 0.00 ? 11  LYS A O    15 
ATOM   8704  C  CB   . LYS A 1 11 ? -2.315  -8.526  -1.336  1.00 0.00 ? 11  LYS A CB   15 
ATOM   8705  C  CG   . LYS A 1 11 ? -1.467  -9.303  -0.344  1.00 0.00 ? 11  LYS A CG   15 
ATOM   8706  C  CD   . LYS A 1 11 ? -0.177  -9.796  -0.979  1.00 0.00 ? 11  LYS A CD   15 
ATOM   8707  C  CE   . LYS A 1 11 ? 0.279   -11.111 -0.366  1.00 0.00 ? 11  LYS A CE   15 
ATOM   8708  N  NZ   . LYS A 1 11 ? 1.417   -11.709 -1.118  1.00 0.00 ? 11  LYS A NZ   15 
ATOM   8709  H  H    . LYS A 1 11 ? -4.367  -10.131 -2.485  1.00 0.00 ? 11  LYS A H    15 
ATOM   8710  H  HA   . LYS A 1 11 ? -4.003  -8.565  -0.020  1.00 0.00 ? 11  LYS A HA   15 
ATOM   8711  H  HB2  . LYS A 1 11 ? -2.100  -8.895  -2.328  1.00 0.00 ? 11  LYS A HB2  15 
ATOM   8712  H  HB3  . LYS A 1 11 ? -2.033  -7.484  -1.279  1.00 0.00 ? 11  LYS A HB3  15 
ATOM   8713  H  HG2  . LYS A 1 11 ? -1.223  -8.661  0.489   1.00 0.00 ? 11  LYS A HG2  15 
ATOM   8714  H  HG3  . LYS A 1 11 ? -2.032  -10.154 0.009   1.00 0.00 ? 11  LYS A HG3  15 
ATOM   8715  H  HD2  . LYS A 1 11 ? -0.339  -9.942  -2.036  1.00 0.00 ? 11  LYS A HD2  15 
ATOM   8716  H  HD3  . LYS A 1 11 ? 0.594   -9.053  -0.830  1.00 0.00 ? 11  LYS A HD3  15 
ATOM   8717  H  HE2  . LYS A 1 11 ? 0.588   -10.930 0.653   1.00 0.00 ? 11  LYS A HE2  15 
ATOM   8718  H  HE3  . LYS A 1 11 ? -0.550  -11.803 -0.373  1.00 0.00 ? 11  LYS A HE3  15 
ATOM   8719  H  HZ1  . LYS A 1 11 ? 1.662   -12.636 -0.718  1.00 0.00 ? 11  LYS A HZ1  15 
ATOM   8720  H  HZ2  . LYS A 1 11 ? 2.248   -11.087 -1.061  1.00 0.00 ? 11  LYS A HZ2  15 
ATOM   8721  H  HZ3  . LYS A 1 11 ? 1.158   -11.832 -2.118  1.00 0.00 ? 11  LYS A HZ3  15 
ATOM   8722  N  N    . PRO A 1 12 ? -5.732  -7.147  -1.262  1.00 0.00 ? 12  PRO A N    15 
ATOM   8723  C  CA   . PRO A 1 12 ? -6.557  -6.077  -1.831  1.00 0.00 ? 12  PRO A CA   15 
ATOM   8724  C  C    . PRO A 1 12 ? -5.929  -4.700  -1.645  1.00 0.00 ? 12  PRO A C    15 
ATOM   8725  O  O    . PRO A 1 12 ? -5.725  -3.964  -2.612  1.00 0.00 ? 12  PRO A O    15 
ATOM   8726  C  CB   . PRO A 1 12 ? -7.864  -6.180  -1.042  1.00 0.00 ? 12  PRO A CB   15 
ATOM   8727  C  CG   . PRO A 1 12 ? -7.477  -6.808  0.252   1.00 0.00 ? 12  PRO A CG   15 
ATOM   8728  C  CD   . PRO A 1 12 ? -6.345  -7.745  -0.065  1.00 0.00 ? 12  PRO A CD   15 
ATOM   8729  H  HA   . PRO A 1 12 ? -6.754  -6.243  -2.880  1.00 0.00 ? 12  PRO A HA   15 
ATOM   8730  H  HB2  . PRO A 1 12 ? -8.277  -5.192  -0.895  1.00 0.00 ? 12  PRO A HB2  15 
ATOM   8731  H  HB3  . PRO A 1 12 ? -8.569  -6.793  -1.584  1.00 0.00 ? 12  PRO A HB3  15 
ATOM   8732  H  HG2  . PRO A 1 12 ? -7.152  -6.049  0.946   1.00 0.00 ? 12  PRO A HG2  15 
ATOM   8733  H  HG3  . PRO A 1 12 ? -8.315  -7.356  0.658   1.00 0.00 ? 12  PRO A HG3  15 
ATOM   8734  H  HD2  . PRO A 1 12 ? -5.641  -7.778  0.753   1.00 0.00 ? 12  PRO A HD2  15 
ATOM   8735  H  HD3  . PRO A 1 12 ? -6.723  -8.734  -0.280  1.00 0.00 ? 12  PRO A HD3  15 
ATOM   8736  N  N    . TYR A 1 13 ? -5.625  -4.357  -0.399  1.00 0.00 ? 13  TYR A N    15 
ATOM   8737  C  CA   . TYR A 1 13 ? -5.022  -3.067  -0.086  1.00 0.00 ? 13  TYR A CA   15 
ATOM   8738  C  C    . TYR A 1 13 ? -3.704  -3.248  0.661   1.00 0.00 ? 13  TYR A C    15 
ATOM   8739  O  O    . TYR A 1 13 ? -3.167  -2.300  1.235   1.00 0.00 ? 13  TYR A O    15 
ATOM   8740  C  CB   . TYR A 1 13 ? -5.983  -2.220  0.751   1.00 0.00 ? 13  TYR A CB   15 
ATOM   8741  C  CG   . TYR A 1 13 ? -7.436  -2.600  0.573   1.00 0.00 ? 13  TYR A CG   15 
ATOM   8742  C  CD1  . TYR A 1 13 ? -7.970  -3.707  1.221   1.00 0.00 ? 13  TYR A CD1  15 
ATOM   8743  C  CD2  . TYR A 1 13 ? -8.275  -1.851  -0.243  1.00 0.00 ? 13  TYR A CD2  15 
ATOM   8744  C  CE1  . TYR A 1 13 ? -9.296  -4.057  1.061   1.00 0.00 ? 13  TYR A CE1  15 
ATOM   8745  C  CE2  . TYR A 1 13 ? -9.603  -2.193  -0.408  1.00 0.00 ? 13  TYR A CE2  15 
ATOM   8746  C  CZ   . TYR A 1 13 ? -10.109 -3.297  0.246   1.00 0.00 ? 13  TYR A CZ   15 
ATOM   8747  O  OH   . TYR A 1 13 ? -11.431 -3.643  0.085   1.00 0.00 ? 13  TYR A OH   15 
ATOM   8748  H  H    . TYR A 1 13 ? -5.812  -4.985  0.330   1.00 0.00 ? 13  TYR A H    15 
ATOM   8749  H  HA   . TYR A 1 13 ? -4.828  -2.557  -1.018  1.00 0.00 ? 13  TYR A HA   15 
ATOM   8750  H  HB2  . TYR A 1 13 ? -5.737  -2.334  1.795   1.00 0.00 ? 13  TYR A HB2  15 
ATOM   8751  H  HB3  . TYR A 1 13 ? -5.875  -1.182  0.471   1.00 0.00 ? 13  TYR A HB3  15 
ATOM   8752  H  HD1  . TYR A 1 13 ? -7.330  -4.299  1.859   1.00 0.00 ? 13  TYR A HD1  15 
ATOM   8753  H  HD2  . TYR A 1 13 ? -7.876  -0.986  -0.754  1.00 0.00 ? 13  TYR A HD2  15 
ATOM   8754  H  HE1  . TYR A 1 13 ? -9.693  -4.922  1.573   1.00 0.00 ? 13  TYR A HE1  15 
ATOM   8755  H  HE2  . TYR A 1 13 ? -10.240 -1.599  -1.046  1.00 0.00 ? 13  TYR A HE2  15 
ATOM   8756  H  HH   . TYR A 1 13 ? -11.954 -2.850  -0.055  1.00 0.00 ? 13  TYR A HH   15 
ATOM   8757  N  N    . VAL A 1 14 ? -3.187  -4.472  0.647   1.00 0.00 ? 14  VAL A N    15 
ATOM   8758  C  CA   . VAL A 1 14 ? -1.931  -4.779  1.321   1.00 0.00 ? 14  VAL A CA   15 
ATOM   8759  C  C    . VAL A 1 14 ? -0.739  -4.260  0.524   1.00 0.00 ? 14  VAL A C    15 
ATOM   8760  O  O    . VAL A 1 14 ? -0.719  -4.337  -0.705  1.00 0.00 ? 14  VAL A O    15 
ATOM   8761  C  CB   . VAL A 1 14 ? -1.768  -6.295  1.540   1.00 0.00 ? 14  VAL A CB   15 
ATOM   8762  C  CG1  . VAL A 1 14 ? -0.413  -6.602  2.158   1.00 0.00 ? 14  VAL A CG1  15 
ATOM   8763  C  CG2  . VAL A 1 14 ? -2.894  -6.832  2.409   1.00 0.00 ? 14  VAL A CG2  15 
ATOM   8764  H  H    . VAL A 1 14 ? -3.662  -5.186  0.172   1.00 0.00 ? 14  VAL A H    15 
ATOM   8765  H  HA   . VAL A 1 14 ? -1.944  -4.297  2.287   1.00 0.00 ? 14  VAL A HA   15 
ATOM   8766  H  HB   . VAL A 1 14 ? -1.819  -6.785  0.578   1.00 0.00 ? 14  VAL A HB   15 
ATOM   8767  H  HG11 . VAL A 1 14 ? -0.218  -7.663  2.090   1.00 0.00 ? 14  VAL A HG11 15 
ATOM   8768  H  HG12 . VAL A 1 14 ? 0.357   -6.059  1.630   1.00 0.00 ? 14  VAL A HG12 15 
ATOM   8769  H  HG13 . VAL A 1 14 ? -0.416  -6.304  3.197   1.00 0.00 ? 14  VAL A HG13 15 
ATOM   8770  H  HG21 . VAL A 1 14 ? -3.812  -6.315  2.171   1.00 0.00 ? 14  VAL A HG21 15 
ATOM   8771  H  HG22 . VAL A 1 14 ? -3.018  -7.889  2.226   1.00 0.00 ? 14  VAL A HG22 15 
ATOM   8772  H  HG23 . VAL A 1 14 ? -2.653  -6.674  3.451   1.00 0.00 ? 14  VAL A HG23 15 
ATOM   8773  N  N    . CYS A 1 15 ? 0.253   -3.732  1.232   1.00 0.00 ? 15  CYS A N    15 
ATOM   8774  C  CA   . CYS A 1 15 ? 1.450   -3.200  0.593   1.00 0.00 ? 15  CYS A CA   15 
ATOM   8775  C  C    . CYS A 1 15 ? 2.273   -4.319  -0.039  1.00 0.00 ? 15  CYS A C    15 
ATOM   8776  O  O    . CYS A 1 15 ? 2.737   -5.227  0.650   1.00 0.00 ? 15  CYS A O    15 
ATOM   8777  C  CB   . CYS A 1 15 ? 2.302   -2.438  1.610   1.00 0.00 ? 15  CYS A CB   15 
ATOM   8778  S  SG   . CYS A 1 15 ? 3.271   -1.072  0.895   1.00 0.00 ? 15  CYS A SG   15 
ATOM   8779  H  H    . CYS A 1 15 ? 0.179   -3.699  2.210   1.00 0.00 ? 15  CYS A H    15 
ATOM   8780  H  HA   . CYS A 1 15 ? 1.137   -2.518  -0.183  1.00 0.00 ? 15  CYS A HA   15 
ATOM   8781  H  HB2  . CYS A 1 15 ? 1.655   -2.019  2.368   1.00 0.00 ? 15  CYS A HB2  15 
ATOM   8782  H  HB3  . CYS A 1 15 ? 2.994   -3.125  2.075   1.00 0.00 ? 15  CYS A HB3  15 
ATOM   8783  N  N    . ASN A 1 16 ? 2.450   -4.246  -1.354  1.00 0.00 ? 16  ASN A N    15 
ATOM   8784  C  CA   . ASN A 1 16 ? 3.216   -5.253  -2.080  1.00 0.00 ? 16  ASN A CA   15 
ATOM   8785  C  C    . ASN A 1 16 ? 4.708   -4.939  -2.033  1.00 0.00 ? 16  ASN A C    15 
ATOM   8786  O  O    . ASN A 1 16 ? 5.455   -5.290  -2.946  1.00 0.00 ? 16  ASN A O    15 
ATOM   8787  C  CB   . ASN A 1 16 ? 2.746   -5.332  -3.533  1.00 0.00 ? 16  ASN A CB   15 
ATOM   8788  C  CG   . ASN A 1 16 ? 1.259   -5.613  -3.645  1.00 0.00 ? 16  ASN A CG   15 
ATOM   8789  O  OD1  . ASN A 1 16 ? 0.448   -4.692  -3.744  1.00 0.00 ? 16  ASN A OD1  15 
ATOM   8790  N  ND2  . ASN A 1 16 ? 0.896   -6.890  -3.631  1.00 0.00 ? 16  ASN A ND2  15 
ATOM   8791  H  H    . ASN A 1 16 ? 2.055   -3.498  -1.849  1.00 0.00 ? 16  ASN A H    15 
ATOM   8792  H  HA   . ASN A 1 16 ? 3.046   -6.206  -1.603  1.00 0.00 ? 16  ASN A HA   15 
ATOM   8793  H  HB2  . ASN A 1 16 ? 2.953   -4.393  -4.024  1.00 0.00 ? 16  ASN A HB2  15 
ATOM   8794  H  HB3  . ASN A 1 16 ? 3.282   -6.123  -4.036  1.00 0.00 ? 16  ASN A HB3  15 
ATOM   8795  H  HD21 . ASN A 1 16 ? 1.597   -7.570  -3.550  1.00 0.00 ? 16  ASN A HD21 15 
ATOM   8796  H  HD22 . ASN A 1 16 ? -0.059  -7.100  -3.702  1.00 0.00 ? 16  ASN A HD22 15 
ATOM   8797  N  N    . GLU A 1 17 ? 5.135   -4.275  -0.963  1.00 0.00 ? 17  GLU A N    15 
ATOM   8798  C  CA   . GLU A 1 17 ? 6.538   -3.913  -0.798  1.00 0.00 ? 17  GLU A CA   15 
ATOM   8799  C  C    . GLU A 1 17 ? 7.032   -4.274  0.600   1.00 0.00 ? 17  GLU A C    15 
ATOM   8800  O  O    . GLU A 1 17 ? 8.175   -4.696  0.778   1.00 0.00 ? 17  GLU A O    15 
ATOM   8801  C  CB   . GLU A 1 17 ? 6.735   -2.417  -1.050  1.00 0.00 ? 17  GLU A CB   15 
ATOM   8802  C  CG   . GLU A 1 17 ? 6.106   -1.930  -2.345  1.00 0.00 ? 17  GLU A CG   15 
ATOM   8803  C  CD   . GLU A 1 17 ? 7.055   -2.017  -3.524  1.00 0.00 ? 17  GLU A CD   15 
ATOM   8804  O  OE1  . GLU A 1 17 ? 7.789   -1.037  -3.767  1.00 0.00 ? 17  GLU A OE1  15 
ATOM   8805  O  OE2  . GLU A 1 17 ? 7.063   -3.065  -4.203  1.00 0.00 ? 17  GLU A OE2  15 
ATOM   8806  H  H    . GLU A 1 17 ? 4.491   -4.022  -0.269  1.00 0.00 ? 17  GLU A H    15 
ATOM   8807  H  HA   . GLU A 1 17 ? 7.111   -4.470  -1.524  1.00 0.00 ? 17  GLU A HA   15 
ATOM   8808  H  HB2  . GLU A 1 17 ? 6.298   -1.865  -0.231  1.00 0.00 ? 17  GLU A HB2  15 
ATOM   8809  H  HB3  . GLU A 1 17 ? 7.794   -2.208  -1.089  1.00 0.00 ? 17  GLU A HB3  15 
ATOM   8810  H  HG2  . GLU A 1 17 ? 5.236   -2.534  -2.557  1.00 0.00 ? 17  GLU A HG2  15 
ATOM   8811  H  HG3  . GLU A 1 17 ? 5.805   -0.901  -2.219  1.00 0.00 ? 17  GLU A HG3  15 
ATOM   8812  N  N    . CYS A 1 18 ? 6.162   -4.104  1.591   1.00 0.00 ? 18  CYS A N    15 
ATOM   8813  C  CA   . CYS A 1 18 ? 6.508   -4.410  2.973   1.00 0.00 ? 18  CYS A CA   15 
ATOM   8814  C  C    . CYS A 1 18 ? 5.562   -5.459  3.551   1.00 0.00 ? 18  CYS A C    15 
ATOM   8815  O  O    . CYS A 1 18 ? 5.977   -6.332  4.313   1.00 0.00 ? 18  CYS A O    15 
ATOM   8816  C  CB   . CYS A 1 18 ? 6.460   -3.140  3.826   1.00 0.00 ? 18  CYS A CB   15 
ATOM   8817  S  SG   . CYS A 1 18 ? 4.826   -2.336  3.872   1.00 0.00 ? 18  CYS A SG   15 
ATOM   8818  H  H    . CYS A 1 18 ? 5.265   -3.764  1.386   1.00 0.00 ? 18  CYS A H    15 
ATOM   8819  H  HA   . CYS A 1 18 ? 7.513   -4.803  2.985   1.00 0.00 ? 18  CYS A HA   15 
ATOM   8820  H  HB2  . CYS A 1 18 ? 6.733   -3.387  4.841   1.00 0.00 ? 18  CYS A HB2  15 
ATOM   8821  H  HB3  . CYS A 1 18 ? 7.168   -2.425  3.432   1.00 0.00 ? 18  CYS A HB3  15 
ATOM   8822  N  N    . GLY A 1 19 ? 4.288   -5.366  3.183   1.00 0.00 ? 19  GLY A N    15 
ATOM   8823  C  CA   . GLY A 1 19 ? 3.304   -6.313  3.674   1.00 0.00 ? 19  GLY A CA   15 
ATOM   8824  C  C    . GLY A 1 19 ? 2.296   -5.671  4.607   1.00 0.00 ? 19  GLY A C    15 
ATOM   8825  O  O    . GLY A 1 19 ? 1.617   -6.359  5.369   1.00 0.00 ? 19  GLY A O    15 
ATOM   8826  H  H    . GLY A 1 19 ? 4.014   -4.649  2.574   1.00 0.00 ? 19  GLY A H    15 
ATOM   8827  H  HA2  . GLY A 1 19 ? 2.778   -6.739  2.832   1.00 0.00 ? 19  GLY A HA2  15 
ATOM   8828  H  HA3  . GLY A 1 19 ? 3.814   -7.104  4.204   1.00 0.00 ? 19  GLY A HA3  15 
ATOM   8829  N  N    . LYS A 1 20 ? 2.200   -4.347  4.550   1.00 0.00 ? 20  LYS A N    15 
ATOM   8830  C  CA   . LYS A 1 20 ? 1.269   -3.610  5.397   1.00 0.00 ? 20  LYS A CA   15 
ATOM   8831  C  C    . LYS A 1 20 ? -0.160  -3.750  4.883   1.00 0.00 ? 20  LYS A C    15 
ATOM   8832  O  O    . LYS A 1 20 ? -0.502  -3.231  3.821   1.00 0.00 ? 20  LYS A O    15 
ATOM   8833  C  CB   . LYS A 1 20 ? 1.660   -2.131  5.453   1.00 0.00 ? 20  LYS A CB   15 
ATOM   8834  C  CG   . LYS A 1 20 ? 1.202   -1.429  6.720   1.00 0.00 ? 20  LYS A CG   15 
ATOM   8835  C  CD   . LYS A 1 20 ? 1.991   -1.896  7.932   1.00 0.00 ? 20  LYS A CD   15 
ATOM   8836  C  CE   . LYS A 1 20 ? 1.382   -1.380  9.226   1.00 0.00 ? 20  LYS A CE   15 
ATOM   8837  N  NZ   . LYS A 1 20 ? 0.367   -2.321  9.776   1.00 0.00 ? 20  LYS A NZ   15 
ATOM   8838  H  H    . LYS A 1 20 ? 2.769   -3.853  3.922   1.00 0.00 ? 20  LYS A H    15 
ATOM   8839  H  HA   . LYS A 1 20 ? 1.324   -4.026  6.391   1.00 0.00 ? 20  LYS A HA   15 
ATOM   8840  H  HB2  . LYS A 1 20 ? 2.735   -2.053  5.391   1.00 0.00 ? 20  LYS A HB2  15 
ATOM   8841  H  HB3  . LYS A 1 20 ? 1.221   -1.623  4.606   1.00 0.00 ? 20  LYS A HB3  15 
ATOM   8842  H  HG2  . LYS A 1 20 ? 1.342   -0.365  6.601   1.00 0.00 ? 20  LYS A HG2  15 
ATOM   8843  H  HG3  . LYS A 1 20 ? 0.155   -1.641  6.880   1.00 0.00 ? 20  LYS A HG3  15 
ATOM   8844  H  HD2  . LYS A 1 20 ? 1.994   -2.976  7.955   1.00 0.00 ? 20  LYS A HD2  15 
ATOM   8845  H  HD3  . LYS A 1 20 ? 3.006   -1.533  7.852   1.00 0.00 ? 20  LYS A HD3  15 
ATOM   8846  H  HE2  . LYS A 1 20 ? 2.169   -1.248  9.952   1.00 0.00 ? 20  LYS A HE2  15 
ATOM   8847  H  HE3  . LYS A 1 20 ? 0.909   -0.428  9.031   1.00 0.00 ? 20  LYS A HE3  15 
ATOM   8848  H  HZ1  . LYS A 1 20 ? 0.327   -2.238  10.812  1.00 0.00 ? 20  LYS A HZ1  15 
ATOM   8849  H  HZ2  . LYS A 1 20 ? 0.617   -3.300  9.527   1.00 0.00 ? 20  LYS A HZ2  15 
ATOM   8850  H  HZ3  . LYS A 1 20 ? -0.571  -2.104  9.385   1.00 0.00 ? 20  LYS A HZ3  15 
ATOM   8851  N  N    . ALA A 1 21 ? -0.992  -4.453  5.646   1.00 0.00 ? 21  ALA A N    15 
ATOM   8852  C  CA   . ALA A 1 21 ? -2.385  -4.657  5.269   1.00 0.00 ? 21  ALA A CA   15 
ATOM   8853  C  C    . ALA A 1 21 ? -3.272  -3.547  5.823   1.00 0.00 ? 21  ALA A C    15 
ATOM   8854  O  O    . ALA A 1 21 ? -3.059  -3.065  6.936   1.00 0.00 ? 21  ALA A O    15 
ATOM   8855  C  CB   . ALA A 1 21 ? -2.870  -6.015  5.756   1.00 0.00 ? 21  ALA A CB   15 
ATOM   8856  H  H    . ALA A 1 21 ? -0.661  -4.842  6.482   1.00 0.00 ? 21  ALA A H    15 
ATOM   8857  H  HA   . ALA A 1 21 ? -2.444  -4.647  4.190   1.00 0.00 ? 21  ALA A HA   15 
ATOM   8858  H  HB1  . ALA A 1 21 ? -3.685  -6.351  5.133   1.00 0.00 ? 21  ALA A HB1  15 
ATOM   8859  H  HB2  . ALA A 1 21 ? -2.058  -6.726  5.703   1.00 0.00 ? 21  ALA A HB2  15 
ATOM   8860  H  HB3  . ALA A 1 21 ? -3.208  -5.931  6.778   1.00 0.00 ? 21  ALA A HB3  15 
ATOM   8861  N  N    . PHE A 1 22 ? -4.267  -3.145  5.039   1.00 0.00 ? 22  PHE A N    15 
ATOM   8862  C  CA   . PHE A 1 22 ? -5.186  -2.090  5.451   1.00 0.00 ? 22  PHE A CA   15 
ATOM   8863  C  C    . PHE A 1 22 ? -6.631  -2.485  5.164   1.00 0.00 ? 22  PHE A C    15 
ATOM   8864  O  O    . PHE A 1 22 ? -6.896  -3.550  4.608   1.00 0.00 ? 22  PHE A O    15 
ATOM   8865  C  CB   . PHE A 1 22 ? -4.850  -0.782  4.731   1.00 0.00 ? 22  PHE A CB   15 
ATOM   8866  C  CG   . PHE A 1 22 ? -3.425  -0.345  4.916   1.00 0.00 ? 22  PHE A CG   15 
ATOM   8867  C  CD1  . PHE A 1 22 ? -2.439  -0.761  4.036   1.00 0.00 ? 22  PHE A CD1  15 
ATOM   8868  C  CD2  . PHE A 1 22 ? -3.072  0.482   5.970   1.00 0.00 ? 22  PHE A CD2  15 
ATOM   8869  C  CE1  . PHE A 1 22 ? -1.126  -0.360  4.203   1.00 0.00 ? 22  PHE A CE1  15 
ATOM   8870  C  CE2  . PHE A 1 22 ? -1.761  0.887   6.142   1.00 0.00 ? 22  PHE A CE2  15 
ATOM   8871  C  CZ   . PHE A 1 22 ? -0.787  0.464   5.258   1.00 0.00 ? 22  PHE A CZ   15 
ATOM   8872  H  H    . PHE A 1 22 ? -4.386  -3.568  4.163   1.00 0.00 ? 22  PHE A H    15 
ATOM   8873  H  HA   . PHE A 1 22 ? -5.069  -1.946  6.514   1.00 0.00 ? 22  PHE A HA   15 
ATOM   8874  H  HB2  . PHE A 1 22 ? -5.023  -0.908  3.672   1.00 0.00 ? 22  PHE A HB2  15 
ATOM   8875  H  HB3  . PHE A 1 22 ? -5.490  0.002   5.106   1.00 0.00 ? 22  PHE A HB3  15 
ATOM   8876  H  HD1  . PHE A 1 22 ? -2.703  -1.406  3.210   1.00 0.00 ? 22  PHE A HD1  15 
ATOM   8877  H  HD2  . PHE A 1 22 ? -3.832  0.812   6.663   1.00 0.00 ? 22  PHE A HD2  15 
ATOM   8878  H  HE1  . PHE A 1 22 ? -0.368  -0.692  3.510   1.00 0.00 ? 22  PHE A HE1  15 
ATOM   8879  H  HE2  . PHE A 1 22 ? -1.499  1.531   6.968   1.00 0.00 ? 22  PHE A HE2  15 
ATOM   8880  H  HZ   . PHE A 1 22 ? 0.237   0.779   5.391   1.00 0.00 ? 22  PHE A HZ   15 
ATOM   8881  N  N    . ARG A 1 23 ? -7.563  -1.618  5.549   1.00 0.00 ? 23  ARG A N    15 
ATOM   8882  C  CA   . ARG A 1 23 ? -8.981  -1.876  5.335   1.00 0.00 ? 23  ARG A CA   15 
ATOM   8883  C  C    . ARG A 1 23 ? -9.424  -1.378  3.963   1.00 0.00 ? 23  ARG A C    15 
ATOM   8884  O  O    . ARG A 1 23 ? -10.206 -2.034  3.275   1.00 0.00 ? 23  ARG A O    15 
ATOM   8885  C  CB   . ARG A 1 23 ? -9.814  -1.203  6.428   1.00 0.00 ? 23  ARG A CB   15 
ATOM   8886  C  CG   . ARG A 1 23 ? -9.536  -1.738  7.823   1.00 0.00 ? 23  ARG A CG   15 
ATOM   8887  C  CD   . ARG A 1 23 ? -10.698 -1.467  8.765   1.00 0.00 ? 23  ARG A CD   15 
ATOM   8888  N  NE   . ARG A 1 23 ? -10.699 -0.089  9.250   1.00 0.00 ? 23  ARG A NE   15 
ATOM   8889  C  CZ   . ARG A 1 23 ? -9.995  0.322   10.298  1.00 0.00 ? 23  ARG A CZ   15 
ATOM   8890  N  NH1  . ARG A 1 23 ? -9.235  -0.534  10.968  1.00 0.00 ? 23  ARG A NH1  15 
ATOM   8891  N  NH2  . ARG A 1 23 ? -10.048 1.592   10.678  1.00 0.00 ? 23  ARG A NH2  15 
ATOM   8892  H  H    . ARG A 1 23 ? -7.289  -0.785  5.988   1.00 0.00 ? 23  ARG A H    15 
ATOM   8893  H  HA   . ARG A 1 23 ? -9.136  -2.944  5.384   1.00 0.00 ? 23  ARG A HA   15 
ATOM   8894  H  HB2  . ARG A 1 23 ? -9.603  -0.144  6.424   1.00 0.00 ? 23  ARG A HB2  15 
ATOM   8895  H  HB3  . ARG A 1 23 ? -10.861 -1.354  6.210   1.00 0.00 ? 23  ARG A HB3  15 
ATOM   8896  H  HG2  . ARG A 1 23 ? -9.376  -2.805  7.764   1.00 0.00 ? 23  ARG A HG2  15 
ATOM   8897  H  HG3  . ARG A 1 23 ? -8.649  -1.260  8.211   1.00 0.00 ? 23  ARG A HG3  15 
ATOM   8898  H  HD2  . ARG A 1 23 ? -11.622 -1.654  8.240   1.00 0.00 ? 23  ARG A HD2  15 
ATOM   8899  H  HD3  . ARG A 1 23 ? -10.622 -2.136  9.610   1.00 0.00 ? 23  ARG A HD3  15 
ATOM   8900  H  HE   . ARG A 1 23 ? -11.254 0.560   8.770   1.00 0.00 ? 23  ARG A HE   15 
ATOM   8901  H  HH11 . ARG A 1 23 ? -9.192  -1.492  10.683  1.00 0.00 ? 23  ARG A HH11 15 
ATOM   8902  H  HH12 . ARG A 1 23 ? -8.704  -0.222  11.756  1.00 0.00 ? 23  ARG A HH12 15 
ATOM   8903  H  HH21 . ARG A 1 23 ? -10.619 2.240   10.176  1.00 0.00 ? 23  ARG A HH21 15 
ATOM   8904  H  HH22 . ARG A 1 23 ? -9.517  1.900   11.467  1.00 0.00 ? 23  ARG A HH22 15 
ATOM   8905  N  N    . SER A 1 24 ? -8.920  -0.212  3.572   1.00 0.00 ? 24  SER A N    15 
ATOM   8906  C  CA   . SER A 1 24 ? -9.266  0.378   2.284   1.00 0.00 ? 24  SER A CA   15 
ATOM   8907  C  C    . SER A 1 24 ? -8.016  0.847   1.547   1.00 0.00 ? 24  SER A C    15 
ATOM   8908  O  O    . SER A 1 24 ? -6.963  1.051   2.152   1.00 0.00 ? 24  SER A O    15 
ATOM   8909  C  CB   . SER A 1 24 ? -10.228 1.551   2.478   1.00 0.00 ? 24  SER A CB   15 
ATOM   8910  O  OG   . SER A 1 24 ? -9.613  2.600   3.207   1.00 0.00 ? 24  SER A OG   15 
ATOM   8911  H  H    . SER A 1 24 ? -8.301  0.265   4.165   1.00 0.00 ? 24  SER A H    15 
ATOM   8912  H  HA   . SER A 1 24 ? -9.754  -0.382  1.692   1.00 0.00 ? 24  SER A HA   15 
ATOM   8913  H  HB2  . SER A 1 24 ? -10.531 1.929   1.514   1.00 0.00 ? 24  SER A HB2  15 
ATOM   8914  H  HB3  . SER A 1 24 ? -11.099 1.213   3.022   1.00 0.00 ? 24  SER A HB3  15 
ATOM   8915  H  HG   . SER A 1 24 ? -8.712  2.718   2.898   1.00 0.00 ? 24  SER A HG   15 
ATOM   8916  N  N    . LYS A 1 25 ? -8.139  1.018   0.235   1.00 0.00 ? 25  LYS A N    15 
ATOM   8917  C  CA   . LYS A 1 25 ? -7.020  1.464   -0.587  1.00 0.00 ? 25  LYS A CA   15 
ATOM   8918  C  C    . LYS A 1 25 ? -6.501  2.817   -0.111  1.00 0.00 ? 25  LYS A C    15 
ATOM   8919  O  O    . LYS A 1 25 ? -5.292  3.034   -0.028  1.00 0.00 ? 25  LYS A O    15 
ATOM   8920  C  CB   . LYS A 1 25 ? -7.445  1.557   -2.055  1.00 0.00 ? 25  LYS A CB   15 
ATOM   8921  C  CG   . LYS A 1 25 ? -8.538  2.580   -2.308  1.00 0.00 ? 25  LYS A CG   15 
ATOM   8922  C  CD   . LYS A 1 25 ? -9.022  2.535   -3.748  1.00 0.00 ? 25  LYS A CD   15 
ATOM   8923  C  CE   . LYS A 1 25 ? -9.581  3.878   -4.191  1.00 0.00 ? 25  LYS A CE   15 
ATOM   8924  N  NZ   . LYS A 1 25 ? -9.569  4.022   -5.673  1.00 0.00 ? 25  LYS A NZ   15 
ATOM   8925  H  H    . LYS A 1 25 ? -9.004  0.839   -0.191  1.00 0.00 ? 25  LYS A H    15 
ATOM   8926  H  HA   . LYS A 1 25 ? -6.229  0.735   -0.496  1.00 0.00 ? 25  LYS A HA   15 
ATOM   8927  H  HB2  . LYS A 1 25 ? -6.584  1.826   -2.650  1.00 0.00 ? 25  LYS A HB2  15 
ATOM   8928  H  HB3  . LYS A 1 25 ? -7.805  0.590   -2.375  1.00 0.00 ? 25  LYS A HB3  15 
ATOM   8929  H  HG2  . LYS A 1 25 ? -9.371  2.373   -1.653  1.00 0.00 ? 25  LYS A HG2  15 
ATOM   8930  H  HG3  . LYS A 1 25 ? -8.150  3.567   -2.099  1.00 0.00 ? 25  LYS A HG3  15 
ATOM   8931  H  HD2  . LYS A 1 25 ? -8.193  2.273   -4.389  1.00 0.00 ? 25  LYS A HD2  15 
ATOM   8932  H  HD3  . LYS A 1 25 ? -9.797  1.786   -3.834  1.00 0.00 ? 25  LYS A HD3  15 
ATOM   8933  H  HE2  . LYS A 1 25 ? -10.597 3.964   -3.838  1.00 0.00 ? 25  LYS A HE2  15 
ATOM   8934  H  HE3  . LYS A 1 25 ? -8.981  4.664   -3.756  1.00 0.00 ? 25  LYS A HE3  15 
ATOM   8935  H  HZ1  . LYS A 1 25 ? -8.617  4.286   -5.999  1.00 0.00 ? 25  LYS A HZ1  15 
ATOM   8936  H  HZ2  . LYS A 1 25 ? -10.241 4.760   -5.965  1.00 0.00 ? 25  LYS A HZ2  15 
ATOM   8937  H  HZ3  . LYS A 1 25 ? -9.841  3.124   -6.122  1.00 0.00 ? 25  LYS A HZ3  15 
ATOM   8938  N  N    . SER A 1 26 ? -7.422  3.722   0.203   1.00 0.00 ? 26  SER A N    15 
ATOM   8939  C  CA   . SER A 1 26 ? -7.056  5.055   0.669   1.00 0.00 ? 26  SER A CA   15 
ATOM   8940  C  C    . SER A 1 26 ? -6.008  4.975   1.775   1.00 0.00 ? 26  SER A C    15 
ATOM   8941  O  O    . SER A 1 26 ? -5.089  5.792   1.834   1.00 0.00 ? 26  SER A O    15 
ATOM   8942  C  CB   . SER A 1 26 ? -8.293  5.798   1.177   1.00 0.00 ? 26  SER A CB   15 
ATOM   8943  O  OG   . SER A 1 26 ? -7.954  7.090   1.648   1.00 0.00 ? 26  SER A OG   15 
ATOM   8944  H  H    . SER A 1 26 ? -8.370  3.489   0.116   1.00 0.00 ? 26  SER A H    15 
ATOM   8945  H  HA   . SER A 1 26 ? -6.640  5.596   -0.167  1.00 0.00 ? 26  SER A HA   15 
ATOM   8946  H  HB2  . SER A 1 26 ? -9.006  5.897   0.372   1.00 0.00 ? 26  SER A HB2  15 
ATOM   8947  H  HB3  . SER A 1 26 ? -8.739  5.238   1.986   1.00 0.00 ? 26  SER A HB3  15 
ATOM   8948  H  HG   . SER A 1 26 ? -8.218  7.176   2.567   1.00 0.00 ? 26  SER A HG   15 
ATOM   8949  N  N    . TYR A 1 27 ? -6.153  3.984   2.648   1.00 0.00 ? 27  TYR A N    15 
ATOM   8950  C  CA   . TYR A 1 27 ? -5.221  3.797   3.753   1.00 0.00 ? 27  TYR A CA   15 
ATOM   8951  C  C    . TYR A 1 27 ? -3.852  3.357   3.243   1.00 0.00 ? 27  TYR A C    15 
ATOM   8952  O  O    . TYR A 1 27 ? -2.818  3.830   3.717   1.00 0.00 ? 27  TYR A O    15 
ATOM   8953  C  CB   . TYR A 1 27 ? -5.767  2.763   4.739   1.00 0.00 ? 27  TYR A CB   15 
ATOM   8954  C  CG   . TYR A 1 27 ? -6.614  3.364   5.838   1.00 0.00 ? 27  TYR A CG   15 
ATOM   8955  C  CD1  . TYR A 1 27 ? -6.203  4.506   6.514   1.00 0.00 ? 27  TYR A CD1  15 
ATOM   8956  C  CD2  . TYR A 1 27 ? -7.825  2.788   6.202   1.00 0.00 ? 27  TYR A CD2  15 
ATOM   8957  C  CE1  . TYR A 1 27 ? -6.974  5.058   7.519   1.00 0.00 ? 27  TYR A CE1  15 
ATOM   8958  C  CE2  . TYR A 1 27 ? -8.603  3.333   7.205   1.00 0.00 ? 27  TYR A CE2  15 
ATOM   8959  C  CZ   . TYR A 1 27 ? -8.173  4.468   7.861   1.00 0.00 ? 27  TYR A CZ   15 
ATOM   8960  O  OH   . TYR A 1 27 ? -8.944  5.013   8.861   1.00 0.00 ? 27  TYR A OH   15 
ATOM   8961  H  H    . TYR A 1 27 ? -6.905  3.365   2.548   1.00 0.00 ? 27  TYR A H    15 
ATOM   8962  H  HA   . TYR A 1 27 ? -5.115  4.745   4.262   1.00 0.00 ? 27  TYR A HA   15 
ATOM   8963  H  HB2  . TYR A 1 27 ? -6.375  2.051   4.204   1.00 0.00 ? 27  TYR A HB2  15 
ATOM   8964  H  HB3  . TYR A 1 27 ? -4.939  2.246   5.203   1.00 0.00 ? 27  TYR A HB3  15 
ATOM   8965  H  HD1  . TYR A 1 27 ? -5.263  4.966   6.244   1.00 0.00 ? 27  TYR A HD1  15 
ATOM   8966  H  HD2  . TYR A 1 27 ? -8.159  1.898   5.687   1.00 0.00 ? 27  TYR A HD2  15 
ATOM   8967  H  HE1  . TYR A 1 27 ? -6.638  5.946   8.033   1.00 0.00 ? 27  TYR A HE1  15 
ATOM   8968  H  HE2  . TYR A 1 27 ? -9.542  2.871   7.473   1.00 0.00 ? 27  TYR A HE2  15 
ATOM   8969  H  HH   . TYR A 1 27 ? -9.400  5.789   8.527   1.00 0.00 ? 27  TYR A HH   15 
ATOM   8970  N  N    . LEU A 1 28 ? -3.853  2.448   2.275   1.00 0.00 ? 28  LEU A N    15 
ATOM   8971  C  CA   . LEU A 1 28 ? -2.612  1.942   1.698   1.00 0.00 ? 28  LEU A CA   15 
ATOM   8972  C  C    . LEU A 1 28 ? -1.969  2.986   0.791   1.00 0.00 ? 28  LEU A C    15 
ATOM   8973  O  O    . LEU A 1 28 ? -0.766  2.939   0.530   1.00 0.00 ? 28  LEU A O    15 
ATOM   8974  C  CB   . LEU A 1 28 ? -2.879  0.659   0.909   1.00 0.00 ? 28  LEU A CB   15 
ATOM   8975  C  CG   . LEU A 1 28 ? -1.776  0.223   -0.056  1.00 0.00 ? 28  LEU A CG   15 
ATOM   8976  C  CD1  . LEU A 1 28 ? -0.588  -0.338  0.709   1.00 0.00 ? 28  LEU A CD1  15 
ATOM   8977  C  CD2  . LEU A 1 28 ? -2.309  -0.803  -1.046  1.00 0.00 ? 28  LEU A CD2  15 
ATOM   8978  H  H    . LEU A 1 28 ? -4.708  2.108   1.938   1.00 0.00 ? 28  LEU A H    15 
ATOM   8979  H  HA   . LEU A 1 28 ? -1.935  1.722   2.510   1.00 0.00 ? 28  LEU A HA   15 
ATOM   8980  H  HB2  . LEU A 1 28 ? -3.032  -0.139  1.619   1.00 0.00 ? 28  LEU A HB2  15 
ATOM   8981  H  HB3  . LEU A 1 28 ? -3.783  0.806   0.336   1.00 0.00 ? 28  LEU A HB3  15 
ATOM   8982  H  HG   . LEU A 1 28 ? -1.436  1.084   -0.616  1.00 0.00 ? 28  LEU A HG   15 
ATOM   8983  H  HD11 . LEU A 1 28 ? -0.922  -1.131  1.361   1.00 0.00 ? 28  LEU A HD11 15 
ATOM   8984  H  HD12 . LEU A 1 28 ? -0.136  0.446   1.298   1.00 0.00 ? 28  LEU A HD12 15 
ATOM   8985  H  HD13 . LEU A 1 28 ? 0.139   -0.727  0.010   1.00 0.00 ? 28  LEU A HD13 15 
ATOM   8986  H  HD21 . LEU A 1 28 ? -1.655  -1.662  -1.060  1.00 0.00 ? 28  LEU A HD21 15 
ATOM   8987  H  HD22 . LEU A 1 28 ? -2.350  -0.364  -2.032  1.00 0.00 ? 28  LEU A HD22 15 
ATOM   8988  H  HD23 . LEU A 1 28 ? -3.301  -1.110  -0.747  1.00 0.00 ? 28  LEU A HD23 15 
ATOM   8989  N  N    . ILE A 1 29 ? -2.777  3.927   0.314   1.00 0.00 ? 29  ILE A N    15 
ATOM   8990  C  CA   . ILE A 1 29 ? -2.285  4.984   -0.561  1.00 0.00 ? 29  ILE A CA   15 
ATOM   8991  C  C    . ILE A 1 29 ? -1.497  6.027   0.225   1.00 0.00 ? 29  ILE A C    15 
ATOM   8992  O  O    . ILE A 1 29 ? -0.458  6.506   -0.229  1.00 0.00 ? 29  ILE A O    15 
ATOM   8993  C  CB   . ILE A 1 29 ? -3.439  5.682   -1.305  1.00 0.00 ? 29  ILE A CB   15 
ATOM   8994  C  CG1  . ILE A 1 29 ? -4.143  4.696   -2.239  1.00 0.00 ? 29  ILE A CG1  15 
ATOM   8995  C  CG2  . ILE A 1 29 ? -2.919  6.880   -2.085  1.00 0.00 ? 29  ILE A CG2  15 
ATOM   8996  C  CD1  . ILE A 1 29 ? -5.605  5.013   -2.463  1.00 0.00 ? 29  ILE A CD1  15 
ATOM   8997  H  H    . ILE A 1 29 ? -3.725  3.911   0.558   1.00 0.00 ? 29  ILE A H    15 
ATOM   8998  H  HA   . ILE A 1 29 ? -1.632  4.532   -1.294  1.00 0.00 ? 29  ILE A HA   15 
ATOM   8999  H  HB   . ILE A 1 29 ? -4.146  6.039   -0.572  1.00 0.00 ? 29  ILE A HB   15 
ATOM   9000  H  HG12 . ILE A 1 29 ? -3.651  4.706   -3.199  1.00 0.00 ? 29  ILE A HG12 15 
ATOM   9001  H  HG13 . ILE A 1 29 ? -4.078  3.703   -1.817  1.00 0.00 ? 29  ILE A HG13 15 
ATOM   9002  H  HG21 . ILE A 1 29 ? -1.839  6.884   -2.060  1.00 0.00 ? 29  ILE A HG21 15 
ATOM   9003  H  HG22 . ILE A 1 29 ? -3.254  6.815   -3.109  1.00 0.00 ? 29  ILE A HG22 15 
ATOM   9004  H  HG23 . ILE A 1 29 ? -3.293  7.790   -1.639  1.00 0.00 ? 29  ILE A HG23 15 
ATOM   9005  H  HD11 . ILE A 1 29 ? -6.214  4.292   -1.937  1.00 0.00 ? 29  ILE A HD11 15 
ATOM   9006  H  HD12 . ILE A 1 29 ? -5.819  6.004   -2.090  1.00 0.00 ? 29  ILE A HD12 15 
ATOM   9007  H  HD13 . ILE A 1 29 ? -5.826  4.969   -3.519  1.00 0.00 ? 29  ILE A HD13 15 
ATOM   9008  N  N    . ILE A 1 30 ? -1.999  6.372   1.406   1.00 0.00 ? 30  ILE A N    15 
ATOM   9009  C  CA   . ILE A 1 30 ? -1.341  7.356   2.257   1.00 0.00 ? 30  ILE A CA   15 
ATOM   9010  C  C    . ILE A 1 30 ? -0.129  6.752   2.959   1.00 0.00 ? 30  ILE A C    15 
ATOM   9011  O  O    . ILE A 1 30 ? 0.699   7.471   3.520   1.00 0.00 ? 30  ILE A O    15 
ATOM   9012  C  CB   . ILE A 1 30 ? -2.306  7.920   3.316   1.00 0.00 ? 30  ILE A CB   15 
ATOM   9013  C  CG1  . ILE A 1 30 ? -2.743  6.815   4.279   1.00 0.00 ? 30  ILE A CG1  15 
ATOM   9014  C  CG2  . ILE A 1 30 ? -3.515  8.555   2.646   1.00 0.00 ? 30  ILE A CG2  15 
ATOM   9015  C  CD1  . ILE A 1 30 ? -3.050  7.315   5.673   1.00 0.00 ? 30  ILE A CD1  15 
ATOM   9016  H  H    . ILE A 1 30 ? -2.831  5.955   1.713   1.00 0.00 ? 30  ILE A H    15 
ATOM   9017  H  HA   . ILE A 1 30 ? -1.010  8.171   1.629   1.00 0.00 ? 30  ILE A HA   15 
ATOM   9018  H  HB   . ILE A 1 30 ? -1.788  8.687   3.871   1.00 0.00 ? 30  ILE A HB   15 
ATOM   9019  H  HG12 . ILE A 1 30 ? -3.632  6.341   3.894   1.00 0.00 ? 30  ILE A HG12 15 
ATOM   9020  H  HG13 . ILE A 1 30 ? -1.954  6.081   4.355   1.00 0.00 ? 30  ILE A HG13 15 
ATOM   9021  H  HG21 . ILE A 1 30 ? -3.276  8.789   1.619   1.00 0.00 ? 30  ILE A HG21 15 
ATOM   9022  H  HG22 . ILE A 1 30 ? -4.345  7.865   2.673   1.00 0.00 ? 30  ILE A HG22 15 
ATOM   9023  H  HG23 . ILE A 1 30 ? -3.783  9.461   3.168   1.00 0.00 ? 30  ILE A HG23 15 
ATOM   9024  H  HD11 . ILE A 1 30 ? -4.007  6.927   5.992   1.00 0.00 ? 30  ILE A HD11 15 
ATOM   9025  H  HD12 . ILE A 1 30 ? -2.282  6.979   6.354   1.00 0.00 ? 30  ILE A HD12 15 
ATOM   9026  H  HD13 . ILE A 1 30 ? -3.083  8.394   5.670   1.00 0.00 ? 30  ILE A HD13 15 
ATOM   9027  N  N    . HIS A 1 31 ? -0.031  5.427   2.924   1.00 0.00 ? 31  HIS A N    15 
ATOM   9028  C  CA   . HIS A 1 31 ? 1.081   4.726   3.555   1.00 0.00 ? 31  HIS A CA   15 
ATOM   9029  C  C    . HIS A 1 31 ? 2.199   4.464   2.551   1.00 0.00 ? 31  HIS A C    15 
ATOM   9030  O  O    . HIS A 1 31 ? 3.382   4.544   2.886   1.00 0.00 ? 31  HIS A O    15 
ATOM   9031  C  CB   . HIS A 1 31 ? 0.603   3.405   4.159   1.00 0.00 ? 31  HIS A CB   15 
ATOM   9032  C  CG   . HIS A 1 31 ? 1.671   2.358   4.232   1.00 0.00 ? 31  HIS A CG   15 
ATOM   9033  N  ND1  . HIS A 1 31 ? 2.227   1.932   5.420   1.00 0.00 ? 31  HIS A ND1  15 
ATOM   9034  C  CD2  . HIS A 1 31 ? 2.284   1.649   3.256   1.00 0.00 ? 31  HIS A CD2  15 
ATOM   9035  C  CE1  . HIS A 1 31 ? 3.137   1.008   5.171   1.00 0.00 ? 31  HIS A CE1  15 
ATOM   9036  N  NE2  . HIS A 1 31 ? 3.191   0.817   3.865   1.00 0.00 ? 31  HIS A NE2  15 
ATOM   9037  H  H    . HIS A 1 31 ? -0.722  4.909   2.462   1.00 0.00 ? 31  HIS A H    15 
ATOM   9038  H  HA   . HIS A 1 31 ? 1.464   5.355   4.345   1.00 0.00 ? 31  HIS A HA   15 
ATOM   9039  H  HB2  . HIS A 1 31 ? 0.245   3.584   5.162   1.00 0.00 ? 31  HIS A HB2  15 
ATOM   9040  H  HB3  . HIS A 1 31 ? -0.206  3.014   3.558   1.00 0.00 ? 31  HIS A HB3  15 
ATOM   9041  H  HD1  . HIS A 1 31 ? 1.991   2.260   6.312   1.00 0.00 ? 31  HIS A HD1  15 
ATOM   9042  H  HD2  . HIS A 1 31 ? 2.096   1.724   2.194   1.00 0.00 ? 31  HIS A HD2  15 
ATOM   9043  H  HE1  . HIS A 1 31 ? 3.735   0.494   5.908   1.00 0.00 ? 31  HIS A HE1  15 
ATOM   9044  N  N    . THR A 1 32 ? 1.818   4.150   1.316   1.00 0.00 ? 32  THR A N    15 
ATOM   9045  C  CA   . THR A 1 32 ? 2.787   3.874   0.263   1.00 0.00 ? 32  THR A CA   15 
ATOM   9046  C  C    . THR A 1 32 ? 3.649   5.098   -0.024  1.00 0.00 ? 32  THR A C    15 
ATOM   9047  O  O    . THR A 1 32 ? 4.711   4.991   -0.638  1.00 0.00 ? 32  THR A O    15 
ATOM   9048  C  CB   . THR A 1 32 ? 2.092   3.433   -1.038  1.00 0.00 ? 32  THR A CB   15 
ATOM   9049  O  OG1  . THR A 1 32 ? 3.061   2.931   -1.965  1.00 0.00 ? 32  THR A OG1  15 
ATOM   9050  C  CG2  . THR A 1 32 ? 1.335   4.593   -1.667  1.00 0.00 ? 32  THR A CG2  15 
ATOM   9051  H  H    . THR A 1 32 ? 0.861   4.102   1.111   1.00 0.00 ? 32  THR A H    15 
ATOM   9052  H  HA   . THR A 1 32 ? 3.423   3.068   0.599   1.00 0.00 ? 32  THR A HA   15 
ATOM   9053  H  HB   . THR A 1 32 ? 1.388   2.647   -0.804  1.00 0.00 ? 32  THR A HB   15 
ATOM   9054  H  HG1  . THR A 1 32 ? 3.494   2.161   -1.590  1.00 0.00 ? 32  THR A HG1  15 
ATOM   9055  H  HG21 . THR A 1 32 ? 1.215   4.413   -2.725  1.00 0.00 ? 32  THR A HG21 15 
ATOM   9056  H  HG22 . THR A 1 32 ? 1.889   5.508   -1.519  1.00 0.00 ? 32  THR A HG22 15 
ATOM   9057  H  HG23 . THR A 1 32 ? 0.363   4.681   -1.205  1.00 0.00 ? 32  THR A HG23 15 
ATOM   9058  N  N    . ARG A 1 33 ? 3.188   6.260   0.425   1.00 0.00 ? 33  ARG A N    15 
ATOM   9059  C  CA   . ARG A 1 33 ? 3.917   7.505   0.216   1.00 0.00 ? 33  ARG A CA   15 
ATOM   9060  C  C    . ARG A 1 33 ? 5.044   7.653   1.234   1.00 0.00 ? 33  ARG A C    15 
ATOM   9061  O  O    . ARG A 1 33 ? 6.029   8.351   0.991   1.00 0.00 ? 33  ARG A O    15 
ATOM   9062  C  CB   . ARG A 1 33 ? 2.968   8.700   0.312   1.00 0.00 ? 33  ARG A CB   15 
ATOM   9063  C  CG   . ARG A 1 33 ? 2.105   8.694   1.563   1.00 0.00 ? 33  ARG A CG   15 
ATOM   9064  C  CD   . ARG A 1 33 ? 1.409   10.030  1.767   1.00 0.00 ? 33  ARG A CD   15 
ATOM   9065  N  NE   . ARG A 1 33 ? 2.284   11.013  2.401   1.00 0.00 ? 33  ARG A NE   15 
ATOM   9066  C  CZ   . ARG A 1 33 ? 2.101   12.326  2.313   1.00 0.00 ? 33  ARG A CZ   15 
ATOM   9067  N  NH1  . ARG A 1 33 ? 1.078   12.811  1.623   1.00 0.00 ? 33  ARG A NH1  15 
ATOM   9068  N  NH2  . ARG A 1 33 ? 2.940   13.156  2.918   1.00 0.00 ? 33  ARG A NH2  15 
ATOM   9069  H  H    . ARG A 1 33 ? 2.335   6.282   0.908   1.00 0.00 ? 33  ARG A H    15 
ATOM   9070  H  HA   . ARG A 1 33 ? 4.346   7.476   -0.775  1.00 0.00 ? 33  ARG A HA   15 
ATOM   9071  H  HB2  . ARG A 1 33 ? 3.551   9.610   0.308   1.00 0.00 ? 33  ARG A HB2  15 
ATOM   9072  H  HB3  . ARG A 1 33 ? 2.316   8.697   -0.549  1.00 0.00 ? 33  ARG A HB3  15 
ATOM   9073  H  HG2  . ARG A 1 33 ? 1.357   7.921   1.470   1.00 0.00 ? 33  ARG A HG2  15 
ATOM   9074  H  HG3  . ARG A 1 33 ? 2.731   8.490   2.419   1.00 0.00 ? 33  ARG A HG3  15 
ATOM   9075  H  HD2  . ARG A 1 33 ? 1.096   10.409  0.805   1.00 0.00 ? 33  ARG A HD2  15 
ATOM   9076  H  HD3  . ARG A 1 33 ? 0.542   9.878   2.392   1.00 0.00 ? 33  ARG A HD3  15 
ATOM   9077  H  HE   . ARG A 1 33 ? 3.046   10.676  2.916   1.00 0.00 ? 33  ARG A HE   15 
ATOM   9078  H  HH11 . ARG A 1 33 ? 0.443   12.187  1.167   1.00 0.00 ? 33  ARG A HH11 15 
ATOM   9079  H  HH12 . ARG A 1 33 ? 0.941   13.799  1.559   1.00 0.00 ? 33  ARG A HH12 15 
ATOM   9080  H  HH21 . ARG A 1 33 ? 3.712   12.794  3.440   1.00 0.00 ? 33  ARG A HH21 15 
ATOM   9081  H  HH22 . ARG A 1 33 ? 2.802   14.143  2.851   1.00 0.00 ? 33  ARG A HH22 15 
ATOM   9082  N  N    . THR A 1 34 ? 4.891   6.992   2.378   1.00 0.00 ? 34  THR A N    15 
ATOM   9083  C  CA   . THR A 1 34 ? 5.893   7.051   3.434   1.00 0.00 ? 34  THR A CA   15 
ATOM   9084  C  C    . THR A 1 34 ? 7.185   6.364   3.006   1.00 0.00 ? 34  THR A C    15 
ATOM   9085  O  O    . THR A 1 34 ? 8.267   6.695   3.493   1.00 0.00 ? 34  THR A O    15 
ATOM   9086  C  CB   . THR A 1 34 ? 5.382   6.396   4.731   1.00 0.00 ? 34  THR A CB   15 
ATOM   9087  O  OG1  . THR A 1 34 ? 5.152   4.999   4.517   1.00 0.00 ? 34  THR A OG1  15 
ATOM   9088  C  CG2  . THR A 1 34 ? 4.097   7.060   5.203   1.00 0.00 ? 34  THR A CG2  15 
ATOM   9089  H  H    . THR A 1 34 ? 4.084   6.453   2.513   1.00 0.00 ? 34  THR A H    15 
ATOM   9090  H  HA   . THR A 1 34 ? 6.101   8.092   3.639   1.00 0.00 ? 34  THR A HA   15 
ATOM   9091  H  HB   . THR A 1 34 ? 6.134   6.516   5.498   1.00 0.00 ? 34  THR A HB   15 
ATOM   9092  H  HG1  . THR A 1 34 ? 5.717   4.687   3.806   1.00 0.00 ? 34  THR A HG1  15 
ATOM   9093  H  HG21 . THR A 1 34 ? 3.310   6.869   4.489   1.00 0.00 ? 34  THR A HG21 15 
ATOM   9094  H  HG22 . THR A 1 34 ? 4.253   8.125   5.289   1.00 0.00 ? 34  THR A HG22 15 
ATOM   9095  H  HG23 . THR A 1 34 ? 3.816   6.658   6.165   1.00 0.00 ? 34  THR A HG23 15 
ATOM   9096  N  N    . HIS A 1 35 ? 7.065   5.406   2.092   1.00 0.00 ? 35  HIS A N    15 
ATOM   9097  C  CA   . HIS A 1 35 ? 8.224   4.672   1.597   1.00 0.00 ? 35  HIS A CA   15 
ATOM   9098  C  C    . HIS A 1 35 ? 9.221   5.616   0.931   1.00 0.00 ? 35  HIS A C    15 
ATOM   9099  O  O    . HIS A 1 35 ? 10.417  5.329   0.866   1.00 0.00 ? 35  HIS A O    15 
ATOM   9100  C  CB   . HIS A 1 35 ? 7.787   3.593   0.607   1.00 0.00 ? 35  HIS A CB   15 
ATOM   9101  C  CG   . HIS A 1 35 ? 7.315   2.332   1.265   1.00 0.00 ? 35  HIS A CG   15 
ATOM   9102  N  ND1  . HIS A 1 35 ? 8.172   1.337   1.685   1.00 0.00 ? 35  HIS A ND1  15 
ATOM   9103  C  CD2  . HIS A 1 35 ? 6.068   1.909   1.576   1.00 0.00 ? 35  HIS A CD2  15 
ATOM   9104  C  CE1  . HIS A 1 35 ? 7.472   0.355   2.225   1.00 0.00 ? 35  HIS A CE1  15 
ATOM   9105  N  NE2  . HIS A 1 35 ? 6.192   0.678   2.171   1.00 0.00 ? 35  HIS A NE2  15 
ATOM   9106  H  H    . HIS A 1 35 ? 6.176   5.188   1.743   1.00 0.00 ? 35  HIS A H    15 
ATOM   9107  H  HA   . HIS A 1 35 ? 8.704   4.201   2.442   1.00 0.00 ? 35  HIS A HA   15 
ATOM   9108  H  HB2  . HIS A 1 35 ? 6.976   3.974   0.004   1.00 0.00 ? 35  HIS A HB2  15 
ATOM   9109  H  HB3  . HIS A 1 35 ? 8.619   3.342   -0.034  1.00 0.00 ? 35  HIS A HB3  15 
ATOM   9110  H  HD1  . HIS A 1 35 ? 9.148   1.348   1.600   1.00 0.00 ? 35  HIS A HD1  15 
ATOM   9111  H  HD2  . HIS A 1 35 ? 5.145   2.440   1.390   1.00 0.00 ? 35  HIS A HD2  15 
ATOM   9112  H  HE1  . HIS A 1 35 ? 7.876   -0.556  2.639   1.00 0.00 ? 35  HIS A HE1  15 
ATOM   9113  N  N    . THR A 1 36 ? 8.720   6.744   0.436   1.00 0.00 ? 36  THR A N    15 
ATOM   9114  C  CA   . THR A 1 36 ? 9.565   7.729   -0.227  1.00 0.00 ? 36  THR A CA   15 
ATOM   9115  C  C    . THR A 1 36 ? 9.626   9.027   0.570   1.00 0.00 ? 36  THR A C    15 
ATOM   9116  O  O    . THR A 1 36 ? 9.621   10.117  0.001   1.00 0.00 ? 36  THR A O    15 
ATOM   9117  C  CB   . THR A 1 36 ? 9.060   8.036   -1.649  1.00 0.00 ? 36  THR A CB   15 
ATOM   9118  O  OG1  . THR A 1 36 ? 7.681   8.417   -1.608  1.00 0.00 ? 36  THR A OG1  15 
ATOM   9119  C  CG2  . THR A 1 36 ? 9.232   6.828   -2.557  1.00 0.00 ? 36  THR A CG2  15 
ATOM   9120  H  H    . THR A 1 36 ? 7.759   6.916   0.519   1.00 0.00 ? 36  THR A H    15 
ATOM   9121  H  HA   . THR A 1 36 ? 10.561  7.317   -0.302  1.00 0.00 ? 36  THR A HA   15 
ATOM   9122  H  HB   . THR A 1 36 ? 9.640   8.855   -2.051  1.00 0.00 ? 36  THR A HB   15 
ATOM   9123  H  HG1  . THR A 1 36 ? 7.387   8.456   -0.694  1.00 0.00 ? 36  THR A HG1  15 
ATOM   9124  H  HG21 . THR A 1 36 ? 8.802   7.041   -3.524  1.00 0.00 ? 36  THR A HG21 15 
ATOM   9125  H  HG22 . THR A 1 36 ? 8.731   5.976   -2.121  1.00 0.00 ? 36  THR A HG22 15 
ATOM   9126  H  HG23 . THR A 1 36 ? 10.283  6.608   -2.670  1.00 0.00 ? 36  THR A HG23 15 
ATOM   9127  N  N    . GLY A 1 37 ? 9.683   8.902   1.893   1.00 0.00 ? 37  GLY A N    15 
ATOM   9128  C  CA   . GLY A 1 37 ? 9.745   10.074  2.747   1.00 0.00 ? 37  GLY A CA   15 
ATOM   9129  C  C    . GLY A 1 37 ? 11.146  10.350  3.253   1.00 0.00 ? 37  GLY A C    15 
ATOM   9130  O  O    . GLY A 1 37 ? 11.706  11.416  2.999   1.00 0.00 ? 37  GLY A O    15 
ATOM   9131  H  H    . GLY A 1 37 ? 9.684   8.007   2.292   1.00 0.00 ? 37  GLY A H    15 
ATOM   9132  H  HA2  . GLY A 1 37 ? 9.399   10.931  2.188   1.00 0.00 ? 37  GLY A HA2  15 
ATOM   9133  H  HA3  . GLY A 1 37 ? 9.092   9.922   3.594   1.00 0.00 ? 37  GLY A HA3  15 
ATOM   9134  N  N    . GLU A 1 38 ? 11.715  9.387   3.972   1.00 0.00 ? 38  GLU A N    15 
ATOM   9135  C  CA   . GLU A 1 38 ? 13.059  9.534   4.517   1.00 0.00 ? 38  GLU A CA   15 
ATOM   9136  C  C    . GLU A 1 38 ? 14.104  9.012   3.535   1.00 0.00 ? 38  GLU A C    15 
ATOM   9137  O  O    . GLU A 1 38 ? 15.017  9.737   3.141   1.00 0.00 ? 38  GLU A O    15 
ATOM   9138  C  CB   . GLU A 1 38 ? 13.178  8.790   5.849   1.00 0.00 ? 38  GLU A CB   15 
ATOM   9139  C  CG   . GLU A 1 38 ? 14.597  8.729   6.388   1.00 0.00 ? 38  GLU A CG   15 
ATOM   9140  C  CD   . GLU A 1 38 ? 15.007  10.005  7.097   1.00 0.00 ? 38  GLU A CD   15 
ATOM   9141  O  OE1  . GLU A 1 38 ? 14.239  10.475  7.963   1.00 0.00 ? 38  GLU A OE1  15 
ATOM   9142  O  OE2  . GLU A 1 38 ? 16.094  10.534  6.787   1.00 0.00 ? 38  GLU A OE2  15 
ATOM   9143  H  H    . GLU A 1 38 ? 11.218  8.560   4.141   1.00 0.00 ? 38  GLU A H    15 
ATOM   9144  H  HA   . GLU A 1 38 ? 13.235  10.586  4.687   1.00 0.00 ? 38  GLU A HA   15 
ATOM   9145  H  HB2  . GLU A 1 38 ? 12.557  9.285   6.581   1.00 0.00 ? 38  GLU A HB2  15 
ATOM   9146  H  HB3  . GLU A 1 38 ? 12.823  7.779   5.714   1.00 0.00 ? 38  GLU A HB3  15 
ATOM   9147  H  HG2  . GLU A 1 38 ? 14.669  7.909   7.086   1.00 0.00 ? 38  GLU A HG2  15 
ATOM   9148  H  HG3  . GLU A 1 38 ? 15.274  8.559   5.564   1.00 0.00 ? 38  GLU A HG3  15 
ATOM   9149  N  N    . SER A 1 39 ? 13.963  7.749   3.146   1.00 0.00 ? 39  SER A N    15 
ATOM   9150  C  CA   . SER A 1 39 ? 14.897  7.128   2.214   1.00 0.00 ? 39  SER A CA   15 
ATOM   9151  C  C    . SER A 1 39 ? 15.320  8.115   1.130   1.00 0.00 ? 39  SER A C    15 
ATOM   9152  O  O    . SER A 1 39 ? 14.534  8.959   0.702   1.00 0.00 ? 39  SER A O    15 
ATOM   9153  C  CB   . SER A 1 39 ? 14.264  5.891   1.574   1.00 0.00 ? 39  SER A CB   15 
ATOM   9154  O  OG   . SER A 1 39 ? 13.852  4.961   2.561   1.00 0.00 ? 39  SER A OG   15 
ATOM   9155  H  H    . SER A 1 39 ? 13.214  7.222   3.496   1.00 0.00 ? 39  SER A H    15 
ATOM   9156  H  HA   . SER A 1 39 ? 15.771  6.827   2.772   1.00 0.00 ? 39  SER A HA   15 
ATOM   9157  H  HB2  . SER A 1 39 ? 13.403  6.188   0.995   1.00 0.00 ? 39  SER A HB2  15 
ATOM   9158  H  HB3  . SER A 1 39 ? 14.986  5.415   0.927   1.00 0.00 ? 39  SER A HB3  15 
ATOM   9159  H  HG   . SER A 1 39 ? 13.112  4.447   2.228   1.00 0.00 ? 39  SER A HG   15 
ATOM   9160  N  N    . GLY A 1 40 ? 16.569  8.001   0.690   1.00 0.00 ? 40  GLY A N    15 
ATOM   9161  C  CA   . GLY A 1 40 ? 17.077  8.889   -0.340  1.00 0.00 ? 40  GLY A CA   15 
ATOM   9162  C  C    . GLY A 1 40 ? 16.722  8.419   -1.737  1.00 0.00 ? 40  GLY A C    15 
ATOM   9163  O  O    . GLY A 1 40 ? 15.712  8.825   -2.313  1.00 0.00 ? 40  GLY A O    15 
ATOM   9164  H  H    . GLY A 1 40 ? 17.151  7.308   1.067   1.00 0.00 ? 40  GLY A H    15 
ATOM   9165  H  HA2  . GLY A 1 40 ? 16.663  9.874   -0.187  1.00 0.00 ? 40  GLY A HA2  15 
ATOM   9166  H  HA3  . GLY A 1 40 ? 18.152  8.943   -0.254  1.00 0.00 ? 40  GLY A HA3  15 
ATOM   9167  N  N    . PRO A 1 41 ? 17.565  7.544   -2.304  1.00 0.00 ? 41  PRO A N    15 
ATOM   9168  C  CA   . PRO A 1 41 ? 17.356  7.001   -3.649  1.00 0.00 ? 41  PRO A CA   15 
ATOM   9169  C  C    . PRO A 1 41 ? 16.169  6.046   -3.711  1.00 0.00 ? 41  PRO A C    15 
ATOM   9170  O  O    . PRO A 1 41 ? 16.125  5.048   -2.992  1.00 0.00 ? 41  PRO A O    15 
ATOM   9171  C  CB   . PRO A 1 41 ? 18.661  6.252   -3.936  1.00 0.00 ? 41  PRO A CB   15 
ATOM   9172  C  CG   . PRO A 1 41 ? 19.197  5.898   -2.592  1.00 0.00 ? 41  PRO A CG   15 
ATOM   9173  C  CD   . PRO A 1 41 ? 18.788  7.017   -1.675  1.00 0.00 ? 41  PRO A CD   15 
ATOM   9174  H  HA   . PRO A 1 41 ? 17.223  7.787   -4.378  1.00 0.00 ? 41  PRO A HA   15 
ATOM   9175  H  HB2  . PRO A 1 41 ? 18.450  5.369   -4.523  1.00 0.00 ? 41  PRO A HB2  15 
ATOM   9176  H  HB3  . PRO A 1 41 ? 19.339  6.896   -4.474  1.00 0.00 ? 41  PRO A HB3  15 
ATOM   9177  H  HG2  . PRO A 1 41 ? 18.769  4.965   -2.260  1.00 0.00 ? 41  PRO A HG2  15 
ATOM   9178  H  HG3  . PRO A 1 41 ? 20.274  5.824   -2.635  1.00 0.00 ? 41  PRO A HG3  15 
ATOM   9179  H  HD2  . PRO A 1 41 ? 18.579  6.637   -0.685  1.00 0.00 ? 41  PRO A HD2  15 
ATOM   9180  H  HD3  . PRO A 1 41 ? 19.558  7.774   -1.636  1.00 0.00 ? 41  PRO A HD3  15 
ATOM   9181  N  N    . SER A 1 42 ? 15.209  6.358   -4.575  1.00 0.00 ? 42  SER A N    15 
ATOM   9182  C  CA   . SER A 1 42 ? 14.019  5.529   -4.728  1.00 0.00 ? 42  SER A CA   15 
ATOM   9183  C  C    . SER A 1 42 ? 14.387  4.048   -4.744  1.00 0.00 ? 42  SER A C    15 
ATOM   9184  O  O    . SER A 1 42 ? 13.756  3.233   -4.071  1.00 0.00 ? 42  SER A O    15 
ATOM   9185  C  CB   . SER A 1 42 ? 13.278  5.895   -6.016  1.00 0.00 ? 42  SER A CB   15 
ATOM   9186  O  OG   . SER A 1 42 ? 14.039  5.546   -7.159  1.00 0.00 ? 42  SER A OG   15 
ATOM   9187  H  H    . SER A 1 42 ? 15.302  7.167   -5.121  1.00 0.00 ? 42  SER A H    15 
ATOM   9188  H  HA   . SER A 1 42 ? 13.372  5.718   -3.884  1.00 0.00 ? 42  SER A HA   15 
ATOM   9189  H  HB2  . SER A 1 42 ? 12.337  5.367   -6.049  1.00 0.00 ? 42  SER A HB2  15 
ATOM   9190  H  HB3  . SER A 1 42 ? 13.095  6.960   -6.031  1.00 0.00 ? 42  SER A HB3  15 
ATOM   9191  H  HG   . SER A 1 42 ? 13.490  5.617   -7.943  1.00 0.00 ? 42  SER A HG   15 
ATOM   9192  N  N    . SER A 1 43 ? 15.414  3.708   -5.517  1.00 0.00 ? 43  SER A N    15 
ATOM   9193  C  CA   . SER A 1 43 ? 15.865  2.326   -5.624  1.00 0.00 ? 43  SER A CA   15 
ATOM   9194  C  C    . SER A 1 43 ? 15.820  1.632   -4.266  1.00 0.00 ? 43  SER A C    15 
ATOM   9195  O  O    . SER A 1 43 ? 15.855  2.284   -3.223  1.00 0.00 ? 43  SER A O    15 
ATOM   9196  C  CB   . SER A 1 43 ? 17.285  2.273   -6.190  1.00 0.00 ? 43  SER A CB   15 
ATOM   9197  O  OG   . SER A 1 43 ? 17.273  2.328   -7.606  1.00 0.00 ? 43  SER A OG   15 
ATOM   9198  H  H    . SER A 1 43 ? 15.877  4.404   -6.029  1.00 0.00 ? 43  SER A H    15 
ATOM   9199  H  HA   . SER A 1 43 ? 15.198  1.811   -6.300  1.00 0.00 ? 43  SER A HA   15 
ATOM   9200  H  HB2  . SER A 1 43 ? 17.851  3.112   -5.814  1.00 0.00 ? 43  SER A HB2  15 
ATOM   9201  H  HB3  . SER A 1 43 ? 17.759  1.352   -5.881  1.00 0.00 ? 43  SER A HB3  15 
ATOM   9202  H  HG   . SER A 1 43 ? 18.112  2.008   -7.946  1.00 0.00 ? 43  SER A HG   15 
ATOM   9203  N  N    . GLY A 1 44 ? 15.742  0.305   -4.288  1.00 0.00 ? 44  GLY A N    15 
ATOM   9204  C  CA   . GLY A 1 44 ? 15.693  -0.456  -3.053  1.00 0.00 ? 44  GLY A CA   15 
ATOM   9205  C  C    . GLY A 1 44 ? 14.936  -1.760  -3.205  1.00 0.00 ? 44  GLY A C    15 
ATOM   9206  O  O    . GLY A 1 44 ? 13.712  -1.732  -3.318  1.00 0.00 ? 44  GLY A O    15 
ATOM   9207  H  H    . GLY A 1 44 ? 15.717  -0.161  -5.150  1.00 0.00 ? 44  GLY A H    15 
ATOM   9208  H  HA2  . GLY A 1 44 ? 16.703  -0.672  -2.737  1.00 0.00 ? 44  GLY A HA2  15 
ATOM   9209  H  HA3  . GLY A 1 44 ? 15.209  0.142   -2.295  1.00 0.00 ? 44  GLY A HA3  15 
HETATM 9210  ZN ZN   . ZN  B 2 .  ? 4.533   -0.394  2.799   1.00 0.00 ? 181 ZN  A ZN   15 
ATOM   9211  N  N    . GLY A 1 1  ? -18.827 -30.754 -9.970  1.00 0.00 ? 1   GLY A N    16 
ATOM   9212  C  CA   . GLY A 1 1  ? -19.938 -29.917 -9.553  1.00 0.00 ? 1   GLY A CA   16 
ATOM   9213  C  C    . GLY A 1 1  ? -19.515 -28.489 -9.275  1.00 0.00 ? 1   GLY A C    16 
ATOM   9214  O  O    . GLY A 1 1  ? -19.714 -27.602 -10.105 1.00 0.00 ? 1   GLY A O    16 
ATOM   9215  H  H1   . GLY A 1 1  ? -17.908 -30.485 -9.760  1.00 0.00 ? 1   GLY A H1   16 
ATOM   9216  H  HA2  . GLY A 1 1  ? -20.685 -29.915 -10.333 1.00 0.00 ? 1   GLY A HA2  16 
ATOM   9217  H  HA3  . GLY A 1 1  ? -20.370 -30.334 -8.655  1.00 0.00 ? 1   GLY A HA3  16 
ATOM   9218  N  N    . SER A 1 2  ? -18.930 -28.264 -8.102  1.00 0.00 ? 2   SER A N    16 
ATOM   9219  C  CA   . SER A 1 2  ? -18.482 -26.932 -7.714  1.00 0.00 ? 2   SER A CA   16 
ATOM   9220  C  C    . SER A 1 2  ? -17.069 -26.979 -7.140  1.00 0.00 ? 2   SER A C    16 
ATOM   9221  O  O    . SER A 1 2  ? -16.744 -27.850 -6.333  1.00 0.00 ? 2   SER A O    16 
ATOM   9222  C  CB   . SER A 1 2  ? -19.442 -26.328 -6.687  1.00 0.00 ? 2   SER A CB   16 
ATOM   9223  O  OG   . SER A 1 2  ? -18.914 -25.134 -6.136  1.00 0.00 ? 2   SER A OG   16 
ATOM   9224  H  H    . SER A 1 2  ? -18.798 -29.013 -7.483  1.00 0.00 ? 2   SER A H    16 
ATOM   9225  H  HA   . SER A 1 2  ? -18.479 -26.312 -8.598  1.00 0.00 ? 2   SER A HA   16 
ATOM   9226  H  HB2  . SER A 1 2  ? -20.383 -26.104 -7.165  1.00 0.00 ? 2   SER A HB2  16 
ATOM   9227  H  HB3  . SER A 1 2  ? -19.604 -27.038 -5.888  1.00 0.00 ? 2   SER A HB3  16 
ATOM   9228  H  HG   . SER A 1 2  ? -19.369 -24.931 -5.315  1.00 0.00 ? 2   SER A HG   16 
ATOM   9229  N  N    . SER A 1 3  ? -16.234 -26.035 -7.563  1.00 0.00 ? 3   SER A N    16 
ATOM   9230  C  CA   . SER A 1 3  ? -14.854 -25.970 -7.095  1.00 0.00 ? 3   SER A CA   16 
ATOM   9231  C  C    . SER A 1 3  ? -14.570 -24.628 -6.428  1.00 0.00 ? 3   SER A C    16 
ATOM   9232  O  O    . SER A 1 3  ? -15.407 -23.727 -6.438  1.00 0.00 ? 3   SER A O    16 
ATOM   9233  C  CB   . SER A 1 3  ? -13.888 -26.189 -8.261  1.00 0.00 ? 3   SER A CB   16 
ATOM   9234  O  OG   . SER A 1 3  ? -13.870 -25.066 -9.126  1.00 0.00 ? 3   SER A OG   16 
ATOM   9235  H  H    . SER A 1 3  ? -16.553 -25.369 -8.207  1.00 0.00 ? 3   SER A H    16 
ATOM   9236  H  HA   . SER A 1 3  ? -14.713 -26.757 -6.369  1.00 0.00 ? 3   SER A HA   16 
ATOM   9237  H  HB2  . SER A 1 3  ? -12.892 -26.346 -7.875  1.00 0.00 ? 3   SER A HB2  16 
ATOM   9238  H  HB3  . SER A 1 3  ? -14.197 -27.058 -8.823  1.00 0.00 ? 3   SER A HB3  16 
ATOM   9239  H  HG   . SER A 1 3  ? -13.617 -24.284 -8.630  1.00 0.00 ? 3   SER A HG   16 
ATOM   9240  N  N    . GLY A 1 4  ? -13.380 -24.503 -5.848  1.00 0.00 ? 4   GLY A N    16 
ATOM   9241  C  CA   . GLY A 1 4  ? -13.004 -23.269 -5.184  1.00 0.00 ? 4   GLY A CA   16 
ATOM   9242  C  C    . GLY A 1 4  ? -11.539 -23.240 -4.799  1.00 0.00 ? 4   GLY A C    16 
ATOM   9243  O  O    . GLY A 1 4  ? -11.187 -23.501 -3.648  1.00 0.00 ? 4   GLY A O    16 
ATOM   9244  H  H    . GLY A 1 4  ? -12.752 -25.255 -5.872  1.00 0.00 ? 4   GLY A H    16 
ATOM   9245  H  HA2  . GLY A 1 4  ? -13.208 -22.440 -5.845  1.00 0.00 ? 4   GLY A HA2  16 
ATOM   9246  H  HA3  . GLY A 1 4  ? -13.601 -23.158 -4.290  1.00 0.00 ? 4   GLY A HA3  16 
ATOM   9247  N  N    . SER A 1 5  ? -10.681 -22.923 -5.763  1.00 0.00 ? 5   SER A N    16 
ATOM   9248  C  CA   . SER A 1 5  ? -9.244  -22.867 -5.521  1.00 0.00 ? 5   SER A CA   16 
ATOM   9249  C  C    . SER A 1 5  ? -8.945  -22.199 -4.183  1.00 0.00 ? 5   SER A C    16 
ATOM   9250  O  O    . SER A 1 5  ? -9.240  -21.020 -3.985  1.00 0.00 ? 5   SER A O    16 
ATOM   9251  C  CB   . SER A 1 5  ? -8.544  -22.109 -6.650  1.00 0.00 ? 5   SER A CB   16 
ATOM   9252  O  OG   . SER A 1 5  ? -9.121  -20.829 -6.839  1.00 0.00 ? 5   SER A OG   16 
ATOM   9253  H  H    . SER A 1 5  ? -11.023 -22.725 -6.661  1.00 0.00 ? 5   SER A H    16 
ATOM   9254  H  HA   . SER A 1 5  ? -8.872  -23.881 -5.495  1.00 0.00 ? 5   SER A HA   16 
ATOM   9255  H  HB2  . SER A 1 5  ? -7.500  -21.988 -6.406  1.00 0.00 ? 5   SER A HB2  16 
ATOM   9256  H  HB3  . SER A 1 5  ? -8.636  -22.672 -7.568  1.00 0.00 ? 5   SER A HB3  16 
ATOM   9257  H  HG   . SER A 1 5  ? -10.056 -20.924 -7.034  1.00 0.00 ? 5   SER A HG   16 
ATOM   9258  N  N    . SER A 1 6  ? -8.357  -22.961 -3.266  1.00 0.00 ? 6   SER A N    16 
ATOM   9259  C  CA   . SER A 1 6  ? -8.021  -22.444 -1.944  1.00 0.00 ? 6   SER A CA   16 
ATOM   9260  C  C    . SER A 1 6  ? -7.169  -21.183 -2.054  1.00 0.00 ? 6   SER A C    16 
ATOM   9261  O  O    . SER A 1 6  ? -5.992  -21.244 -2.409  1.00 0.00 ? 6   SER A O    16 
ATOM   9262  C  CB   . SER A 1 6  ? -7.277  -23.507 -1.132  1.00 0.00 ? 6   SER A CB   16 
ATOM   9263  O  OG   . SER A 1 6  ? -6.116  -23.949 -1.814  1.00 0.00 ? 6   SER A OG   16 
ATOM   9264  H  H    . SER A 1 6  ? -8.147  -23.893 -3.483  1.00 0.00 ? 6   SER A H    16 
ATOM   9265  H  HA   . SER A 1 6  ? -8.943  -22.199 -1.440  1.00 0.00 ? 6   SER A HA   16 
ATOM   9266  H  HB2  . SER A 1 6  ? -6.985  -23.090 -0.181  1.00 0.00 ? 6   SER A HB2  16 
ATOM   9267  H  HB3  . SER A 1 6  ? -7.929  -24.353 -0.970  1.00 0.00 ? 6   SER A HB3  16 
ATOM   9268  H  HG   . SER A 1 6  ? -5.679  -23.198 -2.222  1.00 0.00 ? 6   SER A HG   16 
ATOM   9269  N  N    . GLY A 1 7  ? -7.773  -20.040 -1.746  1.00 0.00 ? 7   GLY A N    16 
ATOM   9270  C  CA   . GLY A 1 7  ? -7.056  -18.780 -1.817  1.00 0.00 ? 7   GLY A CA   16 
ATOM   9271  C  C    . GLY A 1 7  ? -5.762  -18.804 -1.028  1.00 0.00 ? 7   GLY A C    16 
ATOM   9272  O  O    . GLY A 1 7  ? -5.760  -19.101 0.168   1.00 0.00 ? 7   GLY A O    16 
ATOM   9273  H  H    . GLY A 1 7  ? -8.713  -20.052 -1.470  1.00 0.00 ? 7   GLY A H    16 
ATOM   9274  H  HA2  . GLY A 1 7  ? -6.832  -18.563 -2.850  1.00 0.00 ? 7   GLY A HA2  16 
ATOM   9275  H  HA3  . GLY A 1 7  ? -7.689  -17.997 -1.425  1.00 0.00 ? 7   GLY A HA3  16 
ATOM   9276  N  N    . THR A 1 8  ? -4.657  -18.492 -1.697  1.00 0.00 ? 8   THR A N    16 
ATOM   9277  C  CA   . THR A 1 8  ? -3.350  -18.482 -1.052  1.00 0.00 ? 8   THR A CA   16 
ATOM   9278  C  C    . THR A 1 8  ? -3.017  -17.098 -0.506  1.00 0.00 ? 8   THR A C    16 
ATOM   9279  O  O    . THR A 1 8  ? -1.889  -16.624 -0.634  1.00 0.00 ? 8   THR A O    16 
ATOM   9280  C  CB   . THR A 1 8  ? -2.239  -18.918 -2.026  1.00 0.00 ? 8   THR A CB   16 
ATOM   9281  O  OG1  . THR A 1 8  ? -2.355  -18.195 -3.256  1.00 0.00 ? 8   THR A OG1  16 
ATOM   9282  C  CG2  . THR A 1 8  ? -2.316  -20.412 -2.300  1.00 0.00 ? 8   THR A CG2  16 
ATOM   9283  H  H    . THR A 1 8  ? -4.723  -18.264 -2.648  1.00 0.00 ? 8   THR A H    16 
ATOM   9284  H  HA   . THR A 1 8  ? -3.378  -19.185 -0.232  1.00 0.00 ? 8   THR A HA   16 
ATOM   9285  H  HB   . THR A 1 8  ? -1.281  -18.698 -1.577  1.00 0.00 ? 8   THR A HB   16 
ATOM   9286  H  HG1  . THR A 1 8  ? -2.902  -18.692 -3.869  1.00 0.00 ? 8   THR A HG1  16 
ATOM   9287  H  HG21 . THR A 1 8  ? -1.412  -20.734 -2.793  1.00 0.00 ? 8   THR A HG21 16 
ATOM   9288  H  HG22 . THR A 1 8  ? -3.165  -20.619 -2.935  1.00 0.00 ? 8   THR A HG22 16 
ATOM   9289  H  HG23 . THR A 1 8  ? -2.427  -20.944 -1.367  1.00 0.00 ? 8   THR A HG23 16 
ATOM   9290  N  N    . GLY A 1 9  ? -4.007  -16.454 0.106   1.00 0.00 ? 9   GLY A N    16 
ATOM   9291  C  CA   . GLY A 1 9  ? -3.798  -15.131 0.663   1.00 0.00 ? 9   GLY A CA   16 
ATOM   9292  C  C    . GLY A 1 9  ? -4.057  -14.029 -0.346  1.00 0.00 ? 9   GLY A C    16 
ATOM   9293  O  O    . GLY A 1 9  ? -3.305  -13.869 -1.306  1.00 0.00 ? 9   GLY A O    16 
ATOM   9294  H  H    . GLY A 1 9  ? -4.886  -16.881 0.179   1.00 0.00 ? 9   GLY A H    16 
ATOM   9295  H  HA2  . GLY A 1 9  ? -4.462  -14.997 1.504   1.00 0.00 ? 9   GLY A HA2  16 
ATOM   9296  H  HA3  . GLY A 1 9  ? -2.777  -15.054 1.007   1.00 0.00 ? 9   GLY A HA3  16 
ATOM   9297  N  N    . MET A 1 10 ? -5.126  -13.270 -0.129  1.00 0.00 ? 10  MET A N    16 
ATOM   9298  C  CA   . MET A 1 10 ? -5.482  -12.178 -1.028  1.00 0.00 ? 10  MET A CA   16 
ATOM   9299  C  C    . MET A 1 10 ? -4.962  -10.846 -0.498  1.00 0.00 ? 10  MET A C    16 
ATOM   9300  O  O    . MET A 1 10 ? -5.089  -10.545 0.689   1.00 0.00 ? 10  MET A O    16 
ATOM   9301  C  CB   . MET A 1 10 ? -7.000  -12.111 -1.207  1.00 0.00 ? 10  MET A CB   16 
ATOM   9302  C  CG   . MET A 1 10 ? -7.453  -11.006 -2.147  1.00 0.00 ? 10  MET A CG   16 
ATOM   9303  S  SD   . MET A 1 10 ? -6.538  -10.997 -3.701  1.00 0.00 ? 10  MET A SD   16 
ATOM   9304  C  CE   . MET A 1 10 ? -7.448  -9.760  -4.622  1.00 0.00 ? 10  MET A CE   16 
ATOM   9305  H  H    . MET A 1 10 ? -5.688  -13.446 0.654   1.00 0.00 ? 10  MET A H    16 
ATOM   9306  H  HA   . MET A 1 10 ? -5.024  -12.375 -1.986  1.00 0.00 ? 10  MET A HA   16 
ATOM   9307  H  HB2  . MET A 1 10 ? -7.346  -13.054 -1.602  1.00 0.00 ? 10  MET A HB2  16 
ATOM   9308  H  HB3  . MET A 1 10 ? -7.458  -11.944 -0.243  1.00 0.00 ? 10  MET A HB3  16 
ATOM   9309  H  HG2  . MET A 1 10 ? -8.502  -11.143 -2.365  1.00 0.00 ? 10  MET A HG2  16 
ATOM   9310  H  HG3  . MET A 1 10 ? -7.311  -10.054 -1.656  1.00 0.00 ? 10  MET A HG3  16 
ATOM   9311  H  HE1  . MET A 1 10 ? -8.136  -9.253  -3.961  1.00 0.00 ? 10  MET A HE1  16 
ATOM   9312  H  HE2  . MET A 1 10 ? -6.758  -9.043  -5.042  1.00 0.00 ? 10  MET A HE2  16 
ATOM   9313  H  HE3  . MET A 1 10 ? -7.999  -10.238 -5.419  1.00 0.00 ? 10  MET A HE3  16 
ATOM   9314  N  N    . LYS A 1 11 ? -4.374  -10.050 -1.386  1.00 0.00 ? 11  LYS A N    16 
ATOM   9315  C  CA   . LYS A 1 11 ? -3.835  -8.749  -1.008  1.00 0.00 ? 11  LYS A CA   16 
ATOM   9316  C  C    . LYS A 1 11 ? -4.534  -7.628  -1.771  1.00 0.00 ? 11  LYS A C    16 
ATOM   9317  O  O    . LYS A 1 11 ? -4.043  -7.135  -2.786  1.00 0.00 ? 11  LYS A O    16 
ATOM   9318  C  CB   . LYS A 1 11 ? -2.329  -8.701  -1.278  1.00 0.00 ? 11  LYS A CB   16 
ATOM   9319  C  CG   . LYS A 1 11 ? -1.493  -9.314  -0.168  1.00 0.00 ? 11  LYS A CG   16 
ATOM   9320  C  CD   . LYS A 1 11 ? -0.033  -9.438  -0.573  1.00 0.00 ? 11  LYS A CD   16 
ATOM   9321  C  CE   . LYS A 1 11 ? 0.245   -10.771 -1.251  1.00 0.00 ? 11  LYS A CE   16 
ATOM   9322  N  NZ   . LYS A 1 11 ? 1.531   -10.753 -2.002  1.00 0.00 ? 11  LYS A NZ   16 
ATOM   9323  H  H    . LYS A 1 11 ? -4.302  -10.345 -2.318  1.00 0.00 ? 11  LYS A H    16 
ATOM   9324  H  HA   . LYS A 1 11 ? -4.007  -8.612  0.048   1.00 0.00 ? 11  LYS A HA   16 
ATOM   9325  H  HB2  . LYS A 1 11 ? -2.122  -9.235  -2.194  1.00 0.00 ? 11  LYS A HB2  16 
ATOM   9326  H  HB3  . LYS A 1 11 ? -2.030  -7.669  -1.397  1.00 0.00 ? 11  LYS A HB3  16 
ATOM   9327  H  HG2  . LYS A 1 11 ? -1.559  -8.688  0.709   1.00 0.00 ? 11  LYS A HG2  16 
ATOM   9328  H  HG3  . LYS A 1 11 ? -1.879  -10.298 0.059   1.00 0.00 ? 11  LYS A HG3  16 
ATOM   9329  H  HD2  . LYS A 1 11 ? 0.210   -8.641  -1.260  1.00 0.00 ? 11  LYS A HD2  16 
ATOM   9330  H  HD3  . LYS A 1 11 ? 0.585   -9.357  0.310   1.00 0.00 ? 11  LYS A HD3  16 
ATOM   9331  H  HE2  . LYS A 1 11 ? 0.290   -11.541 -0.497  1.00 0.00 ? 11  LYS A HE2  16 
ATOM   9332  H  HE3  . LYS A 1 11 ? -0.560  -10.986 -1.938  1.00 0.00 ? 11  LYS A HE3  16 
ATOM   9333  H  HZ1  . LYS A 1 11 ? 1.592   -11.582 -2.627  1.00 0.00 ? 11  LYS A HZ1  16 
ATOM   9334  H  HZ2  . LYS A 1 11 ? 2.332   -10.773 -1.339  1.00 0.00 ? 11  LYS A HZ2  16 
ATOM   9335  H  HZ3  . LYS A 1 11 ? 1.596   -9.891  -2.580  1.00 0.00 ? 11  LYS A HZ3  16 
ATOM   9336  N  N    . PRO A 1 12 ? -5.708  -7.214  -1.271  1.00 0.00 ? 12  PRO A N    16 
ATOM   9337  C  CA   . PRO A 1 12 ? -6.499  -6.146  -1.888  1.00 0.00 ? 12  PRO A CA   16 
ATOM   9338  C  C    . PRO A 1 12 ? -5.841  -4.778  -1.739  1.00 0.00 ? 12  PRO A C    16 
ATOM   9339  O  O    . PRO A 1 12 ? -5.617  -4.075  -2.725  1.00 0.00 ? 12  PRO A O    16 
ATOM   9340  C  CB   . PRO A 1 12 ? -7.820  -6.191  -1.116  1.00 0.00 ? 12  PRO A CB   16 
ATOM   9341  C  CG   . PRO A 1 12 ? -7.467  -6.784  0.204   1.00 0.00 ? 12  PRO A CG   16 
ATOM   9342  C  CD   . PRO A 1 12 ? -6.353  -7.757  -0.063  1.00 0.00 ? 12  PRO A CD   16 
ATOM   9343  H  HA   . PRO A 1 12 ? -6.684  -6.343  -2.934  1.00 0.00 ? 12  PRO A HA   16 
ATOM   9344  H  HB2  . PRO A 1 12 ? -8.211  -5.189  -1.009  1.00 0.00 ? 12  PRO A HB2  16 
ATOM   9345  H  HB3  . PRO A 1 12 ? -8.531  -6.806  -1.648  1.00 0.00 ? 12  PRO A HB3  16 
ATOM   9346  H  HG2  . PRO A 1 12 ? -7.134  -6.008  0.878   1.00 0.00 ? 12  PRO A HG2  16 
ATOM   9347  H  HG3  . PRO A 1 12 ? -8.323  -7.298  0.616   1.00 0.00 ? 12  PRO A HG3  16 
ATOM   9348  H  HD2  . PRO A 1 12 ? -5.663  -7.778  0.767   1.00 0.00 ? 12  PRO A HD2  16 
ATOM   9349  H  HD3  . PRO A 1 12 ? -6.751  -8.744  -0.250  1.00 0.00 ? 12  PRO A HD3  16 
ATOM   9350  N  N    . TYR A 1 13 ? -5.534  -4.406  -0.501  1.00 0.00 ? 13  TYR A N    16 
ATOM   9351  C  CA   . TYR A 1 13 ? -4.904  -3.121  -0.223  1.00 0.00 ? 13  TYR A CA   16 
ATOM   9352  C  C    . TYR A 1 13 ? -3.611  -3.307  0.564   1.00 0.00 ? 13  TYR A C    16 
ATOM   9353  O  O    . TYR A 1 13 ? -3.133  -2.385  1.224   1.00 0.00 ? 13  TYR A O    16 
ATOM   9354  C  CB   . TYR A 1 13 ? -5.862  -2.217  0.554   1.00 0.00 ? 13  TYR A CB   16 
ATOM   9355  C  CG   . TYR A 1 13 ? -7.319  -2.580  0.373   1.00 0.00 ? 13  TYR A CG   16 
ATOM   9356  C  CD1  . TYR A 1 13 ? -7.877  -3.654  1.053   1.00 0.00 ? 13  TYR A CD1  16 
ATOM   9357  C  CD2  . TYR A 1 13 ? -8.136  -1.846  -0.479  1.00 0.00 ? 13  TYR A CD2  16 
ATOM   9358  C  CE1  . TYR A 1 13 ? -9.207  -3.990  0.889   1.00 0.00 ? 13  TYR A CE1  16 
ATOM   9359  C  CE2  . TYR A 1 13 ? -9.468  -2.174  -0.647  1.00 0.00 ? 13  TYR A CE2  16 
ATOM   9360  C  CZ   . TYR A 1 13 ? -9.999  -3.246  0.038   1.00 0.00 ? 13  TYR A CZ   16 
ATOM   9361  O  OH   . TYR A 1 13 ? -11.324 -3.576  -0.126  1.00 0.00 ? 13  TYR A OH   16 
ATOM   9362  H  H    . TYR A 1 13 ? -5.738  -5.009  0.244   1.00 0.00 ? 13  TYR A H    16 
ATOM   9363  H  HA   . TYR A 1 13 ? -4.672  -2.654  -1.169  1.00 0.00 ? 13  TYR A HA   16 
ATOM   9364  H  HB2  . TYR A 1 13 ? -5.633  -2.283  1.607   1.00 0.00 ? 13  TYR A HB2  16 
ATOM   9365  H  HB3  . TYR A 1 13 ? -5.730  -1.197  0.225   1.00 0.00 ? 13  TYR A HB3  16 
ATOM   9366  H  HD1  . TYR A 1 13 ? -7.255  -4.234  1.719   1.00 0.00 ? 13  TYR A HD1  16 
ATOM   9367  H  HD2  . TYR A 1 13 ? -7.718  -1.007  -1.014  1.00 0.00 ? 13  TYR A HD2  16 
ATOM   9368  H  HE1  . TYR A 1 13 ? -9.623  -4.829  1.426   1.00 0.00 ? 13  TYR A HE1  16 
ATOM   9369  H  HE2  . TYR A 1 13 ? -10.088 -1.592  -1.314  1.00 0.00 ? 13  TYR A HE2  16 
ATOM   9370  H  HH   . TYR A 1 13 ? -11.390 -4.406  -0.604  1.00 0.00 ? 13  TYR A HH   16 
ATOM   9371  N  N    . VAL A 1 14 ? -3.048  -4.509  0.489   1.00 0.00 ? 14  VAL A N    16 
ATOM   9372  C  CA   . VAL A 1 14 ? -1.809  -4.819  1.192   1.00 0.00 ? 14  VAL A CA   16 
ATOM   9373  C  C    . VAL A 1 14 ? -0.608  -4.197  0.489   1.00 0.00 ? 14  VAL A C    16 
ATOM   9374  O  O    . VAL A 1 14 ? -0.554  -4.141  -0.740  1.00 0.00 ? 14  VAL A O    16 
ATOM   9375  C  CB   . VAL A 1 14 ? -1.592  -6.339  1.306   1.00 0.00 ? 14  VAL A CB   16 
ATOM   9376  C  CG1  . VAL A 1 14 ? -0.222  -6.642  1.894   1.00 0.00 ? 14  VAL A CG1  16 
ATOM   9377  C  CG2  . VAL A 1 14 ? -2.693  -6.972  2.144   1.00 0.00 ? 14  VAL A CG2  16 
ATOM   9378  H  H    . VAL A 1 14 ? -3.476  -5.204  -0.054  1.00 0.00 ? 14  VAL A H    16 
ATOM   9379  H  HA   . VAL A 1 14 ? -1.880  -4.411  2.190   1.00 0.00 ? 14  VAL A HA   16 
ATOM   9380  H  HB   . VAL A 1 14 ? -1.635  -6.764  0.314   1.00 0.00 ? 14  VAL A HB   16 
ATOM   9381  H  HG11 . VAL A 1 14 ? -0.323  -7.371  2.684   1.00 0.00 ? 14  VAL A HG11 16 
ATOM   9382  H  HG12 . VAL A 1 14 ? 0.423   -7.033  1.121   1.00 0.00 ? 14  VAL A HG12 16 
ATOM   9383  H  HG13 . VAL A 1 14 ? 0.205   -5.734  2.295   1.00 0.00 ? 14  VAL A HG13 16 
ATOM   9384  H  HG21 . VAL A 1 14 ? -2.289  -7.279  3.097   1.00 0.00 ? 14  VAL A HG21 16 
ATOM   9385  H  HG22 . VAL A 1 14 ? -3.483  -6.254  2.302   1.00 0.00 ? 14  VAL A HG22 16 
ATOM   9386  H  HG23 . VAL A 1 14 ? -3.089  -7.835  1.628   1.00 0.00 ? 14  VAL A HG23 16 
ATOM   9387  N  N    . CYS A 1 15 ? 0.356   -3.730  1.276   1.00 0.00 ? 15  CYS A N    16 
ATOM   9388  C  CA   . CYS A 1 15 ? 1.558   -3.112  0.730   1.00 0.00 ? 15  CYS A CA   16 
ATOM   9389  C  C    . CYS A 1 15 ? 2.499   -4.166  0.156   1.00 0.00 ? 15  CYS A C    16 
ATOM   9390  O  O    . CYS A 1 15 ? 3.150   -4.901  0.897   1.00 0.00 ? 15  CYS A O    16 
ATOM   9391  C  CB   . CYS A 1 15 ? 2.278   -2.304  1.813   1.00 0.00 ? 15  CYS A CB   16 
ATOM   9392  S  SG   . CYS A 1 15 ? 3.273   -0.921  1.170   1.00 0.00 ? 15  CYS A SG   16 
ATOM   9393  H  H    . CYS A 1 15 ? 0.256   -3.803  2.249   1.00 0.00 ? 15  CYS A H    16 
ATOM   9394  H  HA   . CYS A 1 15 ? 1.257   -2.445  -0.063  1.00 0.00 ? 15  CYS A HA   16 
ATOM   9395  H  HB2  . CYS A 1 15 ? 1.545   -1.893  2.492   1.00 0.00 ? 15  CYS A HB2  16 
ATOM   9396  H  HB3  . CYS A 1 15 ? 2.940   -2.960  2.359   1.00 0.00 ? 15  CYS A HB3  16 
ATOM   9397  N  N    . ASN A 1 16 ? 2.566   -4.233  -1.170  1.00 0.00 ? 16  ASN A N    16 
ATOM   9398  C  CA   . ASN A 1 16 ? 3.427   -5.198  -1.844  1.00 0.00 ? 16  ASN A CA   16 
ATOM   9399  C  C    . ASN A 1 16 ? 4.899   -4.887  -1.585  1.00 0.00 ? 16  ASN A C    16 
ATOM   9400  O  O    . ASN A 1 16 ? 5.783   -5.634  -2.003  1.00 0.00 ? 16  ASN A O    16 
ATOM   9401  C  CB   . ASN A 1 16 ? 3.151   -5.195  -3.349  1.00 0.00 ? 16  ASN A CB   16 
ATOM   9402  C  CG   . ASN A 1 16 ? 1.670   -5.108  -3.665  1.00 0.00 ? 16  ASN A CG   16 
ATOM   9403  O  OD1  . ASN A 1 16 ? 1.057   -4.049  -3.531  1.00 0.00 ? 16  ASN A OD1  16 
ATOM   9404  N  ND2  . ASN A 1 16 ? 1.089   -6.225  -4.086  1.00 0.00 ? 16  ASN A ND2  16 
ATOM   9405  H  H    . ASN A 1 16 ? 2.023   -3.620  -1.707  1.00 0.00 ? 16  ASN A H    16 
ATOM   9406  H  HA   . ASN A 1 16 ? 3.203   -6.176  -1.448  1.00 0.00 ? 16  ASN A HA   16 
ATOM   9407  H  HB2  . ASN A 1 16 ? 3.645   -4.345  -3.798  1.00 0.00 ? 16  ASN A HB2  16 
ATOM   9408  H  HB3  . ASN A 1 16 ? 3.541   -6.103  -3.782  1.00 0.00 ? 16  ASN A HB3  16 
ATOM   9409  H  HD21 . ASN A 1 16 ? 1.640   -7.032  -4.169  1.00 0.00 ? 16  ASN A HD21 16 
ATOM   9410  H  HD22 . ASN A 1 16 ? 0.133   -6.197  -4.298  1.00 0.00 ? 16  ASN A HD22 16 
ATOM   9411  N  N    . GLU A 1 17 ? 5.151   -3.780  -0.893  1.00 0.00 ? 17  GLU A N    16 
ATOM   9412  C  CA   . GLU A 1 17 ? 6.515   -3.372  -0.579  1.00 0.00 ? 17  GLU A CA   16 
ATOM   9413  C  C    . GLU A 1 17 ? 6.973   -3.976  0.745   1.00 0.00 ? 17  GLU A C    16 
ATOM   9414  O  O    . GLU A 1 17 ? 8.057   -4.553  0.836   1.00 0.00 ? 17  GLU A O    16 
ATOM   9415  C  CB   . GLU A 1 17 ? 6.613   -1.846  -0.517  1.00 0.00 ? 17  GLU A CB   16 
ATOM   9416  C  CG   . GLU A 1 17 ? 6.190   -1.156  -1.803  1.00 0.00 ? 17  GLU A CG   16 
ATOM   9417  C  CD   . GLU A 1 17 ? 7.297   -1.127  -2.840  1.00 0.00 ? 17  GLU A CD   16 
ATOM   9418  O  OE1  . GLU A 1 17 ? 7.888   -2.193  -3.107  1.00 0.00 ? 17  GLU A OE1  16 
ATOM   9419  O  OE2  . GLU A 1 17 ? 7.570   -0.036  -3.384  1.00 0.00 ? 17  GLU A OE2  16 
ATOM   9420  H  H    . GLU A 1 17 ? 4.403   -3.226  -0.587  1.00 0.00 ? 17  GLU A H    16 
ATOM   9421  H  HA   . GLU A 1 17 ? 7.159   -3.732  -1.367  1.00 0.00 ? 17  GLU A HA   16 
ATOM   9422  H  HB2  . GLU A 1 17 ? 5.981   -1.489  0.283   1.00 0.00 ? 17  GLU A HB2  16 
ATOM   9423  H  HB3  . GLU A 1 17 ? 7.635   -1.571  -0.305  1.00 0.00 ? 17  GLU A HB3  16 
ATOM   9424  H  HG2  . GLU A 1 17 ? 5.344   -1.682  -2.218  1.00 0.00 ? 17  GLU A HG2  16 
ATOM   9425  H  HG3  . GLU A 1 17 ? 5.904   -0.140  -1.575  1.00 0.00 ? 17  GLU A HG3  16 
ATOM   9426  N  N    . CYS A 1 18 ? 6.140   -3.838  1.771   1.00 0.00 ? 18  CYS A N    16 
ATOM   9427  C  CA   . CYS A 1 18 ? 6.457   -4.369  3.091   1.00 0.00 ? 18  CYS A CA   16 
ATOM   9428  C  C    . CYS A 1 18 ? 5.464   -5.454  3.495   1.00 0.00 ? 18  CYS A C    16 
ATOM   9429  O  O    . CYS A 1 18 ? 5.818   -6.410  4.183   1.00 0.00 ? 18  CYS A O    16 
ATOM   9430  C  CB   . CYS A 1 18 ? 6.452   -3.245  4.130   1.00 0.00 ? 18  CYS A CB   16 
ATOM   9431  S  SG   . CYS A 1 18 ? 4.902   -2.288  4.182   1.00 0.00 ? 18  CYS A SG   16 
ATOM   9432  H  H    . CYS A 1 18 ? 5.289   -3.368  1.637   1.00 0.00 ? 18  CYS A H    16 
ATOM   9433  H  HA   . CYS A 1 18 ? 7.445   -4.801  3.047   1.00 0.00 ? 18  CYS A HA   16 
ATOM   9434  H  HB2  . CYS A 1 18 ? 6.607   -3.671  5.110   1.00 0.00 ? 18  CYS A HB2  16 
ATOM   9435  H  HB3  . CYS A 1 18 ? 7.256   -2.558  3.910   1.00 0.00 ? 18  CYS A HB3  16 
ATOM   9436  N  N    . GLY A 1 19 ? 4.217   -5.299  3.060   1.00 0.00 ? 19  GLY A N    16 
ATOM   9437  C  CA   . GLY A 1 19 ? 3.191   -6.272  3.385   1.00 0.00 ? 19  GLY A CA   16 
ATOM   9438  C  C    . GLY A 1 19 ? 2.122   -5.705  4.298   1.00 0.00 ? 19  GLY A C    16 
ATOM   9439  O  O    . GLY A 1 19 ? 1.244   -6.431  4.765   1.00 0.00 ? 19  GLY A O    16 
ATOM   9440  H  H    . GLY A 1 19 ? 3.991   -4.516  2.514   1.00 0.00 ? 19  GLY A H    16 
ATOM   9441  H  HA2  . GLY A 1 19 ? 2.727   -6.609  2.471   1.00 0.00 ? 19  GLY A HA2  16 
ATOM   9442  H  HA3  . GLY A 1 19 ? 3.654   -7.117  3.874   1.00 0.00 ? 19  GLY A HA3  16 
ATOM   9443  N  N    . LYS A 1 20 ? 2.195   -4.404  4.556   1.00 0.00 ? 20  LYS A N    16 
ATOM   9444  C  CA   . LYS A 1 20 ? 1.227   -3.738  5.419   1.00 0.00 ? 20  LYS A CA   16 
ATOM   9445  C  C    . LYS A 1 20 ? -0.185  -3.875  4.860   1.00 0.00 ? 20  LYS A C    16 
ATOM   9446  O  O    . LYS A 1 20 ? -0.503  -3.321  3.808   1.00 0.00 ? 20  LYS A O    16 
ATOM   9447  C  CB   . LYS A 1 20 ? 1.585   -2.258  5.575   1.00 0.00 ? 20  LYS A CB   16 
ATOM   9448  C  CG   . LYS A 1 20 ? 1.192   -1.676  6.922   1.00 0.00 ? 20  LYS A CG   16 
ATOM   9449  C  CD   . LYS A 1 20 ? -0.303  -1.794  7.166   1.00 0.00 ? 20  LYS A CD   16 
ATOM   9450  C  CE   . LYS A 1 20 ? -0.756  -0.888  8.301   1.00 0.00 ? 20  LYS A CE   16 
ATOM   9451  N  NZ   . LYS A 1 20 ? -2.204  -0.557  8.203   1.00 0.00 ? 20  LYS A NZ   16 
ATOM   9452  H  H    . LYS A 1 20 ? 2.919   -3.878  4.154   1.00 0.00 ? 20  LYS A H    16 
ATOM   9453  H  HA   . LYS A 1 20 ? 1.265   -4.213  6.388   1.00 0.00 ? 20  LYS A HA   16 
ATOM   9454  H  HB2  . LYS A 1 20 ? 2.651   -2.143  5.454   1.00 0.00 ? 20  LYS A HB2  16 
ATOM   9455  H  HB3  . LYS A 1 20 ? 1.080   -1.696  4.803   1.00 0.00 ? 20  LYS A HB3  16 
ATOM   9456  H  HG2  . LYS A 1 20 ? 1.716   -2.210  7.701   1.00 0.00 ? 20  LYS A HG2  16 
ATOM   9457  H  HG3  . LYS A 1 20 ? 1.471   -0.632  6.948   1.00 0.00 ? 20  LYS A HG3  16 
ATOM   9458  H  HD2  . LYS A 1 20 ? -0.829  -1.514  6.266   1.00 0.00 ? 20  LYS A HD2  16 
ATOM   9459  H  HD3  . LYS A 1 20 ? -0.538  -2.818  7.419   1.00 0.00 ? 20  LYS A HD3  16 
ATOM   9460  H  HE2  . LYS A 1 20 ? -0.573  -1.389  9.239   1.00 0.00 ? 20  LYS A HE2  16 
ATOM   9461  H  HE3  . LYS A 1 20 ? -0.183  0.027   8.264   1.00 0.00 ? 20  LYS A HE3  16 
ATOM   9462  H  HZ1  . LYS A 1 20 ? -2.751  -1.143  8.866   1.00 0.00 ? 20  LYS A HZ1  16 
ATOM   9463  H  HZ2  . LYS A 1 20 ? -2.546  -0.735  7.236   1.00 0.00 ? 20  LYS A HZ2  16 
ATOM   9464  H  HZ3  . LYS A 1 20 ? -2.359  0.445   8.433   1.00 0.00 ? 20  LYS A HZ3  16 
ATOM   9465  N  N    . ALA A 1 21 ? -1.029  -4.616  5.571   1.00 0.00 ? 21  ALA A N    16 
ATOM   9466  C  CA   . ALA A 1 21 ? -2.408  -4.822  5.147   1.00 0.00 ? 21  ALA A CA   16 
ATOM   9467  C  C    . ALA A 1 21 ? -3.325  -3.746  5.719   1.00 0.00 ? 21  ALA A C    16 
ATOM   9468  O  O    . ALA A 1 21 ? -3.247  -3.415  6.902   1.00 0.00 ? 21  ALA A O    16 
ATOM   9469  C  CB   . ALA A 1 21 ? -2.888  -6.204  5.565   1.00 0.00 ? 21  ALA A CB   16 
ATOM   9470  H  H    . ALA A 1 21 ? -0.717  -5.032  6.401   1.00 0.00 ? 21  ALA A H    16 
ATOM   9471  H  HA   . ALA A 1 21 ? -2.437  -4.768  4.068   1.00 0.00 ? 21  ALA A HA   16 
ATOM   9472  H  HB1  . ALA A 1 21 ? -2.052  -6.779  5.932   1.00 0.00 ? 21  ALA A HB1  16 
ATOM   9473  H  HB2  . ALA A 1 21 ? -3.629  -6.106  6.345   1.00 0.00 ? 21  ALA A HB2  16 
ATOM   9474  H  HB3  . ALA A 1 21 ? -3.325  -6.706  4.714   1.00 0.00 ? 21  ALA A HB3  16 
ATOM   9475  N  N    . PHE A 1 22 ? -4.193  -3.203  4.872   1.00 0.00 ? 22  PHE A N    16 
ATOM   9476  C  CA   . PHE A 1 22 ? -5.125  -2.163  5.294   1.00 0.00 ? 22  PHE A CA   16 
ATOM   9477  C  C    . PHE A 1 22 ? -6.567  -2.585  5.032   1.00 0.00 ? 22  PHE A C    16 
ATOM   9478  O  O    . PHE A 1 22 ? -6.821  -3.661  4.489   1.00 0.00 ? 22  PHE A O    16 
ATOM   9479  C  CB   . PHE A 1 22 ? -4.824  -0.853  4.562   1.00 0.00 ? 22  PHE A CB   16 
ATOM   9480  C  CG   . PHE A 1 22 ? -3.391  -0.417  4.677   1.00 0.00 ? 22  PHE A CG   16 
ATOM   9481  C  CD1  . PHE A 1 22 ? -2.400  -1.052  3.947   1.00 0.00 ? 22  PHE A CD1  16 
ATOM   9482  C  CD2  . PHE A 1 22 ? -3.037  0.627   5.516   1.00 0.00 ? 22  PHE A CD2  16 
ATOM   9483  C  CE1  . PHE A 1 22 ? -1.080  -0.653  4.050   1.00 0.00 ? 22  PHE A CE1  16 
ATOM   9484  C  CE2  . PHE A 1 22 ? -1.719  1.031   5.623   1.00 0.00 ? 22  PHE A CE2  16 
ATOM   9485  C  CZ   . PHE A 1 22 ? -0.740  0.389   4.890   1.00 0.00 ? 22  PHE A CZ   16 
ATOM   9486  H  H    . PHE A 1 22 ? -4.208  -3.509  3.941   1.00 0.00 ? 22  PHE A H    16 
ATOM   9487  H  HA   . PHE A 1 22 ? -4.993  -2.011  6.354   1.00 0.00 ? 22  PHE A HA   16 
ATOM   9488  H  HB2  . PHE A 1 22 ? -5.050  -0.974  3.514   1.00 0.00 ? 22  PHE A HB2  16 
ATOM   9489  H  HB3  . PHE A 1 22 ? -5.445  -0.070  4.972   1.00 0.00 ? 22  PHE A HB3  16 
ATOM   9490  H  HD1  . PHE A 1 22 ? -2.665  -1.868  3.289   1.00 0.00 ? 22  PHE A HD1  16 
ATOM   9491  H  HD2  . PHE A 1 22 ? -3.801  1.129   6.090   1.00 0.00 ? 22  PHE A HD2  16 
ATOM   9492  H  HE1  . PHE A 1 22 ? -0.317  -1.157  3.476   1.00 0.00 ? 22  PHE A HE1  16 
ATOM   9493  H  HE2  . PHE A 1 22 ? -1.455  1.846   6.281   1.00 0.00 ? 22  PHE A HE2  16 
ATOM   9494  H  HZ   . PHE A 1 22 ? 0.290   0.703   4.972   1.00 0.00 ? 22  PHE A HZ   16 
ATOM   9495  N  N    . ARG A 1 23 ? -7.508  -1.732  5.422   1.00 0.00 ? 23  ARG A N    16 
ATOM   9496  C  CA   . ARG A 1 23 ? -8.925  -2.016  5.232   1.00 0.00 ? 23  ARG A CA   16 
ATOM   9497  C  C    . ARG A 1 23 ? -9.417  -1.459  3.899   1.00 0.00 ? 23  ARG A C    16 
ATOM   9498  O  O    . ARG A 1 23 ? -10.365 -1.978  3.311   1.00 0.00 ? 23  ARG A O    16 
ATOM   9499  C  CB   . ARG A 1 23 ? -9.745  -1.423  6.379   1.00 0.00 ? 23  ARG A CB   16 
ATOM   9500  C  CG   . ARG A 1 23 ? -10.027 0.062   6.221   1.00 0.00 ? 23  ARG A CG   16 
ATOM   9501  C  CD   . ARG A 1 23 ? -11.312 0.305   5.445   1.00 0.00 ? 23  ARG A CD   16 
ATOM   9502  N  NE   . ARG A 1 23 ? -12.485 0.309   6.315   1.00 0.00 ? 23  ARG A NE   16 
ATOM   9503  C  CZ   . ARG A 1 23 ? -13.731 0.192   5.869   1.00 0.00 ? 23  ARG A CZ   16 
ATOM   9504  N  NH1  . ARG A 1 23 ? -13.964 0.064   4.570   1.00 0.00 ? 23  ARG A NH1  16 
ATOM   9505  N  NH2  . ARG A 1 23 ? -14.746 0.204   6.723   1.00 0.00 ? 23  ARG A NH2  16 
ATOM   9506  H  H    . ARG A 1 23 ? -7.243  -0.890  5.849   1.00 0.00 ? 23  ARG A H    16 
ATOM   9507  H  HA   . ARG A 1 23 ? -9.050  -3.089  5.228   1.00 0.00 ? 23  ARG A HA   16 
ATOM   9508  H  HB2  . ARG A 1 23 ? -10.690 -1.943  6.437   1.00 0.00 ? 23  ARG A HB2  16 
ATOM   9509  H  HB3  . ARG A 1 23 ? -9.206  -1.569  7.303   1.00 0.00 ? 23  ARG A HB3  16 
ATOM   9510  H  HG2  . ARG A 1 23 ? -10.122 0.507   7.201   1.00 0.00 ? 23  ARG A HG2  16 
ATOM   9511  H  HG3  . ARG A 1 23 ? -9.205  0.521   5.693   1.00 0.00 ? 23  ARG A HG3  16 
ATOM   9512  H  HD2  . ARG A 1 23 ? -11.241 1.262   4.948   1.00 0.00 ? 23  ARG A HD2  16 
ATOM   9513  H  HD3  . ARG A 1 23 ? -11.424 -0.475  4.707   1.00 0.00 ? 23  ARG A HD3  16 
ATOM   9514  H  HE   . ARG A 1 23 ? -12.335 0.403   7.278   1.00 0.00 ? 23  ARG A HE   16 
ATOM   9515  H  HH11 . ARG A 1 23 ? -13.201 0.053   3.925   1.00 0.00 ? 23  ARG A HH11 16 
ATOM   9516  H  HH12 . ARG A 1 23 ? -14.903 -0.025  4.237   1.00 0.00 ? 23  ARG A HH12 16 
ATOM   9517  H  HH21 . ARG A 1 23 ? -14.574 0.301   7.703   1.00 0.00 ? 23  ARG A HH21 16 
ATOM   9518  H  HH22 . ARG A 1 23 ? -15.683 0.117   6.387   1.00 0.00 ? 23  ARG A HH22 16 
ATOM   9519  N  N    . SER A 1 24 ? -8.766  -0.399  3.430   1.00 0.00 ? 24  SER A N    16 
ATOM   9520  C  CA   . SER A 1 24 ? -9.140  0.231   2.170   1.00 0.00 ? 24  SER A CA   16 
ATOM   9521  C  C    . SER A 1 24 ? -7.910  0.768   1.445   1.00 0.00 ? 24  SER A C    16 
ATOM   9522  O  O    . SER A 1 24 ? -6.834  0.891   2.030   1.00 0.00 ? 24  SER A O    16 
ATOM   9523  C  CB   . SER A 1 24 ? -10.136 1.366   2.418   1.00 0.00 ? 24  SER A CB   16 
ATOM   9524  O  OG   . SER A 1 24 ? -10.307 2.158   1.256   1.00 0.00 ? 24  SER A OG   16 
ATOM   9525  H  H    . SER A 1 24 ? -8.018  -0.031  3.946   1.00 0.00 ? 24  SER A H    16 
ATOM   9526  H  HA   . SER A 1 24 ? -9.610  -0.519  1.550   1.00 0.00 ? 24  SER A HA   16 
ATOM   9527  H  HB2  . SER A 1 24 ? -11.091 0.948   2.699   1.00 0.00 ? 24  SER A HB2  16 
ATOM   9528  H  HB3  . SER A 1 24 ? -9.769  1.994   3.217   1.00 0.00 ? 24  SER A HB3  16 
ATOM   9529  H  HG   . SER A 1 24 ? -10.969 1.755   0.689   1.00 0.00 ? 24  SER A HG   16 
ATOM   9530  N  N    . LYS A 1 25 ? -8.077  1.087   0.166   1.00 0.00 ? 25  LYS A N    16 
ATOM   9531  C  CA   . LYS A 1 25 ? -6.982  1.613   -0.641  1.00 0.00 ? 25  LYS A CA   16 
ATOM   9532  C  C    . LYS A 1 25 ? -6.550  2.988   -0.143  1.00 0.00 ? 25  LYS A C    16 
ATOM   9533  O  O    . LYS A 1 25 ? -5.359  3.260   0.004   1.00 0.00 ? 25  LYS A O    16 
ATOM   9534  C  CB   . LYS A 1 25 ? -7.401  1.700   -2.111  1.00 0.00 ? 25  LYS A CB   16 
ATOM   9535  C  CG   . LYS A 1 25 ? -8.649  2.535   -2.339  1.00 0.00 ? 25  LYS A CG   16 
ATOM   9536  C  CD   . LYS A 1 25 ? -9.107  2.469   -3.787  1.00 0.00 ? 25  LYS A CD   16 
ATOM   9537  C  CE   . LYS A 1 25 ? -9.914  3.699   -4.172  1.00 0.00 ? 25  LYS A CE   16 
ATOM   9538  N  NZ   . LYS A 1 25 ? -11.209 3.765   -3.439  1.00 0.00 ? 25  LYS A NZ   16 
ATOM   9539  H  H    . LYS A 1 25 ? -8.959  0.967   -0.245  1.00 0.00 ? 25  LYS A H    16 
ATOM   9540  H  HA   . LYS A 1 25 ? -6.149  0.933   -0.553  1.00 0.00 ? 25  LYS A HA   16 
ATOM   9541  H  HB2  . LYS A 1 25 ? -6.592  2.136   -2.678  1.00 0.00 ? 25  LYS A HB2  16 
ATOM   9542  H  HB3  . LYS A 1 25 ? -7.589  0.701   -2.478  1.00 0.00 ? 25  LYS A HB3  16 
ATOM   9543  H  HG2  . LYS A 1 25 ? -9.441  2.164   -1.706  1.00 0.00 ? 25  LYS A HG2  16 
ATOM   9544  H  HG3  . LYS A 1 25 ? -8.434  3.563   -2.085  1.00 0.00 ? 25  LYS A HG3  16 
ATOM   9545  H  HD2  . LYS A 1 25 ? -8.239  2.407   -4.427  1.00 0.00 ? 25  LYS A HD2  16 
ATOM   9546  H  HD3  . LYS A 1 25 ? -9.720  1.589   -3.922  1.00 0.00 ? 25  LYS A HD3  16 
ATOM   9547  H  HE2  . LYS A 1 25 ? -9.335  4.580   -3.943  1.00 0.00 ? 25  LYS A HE2  16 
ATOM   9548  H  HE3  . LYS A 1 25 ? -10.113 3.665   -5.233  1.00 0.00 ? 25  LYS A HE3  16 
ATOM   9549  H  HZ1  . LYS A 1 25 ? -11.414 4.747   -3.164  1.00 0.00 ? 25  LYS A HZ1  16 
ATOM   9550  H  HZ2  . LYS A 1 25 ? -11.163 3.178   -2.581  1.00 0.00 ? 25  LYS A HZ2  16 
ATOM   9551  H  HZ3  . LYS A 1 25 ? -11.980 3.417   -4.043  1.00 0.00 ? 25  LYS A HZ3  16 
ATOM   9552  N  N    . SER A 1 26 ? -7.527  3.852   0.118   1.00 0.00 ? 26  SER A N    16 
ATOM   9553  C  CA   . SER A 1 26 ? -7.247  5.200   0.598   1.00 0.00 ? 26  SER A CA   16 
ATOM   9554  C  C    . SER A 1 26 ? -6.420  5.159   1.880   1.00 0.00 ? 26  SER A C    16 
ATOM   9555  O  O    . SER A 1 26 ? -5.811  6.155   2.271   1.00 0.00 ? 26  SER A O    16 
ATOM   9556  C  CB   . SER A 1 26 ? -8.553  5.958   0.843   1.00 0.00 ? 26  SER A CB   16 
ATOM   9557  O  OG   . SER A 1 26 ? -8.312  7.188   1.505   1.00 0.00 ? 26  SER A OG   16 
ATOM   9558  H  H    . SER A 1 26 ? -8.457  3.576   -0.019  1.00 0.00 ? 26  SER A H    16 
ATOM   9559  H  HA   . SER A 1 26 ? -6.681  5.713   -0.165  1.00 0.00 ? 26  SER A HA   16 
ATOM   9560  H  HB2  . SER A 1 26 ? -9.032  6.160   -0.102  1.00 0.00 ? 26  SER A HB2  16 
ATOM   9561  H  HB3  . SER A 1 26 ? -9.206  5.355   1.457   1.00 0.00 ? 26  SER A HB3  16 
ATOM   9562  H  HG   . SER A 1 26 ? -8.760  7.189   2.354   1.00 0.00 ? 26  SER A HG   16 
ATOM   9563  N  N    . TYR A 1 27 ? -6.404  4.001   2.529   1.00 0.00 ? 27  TYR A N    16 
ATOM   9564  C  CA   . TYR A 1 27 ? -5.655  3.829   3.768   1.00 0.00 ? 27  TYR A CA   16 
ATOM   9565  C  C    . TYR A 1 27 ? -4.222  3.390   3.482   1.00 0.00 ? 27  TYR A C    16 
ATOM   9566  O  O    . TYR A 1 27 ? -3.299  3.715   4.230   1.00 0.00 ? 27  TYR A O    16 
ATOM   9567  C  CB   . TYR A 1 27 ? -6.345  2.803   4.668   1.00 0.00 ? 27  TYR A CB   16 
ATOM   9568  C  CG   . TYR A 1 27 ? -6.139  3.057   6.145   1.00 0.00 ? 27  TYR A CG   16 
ATOM   9569  C  CD1  . TYR A 1 27 ? -6.259  4.336   6.674   1.00 0.00 ? 27  TYR A CD1  16 
ATOM   9570  C  CD2  . TYR A 1 27 ? -5.824  2.017   7.010   1.00 0.00 ? 27  TYR A CD2  16 
ATOM   9571  C  CE1  . TYR A 1 27 ? -6.071  4.572   8.022   1.00 0.00 ? 27  TYR A CE1  16 
ATOM   9572  C  CE2  . TYR A 1 27 ? -5.635  2.243   8.360   1.00 0.00 ? 27  TYR A CE2  16 
ATOM   9573  C  CZ   . TYR A 1 27 ? -5.759  3.522   8.861   1.00 0.00 ? 27  TYR A CZ   16 
ATOM   9574  O  OH   . TYR A 1 27 ? -5.572  3.753   10.204  1.00 0.00 ? 27  TYR A OH   16 
ATOM   9575  H  H    . TYR A 1 27 ? -6.909  3.243   2.168   1.00 0.00 ? 27  TYR A H    16 
ATOM   9576  H  HA   . TYR A 1 27 ? -5.632  4.782   4.277   1.00 0.00 ? 27  TYR A HA   16 
ATOM   9577  H  HB2  . TYR A 1 27 ? -7.407  2.821   4.475   1.00 0.00 ? 27  TYR A HB2  16 
ATOM   9578  H  HB3  . TYR A 1 27 ? -5.960  1.820   4.443   1.00 0.00 ? 27  TYR A HB3  16 
ATOM   9579  H  HD1  . TYR A 1 27 ? -6.504  5.155   6.014   1.00 0.00 ? 27  TYR A HD1  16 
ATOM   9580  H  HD2  . TYR A 1 27 ? -5.728  1.016   6.615   1.00 0.00 ? 27  TYR A HD2  16 
ATOM   9581  H  HE1  . TYR A 1 27 ? -6.168  5.573   8.414   1.00 0.00 ? 27  TYR A HE1  16 
ATOM   9582  H  HE2  . TYR A 1 27 ? -5.391  1.422   9.018   1.00 0.00 ? 27  TYR A HE2  16 
ATOM   9583  H  HH   . TYR A 1 27 ? -6.275  4.317   10.533  1.00 0.00 ? 27  TYR A HH   16 
ATOM   9584  N  N    . LEU A 1 28 ? -4.044  2.648   2.395   1.00 0.00 ? 28  LEU A N    16 
ATOM   9585  C  CA   . LEU A 1 28 ? -2.724  2.163   2.007   1.00 0.00 ? 28  LEU A CA   16 
ATOM   9586  C  C    . LEU A 1 28 ? -1.990  3.198   1.161   1.00 0.00 ? 28  LEU A C    16 
ATOM   9587  O  O    . LEU A 1 28 ? -0.764  3.296   1.209   1.00 0.00 ? 28  LEU A O    16 
ATOM   9588  C  CB   . LEU A 1 28 ? -2.849  0.850   1.232   1.00 0.00 ? 28  LEU A CB   16 
ATOM   9589  C  CG   . LEU A 1 28 ? -1.684  0.505   0.304   1.00 0.00 ? 28  LEU A CG   16 
ATOM   9590  C  CD1  . LEU A 1 28 ? -0.478  0.047   1.108   1.00 0.00 ? 28  LEU A CD1  16 
ATOM   9591  C  CD2  . LEU A 1 28 ? -2.098  -0.564  -0.697  1.00 0.00 ? 28  LEU A CD2  16 
ATOM   9592  H  H    . LEU A 1 28 ? -4.818  2.421   1.838   1.00 0.00 ? 28  LEU A H    16 
ATOM   9593  H  HA   . LEU A 1 28 ? -2.158  1.986   2.910   1.00 0.00 ? 28  LEU A HA   16 
ATOM   9594  H  HB2  . LEU A 1 28 ? -2.947  0.050   1.950   1.00 0.00 ? 28  LEU A HB2  16 
ATOM   9595  H  HB3  . LEU A 1 28 ? -3.747  0.905   0.632   1.00 0.00 ? 28  LEU A HB3  16 
ATOM   9596  H  HG   . LEU A 1 28 ? -1.399  1.390   -0.249  1.00 0.00 ? 28  LEU A HG   16 
ATOM   9597  H  HD11 . LEU A 1 28 ? -0.465  0.556   2.060   1.00 0.00 ? 28  LEU A HD11 16 
ATOM   9598  H  HD12 . LEU A 1 28 ? 0.426   0.277   0.564   1.00 0.00 ? 28  LEU A HD12 16 
ATOM   9599  H  HD13 . LEU A 1 28 ? -0.538  -1.020  1.271   1.00 0.00 ? 28  LEU A HD13 16 
ATOM   9600  H  HD21 . LEU A 1 28 ? -1.391  -1.379  -0.666  1.00 0.00 ? 28  LEU A HD21 16 
ATOM   9601  H  HD22 . LEU A 1 28 ? -2.115  -0.139  -1.690  1.00 0.00 ? 28  LEU A HD22 16 
ATOM   9602  H  HD23 . LEU A 1 28 ? -3.083  -0.930  -0.446  1.00 0.00 ? 28  LEU A HD23 16 
ATOM   9603  N  N    . ILE A 1 29 ? -2.749  3.970   0.390   1.00 0.00 ? 29  ILE A N    16 
ATOM   9604  C  CA   . ILE A 1 29 ? -2.170  5.000   -0.464  1.00 0.00 ? 29  ILE A CA   16 
ATOM   9605  C  C    . ILE A 1 29 ? -1.417  6.038   0.361   1.00 0.00 ? 29  ILE A C    16 
ATOM   9606  O  O    . ILE A 1 29 ? -0.346  6.501   -0.033  1.00 0.00 ? 29  ILE A O    16 
ATOM   9607  C  CB   . ILE A 1 29 ? -3.251  5.710   -1.300  1.00 0.00 ? 29  ILE A CB   16 
ATOM   9608  C  CG1  . ILE A 1 29 ? -3.965  4.707   -2.209  1.00 0.00 ? 29  ILE A CG1  16 
ATOM   9609  C  CG2  . ILE A 1 29 ? -2.633  6.831   -2.123  1.00 0.00 ? 29  ILE A CG2  16 
ATOM   9610  C  CD1  . ILE A 1 29 ? -5.401  5.078   -2.508  1.00 0.00 ? 29  ILE A CD1  16 
ATOM   9611  H  H    . ILE A 1 29 ? -3.720  3.843   0.395   1.00 0.00 ? 29  ILE A H    16 
ATOM   9612  H  HA   . ILE A 1 29 ? -1.477  4.521   -1.140  1.00 0.00 ? 29  ILE A HA   16 
ATOM   9613  H  HB   . ILE A 1 29 ? -3.969  6.147   -0.623  1.00 0.00 ? 29  ILE A HB   16 
ATOM   9614  H  HG12 . ILE A 1 29 ? -3.437  4.642   -3.147  1.00 0.00 ? 29  ILE A HG12 16 
ATOM   9615  H  HG13 . ILE A 1 29 ? -3.964  3.738   -1.732  1.00 0.00 ? 29  ILE A HG13 16 
ATOM   9616  H  HG21 . ILE A 1 29 ? -3.082  6.847   -3.105  1.00 0.00 ? 29  ILE A HG21 16 
ATOM   9617  H  HG22 . ILE A 1 29 ? -2.809  7.776   -1.632  1.00 0.00 ? 29  ILE A HG22 16 
ATOM   9618  H  HG23 . ILE A 1 29 ? -1.570  6.666   -2.216  1.00 0.00 ? 29  ILE A HG23 16 
ATOM   9619  H  HD11 . ILE A 1 29 ? -5.514  5.252   -3.568  1.00 0.00 ? 29  ILE A HD11 16 
ATOM   9620  H  HD12 . ILE A 1 29 ? -6.052  4.272   -2.205  1.00 0.00 ? 29  ILE A HD12 16 
ATOM   9621  H  HD13 . ILE A 1 29 ? -5.661  5.975   -1.967  1.00 0.00 ? 29  ILE A HD13 16 
ATOM   9622  N  N    . ILE A 1 30 ? -1.984  6.399   1.507   1.00 0.00 ? 30  ILE A N    16 
ATOM   9623  C  CA   . ILE A 1 30 ? -1.364  7.380   2.389   1.00 0.00 ? 30  ILE A CA   16 
ATOM   9624  C  C    . ILE A 1 30 ? -0.134  6.801   3.079   1.00 0.00 ? 30  ILE A C    16 
ATOM   9625  O  O    . ILE A 1 30 ? 0.682   7.535   3.638   1.00 0.00 ? 30  ILE A O    16 
ATOM   9626  C  CB   . ILE A 1 30 ? -2.353  7.877   3.461   1.00 0.00 ? 30  ILE A CB   16 
ATOM   9627  C  CG1  . ILE A 1 30 ? -2.810  6.714   4.343   1.00 0.00 ? 30  ILE A CG1  16 
ATOM   9628  C  CG2  . ILE A 1 30 ? -3.547  8.554   2.805   1.00 0.00 ? 30  ILE A CG2  16 
ATOM   9629  C  CD1  . ILE A 1 30 ? -3.147  7.126   5.759   1.00 0.00 ? 30  ILE A CD1  16 
ATOM   9630  H  H    . ILE A 1 30 ? -2.837  5.995   1.767   1.00 0.00 ? 30  ILE A H    16 
ATOM   9631  H  HA   . ILE A 1 30 ? -1.062  8.225   1.787   1.00 0.00 ? 30  ILE A HA   16 
ATOM   9632  H  HB   . ILE A 1 30 ? -1.847  8.608   4.074   1.00 0.00 ? 30  ILE A HB   16 
ATOM   9633  H  HG12 . ILE A 1 30 ? -3.691  6.267   3.910   1.00 0.00 ? 30  ILE A HG12 16 
ATOM   9634  H  HG13 . ILE A 1 30 ? -2.023  5.976   4.389   1.00 0.00 ? 30  ILE A HG13 16 
ATOM   9635  H  HG21 . ILE A 1 30 ? -3.426  8.538   1.732   1.00 0.00 ? 30  ILE A HG21 16 
ATOM   9636  H  HG22 . ILE A 1 30 ? -4.451  8.027   3.073   1.00 0.00 ? 30  ILE A HG22 16 
ATOM   9637  H  HG23 . ILE A 1 30 ? -3.613  9.577   3.145   1.00 0.00 ? 30  ILE A HG23 16 
ATOM   9638  H  HD11 . ILE A 1 30 ? -2.273  7.009   6.384   1.00 0.00 ? 30  ILE A HD11 16 
ATOM   9639  H  HD12 . ILE A 1 30 ? -3.460  8.159   5.769   1.00 0.00 ? 30  ILE A HD12 16 
ATOM   9640  H  HD13 . ILE A 1 30 ? -3.944  6.503   6.136   1.00 0.00 ? 30  ILE A HD13 16 
ATOM   9641  N  N    . HIS A 1 31 ? -0.005  5.478   3.034   1.00 0.00 ? 31  HIS A N    16 
ATOM   9642  C  CA   . HIS A 1 31 ? 1.128   4.799   3.653   1.00 0.00 ? 31  HIS A CA   16 
ATOM   9643  C  C    . HIS A 1 31 ? 2.244   4.570   2.638   1.00 0.00 ? 31  HIS A C    16 
ATOM   9644  O  O    . HIS A 1 31 ? 3.417   4.815   2.923   1.00 0.00 ? 31  HIS A O    16 
ATOM   9645  C  CB   . HIS A 1 31 ? 0.685   3.464   4.251   1.00 0.00 ? 31  HIS A CB   16 
ATOM   9646  C  CG   . HIS A 1 31 ? 1.784   2.450   4.333   1.00 0.00 ? 31  HIS A CG   16 
ATOM   9647  N  ND1  . HIS A 1 31 ? 2.186   1.870   5.517   1.00 0.00 ? 31  HIS A ND1  16 
ATOM   9648  C  CD2  . HIS A 1 31 ? 2.566   1.911   3.368   1.00 0.00 ? 31  HIS A CD2  16 
ATOM   9649  C  CE1  . HIS A 1 31 ? 3.169   1.020   5.278   1.00 0.00 ? 31  HIS A CE1  16 
ATOM   9650  N  NE2  . HIS A 1 31 ? 3.418   1.026   3.980   1.00 0.00 ? 31  HIS A NE2  16 
ATOM   9651  H  H    . HIS A 1 31 ? -0.688  4.947   2.574   1.00 0.00 ? 31  HIS A H    16 
ATOM   9652  H  HA   . HIS A 1 31 ? 1.502   5.431   4.444   1.00 0.00 ? 31  HIS A HA   16 
ATOM   9653  H  HB2  . HIS A 1 31 ? 0.313   3.630   5.251   1.00 0.00 ? 31  HIS A HB2  16 
ATOM   9654  H  HB3  . HIS A 1 31 ? -0.106  3.049   3.643   1.00 0.00 ? 31  HIS A HB3  16 
ATOM   9655  H  HD1  . HIS A 1 31 ? 1.809   2.055   6.402   1.00 0.00 ? 31  HIS A HD1  16 
ATOM   9656  H  HD2  . HIS A 1 31 ? 2.527   2.136   2.311   1.00 0.00 ? 31  HIS A HD2  16 
ATOM   9657  H  HE1  . HIS A 1 31 ? 3.681   0.421   6.016   1.00 0.00 ? 31  HIS A HE1  16 
ATOM   9658  N  N    . THR A 1 32 ? 1.872   4.099   1.452   1.00 0.00 ? 32  THR A N    16 
ATOM   9659  C  CA   . THR A 1 32 ? 2.841   3.835   0.396   1.00 0.00 ? 32  THR A CA   16 
ATOM   9660  C  C    . THR A 1 32 ? 3.802   5.006   0.227   1.00 0.00 ? 32  THR A C    16 
ATOM   9661  O  O    . THR A 1 32 ? 5.002   4.813   0.028   1.00 0.00 ? 32  THR A O    16 
ATOM   9662  C  CB   . THR A 1 32 ? 2.144   3.558   -0.949  1.00 0.00 ? 32  THR A CB   16 
ATOM   9663  O  OG1  . THR A 1 32 ? 1.261   2.439   -0.823  1.00 0.00 ? 32  THR A OG1  16 
ATOM   9664  C  CG2  . THR A 1 32 ? 3.167   3.283   -2.042  1.00 0.00 ? 32  THR A CG2  16 
ATOM   9665  H  H    . THR A 1 32 ? 0.922   3.924   1.285   1.00 0.00 ? 32  THR A H    16 
ATOM   9666  H  HA   . THR A 1 32 ? 3.405   2.956   0.673   1.00 0.00 ? 32  THR A HA   16 
ATOM   9667  H  HB   . THR A 1 32 ? 1.570   4.431   -1.226  1.00 0.00 ? 32  THR A HB   16 
ATOM   9668  H  HG1  . THR A 1 32 ? 1.729   1.706   -0.415  1.00 0.00 ? 32  THR A HG1  16 
ATOM   9669  H  HG21 . THR A 1 32 ? 2.657   3.131   -2.981  1.00 0.00 ? 32  THR A HG21 16 
ATOM   9670  H  HG22 . THR A 1 32 ? 3.731   2.397   -1.791  1.00 0.00 ? 32  THR A HG22 16 
ATOM   9671  H  HG23 . THR A 1 32 ? 3.837   4.125   -2.127  1.00 0.00 ? 32  THR A HG23 16 
ATOM   9672  N  N    . ARG A 1 33 ? 3.268   6.220   0.307   1.00 0.00 ? 33  ARG A N    16 
ATOM   9673  C  CA   . ARG A 1 33 ? 4.079   7.423   0.162   1.00 0.00 ? 33  ARG A CA   16 
ATOM   9674  C  C    . ARG A 1 33 ? 5.261   7.401   1.127   1.00 0.00 ? 33  ARG A C    16 
ATOM   9675  O  O    . ARG A 1 33 ? 6.363   7.834   0.787   1.00 0.00 ? 33  ARG A O    16 
ATOM   9676  C  CB   . ARG A 1 33 ? 3.228   8.670   0.408   1.00 0.00 ? 33  ARG A CB   16 
ATOM   9677  C  CG   . ARG A 1 33 ? 2.414   8.609   1.690   1.00 0.00 ? 33  ARG A CG   16 
ATOM   9678  C  CD   . ARG A 1 33 ? 1.403   9.742   1.763   1.00 0.00 ? 33  ARG A CD   16 
ATOM   9679  N  NE   . ARG A 1 33 ? 0.366   9.617   0.742   1.00 0.00 ? 33  ARG A NE   16 
ATOM   9680  C  CZ   . ARG A 1 33 ? -0.400  10.626  0.345   1.00 0.00 ? 33  ARG A CZ   16 
ATOM   9681  N  NH1  . ARG A 1 33 ? -0.248  11.829  0.881   1.00 0.00 ? 33  ARG A NH1  16 
ATOM   9682  N  NH2  . ARG A 1 33 ? -1.322  10.433  -0.590  1.00 0.00 ? 33  ARG A NH2  16 
ATOM   9683  H  H    . ARG A 1 33 ? 2.305   6.309   0.467   1.00 0.00 ? 33  ARG A H    16 
ATOM   9684  H  HA   . ARG A 1 33 ? 4.456   7.449   -0.850  1.00 0.00 ? 33  ARG A HA   16 
ATOM   9685  H  HB2  . ARG A 1 33 ? 3.879   9.531   0.462   1.00 0.00 ? 33  ARG A HB2  16 
ATOM   9686  H  HB3  . ARG A 1 33 ? 2.547   8.795   -0.420  1.00 0.00 ? 33  ARG A HB3  16 
ATOM   9687  H  HG2  . ARG A 1 33 ? 1.887   7.667   1.726   1.00 0.00 ? 33  ARG A HG2  16 
ATOM   9688  H  HG3  . ARG A 1 33 ? 3.084   8.681   2.534   1.00 0.00 ? 33  ARG A HG3  16 
ATOM   9689  H  HD2  . ARG A 1 33 ? 0.938   9.730   2.737   1.00 0.00 ? 33  ARG A HD2  16 
ATOM   9690  H  HD3  . ARG A 1 33 ? 1.921   10.679  1.623   1.00 0.00 ? 33  ARG A HD3  16 
ATOM   9691  H  HE   . ARG A 1 33 ? 0.237   8.736   0.333   1.00 0.00 ? 33  ARG A HE   16 
ATOM   9692  H  HH11 . ARG A 1 33 ? 0.447   11.978  1.584   1.00 0.00 ? 33  ARG A HH11 16 
ATOM   9693  H  HH12 . ARG A 1 33 ? -0.826  12.588  0.579   1.00 0.00 ? 33  ARG A HH12 16 
ATOM   9694  H  HH21 . ARG A 1 33 ? -1.440  9.528   -0.996  1.00 0.00 ? 33  ARG A HH21 16 
ATOM   9695  H  HH22 . ARG A 1 33 ? -1.899  11.193  -0.888  1.00 0.00 ? 33  ARG A HH22 16 
ATOM   9696  N  N    . THR A 1 34 ? 5.024   6.895   2.333   1.00 0.00 ? 34  THR A N    16 
ATOM   9697  C  CA   . THR A 1 34 ? 6.067   6.819   3.348   1.00 0.00 ? 34  THR A CA   16 
ATOM   9698  C  C    . THR A 1 34 ? 7.301   6.099   2.816   1.00 0.00 ? 34  THR A C    16 
ATOM   9699  O  O    . THR A 1 34 ? 8.407   6.281   3.326   1.00 0.00 ? 34  THR A O    16 
ATOM   9700  C  CB   . THR A 1 34 ? 5.569   6.093   4.612   1.00 0.00 ? 34  THR A CB   16 
ATOM   9701  O  OG1  . THR A 1 34 ? 5.401   4.697   4.341   1.00 0.00 ? 34  THR A OG1  16 
ATOM   9702  C  CG2  . THR A 1 34 ? 4.252   6.683   5.092   1.00 0.00 ? 34  THR A CG2  16 
ATOM   9703  H  H    . THR A 1 34 ? 4.125   6.567   2.545   1.00 0.00 ? 34  THR A H    16 
ATOM   9704  H  HA   . THR A 1 34 ? 6.341   7.828   3.622   1.00 0.00 ? 34  THR A HA   16 
ATOM   9705  H  HB   . THR A 1 34 ? 6.306   6.214   5.393   1.00 0.00 ? 34  THR A HB   16 
ATOM   9706  H  HG1  . THR A 1 34 ? 5.234   4.570   3.404   1.00 0.00 ? 34  THR A HG1  16 
ATOM   9707  H  HG21 . THR A 1 34 ? 4.375   7.741   5.268   1.00 0.00 ? 34  THR A HG21 16 
ATOM   9708  H  HG22 . THR A 1 34 ? 3.953   6.199   6.010   1.00 0.00 ? 34  THR A HG22 16 
ATOM   9709  H  HG23 . THR A 1 34 ? 3.493   6.529   4.339   1.00 0.00 ? 34  THR A HG23 16 
ATOM   9710  N  N    . HIS A 1 35 ? 7.105   5.281   1.786   1.00 0.00 ? 35  HIS A N    16 
ATOM   9711  C  CA   . HIS A 1 35 ? 8.203   4.535   1.183   1.00 0.00 ? 35  HIS A CA   16 
ATOM   9712  C  C    . HIS A 1 35 ? 8.974   5.405   0.195   1.00 0.00 ? 35  HIS A C    16 
ATOM   9713  O  O    . HIS A 1 35 ? 9.734   4.901   -0.632  1.00 0.00 ? 35  HIS A O    16 
ATOM   9714  C  CB   . HIS A 1 35 ? 7.672   3.288   0.475   1.00 0.00 ? 35  HIS A CB   16 
ATOM   9715  C  CG   . HIS A 1 35 ? 7.249   2.200   1.415   1.00 0.00 ? 35  HIS A CG   16 
ATOM   9716  N  ND1  . HIS A 1 35 ? 8.145   1.379   2.066   1.00 0.00 ? 35  HIS A ND1  16 
ATOM   9717  C  CD2  . HIS A 1 35 ? 6.018   1.803   1.812   1.00 0.00 ? 35  HIS A CD2  16 
ATOM   9718  C  CE1  . HIS A 1 35 ? 7.482   0.521   2.822   1.00 0.00 ? 35  HIS A CE1  16 
ATOM   9719  N  NE2  . HIS A 1 35 ? 6.190   0.758   2.686   1.00 0.00 ? 35  HIS A NE2  16 
ATOM   9720  H  H    . HIS A 1 35 ? 6.200   5.178   1.424   1.00 0.00 ? 35  HIS A H    16 
ATOM   9721  H  HA   . HIS A 1 35 ? 8.872   4.231   1.974   1.00 0.00 ? 35  HIS A HA   16 
ATOM   9722  H  HB2  . HIS A 1 35 ? 6.815   3.559   -0.124  1.00 0.00 ? 35  HIS A HB2  16 
ATOM   9723  H  HB3  . HIS A 1 35 ? 8.444   2.890   -0.168  1.00 0.00 ? 35  HIS A HB3  16 
ATOM   9724  H  HD1  . HIS A 1 35 ? 9.120   1.417   1.985   1.00 0.00 ? 35  HIS A HD1  16 
ATOM   9725  H  HD2  . HIS A 1 35 ? 5.074   2.227   1.499   1.00 0.00 ? 35  HIS A HD2  16 
ATOM   9726  H  HE1  . HIS A 1 35 ? 7.922   -0.243  3.446   1.00 0.00 ? 35  HIS A HE1  16 
ATOM   9727  N  N    . THR A 1 36 ? 8.773   6.716   0.287   1.00 0.00 ? 36  THR A N    16 
ATOM   9728  C  CA   . THR A 1 36 ? 9.447   7.657   -0.599  1.00 0.00 ? 36  THR A CA   16 
ATOM   9729  C  C    . THR A 1 36 ? 10.751  8.153   0.016   1.00 0.00 ? 36  THR A C    16 
ATOM   9730  O  O    . THR A 1 36 ? 11.685  8.518   -0.697  1.00 0.00 ? 36  THR A O    16 
ATOM   9731  C  CB   . THR A 1 36 ? 8.551   8.867   -0.920  1.00 0.00 ? 36  THR A CB   16 
ATOM   9732  O  OG1  . THR A 1 36 ? 9.221   9.745   -1.831  1.00 0.00 ? 36  THR A OG1  16 
ATOM   9733  C  CG2  . THR A 1 36 ? 8.189   9.624   0.348   1.00 0.00 ? 36  THR A CG2  16 
ATOM   9734  H  H    . THR A 1 36 ? 8.156   7.058   0.967   1.00 0.00 ? 36  THR A H    16 
ATOM   9735  H  HA   . THR A 1 36 ? 9.669   7.143   -1.523  1.00 0.00 ? 36  THR A HA   16 
ATOM   9736  H  HB   . THR A 1 36 ? 7.641   8.510   -1.381  1.00 0.00 ? 36  THR A HB   16 
ATOM   9737  H  HG1  . THR A 1 36 ? 9.155   9.393   -2.722  1.00 0.00 ? 36  THR A HG1  16 
ATOM   9738  H  HG21 . THR A 1 36 ? 8.823   10.493  0.442   1.00 0.00 ? 36  THR A HG21 16 
ATOM   9739  H  HG22 . THR A 1 36 ? 8.331   8.982   1.205   1.00 0.00 ? 36  THR A HG22 16 
ATOM   9740  H  HG23 . THR A 1 36 ? 7.156   9.936   0.299   1.00 0.00 ? 36  THR A HG23 16 
ATOM   9741  N  N    . GLY A 1 37 ? 10.808  8.164   1.344   1.00 0.00 ? 37  GLY A N    16 
ATOM   9742  C  CA   . GLY A 1 37 ? 12.002  8.617   2.032   1.00 0.00 ? 37  GLY A CA   16 
ATOM   9743  C  C    . GLY A 1 37 ? 12.199  7.928   3.368   1.00 0.00 ? 37  GLY A C    16 
ATOM   9744  O  O    . GLY A 1 37 ? 11.339  8.006   4.245   1.00 0.00 ? 37  GLY A O    16 
ATOM   9745  H  H    . GLY A 1 37 ? 10.032  7.861   1.861   1.00 0.00 ? 37  GLY A H    16 
ATOM   9746  H  HA2  . GLY A 1 37 ? 12.861  8.420   1.408   1.00 0.00 ? 37  GLY A HA2  16 
ATOM   9747  H  HA3  . GLY A 1 37 ? 11.927  9.682   2.197   1.00 0.00 ? 37  GLY A HA3  16 
ATOM   9748  N  N    . GLU A 1 38 ? 13.332  7.251   3.523   1.00 0.00 ? 38  GLU A N    16 
ATOM   9749  C  CA   . GLU A 1 38 ? 13.636  6.544   4.761   1.00 0.00 ? 38  GLU A CA   16 
ATOM   9750  C  C    . GLU A 1 38 ? 15.125  6.628   5.084   1.00 0.00 ? 38  GLU A C    16 
ATOM   9751  O  O    . GLU A 1 38 ? 15.934  7.014   4.240   1.00 0.00 ? 38  GLU A O    16 
ATOM   9752  C  CB   . GLU A 1 38 ? 13.208  5.079   4.656   1.00 0.00 ? 38  GLU A CB   16 
ATOM   9753  C  CG   . GLU A 1 38 ? 11.748  4.845   5.008   1.00 0.00 ? 38  GLU A CG   16 
ATOM   9754  C  CD   . GLU A 1 38 ? 11.160  3.647   4.288   1.00 0.00 ? 38  GLU A CD   16 
ATOM   9755  O  OE1  . GLU A 1 38 ? 11.539  3.409   3.123   1.00 0.00 ? 38  GLU A OE1  16 
ATOM   9756  O  OE2  . GLU A 1 38 ? 10.320  2.947   4.892   1.00 0.00 ? 38  GLU A OE2  16 
ATOM   9757  H  H    . GLU A 1 38 ? 13.979  7.226   2.786   1.00 0.00 ? 38  GLU A H    16 
ATOM   9758  H  HA   . GLU A 1 38 ? 13.080  7.016   5.557   1.00 0.00 ? 38  GLU A HA   16 
ATOM   9759  H  HB2  . GLU A 1 38 ? 13.372  4.740   3.644   1.00 0.00 ? 38  GLU A HB2  16 
ATOM   9760  H  HB3  . GLU A 1 38 ? 13.816  4.490   5.326   1.00 0.00 ? 38  GLU A HB3  16 
ATOM   9761  H  HG2  . GLU A 1 38 ? 11.669  4.681   6.072   1.00 0.00 ? 38  GLU A HG2  16 
ATOM   9762  H  HG3  . GLU A 1 38 ? 11.181  5.723   4.737   1.00 0.00 ? 38  GLU A HG3  16 
ATOM   9763  N  N    . SER A 1 39 ? 15.480  6.265   6.312   1.00 0.00 ? 39  SER A N    16 
ATOM   9764  C  CA   . SER A 1 39 ? 16.870  6.303   6.750   1.00 0.00 ? 39  SER A CA   16 
ATOM   9765  C  C    . SER A 1 39 ? 17.801  5.814   5.644   1.00 0.00 ? 39  SER A C    16 
ATOM   9766  O  O    . SER A 1 39 ? 18.773  6.481   5.295   1.00 0.00 ? 39  SER A O    16 
ATOM   9767  C  CB   . SER A 1 39 ? 17.056  5.448   8.004   1.00 0.00 ? 39  SER A CB   16 
ATOM   9768  O  OG   . SER A 1 39 ? 16.624  4.116   7.782   1.00 0.00 ? 39  SER A OG   16 
ATOM   9769  H  H    . SER A 1 39 ? 14.789  5.966   6.941   1.00 0.00 ? 39  SER A H    16 
ATOM   9770  H  HA   . SER A 1 39 ? 17.116  7.328   6.984   1.00 0.00 ? 39  SER A HA   16 
ATOM   9771  H  HB2  . SER A 1 39 ? 18.101  5.434   8.276   1.00 0.00 ? 39  SER A HB2  16 
ATOM   9772  H  HB3  . SER A 1 39 ? 16.479  5.871   8.814   1.00 0.00 ? 39  SER A HB3  16 
ATOM   9773  H  HG   . SER A 1 39 ? 15.907  4.114   7.144   1.00 0.00 ? 39  SER A HG   16 
ATOM   9774  N  N    . GLY A 1 40 ? 17.494  4.641   5.097   1.00 0.00 ? 40  GLY A N    16 
ATOM   9775  C  CA   . GLY A 1 40 ? 18.312  4.081   4.037   1.00 0.00 ? 40  GLY A CA   16 
ATOM   9776  C  C    . GLY A 1 40 ? 17.710  2.822   3.444   1.00 0.00 ? 40  GLY A C    16 
ATOM   9777  O  O    . GLY A 1 40 ? 16.821  2.875   2.594   1.00 0.00 ? 40  GLY A O    16 
ATOM   9778  H  H    . GLY A 1 40 ? 16.707  4.153   5.415   1.00 0.00 ? 40  GLY A H    16 
ATOM   9779  H  HA2  . GLY A 1 40 ? 18.423  4.818   3.255   1.00 0.00 ? 40  GLY A HA2  16 
ATOM   9780  H  HA3  . GLY A 1 40 ? 19.288  3.846   4.437   1.00 0.00 ? 40  GLY A HA3  16 
ATOM   9781  N  N    . PRO A 1 41 ? 18.201  1.658   3.895   1.00 0.00 ? 41  PRO A N    16 
ATOM   9782  C  CA   . PRO A 1 41 ? 17.721  0.359   3.416   1.00 0.00 ? 41  PRO A CA   16 
ATOM   9783  C  C    . PRO A 1 41 ? 16.302  0.056   3.886   1.00 0.00 ? 41  PRO A C    16 
ATOM   9784  O  O    . PRO A 1 41 ? 15.697  0.844   4.612   1.00 0.00 ? 41  PRO A O    16 
ATOM   9785  C  CB   . PRO A 1 41 ? 18.711  -0.634  4.031   1.00 0.00 ? 41  PRO A CB   16 
ATOM   9786  C  CG   . PRO A 1 41 ? 19.235  0.056   5.244   1.00 0.00 ? 41  PRO A CG   16 
ATOM   9787  C  CD   . PRO A 1 41 ? 19.261  1.521   4.908   1.00 0.00 ? 41  PRO A CD   16 
ATOM   9788  H  HA   . PRO A 1 41 ? 17.764  0.292   2.339   1.00 0.00 ? 41  PRO A HA   16 
ATOM   9789  H  HB2  . PRO A 1 41 ? 18.196  -1.548  4.288   1.00 0.00 ? 41  PRO A HB2  16 
ATOM   9790  H  HB3  . PRO A 1 41 ? 19.500  -0.844  3.325   1.00 0.00 ? 41  PRO A HB3  16 
ATOM   9791  H  HG2  . PRO A 1 41 ? 18.578  -0.125  6.081   1.00 0.00 ? 41  PRO A HG2  16 
ATOM   9792  H  HG3  . PRO A 1 41 ? 20.232  -0.296  5.463   1.00 0.00 ? 41  PRO A HG3  16 
ATOM   9793  H  HD2  . PRO A 1 41 ? 19.037  2.113   5.783   1.00 0.00 ? 41  PRO A HD2  16 
ATOM   9794  H  HD3  . PRO A 1 41 ? 20.222  1.797   4.499   1.00 0.00 ? 41  PRO A HD3  16 
ATOM   9795  N  N    . SER A 1 42 ? 15.778  -1.092  3.469   1.00 0.00 ? 42  SER A N    16 
ATOM   9796  C  CA   . SER A 1 42 ? 14.428  -1.498  3.845   1.00 0.00 ? 42  SER A CA   16 
ATOM   9797  C  C    . SER A 1 42 ? 14.428  -2.907  4.430   1.00 0.00 ? 42  SER A C    16 
ATOM   9798  O  O    . SER A 1 42 ? 13.779  -3.170  5.442   1.00 0.00 ? 42  SER A O    16 
ATOM   9799  C  CB   . SER A 1 42 ? 13.498  -1.437  2.631   1.00 0.00 ? 42  SER A CB   16 
ATOM   9800  O  OG   . SER A 1 42 ? 13.445  -0.127  2.095   1.00 0.00 ? 42  SER A OG   16 
ATOM   9801  H  H    . SER A 1 42 ? 16.311  -1.679  2.892   1.00 0.00 ? 42  SER A H    16 
ATOM   9802  H  HA   . SER A 1 42 ? 14.072  -0.808  4.595   1.00 0.00 ? 42  SER A HA   16 
ATOM   9803  H  HB2  . SER A 1 42 ? 13.860  -2.111  1.870   1.00 0.00 ? 42  SER A HB2  16 
ATOM   9804  H  HB3  . SER A 1 42 ? 12.503  -1.732  2.930   1.00 0.00 ? 42  SER A HB3  16 
ATOM   9805  H  HG   . SER A 1 42 ? 13.039  -0.153  1.225   1.00 0.00 ? 42  SER A HG   16 
ATOM   9806  N  N    . SER A 1 43 ? 15.160  -3.809  3.785   1.00 0.00 ? 43  SER A N    16 
ATOM   9807  C  CA   . SER A 1 43 ? 15.242  -5.192  4.239   1.00 0.00 ? 43  SER A CA   16 
ATOM   9808  C  C    . SER A 1 43 ? 16.388  -5.372  5.230   1.00 0.00 ? 43  SER A C    16 
ATOM   9809  O  O    . SER A 1 43 ? 16.192  -5.864  6.340   1.00 0.00 ? 43  SER A O    16 
ATOM   9810  C  CB   . SER A 1 43 ? 15.432  -6.132  3.046   1.00 0.00 ? 43  SER A CB   16 
ATOM   9811  O  OG   . SER A 1 43 ? 14.242  -6.237  2.285   1.00 0.00 ? 43  SER A OG   16 
ATOM   9812  H  H    . SER A 1 43 ? 15.656  -3.538  2.984   1.00 0.00 ? 43  SER A H    16 
ATOM   9813  H  HA   . SER A 1 43 ? 14.313  -5.435  4.732   1.00 0.00 ? 43  SER A HA   16 
ATOM   9814  H  HB2  . SER A 1 43 ? 16.218  -5.750  2.412   1.00 0.00 ? 43  SER A HB2  16 
ATOM   9815  H  HB3  . SER A 1 43 ? 15.705  -7.114  3.405   1.00 0.00 ? 43  SER A HB3  16 
ATOM   9816  H  HG   . SER A 1 43 ? 13.669  -6.901  2.677   1.00 0.00 ? 43  SER A HG   16 
ATOM   9817  N  N    . GLY A 1 44 ? 17.587  -4.970  4.819   1.00 0.00 ? 44  GLY A N    16 
ATOM   9818  C  CA   . GLY A 1 44 ? 18.747  -5.095  5.681   1.00 0.00 ? 44  GLY A CA   16 
ATOM   9819  C  C    . GLY A 1 44 ? 19.991  -4.477  5.073   1.00 0.00 ? 44  GLY A C    16 
ATOM   9820  O  O    . GLY A 1 44 ? 20.221  -4.649  3.877   1.00 0.00 ? 44  GLY A O    16 
ATOM   9821  H  H    . GLY A 1 44 ? 17.684  -4.585  3.922   1.00 0.00 ? 44  GLY A H    16 
ATOM   9822  H  HA2  . GLY A 1 44 ? 18.538  -4.606  6.621   1.00 0.00 ? 44  GLY A HA2  16 
ATOM   9823  H  HA3  . GLY A 1 44 ? 18.933  -6.143  5.866   1.00 0.00 ? 44  GLY A HA3  16 
HETATM 9824  ZN ZN   . ZN  B 2 .  ? 4.631   -0.428  3.071   1.00 0.00 ? 181 ZN  A ZN   16 
ATOM   9825  N  N    . GLY A 1 1  ? -17.492 -26.467 -4.433  1.00 0.00 ? 1   GLY A N    17 
ATOM   9826  C  CA   . GLY A 1 1  ? -16.642 -26.997 -5.484  1.00 0.00 ? 1   GLY A CA   17 
ATOM   9827  C  C    . GLY A 1 1  ? -15.290 -26.314 -5.536  1.00 0.00 ? 1   GLY A C    17 
ATOM   9828  O  O    . GLY A 1 1  ? -14.599 -26.213 -4.523  1.00 0.00 ? 1   GLY A O    17 
ATOM   9829  H  H1   . GLY A 1 1  ? -17.100 -26.210 -3.572  1.00 0.00 ? 1   GLY A H1   17 
ATOM   9830  H  HA2  . GLY A 1 1  ? -16.494 -28.053 -5.314  1.00 0.00 ? 1   GLY A HA2  17 
ATOM   9831  H  HA3  . GLY A 1 1  ? -17.138 -26.862 -6.434  1.00 0.00 ? 1   GLY A HA3  17 
ATOM   9832  N  N    . SER A 1 2  ? -14.911 -25.846 -6.721  1.00 0.00 ? 2   SER A N    17 
ATOM   9833  C  CA   . SER A 1 2  ? -13.629 -25.174 -6.902  1.00 0.00 ? 2   SER A CA   17 
ATOM   9834  C  C    . SER A 1 2  ? -13.785 -23.663 -6.769  1.00 0.00 ? 2   SER A C    17 
ATOM   9835  O  O    . SER A 1 2  ? -13.175 -23.039 -5.901  1.00 0.00 ? 2   SER A O    17 
ATOM   9836  C  CB   . SER A 1 2  ? -13.038 -25.519 -8.271  1.00 0.00 ? 2   SER A CB   17 
ATOM   9837  O  OG   . SER A 1 2  ? -11.747 -24.956 -8.425  1.00 0.00 ? 2   SER A OG   17 
ATOM   9838  H  H    . SER A 1 2  ? -15.506 -25.958 -7.492  1.00 0.00 ? 2   SER A H    17 
ATOM   9839  H  HA   . SER A 1 2  ? -12.959 -25.525 -6.132  1.00 0.00 ? 2   SER A HA   17 
ATOM   9840  H  HB2  . SER A 1 2  ? -12.964 -26.591 -8.369  1.00 0.00 ? 2   SER A HB2  17 
ATOM   9841  H  HB3  . SER A 1 2  ? -13.682 -25.130 -9.046  1.00 0.00 ? 2   SER A HB3  17 
ATOM   9842  H  HG   . SER A 1 2  ? -11.796 -24.005 -8.305  1.00 0.00 ? 2   SER A HG   17 
ATOM   9843  N  N    . SER A 1 3  ? -14.607 -23.080 -7.636  1.00 0.00 ? 3   SER A N    17 
ATOM   9844  C  CA   . SER A 1 3  ? -14.840 -21.641 -7.619  1.00 0.00 ? 3   SER A CA   17 
ATOM   9845  C  C    . SER A 1 3  ? -13.521 -20.876 -7.563  1.00 0.00 ? 3   SER A C    17 
ATOM   9846  O  O    . SER A 1 3  ? -13.391 -19.892 -6.836  1.00 0.00 ? 3   SER A O    17 
ATOM   9847  C  CB   . SER A 1 3  ? -15.715 -21.259 -6.423  1.00 0.00 ? 3   SER A CB   17 
ATOM   9848  O  OG   . SER A 1 3  ? -16.470 -20.091 -6.695  1.00 0.00 ? 3   SER A OG   17 
ATOM   9849  H  H    . SER A 1 3  ? -15.064 -23.631 -8.305  1.00 0.00 ? 3   SER A H    17 
ATOM   9850  H  HA   . SER A 1 3  ? -15.357 -21.378 -8.530  1.00 0.00 ? 3   SER A HA   17 
ATOM   9851  H  HB2  . SER A 1 3  ? -16.394 -22.069 -6.204  1.00 0.00 ? 3   SER A HB2  17 
ATOM   9852  H  HB3  . SER A 1 3  ? -15.085 -21.074 -5.564  1.00 0.00 ? 3   SER A HB3  17 
ATOM   9853  H  HG   . SER A 1 3  ? -17.350 -20.340 -6.989  1.00 0.00 ? 3   SER A HG   17 
ATOM   9854  N  N    . GLY A 1 4  ? -12.544 -21.338 -8.338  1.00 0.00 ? 4   GLY A N    17 
ATOM   9855  C  CA   . GLY A 1 4  ? -11.247 -20.687 -8.362  1.00 0.00 ? 4   GLY A CA   17 
ATOM   9856  C  C    . GLY A 1 4  ? -10.118 -21.629 -7.995  1.00 0.00 ? 4   GLY A C    17 
ATOM   9857  O  O    . GLY A 1 4  ? -10.346 -22.813 -7.743  1.00 0.00 ? 4   GLY A O    17 
ATOM   9858  H  H    . GLY A 1 4  ? -12.705 -22.126 -8.897  1.00 0.00 ? 4   GLY A H    17 
ATOM   9859  H  HA2  . GLY A 1 4  ? -11.070 -20.299 -9.354  1.00 0.00 ? 4   GLY A HA2  17 
ATOM   9860  H  HA3  . GLY A 1 4  ? -11.256 -19.865 -7.662  1.00 0.00 ? 4   GLY A HA3  17 
ATOM   9861  N  N    . SER A 1 5  ? -8.897  -21.105 -7.965  1.00 0.00 ? 5   SER A N    17 
ATOM   9862  C  CA   . SER A 1 5  ? -7.728  -21.909 -7.631  1.00 0.00 ? 5   SER A CA   17 
ATOM   9863  C  C    . SER A 1 5  ? -7.489  -21.921 -6.124  1.00 0.00 ? 5   SER A C    17 
ATOM   9864  O  O    . SER A 1 5  ? -7.428  -20.869 -5.486  1.00 0.00 ? 5   SER A O    17 
ATOM   9865  C  CB   . SER A 1 5  ? -6.490  -21.371 -8.351  1.00 0.00 ? 5   SER A CB   17 
ATOM   9866  O  OG   . SER A 1 5  ? -5.396  -22.263 -8.221  1.00 0.00 ? 5   SER A OG   17 
ATOM   9867  H  H    . SER A 1 5  ? -8.780  -20.155 -8.175  1.00 0.00 ? 5   SER A H    17 
ATOM   9868  H  HA   . SER A 1 5  ? -7.915  -22.920 -7.961  1.00 0.00 ? 5   SER A HA   17 
ATOM   9869  H  HB2  . SER A 1 5  ? -6.713  -21.244 -9.399  1.00 0.00 ? 5   SER A HB2  17 
ATOM   9870  H  HB3  . SER A 1 5  ? -6.214  -20.418 -7.923  1.00 0.00 ? 5   SER A HB3  17 
ATOM   9871  H  HG   . SER A 1 5  ? -4.955  -22.354 -9.069  1.00 0.00 ? 5   SER A HG   17 
ATOM   9872  N  N    . SER A 1 6  ? -7.354  -23.117 -5.561  1.00 0.00 ? 6   SER A N    17 
ATOM   9873  C  CA   . SER A 1 6  ? -7.126  -23.267 -4.129  1.00 0.00 ? 6   SER A CA   17 
ATOM   9874  C  C    . SER A 1 6  ? -5.929  -22.434 -3.679  1.00 0.00 ? 6   SER A C    17 
ATOM   9875  O  O    . SER A 1 6  ? -4.780  -22.786 -3.941  1.00 0.00 ? 6   SER A O    17 
ATOM   9876  C  CB   . SER A 1 6  ? -6.897  -24.739 -3.779  1.00 0.00 ? 6   SER A CB   17 
ATOM   9877  O  OG   . SER A 1 6  ? -8.025  -25.526 -4.121  1.00 0.00 ? 6   SER A OG   17 
ATOM   9878  H  H    . SER A 1 6  ? -7.413  -23.918 -6.123  1.00 0.00 ? 6   SER A H    17 
ATOM   9879  H  HA   . SER A 1 6  ? -8.008  -22.917 -3.614  1.00 0.00 ? 6   SER A HA   17 
ATOM   9880  H  HB2  . SER A 1 6  ? -6.040  -25.106 -4.322  1.00 0.00 ? 6   SER A HB2  17 
ATOM   9881  H  HB3  . SER A 1 6  ? -6.718  -24.830 -2.717  1.00 0.00 ? 6   SER A HB3  17 
ATOM   9882  H  HG   . SER A 1 6  ? -8.085  -26.276 -3.525  1.00 0.00 ? 6   SER A HG   17 
ATOM   9883  N  N    . GLY A 1 7  ? -6.210  -21.326 -3.000  1.00 0.00 ? 7   GLY A N    17 
ATOM   9884  C  CA   . GLY A 1 7  ? -5.147  -20.459 -2.525  1.00 0.00 ? 7   GLY A CA   17 
ATOM   9885  C  C    . GLY A 1 7  ? -5.482  -18.990 -2.688  1.00 0.00 ? 7   GLY A C    17 
ATOM   9886  O  O    . GLY A 1 7  ? -6.571  -18.639 -3.143  1.00 0.00 ? 7   GLY A O    17 
ATOM   9887  H  H    . GLY A 1 7  ? -7.145  -21.095 -2.820  1.00 0.00 ? 7   GLY A H    17 
ATOM   9888  H  HA2  . GLY A 1 7  ? -4.971  -20.664 -1.479  1.00 0.00 ? 7   GLY A HA2  17 
ATOM   9889  H  HA3  . GLY A 1 7  ? -4.246  -20.675 -3.080  1.00 0.00 ? 7   GLY A HA3  17 
ATOM   9890  N  N    . THR A 1 8  ? -4.543  -18.125 -2.314  1.00 0.00 ? 8   THR A N    17 
ATOM   9891  C  CA   . THR A 1 8  ? -4.744  -16.686 -2.418  1.00 0.00 ? 8   THR A CA   17 
ATOM   9892  C  C    . THR A 1 8  ? -3.455  -15.978 -2.819  1.00 0.00 ? 8   THR A C    17 
ATOM   9893  O  O    . THR A 1 8  ? -2.364  -16.378 -2.413  1.00 0.00 ? 8   THR A O    17 
ATOM   9894  C  CB   . THR A 1 8  ? -5.251  -16.092 -1.091  1.00 0.00 ? 8   THR A CB   17 
ATOM   9895  O  OG1  . THR A 1 8  ? -6.356  -16.859 -0.601  1.00 0.00 ? 8   THR A OG1  17 
ATOM   9896  C  CG2  . THR A 1 8  ? -5.675  -14.642 -1.274  1.00 0.00 ? 8   THR A CG2  17 
ATOM   9897  H  H    . THR A 1 8  ? -3.696  -18.466 -1.958  1.00 0.00 ? 8   THR A H    17 
ATOM   9898  H  HA   . THR A 1 8  ? -5.492  -16.508 -3.177  1.00 0.00 ? 8   THR A HA   17 
ATOM   9899  H  HB   . THR A 1 8  ? -4.449  -16.128 -0.368  1.00 0.00 ? 8   THR A HB   17 
ATOM   9900  H  HG1  . THR A 1 8  ? -6.758  -17.342 -1.327  1.00 0.00 ? 8   THR A HG1  17 
ATOM   9901  H  HG21 . THR A 1 8  ? -6.629  -14.483 -0.793  1.00 0.00 ? 8   THR A HG21 17 
ATOM   9902  H  HG22 . THR A 1 8  ? -5.763  -14.423 -2.327  1.00 0.00 ? 8   THR A HG22 17 
ATOM   9903  H  HG23 . THR A 1 8  ? -4.936  -13.992 -0.831  1.00 0.00 ? 8   THR A HG23 17 
ATOM   9904  N  N    . GLY A 1 9  ? -3.587  -14.924 -3.618  1.00 0.00 ? 9   GLY A N    17 
ATOM   9905  C  CA   . GLY A 1 9  ? -2.424  -14.177 -4.060  1.00 0.00 ? 9   GLY A CA   17 
ATOM   9906  C  C    . GLY A 1 9  ? -2.638  -12.678 -3.992  1.00 0.00 ? 9   GLY A C    17 
ATOM   9907  O  O    . GLY A 1 9  ? -2.285  -12.038 -3.001  1.00 0.00 ? 9   GLY A O    17 
ATOM   9908  H  H    . GLY A 1 9  ? -4.482  -14.651 -3.910  1.00 0.00 ? 9   GLY A H    17 
ATOM   9909  H  HA2  . GLY A 1 9  ? -1.583  -14.439 -3.435  1.00 0.00 ? 9   GLY A HA2  17 
ATOM   9910  H  HA3  . GLY A 1 9  ? -2.201  -14.451 -5.081  1.00 0.00 ? 9   GLY A HA3  17 
ATOM   9911  N  N    . MET A 1 10 ? -3.215  -12.115 -5.048  1.00 0.00 ? 10  MET A N    17 
ATOM   9912  C  CA   . MET A 1 10 ? -3.474  -10.681 -5.104  1.00 0.00 ? 10  MET A CA   17 
ATOM   9913  C  C    . MET A 1 10 ? -3.907  -10.154 -3.740  1.00 0.00 ? 10  MET A C    17 
ATOM   9914  O  O    . MET A 1 10 ? -4.885  -10.628 -3.161  1.00 0.00 ? 10  MET A O    17 
ATOM   9915  C  CB   . MET A 1 10 ? -4.551  -10.376 -6.147  1.00 0.00 ? 10  MET A CB   17 
ATOM   9916  C  CG   . MET A 1 10 ? -4.070  -10.530 -7.580  1.00 0.00 ? 10  MET A CG   17 
ATOM   9917  S  SD   . MET A 1 10 ? -5.378  -10.242 -8.787  1.00 0.00 ? 10  MET A SD   17 
ATOM   9918  C  CE   . MET A 1 10 ? -5.381  -8.452  -8.861  1.00 0.00 ? 10  MET A CE   17 
ATOM   9919  H  H    . MET A 1 10 ? -3.474  -12.677 -5.808  1.00 0.00 ? 10  MET A H    17 
ATOM   9920  H  HA   . MET A 1 10 ? -2.557  -10.190 -5.392  1.00 0.00 ? 10  MET A HA   17 
ATOM   9921  H  HB2  . MET A 1 10 ? -5.383  -11.047 -5.995  1.00 0.00 ? 10  MET A HB2  17 
ATOM   9922  H  HB3  . MET A 1 10 ? -4.889  -9.359  -6.011  1.00 0.00 ? 10  MET A HB3  17 
ATOM   9923  H  HG2  . MET A 1 10 ? -3.274  -9.822  -7.757  1.00 0.00 ? 10  MET A HG2  17 
ATOM   9924  H  HG3  . MET A 1 10 ? -3.691  -11.533 -7.712  1.00 0.00 ? 10  MET A HG3  17 
ATOM   9925  H  HE1  . MET A 1 10 ? -5.788  -8.055  -7.943  1.00 0.00 ? 10  MET A HE1  17 
ATOM   9926  H  HE2  . MET A 1 10 ? -4.370  -8.095  -8.991  1.00 0.00 ? 10  MET A HE2  17 
ATOM   9927  H  HE3  . MET A 1 10 ? -5.987  -8.128  -9.694  1.00 0.00 ? 10  MET A HE3  17 
ATOM   9928  N  N    . LYS A 1 11 ? -3.173  -9.170  -3.230  1.00 0.00 ? 11  LYS A N    17 
ATOM   9929  C  CA   . LYS A 1 11 ? -3.481  -8.577  -1.934  1.00 0.00 ? 11  LYS A CA   17 
ATOM   9930  C  C    . LYS A 1 11 ? -4.474  -7.429  -2.084  1.00 0.00 ? 11  LYS A C    17 
ATOM   9931  O  O    . LYS A 1 11 ? -4.425  -6.655  -3.040  1.00 0.00 ? 11  LYS A O    17 
ATOM   9932  C  CB   . LYS A 1 11 ? -2.201  -8.075  -1.263  1.00 0.00 ? 11  LYS A CB   17 
ATOM   9933  C  CG   . LYS A 1 11 ? -1.261  -9.189  -0.836  1.00 0.00 ? 11  LYS A CG   17 
ATOM   9934  C  CD   . LYS A 1 11 ? -1.792  -9.933  0.378   1.00 0.00 ? 11  LYS A CD   17 
ATOM   9935  C  CE   . LYS A 1 11 ? -0.792  -10.960 0.884   1.00 0.00 ? 11  LYS A CE   17 
ATOM   9936  N  NZ   . LYS A 1 11 ? -0.917  -12.258 0.164   1.00 0.00 ? 11  LYS A NZ   17 
ATOM   9937  H  H    . LYS A 1 11 ? -2.405  -8.835  -3.739  1.00 0.00 ? 11  LYS A H    17 
ATOM   9938  H  HA   . LYS A 1 11 ? -3.925  -9.343  -1.316  1.00 0.00 ? 11  LYS A HA   17 
ATOM   9939  H  HB2  . LYS A 1 11 ? -1.675  -7.433  -1.954  1.00 0.00 ? 11  LYS A HB2  17 
ATOM   9940  H  HB3  . LYS A 1 11 ? -2.469  -7.503  -0.386  1.00 0.00 ? 11  LYS A HB3  17 
ATOM   9941  H  HG2  . LYS A 1 11 ? -1.150  -9.887  -1.652  1.00 0.00 ? 11  LYS A HG2  17 
ATOM   9942  H  HG3  . LYS A 1 11 ? -0.298  -8.761  -0.592  1.00 0.00 ? 11  LYS A HG3  17 
ATOM   9943  H  HD2  . LYS A 1 11 ? -1.991  -9.222  1.166   1.00 0.00 ? 11  LYS A HD2  17 
ATOM   9944  H  HD3  . LYS A 1 11 ? -2.708  -10.438 0.106   1.00 0.00 ? 11  LYS A HD3  17 
ATOM   9945  H  HE2  . LYS A 1 11 ? 0.205   -10.574 0.741   1.00 0.00 ? 11  LYS A HE2  17 
ATOM   9946  H  HE3  . LYS A 1 11 ? -0.966  -11.124 1.937   1.00 0.00 ? 11  LYS A HE3  17 
ATOM   9947  H  HZ1  . LYS A 1 11 ? 0.021   -12.691 0.043   1.00 0.00 ? 11  LYS A HZ1  17 
ATOM   9948  H  HZ2  . LYS A 1 11 ? -1.341  -12.106 -0.773  1.00 0.00 ? 11  LYS A HZ2  17 
ATOM   9949  H  HZ3  . LYS A 1 11 ? -1.521  -12.909 0.704   1.00 0.00 ? 11  LYS A HZ3  17 
ATOM   9950  N  N    . PRO A 1 12 ? -5.396  -7.313  -1.117  1.00 0.00 ? 12  PRO A N    17 
ATOM   9951  C  CA   . PRO A 1 12 ? -6.416  -6.260  -1.118  1.00 0.00 ? 12  PRO A CA   17 
ATOM   9952  C  C    . PRO A 1 12 ? -5.824  -4.879  -0.855  1.00 0.00 ? 12  PRO A C    17 
ATOM   9953  O  O    . PRO A 1 12 ? -5.428  -4.176  -1.784  1.00 0.00 ? 12  PRO A O    17 
ATOM   9954  C  CB   . PRO A 1 12 ? -7.349  -6.669  0.025   1.00 0.00 ? 12  PRO A CB   17 
ATOM   9955  C  CG   . PRO A 1 12 ? -6.497  -7.484  0.936   1.00 0.00 ? 12  PRO A CG   17 
ATOM   9956  C  CD   . PRO A 1 12 ? -5.514  -8.200  0.053   1.00 0.00 ? 12  PRO A CD   17 
ATOM   9957  H  HA   . PRO A 1 12 ? -6.968  -6.243  -2.046  1.00 0.00 ? 12  PRO A HA   17 
ATOM   9958  H  HB2  . PRO A 1 12 ? -7.725  -5.784  0.520   1.00 0.00 ? 12  PRO A HB2  17 
ATOM   9959  H  HB3  . PRO A 1 12 ? -8.173  -7.246  -0.367  1.00 0.00 ? 12  PRO A HB3  17 
ATOM   9960  H  HG2  . PRO A 1 12 ? -5.979  -6.839  1.629   1.00 0.00 ? 12  PRO A HG2  17 
ATOM   9961  H  HG3  . PRO A 1 12 ? -7.109  -8.196  1.470   1.00 0.00 ? 12  PRO A HG3  17 
ATOM   9962  H  HD2  . PRO A 1 12 ? -4.563  -8.305  0.554   1.00 0.00 ? 12  PRO A HD2  17 
ATOM   9963  H  HD3  . PRO A 1 12 ? -5.899  -9.167  -0.235  1.00 0.00 ? 12  PRO A HD3  17 
ATOM   9964  N  N    . TYR A 1 13 ? -5.768  -4.498  0.416   1.00 0.00 ? 13  TYR A N    17 
ATOM   9965  C  CA   . TYR A 1 13 ? -5.226  -3.200  0.801   1.00 0.00 ? 13  TYR A CA   17 
ATOM   9966  C  C    . TYR A 1 13 ? -3.864  -3.355  1.471   1.00 0.00 ? 13  TYR A C    17 
ATOM   9967  O  O    . TYR A 1 13 ? -3.282  -2.383  1.953   1.00 0.00 ? 13  TYR A O    17 
ATOM   9968  C  CB   . TYR A 1 13 ? -6.191  -2.480  1.745   1.00 0.00 ? 13  TYR A CB   17 
ATOM   9969  C  CG   . TYR A 1 13 ? -7.636  -2.882  1.554   1.00 0.00 ? 13  TYR A CG   17 
ATOM   9970  C  CD1  . TYR A 1 13 ? -8.113  -4.090  2.048   1.00 0.00 ? 13  TYR A CD1  17 
ATOM   9971  C  CD2  . TYR A 1 13 ? -8.525  -2.053  0.881   1.00 0.00 ? 13  TYR A CD2  17 
ATOM   9972  C  CE1  . TYR A 1 13 ? -9.433  -4.461  1.876   1.00 0.00 ? 13  TYR A CE1  17 
ATOM   9973  C  CE2  . TYR A 1 13 ? -9.847  -2.416  0.705   1.00 0.00 ? 13  TYR A CE2  17 
ATOM   9974  C  CZ   . TYR A 1 13 ? -10.295 -3.621  1.204   1.00 0.00 ? 13  TYR A CZ   17 
ATOM   9975  O  OH   . TYR A 1 13 ? -11.611 -3.986  1.031   1.00 0.00 ? 13  TYR A OH   17 
ATOM   9976  H  H    . TYR A 1 13 ? -6.099  -5.102  1.113   1.00 0.00 ? 13  TYR A H    17 
ATOM   9977  H  HA   . TYR A 1 13 ? -5.109  -2.610  -0.096  1.00 0.00 ? 13  TYR A HA   17 
ATOM   9978  H  HB2  . TYR A 1 13 ? -5.918  -2.701  2.765   1.00 0.00 ? 13  TYR A HB2  17 
ATOM   9979  H  HB3  . TYR A 1 13 ? -6.118  -1.415  1.580   1.00 0.00 ? 13  TYR A HB3  17 
ATOM   9980  H  HD1  . TYR A 1 13 ? -7.435  -4.746  2.575   1.00 0.00 ? 13  TYR A HD1  17 
ATOM   9981  H  HD2  . TYR A 1 13 ? -8.171  -1.110  0.491   1.00 0.00 ? 13  TYR A HD2  17 
ATOM   9982  H  HE1  . TYR A 1 13 ? -9.784  -5.404  2.267   1.00 0.00 ? 13  TYR A HE1  17 
ATOM   9983  H  HE2  . TYR A 1 13 ? -10.523 -1.758  0.178   1.00 0.00 ? 13  TYR A HE2  17 
ATOM   9984  H  HH   . TYR A 1 13 ? -11.756 -4.234  0.115   1.00 0.00 ? 13  TYR A HH   17 
ATOM   9985  N  N    . VAL A 1 14 ? -3.360  -4.585  1.495   1.00 0.00 ? 14  VAL A N    17 
ATOM   9986  C  CA   . VAL A 1 14 ? -2.066  -4.869  2.103   1.00 0.00 ? 14  VAL A CA   17 
ATOM   9987  C  C    . VAL A 1 14 ? -0.924  -4.403  1.208   1.00 0.00 ? 14  VAL A C    17 
ATOM   9988  O  O    . VAL A 1 14 ? -0.960  -4.586  -0.009  1.00 0.00 ? 14  VAL A O    17 
ATOM   9989  C  CB   . VAL A 1 14 ? -1.898  -6.373  2.389   1.00 0.00 ? 14  VAL A CB   17 
ATOM   9990  C  CG1  . VAL A 1 14 ? -0.488  -6.671  2.875   1.00 0.00 ? 14  VAL A CG1  17 
ATOM   9991  C  CG2  . VAL A 1 14 ? -2.931  -6.841  3.403   1.00 0.00 ? 14  VAL A CG2  17 
ATOM   9992  H  H    . VAL A 1 14 ? -3.872  -5.319  1.095   1.00 0.00 ? 14  VAL A H    17 
ATOM   9993  H  HA   . VAL A 1 14 ? -2.014  -4.338  3.043   1.00 0.00 ? 14  VAL A HA   17 
ATOM   9994  H  HB   . VAL A 1 14 ? -2.059  -6.914  1.468   1.00 0.00 ? 14  VAL A HB   17 
ATOM   9995  H  HG11 . VAL A 1 14 ? -0.537  -7.211  3.809   1.00 0.00 ? 14  VAL A HG11 17 
ATOM   9996  H  HG12 . VAL A 1 14 ? 0.029   -7.268  2.139   1.00 0.00 ? 14  VAL A HG12 17 
ATOM   9997  H  HG13 . VAL A 1 14 ? 0.044   -5.743  3.025   1.00 0.00 ? 14  VAL A HG13 17 
ATOM   9998  H  HG21 . VAL A 1 14 ? -3.721  -6.109  3.477   1.00 0.00 ? 14  VAL A HG21 17 
ATOM   9999  H  HG22 . VAL A 1 14 ? -3.344  -7.787  3.085   1.00 0.00 ? 14  VAL A HG22 17 
ATOM   10000 H  HG23 . VAL A 1 14 ? -2.460  -6.961  4.368   1.00 0.00 ? 14  VAL A HG23 17 
ATOM   10001 N  N    . CYS A 1 15 ? 0.090   -3.798  1.818   1.00 0.00 ? 15  CYS A N    17 
ATOM   10002 C  CA   . CYS A 1 15 ? 1.244   -3.304  1.077   1.00 0.00 ? 15  CYS A CA   17 
ATOM   10003 C  C    . CYS A 1 15 ? 2.030   -4.459  0.461   1.00 0.00 ? 15  CYS A C    17 
ATOM   10004 O  O    . CYS A 1 15 ? 2.489   -5.357  1.166   1.00 0.00 ? 15  CYS A O    17 
ATOM   10005 C  CB   . CYS A 1 15 ? 2.154   -2.486  1.995   1.00 0.00 ? 15  CYS A CB   17 
ATOM   10006 S  SG   . CYS A 1 15 ? 3.071   -1.161  1.145   1.00 0.00 ? 15  CYS A SG   17 
ATOM   10007 H  H    . CYS A 1 15 ? 0.061   -3.681  2.791   1.00 0.00 ? 15  CYS A H    17 
ATOM   10008 H  HA   . CYS A 1 15 ? 0.882   -2.668  0.284   1.00 0.00 ? 15  CYS A HA   17 
ATOM   10009 H  HB2  . CYS A 1 15 ? 1.554   -2.026  2.767   1.00 0.00 ? 15  CYS A HB2  17 
ATOM   10010 H  HB3  . CYS A 1 15 ? 2.877   -3.145  2.453   1.00 0.00 ? 15  CYS A HB3  17 
ATOM   10011 N  N    . ASN A 1 16 ? 2.181   -4.427  -0.859  1.00 0.00 ? 16  ASN A N    17 
ATOM   10012 C  CA   . ASN A 1 16 ? 2.911   -5.471  -1.570  1.00 0.00 ? 16  ASN A CA   17 
ATOM   10013 C  C    . ASN A 1 16 ? 4.410   -5.188  -1.562  1.00 0.00 ? 16  ASN A C    17 
ATOM   10014 O  O    . ASN A 1 16 ? 5.134   -5.603  -2.466  1.00 0.00 ? 16  ASN A O    17 
ATOM   10015 C  CB   . ASN A 1 16 ? 2.409   -5.581  -3.011  1.00 0.00 ? 16  ASN A CB   17 
ATOM   10016 C  CG   . ASN A 1 16 ? 0.917   -5.843  -3.085  1.00 0.00 ? 16  ASN A CG   17 
ATOM   10017 O  OD1  . ASN A 1 16 ? 0.136   -5.269  -2.327  1.00 0.00 ? 16  ASN A OD1  17 
ATOM   10018 N  ND2  . ASN A 1 16 ? 0.514   -6.715  -4.002  1.00 0.00 ? 16  ASN A ND2  17 
ATOM   10019 H  H    . ASN A 1 16 ? 1.792   -3.685  -1.367  1.00 0.00 ? 16  ASN A H    17 
ATOM   10020 H  HA   . ASN A 1 16 ? 2.730   -6.406  -1.062  1.00 0.00 ? 16  ASN A HA   17 
ATOM   10021 H  HB2  . ASN A 1 16 ? 2.618   -4.657  -3.531  1.00 0.00 ? 16  ASN A HB2  17 
ATOM   10022 H  HB3  . ASN A 1 16 ? 2.923   -6.392  -3.504  1.00 0.00 ? 16  ASN A HB3  17 
ATOM   10023 H  HD21 . ASN A 1 16 ? 1.193   -7.135  -4.572  1.00 0.00 ? 16  ASN A HD21 17 
ATOM   10024 H  HD22 . ASN A 1 16 ? -0.445  -6.903  -4.072  1.00 0.00 ? 16  ASN A HD22 17 
ATOM   10025 N  N    . GLU A 1 17 ? 4.867   -4.479  -0.535  1.00 0.00 ? 17  GLU A N    17 
ATOM   10026 C  CA   . GLU A 1 17 ? 6.280   -4.141  -0.410  1.00 0.00 ? 17  GLU A CA   17 
ATOM   10027 C  C    . GLU A 1 17 ? 6.803   -4.492  0.980   1.00 0.00 ? 17  GLU A C    17 
ATOM   10028 O  O    . GLU A 1 17 ? 7.898   -5.037  1.124   1.00 0.00 ? 17  GLU A O    17 
ATOM   10029 C  CB   . GLU A 1 17 ? 6.498   -2.652  -0.687  1.00 0.00 ? 17  GLU A CB   17 
ATOM   10030 C  CG   . GLU A 1 17 ? 5.880   -2.179  -1.992  1.00 0.00 ? 17  GLU A CG   17 
ATOM   10031 C  CD   . GLU A 1 17 ? 6.834   -2.296  -3.165  1.00 0.00 ? 17  GLU A CD   17 
ATOM   10032 O  OE1  . GLU A 1 17 ? 7.579   -3.297  -3.227  1.00 0.00 ? 17  GLU A OE1  17 
ATOM   10033 O  OE2  . GLU A 1 17 ? 6.835   -1.387  -4.021  1.00 0.00 ? 17  GLU A OE2  17 
ATOM   10034 H  H    . GLU A 1 17 ? 4.240   -4.176  0.155   1.00 0.00 ? 17  GLU A H    17 
ATOM   10035 H  HA   . GLU A 1 17 ? 6.825   -4.717  -1.143  1.00 0.00 ? 17  GLU A HA   17 
ATOM   10036 H  HB2  . GLU A 1 17 ? 6.064   -2.080  0.120   1.00 0.00 ? 17  GLU A HB2  17 
ATOM   10037 H  HB3  . GLU A 1 17 ? 7.559   -2.456  -0.724  1.00 0.00 ? 17  GLU A HB3  17 
ATOM   10038 H  HG2  . GLU A 1 17 ? 5.005   -2.777  -2.199  1.00 0.00 ? 17  GLU A HG2  17 
ATOM   10039 H  HG3  . GLU A 1 17 ? 5.591   -1.144  -1.885  1.00 0.00 ? 17  GLU A HG3  17 
ATOM   10040 N  N    . CYS A 1 18 ? 6.013   -4.176  2.000   1.00 0.00 ? 18  CYS A N    17 
ATOM   10041 C  CA   . CYS A 1 18 ? 6.394   -4.457  3.379   1.00 0.00 ? 18  CYS A CA   17 
ATOM   10042 C  C    . CYS A 1 18 ? 5.435   -5.459  4.015   1.00 0.00 ? 18  CYS A C    17 
ATOM   10043 O  O    . CYS A 1 18 ? 5.847   -6.324  4.787   1.00 0.00 ? 18  CYS A O    17 
ATOM   10044 C  CB   . CYS A 1 18 ? 6.415   -3.164  4.197   1.00 0.00 ? 18  CYS A CB   17 
ATOM   10045 S  SG   . CYS A 1 18 ? 4.843   -2.244  4.174   1.00 0.00 ? 18  CYS A SG   17 
ATOM   10046 H  H    . CYS A 1 18 ? 5.151   -3.743  1.822   1.00 0.00 ? 18  CYS A H    17 
ATOM   10047 H  HA   . CYS A 1 18 ? 7.386   -4.882  3.369   1.00 0.00 ? 18  CYS A HA   17 
ATOM   10048 H  HB2  . CYS A 1 18 ? 6.640   -3.403  5.227   1.00 0.00 ? 18  CYS A HB2  17 
ATOM   10049 H  HB3  . CYS A 1 18 ? 7.184   -2.513  3.808   1.00 0.00 ? 18  CYS A HB3  17 
ATOM   10050 N  N    . GLY A 1 19 ? 4.153   -5.335  3.685   1.00 0.00 ? 19  GLY A N    17 
ATOM   10051 C  CA   . GLY A 1 19 ? 3.156   -6.236  4.233   1.00 0.00 ? 19  GLY A CA   17 
ATOM   10052 C  C    . GLY A 1 19 ? 2.171   -5.528  5.141   1.00 0.00 ? 19  GLY A C    17 
ATOM   10053 O  O    . GLY A 1 19 ? 1.376   -6.169  5.829   1.00 0.00 ? 19  GLY A O    17 
ATOM   10054 H  H    . GLY A 1 19 ? 3.882   -4.626  3.065   1.00 0.00 ? 19  GLY A H    17 
ATOM   10055 H  HA2  . GLY A 1 19 ? 2.614   -6.694  3.419   1.00 0.00 ? 19  GLY A HA2  17 
ATOM   10056 H  HA3  . GLY A 1 19 ? 3.657   -7.009  4.798   1.00 0.00 ? 19  GLY A HA3  17 
ATOM   10057 N  N    . LYS A 1 20 ? 2.222   -4.200  5.146   1.00 0.00 ? 20  LYS A N    17 
ATOM   10058 C  CA   . LYS A 1 20 ? 1.328   -3.402  5.976   1.00 0.00 ? 20  LYS A CA   17 
ATOM   10059 C  C    . LYS A 1 20 ? -0.119  -3.552  5.518   1.00 0.00 ? 20  LYS A C    17 
ATOM   10060 O  O    . LYS A 1 20 ? -0.478  -3.133  4.418   1.00 0.00 ? 20  LYS A O    17 
ATOM   10061 C  CB   . LYS A 1 20 ? 1.738   -1.928  5.933   1.00 0.00 ? 20  LYS A CB   17 
ATOM   10062 C  CG   . LYS A 1 20 ? 1.434   -1.174  7.216   1.00 0.00 ? 20  LYS A CG   17 
ATOM   10063 C  CD   . LYS A 1 20 ? -0.037  -1.273  7.586   1.00 0.00 ? 20  LYS A CD   17 
ATOM   10064 C  CE   . LYS A 1 20 ? -0.456  -0.141  8.512   1.00 0.00 ? 20  LYS A CE   17 
ATOM   10065 N  NZ   . LYS A 1 20 ? -1.668  -0.491  9.302   1.00 0.00 ? 20  LYS A NZ   17 
ATOM   10066 H  H    . LYS A 1 20 ? 2.878   -3.745  4.576   1.00 0.00 ? 20  LYS A H    17 
ATOM   10067 H  HA   . LYS A 1 20 ? 1.410   -3.760  6.991   1.00 0.00 ? 20  LYS A HA   17 
ATOM   10068 H  HB2  . LYS A 1 20 ? 2.800   -1.868  5.747   1.00 0.00 ? 20  LYS A HB2  17 
ATOM   10069 H  HB3  . LYS A 1 20 ? 1.211   -1.444  5.123   1.00 0.00 ? 20  LYS A HB3  17 
ATOM   10070 H  HG2  . LYS A 1 20 ? 2.024   -1.593  8.018   1.00 0.00 ? 20  LYS A HG2  17 
ATOM   10071 H  HG3  . LYS A 1 20 ? 1.693   -0.134  7.081   1.00 0.00 ? 20  LYS A HG3  17 
ATOM   10072 H  HD2  . LYS A 1 20 ? -0.630  -1.223  6.684   1.00 0.00 ? 20  LYS A HD2  17 
ATOM   10073 H  HD3  . LYS A 1 20 ? -0.212  -2.216  8.082   1.00 0.00 ? 20  LYS A HD3  17 
ATOM   10074 H  HE2  . LYS A 1 20 ? 0.357   0.071   9.190   1.00 0.00 ? 20  LYS A HE2  17 
ATOM   10075 H  HE3  . LYS A 1 20 ? -0.665  0.735   7.916   1.00 0.00 ? 20  LYS A HE3  17 
ATOM   10076 H  HZ1  . LYS A 1 20 ? -1.522  -1.391  9.802   1.00 0.00 ? 20  LYS A HZ1  17 
ATOM   10077 H  HZ2  . LYS A 1 20 ? -2.490  -0.587  8.671   1.00 0.00 ? 20  LYS A HZ2  17 
ATOM   10078 H  HZ3  . LYS A 1 20 ? -1.867  0.254   10.000  1.00 0.00 ? 20  LYS A HZ3  17 
ATOM   10079 N  N    . ALA A 1 21 ? -0.946  -4.150  6.369   1.00 0.00 ? 21  ALA A N    17 
ATOM   10080 C  CA   . ALA A 1 21 ? -2.354  -4.352  6.052   1.00 0.00 ? 21  ALA A CA   17 
ATOM   10081 C  C    . ALA A 1 21 ? -3.195  -3.164  6.507   1.00 0.00 ? 21  ALA A C    17 
ATOM   10082 O  O    . ALA A 1 21 ? -2.892  -2.527  7.517   1.00 0.00 ? 21  ALA A O    17 
ATOM   10083 C  CB   . ALA A 1 21 ? -2.861  -5.636  6.692   1.00 0.00 ? 21  ALA A CB   17 
ATOM   10084 H  H    . ALA A 1 21 ? -0.601  -4.462  7.231   1.00 0.00 ? 21  ALA A H    17 
ATOM   10085 H  HA   . ALA A 1 21 ? -2.444  -4.453  4.980   1.00 0.00 ? 21  ALA A HA   17 
ATOM   10086 H  HB1  . ALA A 1 21 ? -3.404  -6.213  5.959   1.00 0.00 ? 21  ALA A HB1  17 
ATOM   10087 H  HB2  . ALA A 1 21 ? -2.022  -6.211  7.055   1.00 0.00 ? 21  ALA A HB2  17 
ATOM   10088 H  HB3  . ALA A 1 21 ? -3.515  -5.393  7.517   1.00 0.00 ? 21  ALA A HB3  17 
ATOM   10089 N  N    . PHE A 1 22 ? -4.251  -2.870  5.756   1.00 0.00 ? 22  PHE A N    17 
ATOM   10090 C  CA   . PHE A 1 22 ? -5.135  -1.757  6.082   1.00 0.00 ? 22  PHE A CA   17 
ATOM   10091 C  C    . PHE A 1 22 ? -6.598  -2.170  5.958   1.00 0.00 ? 22  PHE A C    17 
ATOM   10092 O  O    . PHE A 1 22 ? -6.907  -3.336  5.713   1.00 0.00 ? 22  PHE A O    17 
ATOM   10093 C  CB   . PHE A 1 22 ? -4.849  -0.566  5.165   1.00 0.00 ? 22  PHE A CB   17 
ATOM   10094 C  CG   . PHE A 1 22 ? -3.417  -0.115  5.195   1.00 0.00 ? 22  PHE A CG   17 
ATOM   10095 C  CD1  . PHE A 1 22 ? -2.440  -0.821  4.511   1.00 0.00 ? 22  PHE A CD1  17 
ATOM   10096 C  CD2  . PHE A 1 22 ? -3.047  1.014   5.908   1.00 0.00 ? 22  PHE A CD2  17 
ATOM   10097 C  CE1  . PHE A 1 22 ? -1.121  -0.410  4.536   1.00 0.00 ? 22  PHE A CE1  17 
ATOM   10098 C  CE2  . PHE A 1 22 ? -1.729  1.431   5.936   1.00 0.00 ? 22  PHE A CE2  17 
ATOM   10099 C  CZ   . PHE A 1 22 ? -0.765  0.717   5.251   1.00 0.00 ? 22  PHE A CZ   17 
ATOM   10100 H  H    . PHE A 1 22 ? -4.440  -3.415  4.964   1.00 0.00 ? 22  PHE A H    17 
ATOM   10101 H  HA   . PHE A 1 22 ? -4.940  -1.468  7.104   1.00 0.00 ? 22  PHE A HA   17 
ATOM   10102 H  HB2  . PHE A 1 22 ? -5.090  -0.838  4.148   1.00 0.00 ? 22  PHE A HB2  17 
ATOM   10103 H  HB3  . PHE A 1 22 ? -5.467  0.267   5.466   1.00 0.00 ? 22  PHE A HB3  17 
ATOM   10104 H  HD1  . PHE A 1 22 ? -2.718  -1.704  3.952   1.00 0.00 ? 22  PHE A HD1  17 
ATOM   10105 H  HD2  . PHE A 1 22 ? -3.799  1.572   6.445   1.00 0.00 ? 22  PHE A HD2  17 
ATOM   10106 H  HE1  . PHE A 1 22 ? -0.370  -0.970  3.999   1.00 0.00 ? 22  PHE A HE1  17 
ATOM   10107 H  HE2  . PHE A 1 22 ? -1.454  2.312   6.496   1.00 0.00 ? 22  PHE A HE2  17 
ATOM   10108 H  HZ   . PHE A 1 22 ? 0.265   1.041   5.271   1.00 0.00 ? 22  PHE A HZ   17 
ATOM   10109 N  N    . ARG A 1 23 ? -7.496  -1.204  6.129   1.00 0.00 ? 23  ARG A N    17 
ATOM   10110 C  CA   . ARG A 1 23 ? -8.927  -1.467  6.039   1.00 0.00 ? 23  ARG A CA   17 
ATOM   10111 C  C    . ARG A 1 23 ? -9.495  -0.935  4.726   1.00 0.00 ? 23  ARG A C    17 
ATOM   10112 O  O    . ARG A 1 23 ? -10.436 -1.502  4.170   1.00 0.00 ? 23  ARG A O    17 
ATOM   10113 C  CB   . ARG A 1 23 ? -9.660  -0.829  7.220   1.00 0.00 ? 23  ARG A CB   17 
ATOM   10114 C  CG   . ARG A 1 23 ? -9.603  0.690   7.223   1.00 0.00 ? 23  ARG A CG   17 
ATOM   10115 C  CD   . ARG A 1 23 ? -10.830 1.292   7.891   1.00 0.00 ? 23  ARG A CD   17 
ATOM   10116 N  NE   . ARG A 1 23 ? -10.651 1.442   9.332   1.00 0.00 ? 23  ARG A NE   17 
ATOM   10117 C  CZ   . ARG A 1 23 ? -11.654 1.636   10.181  1.00 0.00 ? 23  ARG A CZ   17 
ATOM   10118 N  NH1  . ARG A 1 23 ? -12.900 1.704   9.735   1.00 0.00 ? 23  ARG A NH1  17 
ATOM   10119 N  NH2  . ARG A 1 23 ? -11.410 1.763   11.479  1.00 0.00 ? 23  ARG A NH2  17 
ATOM   10120 H  H    . ARG A 1 23 ? -7.188  -0.294  6.322   1.00 0.00 ? 23  ARG A H    17 
ATOM   10121 H  HA   . ARG A 1 23 ? -9.071  -2.537  6.072   1.00 0.00 ? 23  ARG A HA   17 
ATOM   10122 H  HB2  . ARG A 1 23 ? -10.698 -1.128  7.189   1.00 0.00 ? 23  ARG A HB2  17 
ATOM   10123 H  HB3  . ARG A 1 23 ? -9.218  -1.186  8.138   1.00 0.00 ? 23  ARG A HB3  17 
ATOM   10124 H  HG2  . ARG A 1 23 ? -8.722  1.007   7.762   1.00 0.00 ? 23  ARG A HG2  17 
ATOM   10125 H  HG3  . ARG A 1 23 ? -9.550  1.041   6.204   1.00 0.00 ? 23  ARG A HG3  17 
ATOM   10126 H  HD2  . ARG A 1 23 ? -11.018 2.263   7.458   1.00 0.00 ? 23  ARG A HD2  17 
ATOM   10127 H  HD3  . ARG A 1 23 ? -11.676 0.646   7.707   1.00 0.00 ? 23  ARG A HD3  17 
ATOM   10128 H  HE   . ARG A 1 23 ? -9.737  1.395   9.683   1.00 0.00 ? 23  ARG A HE   17 
ATOM   10129 H  HH11 . ARG A 1 23 ? -13.087 1.608   8.758   1.00 0.00 ? 23  ARG A HH11 17 
ATOM   10130 H  HH12 . ARG A 1 23 ? -13.654 1.850   10.377  1.00 0.00 ? 23  ARG A HH12 17 
ATOM   10131 H  HH21 . ARG A 1 23 ? -10.472 1.713   11.819  1.00 0.00 ? 23  ARG A HH21 17 
ATOM   10132 H  HH22 . ARG A 1 23 ? -12.166 1.910   12.117  1.00 0.00 ? 23  ARG A HH22 17 
ATOM   10133 N  N    . SER A 1 24 ? -8.917  0.157   4.236   1.00 0.00 ? 24  SER A N    17 
ATOM   10134 C  CA   . SER A 1 24 ? -9.369  0.768   2.992   1.00 0.00 ? 24  SER A CA   17 
ATOM   10135 C  C    . SER A 1 24 ? -8.199  0.980   2.035   1.00 0.00 ? 24  SER A C    17 
ATOM   10136 O  O    . SER A 1 24 ? -7.043  1.045   2.454   1.00 0.00 ? 24  SER A O    17 
ATOM   10137 C  CB   . SER A 1 24 ? -10.058 2.104   3.275   1.00 0.00 ? 24  SER A CB   17 
ATOM   10138 O  OG   . SER A 1 24 ? -11.176 1.930   4.130   1.00 0.00 ? 24  SER A OG   17 
ATOM   10139 H  H    . SER A 1 24 ? -8.171  0.563   4.726   1.00 0.00 ? 24  SER A H    17 
ATOM   10140 H  HA   . SER A 1 24 ? -10.078 0.097   2.531   1.00 0.00 ? 24  SER A HA   17 
ATOM   10141 H  HB2  . SER A 1 24 ? -9.358  2.774   3.751   1.00 0.00 ? 24  SER A HB2  17 
ATOM   10142 H  HB3  . SER A 1 24 ? -10.396 2.536   2.345   1.00 0.00 ? 24  SER A HB3  17 
ATOM   10143 H  HG   . SER A 1 24 ? -10.954 2.234   5.013   1.00 0.00 ? 24  SER A HG   17 
ATOM   10144 N  N    . LYS A 1 25 ? -8.508  1.087   0.747   1.00 0.00 ? 25  LYS A N    17 
ATOM   10145 C  CA   . LYS A 1 25 ? -7.485  1.292   -0.271  1.00 0.00 ? 25  LYS A CA   17 
ATOM   10146 C  C    . LYS A 1 25 ? -6.858  2.677   -0.141  1.00 0.00 ? 25  LYS A C    17 
ATOM   10147 O  O    . LYS A 1 25 ? -5.687  2.871   -0.466  1.00 0.00 ? 25  LYS A O    17 
ATOM   10148 C  CB   . LYS A 1 25 ? -8.086  1.122   -1.668  1.00 0.00 ? 25  LYS A CB   17 
ATOM   10149 C  CG   . LYS A 1 25 ? -7.093  0.613   -2.699  1.00 0.00 ? 25  LYS A CG   17 
ATOM   10150 C  CD   . LYS A 1 25 ? -7.791  -0.132  -3.825  1.00 0.00 ? 25  LYS A CD   17 
ATOM   10151 C  CE   . LYS A 1 25 ? -8.276  0.821   -4.907  1.00 0.00 ? 25  LYS A CE   17 
ATOM   10152 N  NZ   . LYS A 1 25 ? -7.145  1.408   -5.677  1.00 0.00 ? 25  LYS A NZ   17 
ATOM   10153 H  H    . LYS A 1 25 ? -9.448  1.026   0.475   1.00 0.00 ? 25  LYS A H    17 
ATOM   10154 H  HA   . LYS A 1 25 ? -6.718  0.547   -0.125  1.00 0.00 ? 25  LYS A HA   17 
ATOM   10155 H  HB2  . LYS A 1 25 ? -8.906  0.421   -1.612  1.00 0.00 ? 25  LYS A HB2  17 
ATOM   10156 H  HB3  . LYS A 1 25 ? -8.463  2.078   -2.004  1.00 0.00 ? 25  LYS A HB3  17 
ATOM   10157 H  HG2  . LYS A 1 25 ? -6.558  1.454   -3.116  1.00 0.00 ? 25  LYS A HG2  17 
ATOM   10158 H  HG3  . LYS A 1 25 ? -6.396  -0.056  -2.215  1.00 0.00 ? 25  LYS A HG3  17 
ATOM   10159 H  HD2  . LYS A 1 25 ? -7.098  -0.834  -4.264  1.00 0.00 ? 25  LYS A HD2  17 
ATOM   10160 H  HD3  . LYS A 1 25 ? -8.640  -0.665  -3.420  1.00 0.00 ? 25  LYS A HD3  17 
ATOM   10161 H  HE2  . LYS A 1 25 ? -8.918  0.278   -5.584  1.00 0.00 ? 25  LYS A HE2  17 
ATOM   10162 H  HE3  . LYS A 1 25 ? -8.836  1.618   -4.441  1.00 0.00 ? 25  LYS A HE3  17 
ATOM   10163 H  HZ1  . LYS A 1 25 ? -6.715  2.189   -5.141  1.00 0.00 ? 25  LYS A HZ1  17 
ATOM   10164 H  HZ2  . LYS A 1 25 ? -7.485  1.773   -6.589  1.00 0.00 ? 25  LYS A HZ2  17 
ATOM   10165 H  HZ3  . LYS A 1 25 ? -6.420  0.684   -5.855  1.00 0.00 ? 25  LYS A HZ3  17 
ATOM   10166 N  N    . SER A 1 26 ? -7.645  3.635   0.338   1.00 0.00 ? 26  SER A N    17 
ATOM   10167 C  CA   . SER A 1 26 ? -7.167  5.002   0.509   1.00 0.00 ? 26  SER A CA   17 
ATOM   10168 C  C    . SER A 1 26 ? -6.131  5.079   1.627   1.00 0.00 ? 26  SER A C    17 
ATOM   10169 O  O    . SER A 1 26 ? -5.293  5.981   1.650   1.00 0.00 ? 26  SER A O    17 
ATOM   10170 C  CB   . SER A 1 26 ? -8.337  5.939   0.818   1.00 0.00 ? 26  SER A CB   17 
ATOM   10171 O  OG   . SER A 1 26 ? -7.883  7.258   1.063   1.00 0.00 ? 26  SER A OG   17 
ATOM   10172 H  H    . SER A 1 26 ? -8.570  3.417   0.580   1.00 0.00 ? 26  SER A H    17 
ATOM   10173 H  HA   . SER A 1 26 ? -6.705  5.310   -0.416  1.00 0.00 ? 26  SER A HA   17 
ATOM   10174 H  HB2  . SER A 1 26 ? -9.013  5.955   -0.023  1.00 0.00 ? 26  SER A HB2  17 
ATOM   10175 H  HB3  . SER A 1 26 ? -8.859  5.582   1.693   1.00 0.00 ? 26  SER A HB3  17 
ATOM   10176 H  HG   . SER A 1 26 ? -7.084  7.228   1.595   1.00 0.00 ? 26  SER A HG   17 
ATOM   10177 N  N    . TYR A 1 27 ? -6.195  4.128   2.551   1.00 0.00 ? 27  TYR A N    17 
ATOM   10178 C  CA   . TYR A 1 27 ? -5.265  4.088   3.673   1.00 0.00 ? 27  TYR A CA   17 
ATOM   10179 C  C    . TYR A 1 27 ? -3.920  3.509   3.245   1.00 0.00 ? 27  TYR A C    17 
ATOM   10180 O  O    . TYR A 1 27 ? -2.868  3.917   3.741   1.00 0.00 ? 27  TYR A O    17 
ATOM   10181 C  CB   . TYR A 1 27 ? -5.849  3.259   4.818   1.00 0.00 ? 27  TYR A CB   17 
ATOM   10182 C  CG   . TYR A 1 27 ? -5.463  3.765   6.190   1.00 0.00 ? 27  TYR A CG   17 
ATOM   10183 C  CD1  . TYR A 1 27 ? -4.128  3.884   6.558   1.00 0.00 ? 27  TYR A CD1  17 
ATOM   10184 C  CD2  . TYR A 1 27 ? -6.433  4.123   7.118   1.00 0.00 ? 27  TYR A CD2  17 
ATOM   10185 C  CE1  . TYR A 1 27 ? -3.771  4.345   7.810   1.00 0.00 ? 27  TYR A CE1  17 
ATOM   10186 C  CE2  . TYR A 1 27 ? -6.084  4.586   8.372   1.00 0.00 ? 27  TYR A CE2  17 
ATOM   10187 C  CZ   . TYR A 1 27 ? -4.752  4.695   8.713   1.00 0.00 ? 27  TYR A CZ   17 
ATOM   10188 O  OH   . TYR A 1 27 ? -4.402  5.155   9.962   1.00 0.00 ? 27  TYR A OH   17 
ATOM   10189 H  H    . TYR A 1 27 ? -6.885  3.436   2.478   1.00 0.00 ? 27  TYR A H    17 
ATOM   10190 H  HA   . TYR A 1 27 ? -5.115  5.102   4.015   1.00 0.00 ? 27  TYR A HA   17 
ATOM   10191 H  HB2  . TYR A 1 27 ? -6.926  3.274   4.751   1.00 0.00 ? 27  TYR A HB2  17 
ATOM   10192 H  HB3  . TYR A 1 27 ? -5.501  2.240   4.730   1.00 0.00 ? 27  TYR A HB3  17 
ATOM   10193 H  HD1  . TYR A 1 27 ? -3.362  3.609   5.848   1.00 0.00 ? 27  TYR A HD1  17 
ATOM   10194 H  HD2  . TYR A 1 27 ? -7.475  4.036   6.848   1.00 0.00 ? 27  TYR A HD2  17 
ATOM   10195 H  HE1  . TYR A 1 27 ? -2.728  4.431   8.078   1.00 0.00 ? 27  TYR A HE1  17 
ATOM   10196 H  HE2  . TYR A 1 27 ? -6.853  4.860   9.080   1.00 0.00 ? 27  TYR A HE2  17 
ATOM   10197 H  HH   . TYR A 1 27 ? -4.543  6.103   10.005  1.00 0.00 ? 27  TYR A HH   17 
ATOM   10198 N  N    . LEU A 1 28 ? -3.961  2.555   2.322   1.00 0.00 ? 28  LEU A N    17 
ATOM   10199 C  CA   . LEU A 1 28 ? -2.746  1.918   1.825   1.00 0.00 ? 28  LEU A CA   17 
ATOM   10200 C  C    . LEU A 1 28 ? -2.028  2.820   0.826   1.00 0.00 ? 28  LEU A C    17 
ATOM   10201 O  O    . LEU A 1 28 ? -0.800  2.911   0.829   1.00 0.00 ? 28  LEU A O    17 
ATOM   10202 C  CB   . LEU A 1 28 ? -3.081  0.577   1.170   1.00 0.00 ? 28  LEU A CB   17 
ATOM   10203 C  CG   . LEU A 1 28 ? -1.989  -0.032  0.290   1.00 0.00 ? 28  LEU A CG   17 
ATOM   10204 C  CD1  . LEU A 1 28 ? -0.864  -0.592  1.147   1.00 0.00 ? 28  LEU A CD1  17 
ATOM   10205 C  CD2  . LEU A 1 28 ? -2.568  -1.116  -0.607  1.00 0.00 ? 28  LEU A CD2  17 
ATOM   10206 H  H    . LEU A 1 28 ? -4.828  2.272   1.965   1.00 0.00 ? 28  LEU A H    17 
ATOM   10207 H  HA   . LEU A 1 28 ? -2.094  1.745   2.668   1.00 0.00 ? 28  LEU A HA   17 
ATOM   10208 H  HB2  . LEU A 1 28 ? -3.304  -0.128  1.956   1.00 0.00 ? 28  LEU A HB2  17 
ATOM   10209 H  HB3  . LEU A 1 28 ? -3.960  0.720   0.557   1.00 0.00 ? 28  LEU A HB3  17 
ATOM   10210 H  HG   . LEU A 1 28 ? -1.573  0.740   -0.343  1.00 0.00 ? 28  LEU A HG   17 
ATOM   10211 H  HD11 . LEU A 1 28 ? -1.114  -0.474  2.191   1.00 0.00 ? 28  LEU A HD11 17 
ATOM   10212 H  HD12 . LEU A 1 28 ? 0.051   -0.059  0.934   1.00 0.00 ? 28  LEU A HD12 17 
ATOM   10213 H  HD13 . LEU A 1 28 ? -0.729  -1.640  0.924   1.00 0.00 ? 28  LEU A HD13 17 
ATOM   10214 H  HD21 . LEU A 1 28 ? -2.314  -2.087  -0.208  1.00 0.00 ? 28  LEU A HD21 17 
ATOM   10215 H  HD22 . LEU A 1 28 ? -2.160  -1.016  -1.601  1.00 0.00 ? 28  LEU A HD22 17 
ATOM   10216 H  HD23 . LEU A 1 28 ? -3.643  -1.013  -0.647  1.00 0.00 ? 28  LEU A HD23 17 
ATOM   10217 N  N    . ILE A 1 29 ? -2.802  3.485   -0.025  1.00 0.00 ? 29  ILE A N    17 
ATOM   10218 C  CA   . ILE A 1 29 ? -2.240  4.382   -1.027  1.00 0.00 ? 29  ILE A CA   17 
ATOM   10219 C  C    . ILE A 1 29 ? -1.431  5.498   -0.374  1.00 0.00 ? 29  ILE A C    17 
ATOM   10220 O  O    . ILE A 1 29 ? -0.322  5.809   -0.808  1.00 0.00 ? 29  ILE A O    17 
ATOM   10221 C  CB   . ILE A 1 29 ? -3.340  5.006   -1.905  1.00 0.00 ? 29  ILE A CB   17 
ATOM   10222 C  CG1  . ILE A 1 29 ? -4.117  3.913   -2.642  1.00 0.00 ? 29  ILE A CG1  17 
ATOM   10223 C  CG2  . ILE A 1 29 ? -2.734  5.991   -2.894  1.00 0.00 ? 29  ILE A CG2  17 
ATOM   10224 C  CD1  . ILE A 1 29 ? -5.542  4.301   -2.970  1.00 0.00 ? 29  ILE A CD1  17 
ATOM   10225 H  H    . ILE A 1 29 ? -3.774  3.370   0.022   1.00 0.00 ? 29  ILE A H    17 
ATOM   10226 H  HA   . ILE A 1 29 ? -1.585  3.802   -1.663  1.00 0.00 ? 29  ILE A HA   17 
ATOM   10227 H  HB   . ILE A 1 29 ? -4.017  5.548   -1.263  1.00 0.00 ? 29  ILE A HB   17 
ATOM   10228 H  HG12 . ILE A 1 29 ? -3.614  3.685   -3.568  1.00 0.00 ? 29  ILE A HG12 17 
ATOM   10229 H  HG13 . ILE A 1 29 ? -4.147  3.026   -2.026  1.00 0.00 ? 29  ILE A HG13 17 
ATOM   10230 H  HG21 . ILE A 1 29 ? -2.648  5.521   -3.862  1.00 0.00 ? 29  ILE A HG21 17 
ATOM   10231 H  HG22 . ILE A 1 29 ? -3.371  6.860   -2.972  1.00 0.00 ? 29  ILE A HG22 17 
ATOM   10232 H  HG23 . ILE A 1 29 ? -1.756  6.291   -2.550  1.00 0.00 ? 29  ILE A HG23 17 
ATOM   10233 H  HD11 . ILE A 1 29 ? -5.551  5.277   -3.434  1.00 0.00 ? 29  ILE A HD11 17 
ATOM   10234 H  HD12 . ILE A 1 29 ? -5.965  3.577   -3.650  1.00 0.00 ? 29  ILE A HD12 17 
ATOM   10235 H  HD13 . ILE A 1 29 ? -6.126  4.329   -2.063  1.00 0.00 ? 29  ILE A HD13 17 
ATOM   10236 N  N    . ILE A 1 30 ? -1.994  6.094   0.671   1.00 0.00 ? 30  ILE A N    17 
ATOM   10237 C  CA   . ILE A 1 30 ? -1.324  7.174   1.386   1.00 0.00 ? 30  ILE A CA   17 
ATOM   10238 C  C    . ILE A 1 30 ? -0.114  6.655   2.156   1.00 0.00 ? 30  ILE A C    17 
ATOM   10239 O  O    . ILE A 1 30 ? 0.706   7.434   2.643   1.00 0.00 ? 30  ILE A O    17 
ATOM   10240 C  CB   . ILE A 1 30 ? -2.280  7.877   2.367   1.00 0.00 ? 30  ILE A CB   17 
ATOM   10241 C  CG1  . ILE A 1 30 ? -2.833  6.875   3.382   1.00 0.00 ? 30  ILE A CG1  17 
ATOM   10242 C  CG2  . ILE A 1 30 ? -3.414  8.552   1.610   1.00 0.00 ? 30  ILE A CG2  17 
ATOM   10243 C  CD1  . ILE A 1 30 ? -1.898  6.611   4.542   1.00 0.00 ? 30  ILE A CD1  17 
ATOM   10244 H  H    . ILE A 1 30 ? -2.880  5.801   0.969   1.00 0.00 ? 30  ILE A H    17 
ATOM   10245 H  HA   . ILE A 1 30 ? -0.990  7.899   0.657   1.00 0.00 ? 30  ILE A HA   17 
ATOM   10246 H  HB   . ILE A 1 30 ? -1.725  8.640   2.891   1.00 0.00 ? 30  ILE A HB   17 
ATOM   10247 H  HG12 . ILE A 1 30 ? -3.760  7.252   3.783   1.00 0.00 ? 30  ILE A HG12 17 
ATOM   10248 H  HG13 . ILE A 1 30 ? -3.017  5.934   2.883   1.00 0.00 ? 30  ILE A HG13 17 
ATOM   10249 H  HG21 . ILE A 1 30 ? -3.140  8.656   0.570   1.00 0.00 ? 30  ILE A HG21 17 
ATOM   10250 H  HG22 . ILE A 1 30 ? -4.306  7.950   1.688   1.00 0.00 ? 30  ILE A HG22 17 
ATOM   10251 H  HG23 . ILE A 1 30 ? -3.599  9.528   2.033   1.00 0.00 ? 30  ILE A HG23 17 
ATOM   10252 H  HD11 . ILE A 1 30 ? -1.386  7.526   4.806   1.00 0.00 ? 30  ILE A HD11 17 
ATOM   10253 H  HD12 . ILE A 1 30 ? -2.466  6.260   5.390   1.00 0.00 ? 30  ILE A HD12 17 
ATOM   10254 H  HD13 . ILE A 1 30 ? -1.173  5.863   4.258   1.00 0.00 ? 30  ILE A HD13 17 
ATOM   10255 N  N    . HIS A 1 31 ? -0.008  5.334   2.260   1.00 0.00 ? 31  HIS A N    17 
ATOM   10256 C  CA   . HIS A 1 31 ? 1.104   4.711   2.969   1.00 0.00 ? 31  HIS A CA   17 
ATOM   10257 C  C    . HIS A 1 31 ? 2.231   4.352   2.004   1.00 0.00 ? 31  HIS A C    17 
ATOM   10258 O  O    . HIS A 1 31 ? 3.396   4.669   2.247   1.00 0.00 ? 31  HIS A O    17 
ATOM   10259 C  CB   . HIS A 1 31 ? 0.629   3.458   3.705   1.00 0.00 ? 31  HIS A CB   17 
ATOM   10260 C  CG   . HIS A 1 31 ? 1.715   2.455   3.943   1.00 0.00 ? 31  HIS A CG   17 
ATOM   10261 N  ND1  . HIS A 1 31 ? 2.247   2.203   5.190   1.00 0.00 ? 31  HIS A ND1  17 
ATOM   10262 C  CD2  . HIS A 1 31 ? 2.368   1.636   3.085   1.00 0.00 ? 31  HIS A CD2  17 
ATOM   10263 C  CE1  . HIS A 1 31 ? 3.182   1.275   5.088   1.00 0.00 ? 31  HIS A CE1  17 
ATOM   10264 N  NE2  . HIS A 1 31 ? 3.274   0.914   3.821   1.00 0.00 ? 31  HIS A NE2  17 
ATOM   10265 H  H    . HIS A 1 31 ? -0.693  4.766   1.851   1.00 0.00 ? 31  HIS A H    17 
ATOM   10266 H  HA   . HIS A 1 31 ? 1.478   5.422   3.690   1.00 0.00 ? 31  HIS A HA   17 
ATOM   10267 H  HB2  . HIS A 1 31 ? 0.226   3.744   4.666   1.00 0.00 ? 31  HIS A HB2  17 
ATOM   10268 H  HB3  . HIS A 1 31 ? -0.145  2.978   3.124   1.00 0.00 ? 31  HIS A HB3  17 
ATOM   10269 H  HD1  . HIS A 1 31 ? 1.981   2.641   6.025   1.00 0.00 ? 31  HIS A HD1  17 
ATOM   10270 H  HD2  . HIS A 1 31 ? 2.207   1.565   2.018   1.00 0.00 ? 31  HIS A HD2  17 
ATOM   10271 H  HE1  . HIS A 1 31 ? 3.770   0.878   5.902   1.00 0.00 ? 31  HIS A HE1  17 
ATOM   10272 N  N    . THR A 1 32 ? 1.876   3.688   0.909   1.00 0.00 ? 32  THR A N    17 
ATOM   10273 C  CA   . THR A 1 32 ? 2.856   3.284   -0.091  1.00 0.00 ? 32  THR A CA   17 
ATOM   10274 C  C    . THR A 1 32 ? 3.758   4.450   -0.479  1.00 0.00 ? 32  THR A C    17 
ATOM   10275 O  O    . THR A 1 32 ? 4.855   4.251   -1.003  1.00 0.00 ? 32  THR A O    17 
ATOM   10276 C  CB   . THR A 1 32 ? 2.173   2.735   -1.358  1.00 0.00 ? 32  THR A CB   17 
ATOM   10277 O  OG1  . THR A 1 32 ? 1.340   1.620   -1.021  1.00 0.00 ? 32  THR A OG1  17 
ATOM   10278 C  CG2  . THR A 1 32 ? 3.208   2.308   -2.389  1.00 0.00 ? 32  THR A CG2  17 
ATOM   10279 H  H    . THR A 1 32 ? 0.932   3.464   0.771   1.00 0.00 ? 32  THR A H    17 
ATOM   10280 H  HA   . THR A 1 32 ? 3.463   2.498   0.335   1.00 0.00 ? 32  THR A HA   17 
ATOM   10281 H  HB   . THR A 1 32 ? 1.561   3.516   -1.786  1.00 0.00 ? 32  THR A HB   17 
ATOM   10282 H  HG1  . THR A 1 32 ? 1.093   1.673   -0.095  1.00 0.00 ? 32  THR A HG1  17 
ATOM   10283 H  HG21 . THR A 1 32 ? 4.083   1.930   -1.884  1.00 0.00 ? 32  THR A HG21 17 
ATOM   10284 H  HG22 . THR A 1 32 ? 3.482   3.158   -2.996  1.00 0.00 ? 32  THR A HG22 17 
ATOM   10285 H  HG23 . THR A 1 32 ? 2.792   1.535   -3.017  1.00 0.00 ? 32  THR A HG23 17 
ATOM   10286 N  N    . ARG A 1 33 ? 3.290   5.666   -0.218  1.00 0.00 ? 33  ARG A N    17 
ATOM   10287 C  CA   . ARG A 1 33 ? 4.056   6.864   -0.541  1.00 0.00 ? 33  ARG A CA   17 
ATOM   10288 C  C    . ARG A 1 33 ? 5.064   7.179   0.560   1.00 0.00 ? 33  ARG A C    17 
ATOM   10289 O  O    . ARG A 1 33 ? 6.131   7.735   0.300   1.00 0.00 ? 33  ARG A O    17 
ATOM   10290 C  CB   . ARG A 1 33 ? 3.117   8.056   -0.743  1.00 0.00 ? 33  ARG A CB   17 
ATOM   10291 C  CG   . ARG A 1 33 ? 2.266   8.373   0.476   1.00 0.00 ? 33  ARG A CG   17 
ATOM   10292 C  CD   . ARG A 1 33 ? 1.558   9.711   0.327   1.00 0.00 ? 33  ARG A CD   17 
ATOM   10293 N  NE   . ARG A 1 33 ? 2.440   10.834  0.634   1.00 0.00 ? 33  ARG A NE   17 
ATOM   10294 C  CZ   . ARG A 1 33 ? 2.648   11.291  1.863   1.00 0.00 ? 33  ARG A CZ   17 
ATOM   10295 N  NH1  . ARG A 1 33 ? 2.040   10.724  2.896   1.00 0.00 ? 33  ARG A NH1  17 
ATOM   10296 N  NH2  . ARG A 1 33 ? 3.465   12.317  2.062   1.00 0.00 ? 33  ARG A NH2  17 
ATOM   10297 H  H    . ARG A 1 33 ? 2.409   5.760   0.200   1.00 0.00 ? 33  ARG A H    17 
ATOM   10298 H  HA   . ARG A 1 33 ? 4.590   6.679   -1.460  1.00 0.00 ? 33  ARG A HA   17 
ATOM   10299 H  HB2  . ARG A 1 33 ? 3.708   8.929   -0.979  1.00 0.00 ? 33  ARG A HB2  17 
ATOM   10300 H  HB3  . ARG A 1 33 ? 2.457   7.842   -1.570  1.00 0.00 ? 33  ARG A HB3  17 
ATOM   10301 H  HG2  . ARG A 1 33 ? 1.524   7.598   0.597   1.00 0.00 ? 33  ARG A HG2  17 
ATOM   10302 H  HG3  . ARG A 1 33 ? 2.901   8.406   1.348   1.00 0.00 ? 33  ARG A HG3  17 
ATOM   10303 H  HD2  . ARG A 1 33 ? 1.208   9.807   -0.690  1.00 0.00 ? 33  ARG A HD2  17 
ATOM   10304 H  HD3  . ARG A 1 33 ? 0.714   9.733   1.001   1.00 0.00 ? 33  ARG A HD3  17 
ATOM   10305 H  HE   . ARG A 1 33 ? 2.899   11.268  -0.115  1.00 0.00 ? 33  ARG A HE   17 
ATOM   10306 H  HH11 . ARG A 1 33 ? 1.425   9.950   2.750   1.00 0.00 ? 33  ARG A HH11 17 
ATOM   10307 H  HH12 . ARG A 1 33 ? 2.200   11.069  3.822   1.00 0.00 ? 33  ARG A HH12 17 
ATOM   10308 H  HH21 . ARG A 1 33 ? 3.925   12.747  1.285   1.00 0.00 ? 33  ARG A HH21 17 
ATOM   10309 H  HH22 . ARG A 1 33 ? 3.621   12.661  2.987   1.00 0.00 ? 33  ARG A HH22 17 
ATOM   10310 N  N    . THR A 1 34 ? 4.719   6.818   1.793   1.00 0.00 ? 34  THR A N    17 
ATOM   10311 C  CA   . THR A 1 34 ? 5.592   7.062   2.933   1.00 0.00 ? 34  THR A CA   17 
ATOM   10312 C  C    . THR A 1 34 ? 6.937   6.367   2.756   1.00 0.00 ? 34  THR A C    17 
ATOM   10313 O  O    . THR A 1 34 ? 7.959   6.833   3.259   1.00 0.00 ? 34  THR A O    17 
ATOM   10314 C  CB   . THR A 1 34 ? 4.948   6.581   4.247   1.00 0.00 ? 34  THR A CB   17 
ATOM   10315 O  OG1  . THR A 1 34 ? 5.538   7.261   5.360   1.00 0.00 ? 34  THR A OG1  17 
ATOM   10316 C  CG2  . THR A 1 34 ? 5.119   5.079   4.416   1.00 0.00 ? 34  THR A CG2  17 
ATOM   10317 H  H    . THR A 1 34 ? 3.855   6.378   1.936   1.00 0.00 ? 34  THR A H    17 
ATOM   10318 H  HA   . THR A 1 34 ? 5.755   8.128   3.006   1.00 0.00 ? 34  THR A HA   17 
ATOM   10319 H  HB   . THR A 1 34 ? 3.891   6.807   4.216   1.00 0.00 ? 34  THR A HB   17 
ATOM   10320 H  HG1  . THR A 1 34 ? 5.900   8.101   5.067   1.00 0.00 ? 34  THR A HG1  17 
ATOM   10321 H  HG21 . THR A 1 34 ? 5.995   4.882   5.016   1.00 0.00 ? 34  THR A HG21 17 
ATOM   10322 H  HG22 . THR A 1 34 ? 5.237   4.619   3.446   1.00 0.00 ? 34  THR A HG22 17 
ATOM   10323 H  HG23 . THR A 1 34 ? 4.248   4.670   4.904   1.00 0.00 ? 34  THR A HG23 17 
ATOM   10324 N  N    . HIS A 1 35 ? 6.929   5.249   2.036   1.00 0.00 ? 35  HIS A N    17 
ATOM   10325 C  CA   . HIS A 1 35 ? 8.150   4.490   1.790   1.00 0.00 ? 35  HIS A CA   17 
ATOM   10326 C  C    . HIS A 1 35 ? 9.228   5.378   1.177   1.00 0.00 ? 35  HIS A C    17 
ATOM   10327 O  O    . HIS A 1 35 ? 10.403  5.012   1.140   1.00 0.00 ? 35  HIS A O    17 
ATOM   10328 C  CB   . HIS A 1 35 ? 7.862   3.306   0.867   1.00 0.00 ? 35  HIS A CB   17 
ATOM   10329 C  CG   . HIS A 1 35 ? 7.328   2.104   1.584   1.00 0.00 ? 35  HIS A CG   17 
ATOM   10330 N  ND1  . HIS A 1 35 ? 8.132   1.214   2.264   1.00 0.00 ? 35  HIS A ND1  17 
ATOM   10331 C  CD2  . HIS A 1 35 ? 6.061   1.647   1.725   1.00 0.00 ? 35  HIS A CD2  17 
ATOM   10332 C  CE1  . HIS A 1 35 ? 7.384   0.262   2.791   1.00 0.00 ? 35  HIS A CE1  17 
ATOM   10333 N  NE2  . HIS A 1 35 ? 6.123   0.502   2.479   1.00 0.00 ? 35  HIS A NE2  17 
ATOM   10334 H  H    . HIS A 1 35 ? 6.083   4.929   1.661   1.00 0.00 ? 35  HIS A H    17 
ATOM   10335 H  HA   . HIS A 1 35 ? 8.505   4.118   2.739   1.00 0.00 ? 35  HIS A HA   17 
ATOM   10336 H  HB2  . HIS A 1 35 ? 7.132   3.603   0.129   1.00 0.00 ? 35  HIS A HB2  17 
ATOM   10337 H  HB3  . HIS A 1 35 ? 8.775   3.016   0.367   1.00 0.00 ? 35  HIS A HB3  17 
ATOM   10338 H  HD1  . HIS A 1 35 ? 9.107   1.272   2.347   1.00 0.00 ? 35  HIS A HD1  17 
ATOM   10339 H  HD2  . HIS A 1 35 ? 5.167   2.100   1.319   1.00 0.00 ? 35  HIS A HD2  17 
ATOM   10340 H  HE1  . HIS A 1 35 ? 7.741   -0.571  3.378   1.00 0.00 ? 35  HIS A HE1  17 
ATOM   10341 N  N    . THR A 1 36 ? 8.821   6.548   0.694   1.00 0.00 ? 36  THR A N    17 
ATOM   10342 C  CA   . THR A 1 36 ? 9.751   7.487   0.080   1.00 0.00 ? 36  THR A CA   17 
ATOM   10343 C  C    . THR A 1 36 ? 10.463  8.325   1.136   1.00 0.00 ? 36  THR A C    17 
ATOM   10344 O  O    . THR A 1 36 ? 10.651  9.529   0.965   1.00 0.00 ? 36  THR A O    17 
ATOM   10345 C  CB   . THR A 1 36 ? 9.031   8.428   -0.905  1.00 0.00 ? 36  THR A CB   17 
ATOM   10346 O  OG1  . THR A 1 36 ? 8.053   9.210   -0.210  1.00 0.00 ? 36  THR A OG1  17 
ATOM   10347 C  CG2  . THR A 1 36 ? 8.358   7.636   -2.016  1.00 0.00 ? 36  THR A CG2  17 
ATOM   10348 H  H    . THR A 1 36 ? 7.871   6.783   0.752   1.00 0.00 ? 36  THR A H    17 
ATOM   10349 H  HA   . THR A 1 36 ? 10.485  6.918   -0.470  1.00 0.00 ? 36  THR A HA   17 
ATOM   10350 H  HB   . THR A 1 36 ? 9.762   9.089   -1.347  1.00 0.00 ? 36  THR A HB   17 
ATOM   10351 H  HG1  . THR A 1 36 ? 7.350   9.455   -0.816  1.00 0.00 ? 36  THR A HG1  17 
ATOM   10352 H  HG21 . THR A 1 36 ? 9.021   6.852   -2.350  1.00 0.00 ? 36  THR A HG21 17 
ATOM   10353 H  HG22 . THR A 1 36 ? 8.133   8.294   -2.842  1.00 0.00 ? 36  THR A HG22 17 
ATOM   10354 H  HG23 . THR A 1 36 ? 7.443   7.199   -1.643  1.00 0.00 ? 36  THR A HG23 17 
ATOM   10355 N  N    . GLY A 1 37 ? 10.859  7.679   2.229   1.00 0.00 ? 37  GLY A N    17 
ATOM   10356 C  CA   . GLY A 1 37 ? 11.548  8.381   3.296   1.00 0.00 ? 37  GLY A CA   17 
ATOM   10357 C  C    . GLY A 1 37 ? 11.744  7.517   4.526   1.00 0.00 ? 37  GLY A C    17 
ATOM   10358 O  O    . GLY A 1 37 ? 12.846  7.438   5.068   1.00 0.00 ? 37  GLY A O    17 
ATOM   10359 H  H    . GLY A 1 37 ? 10.683  6.719   2.311   1.00 0.00 ? 37  GLY A H    17 
ATOM   10360 H  HA2  . GLY A 1 37 ? 12.514  8.702   2.937   1.00 0.00 ? 37  GLY A HA2  17 
ATOM   10361 H  HA3  . GLY A 1 37 ? 10.970  9.251   3.571   1.00 0.00 ? 37  GLY A HA3  17 
ATOM   10362 N  N    . GLU A 1 38 ? 10.671  6.868   4.969   1.00 0.00 ? 38  GLU A N    17 
ATOM   10363 C  CA   . GLU A 1 38 ? 10.730  6.008   6.145   1.00 0.00 ? 38  GLU A CA   17 
ATOM   10364 C  C    . GLU A 1 38 ? 11.717  4.864   5.932   1.00 0.00 ? 38  GLU A C    17 
ATOM   10365 O  O    . GLU A 1 38 ? 12.664  4.695   6.701   1.00 0.00 ? 38  GLU A O    17 
ATOM   10366 C  CB   . GLU A 1 38 ? 9.343   5.447   6.464   1.00 0.00 ? 38  GLU A CB   17 
ATOM   10367 C  CG   . GLU A 1 38 ? 9.255   4.782   7.828   1.00 0.00 ? 38  GLU A CG   17 
ATOM   10368 C  CD   . GLU A 1 38 ? 7.958   4.020   8.022   1.00 0.00 ? 38  GLU A CD   17 
ATOM   10369 O  OE1  . GLU A 1 38 ? 7.409   3.519   7.018   1.00 0.00 ? 38  GLU A OE1  17 
ATOM   10370 O  OE2  . GLU A 1 38 ? 7.492   3.925   9.177   1.00 0.00 ? 38  GLU A OE2  17 
ATOM   10371 H  H    . GLU A 1 38 ? 9.820   6.972   4.494   1.00 0.00 ? 38  GLU A H    17 
ATOM   10372 H  HA   . GLU A 1 38 ? 11.066  6.607   6.977   1.00 0.00 ? 38  GLU A HA   17 
ATOM   10373 H  HB2  . GLU A 1 38 ? 8.626   6.254   6.433   1.00 0.00 ? 38  GLU A HB2  17 
ATOM   10374 H  HB3  . GLU A 1 38 ? 9.082   4.717   5.713   1.00 0.00 ? 38  GLU A HB3  17 
ATOM   10375 H  HG2  . GLU A 1 38 ? 10.079  4.092   7.931   1.00 0.00 ? 38  GLU A HG2  17 
ATOM   10376 H  HG3  . GLU A 1 38 ? 9.326   5.543   8.591   1.00 0.00 ? 38  GLU A HG3  17 
ATOM   10377 N  N    . SER A 1 39 ? 11.488  4.079   4.884   1.00 0.00 ? 39  SER A N    17 
ATOM   10378 C  CA   . SER A 1 39 ? 12.353  2.948   4.572   1.00 0.00 ? 39  SER A CA   17 
ATOM   10379 C  C    . SER A 1 39 ? 13.606  3.410   3.833   1.00 0.00 ? 39  SER A C    17 
ATOM   10380 O  O    . SER A 1 39 ? 14.726  3.194   4.293   1.00 0.00 ? 39  SER A O    17 
ATOM   10381 C  CB   . SER A 1 39 ? 11.599  1.920   3.727   1.00 0.00 ? 39  SER A CB   17 
ATOM   10382 O  OG   . SER A 1 39 ? 10.906  0.995   4.547   1.00 0.00 ? 39  SER A OG   17 
ATOM   10383 H  H    . SER A 1 39 ? 10.716  4.265   4.308   1.00 0.00 ? 39  SER A H    17 
ATOM   10384 H  HA   . SER A 1 39 ? 12.648  2.489   5.504   1.00 0.00 ? 39  SER A HA   17 
ATOM   10385 H  HB2  . SER A 1 39 ? 10.885  2.429   3.097   1.00 0.00 ? 39  SER A HB2  17 
ATOM   10386 H  HB3  . SER A 1 39 ? 12.302  1.379   3.110   1.00 0.00 ? 39  SER A HB3  17 
ATOM   10387 H  HG   . SER A 1 39 ? 11.493  0.675   5.236   1.00 0.00 ? 39  SER A HG   17 
ATOM   10388 N  N    . GLY A 1 40 ? 13.406  4.047   2.684   1.00 0.00 ? 40  GLY A N    17 
ATOM   10389 C  CA   . GLY A 1 40 ? 14.527  4.530   1.899   1.00 0.00 ? 40  GLY A CA   17 
ATOM   10390 C  C    . GLY A 1 40 ? 15.070  5.849   2.412   1.00 0.00 ? 40  GLY A C    17 
ATOM   10391 O  O    . GLY A 1 40 ? 14.337  6.824   2.578   1.00 0.00 ? 40  GLY A O    17 
ATOM   10392 H  H    . GLY A 1 40 ? 12.490  4.191   2.366   1.00 0.00 ? 40  GLY A H    17 
ATOM   10393 H  HA2  . GLY A 1 40 ? 15.316  3.793   1.926   1.00 0.00 ? 40  GLY A HA2  17 
ATOM   10394 H  HA3  . GLY A 1 40 ? 14.206  4.660   0.876   1.00 0.00 ? 40  GLY A HA3  17 
ATOM   10395 N  N    . PRO A 1 41 ? 16.384  5.890   2.675   1.00 0.00 ? 41  PRO A N    17 
ATOM   10396 C  CA   . PRO A 1 41 ? 17.054  7.093   3.178   1.00 0.00 ? 41  PRO A CA   17 
ATOM   10397 C  C    . PRO A 1 41 ? 17.129  8.196   2.128   1.00 0.00 ? 41  PRO A C    17 
ATOM   10398 O  O    . PRO A 1 41 ? 18.007  8.186   1.265   1.00 0.00 ? 41  PRO A O    17 
ATOM   10399 C  CB   . PRO A 1 41 ? 18.457  6.596   3.534   1.00 0.00 ? 41  PRO A CB   17 
ATOM   10400 C  CG   . PRO A 1 41 ? 18.669  5.406   2.663   1.00 0.00 ? 41  PRO A CG   17 
ATOM   10401 C  CD   . PRO A 1 41 ? 17.319  4.765   2.501   1.00 0.00 ? 41  PRO A CD   17 
ATOM   10402 H  HA   . PRO A 1 41 ? 16.569  7.475   4.065   1.00 0.00 ? 41  PRO A HA   17 
ATOM   10403 H  HB2  . PRO A 1 41 ? 19.180  7.373   3.326   1.00 0.00 ? 41  PRO A HB2  17 
ATOM   10404 H  HB3  . PRO A 1 41 ? 18.495  6.332   4.580   1.00 0.00 ? 41  PRO A HB3  17 
ATOM   10405 H  HG2  . PRO A 1 41 ? 19.054  5.717   1.704   1.00 0.00 ? 41  PRO A HG2  17 
ATOM   10406 H  HG3  . PRO A 1 41 ? 19.354  4.721   3.140   1.00 0.00 ? 41  PRO A HG3  17 
ATOM   10407 H  HD2  . PRO A 1 41 ? 17.222  4.332   1.517   1.00 0.00 ? 41  PRO A HD2  17 
ATOM   10408 H  HD3  . PRO A 1 41 ? 17.164  4.015   3.262   1.00 0.00 ? 41  PRO A HD3  17 
ATOM   10409 N  N    . SER A 1 42 ? 16.204  9.147   2.208   1.00 0.00 ? 42  SER A N    17 
ATOM   10410 C  CA   . SER A 1 42 ? 16.165  10.256  1.261   1.00 0.00 ? 42  SER A CA   17 
ATOM   10411 C  C    . SER A 1 42 ? 15.350  11.419  1.821   1.00 0.00 ? 42  SER A C    17 
ATOM   10412 O  O    . SER A 1 42 ? 14.383  11.217  2.554   1.00 0.00 ? 42  SER A O    17 
ATOM   10413 C  CB   . SER A 1 42 ? 15.569  9.797   -0.071  1.00 0.00 ? 42  SER A CB   17 
ATOM   10414 O  OG   . SER A 1 42 ? 15.594  10.841  -1.028  1.00 0.00 ? 42  SER A OG   17 
ATOM   10415 H  H    . SER A 1 42 ? 15.531  9.101   2.918   1.00 0.00 ? 42  SER A H    17 
ATOM   10416 H  HA   . SER A 1 42 ? 17.179  10.589  1.097   1.00 0.00 ? 42  SER A HA   17 
ATOM   10417 H  HB2  . SER A 1 42 ? 16.142  8.964   -0.450  1.00 0.00 ? 42  SER A HB2  17 
ATOM   10418 H  HB3  . SER A 1 42 ? 14.545  9.489   0.083   1.00 0.00 ? 42  SER A HB3  17 
ATOM   10419 H  HG   . SER A 1 42 ? 15.930  10.505  -1.861  1.00 0.00 ? 42  SER A HG   17 
ATOM   10420 N  N    . SER A 1 43 ? 15.750  12.637  1.469   1.00 0.00 ? 43  SER A N    17 
ATOM   10421 C  CA   . SER A 1 43 ? 15.061  13.833  1.938   1.00 0.00 ? 43  SER A CA   17 
ATOM   10422 C  C    . SER A 1 43 ? 14.227  14.453  0.821   1.00 0.00 ? 43  SER A C    17 
ATOM   10423 O  O    . SER A 1 43 ? 13.009  14.580  0.938   1.00 0.00 ? 43  SER A O    17 
ATOM   10424 C  CB   . SER A 1 43 ? 16.071  14.856  2.464   1.00 0.00 ? 43  SER A CB   17 
ATOM   10425 O  OG   . SER A 1 43 ? 15.466  16.125  2.641   1.00 0.00 ? 43  SER A OG   17 
ATOM   10426 H  H    . SER A 1 43 ? 16.529  12.733  0.882   1.00 0.00 ? 43  SER A H    17 
ATOM   10427 H  HA   . SER A 1 43 ? 14.404  13.542  2.744   1.00 0.00 ? 43  SER A HA   17 
ATOM   10428 H  HB2  . SER A 1 43 ? 16.458  14.520  3.414   1.00 0.00 ? 43  SER A HB2  17 
ATOM   10429 H  HB3  . SER A 1 43 ? 16.882  14.952  1.758   1.00 0.00 ? 43  SER A HB3  17 
ATOM   10430 H  HG   . SER A 1 43 ? 16.072  16.707  3.105   1.00 0.00 ? 43  SER A HG   17 
ATOM   10431 N  N    . GLY A 1 44 ? 14.894  14.838  -0.263  1.00 0.00 ? 44  GLY A N    17 
ATOM   10432 C  CA   . GLY A 1 44 ? 14.199  15.440  -1.386  1.00 0.00 ? 44  GLY A CA   17 
ATOM   10433 C  C    . GLY A 1 44 ? 14.273  14.589  -2.638  1.00 0.00 ? 44  GLY A C    17 
ATOM   10434 O  O    . GLY A 1 44 ? 15.298  13.947  -2.865  1.00 0.00 ? 44  GLY A O    17 
ATOM   10435 H  H    . GLY A 1 44 ? 15.865  14.712  -0.300  1.00 0.00 ? 44  GLY A H    17 
ATOM   10436 H  HA2  . GLY A 1 44 ? 13.162  15.581  -1.120  1.00 0.00 ? 44  GLY A HA2  17 
ATOM   10437 H  HA3  . GLY A 1 44 ? 14.642  16.403  -1.593  1.00 0.00 ? 44  GLY A HA3  17 
HETATM 10438 ZN ZN   . ZN  B 2 .  ? 4.547   -0.486  2.904   1.00 0.00 ? 181 ZN  A ZN   17 
ATOM   10439 N  N    . GLY A 1 1  ? -7.740  -24.387 -15.441 1.00 0.00 ? 1   GLY A N    18 
ATOM   10440 C  CA   . GLY A 1 1  ? -6.613  -24.917 -16.186 1.00 0.00 ? 1   GLY A CA   18 
ATOM   10441 C  C    . GLY A 1 1  ? -5.472  -25.345 -15.284 1.00 0.00 ? 1   GLY A C    18 
ATOM   10442 O  O    . GLY A 1 1  ? -5.564  -26.360 -14.595 1.00 0.00 ? 1   GLY A O    18 
ATOM   10443 H  H1   . GLY A 1 1  ? -8.182  -24.941 -14.764 1.00 0.00 ? 1   GLY A H1   18 
ATOM   10444 H  HA2  . GLY A 1 1  ? -6.943  -25.770 -16.760 1.00 0.00 ? 1   GLY A HA2  18 
ATOM   10445 H  HA3  . GLY A 1 1  ? -6.254  -24.156 -16.864 1.00 0.00 ? 1   GLY A HA3  18 
ATOM   10446 N  N    . SER A 1 2  ? -4.392  -24.569 -15.289 1.00 0.00 ? 2   SER A N    18 
ATOM   10447 C  CA   . SER A 1 2  ? -3.226  -24.876 -14.469 1.00 0.00 ? 2   SER A CA   18 
ATOM   10448 C  C    . SER A 1 2  ? -3.297  -24.150 -13.129 1.00 0.00 ? 2   SER A C    18 
ATOM   10449 O  O    . SER A 1 2  ? -3.906  -23.086 -13.019 1.00 0.00 ? 2   SER A O    18 
ATOM   10450 C  CB   . SER A 1 2  ? -1.942  -24.487 -15.205 1.00 0.00 ? 2   SER A CB   18 
ATOM   10451 O  OG   . SER A 1 2  ? -1.544  -25.505 -16.108 1.00 0.00 ? 2   SER A OG   18 
ATOM   10452 H  H    . SER A 1 2  ? -4.379  -23.772 -15.860 1.00 0.00 ? 2   SER A H    18 
ATOM   10453 H  HA   . SER A 1 2  ? -3.219  -25.941 -14.289 1.00 0.00 ? 2   SER A HA   18 
ATOM   10454 H  HB2  . SER A 1 2  ? -2.110  -23.577 -15.760 1.00 0.00 ? 2   SER A HB2  18 
ATOM   10455 H  HB3  . SER A 1 2  ? -1.152  -24.331 -14.486 1.00 0.00 ? 2   SER A HB3  18 
ATOM   10456 H  HG   . SER A 1 2  ? -1.373  -25.119 -16.970 1.00 0.00 ? 2   SER A HG   18 
ATOM   10457 N  N    . SER A 1 3  ? -2.671  -24.735 -12.113 1.00 0.00 ? 3   SER A N    18 
ATOM   10458 C  CA   . SER A 1 3  ? -2.666  -24.147 -10.779 1.00 0.00 ? 3   SER A CA   18 
ATOM   10459 C  C    . SER A 1 3  ? -1.486  -23.195 -10.609 1.00 0.00 ? 3   SER A C    18 
ATOM   10460 O  O    . SER A 1 3  ? -1.645  -22.067 -10.146 1.00 0.00 ? 3   SER A O    18 
ATOM   10461 C  CB   . SER A 1 3  ? -2.608  -25.245 -9.715  1.00 0.00 ? 3   SER A CB   18 
ATOM   10462 O  OG   . SER A 1 3  ? -2.956  -24.737 -8.438  1.00 0.00 ? 3   SER A OG   18 
ATOM   10463 H  H    . SER A 1 3  ? -2.204  -25.583 -12.264 1.00 0.00 ? 3   SER A H    18 
ATOM   10464 H  HA   . SER A 1 3  ? -3.583  -23.589 -10.659 1.00 0.00 ? 3   SER A HA   18 
ATOM   10465 H  HB2  . SER A 1 3  ? -3.298  -26.033 -9.976  1.00 0.00 ? 3   SER A HB2  18 
ATOM   10466 H  HB3  . SER A 1 3  ? -1.605  -25.645 -9.669  1.00 0.00 ? 3   SER A HB3  18 
ATOM   10467 H  HG   . SER A 1 3  ? -3.524  -23.970 -8.543  1.00 0.00 ? 3   SER A HG   18 
ATOM   10468 N  N    . GLY A 1 4  ? -0.299  -23.661 -10.987 1.00 0.00 ? 4   GLY A N    18 
ATOM   10469 C  CA   . GLY A 1 4  ? 0.892   -22.840 -10.870 1.00 0.00 ? 4   GLY A CA   18 
ATOM   10470 C  C    . GLY A 1 4  ? 1.570   -22.992 -9.522  1.00 0.00 ? 4   GLY A C    18 
ATOM   10471 O  O    . GLY A 1 4  ? 2.131   -24.044 -9.217  1.00 0.00 ? 4   GLY A O    18 
ATOM   10472 H  H    . GLY A 1 4  ? -0.232  -24.569 -11.350 1.00 0.00 ? 4   GLY A H    18 
ATOM   10473 H  HA2  . GLY A 1 4  ? 1.588   -23.121 -11.645 1.00 0.00 ? 4   GLY A HA2  18 
ATOM   10474 H  HA3  . GLY A 1 4  ? 0.616   -21.804 -11.006 1.00 0.00 ? 4   GLY A HA3  18 
ATOM   10475 N  N    . SER A 1 5  ? 1.519   -21.938 -8.714  1.00 0.00 ? 5   SER A N    18 
ATOM   10476 C  CA   . SER A 1 5  ? 2.138   -21.956 -7.394  1.00 0.00 ? 5   SER A CA   18 
ATOM   10477 C  C    . SER A 1 5  ? 1.142   -21.530 -6.320  1.00 0.00 ? 5   SER A C    18 
ATOM   10478 O  O    . SER A 1 5  ? 0.234   -20.740 -6.579  1.00 0.00 ? 5   SER A O    18 
ATOM   10479 C  CB   . SER A 1 5  ? 3.360   -21.035 -7.367  1.00 0.00 ? 5   SER A CB   18 
ATOM   10480 O  OG   . SER A 1 5  ? 2.971   -19.673 -7.330  1.00 0.00 ? 5   SER A OG   18 
ATOM   10481 H  H    . SER A 1 5  ? 1.057   -21.127 -9.014  1.00 0.00 ? 5   SER A H    18 
ATOM   10482 H  HA   . SER A 1 5  ? 2.457   -22.968 -7.191  1.00 0.00 ? 5   SER A HA   18 
ATOM   10483 H  HB2  . SER A 1 5  ? 3.951   -21.252 -6.490  1.00 0.00 ? 5   SER A HB2  18 
ATOM   10484 H  HB3  . SER A 1 5  ? 3.954   -21.204 -8.253  1.00 0.00 ? 5   SER A HB3  18 
ATOM   10485 H  HG   . SER A 1 5  ? 3.655   -19.133 -7.731  1.00 0.00 ? 5   SER A HG   18 
ATOM   10486 N  N    . SER A 1 6  ? 1.318   -22.059 -5.114  1.00 0.00 ? 6   SER A N    18 
ATOM   10487 C  CA   . SER A 1 6  ? 0.433   -21.737 -4.001  1.00 0.00 ? 6   SER A CA   18 
ATOM   10488 C  C    . SER A 1 6  ? 1.049   -20.664 -3.109  1.00 0.00 ? 6   SER A C    18 
ATOM   10489 O  O    . SER A 1 6  ? 0.986   -20.748 -1.884  1.00 0.00 ? 6   SER A O    18 
ATOM   10490 C  CB   . SER A 1 6  ? 0.137   -22.992 -3.178  1.00 0.00 ? 6   SER A CB   18 
ATOM   10491 O  OG   . SER A 1 6  ? -0.804  -22.721 -2.154  1.00 0.00 ? 6   SER A OG   18 
ATOM   10492 H  H    . SER A 1 6  ? 2.060   -22.683 -4.970  1.00 0.00 ? 6   SER A H    18 
ATOM   10493 H  HA   . SER A 1 6  ? -0.492  -21.360 -4.412  1.00 0.00 ? 6   SER A HA   18 
ATOM   10494 H  HB2  . SER A 1 6  ? -0.263  -23.758 -3.824  1.00 0.00 ? 6   SER A HB2  18 
ATOM   10495 H  HB3  . SER A 1 6  ? 1.052   -23.346 -2.725  1.00 0.00 ? 6   SER A HB3  18 
ATOM   10496 H  HG   . SER A 1 6  ? -0.342  -22.536 -1.334  1.00 0.00 ? 6   SER A HG   18 
ATOM   10497 N  N    . GLY A 1 7  ? 1.647   -19.654 -3.736  1.00 0.00 ? 7   GLY A N    18 
ATOM   10498 C  CA   . GLY A 1 7  ? 2.267   -18.578 -2.985  1.00 0.00 ? 7   GLY A CA   18 
ATOM   10499 C  C    . GLY A 1 7  ? 1.518   -17.268 -3.124  1.00 0.00 ? 7   GLY A C    18 
ATOM   10500 O  O    . GLY A 1 7  ? 1.010   -16.726 -2.142  1.00 0.00 ? 7   GLY A O    18 
ATOM   10501 H  H    . GLY A 1 7  ? 1.666   -19.640 -4.715  1.00 0.00 ? 7   GLY A H    18 
ATOM   10502 H  HA2  . GLY A 1 7  ? 2.298   -18.854 -1.941  1.00 0.00 ? 7   GLY A HA2  18 
ATOM   10503 H  HA3  . GLY A 1 7  ? 3.277   -18.442 -3.341  1.00 0.00 ? 7   GLY A HA3  18 
ATOM   10504 N  N    . THR A 1 8  ? 1.450   -16.754 -4.348  1.00 0.00 ? 8   THR A N    18 
ATOM   10505 C  CA   . THR A 1 8  ? 0.761   -15.497 -4.613  1.00 0.00 ? 8   THR A CA   18 
ATOM   10506 C  C    . THR A 1 8  ? -0.520  -15.389 -3.793  1.00 0.00 ? 8   THR A C    18 
ATOM   10507 O  O    . THR A 1 8  ? -1.526  -16.023 -4.109  1.00 0.00 ? 8   THR A O    18 
ATOM   10508 C  CB   . THR A 1 8  ? 0.415   -15.350 -6.107  1.00 0.00 ? 8   THR A CB   18 
ATOM   10509 O  OG1  . THR A 1 8  ? -0.300  -16.505 -6.560  1.00 0.00 ? 8   THR A OG1  18 
ATOM   10510 C  CG2  . THR A 1 8  ? 1.675   -15.168 -6.939  1.00 0.00 ? 8   THR A CG2  18 
ATOM   10511 H  H    . THR A 1 8  ? 1.875   -17.233 -5.091  1.00 0.00 ? 8   THR A H    18 
ATOM   10512 H  HA   . THR A 1 8  ? 1.423   -14.689 -4.337  1.00 0.00 ? 8   THR A HA   18 
ATOM   10513 H  HB   . THR A 1 8  ? -0.210  -14.477 -6.231  1.00 0.00 ? 8   THR A HB   18 
ATOM   10514 H  HG1  . THR A 1 8  ? -0.067  -17.260 -6.015  1.00 0.00 ? 8   THR A HG1  18 
ATOM   10515 H  HG21 . THR A 1 8  ? 1.851   -16.059 -7.523  1.00 0.00 ? 8   THR A HG21 18 
ATOM   10516 H  HG22 . THR A 1 8  ? 2.517   -14.995 -6.285  1.00 0.00 ? 8   THR A HG22 18 
ATOM   10517 H  HG23 . THR A 1 8  ? 1.551   -14.323 -7.599  1.00 0.00 ? 8   THR A HG23 18 
ATOM   10518 N  N    . GLY A 1 9  ? -0.476  -14.581 -2.738  1.00 0.00 ? 9   GLY A N    18 
ATOM   10519 C  CA   . GLY A 1 9  ? -1.639  -14.405 -1.890  1.00 0.00 ? 9   GLY A CA   18 
ATOM   10520 C  C    . GLY A 1 9  ? -2.389  -13.122 -2.192  1.00 0.00 ? 9   GLY A C    18 
ATOM   10521 O  O    . GLY A 1 9  ? -2.282  -12.144 -1.454  1.00 0.00 ? 9   GLY A O    18 
ATOM   10522 H  H    . GLY A 1 9  ? 0.354   -14.101 -2.535  1.00 0.00 ? 9   GLY A H    18 
ATOM   10523 H  HA2  . GLY A 1 9  ? -2.306  -15.242 -2.033  1.00 0.00 ? 9   GLY A HA2  18 
ATOM   10524 H  HA3  . GLY A 1 9  ? -1.319  -14.385 -0.858  1.00 0.00 ? 9   GLY A HA3  18 
ATOM   10525 N  N    . MET A 1 10 ? -3.148  -13.126 -3.283  1.00 0.00 ? 10  MET A N    18 
ATOM   10526 C  CA   . MET A 1 10 ? -3.918  -11.953 -3.682  1.00 0.00 ? 10  MET A CA   18 
ATOM   10527 C  C    . MET A 1 10 ? -4.448  -11.210 -2.460  1.00 0.00 ? 10  MET A C    18 
ATOM   10528 O  O    . MET A 1 10 ? -5.405  -11.648 -1.821  1.00 0.00 ? 10  MET A O    18 
ATOM   10529 C  CB   . MET A 1 10 ? -5.080  -12.364 -4.588  1.00 0.00 ? 10  MET A CB   18 
ATOM   10530 C  CG   . MET A 1 10 ? -5.906  -11.189 -5.087  1.00 0.00 ? 10  MET A CG   18 
ATOM   10531 S  SD   . MET A 1 10 ? -7.577  -11.668 -5.565  1.00 0.00 ? 10  MET A SD   18 
ATOM   10532 C  CE   . MET A 1 10 ? -8.496  -11.197 -4.101  1.00 0.00 ? 10  MET A CE   18 
ATOM   10533 H  H    . MET A 1 10 ? -3.193  -13.936 -3.832  1.00 0.00 ? 10  MET A H    18 
ATOM   10534 H  HA   . MET A 1 10 ? -3.260  -11.297 -4.231  1.00 0.00 ? 10  MET A HA   18 
ATOM   10535 H  HB2  . MET A 1 10 ? -4.685  -12.888 -5.445  1.00 0.00 ? 10  MET A HB2  18 
ATOM   10536 H  HB3  . MET A 1 10 ? -5.733  -13.026 -4.039  1.00 0.00 ? 10  MET A HB3  18 
ATOM   10537 H  HG2  . MET A 1 10 ? -5.969  -10.451 -4.302  1.00 0.00 ? 10  MET A HG2  18 
ATOM   10538 H  HG3  . MET A 1 10 ? -5.410  -10.758 -5.944  1.00 0.00 ? 10  MET A HG3  18 
ATOM   10539 H  HE1  . MET A 1 10 ? -7.914  -11.432 -3.221  1.00 0.00 ? 10  MET A HE1  18 
ATOM   10540 H  HE2  . MET A 1 10 ? -8.697  -10.136 -4.127  1.00 0.00 ? 10  MET A HE2  18 
ATOM   10541 H  HE3  . MET A 1 10 ? -9.429  -11.740 -4.072  1.00 0.00 ? 10  MET A HE3  18 
ATOM   10542 N  N    . LYS A 1 11 ? -3.821  -10.083 -2.140  1.00 0.00 ? 11  LYS A N    18 
ATOM   10543 C  CA   . LYS A 1 11 ? -4.230  -9.278  -0.996  1.00 0.00 ? 11  LYS A CA   18 
ATOM   10544 C  C    . LYS A 1 11 ? -5.070  -8.085  -1.442  1.00 0.00 ? 11  LYS A C    18 
ATOM   10545 O  O    . LYS A 1 11 ? -4.955  -7.601  -2.568  1.00 0.00 ? 11  LYS A O    18 
ATOM   10546 C  CB   . LYS A 1 11 ? -3.001  -8.790  -0.224  1.00 0.00 ? 11  LYS A CB   18 
ATOM   10547 C  CG   . LYS A 1 11 ? -2.056  -7.942  -1.059  1.00 0.00 ? 11  LYS A CG   18 
ATOM   10548 C  CD   . LYS A 1 11 ? -0.612  -8.123  -0.622  1.00 0.00 ? 11  LYS A CD   18 
ATOM   10549 C  CE   . LYS A 1 11 ? 0.008   -9.362  -1.250  1.00 0.00 ? 11  LYS A CE   18 
ATOM   10550 N  NZ   . LYS A 1 11 ? 1.496   -9.310  -1.227  1.00 0.00 ? 11  LYS A NZ   18 
ATOM   10551 H  H    . LYS A 1 11 ? -3.064  -9.785  -2.688  1.00 0.00 ? 11  LYS A H    18 
ATOM   10552 H  HA   . LYS A 1 11 ? -4.827  -9.901  -0.348  1.00 0.00 ? 11  LYS A HA   18 
ATOM   10553 H  HB2  . LYS A 1 11 ? -3.331  -8.200  0.618   1.00 0.00 ? 11  LYS A HB2  18 
ATOM   10554 H  HB3  . LYS A 1 11 ? -2.455  -9.648  0.139   1.00 0.00 ? 11  LYS A HB3  18 
ATOM   10555 H  HG2  . LYS A 1 11 ? -2.147  -8.232  -2.095  1.00 0.00 ? 11  LYS A HG2  18 
ATOM   10556 H  HG3  . LYS A 1 11 ? -2.328  -6.902  -0.949  1.00 0.00 ? 11  LYS A HG3  18 
ATOM   10557 H  HD2  . LYS A 1 11 ? -0.042  -7.257  -0.925  1.00 0.00 ? 11  LYS A HD2  18 
ATOM   10558 H  HD3  . LYS A 1 11 ? -0.580  -8.221  0.454   1.00 0.00 ? 11  LYS A HD3  18 
ATOM   10559 H  HE2  . LYS A 1 11 ? -0.321  -10.231 -0.700  1.00 0.00 ? 11  LYS A HE2  18 
ATOM   10560 H  HE3  . LYS A 1 11 ? -0.325  -9.437  -2.274  1.00 0.00 ? 11  LYS A HE3  18 
ATOM   10561 H  HZ1  . LYS A 1 11 ? 1.816   -8.472  -0.701  1.00 0.00 ? 11  LYS A HZ1  18 
ATOM   10562 H  HZ2  . LYS A 1 11 ? 1.866   -9.259  -2.198  1.00 0.00 ? 11  LYS A HZ2  18 
ATOM   10563 H  HZ3  . LYS A 1 11 ? 1.877   -10.161 -0.767  1.00 0.00 ? 11  LYS A HZ3  18 
ATOM   10564 N  N    . PRO A 1 12 ? -5.934  -7.598  -0.539  1.00 0.00 ? 12  PRO A N    18 
ATOM   10565 C  CA   . PRO A 1 12 ? -6.809  -6.455  -0.817  1.00 0.00 ? 12  PRO A CA   18 
ATOM   10566 C  C    . PRO A 1 12 ? -6.035  -5.146  -0.926  1.00 0.00 ? 12  PRO A C    18 
ATOM   10567 O  O    . PRO A 1 12 ? -5.579  -4.772  -2.007  1.00 0.00 ? 12  PRO A O    18 
ATOM   10568 C  CB   . PRO A 1 12 ? -7.746  -6.423  0.393   1.00 0.00 ? 12  PRO A CB   18 
ATOM   10569 C  CG   . PRO A 1 12 ? -6.975  -7.079  1.486   1.00 0.00 ? 12  PRO A CG   18 
ATOM   10570 C  CD   . PRO A 1 12 ? -6.125  -8.126  0.822   1.00 0.00 ? 12  PRO A CD   18 
ATOM   10571 H  HA   . PRO A 1 12 ? -7.386  -6.607  -1.718  1.00 0.00 ? 12  PRO A HA   18 
ATOM   10572 H  HB2  . PRO A 1 12 ? -7.986  -5.398  0.638   1.00 0.00 ? 12  PRO A HB2  18 
ATOM   10573 H  HB3  . PRO A 1 12 ? -8.651  -6.967  0.167   1.00 0.00 ? 12  PRO A HB3  18 
ATOM   10574 H  HG2  . PRO A 1 12 ? -6.354  -6.352  1.985   1.00 0.00 ? 12  PRO A HG2  18 
ATOM   10575 H  HG3  . PRO A 1 12 ? -7.655  -7.539  2.189   1.00 0.00 ? 12  PRO A HG3  18 
ATOM   10576 H  HD2  . PRO A 1 12 ? -5.179  -8.224  1.334   1.00 0.00 ? 12  PRO A HD2  18 
ATOM   10577 H  HD3  . PRO A 1 12 ? -6.642  -9.074  0.799   1.00 0.00 ? 12  PRO A HD3  18 
ATOM   10578 N  N    . TYR A 1 13 ? -5.889  -4.455  0.199   1.00 0.00 ? 13  TYR A N    18 
ATOM   10579 C  CA   . TYR A 1 13 ? -5.171  -3.186  0.229   1.00 0.00 ? 13  TYR A CA   18 
ATOM   10580 C  C    . TYR A 1 13 ? -3.836  -3.332  0.952   1.00 0.00 ? 13  TYR A C    18 
ATOM   10581 O  O    . TYR A 1 13 ? -3.268  -2.353  1.437   1.00 0.00 ? 13  TYR A O    18 
ATOM   10582 C  CB   . TYR A 1 13 ? -6.019  -2.112  0.912   1.00 0.00 ? 13  TYR A CB   18 
ATOM   10583 C  CG   . TYR A 1 13 ? -7.507  -2.372  0.830   1.00 0.00 ? 13  TYR A CG   18 
ATOM   10584 C  CD1  . TYR A 1 13 ? -8.109  -3.332  1.634   1.00 0.00 ? 13  TYR A CD1  18 
ATOM   10585 C  CD2  . TYR A 1 13 ? -8.309  -1.657  -0.050  1.00 0.00 ? 13  TYR A CD2  18 
ATOM   10586 C  CE1  . TYR A 1 13 ? -9.468  -3.574  1.562   1.00 0.00 ? 13  TYR A CE1  18 
ATOM   10587 C  CE2  . TYR A 1 13 ? -9.669  -1.890  -0.128  1.00 0.00 ? 13  TYR A CE2  18 
ATOM   10588 C  CZ   . TYR A 1 13 ? -10.243 -2.850  0.680   1.00 0.00 ? 13  TYR A CZ   18 
ATOM   10589 O  OH   . TYR A 1 13 ? -11.597 -3.087  0.606   1.00 0.00 ? 13  TYR A OH   18 
ATOM   10590 H  H    . TYR A 1 13 ? -6.275  -4.805  1.029   1.00 0.00 ? 13  TYR A H    18 
ATOM   10591 H  HA   . TYR A 1 13 ? -4.984  -2.887  -0.792  1.00 0.00 ? 13  TYR A HA   18 
ATOM   10592 H  HB2  . TYR A 1 13 ? -5.750  -2.060  1.956   1.00 0.00 ? 13  TYR A HB2  18 
ATOM   10593 H  HB3  . TYR A 1 13 ? -5.823  -1.158  0.446   1.00 0.00 ? 13  TYR A HB3  18 
ATOM   10594 H  HD1  . TYR A 1 13 ? -7.499  -3.897  2.324   1.00 0.00 ? 13  TYR A HD1  18 
ATOM   10595 H  HD2  . TYR A 1 13 ? -7.857  -0.906  -0.681  1.00 0.00 ? 13  TYR A HD2  18 
ATOM   10596 H  HE1  . TYR A 1 13 ? -9.918  -4.325  2.194   1.00 0.00 ? 13  TYR A HE1  18 
ATOM   10597 H  HE2  . TYR A 1 13 ? -10.276 -1.324  -0.818  1.00 0.00 ? 13  TYR A HE2  18 
ATOM   10598 H  HH   . TYR A 1 13 ? -11.990 -2.493  -0.038  1.00 0.00 ? 13  TYR A HH   18 
ATOM   10599 N  N    . VAL A 1 14 ? -3.340  -4.564  1.021   1.00 0.00 ? 14  VAL A N    18 
ATOM   10600 C  CA   . VAL A 1 14 ? -2.071  -4.840  1.684   1.00 0.00 ? 14  VAL A CA   18 
ATOM   10601 C  C    . VAL A 1 14 ? -0.893  -4.400  0.821   1.00 0.00 ? 14  VAL A C    18 
ATOM   10602 O  O    . VAL A 1 14 ? -0.810  -4.745  -0.358  1.00 0.00 ? 14  VAL A O    18 
ATOM   10603 C  CB   . VAL A 1 14 ? -1.923  -6.339  2.010   1.00 0.00 ? 14  VAL A CB   18 
ATOM   10604 C  CG1  . VAL A 1 14 ? -0.606  -6.602  2.724   1.00 0.00 ? 14  VAL A CG1  18 
ATOM   10605 C  CG2  . VAL A 1 14 ? -3.099  -6.820  2.846   1.00 0.00 ? 14  VAL A CG2  18 
ATOM   10606 H  H    . VAL A 1 14 ? -3.839  -5.304  0.616   1.00 0.00 ? 14  VAL A H    18 
ATOM   10607 H  HA   . VAL A 1 14 ? -2.051  -4.288  2.612   1.00 0.00 ? 14  VAL A HA   18 
ATOM   10608 H  HB   . VAL A 1 14 ? -1.919  -6.890  1.081   1.00 0.00 ? 14  VAL A HB   18 
ATOM   10609 H  HG11 . VAL A 1 14 ? -0.248  -7.588  2.467   1.00 0.00 ? 14  VAL A HG11 18 
ATOM   10610 H  HG12 . VAL A 1 14 ? 0.122   -5.863  2.423   1.00 0.00 ? 14  VAL A HG12 18 
ATOM   10611 H  HG13 . VAL A 1 14 ? -0.759  -6.543  3.792   1.00 0.00 ? 14  VAL A HG13 18 
ATOM   10612 H  HG21 . VAL A 1 14 ? -3.955  -6.189  2.662   1.00 0.00 ? 14  VAL A HG21 18 
ATOM   10613 H  HG22 . VAL A 1 14 ? -3.337  -7.838  2.577   1.00 0.00 ? 14  VAL A HG22 18 
ATOM   10614 H  HG23 . VAL A 1 14 ? -2.838  -6.776  3.894   1.00 0.00 ? 14  VAL A HG23 18 
ATOM   10615 N  N    . CYS A 1 15 ? 0.016   -3.636  1.417   1.00 0.00 ? 15  CYS A N    18 
ATOM   10616 C  CA   . CYS A 1 15 ? 1.191   -3.148  0.704   1.00 0.00 ? 15  CYS A CA   18 
ATOM   10617 C  C    . CYS A 1 15 ? 1.951   -4.301  0.055   1.00 0.00 ? 15  CYS A C    18 
ATOM   10618 O  O    . CYS A 1 15 ? 2.352   -5.250  0.727   1.00 0.00 ? 15  CYS A O    18 
ATOM   10619 C  CB   . CYS A 1 15 ? 2.113   -2.388  1.659   1.00 0.00 ? 15  CYS A CB   18 
ATOM   10620 S  SG   . CYS A 1 15 ? 3.073   -1.059  0.865   1.00 0.00 ? 15  CYS A SG   18 
ATOM   10621 H  H    . CYS A 1 15 ? -0.105  -3.395  2.360   1.00 0.00 ? 15  CYS A H    18 
ATOM   10622 H  HA   . CYS A 1 15 ? 0.853   -2.475  -0.069  1.00 0.00 ? 15  CYS A HA   18 
ATOM   10623 H  HB2  . CYS A 1 15 ? 1.518   -1.940  2.442   1.00 0.00 ? 15  CYS A HB2  18 
ATOM   10624 H  HB3  . CYS A 1 15 ? 2.813   -3.082  2.100   1.00 0.00 ? 15  CYS A HB3  18 
ATOM   10625 N  N    . ASN A 1 16 ? 2.145   -4.210  -1.257  1.00 0.00 ? 16  ASN A N    18 
ATOM   10626 C  CA   . ASN A 1 16 ? 2.857   -5.245  -1.998  1.00 0.00 ? 16  ASN A CA   18 
ATOM   10627 C  C    . ASN A 1 16 ? 4.359   -4.975  -2.002  1.00 0.00 ? 16  ASN A C    18 
ATOM   10628 O  O    . ASN A 1 16 ? 5.066   -5.363  -2.931  1.00 0.00 ? 16  ASN A O    18 
ATOM   10629 C  CB   . ASN A 1 16 ? 2.338   -5.322  -3.434  1.00 0.00 ? 16  ASN A CB   18 
ATOM   10630 C  CG   . ASN A 1 16 ? 0.823   -5.295  -3.504  1.00 0.00 ? 16  ASN A CG   18 
ATOM   10631 O  OD1  . ASN A 1 16 ? 0.227   -4.302  -3.921  1.00 0.00 ? 16  ASN A OD1  18 
ATOM   10632 N  ND2  . ASN A 1 16 ? 0.193   -6.389  -3.093  1.00 0.00 ? 16  ASN A ND2  18 
ATOM   10633 H  H    . ASN A 1 16 ? 1.802   -3.428  -1.738  1.00 0.00 ? 16  ASN A H    18 
ATOM   10634 H  HA   . ASN A 1 16 ? 2.674   -6.189  -1.507  1.00 0.00 ? 16  ASN A HA   18 
ATOM   10635 H  HB2  . ASN A 1 16 ? 2.719   -4.480  -3.994  1.00 0.00 ? 16  ASN A HB2  18 
ATOM   10636 H  HB3  . ASN A 1 16 ? 2.685   -6.238  -3.888  1.00 0.00 ? 16  ASN A HB3  18 
ATOM   10637 H  HD21 . ASN A 1 16 ? 0.733   -7.142  -2.772  1.00 0.00 ? 16  ASN A HD21 18 
ATOM   10638 H  HD22 . ASN A 1 16 ? -0.787  -6.400  -3.127  1.00 0.00 ? 16  ASN A HD22 18 
ATOM   10639 N  N    . GLU A 1 17 ? 4.838   -4.308  -0.956  1.00 0.00 ? 17  GLU A N    18 
ATOM   10640 C  CA   . GLU A 1 17 ? 6.256   -3.987  -0.840  1.00 0.00 ? 17  GLU A CA   18 
ATOM   10641 C  C    . GLU A 1 17 ? 6.783   -4.344  0.546   1.00 0.00 ? 17  GLU A C    18 
ATOM   10642 O  O    . GLU A 1 17 ? 7.877   -4.892  0.685   1.00 0.00 ? 17  GLU A O    18 
ATOM   10643 C  CB   . GLU A 1 17 ? 6.489   -2.501  -1.120  1.00 0.00 ? 17  GLU A CB   18 
ATOM   10644 C  CG   . GLU A 1 17 ? 5.858   -2.018  -2.415  1.00 0.00 ? 17  GLU A CG   18 
ATOM   10645 C  CD   . GLU A 1 17 ? 6.794   -2.142  -3.601  1.00 0.00 ? 17  GLU A CD   18 
ATOM   10646 O  OE1  . GLU A 1 17 ? 8.024   -2.101  -3.392  1.00 0.00 ? 17  GLU A OE1  18 
ATOM   10647 O  OE2  . GLU A 1 17 ? 6.296   -2.279  -4.738  1.00 0.00 ? 17  GLU A OE2  18 
ATOM   10648 H  H    . GLU A 1 17 ? 4.224   -4.026  -0.247  1.00 0.00 ? 17  GLU A H    18 
ATOM   10649 H  HA   . GLU A 1 17 ? 6.789   -4.570  -1.576  1.00 0.00 ? 17  GLU A HA   18 
ATOM   10650 H  HB2  . GLU A 1 17 ? 6.076   -1.925  -0.305  1.00 0.00 ? 17  GLU A HB2  18 
ATOM   10651 H  HB3  . GLU A 1 17 ? 7.552   -2.320  -1.173  1.00 0.00 ? 17  GLU A HB3  18 
ATOM   10652 H  HG2  . GLU A 1 17 ? 4.974   -2.607  -2.611  1.00 0.00 ? 17  GLU A HG2  18 
ATOM   10653 H  HG3  . GLU A 1 17 ? 5.580   -0.981  -2.300  1.00 0.00 ? 17  GLU A HG3  18 
ATOM   10654 N  N    . CYS A 1 18 ? 5.997   -4.030  1.571   1.00 0.00 ? 18  CYS A N    18 
ATOM   10655 C  CA   . CYS A 1 18 ? 6.383   -4.315  2.947   1.00 0.00 ? 18  CYS A CA   18 
ATOM   10656 C  C    . CYS A 1 18 ? 5.438   -5.334  3.577   1.00 0.00 ? 18  CYS A C    18 
ATOM   10657 O  O    . CYS A 1 18 ? 5.854   -6.170  4.378   1.00 0.00 ? 18  CYS A O    18 
ATOM   10658 C  CB   . CYS A 1 18 ? 6.388   -3.029  3.775   1.00 0.00 ? 18  CYS A CB   18 
ATOM   10659 S  SG   . CYS A 1 18 ? 4.794   -2.147  3.789   1.00 0.00 ? 18  CYS A SG   18 
ATOM   10660 H  H    . CYS A 1 18 ? 5.136   -3.594  1.397   1.00 0.00 ? 18  CYS A H    18 
ATOM   10661 H  HA   . CYS A 1 18 ? 7.380   -4.728  2.934   1.00 0.00 ? 18  CYS A HA   18 
ATOM   10662 H  HB2  . CYS A 1 18 ? 6.639   -3.269  4.798   1.00 0.00 ? 18  CYS A HB2  18 
ATOM   10663 H  HB3  . CYS A 1 18 ? 7.133   -2.356  3.376   1.00 0.00 ? 18  CYS A HB3  18 
ATOM   10664 N  N    . GLY A 1 19 ? 4.163   -5.258  3.208   1.00 0.00 ? 19  GLY A N    18 
ATOM   10665 C  CA   . GLY A 1 19 ? 3.178   -6.179  3.745   1.00 0.00 ? 19  GLY A CA   18 
ATOM   10666 C  C    . GLY A 1 19 ? 2.230   -5.509  4.720   1.00 0.00 ? 19  GLY A C    18 
ATOM   10667 O  O    . GLY A 1 19 ? 1.610   -6.174  5.551   1.00 0.00 ? 19  GLY A O    18 
ATOM   10668 H  H    . GLY A 1 19 ? 3.888   -4.570  2.565   1.00 0.00 ? 19  GLY A H    18 
ATOM   10669 H  HA2  . GLY A 1 19 ? 2.606   -6.593  2.929   1.00 0.00 ? 19  GLY A HA2  18 
ATOM   10670 H  HA3  . GLY A 1 19 ? 3.693   -6.980  4.255   1.00 0.00 ? 19  GLY A HA3  18 
ATOM   10671 N  N    . LYS A 1 20 ? 2.117   -4.189  4.621   1.00 0.00 ? 20  LYS A N    18 
ATOM   10672 C  CA   . LYS A 1 20 ? 1.237   -3.428  5.500   1.00 0.00 ? 20  LYS A CA   18 
ATOM   10673 C  C    . LYS A 1 20 ? -0.223  -3.608  5.099   1.00 0.00 ? 20  LYS A C    18 
ATOM   10674 O  O    . LYS A 1 20 ? -0.647  -3.146  4.041   1.00 0.00 ? 20  LYS A O    18 
ATOM   10675 C  CB   . LYS A 1 20 ? 1.607   -1.943  5.465   1.00 0.00 ? 20  LYS A CB   18 
ATOM   10676 C  CG   . LYS A 1 20 ? 1.340   -1.218  6.772   1.00 0.00 ? 20  LYS A CG   18 
ATOM   10677 C  CD   . LYS A 1 20 ? -0.085  -1.440  7.251   1.00 0.00 ? 20  LYS A CD   18 
ATOM   10678 C  CE   . LYS A 1 20 ? -0.469  -0.446  8.337   1.00 0.00 ? 20  LYS A CE   18 
ATOM   10679 N  NZ   . LYS A 1 20 ? -1.930  -0.478  8.627   1.00 0.00 ? 20  LYS A NZ   18 
ATOM   10680 H  H    . LYS A 1 20 ? 2.637   -3.715  3.938   1.00 0.00 ? 20  LYS A H    18 
ATOM   10681 H  HA   . LYS A 1 20 ? 1.371   -3.799  6.505   1.00 0.00 ? 20  LYS A HA   18 
ATOM   10682 H  HB2  . LYS A 1 20 ? 2.659   -1.852  5.235   1.00 0.00 ? 20  LYS A HB2  18 
ATOM   10683 H  HB3  . LYS A 1 20 ? 1.035   -1.461  4.686   1.00 0.00 ? 20  LYS A HB3  18 
ATOM   10684 H  HG2  . LYS A 1 20 ? 2.022   -1.586  7.524   1.00 0.00 ? 20  LYS A HG2  18 
ATOM   10685 H  HG3  . LYS A 1 20 ? 1.500   -0.159  6.625   1.00 0.00 ? 20  LYS A HG3  18 
ATOM   10686 H  HD2  . LYS A 1 20 ? -0.759  -1.321  6.416   1.00 0.00 ? 20  LYS A HD2  18 
ATOM   10687 H  HD3  . LYS A 1 20 ? -0.171  -2.442  7.646   1.00 0.00 ? 20  LYS A HD3  18 
ATOM   10688 H  HE2  . LYS A 1 20 ? 0.073   -0.689  9.237   1.00 0.00 ? 20  LYS A HE2  18 
ATOM   10689 H  HE3  . LYS A 1 20 ? -0.197  0.547   8.010   1.00 0.00 ? 20  LYS A HE3  18 
ATOM   10690 H  HZ1  . LYS A 1 20 ? -2.446  0.090   7.926   1.00 0.00 ? 20  LYS A HZ1  18 
ATOM   10691 H  HZ2  . LYS A 1 20 ? -2.114  -0.091  9.575   1.00 0.00 ? 20  LYS A HZ2  18 
ATOM   10692 H  HZ3  . LYS A 1 20 ? -2.280  -1.457  8.590   1.00 0.00 ? 20  LYS A HZ3  18 
ATOM   10693 N  N    . ALA A 1 21 ? -0.987  -4.283  5.952   1.00 0.00 ? 21  ALA A N    18 
ATOM   10694 C  CA   . ALA A 1 21 ? -2.401  -4.521  5.687   1.00 0.00 ? 21  ALA A CA   18 
ATOM   10695 C  C    . ALA A 1 21 ? -3.261  -3.390  6.241   1.00 0.00 ? 21  ALA A C    18 
ATOM   10696 O  O    . ALA A 1 21 ? -3.107  -2.987  7.394   1.00 0.00 ? 21  ALA A O    18 
ATOM   10697 C  CB   . ALA A 1 21 ? -2.831  -5.854  6.281   1.00 0.00 ? 21  ALA A CB   18 
ATOM   10698 H  H    . ALA A 1 21 ? -0.591  -4.627  6.779   1.00 0.00 ? 21  ALA A H    18 
ATOM   10699 H  HA   . ALA A 1 21 ? -2.536  -4.571  4.616   1.00 0.00 ? 21  ALA A HA   18 
ATOM   10700 H  HB1  . ALA A 1 21 ? -3.206  -5.698  7.282   1.00 0.00 ? 21  ALA A HB1  18 
ATOM   10701 H  HB2  . ALA A 1 21 ? -3.610  -6.285  5.668   1.00 0.00 ? 21  ALA A HB2  18 
ATOM   10702 H  HB3  . ALA A 1 21 ? -1.985  -6.524  6.313   1.00 0.00 ? 21  ALA A HB3  18 
ATOM   10703 N  N    . PHE A 1 22 ? -4.167  -2.882  5.413   1.00 0.00 ? 22  PHE A N    18 
ATOM   10704 C  CA   . PHE A 1 22 ? -5.051  -1.796  5.819   1.00 0.00 ? 22  PHE A CA   18 
ATOM   10705 C  C    . PHE A 1 22 ? -6.514  -2.189  5.640   1.00 0.00 ? 22  PHE A C    18 
ATOM   10706 O  O    . PHE A 1 22 ? -6.821  -3.305  5.220   1.00 0.00 ? 22  PHE A O    18 
ATOM   10707 C  CB   . PHE A 1 22 ? -4.748  -0.533  5.010   1.00 0.00 ? 22  PHE A CB   18 
ATOM   10708 C  CG   . PHE A 1 22 ? -3.289  -0.178  4.977   1.00 0.00 ? 22  PHE A CG   18 
ATOM   10709 C  CD1  . PHE A 1 22 ? -2.425  -0.822  4.106   1.00 0.00 ? 22  PHE A CD1  18 
ATOM   10710 C  CD2  . PHE A 1 22 ? -2.781  0.800   5.818   1.00 0.00 ? 22  PHE A CD2  18 
ATOM   10711 C  CE1  . PHE A 1 22 ? -1.082  -0.497  4.073   1.00 0.00 ? 22  PHE A CE1  18 
ATOM   10712 C  CE2  . PHE A 1 22 ? -1.439  1.129   5.788   1.00 0.00 ? 22  PHE A CE2  18 
ATOM   10713 C  CZ   . PHE A 1 22 ? -0.588  0.479   4.916   1.00 0.00 ? 22  PHE A CZ   18 
ATOM   10714 H  H    . PHE A 1 22 ? -4.242  -3.245  4.505   1.00 0.00 ? 22  PHE A H    18 
ATOM   10715 H  HA   . PHE A 1 22 ? -4.870  -1.596  6.864   1.00 0.00 ? 22  PHE A HA   18 
ATOM   10716 H  HB2  . PHE A 1 22 ? -5.076  -0.679  3.992   1.00 0.00 ? 22  PHE A HB2  18 
ATOM   10717 H  HB3  . PHE A 1 22 ? -5.284  0.299   5.442   1.00 0.00 ? 22  PHE A HB3  18 
ATOM   10718 H  HD1  . PHE A 1 22 ? -2.810  -1.587  3.446   1.00 0.00 ? 22  PHE A HD1  18 
ATOM   10719 H  HD2  . PHE A 1 22 ? -3.445  1.309   6.501   1.00 0.00 ? 22  PHE A HD2  18 
ATOM   10720 H  HE1  . PHE A 1 22 ? -0.420  -1.008  3.390   1.00 0.00 ? 22  PHE A HE1  18 
ATOM   10721 H  HE2  . PHE A 1 22 ? -1.056  1.893   6.449   1.00 0.00 ? 22  PHE A HE2  18 
ATOM   10722 H  HZ   . PHE A 1 22 ? 0.461   0.735   4.891   1.00 0.00 ? 22  PHE A HZ   18 
ATOM   10723 N  N    . ARG A 1 23 ? -7.413  -1.265  5.962   1.00 0.00 ? 23  ARG A N    18 
ATOM   10724 C  CA   . ARG A 1 23 ? -8.844  -1.515  5.838   1.00 0.00 ? 23  ARG A CA   18 
ATOM   10725 C  C    . ARG A 1 23 ? -9.338  -1.167  4.437   1.00 0.00 ? 23  ARG A C    18 
ATOM   10726 O  O    . ARG A 1 23 ? -10.148 -1.890  3.857   1.00 0.00 ? 23  ARG A O    18 
ATOM   10727 C  CB   . ARG A 1 23 ? -9.617  -0.703  6.879   1.00 0.00 ? 23  ARG A CB   18 
ATOM   10728 C  CG   . ARG A 1 23 ? -10.945 -1.327  7.275   1.00 0.00 ? 23  ARG A CG   18 
ATOM   10729 C  CD   . ARG A 1 23 ? -10.770 -2.358  8.378   1.00 0.00 ? 23  ARG A CD   18 
ATOM   10730 N  NE   . ARG A 1 23 ? -12.045 -2.736  8.982   1.00 0.00 ? 23  ARG A NE   18 
ATOM   10731 C  CZ   . ARG A 1 23 ? -12.852 -3.661  8.474   1.00 0.00 ? 23  ARG A CZ   18 
ATOM   10732 N  NH1  . ARG A 1 23 ? -12.518 -4.299  7.361   1.00 0.00 ? 23  ARG A NH1  18 
ATOM   10733 N  NH2  . ARG A 1 23 ? -13.996 -3.950  9.081   1.00 0.00 ? 23  ARG A NH2  18 
ATOM   10734 H  H    . ARG A 1 23 ? -7.107  -0.394  6.291   1.00 0.00 ? 23  ARG A H    18 
ATOM   10735 H  HA   . ARG A 1 23 ? -9.014  -2.566  6.017   1.00 0.00 ? 23  ARG A HA   18 
ATOM   10736 H  HB2  . ARG A 1 23 ? -9.010  -0.608  7.768   1.00 0.00 ? 23  ARG A HB2  18 
ATOM   10737 H  HB3  . ARG A 1 23 ? -9.811  0.281   6.479   1.00 0.00 ? 23  ARG A HB3  18 
ATOM   10738 H  HG2  . ARG A 1 23 ? -11.607 -0.549  7.626   1.00 0.00 ? 23  ARG A HG2  18 
ATOM   10739 H  HG3  . ARG A 1 23 ? -11.378 -1.807  6.410   1.00 0.00 ? 23  ARG A HG3  18 
ATOM   10740 H  HD2  . ARG A 1 23 ? -10.305 -3.238  7.960   1.00 0.00 ? 23  ARG A HD2  18 
ATOM   10741 H  HD3  . ARG A 1 23 ? -10.130 -1.942  9.142   1.00 0.00 ? 23  ARG A HD3  18 
ATOM   10742 H  HE   . ARG A 1 23 ? -12.312 -2.277  9.805   1.00 0.00 ? 23  ARG A HE   18 
ATOM   10743 H  HH11 . ARG A 1 23 ? -11.656 -4.084  6.902   1.00 0.00 ? 23  ARG A HH11 18 
ATOM   10744 H  HH12 . ARG A 1 23 ? -13.127 -4.996  6.982   1.00 0.00 ? 23  ARG A HH12 18 
ATOM   10745 H  HH21 . ARG A 1 23 ? -14.251 -3.471  9.921   1.00 0.00 ? 23  ARG A HH21 18 
ATOM   10746 H  HH22 . ARG A 1 23 ? -14.603 -4.646  8.699   1.00 0.00 ? 23  ARG A HH22 18 
ATOM   10747 N  N    . SER A 1 24 ? -8.844  -0.057  3.900   1.00 0.00 ? 24  SER A N    18 
ATOM   10748 C  CA   . SER A 1 24 ? -9.238  0.389   2.568   1.00 0.00 ? 24  SER A CA   18 
ATOM   10749 C  C    . SER A 1 24 ? -8.012  0.700   1.715   1.00 0.00 ? 24  SER A C    18 
ATOM   10750 O  O    . SER A 1 24 ? -6.875  0.516   2.149   1.00 0.00 ? 24  SER A O    18 
ATOM   10751 C  CB   . SER A 1 24 ? -10.132 1.627   2.666   1.00 0.00 ? 24  SER A CB   18 
ATOM   10752 O  OG   . SER A 1 24 ? -9.411  2.739   3.167   1.00 0.00 ? 24  SER A OG   18 
ATOM   10753 H  H    . SER A 1 24 ? -8.201  0.477   4.412   1.00 0.00 ? 24  SER A H    18 
ATOM   10754 H  HA   . SER A 1 24 ? -9.794  -0.410  2.102   1.00 0.00 ? 24  SER A HA   18 
ATOM   10755 H  HB2  . SER A 1 24 ? -10.512 1.871   1.686   1.00 0.00 ? 24  SER A HB2  18 
ATOM   10756 H  HB3  . SER A 1 24 ? -10.958 1.419   3.331   1.00 0.00 ? 24  SER A HB3  18 
ATOM   10757 H  HG   . SER A 1 24 ? -9.782  3.549   2.808   1.00 0.00 ? 24  SER A HG   18 
ATOM   10758 N  N    . LYS A 1 25 ? -8.252  1.172   0.496   1.00 0.00 ? 25  LYS A N    18 
ATOM   10759 C  CA   . LYS A 1 25 ? -7.170  1.511   -0.421  1.00 0.00 ? 25  LYS A CA   18 
ATOM   10760 C  C    . LYS A 1 25 ? -6.562  2.865   -0.069  1.00 0.00 ? 25  LYS A C    18 
ATOM   10761 O  O    . LYS A 1 25 ? -5.344  3.038   -0.108  1.00 0.00 ? 25  LYS A O    18 
ATOM   10762 C  CB   . LYS A 1 25 ? -7.683  1.529   -1.863  1.00 0.00 ? 25  LYS A CB   18 
ATOM   10763 C  CG   . LYS A 1 25 ? -8.798  2.532   -2.099  1.00 0.00 ? 25  LYS A CG   18 
ATOM   10764 C  CD   . LYS A 1 25 ? -9.173  2.614   -3.569  1.00 0.00 ? 25  LYS A CD   18 
ATOM   10765 C  CE   . LYS A 1 25 ? -9.703  3.992   -3.934  1.00 0.00 ? 25  LYS A CE   18 
ATOM   10766 N  NZ   . LYS A 1 25 ? -11.106 4.186   -3.476  1.00 0.00 ? 25  LYS A NZ   18 
ATOM   10767 H  H    . LYS A 1 25 ? -9.181  1.298   0.207   1.00 0.00 ? 25  LYS A H    18 
ATOM   10768 H  HA   . LYS A 1 25 ? -6.408  0.752   -0.328  1.00 0.00 ? 25  LYS A HA   18 
ATOM   10769 H  HB2  . LYS A 1 25 ? -6.862  1.773   -2.521  1.00 0.00 ? 25  LYS A HB2  18 
ATOM   10770 H  HB3  . LYS A 1 25 ? -8.053  0.545   -2.113  1.00 0.00 ? 25  LYS A HB3  18 
ATOM   10771 H  HG2  . LYS A 1 25 ? -9.667  2.231   -1.533  1.00 0.00 ? 25  LYS A HG2  18 
ATOM   10772 H  HG3  . LYS A 1 25 ? -8.470  3.507   -1.766  1.00 0.00 ? 25  LYS A HG3  18 
ATOM   10773 H  HD2  . LYS A 1 25 ? -8.298  2.407   -4.167  1.00 0.00 ? 25  LYS A HD2  18 
ATOM   10774 H  HD3  . LYS A 1 25 ? -9.937  1.877   -3.778  1.00 0.00 ? 25  LYS A HD3  18 
ATOM   10775 H  HE2  . LYS A 1 25 ? -9.076  4.738   -3.471  1.00 0.00 ? 25  LYS A HE2  18 
ATOM   10776 H  HE3  . LYS A 1 25 ? -9.665  4.105   -5.007  1.00 0.00 ? 25  LYS A HE3  18 
ATOM   10777 H  HZ1  . LYS A 1 25 ? -11.428 5.148   -3.705  1.00 0.00 ? 25  LYS A HZ1  18 
ATOM   10778 H  HZ2  . LYS A 1 25 ? -11.168 4.047   -2.447  1.00 0.00 ? 25  LYS A HZ2  18 
ATOM   10779 H  HZ3  . LYS A 1 25 ? -11.733 3.502   -3.944  1.00 0.00 ? 25  LYS A HZ3  18 
ATOM   10780 N  N    . SER A 1 26 ? -7.418  3.821   0.276   1.00 0.00 ? 26  SER A N    18 
ATOM   10781 C  CA   . SER A 1 26 ? -6.965  5.161   0.633   1.00 0.00 ? 26  SER A CA   18 
ATOM   10782 C  C    . SER A 1 26 ? -5.912  5.102   1.735   1.00 0.00 ? 26  SER A C    18 
ATOM   10783 O  O    . SER A 1 26 ? -5.056  5.981   1.839   1.00 0.00 ? 26  SER A O    18 
ATOM   10784 C  CB   . SER A 1 26 ? -8.148  6.018   1.087   1.00 0.00 ? 26  SER A CB   18 
ATOM   10785 O  OG   . SER A 1 26 ? -8.353  5.905   2.484   1.00 0.00 ? 26  SER A OG   18 
ATOM   10786 H  H    . SER A 1 26 ? -8.378  3.622   0.288   1.00 0.00 ? 26  SER A H    18 
ATOM   10787 H  HA   . SER A 1 26 ? -6.525  5.606   -0.247  1.00 0.00 ? 26  SER A HA   18 
ATOM   10788 H  HB2  . SER A 1 26 ? -7.953  7.052   0.846   1.00 0.00 ? 26  SER A HB2  18 
ATOM   10789 H  HB3  . SER A 1 26 ? -9.042  5.692   0.576   1.00 0.00 ? 26  SER A HB3  18 
ATOM   10790 H  HG   . SER A 1 26 ? -8.165  5.006   2.764   1.00 0.00 ? 26  SER A HG   18 
ATOM   10791 N  N    . TYR A 1 27 ? -5.982  4.060   2.556   1.00 0.00 ? 27  TYR A N    18 
ATOM   10792 C  CA   . TYR A 1 27 ? -5.037  3.887   3.653   1.00 0.00 ? 27  TYR A CA   18 
ATOM   10793 C  C    . TYR A 1 27 ? -3.695  3.371   3.140   1.00 0.00 ? 27  TYR A C    18 
ATOM   10794 O  O    . TYR A 1 27 ? -2.637  3.762   3.633   1.00 0.00 ? 27  TYR A O    18 
ATOM   10795 C  CB   . TYR A 1 27 ? -5.603  2.920   4.694   1.00 0.00 ? 27  TYR A CB   18 
ATOM   10796 C  CG   . TYR A 1 27 ? -6.405  3.601   5.780   1.00 0.00 ? 27  TYR A CG   18 
ATOM   10797 C  CD1  . TYR A 1 27 ? -5.843  4.604   6.559   1.00 0.00 ? 27  TYR A CD1  18 
ATOM   10798 C  CD2  . TYR A 1 27 ? -7.724  3.240   6.026   1.00 0.00 ? 27  TYR A CD2  18 
ATOM   10799 C  CE1  . TYR A 1 27 ? -6.572  5.229   7.553   1.00 0.00 ? 27  TYR A CE1  18 
ATOM   10800 C  CE2  . TYR A 1 27 ? -8.460  3.860   7.017   1.00 0.00 ? 27  TYR A CE2  18 
ATOM   10801 C  CZ   . TYR A 1 27 ? -7.880  4.853   7.778   1.00 0.00 ? 27  TYR A CZ   18 
ATOM   10802 O  OH   . TYR A 1 27 ? -8.610  5.473   8.766   1.00 0.00 ? 27  TYR A OH   18 
ATOM   10803 H  H    . TYR A 1 27 ? -6.686  3.392   2.422   1.00 0.00 ? 27  TYR A H    18 
ATOM   10804 H  HA   . TYR A 1 27 ? -4.886  4.851   4.116   1.00 0.00 ? 27  TYR A HA   18 
ATOM   10805 H  HB2  . TYR A 1 27 ? -6.249  2.209   4.201   1.00 0.00 ? 27  TYR A HB2  18 
ATOM   10806 H  HB3  . TYR A 1 27 ? -4.787  2.391   5.165   1.00 0.00 ? 27  TYR A HB3  18 
ATOM   10807 H  HD1  . TYR A 1 27 ? -4.818  4.896   6.381   1.00 0.00 ? 27  TYR A HD1  18 
ATOM   10808 H  HD2  . TYR A 1 27 ? -8.175  2.461   5.429   1.00 0.00 ? 27  TYR A HD2  18 
ATOM   10809 H  HE1  . TYR A 1 27 ? -6.118  6.007   8.149   1.00 0.00 ? 27  TYR A HE1  18 
ATOM   10810 H  HE2  . TYR A 1 27 ? -9.485  3.566   7.193   1.00 0.00 ? 27  TYR A HE2  18 
ATOM   10811 H  HH   . TYR A 1 27 ? -9.043  4.808   9.308   1.00 0.00 ? 27  TYR A HH   18 
ATOM   10812 N  N    . LEU A 1 28 ? -3.748  2.491   2.146   1.00 0.00 ? 28  LEU A N    18 
ATOM   10813 C  CA   . LEU A 1 28 ? -2.538  1.921   1.564   1.00 0.00 ? 28  LEU A CA   18 
ATOM   10814 C  C    . LEU A 1 28 ? -1.835  2.936   0.668   1.00 0.00 ? 28  LEU A C    18 
ATOM   10815 O  O    . LEU A 1 28 ? -0.606  3.009   0.643   1.00 0.00 ? 28  LEU A O    18 
ATOM   10816 C  CB   . LEU A 1 28 ? -2.878  0.664   0.760   1.00 0.00 ? 28  LEU A CB   18 
ATOM   10817 C  CG   . LEU A 1 28 ? -1.792  0.161   -0.190  1.00 0.00 ? 28  LEU A CG   18 
ATOM   10818 C  CD1  . LEU A 1 28 ? -0.614  -0.398  0.594   1.00 0.00 ? 28  LEU A CD1  18 
ATOM   10819 C  CD2  . LEU A 1 28 ? -2.354  -0.893  -1.133  1.00 0.00 ? 28  LEU A CD2  18 
ATOM   10820 H  H    . LEU A 1 28 ? -4.621  2.218   1.795   1.00 0.00 ? 28  LEU A H    18 
ATOM   10821 H  HA   . LEU A 1 28 ? -1.876  1.653   2.373   1.00 0.00 ? 28  LEU A HA   18 
ATOM   10822 H  HB2  . LEU A 1 28 ? -3.097  -0.126  1.461   1.00 0.00 ? 28  LEU A HB2  18 
ATOM   10823 H  HB3  . LEU A 1 28 ? -3.760  0.877   0.173   1.00 0.00 ? 28  LEU A HB3  18 
ATOM   10824 H  HG   . LEU A 1 28 ? -1.432  0.988   -0.787  1.00 0.00 ? 28  LEU A HG   18 
ATOM   10825 H  HD11 . LEU A 1 28 ? 0.303   -0.188  0.065   1.00 0.00 ? 28  LEU A HD11 18 
ATOM   10826 H  HD12 . LEU A 1 28 ? -0.730  -1.466  0.705   1.00 0.00 ? 28  LEU A HD12 18 
ATOM   10827 H  HD13 . LEU A 1 28 ? -0.581  0.063   1.570   1.00 0.00 ? 28  LEU A HD13 18 
ATOM   10828 H  HD21 . LEU A 1 28 ? -1.804  -1.814  -1.014  1.00 0.00 ? 28  LEU A HD21 18 
ATOM   10829 H  HD22 . LEU A 1 28 ? -2.264  -0.547  -2.152  1.00 0.00 ? 28  LEU A HD22 18 
ATOM   10830 H  HD23 . LEU A 1 28 ? -3.396  -1.063  -0.902  1.00 0.00 ? 28  LEU A HD23 18 
ATOM   10831 N  N    . ILE A 1 29 ? -2.622  3.717   -0.064  1.00 0.00 ? 29  ILE A N    18 
ATOM   10832 C  CA   . ILE A 1 29 ? -2.074  4.730   -0.958  1.00 0.00 ? 29  ILE A CA   18 
ATOM   10833 C  C    . ILE A 1 29 ? -1.332  5.809   -0.177  1.00 0.00 ? 29  ILE A C    18 
ATOM   10834 O  O    . ILE A 1 29 ? -0.185  6.136   -0.486  1.00 0.00 ? 29  ILE A O    18 
ATOM   10835 C  CB   . ILE A 1 29 ? -3.178  5.391   -1.803  1.00 0.00 ? 29  ILE A CB   18 
ATOM   10836 C  CG1  . ILE A 1 29 ? -3.907  4.340   -2.642  1.00 0.00 ? 29  ILE A CG1  18 
ATOM   10837 C  CG2  . ILE A 1 29 ? -2.586  6.472   -2.695  1.00 0.00 ? 29  ILE A CG2  18 
ATOM   10838 C  CD1  . ILE A 1 29 ? -5.340  4.706   -2.958  1.00 0.00 ? 29  ILE A CD1  18 
ATOM   10839 H  H    . ILE A 1 29 ? -3.593  3.611   -0.000  1.00 0.00 ? 29  ILE A H    18 
ATOM   10840 H  HA   . ILE A 1 29 ? -1.379  4.243   -1.627  1.00 0.00 ? 29  ILE A HA   18 
ATOM   10841 H  HB   . ILE A 1 29 ? -3.883  5.858   -1.133  1.00 0.00 ? 29  ILE A HB   18 
ATOM   10842 H  HG12 . ILE A 1 29 ? -3.385  4.209   -3.577  1.00 0.00 ? 29  ILE A HG12 18 
ATOM   10843 H  HG13 . ILE A 1 29 ? -3.914  3.403   -2.105  1.00 0.00 ? 29  ILE A HG13 18 
ATOM   10844 H  HG21 . ILE A 1 29 ? -1.550  6.628   -2.433  1.00 0.00 ? 29  ILE A HG21 18 
ATOM   10845 H  HG22 . ILE A 1 29 ? -2.652  6.162   -3.728  1.00 0.00 ? 29  ILE A HG22 18 
ATOM   10846 H  HG23 . ILE A 1 29 ? -3.134  7.392   -2.559  1.00 0.00 ? 29  ILE A HG23 18 
ATOM   10847 H  HD11 . ILE A 1 29 ? -5.706  4.073   -3.754  1.00 0.00 ? 29  ILE A HD11 18 
ATOM   10848 H  HD12 . ILE A 1 29 ? -5.950  4.566   -2.079  1.00 0.00 ? 29  ILE A HD12 18 
ATOM   10849 H  HD13 . ILE A 1 29 ? -5.388  5.738   -3.271  1.00 0.00 ? 29  ILE A HD13 18 
ATOM   10850 N  N    . ILE A 1 30 ? -1.992  6.357   0.838   1.00 0.00 ? 30  ILE A N    18 
ATOM   10851 C  CA   . ILE A 1 30 ? -1.394  7.398   1.665   1.00 0.00 ? 30  ILE A CA   18 
ATOM   10852 C  C    . ILE A 1 30 ? -0.202  6.859   2.449   1.00 0.00 ? 30  ILE A C    18 
ATOM   10853 O  O    . ILE A 1 30 ? 0.568   7.623   3.032   1.00 0.00 ? 30  ILE A O    18 
ATOM   10854 C  CB   . ILE A 1 30 ? -2.417  7.990   2.651   1.00 0.00 ? 30  ILE A CB   18 
ATOM   10855 C  CG1  . ILE A 1 30 ? -2.932  6.906   3.600   1.00 0.00 ? 30  ILE A CG1  18 
ATOM   10856 C  CG2  . ILE A 1 30 ? -3.572  8.631   1.896   1.00 0.00 ? 30  ILE A CG2  18 
ATOM   10857 C  CD1  . ILE A 1 30 ? -2.092  6.747   4.848   1.00 0.00 ? 30  ILE A CD1  18 
ATOM   10858 H  H    . ILE A 1 30 ? -2.903  6.055   1.035   1.00 0.00 ? 30  ILE A H    18 
ATOM   10859 H  HA   . ILE A 1 30 ? -1.054  8.188   1.012   1.00 0.00 ? 30  ILE A HA   18 
ATOM   10860 H  HB   . ILE A 1 30 ? -1.925  8.759   3.228   1.00 0.00 ? 30  ILE A HB   18 
ATOM   10861 H  HG12 . ILE A 1 30 ? -3.936  7.150   3.906   1.00 0.00 ? 30  ILE A HG12 18 
ATOM   10862 H  HG13 . ILE A 1 30 ? -2.938  5.958   3.081   1.00 0.00 ? 30  ILE A HG13 18 
ATOM   10863 H  HG21 . ILE A 1 30 ? -3.431  9.702   1.864   1.00 0.00 ? 30  ILE A HG21 18 
ATOM   10864 H  HG22 . ILE A 1 30 ? -3.602  8.243   0.889   1.00 0.00 ? 30  ILE A HG22 18 
ATOM   10865 H  HG23 . ILE A 1 30 ? -4.501  8.405   2.397   1.00 0.00 ? 30  ILE A HG23 18 
ATOM   10866 H  HD11 . ILE A 1 30 ? -1.535  7.656   5.025   1.00 0.00 ? 30  ILE A HD11 18 
ATOM   10867 H  HD12 . ILE A 1 30 ? -2.736  6.550   5.693   1.00 0.00 ? 30  ILE A HD12 18 
ATOM   10868 H  HD13 . ILE A 1 30 ? -1.405  5.924   4.718   1.00 0.00 ? 30  ILE A HD13 18 
ATOM   10869 N  N    . HIS A 1 31 ? -0.055  5.538   2.458   1.00 0.00 ? 31  HIS A N    18 
ATOM   10870 C  CA   . HIS A 1 31 ? 1.046   4.896   3.169   1.00 0.00 ? 31  HIS A CA   18 
ATOM   10871 C  C    . HIS A 1 31 ? 2.224   4.644   2.232   1.00 0.00 ? 31  HIS A C    18 
ATOM   10872 O  O    . HIS A 1 31 ? 3.353   5.044   2.516   1.00 0.00 ? 31  HIS A O    18 
ATOM   10873 C  CB   . HIS A 1 31 ? 0.581   3.578   3.788   1.00 0.00 ? 31  HIS A CB   18 
ATOM   10874 C  CG   . HIS A 1 31 ? 1.675   2.566   3.934   1.00 0.00 ? 31  HIS A CG   18 
ATOM   10875 N  ND1  . HIS A 1 31 ? 2.219   2.215   5.151   1.00 0.00 ? 31  HIS A ND1  18 
ATOM   10876 C  CD2  . HIS A 1 31 ? 2.326   1.826   3.005   1.00 0.00 ? 31  HIS A CD2  18 
ATOM   10877 C  CE1  . HIS A 1 31 ? 3.158   1.305   4.966   1.00 0.00 ? 31  HIS A CE1  18 
ATOM   10878 N  NE2  . HIS A 1 31 ? 3.243   1.051   3.672   1.00 0.00 ? 31  HIS A NE2  18 
ATOM   10879 H  H    . HIS A 1 31 ? -0.701  4.982   1.975   1.00 0.00 ? 31  HIS A H    18 
ATOM   10880 H  HA   . HIS A 1 31 ? 1.364   5.562   3.957   1.00 0.00 ? 31  HIS A HA   18 
ATOM   10881 H  HB2  . HIS A 1 31 ? 0.177   3.772   4.771   1.00 0.00 ? 31  HIS A HB2  18 
ATOM   10882 H  HB3  . HIS A 1 31 ? -0.190  3.147   3.166   1.00 0.00 ? 31  HIS A HB3  18 
ATOM   10883 H  HD1  . HIS A 1 31 ? 1.956   2.580   6.021   1.00 0.00 ? 31  HIS A HD1  18 
ATOM   10884 H  HD2  . HIS A 1 31 ? 2.157   1.842   1.938   1.00 0.00 ? 31  HIS A HD2  18 
ATOM   10885 H  HE1  . HIS A 1 31 ? 3.755   0.845   5.739   1.00 0.00 ? 31  HIS A HE1  18 
ATOM   10886 N  N    . THR A 1 32 ? 1.953   3.978   1.114   1.00 0.00 ? 32  THR A N    18 
ATOM   10887 C  CA   . THR A 1 32 ? 2.990   3.671   0.137   1.00 0.00 ? 32  THR A CA   18 
ATOM   10888 C  C    . THR A 1 32 ? 3.943   4.848   -0.041  1.00 0.00 ? 32  THR A C    18 
ATOM   10889 O  O    . THR A 1 32 ? 5.128   4.662   -0.317  1.00 0.00 ? 32  THR A O    18 
ATOM   10890 C  CB   . THR A 1 32 ? 2.383   3.306   -1.231  1.00 0.00 ? 32  THR A CB   18 
ATOM   10891 O  OG1  . THR A 1 32 ? 1.499   2.188   -1.092  1.00 0.00 ? 32  THR A OG1  18 
ATOM   10892 C  CG2  . THR A 1 32 ? 3.475   2.974   -2.236  1.00 0.00 ? 32  THR A CG2  18 
ATOM   10893 H  H    . THR A 1 32 ? 1.033   3.686   0.944   1.00 0.00 ? 32  THR A H    18 
ATOM   10894 H  HA   . THR A 1 32 ? 3.547   2.820   0.499   1.00 0.00 ? 32  THR A HA   18 
ATOM   10895 H  HB   . THR A 1 32 ? 1.822   4.155   -1.597  1.00 0.00 ? 32  THR A HB   18 
ATOM   10896 H  HG1  . THR A 1 32 ? 0.721   2.454   -0.596  1.00 0.00 ? 32  THR A HG1  18 
ATOM   10897 H  HG21 . THR A 1 32 ? 3.421   1.927   -2.492  1.00 0.00 ? 32  THR A HG21 18 
ATOM   10898 H  HG22 . THR A 1 32 ? 4.440   3.190   -1.804  1.00 0.00 ? 32  THR A HG22 18 
ATOM   10899 H  HG23 . THR A 1 32 ? 3.337   3.570   -3.127  1.00 0.00 ? 32  THR A HG23 18 
ATOM   10900 N  N    . ARG A 1 33 ? 3.419   6.058   0.120   1.00 0.00 ? 33  ARG A N    18 
ATOM   10901 C  CA   . ARG A 1 33 ? 4.224   7.265   -0.023  1.00 0.00 ? 33  ARG A CA   18 
ATOM   10902 C  C    . ARG A 1 33 ? 5.216   7.396   1.128   1.00 0.00 ? 33  ARG A C    18 
ATOM   10903 O  O    . ARG A 1 33 ? 6.373   7.767   0.927   1.00 0.00 ? 33  ARG A O    18 
ATOM   10904 C  CB   . ARG A 1 33 ? 3.324   8.501   -0.079  1.00 0.00 ? 33  ARG A CB   18 
ATOM   10905 C  CG   . ARG A 1 33 ? 2.404   8.638   1.123   1.00 0.00 ? 33  ARG A CG   18 
ATOM   10906 C  CD   . ARG A 1 33 ? 1.315   9.670   0.875   1.00 0.00 ? 33  ARG A CD   18 
ATOM   10907 N  NE   . ARG A 1 33 ? 0.762   10.193  2.122   1.00 0.00 ? 33  ARG A NE   18 
ATOM   10908 C  CZ   . ARG A 1 33 ? -0.453  10.719  2.223   1.00 0.00 ? 33  ARG A CZ   18 
ATOM   10909 N  NH1  . ARG A 1 33 ? -1.239  10.793  1.158   1.00 0.00 ? 33  ARG A NH1  18 
ATOM   10910 N  NH2  . ARG A 1 33 ? -0.885  11.174  3.393   1.00 0.00 ? 33  ARG A NH2  18 
ATOM   10911 H  H    . ARG A 1 33 ? 2.467   6.142   0.340   1.00 0.00 ? 33  ARG A H    18 
ATOM   10912 H  HA   . ARG A 1 33 ? 4.774   7.189   -0.949  1.00 0.00 ? 33  ARG A HA   18 
ATOM   10913 H  HB2  . ARG A 1 33 ? 3.946   9.382   -0.131  1.00 0.00 ? 33  ARG A HB2  18 
ATOM   10914 H  HB3  . ARG A 1 33 ? 2.714   8.447   -0.968  1.00 0.00 ? 33  ARG A HB3  18 
ATOM   10915 H  HG2  . ARG A 1 33 ? 1.940   7.683   1.321   1.00 0.00 ? 33  ARG A HG2  18 
ATOM   10916 H  HG3  . ARG A 1 33 ? 2.988   8.942   1.979   1.00 0.00 ? 33  ARG A HG3  18 
ATOM   10917 H  HD2  . ARG A 1 33 ? 1.734   10.488  0.308   1.00 0.00 ? 33  ARG A HD2  18 
ATOM   10918 H  HD3  . ARG A 1 33 ? 0.522   9.208   0.306   1.00 0.00 ? 33  ARG A HD3  18 
ATOM   10919 H  HE   . ARG A 1 33 ? 1.326   10.149  2.922   1.00 0.00 ? 33  ARG A HE   18 
ATOM   10920 H  HH11 . ARG A 1 33 ? -0.916  10.450  0.275   1.00 0.00 ? 33  ARG A HH11 18 
ATOM   10921 H  HH12 . ARG A 1 33 ? -2.154  11.188  1.237   1.00 0.00 ? 33  ARG A HH12 18 
ATOM   10922 H  HH21 . ARG A 1 33 ? -0.296  11.120  4.198   1.00 0.00 ? 33  ARG A HH21 18 
ATOM   10923 H  HH22 . ARG A 1 33 ? -1.800  11.570  3.468   1.00 0.00 ? 33  ARG A HH22 18 
ATOM   10924 N  N    . THR A 1 34 ? 4.756   7.090   2.337   1.00 0.00 ? 34  THR A N    18 
ATOM   10925 C  CA   . THR A 1 34 ? 5.601   7.175   3.522   1.00 0.00 ? 34  THR A CA   18 
ATOM   10926 C  C    . THR A 1 34 ? 6.934   6.472   3.297   1.00 0.00 ? 34  THR A C    18 
ATOM   10927 O  O    . THR A 1 34 ? 7.958   6.865   3.858   1.00 0.00 ? 34  THR A O    18 
ATOM   10928 C  CB   . THR A 1 34 ? 4.909   6.558   4.752   1.00 0.00 ? 34  THR A CB   18 
ATOM   10929 O  OG1  . THR A 1 34 ? 4.722   5.152   4.555   1.00 0.00 ? 34  THR A OG1  18 
ATOM   10930 C  CG2  . THR A 1 34 ? 3.564   7.223   5.006   1.00 0.00 ? 34  THR A CG2  18 
ATOM   10931 H  H    . THR A 1 34 ? 3.824   6.800   2.434   1.00 0.00 ? 34  THR A H    18 
ATOM   10932 H  HA   . THR A 1 34 ? 5.786   8.220   3.725   1.00 0.00 ? 34  THR A HA   18 
ATOM   10933 H  HB   . THR A 1 34 ? 5.539   6.713   5.616   1.00 0.00 ? 34  THR A HB   18 
ATOM   10934 H  HG1  . THR A 1 34 ? 4.773   4.951   3.618   1.00 0.00 ? 34  THR A HG1  18 
ATOM   10935 H  HG21 . THR A 1 34 ? 3.722   8.211   5.410   1.00 0.00 ? 34  THR A HG21 18 
ATOM   10936 H  HG22 . THR A 1 34 ? 2.998   6.632   5.711   1.00 0.00 ? 34  THR A HG22 18 
ATOM   10937 H  HG23 . THR A 1 34 ? 3.018   7.296   4.077   1.00 0.00 ? 34  THR A HG23 18 
ATOM   10938 N  N    . HIS A 1 35 ? 6.917   5.429   2.473   1.00 0.00 ? 35  HIS A N    18 
ATOM   10939 C  CA   . HIS A 1 35 ? 8.126   4.671   2.173   1.00 0.00 ? 35  HIS A CA   18 
ATOM   10940 C  C    . HIS A 1 35 ? 9.290   5.606   1.859   1.00 0.00 ? 35  HIS A C    18 
ATOM   10941 O  O    . HIS A 1 35 ? 10.444  5.306   2.168   1.00 0.00 ? 35  HIS A O    18 
ATOM   10942 C  CB   . HIS A 1 35 ? 7.883   3.727   0.995   1.00 0.00 ? 35  HIS A CB   18 
ATOM   10943 C  CG   . HIS A 1 35 ? 7.245   2.431   1.388   1.00 0.00 ? 35  HIS A CG   18 
ATOM   10944 N  ND1  . HIS A 1 35 ? 7.917   1.226   1.374   1.00 0.00 ? 35  HIS A ND1  18 
ATOM   10945 C  CD2  . HIS A 1 35 ? 5.989   2.154   1.810   1.00 0.00 ? 35  HIS A CD2  18 
ATOM   10946 C  CE1  . HIS A 1 35 ? 7.101   0.265   1.768   1.00 0.00 ? 35  HIS A CE1  18 
ATOM   10947 N  NE2  . HIS A 1 35 ? 5.925   0.801   2.039   1.00 0.00 ? 35  HIS A NE2  18 
ATOM   10948 H  H    . HIS A 1 35 ? 6.071   5.164   2.056   1.00 0.00 ? 35  HIS A H    18 
ATOM   10949 H  HA   . HIS A 1 35 ? 8.376   4.087   3.045   1.00 0.00 ? 35  HIS A HA   18 
ATOM   10950 H  HB2  . HIS A 1 35 ? 7.234   4.213   0.281   1.00 0.00 ? 35  HIS A HB2  18 
ATOM   10951 H  HB3  . HIS A 1 35 ? 8.828   3.503   0.520   1.00 0.00 ? 35  HIS A HB3  18 
ATOM   10952 H  HD1  . HIS A 1 35 ? 8.852   1.096   1.112   1.00 0.00 ? 35  HIS A HD1  18 
ATOM   10953 H  HD2  . HIS A 1 35 ? 5.185   2.865   1.941   1.00 0.00 ? 35  HIS A HD2  18 
ATOM   10954 H  HE1  . HIS A 1 35 ? 7.353   -0.781  1.855   1.00 0.00 ? 35  HIS A HE1  18 
ATOM   10955 N  N    . THR A 1 36 ? 8.980   6.742   1.241   1.00 0.00 ? 36  THR A N    18 
ATOM   10956 C  CA   . THR A 1 36 ? 9.999   7.721   0.884   1.00 0.00 ? 36  THR A CA   18 
ATOM   10957 C  C    . THR A 1 36 ? 10.895  8.042   2.075   1.00 0.00 ? 36  THR A C    18 
ATOM   10958 O  O    . THR A 1 36 ? 12.108  7.846   2.022   1.00 0.00 ? 36  THR A O    18 
ATOM   10959 C  CB   . THR A 1 36 ? 9.368   9.026   0.364   1.00 0.00 ? 36  THR A CB   18 
ATOM   10960 O  OG1  . THR A 1 36 ? 8.462   9.554   1.339   1.00 0.00 ? 36  THR A OG1  18 
ATOM   10961 C  CG2  . THR A 1 36 ? 8.629   8.786   -0.944  1.00 0.00 ? 36  THR A CG2  18 
ATOM   10962 H  H    . THR A 1 36 ? 8.043   6.925   1.021   1.00 0.00 ? 36  THR A H    18 
ATOM   10963 H  HA   . THR A 1 36 ? 10.604  7.299   0.094   1.00 0.00 ? 36  THR A HA   18 
ATOM   10964 H  HB   . THR A 1 36 ? 10.156  9.745   0.189   1.00 0.00 ? 36  THR A HB   18 
ATOM   10965 H  HG1  . THR A 1 36 ? 7.692   9.919   0.896   1.00 0.00 ? 36  THR A HG1  18 
ATOM   10966 H  HG21 . THR A 1 36 ? 8.656   9.684   -1.542  1.00 0.00 ? 36  THR A HG21 18 
ATOM   10967 H  HG22 . THR A 1 36 ? 7.603   8.524   -0.736  1.00 0.00 ? 36  THR A HG22 18 
ATOM   10968 H  HG23 . THR A 1 36 ? 9.105   7.980   -1.484  1.00 0.00 ? 36  THR A HG23 18 
ATOM   10969 N  N    . GLY A 1 37 ? 10.288  8.537   3.149   1.00 0.00 ? 37  GLY A N    18 
ATOM   10970 C  CA   . GLY A 1 37 ? 11.046  8.877   4.339   1.00 0.00 ? 37  GLY A CA   18 
ATOM   10971 C  C    . GLY A 1 37 ? 10.511  10.113  5.034   1.00 0.00 ? 37  GLY A C    18 
ATOM   10972 O  O    . GLY A 1 37 ? 11.123  11.179  4.976   1.00 0.00 ? 37  GLY A O    18 
ATOM   10973 H  H    . GLY A 1 37 ? 9.317   8.672   3.134   1.00 0.00 ? 37  GLY A H    18 
ATOM   10974 H  HA2  . GLY A 1 37 ? 11.009  8.045   5.026   1.00 0.00 ? 37  GLY A HA2  18 
ATOM   10975 H  HA3  . GLY A 1 37 ? 12.075  9.053   4.058   1.00 0.00 ? 37  GLY A HA3  18 
ATOM   10976 N  N    . GLU A 1 38 ? 9.365   9.971   5.692   1.00 0.00 ? 38  GLU A N    18 
ATOM   10977 C  CA   . GLU A 1 38 ? 8.747   11.086  6.399   1.00 0.00 ? 38  GLU A CA   18 
ATOM   10978 C  C    . GLU A 1 38 ? 8.963   10.964  7.904   1.00 0.00 ? 38  GLU A C    18 
ATOM   10979 O  O    . GLU A 1 38 ? 8.204   10.288  8.598   1.00 0.00 ? 38  GLU A O    18 
ATOM   10980 C  CB   . GLU A 1 38 ? 7.249   11.147  6.091   1.00 0.00 ? 38  GLU A CB   18 
ATOM   10981 C  CG   . GLU A 1 38 ? 6.492   12.148  6.948   1.00 0.00 ? 38  GLU A CG   18 
ATOM   10982 C  CD   . GLU A 1 38 ? 5.042   11.757  7.157   1.00 0.00 ? 38  GLU A CD   18 
ATOM   10983 O  OE1  . GLU A 1 38 ? 4.434   11.203  6.218   1.00 0.00 ? 38  GLU A OE1  18 
ATOM   10984 O  OE2  . GLU A 1 38 ? 4.515   12.005  8.262   1.00 0.00 ? 38  GLU A OE2  18 
ATOM   10985 H  H    . GLU A 1 38 ? 8.925   9.095   5.702   1.00 0.00 ? 38  GLU A H    18 
ATOM   10986 H  HA   . GLU A 1 38 ? 9.213   11.997  6.053   1.00 0.00 ? 38  GLU A HA   18 
ATOM   10987 H  HB2  . GLU A 1 38 ? 7.118   11.419  5.054   1.00 0.00 ? 38  GLU A HB2  18 
ATOM   10988 H  HB3  . GLU A 1 38 ? 6.821   10.169  6.254   1.00 0.00 ? 38  GLU A HB3  18 
ATOM   10989 H  HG2  . GLU A 1 38 ? 6.974   12.214  7.912   1.00 0.00 ? 38  GLU A HG2  18 
ATOM   10990 H  HG3  . GLU A 1 38 ? 6.523   13.113  6.464   1.00 0.00 ? 38  GLU A HG3  18 
ATOM   10991 N  N    . SER A 1 39 ? 10.005  11.622  8.402   1.00 0.00 ? 39  SER A N    18 
ATOM   10992 C  CA   . SER A 1 39 ? 10.325  11.584  9.824   1.00 0.00 ? 39  SER A CA   18 
ATOM   10993 C  C    . SER A 1 39 ? 10.043  12.932  10.481  1.00 0.00 ? 39  SER A C    18 
ATOM   10994 O  O    . SER A 1 39 ? 10.922  13.788  10.571  1.00 0.00 ? 39  SER A O    18 
ATOM   10995 C  CB   . SER A 1 39 ? 11.793  11.202  10.028  1.00 0.00 ? 39  SER A CB   18 
ATOM   10996 O  OG   . SER A 1 39 ? 11.954  9.795   10.057  1.00 0.00 ? 39  SER A OG   18 
ATOM   10997 H  H    . SER A 1 39 ? 10.574  12.144  7.797   1.00 0.00 ? 39  SER A H    18 
ATOM   10998 H  HA   . SER A 1 39 ? 9.700   10.834  10.284  1.00 0.00 ? 39  SER A HA   18 
ATOM   10999 H  HB2  . SER A 1 39 ? 12.383  11.603  9.217   1.00 0.00 ? 39  SER A HB2  18 
ATOM   11000 H  HB3  . SER A 1 39 ? 12.142  11.613  10.964  1.00 0.00 ? 39  SER A HB3  18 
ATOM   11001 H  HG   . SER A 1 39 ? 12.741  9.552   9.564   1.00 0.00 ? 39  SER A HG   18 
ATOM   11002 N  N    . GLY A 1 40 ? 8.808   13.113  10.938  1.00 0.00 ? 40  GLY A N    18 
ATOM   11003 C  CA   . GLY A 1 40 ? 8.430   14.358  11.580  1.00 0.00 ? 40  GLY A CA   18 
ATOM   11004 C  C    . GLY A 1 40 ? 7.045   14.297  12.195  1.00 0.00 ? 40  GLY A C    18 
ATOM   11005 O  O    . GLY A 1 40 ? 6.078   14.833  11.653  1.00 0.00 ? 40  GLY A O    18 
ATOM   11006 H  H    . GLY A 1 40 ? 8.148   12.396  10.838  1.00 0.00 ? 40  GLY A H    18 
ATOM   11007 H  HA2  . GLY A 1 40 ? 9.147   14.583  12.356  1.00 0.00 ? 40  GLY A HA2  18 
ATOM   11008 H  HA3  . GLY A 1 40 ? 8.450   15.150  10.846  1.00 0.00 ? 40  GLY A HA3  18 
ATOM   11009 N  N    . PRO A 1 41 ? 6.936   13.629  13.352  1.00 0.00 ? 41  PRO A N    18 
ATOM   11010 C  CA   . PRO A 1 41 ? 5.664   13.482  14.065  1.00 0.00 ? 41  PRO A CA   18 
ATOM   11011 C  C    . PRO A 1 41 ? 5.181   14.798  14.666  1.00 0.00 ? 41  PRO A C    18 
ATOM   11012 O  O    . PRO A 1 41 ? 3.993   15.116  14.614  1.00 0.00 ? 41  PRO A O    18 
ATOM   11013 C  CB   . PRO A 1 41 ? 5.991   12.476  15.172  1.00 0.00 ? 41  PRO A CB   18 
ATOM   11014 C  CG   . PRO A 1 41 ? 7.457   12.622  15.395  1.00 0.00 ? 41  PRO A CG   18 
ATOM   11015 C  CD   . PRO A 1 41 ? 8.047   12.965  14.055  1.00 0.00 ? 41  PRO A CD   18 
ATOM   11016 H  HA   . PRO A 1 41 ? 4.894   13.077  13.424  1.00 0.00 ? 41  PRO A HA   18 
ATOM   11017 H  HB2  . PRO A 1 41 ? 5.429   12.722  16.062  1.00 0.00 ? 41  PRO A HB2  18 
ATOM   11018 H  HB3  . PRO A 1 41 ? 5.739   11.479  14.843  1.00 0.00 ? 41  PRO A HB3  18 
ATOM   11019 H  HG2  . PRO A 1 41 ? 7.644   13.416  16.101  1.00 0.00 ? 41  PRO A HG2  18 
ATOM   11020 H  HG3  . PRO A 1 41 ? 7.866   11.691  15.757  1.00 0.00 ? 41  PRO A HG3  18 
ATOM   11021 H  HD2  . PRO A 1 41 ? 8.885   13.636  14.172  1.00 0.00 ? 41  PRO A HD2  18 
ATOM   11022 H  HD3  . PRO A 1 41 ? 8.350   12.068  13.535  1.00 0.00 ? 41  PRO A HD3  18 
ATOM   11023 N  N    . SER A 1 42 ? 6.110   15.558  15.237  1.00 0.00 ? 42  SER A N    18 
ATOM   11024 C  CA   . SER A 1 42 ? 5.778   16.839  15.851  1.00 0.00 ? 42  SER A CA   18 
ATOM   11025 C  C    . SER A 1 42 ? 4.901   16.639  17.083  1.00 0.00 ? 42  SER A C    18 
ATOM   11026 O  O    . SER A 1 42 ? 3.937   17.374  17.298  1.00 0.00 ? 42  SER A O    18 
ATOM   11027 C  CB   . SER A 1 42 ? 5.065   17.742  14.843  1.00 0.00 ? 42  SER A CB   18 
ATOM   11028 O  OG   . SER A 1 42 ? 5.097   19.096  15.261  1.00 0.00 ? 42  SER A OG   18 
ATOM   11029 H  H    . SER A 1 42 ? 7.040   15.249  15.247  1.00 0.00 ? 42  SER A H    18 
ATOM   11030 H  HA   . SER A 1 42 ? 6.701   17.310  16.154  1.00 0.00 ? 42  SER A HA   18 
ATOM   11031 H  HB2  . SER A 1 42 ? 5.552   17.662  13.884  1.00 0.00 ? 42  SER A HB2  18 
ATOM   11032 H  HB3  . SER A 1 42 ? 4.034   17.430  14.751  1.00 0.00 ? 42  SER A HB3  18 
ATOM   11033 H  HG   . SER A 1 42 ? 5.768   19.569  14.763  1.00 0.00 ? 42  SER A HG   18 
ATOM   11034 N  N    . SER A 1 43 ? 5.242   15.639  17.889  1.00 0.00 ? 43  SER A N    18 
ATOM   11035 C  CA   . SER A 1 43 ? 4.484   15.338  19.098  1.00 0.00 ? 43  SER A CA   18 
ATOM   11036 C  C    . SER A 1 43 ? 5.179   15.908  20.331  1.00 0.00 ? 43  SER A C    18 
ATOM   11037 O  O    . SER A 1 43 ? 4.558   16.582  21.152  1.00 0.00 ? 43  SER A O    18 
ATOM   11038 C  CB   . SER A 1 43 ? 4.306   13.827  19.252  1.00 0.00 ? 43  SER A CB   18 
ATOM   11039 O  OG   . SER A 1 43 ? 3.714   13.263  18.094  1.00 0.00 ? 43  SER A OG   18 
ATOM   11040 H  H    . SER A 1 43 ? 6.021   15.088  17.664  1.00 0.00 ? 43  SER A H    18 
ATOM   11041 H  HA   . SER A 1 43 ? 3.512   15.799  19.002  1.00 0.00 ? 43  SER A HA   18 
ATOM   11042 H  HB2  . SER A 1 43 ? 5.270   13.367  19.408  1.00 0.00 ? 43  SER A HB2  18 
ATOM   11043 H  HB3  . SER A 1 43 ? 3.670   13.626  20.101  1.00 0.00 ? 43  SER A HB3  18 
ATOM   11044 H  HG   . SER A 1 43 ? 3.648   12.311  18.200  1.00 0.00 ? 43  SER A HG   18 
ATOM   11045 N  N    . GLY A 1 44 ? 6.474   15.631  20.453  1.00 0.00 ? 44  GLY A N    18 
ATOM   11046 C  CA   . GLY A 1 44 ? 7.233   16.123  21.588  1.00 0.00 ? 44  GLY A CA   18 
ATOM   11047 C  C    . GLY A 1 44 ? 6.883   15.404  22.876  1.00 0.00 ? 44  GLY A C    18 
ATOM   11048 O  O    . GLY A 1 44 ? 7.327   15.831  23.940  1.00 0.00 ? 44  GLY A O    18 
ATOM   11049 H  H    . GLY A 1 44 ? 6.917   15.089  19.768  1.00 0.00 ? 44  GLY A H    18 
ATOM   11050 H  HA2  . GLY A 1 44 ? 8.286   15.989  21.388  1.00 0.00 ? 44  GLY A HA2  18 
ATOM   11051 H  HA3  . GLY A 1 44 ? 7.032   17.177  21.712  1.00 0.00 ? 44  GLY A HA3  18 
HETATM 11052 ZN ZN   . ZN  B 2 .  ? 4.475   -0.306  2.648   1.00 0.00 ? 181 ZN  A ZN   18 
ATOM   11053 N  N    . GLY A 1 1  ? 15.063  -9.276  -17.632 1.00 0.00 ? 1   GLY A N    19 
ATOM   11054 C  CA   . GLY A 1 1  ? 13.637  -9.507  -17.498 1.00 0.00 ? 1   GLY A CA   19 
ATOM   11055 C  C    . GLY A 1 1  ? 13.322  -10.688 -16.602 1.00 0.00 ? 1   GLY A C    19 
ATOM   11056 O  O    . GLY A 1 1  ? 13.214  -11.821 -17.073 1.00 0.00 ? 1   GLY A O    19 
ATOM   11057 H  H1   . GLY A 1 1  ? 15.408  -8.360  -17.673 1.00 0.00 ? 1   GLY A H1   19 
ATOM   11058 H  HA2  . GLY A 1 1  ? 13.178  -8.622  -17.083 1.00 0.00 ? 1   GLY A HA2  19 
ATOM   11059 H  HA3  . GLY A 1 1  ? 13.219  -9.691  -18.477 1.00 0.00 ? 1   GLY A HA3  19 
ATOM   11060 N  N    . SER A 1 2  ? 13.176  -10.426 -15.307 1.00 0.00 ? 2   SER A N    19 
ATOM   11061 C  CA   . SER A 1 2  ? 12.878  -11.478 -14.343 1.00 0.00 ? 2   SER A CA   19 
ATOM   11062 C  C    . SER A 1 2  ? 11.487  -11.289 -13.746 1.00 0.00 ? 2   SER A C    19 
ATOM   11063 O  O    . SER A 1 2  ? 11.311  -10.560 -12.770 1.00 0.00 ? 2   SER A O    19 
ATOM   11064 C  CB   . SER A 1 2  ? 13.926  -11.489 -13.228 1.00 0.00 ? 2   SER A CB   19 
ATOM   11065 O  OG   . SER A 1 2  ? 13.895  -12.711 -12.512 1.00 0.00 ? 2   SER A OG   19 
ATOM   11066 H  H    . SER A 1 2  ? 13.274  -9.502  -14.993 1.00 0.00 ? 2   SER A H    19 
ATOM   11067 H  HA   . SER A 1 2  ? 12.908  -12.423 -14.863 1.00 0.00 ? 2   SER A HA   19 
ATOM   11068 H  HB2  . SER A 1 2  ? 14.908  -11.363 -13.659 1.00 0.00 ? 2   SER A HB2  19 
ATOM   11069 H  HB3  . SER A 1 2  ? 13.727  -10.678 -12.543 1.00 0.00 ? 2   SER A HB3  19 
ATOM   11070 H  HG   . SER A 1 2  ? 13.027  -13.112 -12.598 1.00 0.00 ? 2   SER A HG   19 
ATOM   11071 N  N    . SER A 1 3  ? 10.500  -11.952 -14.341 1.00 0.00 ? 3   SER A N    19 
ATOM   11072 C  CA   . SER A 1 3  ? 9.123   -11.855 -13.871 1.00 0.00 ? 3   SER A CA   19 
ATOM   11073 C  C    . SER A 1 3  ? 9.074   -11.723 -12.352 1.00 0.00 ? 3   SER A C    19 
ATOM   11074 O  O    . SER A 1 3  ? 8.405   -10.841 -11.816 1.00 0.00 ? 3   SER A O    19 
ATOM   11075 C  CB   . SER A 1 3  ? 8.323   -13.083 -14.313 1.00 0.00 ? 3   SER A CB   19 
ATOM   11076 O  OG   . SER A 1 3  ? 6.952   -12.943 -13.987 1.00 0.00 ? 3   SER A OG   19 
ATOM   11077 H  H    . SER A 1 3  ? 10.703  -12.518 -15.115 1.00 0.00 ? 3   SER A H    19 
ATOM   11078 H  HA   . SER A 1 3  ? 8.684   -10.973 -14.312 1.00 0.00 ? 3   SER A HA   19 
ATOM   11079 H  HB2  . SER A 1 3  ? 8.416   -13.204 -15.382 1.00 0.00 ? 3   SER A HB2  19 
ATOM   11080 H  HB3  . SER A 1 3  ? 8.712   -13.960 -13.816 1.00 0.00 ? 3   SER A HB3  19 
ATOM   11081 H  HG   . SER A 1 3  ? 6.526   -13.803 -14.016 1.00 0.00 ? 3   SER A HG   19 
ATOM   11082 N  N    . GLY A 1 4  ? 9.790   -12.608 -11.664 1.00 0.00 ? 4   GLY A N    19 
ATOM   11083 C  CA   . GLY A 1 4  ? 9.816   -12.573 -10.214 1.00 0.00 ? 4   GLY A CA   19 
ATOM   11084 C  C    . GLY A 1 4  ? 8.484   -12.960 -9.601  1.00 0.00 ? 4   GLY A C    19 
ATOM   11085 O  O    . GLY A 1 4  ? 7.660   -13.606 -10.247 1.00 0.00 ? 4   GLY A O    19 
ATOM   11086 H  H    . GLY A 1 4  ? 10.305  -13.289 -12.146 1.00 0.00 ? 4   GLY A H    19 
ATOM   11087 H  HA2  . GLY A 1 4  ? 10.574  -13.257 -9.862  1.00 0.00 ? 4   GLY A HA2  19 
ATOM   11088 H  HA3  . GLY A 1 4  ? 10.070  -11.574 -9.893  1.00 0.00 ? 4   GLY A HA3  19 
ATOM   11089 N  N    . SER A 1 5  ? 8.273   -12.564 -8.349  1.00 0.00 ? 5   SER A N    19 
ATOM   11090 C  CA   . SER A 1 5  ? 7.034   -12.878 -7.647  1.00 0.00 ? 5   SER A CA   19 
ATOM   11091 C  C    . SER A 1 5  ? 6.277   -11.603 -7.286  1.00 0.00 ? 5   SER A C    19 
ATOM   11092 O  O    . SER A 1 5  ? 6.347   -11.126 -6.153  1.00 0.00 ? 5   SER A O    19 
ATOM   11093 C  CB   . SER A 1 5  ? 7.331   -13.684 -6.381  1.00 0.00 ? 5   SER A CB   19 
ATOM   11094 O  OG   . SER A 1 5  ? 8.152   -14.802 -6.670  1.00 0.00 ? 5   SER A OG   19 
ATOM   11095 H  H    . SER A 1 5  ? 8.969   -12.052 -7.887  1.00 0.00 ? 5   SER A H    19 
ATOM   11096 H  HA   . SER A 1 5  ? 6.421   -13.472 -8.307  1.00 0.00 ? 5   SER A HA   19 
ATOM   11097 H  HB2  . SER A 1 5  ? 7.839   -13.055 -5.667  1.00 0.00 ? 5   SER A HB2  19 
ATOM   11098 H  HB3  . SER A 1 5  ? 6.402   -14.035 -5.956  1.00 0.00 ? 5   SER A HB3  19 
ATOM   11099 H  HG   . SER A 1 5  ? 7.967   -15.506 -6.044  1.00 0.00 ? 5   SER A HG   19 
ATOM   11100 N  N    . SER A 1 6  ? 5.554   -11.057 -8.258  1.00 0.00 ? 6   SER A N    19 
ATOM   11101 C  CA   . SER A 1 6  ? 4.786   -9.836  -8.045  1.00 0.00 ? 6   SER A CA   19 
ATOM   11102 C  C    . SER A 1 6  ? 3.299   -10.079 -8.286  1.00 0.00 ? 6   SER A C    19 
ATOM   11103 O  O    . SER A 1 6  ? 2.825   -10.024 -9.420  1.00 0.00 ? 6   SER A O    19 
ATOM   11104 C  CB   . SER A 1 6  ? 5.288   -8.724  -8.969  1.00 0.00 ? 6   SER A CB   19 
ATOM   11105 O  OG   . SER A 1 6  ? 5.109   -9.073  -10.330 1.00 0.00 ? 6   SER A OG   19 
ATOM   11106 H  H    . SER A 1 6  ? 5.538   -11.484 -9.140  1.00 0.00 ? 6   SER A H    19 
ATOM   11107 H  HA   . SER A 1 6  ? 4.927   -9.530  -7.019  1.00 0.00 ? 6   SER A HA   19 
ATOM   11108 H  HB2  . SER A 1 6  ? 4.741   -7.817  -8.767  1.00 0.00 ? 6   SER A HB2  19 
ATOM   11109 H  HB3  . SER A 1 6  ? 6.341   -8.558  -8.788  1.00 0.00 ? 6   SER A HB3  19 
ATOM   11110 H  HG   . SER A 1 6  ? 5.908   -8.869  -10.822 1.00 0.00 ? 6   SER A HG   19 
ATOM   11111 N  N    . GLY A 1 7  ? 2.568   -10.350 -7.209  1.00 0.00 ? 7   GLY A N    19 
ATOM   11112 C  CA   . GLY A 1 7  ? 1.143   -10.599 -7.323  1.00 0.00 ? 7   GLY A CA   19 
ATOM   11113 C  C    . GLY A 1 7  ? 0.811   -12.078 -7.329  1.00 0.00 ? 7   GLY A C    19 
ATOM   11114 O  O    . GLY A 1 7  ? -0.048  -12.527 -8.089  1.00 0.00 ? 7   GLY A O    19 
ATOM   11115 H  H    . GLY A 1 7  ? 3.000   -10.382 -6.329  1.00 0.00 ? 7   GLY A H    19 
ATOM   11116 H  HA2  . GLY A 1 7  ? 0.639   -10.131 -6.491  1.00 0.00 ? 7   GLY A HA2  19 
ATOM   11117 H  HA3  . GLY A 1 7  ? 0.785   -10.158 -8.242  1.00 0.00 ? 7   GLY A HA3  19 
ATOM   11118 N  N    . THR A 1 8  ? 1.495   -12.840 -6.481  1.00 0.00 ? 8   THR A N    19 
ATOM   11119 C  CA   . THR A 1 8  ? 1.270   -14.277 -6.393  1.00 0.00 ? 8   THR A CA   19 
ATOM   11120 C  C    . THR A 1 8  ? 0.057   -14.593 -5.526  1.00 0.00 ? 8   THR A C    19 
ATOM   11121 O  O    . THR A 1 8  ? -0.759  -15.446 -5.870  1.00 0.00 ? 8   THR A O    19 
ATOM   11122 C  CB   . THR A 1 8  ? 2.501   -15.004 -5.819  1.00 0.00 ? 8   THR A CB   19 
ATOM   11123 O  OG1  . THR A 1 8  ? 2.809   -14.492 -4.518  1.00 0.00 ? 8   THR A OG1  19 
ATOM   11124 C  CG2  . THR A 1 8  ? 3.705   -14.836 -6.734  1.00 0.00 ? 8   THR A CG2  19 
ATOM   11125 H  H    . THR A 1 8  ? 2.166   -12.424 -5.901  1.00 0.00 ? 8   THR A H    19 
ATOM   11126 H  HA   . THR A 1 8  ? 1.093   -14.649 -7.392  1.00 0.00 ? 8   THR A HA   19 
ATOM   11127 H  HB   . THR A 1 8  ? 2.273   -16.057 -5.738  1.00 0.00 ? 8   THR A HB   19 
ATOM   11128 H  HG1  . THR A 1 8  ? 2.869   -15.219 -3.893  1.00 0.00 ? 8   THR A HG1  19 
ATOM   11129 H  HG21 . THR A 1 8  ? 4.254   -13.953 -6.446  1.00 0.00 ? 8   THR A HG21 19 
ATOM   11130 H  HG22 . THR A 1 8  ? 3.369   -14.734 -7.755  1.00 0.00 ? 8   THR A HG22 19 
ATOM   11131 H  HG23 . THR A 1 8  ? 4.345   -15.702 -6.649  1.00 0.00 ? 8   THR A HG23 19 
ATOM   11132 N  N    . GLY A 1 9  ? -0.055  -13.898 -4.398  1.00 0.00 ? 9   GLY A N    19 
ATOM   11133 C  CA   . GLY A 1 9  ? -1.173  -14.118 -3.499  1.00 0.00 ? 9   GLY A CA   19 
ATOM   11134 C  C    . GLY A 1 9  ? -2.288  -13.112 -3.703  1.00 0.00 ? 9   GLY A C    19 
ATOM   11135 O  O    . GLY A 1 9  ? -2.121  -12.127 -4.421  1.00 0.00 ? 9   GLY A O    19 
ATOM   11136 H  H    . GLY A 1 9  ? 0.626   -13.229 -4.175  1.00 0.00 ? 9   GLY A H    19 
ATOM   11137 H  HA2  . GLY A 1 9  ? -1.563  -15.111 -3.664  1.00 0.00 ? 9   GLY A HA2  19 
ATOM   11138 H  HA3  . GLY A 1 9  ? -0.820  -14.045 -2.481  1.00 0.00 ? 9   GLY A HA3  19 
ATOM   11139 N  N    . MET A 1 10 ? -3.431  -13.362 -3.072  1.00 0.00 ? 10  MET A N    19 
ATOM   11140 C  CA   . MET A 1 10 ? -4.579  -12.470 -3.189  1.00 0.00 ? 10  MET A CA   19 
ATOM   11141 C  C    . MET A 1 10 ? -4.561  -11.414 -2.089  1.00 0.00 ? 10  MET A C    19 
ATOM   11142 O  O    . MET A 1 10 ? -5.103  -11.624 -1.003  1.00 0.00 ? 10  MET A O    19 
ATOM   11143 C  CB   . MET A 1 10 ? -5.882  -13.270 -3.124  1.00 0.00 ? 10  MET A CB   19 
ATOM   11144 C  CG   . MET A 1 10 ? -6.028  -14.286 -4.245  1.00 0.00 ? 10  MET A CG   19 
ATOM   11145 S  SD   . MET A 1 10 ? -7.241  -15.566 -3.868  1.00 0.00 ? 10  MET A SD   19 
ATOM   11146 C  CE   . MET A 1 10 ? -6.425  -17.012 -4.539  1.00 0.00 ? 10  MET A CE   19 
ATOM   11147 H  H    . MET A 1 10 ? -3.505  -14.164 -2.514  1.00 0.00 ? 10  MET A H    19 
ATOM   11148 H  HA   . MET A 1 10 ? -4.518  -11.976 -4.147  1.00 0.00 ? 10  MET A HA   19 
ATOM   11149 H  HB2  . MET A 1 10 ? -5.920  -13.797 -2.182  1.00 0.00 ? 10  MET A HB2  19 
ATOM   11150 H  HB3  . MET A 1 10 ? -6.714  -12.584 -3.178  1.00 0.00 ? 10  MET A HB3  19 
ATOM   11151 H  HG2  . MET A 1 10 ? -6.338  -13.770 -5.142  1.00 0.00 ? 10  MET A HG2  19 
ATOM   11152 H  HG3  . MET A 1 10 ? -5.070  -14.754 -4.415  1.00 0.00 ? 10  MET A HG3  19 
ATOM   11153 H  HE1  . MET A 1 10 ? -6.944  -17.902 -4.212  1.00 0.00 ? 10  MET A HE1  19 
ATOM   11154 H  HE2  . MET A 1 10 ? -6.436  -16.965 -5.618  1.00 0.00 ? 10  MET A HE2  19 
ATOM   11155 H  HE3  . MET A 1 10 ? -5.403  -17.043 -4.190  1.00 0.00 ? 10  MET A HE3  19 
ATOM   11156 N  N    . LYS A 1 11 ? -3.935  -10.278 -2.375  1.00 0.00 ? 11  LYS A N    19 
ATOM   11157 C  CA   . LYS A 1 11 ? -3.846  -9.188  -1.411  1.00 0.00 ? 11  LYS A CA   19 
ATOM   11158 C  C    . LYS A 1 11 ? -4.685  -7.995  -1.860  1.00 0.00 ? 11  LYS A C    19 
ATOM   11159 O  O    . LYS A 1 11 ? -4.482  -7.433  -2.936  1.00 0.00 ? 11  LYS A O    19 
ATOM   11160 C  CB   . LYS A 1 11 ? -2.389  -8.759  -1.227  1.00 0.00 ? 11  LYS A CB   19 
ATOM   11161 C  CG   . LYS A 1 11 ? -1.659  -9.536  -0.144  1.00 0.00 ? 11  LYS A CG   19 
ATOM   11162 C  CD   . LYS A 1 11 ? -0.992  -10.781 -0.704  1.00 0.00 ? 11  LYS A CD   19 
ATOM   11163 C  CE   . LYS A 1 11 ? -0.127  -11.468 0.341   1.00 0.00 ? 11  LYS A CE   19 
ATOM   11164 N  NZ   . LYS A 1 11 ? -0.016  -12.932 0.093   1.00 0.00 ? 11  LYS A NZ   19 
ATOM   11165 H  H    . LYS A 1 11 ? -3.522  -10.170 -3.258  1.00 0.00 ? 11  LYS A H    19 
ATOM   11166 H  HA   . LYS A 1 11 ? -4.229  -9.547  -0.468  1.00 0.00 ? 11  LYS A HA   19 
ATOM   11167 H  HB2  . LYS A 1 11 ? -1.863  -8.902  -2.159  1.00 0.00 ? 11  LYS A HB2  19 
ATOM   11168 H  HB3  . LYS A 1 11 ? -2.365  -7.711  -0.967  1.00 0.00 ? 11  LYS A HB3  19 
ATOM   11169 H  HG2  . LYS A 1 11 ? -0.903  -8.901  0.293   1.00 0.00 ? 11  LYS A HG2  19 
ATOM   11170 H  HG3  . LYS A 1 11 ? -2.369  -9.830  0.616   1.00 0.00 ? 11  LYS A HG3  19 
ATOM   11171 H  HD2  . LYS A 1 11 ? -1.755  -11.470 -1.034  1.00 0.00 ? 11  LYS A HD2  19 
ATOM   11172 H  HD3  . LYS A 1 11 ? -0.371  -10.499 -1.544  1.00 0.00 ? 11  LYS A HD3  19 
ATOM   11173 H  HE2  . LYS A 1 11 ? 0.859   -11.032 0.317   1.00 0.00 ? 11  LYS A HE2  19 
ATOM   11174 H  HE3  . LYS A 1 11 ? -0.568  -11.309 1.314   1.00 0.00 ? 11  LYS A HE3  19 
ATOM   11175 H  HZ1  . LYS A 1 11 ? -0.821  -13.261 -0.477  1.00 0.00 ? 11  LYS A HZ1  19 
ATOM   11176 H  HZ2  . LYS A 1 11 ? -0.011  -13.448 0.996   1.00 0.00 ? 11  LYS A HZ2  19 
ATOM   11177 H  HZ3  . LYS A 1 11 ? 0.865   -13.142 -0.418  1.00 0.00 ? 11  LYS A HZ3  19 
ATOM   11178 N  N    . PRO A 1 12 ? -5.649  -7.598  -1.016  1.00 0.00 ? 12  PRO A N    19 
ATOM   11179 C  CA   . PRO A 1 12 ? -6.536  -6.467  -1.304  1.00 0.00 ? 12  PRO A CA   19 
ATOM   11180 C  C    . PRO A 1 12 ? -5.806  -5.130  -1.254  1.00 0.00 ? 12  PRO A C    19 
ATOM   11181 O  O    . PRO A 1 12 ? -5.265  -4.669  -2.259  1.00 0.00 ? 12  PRO A O    19 
ATOM   11182 C  CB   . PRO A 1 12 ? -7.584  -6.546  -0.191  1.00 0.00 ? 12  PRO A CB   19 
ATOM   11183 C  CG   . PRO A 1 12 ? -6.897  -7.250  0.927   1.00 0.00 ? 12  PRO A CG   19 
ATOM   11184 C  CD   . PRO A 1 12 ? -5.948  -8.222  0.284   1.00 0.00 ? 12  PRO A CD   19 
ATOM   11185 H  HA   . PRO A 1 12 ? -7.019  -6.576  -2.264  1.00 0.00 ? 12  PRO A HA   19 
ATOM   11186 H  HB2  . PRO A 1 12 ? -7.886  -5.548  0.094   1.00 0.00 ? 12  PRO A HB2  19 
ATOM   11187 H  HB3  . PRO A 1 12 ? -8.442  -7.102  -0.539  1.00 0.00 ? 12  PRO A HB3  19 
ATOM   11188 H  HG2  . PRO A 1 12 ? -6.353  -6.538  1.530   1.00 0.00 ? 12  PRO A HG2  19 
ATOM   11189 H  HG3  . PRO A 1 12 ? -7.622  -7.777  1.530   1.00 0.00 ? 12  PRO A HG3  19 
ATOM   11190 H  HD2  . PRO A 1 12 ? -5.051  -8.324  0.877   1.00 0.00 ? 12  PRO A HD2  19 
ATOM   11191 H  HD3  . PRO A 1 12 ? -6.424  -9.182  0.150   1.00 0.00 ? 12  PRO A HD3  19 
ATOM   11192 N  N    . TYR A 1 13 ? -5.793  -4.512  -0.078  1.00 0.00 ? 13  TYR A N    19 
ATOM   11193 C  CA   . TYR A 1 13 ? -5.130  -3.226  0.102   1.00 0.00 ? 13  TYR A CA   19 
ATOM   11194 C  C    . TYR A 1 13 ? -3.810  -3.394  0.849   1.00 0.00 ? 13  TYR A C    19 
ATOM   11195 O  O    . TYR A 1 13 ? -3.268  -2.435  1.400   1.00 0.00 ? 13  TYR A O    19 
ATOM   11196 C  CB   . TYR A 1 13 ? -6.040  -2.261  0.864   1.00 0.00 ? 13  TYR A CB   19 
ATOM   11197 C  CG   . TYR A 1 13 ? -7.514  -2.529  0.657   1.00 0.00 ? 13  TYR A CG   19 
ATOM   11198 C  CD1  . TYR A 1 13 ? -8.148  -3.579  1.310   1.00 0.00 ? 13  TYR A CD1  19 
ATOM   11199 C  CD2  . TYR A 1 13 ? -8.273  -1.731  -0.191  1.00 0.00 ? 13  TYR A CD2  19 
ATOM   11200 C  CE1  . TYR A 1 13 ? -9.494  -3.828  1.123   1.00 0.00 ? 13  TYR A CE1  19 
ATOM   11201 C  CE2  . TYR A 1 13 ? -9.620  -1.971  -0.382  1.00 0.00 ? 13  TYR A CE2  19 
ATOM   11202 C  CZ   . TYR A 1 13 ? -10.225 -3.021  0.276   1.00 0.00 ? 13  TYR A CZ   19 
ATOM   11203 O  OH   . TYR A 1 13 ? -11.567 -3.265  0.089   1.00 0.00 ? 13  TYR A OH   19 
ATOM   11204 H  H    . TYR A 1 13 ? -6.241  -4.930  0.687   1.00 0.00 ? 13  TYR A H    19 
ATOM   11205 H  HA   . TYR A 1 13 ? -4.927  -2.817  -0.877  1.00 0.00 ? 13  TYR A HA   19 
ATOM   11206 H  HB2  . TYR A 1 13 ? -5.835  -2.341  1.920   1.00 0.00 ? 13  TYR A HB2  19 
ATOM   11207 H  HB3  . TYR A 1 13 ? -5.837  -1.252  0.537   1.00 0.00 ? 13  TYR A HB3  19 
ATOM   11208 H  HD1  . TYR A 1 13 ? -7.572  -4.209  1.973   1.00 0.00 ? 13  TYR A HD1  19 
ATOM   11209 H  HD2  . TYR A 1 13 ? -7.795  -0.910  -0.705  1.00 0.00 ? 13  TYR A HD2  19 
ATOM   11210 H  HE1  . TYR A 1 13 ? -9.969  -4.649  1.639   1.00 0.00 ? 13  TYR A HE1  19 
ATOM   11211 H  HE2  . TYR A 1 13 ? -10.193 -1.340  -1.045  1.00 0.00 ? 13  TYR A HE2  19 
ATOM   11212 H  HH   . TYR A 1 13 ? -12.031 -2.431  -0.020  1.00 0.00 ? 13  TYR A HH   19 
ATOM   11213 N  N    . VAL A 1 14 ? -3.297  -4.620  0.862   1.00 0.00 ? 14  VAL A N    19 
ATOM   11214 C  CA   . VAL A 1 14 ? -2.039  -4.915  1.539   1.00 0.00 ? 14  VAL A CA   19 
ATOM   11215 C  C    . VAL A 1 14 ? -0.849  -4.401  0.736   1.00 0.00 ? 14  VAL A C    19 
ATOM   11216 O  O    . VAL A 1 14 ? -0.846  -4.456  -0.494  1.00 0.00 ? 14  VAL A O    19 
ATOM   11217 C  CB   . VAL A 1 14 ? -1.871  -6.428  1.775   1.00 0.00 ? 14  VAL A CB   19 
ATOM   11218 C  CG1  . VAL A 1 14 ? -0.504  -6.726  2.371   1.00 0.00 ? 14  VAL A CG1  19 
ATOM   11219 C  CG2  . VAL A 1 14 ? -2.980  -6.953  2.674   1.00 0.00 ? 14  VAL A CG2  19 
ATOM   11220 H  H    . VAL A 1 14 ? -3.775  -5.343  0.405   1.00 0.00 ? 14  VAL A H    19 
ATOM   11221 H  HA   . VAL A 1 14 ? -2.053  -4.422  2.500   1.00 0.00 ? 14  VAL A HA   19 
ATOM   11222 H  HB   . VAL A 1 14 ? -1.940  -6.930  0.821   1.00 0.00 ? 14  VAL A HB   19 
ATOM   11223 H  HG11 . VAL A 1 14 ? -0.502  -6.460  3.418   1.00 0.00 ? 14  VAL A HG11 19 
ATOM   11224 H  HG12 . VAL A 1 14 ? -0.287  -7.779  2.266   1.00 0.00 ? 14  VAL A HG12 19 
ATOM   11225 H  HG13 . VAL A 1 14 ? 0.248   -6.150  1.853   1.00 0.00 ? 14  VAL A HG13 19 
ATOM   11226 H  HG21 . VAL A 1 14 ? -3.667  -7.546  2.089   1.00 0.00 ? 14  VAL A HG21 19 
ATOM   11227 H  HG22 . VAL A 1 14 ? -2.551  -7.564  3.454   1.00 0.00 ? 14  VAL A HG22 19 
ATOM   11228 H  HG23 . VAL A 1 14 ? -3.509  -6.122  3.117   1.00 0.00 ? 14  VAL A HG23 19 
ATOM   11229 N  N    . CYS A 1 15 ? 0.161   -3.902  1.441   1.00 0.00 ? 15  CYS A N    19 
ATOM   11230 C  CA   . CYS A 1 15 ? 1.358   -3.377  0.795   1.00 0.00 ? 15  CYS A CA   19 
ATOM   11231 C  C    . CYS A 1 15 ? 2.257   -4.512  0.312   1.00 0.00 ? 15  CYS A C    19 
ATOM   11232 O  O    . CYS A 1 15 ? 2.880   -5.208  1.114   1.00 0.00 ? 15  CYS A O    19 
ATOM   11233 C  CB   . CYS A 1 15 ? 2.130   -2.476  1.761   1.00 0.00 ? 15  CYS A CB   19 
ATOM   11234 S  SG   . CYS A 1 15 ? 3.083   -1.156  0.944   1.00 0.00 ? 15  CYS A SG   19 
ATOM   11235 H  H    . CYS A 1 15 ? 0.099   -3.885  2.420   1.00 0.00 ? 15  CYS A H    19 
ATOM   11236 H  HA   . CYS A 1 15 ? 1.047   -2.794  -0.058  1.00 0.00 ? 15  CYS A HA   19 
ATOM   11237 H  HB2  . CYS A 1 15 ? 1.432   -2.005  2.437   1.00 0.00 ? 15  CYS A HB2  19 
ATOM   11238 H  HB3  . CYS A 1 15 ? 2.823   -3.079  2.328   1.00 0.00 ? 15  CYS A HB3  19 
ATOM   11239 N  N    . ASN A 1 16 ? 2.319   -4.692  -1.003  1.00 0.00 ? 16  ASN A N    19 
ATOM   11240 C  CA   . ASN A 1 16 ? 3.141   -5.742  -1.593  1.00 0.00 ? 16  ASN A CA   19 
ATOM   11241 C  C    . ASN A 1 16 ? 4.623   -5.471  -1.354  1.00 0.00 ? 16  ASN A C    19 
ATOM   11242 O  O    . ASN A 1 16 ? 5.475   -6.295  -1.684  1.00 0.00 ? 16  ASN A O    19 
ATOM   11243 C  CB   . ASN A 1 16 ? 2.866   -5.851  -3.094  1.00 0.00 ? 16  ASN A CB   19 
ATOM   11244 C  CG   . ASN A 1 16 ? 1.636   -6.684  -3.398  1.00 0.00 ? 16  ASN A CG   19 
ATOM   11245 O  OD1  . ASN A 1 16 ? 0.520   -6.320  -3.028  1.00 0.00 ? 16  ASN A OD1  19 
ATOM   11246 N  ND2  . ASN A 1 16 ? 1.836   -7.808  -4.076  1.00 0.00 ? 16  ASN A ND2  19 
ATOM   11247 H  H    . ASN A 1 16 ? 1.799   -4.105  -1.591  1.00 0.00 ? 16  ASN A H    19 
ATOM   11248 H  HA   . ASN A 1 16 ? 2.877   -6.675  -1.119  1.00 0.00 ? 16  ASN A HA   19 
ATOM   11249 H  HB2  . ASN A 1 16 ? 2.716   -4.860  -3.499  1.00 0.00 ? 16  ASN A HB2  19 
ATOM   11250 H  HB3  . ASN A 1 16 ? 3.717   -6.307  -3.578  1.00 0.00 ? 16  ASN A HB3  19 
ATOM   11251 H  HD21 . ASN A 1 16 ? 2.753   -8.034  -4.339  1.00 0.00 ? 16  ASN A HD21 19 
ATOM   11252 H  HD22 . ASN A 1 16 ? 1.058   -8.365  -4.287  1.00 0.00 ? 16  ASN A HD22 19 
ATOM   11253 N  N    . GLU A 1 17 ? 4.922   -4.311  -0.778  1.00 0.00 ? 17  GLU A N    19 
ATOM   11254 C  CA   . GLU A 1 17 ? 6.301   -3.932  -0.495  1.00 0.00 ? 17  GLU A CA   19 
ATOM   11255 C  C    . GLU A 1 17 ? 6.721   -4.402  0.895   1.00 0.00 ? 17  GLU A C    19 
ATOM   11256 O  O    . GLU A 1 17 ? 7.686   -5.152  1.045   1.00 0.00 ? 17  GLU A O    19 
ATOM   11257 C  CB   . GLU A 1 17 ? 6.470   -2.415  -0.605  1.00 0.00 ? 17  GLU A CB   19 
ATOM   11258 C  CG   . GLU A 1 17 ? 6.073   -1.855  -1.961  1.00 0.00 ? 17  GLU A CG   19 
ATOM   11259 C  CD   . GLU A 1 17 ? 7.058   -2.220  -3.054  1.00 0.00 ? 17  GLU A CD   19 
ATOM   11260 O  OE1  . GLU A 1 17 ? 8.239   -2.464  -2.729  1.00 0.00 ? 17  GLU A OE1  19 
ATOM   11261 O  OE2  . GLU A 1 17 ? 6.650   -2.260  -4.233  1.00 0.00 ? 17  GLU A OE2  19 
ATOM   11262 H  H    . GLU A 1 17 ? 4.198   -3.696  -0.538  1.00 0.00 ? 17  GLU A H    19 
ATOM   11263 H  HA   . GLU A 1 17 ? 6.933   -4.409  -1.229  1.00 0.00 ? 17  GLU A HA   19 
ATOM   11264 H  HB2  . GLU A 1 17 ? 5.860   -1.942  0.150   1.00 0.00 ? 17  GLU A HB2  19 
ATOM   11265 H  HB3  . GLU A 1 17 ? 7.505   -2.167  -0.426  1.00 0.00 ? 17  GLU A HB3  19 
ATOM   11266 H  HG2  . GLU A 1 17 ? 5.102   -2.247  -2.227  1.00 0.00 ? 17  GLU A HG2  19 
ATOM   11267 H  HG3  . GLU A 1 17 ? 6.018   -0.779  -1.889  1.00 0.00 ? 17  GLU A HG3  19 
ATOM   11268 N  N    . CYS A 1 18 ? 5.989   -3.954  1.910   1.00 0.00 ? 18  CYS A N    19 
ATOM   11269 C  CA   . CYS A 1 18 ? 6.284   -4.327  3.288   1.00 0.00 ? 18  CYS A CA   19 
ATOM   11270 C  C    . CYS A 1 18 ? 5.271   -5.345  3.805   1.00 0.00 ? 18  CYS A C    19 
ATOM   11271 O  O    . CYS A 1 18 ? 5.578   -6.151  4.683   1.00 0.00 ? 18  CYS A O    19 
ATOM   11272 C  CB   . CYS A 1 18 ? 6.280   -3.087  4.185   1.00 0.00 ? 18  CYS A CB   19 
ATOM   11273 S  SG   . CYS A 1 18 ? 4.791   -2.052  4.016   1.00 0.00 ? 18  CYS A SG   19 
ATOM   11274 H  H    . CYS A 1 18 ? 5.231   -3.358  1.728   1.00 0.00 ? 18  CYS A H    19 
ATOM   11275 H  HA   . CYS A 1 18 ? 7.267   -4.772  3.309   1.00 0.00 ? 18  CYS A HA   19 
ATOM   11276 H  HB2  . CYS A 1 18 ? 6.346   -3.399  5.218   1.00 0.00 ? 18  CYS A HB2  19 
ATOM   11277 H  HB3  . CYS A 1 18 ? 7.136   -2.475  3.944   1.00 0.00 ? 18  CYS A HB3  19 
ATOM   11278 N  N    . GLY A 1 19 ? 4.063   -5.303  3.253   1.00 0.00 ? 19  GLY A N    19 
ATOM   11279 C  CA   . GLY A 1 19 ? 3.024   -6.226  3.670   1.00 0.00 ? 19  GLY A CA   19 
ATOM   11280 C  C    . GLY A 1 19 ? 1.964   -5.559  4.525   1.00 0.00 ? 19  GLY A C    19 
ATOM   11281 O  O    . GLY A 1 19 ? 1.023   -6.210  4.980   1.00 0.00 ? 19  GLY A O    19 
ATOM   11282 H  H    . GLY A 1 19 ? 3.875   -4.639  2.557   1.00 0.00 ? 19  GLY A H    19 
ATOM   11283 H  HA2  . GLY A 1 19 ? 2.553   -6.642  2.791   1.00 0.00 ? 19  GLY A HA2  19 
ATOM   11284 H  HA3  . GLY A 1 19 ? 3.476   -7.026  4.237   1.00 0.00 ? 19  GLY A HA3  19 
ATOM   11285 N  N    . LYS A 1 20 ? 2.117   -4.258  4.746   1.00 0.00 ? 20  LYS A N    19 
ATOM   11286 C  CA   . LYS A 1 20 ? 1.167   -3.502  5.552   1.00 0.00 ? 20  LYS A CA   19 
ATOM   11287 C  C    . LYS A 1 20 ? -0.259  -3.712  5.053   1.00 0.00 ? 20  LYS A C    19 
ATOM   11288 O  O    . LYS A 1 20 ? -0.612  -3.282  3.955   1.00 0.00 ? 20  LYS A O    19 
ATOM   11289 C  CB   . LYS A 1 20 ? 1.514   -2.012  5.523   1.00 0.00 ? 20  LYS A CB   19 
ATOM   11290 C  CG   . LYS A 1 20 ? 1.137   -1.274  6.796   1.00 0.00 ? 20  LYS A CG   19 
ATOM   11291 C  CD   . LYS A 1 20 ? 2.084   -1.608  7.936   1.00 0.00 ? 20  LYS A CD   19 
ATOM   11292 C  CE   . LYS A 1 20 ? 3.530   -1.315  7.564   1.00 0.00 ? 20  LYS A CE   19 
ATOM   11293 N  NZ   . LYS A 1 20 ? 4.419   -1.303  8.759   1.00 0.00 ? 20  LYS A NZ   19 
ATOM   11294 H  H    . LYS A 1 20 ? 2.888   -3.795  4.356   1.00 0.00 ? 20  LYS A H    19 
ATOM   11295 H  HA   . LYS A 1 20 ? 1.236   -3.859  6.569   1.00 0.00 ? 20  LYS A HA   19 
ATOM   11296 H  HB2  . LYS A 1 20 ? 2.579   -1.905  5.372   1.00 0.00 ? 20  LYS A HB2  19 
ATOM   11297 H  HB3  . LYS A 1 20 ? 0.994   -1.549  4.697   1.00 0.00 ? 20  LYS A HB3  19 
ATOM   11298 H  HG2  . LYS A 1 20 ? 1.176   -0.211  6.611   1.00 0.00 ? 20  LYS A HG2  19 
ATOM   11299 H  HG3  . LYS A 1 20 ? 0.133   -1.556  7.080   1.00 0.00 ? 20  LYS A HG3  19 
ATOM   11300 H  HD2  . LYS A 1 20 ? 1.820   -1.016  8.799   1.00 0.00 ? 20  LYS A HD2  19 
ATOM   11301 H  HD3  . LYS A 1 20 ? 1.989   -2.658  8.176   1.00 0.00 ? 20  LYS A HD3  19 
ATOM   11302 H  HE2  . LYS A 1 20 ? 3.873   -2.075  6.879   1.00 0.00 ? 20  LYS A HE2  19 
ATOM   11303 H  HE3  . LYS A 1 20 ? 3.575   -0.349  7.082   1.00 0.00 ? 20  LYS A HE3  19 
ATOM   11304 H  HZ1  . LYS A 1 20 ? 4.206   -2.116  9.371   1.00 0.00 ? 20  LYS A HZ1  19 
ATOM   11305 H  HZ2  . LYS A 1 20 ? 4.276   -0.427  9.301   1.00 0.00 ? 20  LYS A HZ2  19 
ATOM   11306 H  HZ3  . LYS A 1 20 ? 5.414   -1.356  8.464   1.00 0.00 ? 20  LYS A HZ3  19 
ATOM   11307 N  N    . ALA A 1 21 ? -1.075  -4.374  5.867   1.00 0.00 ? 21  ALA A N    19 
ATOM   11308 C  CA   . ALA A 1 21 ? -2.463  -4.637  5.509   1.00 0.00 ? 21  ALA A CA   19 
ATOM   11309 C  C    . ALA A 1 21 ? -3.387  -3.556  6.061   1.00 0.00 ? 21  ALA A C    19 
ATOM   11310 O  O    . ALA A 1 21 ? -3.411  -3.302  7.265   1.00 0.00 ? 21  ALA A O    19 
ATOM   11311 C  CB   . ALA A 1 21 ? -2.888  -6.007  6.016   1.00 0.00 ? 21  ALA A CB   19 
ATOM   11312 H  H    . ALA A 1 21 ? -0.735  -4.691  6.730   1.00 0.00 ? 21  ALA A H    19 
ATOM   11313 H  HA   . ALA A 1 21 ? -2.534  -4.641  4.431   1.00 0.00 ? 21  ALA A HA   19 
ATOM   11314 H  HB1  . ALA A 1 21 ? -3.020  -6.675  5.