data_2ENV
# 
_entry.id   2ENV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.332 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ENV         
RCSB  RCSB026889   
WWPDB D_1000026889 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsi002005357.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ENV 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-28 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Nagashima, T.'                                          1 ? 
'Hayashi, F.'                                            2 ? 
'Yokoyama, S.'                                           3 ? 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 ? 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of the C4-type zinc finger domain from human Peroxisome proliferator-activated receptor delta' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Nagashima, T.' 1 ? 
primary 'Hayashi, F.'   2 ? 
primary 'Yokoyama, S.'  3 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Peroxisome proliferator-activated receptor delta' 9802.377 1 ? ? zf-C4 ? 
2 non-polymer syn 'ZINC ION'                                         65.409   2 ? ? ?     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PPAR-delta, PPAR-beta, Nuclear hormone receptor 1, NUC1, NUCI' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIR
FGSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIR
FGSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsi002005357.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  MET n 
1 9  GLU n 
1 10 CYS n 
1 11 ARG n 
1 12 VAL n 
1 13 CYS n 
1 14 GLY n 
1 15 ASP n 
1 16 LYS n 
1 17 ALA n 
1 18 SER n 
1 19 GLY n 
1 20 PHE n 
1 21 HIS n 
1 22 TYR n 
1 23 GLY n 
1 24 VAL n 
1 25 HIS n 
1 26 ALA n 
1 27 CYS n 
1 28 GLU n 
1 29 GLY n 
1 30 CYS n 
1 31 LYS n 
1 32 GLY n 
1 33 PHE n 
1 34 PHE n 
1 35 ARG n 
1 36 ARG n 
1 37 THR n 
1 38 ILE n 
1 39 ARG n 
1 40 MET n 
1 41 LYS n 
1 42 LEU n 
1 43 GLU n 
1 44 TYR n 
1 45 GLU n 
1 46 LYS n 
1 47 CYS n 
1 48 GLU n 
1 49 ARG n 
1 50 SER n 
1 51 CYS n 
1 52 LYS n 
1 53 ILE n 
1 54 GLN n 
1 55 LYS n 
1 56 LYS n 
1 57 ASN n 
1 58 ARG n 
1 59 ASN n 
1 60 LYS n 
1 61 CYS n 
1 62 GLN n 
1 63 TYR n 
1 64 CYS n 
1 65 ARG n 
1 66 PHE n 
1 67 GLN n 
1 68 LYS n 
1 69 CYS n 
1 70 LEU n 
1 71 ALA n 
1 72 LEU n 
1 73 GLY n 
1 74 MET n 
1 75 SER n 
1 76 HIS n 
1 77 ASN n 
1 78 ALA n 
1 79 ILE n 
1 80 ARG n 
1 81 PHE n 
1 82 GLY n 
1 83 SER n 
1 84 GLY n 
1 85 PRO n 
1 86 SER n 
1 87 SER n 
1 88 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'PPARD, NR1C2, PPARB' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P051212-04 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PPARD_HUMAN 
_struct_ref.pdbx_db_accession          Q03181 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFG 
_struct_ref.pdbx_align_begin           72 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2ENV 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 82 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q03181 
_struct_ref_seq.db_align_beg                  72 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  146 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       72 
_struct_ref_seq.pdbx_auth_seq_align_end       146 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2ENV GLY A 1  ? UNP Q03181 ? ? 'expression tag' 65  1  
1 2ENV SER A 2  ? UNP Q03181 ? ? 'expression tag' 66  2  
1 2ENV SER A 3  ? UNP Q03181 ? ? 'expression tag' 67  3  
1 2ENV GLY A 4  ? UNP Q03181 ? ? 'expression tag' 68  4  
1 2ENV SER A 5  ? UNP Q03181 ? ? 'expression tag' 69  5  
1 2ENV SER A 6  ? UNP Q03181 ? ? 'expression tag' 70  6  
1 2ENV GLY A 7  ? UNP Q03181 ? ? 'expression tag' 71  7  
1 2ENV SER A 83 ? UNP Q03181 ? ? 'expression tag' 147 8  
1 2ENV GLY A 84 ? UNP Q03181 ? ? 'expression tag' 148 9  
1 2ENV PRO A 85 ? UNP Q03181 ? ? 'expression tag' 149 10 
1 2ENV SER A 86 ? UNP Q03181 ? ? 'expression tag' 150 11 
1 2ENV SER A 87 ? UNP Q03181 ? ? 'expression tag' 151 12 
1 2ENV GLY A 88 ? UNP Q03181 ? ? 'expression tag' 152 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_13C-separated_NOESY 1 
2 1 3D_15N-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.19mM uniformly 13C, 15N-labeled protein; 20mM TrisHCl, 100mM NaCl, 1mM DTT, 0.02% NaN3, 0.05mM ZnCl2, 1mM IDA; 10% D2O, 90% H2O' 
_pdbx_nmr_sample_details.solvent_system   '10% D2O, 90% H2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2ENV 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2ENV 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2ENV 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1C     Varian          1 
processing           NMRPipe 20020425 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      KUJIRA  0.9822   'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.entry_id          2ENV 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2ENV 
_struct.title                     
'Solution structure of the C4-type zinc finger domain from human Peroxisome proliferator-activated receptor delta' 
_struct.pdbx_descriptor           'Peroxisome proliferator-activated receptor delta' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ENV 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
;zinc binding, PPAR delta, PPAR beta, RXR, NR, nuclear receptor, prostaglandin, insulin sensitivity, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS A 27 ? MET A 40 ? CYS A 91  MET A 104 1 ? 14 
HELX_P HELX_P2 2 GLN A 62 ? GLY A 73 ? GLN A 126 GLY A 137 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A CYS 10 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 74  A ZN 200 1_555 ? ? ? ? ? ? ? 2.250 ? ? 
metalc2 metalc ? ? A CYS 13 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 77  A ZN 200 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc3 metalc ? ? A CYS 27 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 91  A ZN 200 1_555 ? ? ? ? ? ? ? 2.249 ? ? 
metalc4 metalc ? ? A CYS 30 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 94  A ZN 200 1_555 ? ? ? ? ? ? ? 2.352 ? ? 
metalc5 metalc ? ? A CYS 47 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 111 A ZN 300 1_555 ? ? ? ? ? ? ? 2.278 ? ? 
metalc6 metalc ? ? A CYS 51 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 115 A ZN 300 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc7 metalc ? ? A CYS 61 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 125 A ZN 300 1_555 ? ? ? ? ? ? ? 2.290 ? ? 
metalc8 metalc ? ? A CYS 64 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 128 A ZN 300 1_555 ? ? ? ? ? ? ? 2.262 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 19 ? HIS A 21 ? GLY A 83 HIS A 85 
A 2 VAL A 24 ? ALA A 26 ? VAL A 88 ALA A 90 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   HIS 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    21 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    HIS 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     85 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    24 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     88 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 200 ? 2 'BINDING SITE FOR RESIDUE ZN A 200' 
AC2 Software A ZN 300 ? 5 'BINDING SITE FOR RESIDUE ZN A 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 CYS A 10 ? CYS A 74  . ? 1_555 ? 
2 AC1 2 CYS A 13 ? CYS A 77  . ? 1_555 ? 
3 AC2 5 LYS A 46 ? LYS A 110 . ? 1_555 ? 
4 AC2 5 CYS A 47 ? CYS A 111 . ? 1_555 ? 
5 AC2 5 ARG A 49 ? ARG A 113 . ? 1_555 ? 
6 AC2 5 CYS A 51 ? CYS A 115 . ? 1_555 ? 
7 AC2 5 CYS A 61 ? CYS A 125 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2ENV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ENV 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1  ? 16.798  9.081   -22.548 1.00 0.00 ? 65  GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1  ? 16.747  10.257  -21.700 1.00 0.00 ? 65  GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1  ? 17.200  9.970   -20.282 1.00 0.00 ? 65  GLY A C    1  
ATOM   4     O  O    . GLY A 1 1  ? 18.172  10.553  -19.803 1.00 0.00 ? 65  GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1  ? 16.072  8.423   -22.515 1.00 0.00 ? 65  GLY A H1   1  
ATOM   6     H  HA2  . GLY A 1 1  ? 17.384  11.020  -22.122 1.00 0.00 ? 65  GLY A HA2  1  
ATOM   7     H  HA3  . GLY A 1 1  ? 15.732  10.624  -21.673 1.00 0.00 ? 65  GLY A HA3  1  
ATOM   8     N  N    . SER A 1 2  ? 16.492  9.069   -19.608 1.00 0.00 ? 66  SER A N    1  
ATOM   9     C  CA   . SER A 1 2  ? 16.823  8.709   -18.234 1.00 0.00 ? 66  SER A CA   1  
ATOM   10    C  C    . SER A 1 2  ? 17.354  9.917   -17.469 1.00 0.00 ? 66  SER A C    1  
ATOM   11    O  O    . SER A 1 2  ? 18.318  9.812   -16.712 1.00 0.00 ? 66  SER A O    1  
ATOM   12    C  CB   . SER A 1 2  ? 17.860  7.584   -18.215 1.00 0.00 ? 66  SER A CB   1  
ATOM   13    O  OG   . SER A 1 2  ? 19.115  8.038   -18.691 1.00 0.00 ? 66  SER A OG   1  
ATOM   14    H  H    . SER A 1 2  ? 15.728  8.638   -20.045 1.00 0.00 ? 66  SER A H    1  
ATOM   15    H  HA   . SER A 1 2  ? 15.920  8.362   -17.755 1.00 0.00 ? 66  SER A HA   1  
ATOM   16    H  HB2  . SER A 1 2  ? 17.980  7.226   -17.204 1.00 0.00 ? 66  SER A HB2  1  
ATOM   17    H  HB3  . SER A 1 2  ? 17.520  6.775   -18.846 1.00 0.00 ? 66  SER A HB3  1  
ATOM   18    H  HG   . SER A 1 2  ? 19.304  8.903   -18.319 1.00 0.00 ? 66  SER A HG   1  
ATOM   19    N  N    . SER A 1 3  ? 16.715  11.065  -17.672 1.00 0.00 ? 67  SER A N    1  
ATOM   20    C  CA   . SER A 1 3  ? 17.124  12.296  -17.005 1.00 0.00 ? 67  SER A CA   1  
ATOM   21    C  C    . SER A 1 3  ? 16.340  12.499  -15.712 1.00 0.00 ? 67  SER A C    1  
ATOM   22    O  O    . SER A 1 3  ? 15.375  11.786  -15.439 1.00 0.00 ? 67  SER A O    1  
ATOM   23    C  CB   . SER A 1 3  ? 16.921  13.496  -17.932 1.00 0.00 ? 67  SER A CB   1  
ATOM   24    O  OG   . SER A 1 3  ? 15.545  13.705  -18.201 1.00 0.00 ? 67  SER A OG   1  
ATOM   25    H  H    . SER A 1 3  ? 15.953  11.085  -18.288 1.00 0.00 ? 67  SER A H    1  
ATOM   26    H  HA   . SER A 1 3  ? 18.174  12.210  -16.766 1.00 0.00 ? 67  SER A HA   1  
ATOM   27    H  HB2  . SER A 1 3  ? 17.322  14.381  -17.464 1.00 0.00 ? 67  SER A HB2  1  
ATOM   28    H  HB3  . SER A 1 3  ? 17.435  13.317  -18.865 1.00 0.00 ? 67  SER A HB3  1  
ATOM   29    H  HG   . SER A 1 3  ? 15.165  14.257  -17.514 1.00 0.00 ? 67  SER A HG   1  
ATOM   30    N  N    . GLY A 1 4  ? 16.763  13.479  -14.918 1.00 0.00 ? 68  GLY A N    1  
ATOM   31    C  CA   . GLY A 1 4  ? 16.090  13.759  -13.663 1.00 0.00 ? 68  GLY A CA   1  
ATOM   32    C  C    . GLY A 1 4  ? 14.589  13.896  -13.828 1.00 0.00 ? 68  GLY A C    1  
ATOM   33    O  O    . GLY A 1 4  ? 14.071  13.819  -14.942 1.00 0.00 ? 68  GLY A O    1  
ATOM   34    H  H    . GLY A 1 4  ? 17.538  14.015  -15.187 1.00 0.00 ? 68  GLY A H    1  
ATOM   35    H  HA2  . GLY A 1 4  ? 16.295  12.956  -12.971 1.00 0.00 ? 68  GLY A HA2  1  
ATOM   36    H  HA3  . GLY A 1 4  ? 16.481  14.680  -13.257 1.00 0.00 ? 68  GLY A HA3  1  
ATOM   37    N  N    . SER A 1 5  ? 13.890  14.097  -12.716 1.00 0.00 ? 69  SER A N    1  
ATOM   38    C  CA   . SER A 1 5  ? 12.439  14.238  -12.741 1.00 0.00 ? 69  SER A CA   1  
ATOM   39    C  C    . SER A 1 5  ? 11.975  15.262  -11.709 1.00 0.00 ? 69  SER A C    1  
ATOM   40    O  O    . SER A 1 5  ? 12.449  15.274  -10.573 1.00 0.00 ? 69  SER A O    1  
ATOM   41    C  CB   . SER A 1 5  ? 11.769  12.889  -12.474 1.00 0.00 ? 69  SER A CB   1  
ATOM   42    O  OG   . SER A 1 5  ? 11.729  12.098  -13.649 1.00 0.00 ? 69  SER A OG   1  
ATOM   43    H  H    . SER A 1 5  ? 14.361  14.148  -11.858 1.00 0.00 ? 69  SER A H    1  
ATOM   44    H  HA   . SER A 1 5  ? 12.156  14.583  -13.725 1.00 0.00 ? 69  SER A HA   1  
ATOM   45    H  HB2  . SER A 1 5  ? 12.324  12.358  -11.716 1.00 0.00 ? 69  SER A HB2  1  
ATOM   46    H  HB3  . SER A 1 5  ? 10.757  13.054  -12.131 1.00 0.00 ? 69  SER A HB3  1  
ATOM   47    H  HG   . SER A 1 5  ? 11.238  11.291  -13.476 1.00 0.00 ? 69  SER A HG   1  
ATOM   48    N  N    . SER A 1 6  ? 11.045  16.121  -12.114 1.00 0.00 ? 70  SER A N    1  
ATOM   49    C  CA   . SER A 1 6  ? 10.519  17.152  -11.227 1.00 0.00 ? 70  SER A CA   1  
ATOM   50    C  C    . SER A 1 6  ? 9.000   17.054  -11.121 1.00 0.00 ? 70  SER A C    1  
ATOM   51    O  O    . SER A 1 6  ? 8.271   17.716  -11.859 1.00 0.00 ? 70  SER A O    1  
ATOM   52    C  CB   . SER A 1 6  ? 10.918  18.540  -11.731 1.00 0.00 ? 70  SER A CB   1  
ATOM   53    O  OG   . SER A 1 6  ? 10.532  18.723  -13.082 1.00 0.00 ? 70  SER A OG   1  
ATOM   54    H  H    . SER A 1 6  ? 10.707  16.061  -13.032 1.00 0.00 ? 70  SER A H    1  
ATOM   55    H  HA   . SER A 1 6  ? 10.947  16.997  -10.248 1.00 0.00 ? 70  SER A HA   1  
ATOM   56    H  HB2  . SER A 1 6  ? 10.435  19.293  -11.126 1.00 0.00 ? 70  SER A HB2  1  
ATOM   57    H  HB3  . SER A 1 6  ? 11.990  18.653  -11.656 1.00 0.00 ? 70  SER A HB3  1  
ATOM   58    H  HG   . SER A 1 6  ? 9.574   18.750  -13.141 1.00 0.00 ? 70  SER A HG   1  
ATOM   59    N  N    . GLY A 1 7  ? 8.529   16.222  -10.197 1.00 0.00 ? 71  GLY A N    1  
ATOM   60    C  CA   . GLY A 1 7  ? 7.100   16.052  -10.011 1.00 0.00 ? 71  GLY A CA   1  
ATOM   61    C  C    . GLY A 1 7  ? 6.773   15.011  -8.958  1.00 0.00 ? 71  GLY A C    1  
ATOM   62    O  O    . GLY A 1 7  ? 7.539   14.808  -8.017  1.00 0.00 ? 71  GLY A O    1  
ATOM   63    H  H    . GLY A 1 7  ? 9.158   15.720  -9.637  1.00 0.00 ? 71  GLY A H    1  
ATOM   64    H  HA2  . GLY A 1 7  ? 6.672   16.997  -9.713  1.00 0.00 ? 71  GLY A HA2  1  
ATOM   65    H  HA3  . GLY A 1 7  ? 6.660   15.748  -10.949 1.00 0.00 ? 71  GLY A HA3  1  
ATOM   66    N  N    . MET A 1 8  ? 5.630   14.351  -9.116  1.00 0.00 ? 72  MET A N    1  
ATOM   67    C  CA   . MET A 1 8  ? 5.203   13.326  -8.171  1.00 0.00 ? 72  MET A CA   1  
ATOM   68    C  C    . MET A 1 8  ? 5.520   11.931  -8.702  1.00 0.00 ? 72  MET A C    1  
ATOM   69    O  O    . MET A 1 8  ? 5.430   11.680  -9.903  1.00 0.00 ? 72  MET A O    1  
ATOM   70    C  CB   . MET A 1 8  ? 3.704   13.450  -7.894  1.00 0.00 ? 72  MET A CB   1  
ATOM   71    C  CG   . MET A 1 8  ? 3.362   14.526  -6.875  1.00 0.00 ? 72  MET A CG   1  
ATOM   72    S  SD   . MET A 1 8  ? 4.223   14.297  -5.308  1.00 0.00 ? 72  MET A SD   1  
ATOM   73    C  CE   . MET A 1 8  ? 4.363   15.993  -4.748  1.00 0.00 ? 72  MET A CE   1  
ATOM   74    H  H    . MET A 1 8  ? 5.061   14.557  -9.887  1.00 0.00 ? 72  MET A H    1  
ATOM   75    H  HA   . MET A 1 8  ? 5.745   13.479  -7.250  1.00 0.00 ? 72  MET A HA   1  
ATOM   76    H  HB2  . MET A 1 8  ? 3.197   13.686  -8.818  1.00 0.00 ? 72  MET A HB2  1  
ATOM   77    H  HB3  . MET A 1 8  ? 3.339   12.505  -7.522  1.00 0.00 ? 72  MET A HB3  1  
ATOM   78    H  HG2  . MET A 1 8  ? 3.635   15.488  -7.282  1.00 0.00 ? 72  MET A HG2  1  
ATOM   79    H  HG3  . MET A 1 8  ? 2.298   14.504  -6.693  1.00 0.00 ? 72  MET A HG3  1  
ATOM   80    H  HE1  . MET A 1 8  ? 3.381   16.440  -4.705  1.00 0.00 ? 72  MET A HE1  1  
ATOM   81    H  HE2  . MET A 1 8  ? 4.810   16.012  -3.765  1.00 0.00 ? 72  MET A HE2  1  
ATOM   82    H  HE3  . MET A 1 8  ? 4.983   16.548  -5.436  1.00 0.00 ? 72  MET A HE3  1  
ATOM   83    N  N    . GLU A 1 9  ? 5.891   11.029  -7.799  1.00 0.00 ? 73  GLU A N    1  
ATOM   84    C  CA   . GLU A 1 9  ? 6.221   9.660   -8.178  1.00 0.00 ? 73  GLU A CA   1  
ATOM   85    C  C    . GLU A 1 9  ? 5.466   8.658   -7.311  1.00 0.00 ? 73  GLU A C    1  
ATOM   86    O  O    . GLU A 1 9  ? 5.257   8.884   -6.119  1.00 0.00 ? 73  GLU A O    1  
ATOM   87    C  CB   . GLU A 1 9  ? 7.728   9.423   -8.056  1.00 0.00 ? 73  GLU A CB   1  
ATOM   88    C  CG   . GLU A 1 9  ? 8.205   9.262   -6.623  1.00 0.00 ? 73  GLU A CG   1  
ATOM   89    C  CD   . GLU A 1 9  ? 9.708   9.094   -6.523  1.00 0.00 ? 73  GLU A CD   1  
ATOM   90    O  OE1  . GLU A 1 9  ? 10.249  8.182   -7.184  1.00 0.00 ? 73  GLU A OE1  1  
ATOM   91    O  OE2  . GLU A 1 9  ? 10.344  9.874   -5.785  1.00 0.00 ? 73  GLU A OE2  1  
ATOM   92    H  H    . GLU A 1 9  ? 5.944   11.290  -6.856  1.00 0.00 ? 73  GLU A H    1  
ATOM   93    H  HA   . GLU A 1 9  ? 5.927   9.521   -9.208  1.00 0.00 ? 73  GLU A HA   1  
ATOM   94    H  HB2  . GLU A 1 9  ? 7.985   8.528   -8.603  1.00 0.00 ? 73  GLU A HB2  1  
ATOM   95    H  HB3  . GLU A 1 9  ? 8.248   10.263  -8.494  1.00 0.00 ? 73  GLU A HB3  1  
ATOM   96    H  HG2  . GLU A 1 9  ? 7.918   10.138  -6.061  1.00 0.00 ? 73  GLU A HG2  1  
ATOM   97    H  HG3  . GLU A 1 9  ? 7.731   8.390   -6.195  1.00 0.00 ? 73  GLU A HG3  1  
ATOM   98    N  N    . CYS A 1 10 ? 5.058   7.548   -7.918  1.00 0.00 ? 74  CYS A N    1  
ATOM   99    C  CA   . CYS A 1 10 ? 4.324   6.510   -7.204  1.00 0.00 ? 74  CYS A CA   1  
ATOM   100   C  C    . CYS A 1 10 ? 5.019   6.159   -5.891  1.00 0.00 ? 74  CYS A C    1  
ATOM   101   O  O    . CYS A 1 10 ? 6.242   6.243   -5.783  1.00 0.00 ? 74  CYS A O    1  
ATOM   102   C  CB   . CYS A 1 10 ? 4.192   5.259   -8.074  1.00 0.00 ? 74  CYS A CB   1  
ATOM   103   S  SG   . CYS A 1 10 ? 3.226   3.919   -7.307  1.00 0.00 ? 74  CYS A SG   1  
ATOM   104   H  H    . CYS A 1 10 ? 5.254   7.425   -8.871  1.00 0.00 ? 74  CYS A H    1  
ATOM   105   H  HA   . CYS A 1 10 ? 3.339   6.892   -6.984  1.00 0.00 ? 74  CYS A HA   1  
ATOM   106   H  HB2  . CYS A 1 10 ? 3.705   5.525   -9.001  1.00 0.00 ? 74  CYS A HB2  1  
ATOM   107   H  HB3  . CYS A 1 10 ? 5.178   4.874   -8.289  1.00 0.00 ? 74  CYS A HB3  1  
ATOM   108   N  N    . ARG A 1 11 ? 4.229   5.766   -4.897  1.00 0.00 ? 75  ARG A N    1  
ATOM   109   C  CA   . ARG A 1 11 ? 4.768   5.403   -3.592  1.00 0.00 ? 75  ARG A CA   1  
ATOM   110   C  C    . ARG A 1 11 ? 4.863   3.887   -3.445  1.00 0.00 ? 75  ARG A C    1  
ATOM   111   O  O    . ARG A 1 11 ? 5.660   3.378   -2.657  1.00 0.00 ? 75  ARG A O    1  
ATOM   112   C  CB   . ARG A 1 11 ? 3.893   5.980   -2.477  1.00 0.00 ? 75  ARG A CB   1  
ATOM   113   C  CG   . ARG A 1 11 ? 3.875   7.499   -2.441  1.00 0.00 ? 75  ARG A CG   1  
ATOM   114   C  CD   . ARG A 1 11 ? 5.076   8.053   -1.691  1.00 0.00 ? 75  ARG A CD   1  
ATOM   115   N  NE   . ARG A 1 11 ? 5.048   7.698   -0.275  1.00 0.00 ? 75  ARG A NE   1  
ATOM   116   C  CZ   . ARG A 1 11 ? 6.107   7.776   0.523   1.00 0.00 ? 75  ARG A CZ   1  
ATOM   117   N  NH1  . ARG A 1 11 ? 7.271   8.195   0.046   1.00 0.00 ? 75  ARG A NH1  1  
ATOM   118   N  NH2  . ARG A 1 11 ? 6.003   7.435   1.801   1.00 0.00 ? 75  ARG A NH2  1  
ATOM   119   H  H    . ARG A 1 11 ? 3.262   5.720   -5.044  1.00 0.00 ? 75  ARG A H    1  
ATOM   120   H  HA   . ARG A 1 11 ? 5.759   5.824   -3.513  1.00 0.00 ? 75  ARG A HA   1  
ATOM   121   H  HB2  . ARG A 1 11 ? 2.879   5.633   -2.615  1.00 0.00 ? 75  ARG A HB2  1  
ATOM   122   H  HB3  . ARG A 1 11 ? 4.260   5.623   -1.527  1.00 0.00 ? 75  ARG A HB3  1  
ATOM   123   H  HG2  . ARG A 1 11 ? 3.893   7.874   -3.454  1.00 0.00 ? 75  ARG A HG2  1  
ATOM   124   H  HG3  . ARG A 1 11 ? 2.971   7.828   -1.950  1.00 0.00 ? 75  ARG A HG3  1  
ATOM   125   H  HD2  . ARG A 1 11 ? 5.976   7.654   -2.135  1.00 0.00 ? 75  ARG A HD2  1  
ATOM   126   H  HD3  . ARG A 1 11 ? 5.076   9.129   -1.783  1.00 0.00 ? 75  ARG A HD3  1  
ATOM   127   H  HE   . ARG A 1 11 ? 4.198   7.385   0.098   1.00 0.00 ? 75  ARG A HE   1  
ATOM   128   H  HH11 . ARG A 1 11 ? 7.353   8.454   -0.916  1.00 0.00 ? 75  ARG A HH11 1  
ATOM   129   H  HH12 . ARG A 1 11 ? 8.067   8.255   0.650   1.00 0.00 ? 75  ARG A HH12 1  
ATOM   130   H  HH21 . ARG A 1 11 ? 5.127   7.119   2.164   1.00 0.00 ? 75  ARG A HH21 1  
ATOM   131   H  HH22 . ARG A 1 11 ? 6.800   7.494   2.401   1.00 0.00 ? 75  ARG A HH22 1  
ATOM   132   N  N    . VAL A 1 12 ? 4.044   3.171   -4.210  1.00 0.00 ? 76  VAL A N    1  
ATOM   133   C  CA   . VAL A 1 12 ? 4.037   1.714   -4.166  1.00 0.00 ? 76  VAL A CA   1  
ATOM   134   C  C    . VAL A 1 12 ? 5.252   1.136   -4.882  1.00 0.00 ? 76  VAL A C    1  
ATOM   135   O  O    . VAL A 1 12 ? 6.059   0.424   -4.283  1.00 0.00 ? 76  VAL A O    1  
ATOM   136   C  CB   . VAL A 1 12 ? 2.758   1.140   -4.805  1.00 0.00 ? 76  VAL A CB   1  
ATOM   137   C  CG1  . VAL A 1 12 ? 2.837   -0.376  -4.888  1.00 0.00 ? 76  VAL A CG1  1  
ATOM   138   C  CG2  . VAL A 1 12 ? 1.529   1.576   -4.020  1.00 0.00 ? 76  VAL A CG2  1  
ATOM   139   H  H    . VAL A 1 12 ? 3.432   3.635   -4.819  1.00 0.00 ? 76  VAL A H    1  
ATOM   140   H  HA   . VAL A 1 12 ? 4.063   1.411   -3.130  1.00 0.00 ? 76  VAL A HA   1  
ATOM   141   H  HB   . VAL A 1 12 ? 2.675   1.530   -5.809  1.00 0.00 ? 76  VAL A HB   1  
ATOM   142   H  HG11 . VAL A 1 12 ? 3.521   -0.743  -4.137  1.00 0.00 ? 76  VAL A HG11 1  
ATOM   143   H  HG12 . VAL A 1 12 ? 1.856   -0.798  -4.720  1.00 0.00 ? 76  VAL A HG12 1  
ATOM   144   H  HG13 . VAL A 1 12 ? 3.190   -0.665  -5.867  1.00 0.00 ? 76  VAL A HG13 1  
ATOM   145   H  HG21 . VAL A 1 12 ? 1.587   2.636   -3.820  1.00 0.00 ? 76  VAL A HG21 1  
ATOM   146   H  HG22 . VAL A 1 12 ? 0.641   1.366   -4.598  1.00 0.00 ? 76  VAL A HG22 1  
ATOM   147   H  HG23 . VAL A 1 12 ? 1.487   1.035   -3.086  1.00 0.00 ? 76  VAL A HG23 1  
ATOM   148   N  N    . CYS A 1 13 ? 5.378   1.448   -6.168  1.00 0.00 ? 77  CYS A N    1  
ATOM   149   C  CA   . CYS A 1 13 ? 6.496   0.960   -6.967  1.00 0.00 ? 77  CYS A CA   1  
ATOM   150   C  C    . CYS A 1 13 ? 7.553   2.046   -7.144  1.00 0.00 ? 77  CYS A C    1  
ATOM   151   O  O    . CYS A 1 13 ? 8.747   1.796   -6.984  1.00 0.00 ? 77  CYS A O    1  
ATOM   152   C  CB   . CYS A 1 13 ? 6.002   0.486   -8.336  1.00 0.00 ? 77  CYS A CB   1  
ATOM   153   S  SG   . CYS A 1 13 ? 5.442   1.830   -9.431  1.00 0.00 ? 77  CYS A SG   1  
ATOM   154   H  H    . CYS A 1 13 ? 4.703   2.020   -6.590  1.00 0.00 ? 77  CYS A H    1  
ATOM   155   H  HA   . CYS A 1 13 ? 6.938   0.125   -6.445  1.00 0.00 ? 77  CYS A HA   1  
ATOM   156   H  HB2  . CYS A 1 13 ? 6.805   -0.034  -8.839  1.00 0.00 ? 77  CYS A HB2  1  
ATOM   157   H  HB3  . CYS A 1 13 ? 5.173   -0.192  -8.196  1.00 0.00 ? 77  CYS A HB3  1  
ATOM   158   N  N    . GLY A 1 14 ? 7.104   3.253   -7.474  1.00 0.00 ? 78  GLY A N    1  
ATOM   159   C  CA   . GLY A 1 14 ? 8.024   4.359   -7.667  1.00 0.00 ? 78  GLY A CA   1  
ATOM   160   C  C    . GLY A 1 14 ? 7.772   5.104   -8.962  1.00 0.00 ? 78  GLY A C    1  
ATOM   161   O  O    . GLY A 1 14 ? 7.857   6.332   -9.007  1.00 0.00 ? 78  GLY A O    1  
ATOM   162   H  H    . GLY A 1 14 ? 6.141   3.394   -7.588  1.00 0.00 ? 78  GLY A H    1  
ATOM   163   H  HA2  . GLY A 1 14 ? 7.920   5.047   -6.841  1.00 0.00 ? 78  GLY A HA2  1  
ATOM   164   H  HA3  . GLY A 1 14 ? 9.034   3.975   -7.677  1.00 0.00 ? 78  GLY A HA3  1  
ATOM   165   N  N    . ASP A 1 15 ? 7.462   4.362   -10.019 1.00 0.00 ? 79  ASP A N    1  
ATOM   166   C  CA   . ASP A 1 15 ? 7.197   4.960   -11.323 1.00 0.00 ? 79  ASP A CA   1  
ATOM   167   C  C    . ASP A 1 15 ? 6.283   6.174   -11.188 1.00 0.00 ? 79  ASP A C    1  
ATOM   168   O  O    . ASP A 1 15 ? 5.457   6.245   -10.278 1.00 0.00 ? 79  ASP A O    1  
ATOM   169   C  CB   . ASP A 1 15 ? 6.564   3.931   -12.260 1.00 0.00 ? 79  ASP A CB   1  
ATOM   170   C  CG   . ASP A 1 15 ? 6.544   4.397   -13.703 1.00 0.00 ? 79  ASP A CG   1  
ATOM   171   O  OD1  . ASP A 1 15 ? 7.434   5.186   -14.083 1.00 0.00 ? 79  ASP A OD1  1  
ATOM   172   O  OD2  . ASP A 1 15 ? 5.637   3.974   -14.451 1.00 0.00 ? 79  ASP A OD2  1  
ATOM   173   H  H    . ASP A 1 15 ? 7.410   3.388   -9.920  1.00 0.00 ? 79  ASP A H    1  
ATOM   174   H  HA   . ASP A 1 15 ? 8.140   5.280   -11.739 1.00 0.00 ? 79  ASP A HA   1  
ATOM   175   H  HB2  . ASP A 1 15 ? 7.127   3.010   -12.207 1.00 0.00 ? 79  ASP A HB2  1  
ATOM   176   H  HB3  . ASP A 1 15 ? 5.548   3.744   -11.946 1.00 0.00 ? 79  ASP A HB3  1  
ATOM   177   N  N    . LYS A 1 16 ? 6.437   7.128   -12.100 1.00 0.00 ? 80  LYS A N    1  
ATOM   178   C  CA   . LYS A 1 16 ? 5.626   8.340   -12.084 1.00 0.00 ? 80  LYS A CA   1  
ATOM   179   C  C    . LYS A 1 16 ? 4.201   8.035   -11.632 1.00 0.00 ? 80  LYS A C    1  
ATOM   180   O  O    . LYS A 1 16 ? 3.583   7.079   -12.100 1.00 0.00 ? 80  LYS A O    1  
ATOM   181   C  CB   . LYS A 1 16 ? 5.606   8.982   -13.473 1.00 0.00 ? 80  LYS A CB   1  
ATOM   182   C  CG   . LYS A 1 16 ? 6.868   9.762   -13.801 1.00 0.00 ? 80  LYS A CG   1  
ATOM   183   C  CD   . LYS A 1 16 ? 7.086   9.864   -15.301 1.00 0.00 ? 80  LYS A CD   1  
ATOM   184   C  CE   . LYS A 1 16 ? 7.720   8.599   -15.859 1.00 0.00 ? 80  LYS A CE   1  
ATOM   185   N  NZ   . LYS A 1 16 ? 7.661   8.560   -17.347 1.00 0.00 ? 80  LYS A NZ   1  
ATOM   186   H  H    . LYS A 1 16 ? 7.113   7.014   -12.801 1.00 0.00 ? 80  LYS A H    1  
ATOM   187   H  HA   . LYS A 1 16 ? 6.073   9.029   -11.384 1.00 0.00 ? 80  LYS A HA   1  
ATOM   188   H  HB2  . LYS A 1 16 ? 5.485   8.206   -14.214 1.00 0.00 ? 80  LYS A HB2  1  
ATOM   189   H  HB3  . LYS A 1 16 ? 4.765   9.658   -13.531 1.00 0.00 ? 80  LYS A HB3  1  
ATOM   190   H  HG2  . LYS A 1 16 ? 6.781   10.758  -13.392 1.00 0.00 ? 80  LYS A HG2  1  
ATOM   191   H  HG3  . LYS A 1 16 ? 7.715   9.261   -13.356 1.00 0.00 ? 80  LYS A HG3  1  
ATOM   192   H  HD2  . LYS A 1 16 ? 6.133   10.020  -15.785 1.00 0.00 ? 80  LYS A HD2  1  
ATOM   193   H  HD3  . LYS A 1 16 ? 7.737   10.703  -15.505 1.00 0.00 ? 80  LYS A HD3  1  
ATOM   194   H  HE2  . LYS A 1 16 ? 8.752   8.562   -15.547 1.00 0.00 ? 80  LYS A HE2  1  
ATOM   195   H  HE3  . LYS A 1 16 ? 7.193   7.744   -15.464 1.00 0.00 ? 80  LYS A HE3  1  
ATOM   196   H  HZ1  . LYS A 1 16 ? 7.297   7.639   -17.666 1.00 0.00 ? 80  LYS A HZ1  1  
ATOM   197   H  HZ2  . LYS A 1 16 ? 8.612   8.702   -17.745 1.00 0.00 ? 80  LYS A HZ2  1  
ATOM   198   H  HZ3  . LYS A 1 16 ? 7.034   9.310   -17.700 1.00 0.00 ? 80  LYS A HZ3  1  
ATOM   199   N  N    . ALA A 1 17 ? 3.686   8.855   -10.722 1.00 0.00 ? 81  ALA A N    1  
ATOM   200   C  CA   . ALA A 1 17 ? 2.333   8.675   -10.210 1.00 0.00 ? 81  ALA A CA   1  
ATOM   201   C  C    . ALA A 1 17 ? 1.328   9.490   -11.017 1.00 0.00 ? 81  ALA A C    1  
ATOM   202   O  O    . ALA A 1 17 ? 1.647   10.571  -11.513 1.00 0.00 ? 81  ALA A O    1  
ATOM   203   C  CB   . ALA A 1 17 ? 2.269   9.061   -8.740  1.00 0.00 ? 81  ALA A CB   1  
ATOM   204   H  H    . ALA A 1 17 ? 4.229   9.599   -10.388 1.00 0.00 ? 81  ALA A H    1  
ATOM   205   H  HA   . ALA A 1 17 ? 2.082   7.627   -10.294 1.00 0.00 ? 81  ALA A HA   1  
ATOM   206   H  HB1  . ALA A 1 17 ? 3.262   9.028   -8.316  1.00 0.00 ? 81  ALA A HB1  1  
ATOM   207   H  HB2  . ALA A 1 17 ? 1.871   10.061  -8.648  1.00 0.00 ? 81  ALA A HB2  1  
ATOM   208   H  HB3  . ALA A 1 17 ? 1.630   8.368   -8.214  1.00 0.00 ? 81  ALA A HB3  1  
ATOM   209   N  N    . SER A 1 18 ? 0.114   8.964   -11.146 1.00 0.00 ? 82  SER A N    1  
ATOM   210   C  CA   . SER A 1 18 ? -0.936  9.642   -11.897 1.00 0.00 ? 82  SER A CA   1  
ATOM   211   C  C    . SER A 1 18 ? -1.538  10.783  -11.082 1.00 0.00 ? 82  SER A C    1  
ATOM   212   O  O    . SER A 1 18 ? -1.985  11.786  -11.635 1.00 0.00 ? 82  SER A O    1  
ATOM   213   C  CB   . SER A 1 18 ? -2.031  8.649   -12.291 1.00 0.00 ? 82  SER A CB   1  
ATOM   214   O  OG   . SER A 1 18 ? -2.901  9.207   -13.261 1.00 0.00 ? 82  SER A OG   1  
ATOM   215   H  H    . SER A 1 18 ? -0.078  8.099   -10.728 1.00 0.00 ? 82  SER A H    1  
ATOM   216   H  HA   . SER A 1 18 ? -0.493  10.050  -12.793 1.00 0.00 ? 82  SER A HA   1  
ATOM   217   H  HB2  . SER A 1 18 ? -1.577  7.760   -12.702 1.00 0.00 ? 82  SER A HB2  1  
ATOM   218   H  HB3  . SER A 1 18 ? -2.608  8.387   -11.416 1.00 0.00 ? 82  SER A HB3  1  
ATOM   219   H  HG   . SER A 1 18 ? -3.558  8.555   -13.516 1.00 0.00 ? 82  SER A HG   1  
ATOM   220   N  N    . GLY A 1 19 ? -1.544  10.620  -9.762  1.00 0.00 ? 83  GLY A N    1  
ATOM   221   C  CA   . GLY A 1 19 ? -2.092  11.643  -8.891  1.00 0.00 ? 83  GLY A CA   1  
ATOM   222   C  C    . GLY A 1 19 ? -2.541  11.086  -7.555  1.00 0.00 ? 83  GLY A C    1  
ATOM   223   O  O    . GLY A 1 19 ? -2.199  9.959   -7.197  1.00 0.00 ? 83  GLY A O    1  
ATOM   224   H  H    . GLY A 1 19 ? -1.173  9.798   -9.377  1.00 0.00 ? 83  GLY A H    1  
ATOM   225   H  HA2  . GLY A 1 19 ? -1.338  12.397  -8.721  1.00 0.00 ? 83  GLY A HA2  1  
ATOM   226   H  HA3  . GLY A 1 19 ? -2.940  12.099  -9.381  1.00 0.00 ? 83  GLY A HA3  1  
ATOM   227   N  N    . PHE A 1 20 ? -3.307  11.879  -6.813  1.00 0.00 ? 84  PHE A N    1  
ATOM   228   C  CA   . PHE A 1 20 ? -3.802  11.460  -5.506  1.00 0.00 ? 84  PHE A CA   1  
ATOM   229   C  C    . PHE A 1 20 ? -4.795  10.310  -5.644  1.00 0.00 ? 84  PHE A C    1  
ATOM   230   O  O    . PHE A 1 20 ? -5.849  10.456  -6.263  1.00 0.00 ? 84  PHE A O    1  
ATOM   231   C  CB   . PHE A 1 20 ? -4.463  12.637  -4.787  1.00 0.00 ? 84  PHE A CB   1  
ATOM   232   C  CG   . PHE A 1 20 ? -4.336  12.573  -3.291  1.00 0.00 ? 84  PHE A CG   1  
ATOM   233   C  CD1  . PHE A 1 20 ? -3.091  12.625  -2.686  1.00 0.00 ? 84  PHE A CD1  1  
ATOM   234   C  CD2  . PHE A 1 20 ? -5.462  12.463  -2.491  1.00 0.00 ? 84  PHE A CD2  1  
ATOM   235   C  CE1  . PHE A 1 20 ? -2.971  12.566  -1.310  1.00 0.00 ? 84  PHE A CE1  1  
ATOM   236   C  CE2  . PHE A 1 20 ? -5.348  12.403  -1.115  1.00 0.00 ? 84  PHE A CE2  1  
ATOM   237   C  CZ   . PHE A 1 20 ? -4.101  12.456  -0.524  1.00 0.00 ? 84  PHE A CZ   1  
ATOM   238   H  H    . PHE A 1 20 ? -3.546  12.767  -7.152  1.00 0.00 ? 84  PHE A H    1  
ATOM   239   H  HA   . PHE A 1 20 ? -2.957  11.123  -4.926  1.00 0.00 ? 84  PHE A HA   1  
ATOM   240   H  HB2  . PHE A 1 20 ? -4.005  13.557  -5.119  1.00 0.00 ? 84  PHE A HB2  1  
ATOM   241   H  HB3  . PHE A 1 20 ? -5.514  12.654  -5.031  1.00 0.00 ? 84  PHE A HB3  1  
ATOM   242   H  HD1  . PHE A 1 20 ? -2.206  12.712  -3.300  1.00 0.00 ? 84  PHE A HD1  1  
ATOM   243   H  HD2  . PHE A 1 20 ? -6.438  12.422  -2.953  1.00 0.00 ? 84  PHE A HD2  1  
ATOM   244   H  HE1  . PHE A 1 20 ? -1.995  12.608  -0.851  1.00 0.00 ? 84  PHE A HE1  1  
ATOM   245   H  HE2  . PHE A 1 20 ? -6.234  12.318  -0.503  1.00 0.00 ? 84  PHE A HE2  1  
ATOM   246   H  HZ   . PHE A 1 20 ? -4.010  12.409  0.551   1.00 0.00 ? 84  PHE A HZ   1  
ATOM   247   N  N    . HIS A 1 21 ? -4.450  9.166   -5.062  1.00 0.00 ? 85  HIS A N    1  
ATOM   248   C  CA   . HIS A 1 21 ? -5.311  7.989   -5.119  1.00 0.00 ? 85  HIS A CA   1  
ATOM   249   C  C    . HIS A 1 21 ? -5.322  7.259   -3.779  1.00 0.00 ? 85  HIS A C    1  
ATOM   250   O  O    . HIS A 1 21 ? -4.321  6.666   -3.376  1.00 0.00 ? 85  HIS A O    1  
ATOM   251   C  CB   . HIS A 1 21 ? -4.844  7.043   -6.225  1.00 0.00 ? 85  HIS A CB   1  
ATOM   252   C  CG   . HIS A 1 21 ? -4.869  7.658   -7.590  1.00 0.00 ? 85  HIS A CG   1  
ATOM   253   N  ND1  . HIS A 1 21 ? -5.914  8.435   -8.046  1.00 0.00 ? 85  HIS A ND1  1  
ATOM   254   C  CD2  . HIS A 1 21 ? -3.969  7.609   -8.600  1.00 0.00 ? 85  HIS A CD2  1  
ATOM   255   C  CE1  . HIS A 1 21 ? -5.656  8.835   -9.278  1.00 0.00 ? 85  HIS A CE1  1  
ATOM   256   N  NE2  . HIS A 1 21 ? -4.482  8.349   -9.638  1.00 0.00 ? 85  HIS A NE2  1  
ATOM   257   H  H    . HIS A 1 21 ? -3.597  9.111   -4.583  1.00 0.00 ? 85  HIS A H    1  
ATOM   258   H  HA   . HIS A 1 21 ? -6.313  8.322   -5.341  1.00 0.00 ? 85  HIS A HA   1  
ATOM   259   H  HB2  . HIS A 1 21 ? -3.830  6.733   -6.020  1.00 0.00 ? 85  HIS A HB2  1  
ATOM   260   H  HB3  . HIS A 1 21 ? -5.485  6.173   -6.240  1.00 0.00 ? 85  HIS A HB3  1  
ATOM   261   H  HD1  . HIS A 1 21 ? -6.724  8.657   -7.543  1.00 0.00 ? 85  HIS A HD1  1  
ATOM   262   H  HD2  . HIS A 1 21 ? -3.024  7.086   -8.592  1.00 0.00 ? 85  HIS A HD2  1  
ATOM   263   H  HE1  . HIS A 1 21 ? -6.295  9.456   -9.888  1.00 0.00 ? 85  HIS A HE1  1  
ATOM   264   N  N    . TYR A 1 22 ? -6.459  7.308   -3.094  1.00 0.00 ? 86  TYR A N    1  
ATOM   265   C  CA   . TYR A 1 22 ? -6.599  6.654   -1.798  1.00 0.00 ? 86  TYR A CA   1  
ATOM   266   C  C    . TYR A 1 22 ? -5.656  7.272   -0.771  1.00 0.00 ? 86  TYR A C    1  
ATOM   267   O  O    . TYR A 1 22 ? -5.182  6.595   0.140   1.00 0.00 ? 86  TYR A O    1  
ATOM   268   C  CB   . TYR A 1 22 ? -6.319  5.155   -1.927  1.00 0.00 ? 86  TYR A CB   1  
ATOM   269   C  CG   . TYR A 1 22 ? -7.152  4.473   -2.989  1.00 0.00 ? 86  TYR A CG   1  
ATOM   270   C  CD1  . TYR A 1 22 ? -8.435  4.020   -2.708  1.00 0.00 ? 86  TYR A CD1  1  
ATOM   271   C  CD2  . TYR A 1 22 ? -6.655  4.279   -4.271  1.00 0.00 ? 86  TYR A CD2  1  
ATOM   272   C  CE1  . TYR A 1 22 ? -9.200  3.395   -3.674  1.00 0.00 ? 86  TYR A CE1  1  
ATOM   273   C  CE2  . TYR A 1 22 ? -7.413  3.657   -5.244  1.00 0.00 ? 86  TYR A CE2  1  
ATOM   274   C  CZ   . TYR A 1 22 ? -8.684  3.216   -4.941  1.00 0.00 ? 86  TYR A CZ   1  
ATOM   275   O  OH   . TYR A 1 22 ? -9.441  2.595   -5.907  1.00 0.00 ? 86  TYR A OH   1  
ATOM   276   H  H    . TYR A 1 22 ? -7.222  7.796   -3.467  1.00 0.00 ? 86  TYR A H    1  
ATOM   277   H  HA   . TYR A 1 22 ? -7.617  6.792   -1.465  1.00 0.00 ? 86  TYR A HA   1  
ATOM   278   H  HB2  . TYR A 1 22 ? -5.280  5.010   -2.178  1.00 0.00 ? 86  TYR A HB2  1  
ATOM   279   H  HB3  . TYR A 1 22 ? -6.527  4.675   -0.982  1.00 0.00 ? 86  TYR A HB3  1  
ATOM   280   H  HD1  . TYR A 1 22 ? -8.837  4.162   -1.715  1.00 0.00 ? 86  TYR A HD1  1  
ATOM   281   H  HD2  . TYR A 1 22 ? -5.658  4.625   -4.506  1.00 0.00 ? 86  TYR A HD2  1  
ATOM   282   H  HE1  . TYR A 1 22 ? -10.196 3.051   -3.438  1.00 0.00 ? 86  TYR A HE1  1  
ATOM   283   H  HE2  . TYR A 1 22 ? -7.009  3.516   -6.236  1.00 0.00 ? 86  TYR A HE2  1  
ATOM   284   H  HH   . TYR A 1 22 ? -9.592  3.202   -6.636  1.00 0.00 ? 86  TYR A HH   1  
ATOM   285   N  N    . GLY A 1 23 ? -5.389  8.566   -0.925  1.00 0.00 ? 87  GLY A N    1  
ATOM   286   C  CA   . GLY A 1 23 ? -4.505  9.256   -0.005  1.00 0.00 ? 87  GLY A CA   1  
ATOM   287   C  C    . GLY A 1 23 ? -3.053  9.188   -0.435  1.00 0.00 ? 87  GLY A C    1  
ATOM   288   O  O    . GLY A 1 23 ? -2.309  10.158  -0.289  1.00 0.00 ? 87  GLY A O    1  
ATOM   289   H  H    . GLY A 1 23 ? -5.796  9.055   -1.671  1.00 0.00 ? 87  GLY A H    1  
ATOM   290   H  HA2  . GLY A 1 23 ? -4.804  10.292  0.056   1.00 0.00 ? 87  GLY A HA2  1  
ATOM   291   H  HA3  . GLY A 1 23 ? -4.600  8.806   0.973   1.00 0.00 ? 87  GLY A HA3  1  
ATOM   292   N  N    . VAL A 1 24 ? -2.647  8.039   -0.965  1.00 0.00 ? 88  VAL A N    1  
ATOM   293   C  CA   . VAL A 1 24 ? -1.274  7.848   -1.417  1.00 0.00 ? 88  VAL A CA   1  
ATOM   294   C  C    . VAL A 1 24 ? -1.160  8.042   -2.925  1.00 0.00 ? 88  VAL A C    1  
ATOM   295   O  O    . VAL A 1 24 ? -1.991  7.551   -3.690  1.00 0.00 ? 88  VAL A O    1  
ATOM   296   C  CB   . VAL A 1 24 ? -0.753  6.446   -1.051  1.00 0.00 ? 88  VAL A CB   1  
ATOM   297   C  CG1  . VAL A 1 24 ? -1.610  5.370   -1.700  1.00 0.00 ? 88  VAL A CG1  1  
ATOM   298   C  CG2  . VAL A 1 24 ? 0.705   6.296   -1.460  1.00 0.00 ? 88  VAL A CG2  1  
ATOM   299   H  H    . VAL A 1 24 ? -3.287  7.302   -1.055  1.00 0.00 ? 88  VAL A H    1  
ATOM   300   H  HA   . VAL A 1 24 ? -0.655  8.581   -0.922  1.00 0.00 ? 88  VAL A HA   1  
ATOM   301   H  HB   . VAL A 1 24 ? -0.818  6.329   0.021   1.00 0.00 ? 88  VAL A HB   1  
ATOM   302   H  HG11 . VAL A 1 24 ? -1.438  5.368   -2.766  1.00 0.00 ? 88  VAL A HG11 1  
ATOM   303   H  HG12 . VAL A 1 24 ? -1.350  4.405   -1.289  1.00 0.00 ? 88  VAL A HG12 1  
ATOM   304   H  HG13 . VAL A 1 24 ? -2.653  5.575   -1.505  1.00 0.00 ? 88  VAL A HG13 1  
ATOM   305   H  HG21 . VAL A 1 24 ? 0.939   7.017   -2.229  1.00 0.00 ? 88  VAL A HG21 1  
ATOM   306   H  HG22 . VAL A 1 24 ? 1.338   6.466   -0.602  1.00 0.00 ? 88  VAL A HG22 1  
ATOM   307   H  HG23 . VAL A 1 24 ? 0.872   5.298   -1.839  1.00 0.00 ? 88  VAL A HG23 1  
ATOM   308   N  N    . HIS A 1 25 ? -0.126  8.762   -3.347  1.00 0.00 ? 89  HIS A N    1  
ATOM   309   C  CA   . HIS A 1 25 ? 0.099   9.021   -4.765  1.00 0.00 ? 89  HIS A CA   1  
ATOM   310   C  C    . HIS A 1 25 ? 0.603   7.768   -5.473  1.00 0.00 ? 89  HIS A C    1  
ATOM   311   O  O    . HIS A 1 25 ? 1.807   7.518   -5.531  1.00 0.00 ? 89  HIS A O    1  
ATOM   312   C  CB   . HIS A 1 25 ? 1.102   10.161  -4.944  1.00 0.00 ? 89  HIS A CB   1  
ATOM   313   C  CG   . HIS A 1 25 ? 0.524   11.516  -4.673  1.00 0.00 ? 89  HIS A CG   1  
ATOM   314   N  ND1  . HIS A 1 25 ? 0.690   12.179  -3.475  1.00 0.00 ? 89  HIS A ND1  1  
ATOM   315   C  CD2  . HIS A 1 25 ? -0.221  12.333  -5.454  1.00 0.00 ? 89  HIS A CD2  1  
ATOM   316   C  CE1  . HIS A 1 25 ? 0.071   13.345  -3.531  1.00 0.00 ? 89  HIS A CE1  1  
ATOM   317   N  NE2  . HIS A 1 25 ? -0.489  13.463  -4.721  1.00 0.00 ? 89  HIS A NE2  1  
ATOM   318   H  H    . HIS A 1 25 ? 0.502   9.127   -2.689  1.00 0.00 ? 89  HIS A H    1  
ATOM   319   H  HA   . HIS A 1 25 ? -0.845  9.312   -5.202  1.00 0.00 ? 89  HIS A HA   1  
ATOM   320   H  HB2  . HIS A 1 25 ? 1.930   10.013  -4.267  1.00 0.00 ? 89  HIS A HB2  1  
ATOM   321   H  HB3  . HIS A 1 25 ? 1.468   10.153  -5.961  1.00 0.00 ? 89  HIS A HB3  1  
ATOM   322   H  HD1  . HIS A 1 25 ? 1.186   11.844  -2.700  1.00 0.00 ? 89  HIS A HD1  1  
ATOM   323   H  HD2  . HIS A 1 25 ? -0.545  12.134  -6.466  1.00 0.00 ? 89  HIS A HD2  1  
ATOM   324   H  HE1  . HIS A 1 25 ? 0.030   14.077  -2.738  1.00 0.00 ? 89  HIS A HE1  1  
ATOM   325   N  N    . ALA A 1 26 ? -0.326  6.982   -6.009  1.00 0.00 ? 90  ALA A N    1  
ATOM   326   C  CA   . ALA A 1 26 ? 0.025   5.756   -6.714  1.00 0.00 ? 90  ALA A CA   1  
ATOM   327   C  C    . ALA A 1 26 ? -0.125  5.927   -8.221  1.00 0.00 ? 90  ALA A C    1  
ATOM   328   O  O    . ALA A 1 26 ? -0.777  6.861   -8.689  1.00 0.00 ? 90  ALA A O    1  
ATOM   329   C  CB   . ALA A 1 26 ? -0.836  4.601   -6.223  1.00 0.00 ? 90  ALA A CB   1  
ATOM   330   H  H    . ALA A 1 26 ? -1.269  7.235   -5.929  1.00 0.00 ? 90  ALA A H    1  
ATOM   331   H  HA   . ALA A 1 26 ? 1.056   5.525   -6.488  1.00 0.00 ? 90  ALA A HA   1  
ATOM   332   H  HB1  . ALA A 1 26 ? -0.207  3.855   -5.761  1.00 0.00 ? 90  ALA A HB1  1  
ATOM   333   H  HB2  . ALA A 1 26 ? -1.551  4.967   -5.502  1.00 0.00 ? 90  ALA A HB2  1  
ATOM   334   H  HB3  . ALA A 1 26 ? -1.359  4.162   -7.060  1.00 0.00 ? 90  ALA A HB3  1  
ATOM   335   N  N    . CYS A 1 27 ? 0.483   5.020   -8.979  1.00 0.00 ? 91  CYS A N    1  
ATOM   336   C  CA   . CYS A 1 27 ? 0.419   5.071   -10.434 1.00 0.00 ? 91  CYS A CA   1  
ATOM   337   C  C    . CYS A 1 27 ? -0.739  4.225   -10.957 1.00 0.00 ? 91  CYS A C    1  
ATOM   338   O  O    . CYS A 1 27 ? -1.396  3.516   -10.196 1.00 0.00 ? 91  CYS A O    1  
ATOM   339   C  CB   . CYS A 1 27 ? 1.736   4.584   -11.041 1.00 0.00 ? 91  CYS A CB   1  
ATOM   340   S  SG   . CYS A 1 27 ? 2.053   2.806   -10.801 1.00 0.00 ? 91  CYS A SG   1  
ATOM   341   H  H    . CYS A 1 27 ? 0.988   4.298   -8.548  1.00 0.00 ? 91  CYS A H    1  
ATOM   342   H  HA   . CYS A 1 27 ? 0.257   6.098   -10.724 1.00 0.00 ? 91  CYS A HA   1  
ATOM   343   H  HB2  . CYS A 1 27 ? 1.725   4.774   -12.105 1.00 0.00 ? 91  CYS A HB2  1  
ATOM   344   H  HB3  . CYS A 1 27 ? 2.553   5.128   -10.592 1.00 0.00 ? 91  CYS A HB3  1  
ATOM   345   N  N    . GLU A 1 28 ? -0.981  4.305   -12.262 1.00 0.00 ? 92  GLU A N    1  
ATOM   346   C  CA   . GLU A 1 28 ? -2.059  3.548   -12.886 1.00 0.00 ? 92  GLU A CA   1  
ATOM   347   C  C    . GLU A 1 28 ? -1.910  2.056   -12.603 1.00 0.00 ? 92  GLU A C    1  
ATOM   348   O  O    . GLU A 1 28 ? -2.855  1.398   -12.170 1.00 0.00 ? 92  GLU A O    1  
ATOM   349   C  CB   . GLU A 1 28 ? -2.076  3.792   -14.397 1.00 0.00 ? 92  GLU A CB   1  
ATOM   350   C  CG   . GLU A 1 28 ? -2.283  5.249   -14.775 1.00 0.00 ? 92  GLU A CG   1  
ATOM   351   C  CD   . GLU A 1 28 ? -3.709  5.714   -14.548 1.00 0.00 ? 92  GLU A CD   1  
ATOM   352   O  OE1  . GLU A 1 28 ? -4.153  5.712   -13.381 1.00 0.00 ? 92  GLU A OE1  1  
ATOM   353   O  OE2  . GLU A 1 28 ? -4.379  6.079   -15.536 1.00 0.00 ? 92  GLU A OE2  1  
ATOM   354   H  H    . GLU A 1 28 ? -0.422  4.888   -12.817 1.00 0.00 ? 92  GLU A H    1  
ATOM   355   H  HA   . GLU A 1 28 ? -2.992  3.890   -12.465 1.00 0.00 ? 92  GLU A HA   1  
ATOM   356   H  HB2  . GLU A 1 28 ? -1.135  3.463   -14.813 1.00 0.00 ? 92  GLU A HB2  1  
ATOM   357   H  HB3  . GLU A 1 28 ? -2.875  3.211   -14.834 1.00 0.00 ? 92  GLU A HB3  1  
ATOM   358   H  HG2  . GLU A 1 28 ? -1.622  5.860   -14.179 1.00 0.00 ? 92  GLU A HG2  1  
ATOM   359   H  HG3  . GLU A 1 28 ? -2.042  5.374   -15.820 1.00 0.00 ? 92  GLU A HG3  1  
ATOM   360   N  N    . GLY A 1 29 ? -0.715  1.528   -12.852 1.00 0.00 ? 93  GLY A N    1  
ATOM   361   C  CA   . GLY A 1 29 ? -0.464  0.118   -12.618 1.00 0.00 ? 93  GLY A CA   1  
ATOM   362   C  C    . GLY A 1 29 ? -0.832  -0.312  -11.212 1.00 0.00 ? 93  GLY A C    1  
ATOM   363   O  O    . GLY A 1 29 ? -1.805  -1.040  -11.012 1.00 0.00 ? 93  GLY A O    1  
ATOM   364   H  H    . GLY A 1 29 ? 0.002   2.101   -13.196 1.00 0.00 ? 93  GLY A H    1  
ATOM   365   H  HA2  . GLY A 1 29 ? -1.041  -0.461  -13.324 1.00 0.00 ? 93  GLY A HA2  1  
ATOM   366   H  HA3  . GLY A 1 29 ? 0.586   -0.080  -12.779 1.00 0.00 ? 93  GLY A HA3  1  
ATOM   367   N  N    . CYS A 1 30 ? -0.052  0.137   -10.235 1.00 0.00 ? 94  CYS A N    1  
ATOM   368   C  CA   . CYS A 1 30 ? -0.300  -0.207  -8.840  1.00 0.00 ? 94  CYS A CA   1  
ATOM   369   C  C    . CYS A 1 30 ? -1.771  -0.016  -8.485  1.00 0.00 ? 94  CYS A C    1  
ATOM   370   O  O    . CYS A 1 30 ? -2.463  -0.967  -8.122  1.00 0.00 ? 94  CYS A O    1  
ATOM   371   C  CB   . CYS A 1 30 ? 0.573   0.649   -7.919  1.00 0.00 ? 94  CYS A CB   1  
ATOM   372   S  SG   . CYS A 1 30 ? 2.362   0.359   -8.110  1.00 0.00 ? 94  CYS A SG   1  
ATOM   373   H  H    . CYS A 1 30 ? 0.709   0.715   -10.457 1.00 0.00 ? 94  CYS A H    1  
ATOM   374   H  HA   . CYS A 1 30 ? -0.041  -1.246  -8.703  1.00 0.00 ? 94  CYS A HA   1  
ATOM   375   H  HB2  . CYS A 1 30 ? 0.387   1.693   -8.127  1.00 0.00 ? 94  CYS A HB2  1  
ATOM   376   H  HB3  . CYS A 1 30 ? 0.314   0.439   -6.892  1.00 0.00 ? 94  CYS A HB3  1  
ATOM   377   N  N    . LYS A 1 31 ? -2.244  1.221   -8.593  1.00 0.00 ? 95  LYS A N    1  
ATOM   378   C  CA   . LYS A 1 31 ? -3.634  1.539   -8.285  1.00 0.00 ? 95  LYS A CA   1  
ATOM   379   C  C    . LYS A 1 31 ? -4.562  0.419   -8.744  1.00 0.00 ? 95  LYS A C    1  
ATOM   380   O  O    . LYS A 1 31 ? -5.321  -0.135  -7.950  1.00 0.00 ? 95  LYS A O    1  
ATOM   381   C  CB   . LYS A 1 31 ? -4.037  2.856   -8.953  1.00 0.00 ? 95  LYS A CB   1  
ATOM   382   C  CG   . LYS A 1 31 ? -5.370  3.400   -8.470  1.00 0.00 ? 95  LYS A CG   1  
ATOM   383   C  CD   . LYS A 1 31 ? -5.708  4.723   -9.137  1.00 0.00 ? 95  LYS A CD   1  
ATOM   384   C  CE   . LYS A 1 31 ? -6.099  4.529   -10.594 1.00 0.00 ? 95  LYS A CE   1  
ATOM   385   N  NZ   . LYS A 1 31 ? -6.213  5.826   -11.315 1.00 0.00 ? 95  LYS A NZ   1  
ATOM   386   H  H    . LYS A 1 31 ? -1.644  1.939   -8.887  1.00 0.00 ? 95  LYS A H    1  
ATOM   387   H  HA   . LYS A 1 31 ? -3.721  1.647   -7.215  1.00 0.00 ? 95  LYS A HA   1  
ATOM   388   H  HB2  . LYS A 1 31 ? -3.276  3.595   -8.753  1.00 0.00 ? 95  LYS A HB2  1  
ATOM   389   H  HB3  . LYS A 1 31 ? -4.102  2.699   -10.021 1.00 0.00 ? 95  LYS A HB3  1  
ATOM   390   H  HG2  . LYS A 1 31 ? -6.146  2.685   -8.701  1.00 0.00 ? 95  LYS A HG2  1  
ATOM   391   H  HG3  . LYS A 1 31 ? -5.322  3.548   -7.401  1.00 0.00 ? 95  LYS A HG3  1  
ATOM   392   H  HD2  . LYS A 1 31 ? -6.533  5.180   -8.613  1.00 0.00 ? 95  LYS A HD2  1  
ATOM   393   H  HD3  . LYS A 1 31 ? -4.844  5.371   -9.088  1.00 0.00 ? 95  LYS A HD3  1  
ATOM   394   H  HE2  . LYS A 1 31 ? -5.348  3.923   -11.077 1.00 0.00 ? 95  LYS A HE2  1  
ATOM   395   H  HE3  . LYS A 1 31 ? -7.051  4.020   -10.633 1.00 0.00 ? 95  LYS A HE3  1  
ATOM   396   H  HZ1  . LYS A 1 31 ? -7.101  6.302   -11.056 1.00 0.00 ? 95  LYS A HZ1  1  
ATOM   397   H  HZ2  . LYS A 1 31 ? -6.205  5.666   -12.343 1.00 0.00 ? 95  LYS A HZ2  1  
ATOM   398   H  HZ3  . LYS A 1 31 ? -5.415  6.445   -11.066 1.00 0.00 ? 95  LYS A HZ3  1  
ATOM   399   N  N    . GLY A 1 32 ? -4.495  0.090   -10.030 1.00 0.00 ? 96  GLY A N    1  
ATOM   400   C  CA   . GLY A 1 32 ? -5.334  -0.964  -10.571 1.00 0.00 ? 96  GLY A CA   1  
ATOM   401   C  C    . GLY A 1 32 ? -5.307  -2.219  -9.722  1.00 0.00 ? 96  GLY A C    1  
ATOM   402   O  O    . GLY A 1 32 ? -6.355  -2.759  -9.365  1.00 0.00 ? 96  GLY A O    1  
ATOM   403   H  H    . GLY A 1 32 ? -3.871  0.566   -10.617 1.00 0.00 ? 96  GLY A H    1  
ATOM   404   H  HA2  . GLY A 1 32 ? -6.350  -0.604  -10.631 1.00 0.00 ? 96  GLY A HA2  1  
ATOM   405   H  HA3  . GLY A 1 32 ? -4.989  -1.208  -11.565 1.00 0.00 ? 96  GLY A HA3  1  
ATOM   406   N  N    . PHE A 1 33 ? -4.106  -2.688  -9.399  1.00 0.00 ? 97  PHE A N    1  
ATOM   407   C  CA   . PHE A 1 33 ? -3.947  -3.890  -8.589  1.00 0.00 ? 97  PHE A CA   1  
ATOM   408   C  C    . PHE A 1 33 ? -4.713  -3.766  -7.275  1.00 0.00 ? 97  PHE A C    1  
ATOM   409   O  O    . PHE A 1 33 ? -5.557  -4.604  -6.954  1.00 0.00 ? 97  PHE A O    1  
ATOM   410   C  CB   . PHE A 1 33 ? -2.465  -4.147  -8.306  1.00 0.00 ? 97  PHE A CB   1  
ATOM   411   C  CG   . PHE A 1 33 ? -2.226  -5.273  -7.340  1.00 0.00 ? 97  PHE A CG   1  
ATOM   412   C  CD1  . PHE A 1 33 ? -2.220  -6.588  -7.777  1.00 0.00 ? 97  PHE A CD1  1  
ATOM   413   C  CD2  . PHE A 1 33 ? -2.008  -5.015  -5.997  1.00 0.00 ? 97  PHE A CD2  1  
ATOM   414   C  CE1  . PHE A 1 33 ? -2.001  -7.625  -6.890  1.00 0.00 ? 97  PHE A CE1  1  
ATOM   415   C  CE2  . PHE A 1 33 ? -1.788  -6.049  -5.105  1.00 0.00 ? 97  PHE A CE2  1  
ATOM   416   C  CZ   . PHE A 1 33 ? -1.783  -7.355  -5.553  1.00 0.00 ? 97  PHE A CZ   1  
ATOM   417   H  H    . PHE A 1 33 ? -3.308  -2.214  -9.714  1.00 0.00 ? 97  PHE A H    1  
ATOM   418   H  HA   . PHE A 1 33 ? -4.347  -4.721  -9.149  1.00 0.00 ? 97  PHE A HA   1  
ATOM   419   H  HB2  . PHE A 1 33 ? -1.967  -4.393  -9.231  1.00 0.00 ? 97  PHE A HB2  1  
ATOM   420   H  HB3  . PHE A 1 33 ? -2.025  -3.253  -7.891  1.00 0.00 ? 97  PHE A HB3  1  
ATOM   421   H  HD1  . PHE A 1 33 ? -2.389  -6.800  -8.822  1.00 0.00 ? 97  PHE A HD1  1  
ATOM   422   H  HD2  . PHE A 1 33 ? -2.011  -3.993  -5.645  1.00 0.00 ? 97  PHE A HD2  1  
ATOM   423   H  HE1  . PHE A 1 33 ? -1.997  -8.646  -7.242  1.00 0.00 ? 97  PHE A HE1  1  
ATOM   424   H  HE2  . PHE A 1 33 ? -1.618  -5.834  -4.061  1.00 0.00 ? 97  PHE A HE2  1  
ATOM   425   H  HZ   . PHE A 1 33 ? -1.612  -8.164  -4.858  1.00 0.00 ? 97  PHE A HZ   1  
ATOM   426   N  N    . PHE A 1 34 ? -4.413  -2.716  -6.519  1.00 0.00 ? 98  PHE A N    1  
ATOM   427   C  CA   . PHE A 1 34 ? -5.072  -2.482  -5.239  1.00 0.00 ? 98  PHE A CA   1  
ATOM   428   C  C    . PHE A 1 34 ? -6.587  -2.598  -5.378  1.00 0.00 ? 98  PHE A C    1  
ATOM   429   O  O    . PHE A 1 34 ? -7.192  -3.558  -4.901  1.00 0.00 ? 98  PHE A O    1  
ATOM   430   C  CB   . PHE A 1 34 ? -4.703  -1.099  -4.697  1.00 0.00 ? 98  PHE A CB   1  
ATOM   431   C  CG   . PHE A 1 34 ? -5.299  -0.805  -3.350  1.00 0.00 ? 98  PHE A CG   1  
ATOM   432   C  CD1  . PHE A 1 34 ? -4.776  -1.384  -2.205  1.00 0.00 ? 98  PHE A CD1  1  
ATOM   433   C  CD2  . PHE A 1 34 ? -6.383  0.049   -3.229  1.00 0.00 ? 98  PHE A CD2  1  
ATOM   434   C  CE1  . PHE A 1 34 ? -5.322  -1.115  -0.964  1.00 0.00 ? 98  PHE A CE1  1  
ATOM   435   C  CE2  . PHE A 1 34 ? -6.933  0.322   -1.991  1.00 0.00 ? 98  PHE A CE2  1  
ATOM   436   C  CZ   . PHE A 1 34 ? -6.403  -0.262  -0.857  1.00 0.00 ? 98  PHE A CZ   1  
ATOM   437   H  H    . PHE A 1 34 ? -3.731  -2.083  -6.829  1.00 0.00 ? 98  PHE A H    1  
ATOM   438   H  HA   . PHE A 1 34 ? -4.727  -3.235  -4.547  1.00 0.00 ? 98  PHE A HA   1  
ATOM   439   H  HB2  . PHE A 1 34 ? -3.629  -1.031  -4.606  1.00 0.00 ? 98  PHE A HB2  1  
ATOM   440   H  HB3  . PHE A 1 34 ? -5.050  -0.346  -5.387  1.00 0.00 ? 98  PHE A HB3  1  
ATOM   441   H  HD1  . PHE A 1 34 ? -3.931  -2.053  -2.287  1.00 0.00 ? 98  PHE A HD1  1  
ATOM   442   H  HD2  . PHE A 1 34 ? -6.799  0.506   -4.115  1.00 0.00 ? 98  PHE A HD2  1  
ATOM   443   H  HE1  . PHE A 1 34 ? -4.905  -1.574  -0.079  1.00 0.00 ? 98  PHE A HE1  1  
ATOM   444   H  HE2  . PHE A 1 34 ? -7.778  0.990   -1.910  1.00 0.00 ? 98  PHE A HE2  1  
ATOM   445   H  HZ   . PHE A 1 34 ? -6.830  -0.050  0.112   1.00 0.00 ? 98  PHE A HZ   1  
ATOM   446   N  N    . ARG A 1 35 ? -7.192  -1.614  -6.034  1.00 0.00 ? 99  ARG A N    1  
ATOM   447   C  CA   . ARG A 1 35 ? -8.637  -1.604  -6.234  1.00 0.00 ? 99  ARG A CA   1  
ATOM   448   C  C    . ARG A 1 35 ? -9.147  -3.000  -6.579  1.00 0.00 ? 99  ARG A C    1  
ATOM   449   O  O    . ARG A 1 35 ? -10.113 -3.482  -5.987  1.00 0.00 ? 99  ARG A O    1  
ATOM   450   C  CB   . ARG A 1 35 ? -9.012  -0.623  -7.346  1.00 0.00 ? 99  ARG A CB   1  
ATOM   451   C  CG   . ARG A 1 35 ? -10.481 -0.673  -7.732  1.00 0.00 ? 99  ARG A CG   1  
ATOM   452   C  CD   . ARG A 1 35 ? -10.857 0.484   -8.644  1.00 0.00 ? 99  ARG A CD   1  
ATOM   453   N  NE   . ARG A 1 35 ? -11.244 1.673   -7.889  1.00 0.00 ? 99  ARG A NE   1  
ATOM   454   C  CZ   . ARG A 1 35 ? -11.361 2.881   -8.429  1.00 0.00 ? 99  ARG A CZ   1  
ATOM   455   N  NH1  . ARG A 1 35 ? -11.123 3.059   -9.721  1.00 0.00 ? 99  ARG A NH1  1  
ATOM   456   N  NH2  . ARG A 1 35 ? -11.717 3.914   -7.677  1.00 0.00 ? 99  ARG A NH2  1  
ATOM   457   H  H    . ARG A 1 35 ? -6.656  -0.876  -6.390  1.00 0.00 ? 99  ARG A H    1  
ATOM   458   H  HA   . ARG A 1 35 ? -9.097  -1.283  -5.312  1.00 0.00 ? 99  ARG A HA   1  
ATOM   459   H  HB2  . ARG A 1 35 ? -8.783  0.380   -7.018  1.00 0.00 ? 99  ARG A HB2  1  
ATOM   460   H  HB3  . ARG A 1 35 ? -8.424  -0.849  -8.222  1.00 0.00 ? 99  ARG A HB3  1  
ATOM   461   H  HG2  . ARG A 1 35 ? -10.677 -1.602  -8.248  1.00 0.00 ? 99  ARG A HG2  1  
ATOM   462   H  HG3  . ARG A 1 35 ? -11.081 -0.624  -6.835  1.00 0.00 ? 99  ARG A HG3  1  
ATOM   463   H  HD2  . ARG A 1 35 ? -10.009 0.725   -9.266  1.00 0.00 ? 99  ARG A HD2  1  
ATOM   464   H  HD3  . ARG A 1 35 ? -11.685 0.179   -9.267  1.00 0.00 ? 99  ARG A HD3  1  
ATOM   465   H  HE   . ARG A 1 35 ? -11.425 1.564   -6.933  1.00 0.00 ? 99  ARG A HE   1  
ATOM   466   H  HH11 . ARG A 1 35 ? -10.855 2.282   -10.291 1.00 0.00 ? 99  ARG A HH11 1  
ATOM   467   H  HH12 . ARG A 1 35 ? -11.212 3.969   -10.126 1.00 0.00 ? 99  ARG A HH12 1  
ATOM   468   H  HH21 . ARG A 1 35 ? -11.898 3.783   -6.702  1.00 0.00 ? 99  ARG A HH21 1  
ATOM   469   H  HH22 . ARG A 1 35 ? -11.805 4.822   -8.084  1.00 0.00 ? 99  ARG A HH22 1  
ATOM   470   N  N    . ARG A 1 36 ? -8.492  -3.643  -7.540  1.00 0.00 ? 100 ARG A N    1  
ATOM   471   C  CA   . ARG A 1 36 ? -8.880  -4.983  -7.965  1.00 0.00 ? 100 ARG A CA   1  
ATOM   472   C  C    . ARG A 1 36 ? -8.955  -5.931  -6.772  1.00 0.00 ? 100 ARG A C    1  
ATOM   473   O  O    . ARG A 1 36 ? -9.954  -6.625  -6.578  1.00 0.00 ? 100 ARG A O    1  
ATOM   474   C  CB   . ARG A 1 36 ? -7.887  -5.522  -8.996  1.00 0.00 ? 100 ARG A CB   1  
ATOM   475   C  CG   . ARG A 1 36 ? -8.153  -6.962  -9.403  1.00 0.00 ? 100 ARG A CG   1  
ATOM   476   C  CD   . ARG A 1 36 ? -7.608  -7.258  -10.792 1.00 0.00 ? 100 ARG A CD   1  
ATOM   477   N  NE   . ARG A 1 36 ? -7.493  -8.692  -11.040 1.00 0.00 ? 100 ARG A NE   1  
ATOM   478   C  CZ   . ARG A 1 36 ? -6.576  -9.466  -10.471 1.00 0.00 ? 100 ARG A CZ   1  
ATOM   479   N  NH1  . ARG A 1 36 ? -5.698  -8.945  -9.624  1.00 0.00 ? 100 ARG A NH1  1  
ATOM   480   N  NH2  . ARG A 1 36 ? -6.535  -10.763 -10.747 1.00 0.00 ? 100 ARG A NH2  1  
ATOM   481   H  H    . ARG A 1 36 ? -7.729  -3.206  -7.974  1.00 0.00 ? 100 ARG A H    1  
ATOM   482   H  HA   . ARG A 1 36 ? -9.857  -4.916  -8.419  1.00 0.00 ? 100 ARG A HA   1  
ATOM   483   H  HB2  . ARG A 1 36 ? -7.936  -4.905  -9.882  1.00 0.00 ? 100 ARG A HB2  1  
ATOM   484   H  HB3  . ARG A 1 36 ? -6.891  -5.465  -8.583  1.00 0.00 ? 100 ARG A HB3  1  
ATOM   485   H  HG2  . ARG A 1 36 ? -7.676  -7.621  -8.694  1.00 0.00 ? 100 ARG A HG2  1  
ATOM   486   H  HG3  . ARG A 1 36 ? -9.219  -7.136  -9.400  1.00 0.00 ? 100 ARG A HG3  1  
ATOM   487   H  HD2  . ARG A 1 36 ? -8.274  -6.827  -11.525 1.00 0.00 ? 100 ARG A HD2  1  
ATOM   488   H  HD3  . ARG A 1 36 ? -6.632  -6.806  -10.884 1.00 0.00 ? 100 ARG A HD3  1  
ATOM   489   H  HE   . ARG A 1 36 ? -8.132  -9.098  -11.663 1.00 0.00 ? 100 ARG A HE   1  
ATOM   490   H  HH11 . ARG A 1 36 ? -5.727  -7.968  -9.413  1.00 0.00 ? 100 ARG A HH11 1  
ATOM   491   H  HH12 . ARG A 1 36 ? -5.009  -9.530  -9.195  1.00 0.00 ? 100 ARG A HH12 1  
ATOM   492   H  HH21 . ARG A 1 36 ? -7.195  -11.159 -11.385 1.00 0.00 ? 100 ARG A HH21 1  
ATOM   493   H  HH22 . ARG A 1 36 ? -5.844  -11.344 -10.318 1.00 0.00 ? 100 ARG A HH22 1  
ATOM   494   N  N    . THR A 1 37 ? -7.892  -5.957  -5.975  1.00 0.00 ? 101 THR A N    1  
ATOM   495   C  CA   . THR A 1 37 ? -7.836  -6.821  -4.802  1.00 0.00 ? 101 THR A CA   1  
ATOM   496   C  C    . THR A 1 37 ? -8.994  -6.534  -3.853  1.00 0.00 ? 101 THR A C    1  
ATOM   497   O  O    . THR A 1 37 ? -9.412  -7.404  -3.089  1.00 0.00 ? 101 THR A O    1  
ATOM   498   C  CB   . THR A 1 37 ? -6.508  -6.650  -4.041  1.00 0.00 ? 101 THR A CB   1  
ATOM   499   O  OG1  . THR A 1 37 ? -5.406  -6.950  -4.904  1.00 0.00 ? 101 THR A OG1  1  
ATOM   500   C  CG2  . THR A 1 37 ? -6.464  -7.556  -2.820  1.00 0.00 ? 101 THR A CG2  1  
ATOM   501   H  H    . THR A 1 37 ? -7.126  -5.381  -6.182  1.00 0.00 ? 101 THR A H    1  
ATOM   502   H  HA   . THR A 1 37 ? -7.905  -7.845  -5.139  1.00 0.00 ? 101 THR A HA   1  
ATOM   503   H  HB   . THR A 1 37 ? -6.429  -5.623  -3.712  1.00 0.00 ? 101 THR A HB   1  
ATOM   504   H  HG1  . THR A 1 37 ? -5.176  -6.168  -5.413  1.00 0.00 ? 101 THR A HG1  1  
ATOM   505   H  HG21 . THR A 1 37 ? -6.668  -6.975  -1.933  1.00 0.00 ? 101 THR A HG21 1  
ATOM   506   H  HG22 . THR A 1 37 ? -5.484  -8.004  -2.739  1.00 0.00 ? 101 THR A HG22 1  
ATOM   507   H  HG23 . THR A 1 37 ? -7.208  -8.332  -2.921  1.00 0.00 ? 101 THR A HG23 1  
ATOM   508   N  N    . ILE A 1 38 ? -9.507  -5.310  -3.906  1.00 0.00 ? 102 ILE A N    1  
ATOM   509   C  CA   . ILE A 1 38 ? -10.618 -4.910  -3.051  1.00 0.00 ? 102 ILE A CA   1  
ATOM   510   C  C    . ILE A 1 38 ? -11.955 -5.315  -3.662  1.00 0.00 ? 102 ILE A C    1  
ATOM   511   O  O    . ILE A 1 38 ? -12.671 -6.154  -3.114  1.00 0.00 ? 102 ILE A O    1  
ATOM   512   C  CB   . ILE A 1 38 ? -10.619 -3.390  -2.804  1.00 0.00 ? 102 ILE A CB   1  
ATOM   513   C  CG1  . ILE A 1 38 ? -9.248  -2.931  -2.304  1.00 0.00 ? 102 ILE A CG1  1  
ATOM   514   C  CG2  . ILE A 1 38 ? -11.705 -3.016  -1.805  1.00 0.00 ? 102 ILE A CG2  1  
ATOM   515   C  CD1  . ILE A 1 38 ? -8.884  -3.485  -0.944  1.00 0.00 ? 102 ILE A CD1  1  
ATOM   516   H  H    . ILE A 1 38 ? -9.131  -4.660  -4.535  1.00 0.00 ? 102 ILE A H    1  
ATOM   517   H  HA   . ILE A 1 38 ? -10.503 -5.409  -2.100  1.00 0.00 ? 102 ILE A HA   1  
ATOM   518   H  HB   . ILE A 1 38 ? -10.838 -2.896  -3.738  1.00 0.00 ? 102 ILE A HB   1  
ATOM   519   H  HG12 . ILE A 1 38 ? -8.492  -3.249  -3.004  1.00 0.00 ? 102 ILE A HG12 1  
ATOM   520   H  HG13 . ILE A 1 38 ? -9.240  -1.853  -2.237  1.00 0.00 ? 102 ILE A HG13 1  
ATOM   521   H  HG21 . ILE A 1 38 ? -12.171 -3.915  -1.428  1.00 0.00 ? 102 ILE A HG21 1  
ATOM   522   H  HG22 . ILE A 1 38 ? -11.266 -2.468  -0.986  1.00 0.00 ? 102 ILE A HG22 1  
ATOM   523   H  HG23 . ILE A 1 38 ? -12.448 -2.403  -2.293  1.00 0.00 ? 102 ILE A HG23 1  
ATOM   524   H  HD11 . ILE A 1 38 ? -7.817  -3.403  -0.796  1.00 0.00 ? 102 ILE A HD11 1  
ATOM   525   H  HD12 . ILE A 1 38 ? -9.397  -2.924  -0.177  1.00 0.00 ? 102 ILE A HD12 1  
ATOM   526   H  HD13 . ILE A 1 38 ? -9.176  -4.523  -0.888  1.00 0.00 ? 102 ILE A HD13 1  
ATOM   527   N  N    . ARG A 1 39 ? -12.285 -4.716  -4.802  1.00 0.00 ? 103 ARG A N    1  
ATOM   528   C  CA   . ARG A 1 39 ? -13.536 -5.015  -5.488  1.00 0.00 ? 103 ARG A CA   1  
ATOM   529   C  C    . ARG A 1 39 ? -13.720 -6.521  -5.651  1.00 0.00 ? 103 ARG A C    1  
ATOM   530   O  O    . ARG A 1 39 ? -14.839 -7.030  -5.584  1.00 0.00 ? 103 ARG A O    1  
ATOM   531   C  CB   . ARG A 1 39 ? -13.566 -4.335  -6.858  1.00 0.00 ? 103 ARG A CB   1  
ATOM   532   C  CG   . ARG A 1 39 ? -12.762 -5.069  -7.919  1.00 0.00 ? 103 ARG A CG   1  
ATOM   533   C  CD   . ARG A 1 39 ? -12.905 -4.409  -9.282  1.00 0.00 ? 103 ARG A CD   1  
ATOM   534   N  NE   . ARG A 1 39 ? -14.126 -4.824  -9.966  1.00 0.00 ? 103 ARG A NE   1  
ATOM   535   C  CZ   . ARG A 1 39 ? -14.287 -4.764  -11.284 1.00 0.00 ? 103 ARG A CZ   1  
ATOM   536   N  NH1  . ARG A 1 39 ? -13.309 -4.308  -12.054 1.00 0.00 ? 103 ARG A NH1  1  
ATOM   537   N  NH2  . ARG A 1 39 ? -15.428 -5.160  -11.832 1.00 0.00 ? 103 ARG A NH2  1  
ATOM   538   H  H    . ARG A 1 39 ? -11.673 -4.056  -5.190  1.00 0.00 ? 103 ARG A H    1  
ATOM   539   H  HA   . ARG A 1 39 ? -14.345 -4.628  -4.887  1.00 0.00 ? 103 ARG A HA   1  
ATOM   540   H  HB2  . ARG A 1 39 ? -14.590 -4.272  -7.194  1.00 0.00 ? 103 ARG A HB2  1  
ATOM   541   H  HB3  . ARG A 1 39 ? -13.165 -3.337  -6.760  1.00 0.00 ? 103 ARG A HB3  1  
ATOM   542   H  HG2  . ARG A 1 39 ? -11.720 -5.064  -7.637  1.00 0.00 ? 103 ARG A HG2  1  
ATOM   543   H  HG3  . ARG A 1 39 ? -13.115 -6.088  -7.984  1.00 0.00 ? 103 ARG A HG3  1  
ATOM   544   H  HD2  . ARG A 1 39 ? -12.925 -3.338  -9.147  1.00 0.00 ? 103 ARG A HD2  1  
ATOM   545   H  HD3  . ARG A 1 39 ? -12.053 -4.679  -9.888  1.00 0.00 ? 103 ARG A HD3  1  
ATOM   546   H  HE   . ARG A 1 39 ? -14.862 -5.164  -9.416  1.00 0.00 ? 103 ARG A HE   1  
ATOM   547   H  HH11 . ARG A 1 39 ? -12.448 -4.010  -11.643 1.00 0.00 ? 103 ARG A HH11 1  
ATOM   548   H  HH12 . ARG A 1 39 ? -13.433 -4.265  -13.046 1.00 0.00 ? 103 ARG A HH12 1  
ATOM   549   H  HH21 . ARG A 1 39 ? -16.168 -5.505  -11.255 1.00 0.00 ? 103 ARG A HH21 1  
ATOM   550   H  HH22 . ARG A 1 39 ? -15.549 -5.114  -12.824 1.00 0.00 ? 103 ARG A HH22 1  
ATOM   551   N  N    . MET A 1 40 ? -12.615 -7.227  -5.865  1.00 0.00 ? 104 MET A N    1  
ATOM   552   C  CA   . MET A 1 40 ? -12.655 -8.675  -6.037  1.00 0.00 ? 104 MET A CA   1  
ATOM   553   C  C    . MET A 1 40 ? -12.503 -9.386  -4.696  1.00 0.00 ? 104 MET A C    1  
ATOM   554   O  O    . MET A 1 40 ? -12.843 -10.561 -4.563  1.00 0.00 ? 104 MET A O    1  
ATOM   555   C  CB   . MET A 1 40 ? -11.552 -9.127  -6.995  1.00 0.00 ? 104 MET A CB   1  
ATOM   556   C  CG   . MET A 1 40 ? -11.677 -8.533  -8.389  1.00 0.00 ? 104 MET A CG   1  
ATOM   557   S  SD   . MET A 1 40 ? -10.810 -9.504  -9.638  1.00 0.00 ? 104 MET A SD   1  
ATOM   558   C  CE   . MET A 1 40 ? -12.185 -10.320 -10.446 1.00 0.00 ? 104 MET A CE   1  
ATOM   559   H  H    . MET A 1 40 ? -11.752 -6.765  -5.908  1.00 0.00 ? 104 MET A H    1  
ATOM   560   H  HA   . MET A 1 40 ? -13.615 -8.931  -6.461  1.00 0.00 ? 104 MET A HA   1  
ATOM   561   H  HB2  . MET A 1 40 ? -10.596 -8.835  -6.588  1.00 0.00 ? 104 MET A HB2  1  
ATOM   562   H  HB3  . MET A 1 40 ? -11.584 -10.202 -7.082  1.00 0.00 ? 104 MET A HB3  1  
ATOM   563   H  HG2  . MET A 1 40 ? -12.722 -8.485  -8.654  1.00 0.00 ? 104 MET A HG2  1  
ATOM   564   H  HG3  . MET A 1 40 ? -11.264 -7.535  -8.378  1.00 0.00 ? 104 MET A HG3  1  
ATOM   565   H  HE1  . MET A 1 40 ? -13.079 -10.190 -9.853  1.00 0.00 ? 104 MET A HE1  1  
ATOM   566   H  HE2  . MET A 1 40 ? -12.335 -9.888  -11.424 1.00 0.00 ? 104 MET A HE2  1  
ATOM   567   H  HE3  . MET A 1 40 ? -11.969 -11.373 -10.547 1.00 0.00 ? 104 MET A HE3  1  
ATOM   568   N  N    . LYS A 1 41 ? -11.990 -8.665  -3.704  1.00 0.00 ? 105 LYS A N    1  
ATOM   569   C  CA   . LYS A 1 41 ? -11.794 -9.226  -2.373  1.00 0.00 ? 105 LYS A CA   1  
ATOM   570   C  C    . LYS A 1 41 ? -10.901 -10.462 -2.430  1.00 0.00 ? 105 LYS A C    1  
ATOM   571   O  O    . LYS A 1 41 ? -11.171 -11.466 -1.770  1.00 0.00 ? 105 LYS A O    1  
ATOM   572   C  CB   . LYS A 1 41 ? -13.142 -9.586  -1.745  1.00 0.00 ? 105 LYS A CB   1  
ATOM   573   C  CG   . LYS A 1 41 ? -14.131 -8.434  -1.726  1.00 0.00 ? 105 LYS A CG   1  
ATOM   574   C  CD   . LYS A 1 41 ? -15.552 -8.923  -1.498  1.00 0.00 ? 105 LYS A CD   1  
ATOM   575   C  CE   . LYS A 1 41 ? -16.554 -7.782  -1.580  1.00 0.00 ? 105 LYS A CE   1  
ATOM   576   N  NZ   . LYS A 1 41 ? -16.559 -7.143  -2.926  1.00 0.00 ? 105 LYS A NZ   1  
ATOM   577   H  H    . LYS A 1 41 ? -11.738 -7.732  -3.872  1.00 0.00 ? 105 LYS A H    1  
ATOM   578   H  HA   . LYS A 1 41 ? -11.311 -8.476  -1.765  1.00 0.00 ? 105 LYS A HA   1  
ATOM   579   H  HB2  . LYS A 1 41 ? -13.579 -10.401 -2.303  1.00 0.00 ? 105 LYS A HB2  1  
ATOM   580   H  HB3  . LYS A 1 41 ? -12.976 -9.907  -0.726  1.00 0.00 ? 105 LYS A HB3  1  
ATOM   581   H  HG2  . LYS A 1 41 ? -13.864 -7.754  -0.931  1.00 0.00 ? 105 LYS A HG2  1  
ATOM   582   H  HG3  . LYS A 1 41 ? -14.086 -7.917  -2.674  1.00 0.00 ? 105 LYS A HG3  1  
ATOM   583   H  HD2  . LYS A 1 41 ? -15.797 -9.656  -2.252  1.00 0.00 ? 105 LYS A HD2  1  
ATOM   584   H  HD3  . LYS A 1 41 ? -15.615 -9.376  -0.518  1.00 0.00 ? 105 LYS A HD3  1  
ATOM   585   H  HE2  . LYS A 1 41 ? -17.539 -8.169  -1.372  1.00 0.00 ? 105 LYS A HE2  1  
ATOM   586   H  HE3  . LYS A 1 41 ? -16.295 -7.039  -0.840  1.00 0.00 ? 105 LYS A HE3  1  
ATOM   587   H  HZ1  . LYS A 1 41 ? -17.492 -7.254  -3.370  1.00 0.00 ? 105 LYS A HZ1  1  
ATOM   588   H  HZ2  . LYS A 1 41 ? -15.841 -7.588  -3.534  1.00 0.00 ? 105 LYS A HZ2  1  
ATOM   589   H  HZ3  . LYS A 1 41 ? -16.345 -6.129  -2.841  1.00 0.00 ? 105 LYS A HZ3  1  
ATOM   590   N  N    . LEU A 1 42 ? -9.836  -10.381 -3.219  1.00 0.00 ? 106 LEU A N    1  
ATOM   591   C  CA   . LEU A 1 42 ? -8.902  -11.492 -3.360  1.00 0.00 ? 106 LEU A CA   1  
ATOM   592   C  C    . LEU A 1 42 ? -7.939  -11.548 -2.178  1.00 0.00 ? 106 LEU A C    1  
ATOM   593   O  O    . LEU A 1 42 ? -7.521  -10.514 -1.658  1.00 0.00 ? 106 LEU A O    1  
ATOM   594   C  CB   . LEU A 1 42 ? -8.116  -11.361 -4.667  1.00 0.00 ? 106 LEU A CB   1  
ATOM   595   C  CG   . LEU A 1 42 ? -8.951  -11.203 -5.938  1.00 0.00 ? 106 LEU A CG   1  
ATOM   596   C  CD1  . LEU A 1 42 ? -8.075  -10.755 -7.099  1.00 0.00 ? 106 LEU A CD1  1  
ATOM   597   C  CD2  . LEU A 1 42 ? -9.660  -12.507 -6.276  1.00 0.00 ? 106 LEU A CD2  1  
ATOM   598   H  H    . LEU A 1 42 ? -9.673  -9.554  -3.719  1.00 0.00 ? 106 LEU A H    1  
ATOM   599   H  HA   . LEU A 1 42 ? -9.476  -12.406 -3.385  1.00 0.00 ? 106 LEU A HA   1  
ATOM   600   H  HB2  . LEU A 1 42 ? -7.476  -10.497 -4.582  1.00 0.00 ? 106 LEU A HB2  1  
ATOM   601   H  HB3  . LEU A 1 42 ? -7.508  -12.248 -4.776  1.00 0.00 ? 106 LEU A HB3  1  
ATOM   602   H  HG   . LEU A 1 42 ? -9.703  -10.444 -5.776  1.00 0.00 ? 106 LEU A HG   1  
ATOM   603   H  HD11 . LEU A 1 42 ? -7.220  -10.218 -6.718  1.00 0.00 ? 106 LEU A HD11 1  
ATOM   604   H  HD12 . LEU A 1 42 ? -8.645  -10.110 -7.751  1.00 0.00 ? 106 LEU A HD12 1  
ATOM   605   H  HD13 . LEU A 1 42 ? -7.741  -11.620 -7.652  1.00 0.00 ? 106 LEU A HD13 1  
ATOM   606   H  HD21 . LEU A 1 42 ? -9.707  -13.129 -5.395  1.00 0.00 ? 106 LEU A HD21 1  
ATOM   607   H  HD22 . LEU A 1 42 ? -9.115  -13.022 -7.053  1.00 0.00 ? 106 LEU A HD22 1  
ATOM   608   H  HD23 . LEU A 1 42 ? -10.662 -12.292 -6.620  1.00 0.00 ? 106 LEU A HD23 1  
ATOM   609   N  N    . GLU A 1 43 ? -7.591  -12.761 -1.762  1.00 0.00 ? 107 GLU A N    1  
ATOM   610   C  CA   . GLU A 1 43 ? -6.676  -12.951 -0.642  1.00 0.00 ? 107 GLU A CA   1  
ATOM   611   C  C    . GLU A 1 43 ? -5.312  -13.429 -1.130  1.00 0.00 ? 107 GLU A C    1  
ATOM   612   O  O    . GLU A 1 43 ? -5.156  -13.823 -2.286  1.00 0.00 ? 107 GLU A O    1  
ATOM   613   C  CB   . GLU A 1 43 ? -7.256  -13.957 0.354   1.00 0.00 ? 107 GLU A CB   1  
ATOM   614   C  CG   . GLU A 1 43 ? -8.293  -13.359 1.289   1.00 0.00 ? 107 GLU A CG   1  
ATOM   615   C  CD   . GLU A 1 43 ? -9.316  -14.378 1.754   1.00 0.00 ? 107 GLU A CD   1  
ATOM   616   O  OE1  . GLU A 1 43 ? -9.951  -15.017 0.890   1.00 0.00 ? 107 GLU A OE1  1  
ATOM   617   O  OE2  . GLU A 1 43 ? -9.481  -14.536 2.982   1.00 0.00 ? 107 GLU A OE2  1  
ATOM   618   H  H    . GLU A 1 43 ? -7.958  -13.547 -2.218  1.00 0.00 ? 107 GLU A H    1  
ATOM   619   H  HA   . GLU A 1 43 ? -6.555  -11.999 -0.149  1.00 0.00 ? 107 GLU A HA   1  
ATOM   620   H  HB2  . GLU A 1 43 ? -7.718  -14.764 -0.195  1.00 0.00 ? 107 GLU A HB2  1  
ATOM   621   H  HB3  . GLU A 1 43 ? -6.451  -14.357 0.953   1.00 0.00 ? 107 GLU A HB3  1  
ATOM   622   H  HG2  . GLU A 1 43 ? -7.790  -12.957 2.155   1.00 0.00 ? 107 GLU A HG2  1  
ATOM   623   H  HG3  . GLU A 1 43 ? -8.809  -12.563 0.772   1.00 0.00 ? 107 GLU A HG3  1  
ATOM   624   N  N    . TYR A 1 44 ? -4.326  -13.392 -0.240  1.00 0.00 ? 108 TYR A N    1  
ATOM   625   C  CA   . TYR A 1 44 ? -2.974  -13.818 -0.579  1.00 0.00 ? 108 TYR A CA   1  
ATOM   626   C  C    . TYR A 1 44 ? -2.275  -14.429 0.632   1.00 0.00 ? 108 TYR A C    1  
ATOM   627   O  O    . TYR A 1 44 ? -2.607  -14.118 1.775   1.00 0.00 ? 108 TYR A O    1  
ATOM   628   C  CB   . TYR A 1 44 ? -2.160  -12.635 -1.107  1.00 0.00 ? 108 TYR A CB   1  
ATOM   629   C  CG   . TYR A 1 44 ? -2.566  -12.193 -2.495  1.00 0.00 ? 108 TYR A CG   1  
ATOM   630   C  CD1  . TYR A 1 44 ? -2.402  -13.034 -3.589  1.00 0.00 ? 108 TYR A CD1  1  
ATOM   631   C  CD2  . TYR A 1 44 ? -3.115  -10.935 -2.712  1.00 0.00 ? 108 TYR A CD2  1  
ATOM   632   C  CE1  . TYR A 1 44 ? -2.771  -12.634 -4.859  1.00 0.00 ? 108 TYR A CE1  1  
ATOM   633   C  CE2  . TYR A 1 44 ? -3.488  -10.527 -3.978  1.00 0.00 ? 108 TYR A CE2  1  
ATOM   634   C  CZ   . TYR A 1 44 ? -3.313  -11.380 -5.048  1.00 0.00 ? 108 TYR A CZ   1  
ATOM   635   O  OH   . TYR A 1 44 ? -3.683  -10.978 -6.312  1.00 0.00 ? 108 TYR A OH   1  
ATOM   636   H  H    . TYR A 1 44 ? -4.511  -13.068 0.666   1.00 0.00 ? 108 TYR A H    1  
ATOM   637   H  HA   . TYR A 1 44 ? -3.046  -14.567 -1.354  1.00 0.00 ? 108 TYR A HA   1  
ATOM   638   H  HB2  . TYR A 1 44 ? -2.287  -11.795 -0.442  1.00 0.00 ? 108 TYR A HB2  1  
ATOM   639   H  HB3  . TYR A 1 44 ? -1.116  -12.910 -1.138  1.00 0.00 ? 108 TYR A HB3  1  
ATOM   640   H  HD1  . TYR A 1 44 ? -1.978  -14.016 -3.437  1.00 0.00 ? 108 TYR A HD1  1  
ATOM   641   H  HD2  . TYR A 1 44 ? -3.250  -10.269 -1.872  1.00 0.00 ? 108 TYR A HD2  1  
ATOM   642   H  HE1  . TYR A 1 44 ? -2.635  -13.301 -5.697  1.00 0.00 ? 108 TYR A HE1  1  
ATOM   643   H  HE2  . TYR A 1 44 ? -3.912  -9.545  -4.127  1.00 0.00 ? 108 TYR A HE2  1  
ATOM   644   H  HH   . TYR A 1 44 ? -4.020  -11.732 -6.801  1.00 0.00 ? 108 TYR A HH   1  
ATOM   645   N  N    . GLU A 1 45 ? -1.306  -15.300 0.371   1.00 0.00 ? 109 GLU A N    1  
ATOM   646   C  CA   . GLU A 1 45 ? -0.560  -15.956 1.439   1.00 0.00 ? 109 GLU A CA   1  
ATOM   647   C  C    . GLU A 1 45 ? 0.516   -15.030 1.999   1.00 0.00 ? 109 GLU A C    1  
ATOM   648   O  O    . GLU A 1 45 ? 1.180   -14.308 1.254   1.00 0.00 ? 109 GLU A O    1  
ATOM   649   C  CB   . GLU A 1 45 ? 0.080   -17.248 0.926   1.00 0.00 ? 109 GLU A CB   1  
ATOM   650   C  CG   . GLU A 1 45 ? -0.846  -18.451 0.989   1.00 0.00 ? 109 GLU A CG   1  
ATOM   651   C  CD   . GLU A 1 45 ? -0.219  -19.700 0.400   1.00 0.00 ? 109 GLU A CD   1  
ATOM   652   O  OE1  . GLU A 1 45 ? 0.648   -20.300 1.070   1.00 0.00 ? 109 GLU A OE1  1  
ATOM   653   O  OE2  . GLU A 1 45 ? -0.594  -20.077 -0.729  1.00 0.00 ? 109 GLU A OE2  1  
ATOM   654   H  H    . GLU A 1 45 ? -1.087  -15.508 -0.562  1.00 0.00 ? 109 GLU A H    1  
ATOM   655   H  HA   . GLU A 1 45 ? -1.255  -16.198 2.228   1.00 0.00 ? 109 GLU A HA   1  
ATOM   656   H  HB2  . GLU A 1 45 ? 0.381   -17.103 -0.101  1.00 0.00 ? 109 GLU A HB2  1  
ATOM   657   H  HB3  . GLU A 1 45 ? 0.955   -17.462 1.522   1.00 0.00 ? 109 GLU A HB3  1  
ATOM   658   H  HG2  . GLU A 1 45 ? -1.095  -18.645 2.021   1.00 0.00 ? 109 GLU A HG2  1  
ATOM   659   H  HG3  . GLU A 1 45 ? -1.747  -18.225 0.438   1.00 0.00 ? 109 GLU A HG3  1  
ATOM   660   N  N    . LYS A 1 46 ? 0.682   -15.055 3.317   1.00 0.00 ? 110 LYS A N    1  
ATOM   661   C  CA   . LYS A 1 46 ? 1.677   -14.219 3.979   1.00 0.00 ? 110 LYS A CA   1  
ATOM   662   C  C    . LYS A 1 46 ? 3.075   -14.507 3.440   1.00 0.00 ? 110 LYS A C    1  
ATOM   663   O  O    . LYS A 1 46 ? 3.606   -15.604 3.616   1.00 0.00 ? 110 LYS A O    1  
ATOM   664   C  CB   . LYS A 1 46 ? 1.645   -14.452 5.491   1.00 0.00 ? 110 LYS A CB   1  
ATOM   665   C  CG   . LYS A 1 46 ? 2.653   -13.615 6.257   1.00 0.00 ? 110 LYS A CG   1  
ATOM   666   C  CD   . LYS A 1 46 ? 2.414   -13.686 7.756   1.00 0.00 ? 110 LYS A CD   1  
ATOM   667   C  CE   . LYS A 1 46 ? 2.928   -14.993 8.341   1.00 0.00 ? 110 LYS A CE   1  
ATOM   668   N  NZ   . LYS A 1 46 ? 2.542   -15.151 9.770   1.00 0.00 ? 110 LYS A NZ   1  
ATOM   669   H  H    . LYS A 1 46 ? 0.123   -15.651 3.858   1.00 0.00 ? 110 LYS A H    1  
ATOM   670   H  HA   . LYS A 1 46 ? 1.432   -13.188 3.776   1.00 0.00 ? 110 LYS A HA   1  
ATOM   671   H  HB2  . LYS A 1 46 ? 0.657   -14.215 5.858   1.00 0.00 ? 110 LYS A HB2  1  
ATOM   672   H  HB3  . LYS A 1 46 ? 1.851   -15.495 5.687   1.00 0.00 ? 110 LYS A HB3  1  
ATOM   673   H  HG2  . LYS A 1 46 ? 3.647   -13.980 6.045   1.00 0.00 ? 110 LYS A HG2  1  
ATOM   674   H  HG3  . LYS A 1 46 ? 2.570   -12.585 5.937   1.00 0.00 ? 110 LYS A HG3  1  
ATOM   675   H  HD2  . LYS A 1 46 ? 2.926   -12.865 8.234   1.00 0.00 ? 110 LYS A HD2  1  
ATOM   676   H  HD3  . LYS A 1 46 ? 1.352   -13.610 7.946   1.00 0.00 ? 110 LYS A HD3  1  
ATOM   677   H  HE2  . LYS A 1 46 ? 2.516   -15.813 7.773   1.00 0.00 ? 110 LYS A HE2  1  
ATOM   678   H  HE3  . LYS A 1 46 ? 4.005   -15.007 8.264   1.00 0.00 ? 110 LYS A HE3  1  
ATOM   679   H  HZ1  . LYS A 1 46 ? 1.507   -15.199 9.858   1.00 0.00 ? 110 LYS A HZ1  1  
ATOM   680   H  HZ2  . LYS A 1 46 ? 2.889   -14.342 10.325  1.00 0.00 ? 110 LYS A HZ2  1  
ATOM   681   H  HZ3  . LYS A 1 46 ? 2.953   -16.024 10.157  1.00 0.00 ? 110 LYS A HZ3  1  
ATOM   682   N  N    . CYS A 1 47 ? 3.667   -13.515 2.783   1.00 0.00 ? 111 CYS A N    1  
ATOM   683   C  CA   . CYS A 1 47 ? 5.003   -13.660 2.219   1.00 0.00 ? 111 CYS A CA   1  
ATOM   684   C  C    . CYS A 1 47 ? 6.063   -13.153 3.193   1.00 0.00 ? 111 CYS A C    1  
ATOM   685   O  O    . CYS A 1 47 ? 6.356   -11.959 3.240   1.00 0.00 ? 111 CYS A O    1  
ATOM   686   C  CB   . CYS A 1 47 ? 5.107   -12.900 0.896   1.00 0.00 ? 111 CYS A CB   1  
ATOM   687   S  SG   . CYS A 1 47 ? 6.711   -13.088 0.053   1.00 0.00 ? 111 CYS A SG   1  
ATOM   688   H  H    . CYS A 1 47 ? 3.193   -12.663 2.675   1.00 0.00 ? 111 CYS A H    1  
ATOM   689   H  HA   . CYS A 1 47 ? 5.174   -14.710 2.036   1.00 0.00 ? 111 CYS A HA   1  
ATOM   690   H  HB2  . CYS A 1 47 ? 4.340   -13.258 0.224   1.00 0.00 ? 111 CYS A HB2  1  
ATOM   691   H  HB3  . CYS A 1 47 ? 4.953   -11.847 1.081   1.00 0.00 ? 111 CYS A HB3  1  
ATOM   692   N  N    . GLU A 1 48 ? 6.633   -14.070 3.969   1.00 0.00 ? 112 GLU A N    1  
ATOM   693   C  CA   . GLU A 1 48 ? 7.659   -13.715 4.942   1.00 0.00 ? 112 GLU A CA   1  
ATOM   694   C  C    . GLU A 1 48 ? 8.819   -12.985 4.269   1.00 0.00 ? 112 GLU A C    1  
ATOM   695   O  O    . GLU A 1 48 ? 9.299   -11.968 4.768   1.00 0.00 ? 112 GLU A O    1  
ATOM   696   C  CB   . GLU A 1 48 ? 8.175   -14.968 5.653   1.00 0.00 ? 112 GLU A CB   1  
ATOM   697   C  CG   . GLU A 1 48 ? 7.105   -15.704 6.442   1.00 0.00 ? 112 GLU A CG   1  
ATOM   698   C  CD   . GLU A 1 48 ? 6.319   -16.681 5.588   1.00 0.00 ? 112 GLU A CD   1  
ATOM   699   O  OE1  . GLU A 1 48 ? 6.929   -17.318 4.704   1.00 0.00 ? 112 GLU A OE1  1  
ATOM   700   O  OE2  . GLU A 1 48 ? 5.096   -16.807 5.803   1.00 0.00 ? 112 GLU A OE2  1  
ATOM   701   H  H    . GLU A 1 48 ? 6.357   -15.006 3.885   1.00 0.00 ? 112 GLU A H    1  
ATOM   702   H  HA   . GLU A 1 48 ? 7.211   -13.057 5.672   1.00 0.00 ? 112 GLU A HA   1  
ATOM   703   H  HB2  . GLU A 1 48 ? 8.580   -15.645 4.915   1.00 0.00 ? 112 GLU A HB2  1  
ATOM   704   H  HB3  . GLU A 1 48 ? 8.962   -14.682 6.335   1.00 0.00 ? 112 GLU A HB3  1  
ATOM   705   H  HG2  . GLU A 1 48 ? 7.578   -16.251 7.243   1.00 0.00 ? 112 GLU A HG2  1  
ATOM   706   H  HG3  . GLU A 1 48 ? 6.419   -14.980 6.857   1.00 0.00 ? 112 GLU A HG3  1  
ATOM   707   N  N    . ARG A 1 49 ? 9.263   -13.514 3.133   1.00 0.00 ? 113 ARG A N    1  
ATOM   708   C  CA   . ARG A 1 49 ? 10.366  -12.915 2.392   1.00 0.00 ? 113 ARG A CA   1  
ATOM   709   C  C    . ARG A 1 49 ? 10.282  -11.392 2.428   1.00 0.00 ? 113 ARG A C    1  
ATOM   710   O  O    . ARG A 1 49 ? 11.301  -10.703 2.381   1.00 0.00 ? 113 ARG A O    1  
ATOM   711   C  CB   . ARG A 1 49 ? 10.359  -13.403 0.943   1.00 0.00 ? 113 ARG A CB   1  
ATOM   712   C  CG   . ARG A 1 49 ? 10.747  -14.865 0.790   1.00 0.00 ? 113 ARG A CG   1  
ATOM   713   C  CD   . ARG A 1 49 ? 10.268  -15.433 -0.537  1.00 0.00 ? 113 ARG A CD   1  
ATOM   714   N  NE   . ARG A 1 49 ? 11.002  -16.638 -0.914  1.00 0.00 ? 113 ARG A NE   1  
ATOM   715   C  CZ   . ARG A 1 49 ? 12.206  -16.618 -1.475  1.00 0.00 ? 113 ARG A CZ   1  
ATOM   716   N  NH1  . ARG A 1 49 ? 12.808  -15.463 -1.722  1.00 0.00 ? 113 ARG A NH1  1  
ATOM   717   N  NH2  . ARG A 1 49 ? 12.811  -17.757 -1.790  1.00 0.00 ? 113 ARG A NH2  1  
ATOM   718   H  H    . ARG A 1 49 ? 8.839   -14.326 2.786   1.00 0.00 ? 113 ARG A H    1  
ATOM   719   H  HA   . ARG A 1 49 ? 11.288  -13.224 2.862   1.00 0.00 ? 113 ARG A HA   1  
ATOM   720   H  HB2  . ARG A 1 49 ? 9.367   -13.273 0.536   1.00 0.00 ? 113 ARG A HB2  1  
ATOM   721   H  HB3  . ARG A 1 49 ? 11.055  -12.807 0.372   1.00 0.00 ? 113 ARG A HB3  1  
ATOM   722   H  HG2  . ARG A 1 49 ? 11.823  -14.949 0.837   1.00 0.00 ? 113 ARG A HG2  1  
ATOM   723   H  HG3  . ARG A 1 49 ? 10.304  -15.431 1.596   1.00 0.00 ? 113 ARG A HG3  1  
ATOM   724   H  HD2  . ARG A 1 49 ? 9.219   -15.675 -0.451  1.00 0.00 ? 113 ARG A HD2  1  
ATOM   725   H  HD3  . ARG A 1 49 ? 10.403  -14.685 -1.303  1.00 0.00 ? 113 ARG A HD3  1  
ATOM   726   H  HE   . ARG A 1 49 ? 10.576  -17.502 -0.740  1.00 0.00 ? 113 ARG A HE   1  
ATOM   727   H  HH11 . ARG A 1 49 ? 12.355  -14.604 -1.485  1.00 0.00 ? 113 ARG A HH11 1  
ATOM   728   H  HH12 . ARG A 1 49 ? 13.715  -15.452 -2.144  1.00 0.00 ? 113 ARG A HH12 1  
ATOM   729   H  HH21 . ARG A 1 49 ? 12.360  -18.630 -1.604  1.00 0.00 ? 113 ARG A HH21 1  
ATOM   730   H  HH22 . ARG A 1 49 ? 13.716  -17.741 -2.212  1.00 0.00 ? 113 ARG A HH22 1  
ATOM   731   N  N    . SER A 1 50 ? 9.061   -10.874 2.511   1.00 0.00 ? 114 SER A N    1  
ATOM   732   C  CA   . SER A 1 50 ? 8.843   -9.432  2.549   1.00 0.00 ? 114 SER A CA   1  
ATOM   733   C  C    . SER A 1 50 ? 9.507   -8.751  1.356   1.00 0.00 ? 114 SER A C    1  
ATOM   734   O  O    . SER A 1 50 ? 10.247  -7.780  1.513   1.00 0.00 ? 114 SER A O    1  
ATOM   735   C  CB   . SER A 1 50 ? 9.388   -8.847  3.853   1.00 0.00 ? 114 SER A CB   1  
ATOM   736   O  OG   . SER A 1 50 ? 8.589   -9.232  4.958   1.00 0.00 ? 114 SER A OG   1  
ATOM   737   H  H    . SER A 1 50 ? 8.288   -11.476 2.546   1.00 0.00 ? 114 SER A H    1  
ATOM   738   H  HA   . SER A 1 50 ? 7.779   -9.257  2.502   1.00 0.00 ? 114 SER A HA   1  
ATOM   739   H  HB2  . SER A 1 50 ? 10.395  -9.202  4.011   1.00 0.00 ? 114 SER A HB2  1  
ATOM   740   H  HB3  . SER A 1 50 ? 9.392   -7.768  3.786   1.00 0.00 ? 114 SER A HB3  1  
ATOM   741   H  HG   . SER A 1 50 ? 8.340   -10.155 4.867   1.00 0.00 ? 114 SER A HG   1  
ATOM   742   N  N    . CYS A 1 51 ? 9.238   -9.269  0.162   1.00 0.00 ? 115 CYS A N    1  
ATOM   743   C  CA   . CYS A 1 51 ? 9.808   -8.713  -1.059  1.00 0.00 ? 115 CYS A CA   1  
ATOM   744   C  C    . CYS A 1 51 ? 9.702   -7.191  -1.065  1.00 0.00 ? 115 CYS A C    1  
ATOM   745   O  O    . CYS A 1 51 ? 9.027   -6.601  -0.222  1.00 0.00 ? 115 CYS A O    1  
ATOM   746   C  CB   . CYS A 1 51 ? 9.099   -9.290  -2.286  1.00 0.00 ? 115 CYS A CB   1  
ATOM   747   S  SG   . CYS A 1 51 ? 8.782   -11.081 -2.188  1.00 0.00 ? 115 CYS A SG   1  
ATOM   748   H  H    . CYS A 1 51 ? 8.640   -10.044 0.100   1.00 0.00 ? 115 CYS A H    1  
ATOM   749   H  HA   . CYS A 1 51 ? 10.851  -8.989  -1.094  1.00 0.00 ? 115 CYS A HA   1  
ATOM   750   H  HB2  . CYS A 1 51 ? 8.147   -8.794  -2.408  1.00 0.00 ? 115 CYS A HB2  1  
ATOM   751   H  HB3  . CYS A 1 51 ? 9.707   -9.110  -3.161  1.00 0.00 ? 115 CYS A HB3  1  
ATOM   752   N  N    . LYS A 1 52 ? 10.374  -6.561  -2.023  1.00 0.00 ? 116 LYS A N    1  
ATOM   753   C  CA   . LYS A 1 52 ? 10.355  -5.107  -2.141  1.00 0.00 ? 116 LYS A CA   1  
ATOM   754   C  C    . LYS A 1 52 ? 9.818   -4.680  -3.504  1.00 0.00 ? 116 LYS A C    1  
ATOM   755   O  O    . LYS A 1 52 ? 10.482  -4.855  -4.526  1.00 0.00 ? 116 LYS A O    1  
ATOM   756   C  CB   . LYS A 1 52 ? 11.762  -4.540  -1.935  1.00 0.00 ? 116 LYS A CB   1  
ATOM   757   C  CG   . LYS A 1 52 ? 11.784  -3.040  -1.698  1.00 0.00 ? 116 LYS A CG   1  
ATOM   758   C  CD   . LYS A 1 52 ? 13.192  -2.479  -1.805  1.00 0.00 ? 116 LYS A CD   1  
ATOM   759   C  CE   . LYS A 1 52 ? 13.205  -0.968  -1.629  1.00 0.00 ? 116 LYS A CE   1  
ATOM   760   N  NZ   . LYS A 1 52 ? 14.445  -0.356  -2.182  1.00 0.00 ? 116 LYS A NZ   1  
ATOM   761   H  H    . LYS A 1 52 ? 10.895  -7.086  -2.666  1.00 0.00 ? 116 LYS A H    1  
ATOM   762   H  HA   . LYS A 1 52 ? 9.704   -4.720  -1.373  1.00 0.00 ? 116 LYS A HA   1  
ATOM   763   H  HB2  . LYS A 1 52 ? 12.210  -5.025  -1.080  1.00 0.00 ? 116 LYS A HB2  1  
ATOM   764   H  HB3  . LYS A 1 52 ? 12.355  -4.754  -2.812  1.00 0.00 ? 116 LYS A HB3  1  
ATOM   765   H  HG2  . LYS A 1 52 ? 11.159  -2.559  -2.436  1.00 0.00 ? 116 LYS A HG2  1  
ATOM   766   H  HG3  . LYS A 1 52 ? 11.399  -2.835  -0.709  1.00 0.00 ? 116 LYS A HG3  1  
ATOM   767   H  HD2  . LYS A 1 52 ? 13.807  -2.925  -1.038  1.00 0.00 ? 116 LYS A HD2  1  
ATOM   768   H  HD3  . LYS A 1 52 ? 13.594  -2.723  -2.779  1.00 0.00 ? 116 LYS A HD3  1  
ATOM   769   H  HE2  . LYS A 1 52 ? 12.350  -0.552  -2.140  1.00 0.00 ? 116 LYS A HE2  1  
ATOM   770   H  HE3  . LYS A 1 52 ? 13.141  -0.742  -0.576  1.00 0.00 ? 116 LYS A HE3  1  
ATOM   771   H  HZ1  . LYS A 1 52 ? 14.237  0.123   -3.081  1.00 0.00 ? 116 LYS A HZ1  1  
ATOM   772   H  HZ2  . LYS A 1 52 ? 15.161  -1.092  -2.351  1.00 0.00 ? 116 LYS A HZ2  1  
ATOM   773   H  HZ3  . LYS A 1 52 ? 14.830  0.339   -1.512  1.00 0.00 ? 116 LYS A HZ3  1  
ATOM   774   N  N    . ILE A 1 53 ? 8.615   -4.117  -3.510  1.00 0.00 ? 117 ILE A N    1  
ATOM   775   C  CA   . ILE A 1 53 ? 7.991   -3.662  -4.746  1.00 0.00 ? 117 ILE A CA   1  
ATOM   776   C  C    . ILE A 1 53 ? 8.804   -2.547  -5.394  1.00 0.00 ? 117 ILE A C    1  
ATOM   777   O  O    . ILE A 1 53 ? 8.888   -1.439  -4.864  1.00 0.00 ? 117 ILE A O    1  
ATOM   778   C  CB   . ILE A 1 53 ? 6.556   -3.160  -4.501  1.00 0.00 ? 117 ILE A CB   1  
ATOM   779   C  CG1  . ILE A 1 53 ? 5.737   -4.227  -3.772  1.00 0.00 ? 117 ILE A CG1  1  
ATOM   780   C  CG2  . ILE A 1 53 ? 5.894   -2.785  -5.819  1.00 0.00 ? 117 ILE A CG2  1  
ATOM   781   C  CD1  . ILE A 1 53 ? 5.439   -5.444  -4.619  1.00 0.00 ? 117 ILE A CD1  1  
ATOM   782   H  H    . ILE A 1 53 ? 8.135   -4.004  -2.663  1.00 0.00 ? 117 ILE A H    1  
ATOM   783   H  HA   . ILE A 1 53 ? 7.947   -4.502  -5.425  1.00 0.00 ? 117 ILE A HA   1  
ATOM   784   H  HB   . ILE A 1 53 ? 6.608   -2.274  -3.888  1.00 0.00 ? 117 ILE A HB   1  
ATOM   785   H  HG12 . ILE A 1 53 ? 6.280   -4.555  -2.900  1.00 0.00 ? 117 ILE A HG12 1  
ATOM   786   H  HG13 . ILE A 1 53 ? 4.794   -3.797  -3.463  1.00 0.00 ? 117 ILE A HG13 1  
ATOM   787   H  HG21 . ILE A 1 53 ? 4.900   -2.407  -5.628  1.00 0.00 ? 117 ILE A HG21 1  
ATOM   788   H  HG22 . ILE A 1 53 ? 6.479   -2.023  -6.311  1.00 0.00 ? 117 ILE A HG22 1  
ATOM   789   H  HG23 . ILE A 1 53 ? 5.832   -3.657  -6.452  1.00 0.00 ? 117 ILE A HG23 1  
ATOM   790   H  HD11 . ILE A 1 53 ? 6.071   -5.436  -5.495  1.00 0.00 ? 117 ILE A HD11 1  
ATOM   791   H  HD12 . ILE A 1 53 ? 5.632   -6.338  -4.045  1.00 0.00 ? 117 ILE A HD12 1  
ATOM   792   H  HD13 . ILE A 1 53 ? 4.403   -5.427  -4.923  1.00 0.00 ? 117 ILE A HD13 1  
ATOM   793   N  N    . GLN A 1 54 ? 9.400   -2.847  -6.544  1.00 0.00 ? 118 GLN A N    1  
ATOM   794   C  CA   . GLN A 1 54 ? 10.205  -1.868  -7.265  1.00 0.00 ? 118 GLN A CA   1  
ATOM   795   C  C    . GLN A 1 54 ? 9.727   -1.725  -8.706  1.00 0.00 ? 118 GLN A C    1  
ATOM   796   O  O    . GLN A 1 54 ? 9.035   -2.597  -9.232  1.00 0.00 ? 118 GLN A O    1  
ATOM   797   C  CB   . GLN A 1 54 ? 11.680  -2.275  -7.243  1.00 0.00 ? 118 GLN A CB   1  
ATOM   798   C  CG   . GLN A 1 54 ? 12.628  -1.146  -7.615  1.00 0.00 ? 118 GLN A CG   1  
ATOM   799   C  CD   . GLN A 1 54 ? 12.395  0.106   -6.793  1.00 0.00 ? 118 GLN A CD   1  
ATOM   800   O  OE1  . GLN A 1 54 ? 11.615  0.978   -7.176  1.00 0.00 ? 118 GLN A OE1  1  
ATOM   801   N  NE2  . GLN A 1 54 ? 13.073  0.203   -5.655  1.00 0.00 ? 118 GLN A NE2  1  
ATOM   802   H  H    . GLN A 1 54 ? 9.295   -3.747  -6.916  1.00 0.00 ? 118 GLN A H    1  
ATOM   803   H  HA   . GLN A 1 54 ? 10.096  -0.917  -6.766  1.00 0.00 ? 118 GLN A HA   1  
ATOM   804   H  HB2  . GLN A 1 54 ? 11.932  -2.615  -6.250  1.00 0.00 ? 118 GLN A HB2  1  
ATOM   805   H  HB3  . GLN A 1 54 ? 11.828  -3.085  -7.941  1.00 0.00 ? 118 GLN A HB3  1  
ATOM   806   H  HG2  . GLN A 1 54 ? 13.643  -1.478  -7.456  1.00 0.00 ? 118 GLN A HG2  1  
ATOM   807   H  HG3  . GLN A 1 54 ? 12.488  -0.906  -8.658  1.00 0.00 ? 118 GLN A HG3  1  
ATOM   808   H  HE21 . GLN A 1 54 ? 13.679  -0.530  -5.414  1.00 0.00 ? 118 GLN A HE21 1  
ATOM   809   H  HE22 . GLN A 1 54 ? 12.943  1.002   -5.105  1.00 0.00 ? 118 GLN A HE22 1  
ATOM   810   N  N    . LYS A 1 55 ? 10.099  -0.618  -9.340  1.00 0.00 ? 119 LYS A N    1  
ATOM   811   C  CA   . LYS A 1 55 ? 9.710   -0.359  -10.721 1.00 0.00 ? 119 LYS A CA   1  
ATOM   812   C  C    . LYS A 1 55 ? 10.227  -1.455  -11.647 1.00 0.00 ? 119 LYS A C    1  
ATOM   813   O  O    . LYS A 1 55 ? 9.457   -2.084  -12.373 1.00 0.00 ? 119 LYS A O    1  
ATOM   814   C  CB   . LYS A 1 55 ? 10.242  1.001   -11.176 1.00 0.00 ? 119 LYS A CB   1  
ATOM   815   C  CG   . LYS A 1 55 ? 11.745  1.150   -11.020 1.00 0.00 ? 119 LYS A CG   1  
ATOM   816   C  CD   . LYS A 1 55 ? 12.147  2.604   -10.844 1.00 0.00 ? 119 LYS A CD   1  
ATOM   817   C  CE   . LYS A 1 55 ? 13.579  2.731   -10.347 1.00 0.00 ? 119 LYS A CE   1  
ATOM   818   N  NZ   . LYS A 1 55 ? 14.554  2.785   -11.471 1.00 0.00 ? 119 LYS A NZ   1  
ATOM   819   H  H    . LYS A 1 55 ? 10.651  0.041   -8.867  1.00 0.00 ? 119 LYS A H    1  
ATOM   820   H  HA   . LYS A 1 55 ? 8.631   -0.347  -10.765 1.00 0.00 ? 119 LYS A HA   1  
ATOM   821   H  HB2  . LYS A 1 55 ? 9.994   1.142   -12.218 1.00 0.00 ? 119 LYS A HB2  1  
ATOM   822   H  HB3  . LYS A 1 55 ? 9.763   1.775   -10.594 1.00 0.00 ? 119 LYS A HB3  1  
ATOM   823   H  HG2  . LYS A 1 55 ? 12.065  0.592   -10.152 1.00 0.00 ? 119 LYS A HG2  1  
ATOM   824   H  HG3  . LYS A 1 55 ? 12.230  0.756   -11.902 1.00 0.00 ? 119 LYS A HG3  1  
ATOM   825   H  HD2  . LYS A 1 55 ? 12.062  3.110   -11.794 1.00 0.00 ? 119 LYS A HD2  1  
ATOM   826   H  HD3  . LYS A 1 55 ? 11.484  3.068   -10.127 1.00 0.00 ? 119 LYS A HD3  1  
ATOM   827   H  HE2  . LYS A 1 55 ? 13.665  3.635   -9.763  1.00 0.00 ? 119 LYS A HE2  1  
ATOM   828   H  HE3  . LYS A 1 55 ? 13.807  1.878   -9.724  1.00 0.00 ? 119 LYS A HE3  1  
ATOM   829   H  HZ1  . LYS A 1 55 ? 14.330  3.582   -12.100 1.00 0.00 ? 119 LYS A HZ1  1  
ATOM   830   H  HZ2  . LYS A 1 55 ? 14.515  1.902   -12.020 1.00 0.00 ? 119 LYS A HZ2  1  
ATOM   831   H  HZ3  . LYS A 1 55 ? 15.518  2.909   -11.102 1.00 0.00 ? 119 LYS A HZ3  1  
ATOM   832   N  N    . LYS A 1 56 ? 11.536  -1.681  -11.615 1.00 0.00 ? 120 LYS A N    1  
ATOM   833   C  CA   . LYS A 1 56 ? 12.157  -2.703  -12.449 1.00 0.00 ? 120 LYS A CA   1  
ATOM   834   C  C    . LYS A 1 56 ? 11.399  -4.022  -12.349 1.00 0.00 ? 120 LYS A C    1  
ATOM   835   O  O    . LYS A 1 56 ? 11.215  -4.721  -13.345 1.00 0.00 ? 120 LYS A O    1  
ATOM   836   C  CB   . LYS A 1 56 ? 13.617  -2.909  -12.037 1.00 0.00 ? 120 LYS A CB   1  
ATOM   837   C  CG   . LYS A 1 56 ? 13.791  -3.254  -10.569 1.00 0.00 ? 120 LYS A CG   1  
ATOM   838   C  CD   . LYS A 1 56 ? 15.169  -3.831  -10.291 1.00 0.00 ? 120 LYS A CD   1  
ATOM   839   C  CE   . LYS A 1 56 ? 16.180  -2.738  -9.983  1.00 0.00 ? 120 LYS A CE   1  
ATOM   840   N  NZ   . LYS A 1 56 ? 16.858  -2.246  -11.215 1.00 0.00 ? 120 LYS A NZ   1  
ATOM   841   H  H    . LYS A 1 56 ? 12.099  -1.147  -11.015 1.00 0.00 ? 120 LYS A H    1  
ATOM   842   H  HA   . LYS A 1 56 ? 12.126  -2.360  -13.473 1.00 0.00 ? 120 LYS A HA   1  
ATOM   843   H  HB2  . LYS A 1 56 ? 14.035  -3.712  -12.627 1.00 0.00 ? 120 LYS A HB2  1  
ATOM   844   H  HB3  . LYS A 1 56 ? 14.167  -2.001  -12.240 1.00 0.00 ? 120 LYS A HB3  1  
ATOM   845   H  HG2  . LYS A 1 56 ? 13.663  -2.358  -9.980  1.00 0.00 ? 120 LYS A HG2  1  
ATOM   846   H  HG3  . LYS A 1 56 ? 13.043  -3.981  -10.288 1.00 0.00 ? 120 LYS A HG3  1  
ATOM   847   H  HD2  . LYS A 1 56 ? 15.107  -4.497  -9.444  1.00 0.00 ? 120 LYS A HD2  1  
ATOM   848   H  HD3  . LYS A 1 56 ? 15.501  -4.382  -11.161 1.00 0.00 ? 120 LYS A HD3  1  
ATOM   849   H  HE2  . LYS A 1 56 ? 15.667  -1.914  -9.512  1.00 0.00 ? 120 LYS A HE2  1  
ATOM   850   H  HE3  . LYS A 1 56 ? 16.923  -3.133  -9.307  1.00 0.00 ? 120 LYS A HE3  1  
ATOM   851   H  HZ1  . LYS A 1 56 ? 17.626  -1.591  -10.963 1.00 0.00 ? 120 LYS A HZ1  1  
ATOM   852   H  HZ2  . LYS A 1 56 ? 16.177  -1.748  -11.822 1.00 0.00 ? 120 LYS A HZ2  1  
ATOM   853   H  HZ3  . LYS A 1 56 ? 17.258  -3.046  -11.746 1.00 0.00 ? 120 LYS A HZ3  1  
ATOM   854   N  N    . ASN A 1 57 ? 10.958  -4.356  -11.140 1.00 0.00 ? 121 ASN A N    1  
ATOM   855   C  CA   . ASN A 1 57 ? 10.218  -5.591  -10.910 1.00 0.00 ? 121 ASN A CA   1  
ATOM   856   C  C    . ASN A 1 57 ? 8.969   -5.329  -10.074 1.00 0.00 ? 121 ASN A C    1  
ATOM   857   O  O    . ASN A 1 57 ? 8.985   -5.477  -8.852  1.00 0.00 ? 121 ASN A O    1  
ATOM   858   C  CB   . ASN A 1 57 ? 11.108  -6.620  -10.209 1.00 0.00 ? 121 ASN A CB   1  
ATOM   859   C  CG   . ASN A 1 57 ? 11.931  -7.435  -11.188 1.00 0.00 ? 121 ASN A CG   1  
ATOM   860   O  OD1  . ASN A 1 57 ? 11.391  -8.217  -11.970 1.00 0.00 ? 121 ASN A OD1  1  
ATOM   861   N  ND2  . ASN A 1 57 ? 13.246  -7.254  -11.149 1.00 0.00 ? 121 ASN A ND2  1  
ATOM   862   H  H    . ASN A 1 57 ? 11.136  -3.757  -10.384 1.00 0.00 ? 121 ASN A H    1  
ATOM   863   H  HA   . ASN A 1 57 ? 9.919   -5.982  -11.871 1.00 0.00 ? 121 ASN A HA   1  
ATOM   864   H  HB2  . ASN A 1 57 ? 11.784  -6.107  -9.541  1.00 0.00 ? 121 ASN A HB2  1  
ATOM   865   H  HB3  . ASN A 1 57 ? 10.488  -7.295  -9.639  1.00 0.00 ? 121 ASN A HB3  1  
ATOM   866   H  HD21 . ASN A 1 57 ? 13.607  -6.614  -10.500 1.00 0.00 ? 121 ASN A HD21 1  
ATOM   867   H  HD22 . ASN A 1 57 ? 13.802  -7.767  -11.772 1.00 0.00 ? 121 ASN A HD22 1  
ATOM   868   N  N    . ARG A 1 58 ? 7.888   -4.941  -10.742 1.00 0.00 ? 122 ARG A N    1  
ATOM   869   C  CA   . ARG A 1 58 ? 6.630   -4.658  -10.062 1.00 0.00 ? 122 ARG A CA   1  
ATOM   870   C  C    . ARG A 1 58 ? 5.777   -5.919  -9.950  1.00 0.00 ? 122 ARG A C    1  
ATOM   871   O  O    . ARG A 1 58 ? 5.305   -6.267  -8.869  1.00 0.00 ? 122 ARG A O    1  
ATOM   872   C  CB   . ARG A 1 58 ? 5.856   -3.570  -10.807 1.00 0.00 ? 122 ARG A CB   1  
ATOM   873   C  CG   . ARG A 1 58 ? 6.446   -2.179  -10.639 1.00 0.00 ? 122 ARG A CG   1  
ATOM   874   C  CD   . ARG A 1 58 ? 5.827   -1.190  -11.614 1.00 0.00 ? 122 ARG A CD   1  
ATOM   875   N  NE   . ARG A 1 58 ? 6.454   -1.255  -12.932 1.00 0.00 ? 122 ARG A NE   1  
ATOM   876   C  CZ   . ARG A 1 58 ? 6.025   -2.044  -13.911 1.00 0.00 ? 122 ARG A CZ   1  
ATOM   877   N  NH1  . ARG A 1 58 ? 4.974   -2.829  -13.722 1.00 0.00 ? 122 ARG A NH1  1  
ATOM   878   N  NH2  . ARG A 1 58 ? 6.648   -2.048  -15.083 1.00 0.00 ? 122 ARG A NH2  1  
ATOM   879   H  H    . ARG A 1 58 ? 7.937   -4.842  -11.716 1.00 0.00 ? 122 ARG A H    1  
ATOM   880   H  HA   . ARG A 1 58 ? 6.862   -4.306  -9.068  1.00 0.00 ? 122 ARG A HA   1  
ATOM   881   H  HB2  . ARG A 1 58 ? 5.846   -3.808  -11.860 1.00 0.00 ? 122 ARG A HB2  1  
ATOM   882   H  HB3  . ARG A 1 58 ? 4.840   -3.553  -10.441 1.00 0.00 ? 122 ARG A HB3  1  
ATOM   883   H  HG2  . ARG A 1 58 ? 6.260   -1.838  -9.631  1.00 0.00 ? 122 ARG A HG2  1  
ATOM   884   H  HG3  . ARG A 1 58 ? 7.510   -2.227  -10.815 1.00 0.00 ? 122 ARG A HG3  1  
ATOM   885   H  HD2  . ARG A 1 58 ? 4.776   -1.414  -11.715 1.00 0.00 ? 122 ARG A HD2  1  
ATOM   886   H  HD3  . ARG A 1 58 ? 5.946   -0.193  -11.218 1.00 0.00 ? 122 ARG A HD3  1  
ATOM   887   H  HE   . ARG A 1 58 ? 7.233   -0.683  -13.093 1.00 0.00 ? 122 ARG A HE   1  
ATOM   888   H  HH11 . ARG A 1 58 ? 4.502   -2.828  -12.841 1.00 0.00 ? 122 ARG A HH11 1  
ATOM   889   H  HH12 . ARG A 1 58 ? 4.652   -3.421  -14.462 1.00 0.00 ? 122 ARG A HH12 1  
ATOM   890   H  HH21 . ARG A 1 58 ? 7.441   -1.457  -15.229 1.00 0.00 ? 122 ARG A HH21 1  
ATOM   891   H  HH22 . ARG A 1 58 ? 6.325   -2.641  -15.819 1.00 0.00 ? 122 ARG A HH22 1  
ATOM   892   N  N    . ASN A 1 59 ? 5.583   -6.597  -11.077 1.00 0.00 ? 123 ASN A N    1  
ATOM   893   C  CA   . ASN A 1 59 ? 4.786   -7.818  -11.106 1.00 0.00 ? 123 ASN A CA   1  
ATOM   894   C  C    . ASN A 1 59 ? 5.598   -9.010  -10.609 1.00 0.00 ? 123 ASN A C    1  
ATOM   895   O  O    . ASN A 1 59 ? 5.634   -10.061 -11.249 1.00 0.00 ? 123 ASN A O    1  
ATOM   896   C  CB   . ASN A 1 59 ? 4.279   -8.087  -12.524 1.00 0.00 ? 123 ASN A CB   1  
ATOM   897   C  CG   . ASN A 1 59 ? 2.967   -8.848  -12.535 1.00 0.00 ? 123 ASN A CG   1  
ATOM   898   O  OD1  . ASN A 1 59 ? 2.069   -8.570  -11.739 1.00 0.00 ? 123 ASN A OD1  1  
ATOM   899   N  ND2  . ASN A 1 59 ? 2.850   -9.814  -13.438 1.00 0.00 ? 123 ASN A ND2  1  
ATOM   900   H  H    . ASN A 1 59 ? 5.985   -6.269  -11.908 1.00 0.00 ? 123 ASN A H    1  
ATOM   901   H  HA   . ASN A 1 59 ? 3.939   -7.676  -10.451 1.00 0.00 ? 123 ASN A HA   1  
ATOM   902   H  HB2  . ASN A 1 59 ? 4.130   -7.145  -13.032 1.00 0.00 ? 123 ASN A HB2  1  
ATOM   903   H  HB3  . ASN A 1 59 ? 5.015   -8.668  -13.059 1.00 0.00 ? 123 ASN A HB3  1  
ATOM   904   H  HD21 . ASN A 1 59 ? 3.606   -9.979  -14.040 1.00 0.00 ? 123 ASN A HD21 1  
ATOM   905   H  HD22 . ASN A 1 59 ? 2.012   -10.321 -13.468 1.00 0.00 ? 123 ASN A HD22 1  
ATOM   906   N  N    . LYS A 1 60 ? 6.249   -8.839  -9.464  1.00 0.00 ? 124 LYS A N    1  
ATOM   907   C  CA   . LYS A 1 60 ? 7.060   -9.901  -8.878  1.00 0.00 ? 124 LYS A CA   1  
ATOM   908   C  C    . LYS A 1 60 ? 6.269   -10.673 -7.827  1.00 0.00 ? 124 LYS A C    1  
ATOM   909   O  O    . LYS A 1 60 ? 5.995   -11.862 -7.991  1.00 0.00 ? 124 LYS A O    1  
ATOM   910   C  CB   . LYS A 1 60 ? 8.327   -9.315  -8.251  1.00 0.00 ? 124 LYS A CB   1  
ATOM   911   C  CG   . LYS A 1 60 ? 9.237   -10.361 -7.631  1.00 0.00 ? 124 LYS A CG   1  
ATOM   912   C  CD   . LYS A 1 60 ? 10.127  -11.015 -8.674  1.00 0.00 ? 124 LYS A CD   1  
ATOM   913   C  CE   . LYS A 1 60 ? 11.128  -11.966 -8.036  1.00 0.00 ? 124 LYS A CE   1  
ATOM   914   N  NZ   . LYS A 1 60 ? 12.303  -12.208 -8.918  1.00 0.00 ? 124 LYS A NZ   1  
ATOM   915   H  H    . LYS A 1 60 ? 6.182   -7.978  -9.000  1.00 0.00 ? 124 LYS A H    1  
ATOM   916   H  HA   . LYS A 1 60 ? 7.341   -10.578 -9.670  1.00 0.00 ? 124 LYS A HA   1  
ATOM   917   H  HB2  . LYS A 1 60 ? 8.883   -8.791  -9.014  1.00 0.00 ? 124 LYS A HB2  1  
ATOM   918   H  HB3  . LYS A 1 60 ? 8.041   -8.614  -7.480  1.00 0.00 ? 124 LYS A HB3  1  
ATOM   919   H  HG2  . LYS A 1 60 ? 9.861   -9.887  -6.888  1.00 0.00 ? 124 LYS A HG2  1  
ATOM   920   H  HG3  . LYS A 1 60 ? 8.630   -11.121 -7.161  1.00 0.00 ? 124 LYS A HG3  1  
ATOM   921   H  HD2  . LYS A 1 60 ? 9.509   -11.571 -9.364  1.00 0.00 ? 124 LYS A HD2  1  
ATOM   922   H  HD3  . LYS A 1 60 ? 10.665  -10.246 -9.210  1.00 0.00 ? 124 LYS A HD3  1  
ATOM   923   H  HE2  . LYS A 1 60 ? 11.470  -11.537 -7.106  1.00 0.00 ? 124 LYS A HE2  1  
ATOM   924   H  HE3  . LYS A 1 60 ? 10.636  -12.907 -7.840  1.00 0.00 ? 124 LYS A HE3  1  
ATOM   925   H  HZ1  . LYS A 1 60 ? 12.878  -12.988 -8.542  1.00 0.00 ? 124 LYS A HZ1  1  
ATOM   926   H  HZ2  . LYS A 1 60 ? 12.892  -11.352 -8.972  1.00 0.00 ? 124 LYS A HZ2  1  
ATOM   927   H  HZ3  . LYS A 1 60 ? 11.985  -12.456 -9.877  1.00 0.00 ? 124 LYS A HZ3  1  
ATOM   928   N  N    . CYS A 1 61 ? 5.904   -9.989  -6.748  1.00 0.00 ? 125 CYS A N    1  
ATOM   929   C  CA   . CYS A 1 61 ? 5.143   -10.610 -5.670  1.00 0.00 ? 125 CYS A CA   1  
ATOM   930   C  C    . CYS A 1 61 ? 3.756   -9.984  -5.552  1.00 0.00 ? 125 CYS A C    1  
ATOM   931   O  O    . CYS A 1 61 ? 3.587   -8.784  -5.766  1.00 0.00 ? 125 CYS A O    1  
ATOM   932   C  CB   . CYS A 1 61 ? 5.892   -10.470 -4.343  1.00 0.00 ? 125 CYS A CB   1  
ATOM   933   S  SG   . CYS A 1 61 ? 5.126   -11.373 -2.959  1.00 0.00 ? 125 CYS A SG   1  
ATOM   934   H  H    . CYS A 1 61 ? 6.152   -9.043  -6.674  1.00 0.00 ? 125 CYS A H    1  
ATOM   935   H  HA   . CYS A 1 61 ? 5.033   -11.658 -5.903  1.00 0.00 ? 125 CYS A HA   1  
ATOM   936   H  HB2  . CYS A 1 61 ? 6.897   -10.847 -4.465  1.00 0.00 ? 125 CYS A HB2  1  
ATOM   937   H  HB3  . CYS A 1 61 ? 5.936   -9.426  -4.072  1.00 0.00 ? 125 CYS A HB3  1  
ATOM   938   N  N    . GLN A 1 62 ? 2.769   -10.806 -5.211  1.00 0.00 ? 126 GLN A N    1  
ATOM   939   C  CA   . GLN A 1 62 ? 1.398   -10.333 -5.065  1.00 0.00 ? 126 GLN A CA   1  
ATOM   940   C  C    . GLN A 1 62 ? 1.140   -9.839  -3.645  1.00 0.00 ? 126 GLN A C    1  
ATOM   941   O  O    . GLN A 1 62 ? 0.878   -8.657  -3.426  1.00 0.00 ? 126 GLN A O    1  
ATOM   942   C  CB   . GLN A 1 62 ? 0.411   -11.448 -5.417  1.00 0.00 ? 126 GLN A CB   1  
ATOM   943   C  CG   . GLN A 1 62 ? 0.327   -11.738 -6.907  1.00 0.00 ? 126 GLN A CG   1  
ATOM   944   C  CD   . GLN A 1 62 ? -0.345  -10.622 -7.682  1.00 0.00 ? 126 GLN A CD   1  
ATOM   945   O  OE1  . GLN A 1 62 ? 0.113   -9.479  -7.671  1.00 0.00 ? 126 GLN A OE1  1  
ATOM   946   N  NE2  . GLN A 1 62 ? -1.440  -10.947 -8.360  1.00 0.00 ? 126 GLN A NE2  1  
ATOM   947   H  H    . GLN A 1 62 ? 2.968   -11.752 -5.054  1.00 0.00 ? 126 GLN A H    1  
ATOM   948   H  HA   . GLN A 1 62 ? 1.257   -9.510  -5.750  1.00 0.00 ? 126 GLN A HA   1  
ATOM   949   H  HB2  . GLN A 1 62 ? 0.714   -12.353 -4.912  1.00 0.00 ? 126 GLN A HB2  1  
ATOM   950   H  HB3  . GLN A 1 62 ? -0.572  -11.164 -5.072  1.00 0.00 ? 126 GLN A HB3  1  
ATOM   951   H  HG2  . GLN A 1 62 ? 1.328   -11.869 -7.292  1.00 0.00 ? 126 GLN A HG2  1  
ATOM   952   H  HG3  . GLN A 1 62 ? -0.236  -12.647 -7.052  1.00 0.00 ? 126 GLN A HG3  1  
ATOM   953   H  HE21 . GLN A 1 62 ? -1.748  -11.877 -8.321  1.00 0.00 ? 126 GLN A HE21 1  
ATOM   954   H  HE22 . GLN A 1 62 ? -1.895  -10.246 -8.868  1.00 0.00 ? 126 GLN A HE22 1  
ATOM   955   N  N    . TYR A 1 63 ? 1.216   -10.753 -2.684  1.00 0.00 ? 127 TYR A N    1  
ATOM   956   C  CA   . TYR A 1 63 ? 0.989   -10.411 -1.285  1.00 0.00 ? 127 TYR A CA   1  
ATOM   957   C  C    . TYR A 1 63 ? 1.709   -9.118  -0.915  1.00 0.00 ? 127 TYR A C    1  
ATOM   958   O  O    . TYR A 1 63 ? 1.078   -8.116  -0.577  1.00 0.00 ? 127 TYR A O    1  
ATOM   959   C  CB   . TYR A 1 63 ? 1.460   -11.548 -0.377  1.00 0.00 ? 127 TYR A CB   1  
ATOM   960   C  CG   . TYR A 1 63 ? 1.243   -11.278 1.095   1.00 0.00 ? 127 TYR A CG   1  
ATOM   961   C  CD1  . TYR A 1 63 ? 0.030   -11.572 1.704   1.00 0.00 ? 127 TYR A CD1  1  
ATOM   962   C  CD2  . TYR A 1 63 ? 2.252   -10.729 1.876   1.00 0.00 ? 127 TYR A CD2  1  
ATOM   963   C  CE1  . TYR A 1 63 ? -0.173  -11.326 3.048   1.00 0.00 ? 127 TYR A CE1  1  
ATOM   964   C  CE2  . TYR A 1 63 ? 2.059   -10.481 3.222   1.00 0.00 ? 127 TYR A CE2  1  
ATOM   965   C  CZ   . TYR A 1 63 ? 0.844   -10.781 3.803   1.00 0.00 ? 127 TYR A CZ   1  
ATOM   966   O  OH   . TYR A 1 63 ? 0.647   -10.535 5.142   1.00 0.00 ? 127 TYR A OH   1  
ATOM   967   H  H    . TYR A 1 63 ? 1.429   -11.680 -2.921  1.00 0.00 ? 127 TYR A H    1  
ATOM   968   H  HA   . TYR A 1 63 ? -0.073  -10.270 -1.147  1.00 0.00 ? 127 TYR A HA   1  
ATOM   969   H  HB2  . TYR A 1 63 ? 0.923   -12.449 -0.631  1.00 0.00 ? 127 TYR A HB2  1  
ATOM   970   H  HB3  . TYR A 1 63 ? 2.517   -11.709 -0.533  1.00 0.00 ? 127 TYR A HB3  1  
ATOM   971   H  HD1  . TYR A 1 63 ? -0.765  -12.000 1.110   1.00 0.00 ? 127 TYR A HD1  1  
ATOM   972   H  HD2  . TYR A 1 63 ? 3.202   -10.495 1.418   1.00 0.00 ? 127 TYR A HD2  1  
ATOM   973   H  HE1  . TYR A 1 63 ? -1.124  -11.561 3.503   1.00 0.00 ? 127 TYR A HE1  1  
ATOM   974   H  HE2  . TYR A 1 63 ? 2.855   -10.053 3.813   1.00 0.00 ? 127 TYR A HE2  1  
ATOM   975   H  HH   . TYR A 1 63 ? 1.348   -9.967  5.470   1.00 0.00 ? 127 TYR A HH   1  
ATOM   976   N  N    . CYS A 1 64 ? 3.036   -9.148  -0.983  1.00 0.00 ? 128 CYS A N    1  
ATOM   977   C  CA   . CYS A 1 64 ? 3.845   -7.980  -0.657  1.00 0.00 ? 128 CYS A CA   1  
ATOM   978   C  C    . CYS A 1 64 ? 3.268   -6.722  -1.298  1.00 0.00 ? 128 CYS A C    1  
ATOM   979   O  O    . CYS A 1 64 ? 3.140   -5.684  -0.648  1.00 0.00 ? 128 CYS A O    1  
ATOM   980   C  CB   . CYS A 1 64 ? 5.288   -8.187  -1.123  1.00 0.00 ? 128 CYS A CB   1  
ATOM   981   S  SG   . CYS A 1 64 ? 6.244   -9.344  -0.090  1.00 0.00 ? 128 CYS A SG   1  
ATOM   982   H  H    . CYS A 1 64 ? 3.482   -9.977  -1.260  1.00 0.00 ? 128 CYS A H    1  
ATOM   983   H  HA   . CYS A 1 64 ? 3.836   -7.859  0.415   1.00 0.00 ? 128 CYS A HA   1  
ATOM   984   H  HB2  . CYS A 1 64 ? 5.280   -8.577  -2.130  1.00 0.00 ? 128 CYS A HB2  1  
ATOM   985   H  HB3  . CYS A 1 64 ? 5.801   -7.237  -1.114  1.00 0.00 ? 128 CYS A HB3  1  
ATOM   986   N  N    . ARG A 1 65 ? 2.921   -6.822  -2.577  1.00 0.00 ? 129 ARG A N    1  
ATOM   987   C  CA   . ARG A 1 65 ? 2.358   -5.693  -3.307  1.00 0.00 ? 129 ARG A CA   1  
ATOM   988   C  C    . ARG A 1 65 ? 1.153   -5.115  -2.570  1.00 0.00 ? 129 ARG A C    1  
ATOM   989   O  O    . ARG A 1 65 ? 1.143   -3.941  -2.199  1.00 0.00 ? 129 ARG A O    1  
ATOM   990   C  CB   . ARG A 1 65 ? 1.948   -6.122  -4.717  1.00 0.00 ? 129 ARG A CB   1  
ATOM   991   C  CG   . ARG A 1 65 ? 1.496   -4.968  -5.598  1.00 0.00 ? 129 ARG A CG   1  
ATOM   992   C  CD   . ARG A 1 65 ? 0.893   -5.466  -6.902  1.00 0.00 ? 129 ARG A CD   1  
ATOM   993   N  NE   . ARG A 1 65 ? 1.899   -5.604  -7.952  1.00 0.00 ? 129 ARG A NE   1  
ATOM   994   C  CZ   . ARG A 1 65 ? 1.603   -5.700  -9.244  1.00 0.00 ? 129 ARG A CZ   1  
ATOM   995   N  NH1  . ARG A 1 65 ? 0.339   -5.674  -9.642  1.00 0.00 ? 129 ARG A NH1  1  
ATOM   996   N  NH2  . ARG A 1 65 ? 2.574   -5.823  -10.140 1.00 0.00 ? 129 ARG A NH2  1  
ATOM   997   H  H    . ARG A 1 65 ? 3.047   -7.676  -3.042  1.00 0.00 ? 129 ARG A H    1  
ATOM   998   H  HA   . ARG A 1 65 ? 3.120   -4.931  -3.379  1.00 0.00 ? 129 ARG A HA   1  
ATOM   999   H  HB2  . ARG A 1 65 ? 2.791   -6.601  -5.194  1.00 0.00 ? 129 ARG A HB2  1  
ATOM   1000  H  HB3  . ARG A 1 65 ? 1.137   -6.829  -4.643  1.00 0.00 ? 129 ARG A HB3  1  
ATOM   1001  H  HG2  . ARG A 1 65 ? 0.753   -4.392  -5.067  1.00 0.00 ? 129 ARG A HG2  1  
ATOM   1002  H  HG3  . ARG A 1 65 ? 2.348   -4.343  -5.820  1.00 0.00 ? 129 ARG A HG3  1  
ATOM   1003  H  HD2  . ARG A 1 65 ? 0.436   -6.429  -6.727  1.00 0.00 ? 129 ARG A HD2  1  
ATOM   1004  H  HD3  . ARG A 1 65 ? 0.141   -4.764  -7.226  1.00 0.00 ? 129 ARG A HD3  1  
ATOM   1005  H  HE   . ARG A 1 65 ? 2.839   -5.625  -7.680  1.00 0.00 ? 129 ARG A HE   1  
ATOM   1006  H  HH11 . ARG A 1 65 ? -0.394  -5.581  -8.969  1.00 0.00 ? 129 ARG A HH11 1  
ATOM   1007  H  HH12 . ARG A 1 65 ? 0.119   -5.746  -10.615 1.00 0.00 ? 129 ARG A HH12 1  
ATOM   1008  H  HH21 . ARG A 1 65 ? 3.528   -5.842  -9.844  1.00 0.00 ? 129 ARG A HH21 1  
ATOM   1009  H  HH22 . ARG A 1 65 ? 2.351   -5.895  -11.112 1.00 0.00 ? 129 ARG A HH22 1  
ATOM   1010  N  N    . PHE A 1 66 ? 0.139   -5.948  -2.360  1.00 0.00 ? 130 PHE A N    1  
ATOM   1011  C  CA   . PHE A 1 66 ? -1.072  -5.520  -1.669  1.00 0.00 ? 130 PHE A CA   1  
ATOM   1012  C  C    . PHE A 1 66 ? -0.741  -4.971  -0.284  1.00 0.00 ? 130 PHE A C    1  
ATOM   1013  O  O    . PHE A 1 66 ? -1.333  -3.988  0.162   1.00 0.00 ? 130 PHE A O    1  
ATOM   1014  C  CB   . PHE A 1 66 ? -2.054  -6.686  -1.547  1.00 0.00 ? 130 PHE A CB   1  
ATOM   1015  C  CG   . PHE A 1 66 ? -3.382  -6.293  -0.964  1.00 0.00 ? 130 PHE A CG   1  
ATOM   1016  C  CD1  . PHE A 1 66 ? -4.148  -5.304  -1.558  1.00 0.00 ? 130 PHE A CD1  1  
ATOM   1017  C  CD2  . PHE A 1 66 ? -3.863  -6.913  0.178   1.00 0.00 ? 130 PHE A CD2  1  
ATOM   1018  C  CE1  . PHE A 1 66 ? -5.370  -4.940  -1.025  1.00 0.00 ? 130 PHE A CE1  1  
ATOM   1019  C  CE2  . PHE A 1 66 ? -5.084  -6.554  0.715   1.00 0.00 ? 130 PHE A CE2  1  
ATOM   1020  C  CZ   . PHE A 1 66 ? -5.838  -5.565  0.114   1.00 0.00 ? 130 PHE A CZ   1  
ATOM   1021  H  H    . PHE A 1 66 ? 0.206   -6.872  -2.680  1.00 0.00 ? 130 PHE A H    1  
ATOM   1022  H  HA   . PHE A 1 66 ? -1.527  -4.736  -2.254  1.00 0.00 ? 130 PHE A HA   1  
ATOM   1023  H  HB2  . PHE A 1 66 ? -2.232  -7.101  -2.527  1.00 0.00 ? 130 PHE A HB2  1  
ATOM   1024  H  HB3  . PHE A 1 66 ? -1.623  -7.445  -0.912  1.00 0.00 ? 130 PHE A HB3  1  
ATOM   1025  H  HD1  . PHE A 1 66 ? -3.783  -4.813  -2.450  1.00 0.00 ? 130 PHE A HD1  1  
ATOM   1026  H  HD2  . PHE A 1 66 ? -3.274  -7.686  0.650   1.00 0.00 ? 130 PHE A HD2  1  
ATOM   1027  H  HE1  . PHE A 1 66 ? -5.957  -4.167  -1.498  1.00 0.00 ? 130 PHE A HE1  1  
ATOM   1028  H  HE2  . PHE A 1 66 ? -5.448  -7.044  1.606   1.00 0.00 ? 130 PHE A HE2  1  
ATOM   1029  H  HZ   . PHE A 1 66 ? -6.793  -5.283  0.532   1.00 0.00 ? 130 PHE A HZ   1  
ATOM   1030  N  N    . GLN A 1 67 ? 0.206   -5.614  0.390   1.00 0.00 ? 131 GLN A N    1  
ATOM   1031  C  CA   . GLN A 1 67 ? 0.614   -5.191  1.725   1.00 0.00 ? 131 GLN A CA   1  
ATOM   1032  C  C    . GLN A 1 67 ? 1.171   -3.772  1.700   1.00 0.00 ? 131 GLN A C    1  
ATOM   1033  O  O    . GLN A 1 67 ? 0.704   -2.897  2.429   1.00 0.00 ? 131 GLN A O    1  
ATOM   1034  C  CB   . GLN A 1 67 ? 1.661   -6.153  2.290   1.00 0.00 ? 131 GLN A CB   1  
ATOM   1035  C  CG   . GLN A 1 67 ? 1.063   -7.336  3.033   1.00 0.00 ? 131 GLN A CG   1  
ATOM   1036  C  CD   . GLN A 1 67 ? 0.582   -6.970  4.423   1.00 0.00 ? 131 GLN A CD   1  
ATOM   1037  O  OE1  . GLN A 1 67 ? 1.363   -6.934  5.373   1.00 0.00 ? 131 GLN A OE1  1  
ATOM   1038  N  NE2  . GLN A 1 67 ? -0.711  -6.695  4.549   1.00 0.00 ? 131 GLN A NE2  1  
ATOM   1039  H  H    . GLN A 1 67 ? 0.641   -6.390  -0.019  1.00 0.00 ? 131 GLN A H    1  
ATOM   1040  H  HA   . GLN A 1 67 ? -0.259  -5.211  2.360   1.00 0.00 ? 131 GLN A HA   1  
ATOM   1041  H  HB2  . GLN A 1 67 ? 2.261   -6.532  1.475   1.00 0.00 ? 131 GLN A HB2  1  
ATOM   1042  H  HB3  . GLN A 1 67 ? 2.298   -5.611  2.973   1.00 0.00 ? 131 GLN A HB3  1  
ATOM   1043  H  HG2  . GLN A 1 67 ? 0.224   -7.714  2.467   1.00 0.00 ? 131 GLN A HG2  1  
ATOM   1044  H  HG3  . GLN A 1 67 ? 1.814   -8.108  3.119   1.00 0.00 ? 131 GLN A HG3  1  
ATOM   1045  H  HE21 . GLN A 1 67 ? -1.275  -6.745  3.748   1.00 0.00 ? 131 GLN A HE21 1  
ATOM   1046  H  HE22 . GLN A 1 67 ? -1.050  -6.456  5.436   1.00 0.00 ? 131 GLN A HE22 1  
ATOM   1047  N  N    . LYS A 1 68 ? 2.173   -3.549  0.856   1.00 0.00 ? 132 LYS A N    1  
ATOM   1048  C  CA   . LYS A 1 68 ? 2.794   -2.236  0.734   1.00 0.00 ? 132 LYS A CA   1  
ATOM   1049  C  C    . LYS A 1 68 ? 1.737   -1.139  0.661   1.00 0.00 ? 132 LYS A C    1  
ATOM   1050  O  O    . LYS A 1 68 ? 1.869   -0.093  1.298   1.00 0.00 ? 132 LYS A O    1  
ATOM   1051  C  CB   . LYS A 1 68 ? 3.686   -2.184  -0.508  1.00 0.00 ? 132 LYS A CB   1  
ATOM   1052  C  CG   . LYS A 1 68 ? 4.410   -0.860  -0.682  1.00 0.00 ? 132 LYS A CG   1  
ATOM   1053  C  CD   . LYS A 1 68 ? 5.734   -1.040  -1.407  1.00 0.00 ? 132 LYS A CD   1  
ATOM   1054  C  CE   . LYS A 1 68 ? 6.526   0.258   -1.451  1.00 0.00 ? 132 LYS A CE   1  
ATOM   1055  N  NZ   . LYS A 1 68 ? 7.833   0.087   -2.143  1.00 0.00 ? 132 LYS A NZ   1  
ATOM   1056  H  H    . LYS A 1 68 ? 2.502   -4.287  0.300   1.00 0.00 ? 132 LYS A H    1  
ATOM   1057  H  HA   . LYS A 1 68 ? 3.403   -2.074  1.611   1.00 0.00 ? 132 LYS A HA   1  
ATOM   1058  H  HB2  . LYS A 1 68 ? 4.425   -2.969  -0.439  1.00 0.00 ? 132 LYS A HB2  1  
ATOM   1059  H  HB3  . LYS A 1 68 ? 3.075   -2.353  -1.383  1.00 0.00 ? 132 LYS A HB3  1  
ATOM   1060  H  HG2  . LYS A 1 68 ? 3.786   -0.191  -1.256  1.00 0.00 ? 132 LYS A HG2  1  
ATOM   1061  H  HG3  . LYS A 1 68 ? 4.599   -0.433  0.292   1.00 0.00 ? 132 LYS A HG3  1  
ATOM   1062  H  HD2  . LYS A 1 68 ? 6.319   -1.787  -0.892  1.00 0.00 ? 132 LYS A HD2  1  
ATOM   1063  H  HD3  . LYS A 1 68 ? 5.539   -1.367  -2.419  1.00 0.00 ? 132 LYS A HD3  1  
ATOM   1064  H  HE2  . LYS A 1 68 ? 5.945   1.001   -1.977  1.00 0.00 ? 132 LYS A HE2  1  
ATOM   1065  H  HE3  . LYS A 1 68 ? 6.704   0.590   -0.439  1.00 0.00 ? 132 LYS A HE3  1  
ATOM   1066  H  HZ1  . LYS A 1 68 ? 8.303   -0.780  -1.811  1.00 0.00 ? 132 LYS A HZ1  1  
ATOM   1067  H  HZ2  . LYS A 1 68 ? 8.451   0.900   -1.945  1.00 0.00 ? 132 LYS A HZ2  1  
ATOM   1068  H  HZ3  . LYS A 1 68 ? 7.688   0.018   -3.170  1.00 0.00 ? 132 LYS A HZ3  1  
ATOM   1069  N  N    . CYS A 1 69 ? 0.690   -1.384  -0.118  1.00 0.00 ? 133 CYS A N    1  
ATOM   1070  C  CA   . CYS A 1 69 ? -0.390  -0.417  -0.274  1.00 0.00 ? 133 CYS A CA   1  
ATOM   1071  C  C    . CYS A 1 69 ? -1.005  -0.066  1.076   1.00 0.00 ? 133 CYS A C    1  
ATOM   1072  O  O    . CYS A 1 69 ? -1.216  1.107   1.389   1.00 0.00 ? 133 CYS A O    1  
ATOM   1073  C  CB   . CYS A 1 69 ? -1.467  -0.969  -1.210  1.00 0.00 ? 133 CYS A CB   1  
ATOM   1074  S  SG   . CYS A 1 69 ? -1.000  -0.963  -2.957  1.00 0.00 ? 133 CYS A SG   1  
ATOM   1075  H  H    . CYS A 1 69 ? 0.641   -2.236  -0.601  1.00 0.00 ? 133 CYS A H    1  
ATOM   1076  H  HA   . CYS A 1 69 ? 0.028   0.478   -0.709  1.00 0.00 ? 133 CYS A HA   1  
ATOM   1077  H  HB2  . CYS A 1 69 ? -1.685  -1.990  -0.933  1.00 0.00 ? 133 CYS A HB2  1  
ATOM   1078  H  HB3  . CYS A 1 69 ? -2.363  -0.376  -1.106  1.00 0.00 ? 133 CYS A HB3  1  
ATOM   1079  H  HG   . CYS A 1 69 ? -0.426  -2.126  -3.231  1.00 0.00 ? 133 CYS A HG   1  
ATOM   1080  N  N    . LEU A 1 70 ? -1.293  -1.089  1.873   1.00 0.00 ? 134 LEU A N    1  
ATOM   1081  C  CA   . LEU A 1 70 ? -1.886  -0.890  3.191   1.00 0.00 ? 134 LEU A CA   1  
ATOM   1082  C  C    . LEU A 1 70 ? -0.927  -0.142  4.112   1.00 0.00 ? 134 LEU A C    1  
ATOM   1083  O  O    . LEU A 1 70 ? -1.321  0.798   4.802   1.00 0.00 ? 134 LEU A O    1  
ATOM   1084  C  CB   . LEU A 1 70 ? -2.262  -2.237  3.812   1.00 0.00 ? 134 LEU A CB   1  
ATOM   1085  C  CG   . LEU A 1 70 ? -3.289  -3.068  3.042   1.00 0.00 ? 134 LEU A CG   1  
ATOM   1086  C  CD1  . LEU A 1 70 ? -3.247  -4.519  3.493   1.00 0.00 ? 134 LEU A CD1  1  
ATOM   1087  C  CD2  . LEU A 1 70 ? -4.686  -2.491  3.224   1.00 0.00 ? 134 LEU A CD2  1  
ATOM   1088  H  H    . LEU A 1 70 ? -1.103  -2.001  1.569   1.00 0.00 ? 134 LEU A H    1  
ATOM   1089  H  HA   . LEU A 1 70 ? -2.781  -0.298  3.065   1.00 0.00 ? 134 LEU A HA   1  
ATOM   1090  H  HB2  . LEU A 1 70 ? -1.361  -2.823  3.899   1.00 0.00 ? 134 LEU A HB2  1  
ATOM   1091  H  HB3  . LEU A 1 70 ? -2.661  -2.045  4.798   1.00 0.00 ? 134 LEU A HB3  1  
ATOM   1092  H  HG   . LEU A 1 70 ? -3.049  -3.038  1.988   1.00 0.00 ? 134 LEU A HG   1  
ATOM   1093  H  HD11 . LEU A 1 70 ? -2.853  -4.574  4.496   1.00 0.00 ? 134 LEU A HD11 1  
ATOM   1094  H  HD12 . LEU A 1 70 ? -2.613  -5.085  2.826   1.00 0.00 ? 134 LEU A HD12 1  
ATOM   1095  H  HD13 . LEU A 1 70 ? -4.245  -4.931  3.474   1.00 0.00 ? 134 LEU A HD13 1  
ATOM   1096  H  HD21 . LEU A 1 70 ? -5.386  -3.294  3.399   1.00 0.00 ? 134 LEU A HD21 1  
ATOM   1097  H  HD22 . LEU A 1 70 ? -4.971  -1.951  2.333   1.00 0.00 ? 134 LEU A HD22 1  
ATOM   1098  H  HD23 . LEU A 1 70 ? -4.690  -1.818  4.069   1.00 0.00 ? 134 LEU A HD23 1  
ATOM   1099  N  N    . ALA A 1 71 ? 0.332   -0.565  4.115   1.00 0.00 ? 135 ALA A N    1  
ATOM   1100  C  CA   . ALA A 1 71 ? 1.348   0.067   4.948   1.00 0.00 ? 135 ALA A CA   1  
ATOM   1101  C  C    . ALA A 1 71 ? 1.420   1.567   4.682   1.00 0.00 ? 135 ALA A C    1  
ATOM   1102  O  O    . ALA A 1 71 ? 1.514   2.369   5.612   1.00 0.00 ? 135 ALA A O    1  
ATOM   1103  C  CB   . ALA A 1 71 ? 2.705   -0.579  4.708   1.00 0.00 ? 135 ALA A CB   1  
ATOM   1104  H  H    . ALA A 1 71 ? 0.585   -1.319  3.543   1.00 0.00 ? 135 ALA A H    1  
ATOM   1105  H  HA   . ALA A 1 71 ? 1.079   -0.093  5.982   1.00 0.00 ? 135 ALA A HA   1  
ATOM   1106  H  HB1  . ALA A 1 71 ? 3.386   -0.288  5.493   1.00 0.00 ? 135 ALA A HB1  1  
ATOM   1107  H  HB2  . ALA A 1 71 ? 2.595   -1.654  4.705   1.00 0.00 ? 135 ALA A HB2  1  
ATOM   1108  H  HB3  . ALA A 1 71 ? 3.094   -0.254  3.754   1.00 0.00 ? 135 ALA A HB3  1  
ATOM   1109  N  N    . LEU A 1 72 ? 1.376   1.940   3.408   1.00 0.00 ? 136 LEU A N    1  
ATOM   1110  C  CA   . LEU A 1 72 ? 1.437   3.345   3.020   1.00 0.00 ? 136 LEU A CA   1  
ATOM   1111  C  C    . LEU A 1 72 ? 0.236   4.112   3.562   1.00 0.00 ? 136 LEU A C    1  
ATOM   1112  O  O    . LEU A 1 72 ? 0.323   5.308   3.838   1.00 0.00 ? 136 LEU A O    1  
ATOM   1113  C  CB   . LEU A 1 72 ? 1.492   3.471   1.496   1.00 0.00 ? 136 LEU A CB   1  
ATOM   1114  C  CG   . LEU A 1 72 ? 2.777   2.981   0.828   1.00 0.00 ? 136 LEU A CG   1  
ATOM   1115  C  CD1  . LEU A 1 72 ? 2.534   2.689   -0.645  1.00 0.00 ? 136 LEU A CD1  1  
ATOM   1116  C  CD2  . LEU A 1 72 ? 3.889   4.006   0.994   1.00 0.00 ? 136 LEU A CD2  1  
ATOM   1117  H  H    . LEU A 1 72 ? 1.301   1.256   2.711   1.00 0.00 ? 136 LEU A H    1  
ATOM   1118  H  HA   . LEU A 1 72 ? 2.338   3.766   3.440   1.00 0.00 ? 136 LEU A HA   1  
ATOM   1119  H  HB2  . LEU A 1 72 ? 0.669   2.904   1.088   1.00 0.00 ? 136 LEU A HB2  1  
ATOM   1120  H  HB3  . LEU A 1 72 ? 1.366   4.515   1.247   1.00 0.00 ? 136 LEU A HB3  1  
ATOM   1121  H  HG   . LEU A 1 72 ? 3.093   2.062   1.301   1.00 0.00 ? 136 LEU A HG   1  
ATOM   1122  H  HD11 . LEU A 1 72 ? 2.549   3.614   -1.202  1.00 0.00 ? 136 LEU A HD11 1  
ATOM   1123  H  HD12 . LEU A 1 72 ? 1.573   2.212   -0.764  1.00 0.00 ? 136 LEU A HD12 1  
ATOM   1124  H  HD13 . LEU A 1 72 ? 3.309   2.034   -1.014  1.00 0.00 ? 136 LEU A HD13 1  
ATOM   1125  H  HD21 . LEU A 1 72 ? 4.370   3.863   1.951   1.00 0.00 ? 136 LEU A HD21 1  
ATOM   1126  H  HD22 . LEU A 1 72 ? 3.472   5.001   0.946   1.00 0.00 ? 136 LEU A HD22 1  
ATOM   1127  H  HD23 . LEU A 1 72 ? 4.615   3.881   0.204   1.00 0.00 ? 136 LEU A HD23 1  
ATOM   1128  N  N    . GLY A 1 73 ? -0.886  3.415   3.714   1.00 0.00 ? 137 GLY A N    1  
ATOM   1129  C  CA   . GLY A 1 73 ? -2.089  4.047   4.225   1.00 0.00 ? 137 GLY A CA   1  
ATOM   1130  C  C    . GLY A 1 73 ? -3.157  4.204   3.162   1.00 0.00 ? 137 GLY A C    1  
ATOM   1131  O  O    . GLY A 1 73 ? -3.821  5.238   3.088   1.00 0.00 ? 137 GLY A O    1  
ATOM   1132  H  H    . GLY A 1 73 ? -0.897  2.464   3.477   1.00 0.00 ? 137 GLY A H    1  
ATOM   1133  H  HA2  . GLY A 1 73 ? -2.483  3.446   5.031   1.00 0.00 ? 137 GLY A HA2  1  
ATOM   1134  H  HA3  . GLY A 1 73 ? -1.833  5.023   4.610   1.00 0.00 ? 137 GLY A HA3  1  
ATOM   1135  N  N    . MET A 1 74 ? -3.324  3.177   2.336   1.00 0.00 ? 138 MET A N    1  
ATOM   1136  C  CA   . MET A 1 74 ? -4.320  3.207   1.271   1.00 0.00 ? 138 MET A CA   1  
ATOM   1137  C  C    . MET A 1 74 ? -5.724  3.010   1.834   1.00 0.00 ? 138 MET A C    1  
ATOM   1138  O  O    . MET A 1 74 ? -6.039  1.957   2.387   1.00 0.00 ? 138 MET A O    1  
ATOM   1139  C  CB   . MET A 1 74 ? -4.018  2.126   0.231   1.00 0.00 ? 138 MET A CB   1  
ATOM   1140  C  CG   . MET A 1 74 ? -3.094  2.594   -0.882  1.00 0.00 ? 138 MET A CG   1  
ATOM   1141  S  SD   . MET A 1 74 ? -3.322  1.665   -2.410  1.00 0.00 ? 138 MET A SD   1  
ATOM   1142  C  CE   . MET A 1 74 ? -2.996  2.935   -3.630  1.00 0.00 ? 138 MET A CE   1  
ATOM   1143  H  H    . MET A 1 74 ? -2.765  2.379   2.445   1.00 0.00 ? 138 MET A H    1  
ATOM   1144  H  HA   . MET A 1 74 ? -4.268  4.175   0.796   1.00 0.00 ? 138 MET A HA   1  
ATOM   1145  H  HB2  . MET A 1 74 ? -3.554  1.286   0.726   1.00 0.00 ? 138 MET A HB2  1  
ATOM   1146  H  HB3  . MET A 1 74 ? -4.947  1.802   -0.215  1.00 0.00 ? 138 MET A HB3  1  
ATOM   1147  H  HG2  . MET A 1 74 ? -3.290  3.637   -1.080  1.00 0.00 ? 138 MET A HG2  1  
ATOM   1148  H  HG3  . MET A 1 74 ? -2.072  2.478   -0.554  1.00 0.00 ? 138 MET A HG3  1  
ATOM   1149  H  HE1  . MET A 1 74 ? -1.931  3.003   -3.803  1.00 0.00 ? 138 MET A HE1  1  
ATOM   1150  H  HE2  . MET A 1 74 ? -3.495  2.683   -4.554  1.00 0.00 ? 138 MET A HE2  1  
ATOM   1151  H  HE3  . MET A 1 74 ? -3.364  3.883   -3.269  1.00 0.00 ? 138 MET A HE3  1  
ATOM   1152  N  N    . SER A 1 75 ? -6.563  4.030   1.689   1.00 0.00 ? 139 SER A N    1  
ATOM   1153  C  CA   . SER A 1 75 ? -7.932  3.970   2.187   1.00 0.00 ? 139 SER A CA   1  
ATOM   1154  C  C    . SER A 1 75 ? -8.741  2.922   1.428   1.00 0.00 ? 139 SER A C    1  
ATOM   1155  O  O    . SER A 1 75 ? -8.944  3.034   0.219   1.00 0.00 ? 139 SER A O    1  
ATOM   1156  C  CB   . SER A 1 75 ? -8.604  5.339   2.060   1.00 0.00 ? 139 SER A CB   1  
ATOM   1157  O  OG   . SER A 1 75 ? -9.622  5.500   3.032   1.00 0.00 ? 139 SER A OG   1  
ATOM   1158  H  H    . SER A 1 75 ? -6.253  4.844   1.238   1.00 0.00 ? 139 SER A H    1  
ATOM   1159  H  HA   . SER A 1 75 ? -7.894  3.693   3.230   1.00 0.00 ? 139 SER A HA   1  
ATOM   1160  H  HB2  . SER A 1 75 ? -7.866  6.114   2.198   1.00 0.00 ? 139 SER A HB2  1  
ATOM   1161  H  HB3  . SER A 1 75 ? -9.043  5.431   1.077   1.00 0.00 ? 139 SER A HB3  1  
ATOM   1162  H  HG   . SER A 1 75 ? -9.305  6.068   3.737   1.00 0.00 ? 139 SER A HG   1  
ATOM   1163  N  N    . HIS A 1 76 ? -9.200  1.903   2.148   1.00 0.00 ? 140 HIS A N    1  
ATOM   1164  C  CA   . HIS A 1 76 ? -9.987  0.834   1.544   1.00 0.00 ? 140 HIS A CA   1  
ATOM   1165  C  C    . HIS A 1 76 ? -11.473 1.179   1.558   1.00 0.00 ? 140 HIS A C    1  
ATOM   1166  O  O    . HIS A 1 76 ? -12.236 0.713   0.713   1.00 0.00 ? 140 HIS A O    1  
ATOM   1167  C  CB   . HIS A 1 76 ? -9.751  -0.483  2.285   1.00 0.00 ? 140 HIS A CB   1  
ATOM   1168  C  CG   . HIS A 1 76 ? -10.423 -0.547  3.622   1.00 0.00 ? 140 HIS A CG   1  
ATOM   1169  N  ND1  . HIS A 1 76 ? -10.072 0.265   4.680   1.00 0.00 ? 140 HIS A ND1  1  
ATOM   1170  C  CD2  . HIS A 1 76 ? -11.431 -1.331  4.069   1.00 0.00 ? 140 HIS A CD2  1  
ATOM   1171  C  CE1  . HIS A 1 76 ? -10.834 -0.019  5.721   1.00 0.00 ? 140 HIS A CE1  1  
ATOM   1172  N  NE2  . HIS A 1 76 ? -11.668 -0.984  5.376   1.00 0.00 ? 140 HIS A NE2  1  
ATOM   1173  H  H    . HIS A 1 76 ? -9.005  1.870   3.107   1.00 0.00 ? 140 HIS A H    1  
ATOM   1174  H  HA   . HIS A 1 76 ? -9.665  0.723   0.520   1.00 0.00 ? 140 HIS A HA   1  
ATOM   1175  H  HB2  . HIS A 1 76 ? -10.128 -1.298  1.685   1.00 0.00 ? 140 HIS A HB2  1  
ATOM   1176  H  HB3  . HIS A 1 76 ? -8.690  -0.616  2.439   1.00 0.00 ? 140 HIS A HB3  1  
ATOM   1177  H  HD1  . HIS A 1 76 ? -9.368  0.946   4.670   1.00 0.00 ? 140 HIS A HD1  1  
ATOM   1178  H  HD2  . HIS A 1 76 ? -11.953 -2.090  3.503   1.00 0.00 ? 140 HIS A HD2  1  
ATOM   1179  H  HE1  . HIS A 1 76 ? -10.785 0.457   6.689   1.00 0.00 ? 140 HIS A HE1  1  
ATOM   1180  N  N    . ASN A 1 77 ? -11.876 1.999   2.523   1.00 0.00 ? 141 ASN A N    1  
ATOM   1181  C  CA   . ASN A 1 77 ? -13.272 2.405   2.647   1.00 0.00 ? 141 ASN A CA   1  
ATOM   1182  C  C    . ASN A 1 77 ? -13.568 3.610   1.758   1.00 0.00 ? 141 ASN A C    1  
ATOM   1183  O  O    . ASN A 1 77 ? -14.300 4.518   2.151   1.00 0.00 ? 141 ASN A O    1  
ATOM   1184  C  CB   . ASN A 1 77 ? -13.600 2.739   4.104   1.00 0.00 ? 141 ASN A CB   1  
ATOM   1185  C  CG   . ASN A 1 77 ? -15.085 2.948   4.329   1.00 0.00 ? 141 ASN A CG   1  
ATOM   1186  O  OD1  . ASN A 1 77 ? -15.517 4.028   4.733   1.00 0.00 ? 141 ASN A OD1  1  
ATOM   1187  N  ND2  . ASN A 1 77 ? -15.874 1.913   4.067   1.00 0.00 ? 141 ASN A ND2  1  
ATOM   1188  H  H    . ASN A 1 77 ? -11.221 2.338   3.167   1.00 0.00 ? 141 ASN A H    1  
ATOM   1189  H  HA   . ASN A 1 77 ? -13.887 1.578   2.329   1.00 0.00 ? 141 ASN A HA   1  
ATOM   1190  H  HB2  . ASN A 1 77 ? -13.270 1.927   4.735   1.00 0.00 ? 141 ASN A HB2  1  
ATOM   1191  H  HB3  . ASN A 1 77 ? -13.080 3.643   4.386   1.00 0.00 ? 141 ASN A HB3  1  
ATOM   1192  H  HD21 . ASN A 1 77 ? -15.460 1.084   3.747   1.00 0.00 ? 141 ASN A HD21 1  
ATOM   1193  H  HD22 . ASN A 1 77 ? -16.838 2.021   4.203   1.00 0.00 ? 141 ASN A HD22 1  
ATOM   1194  N  N    . ALA A 1 78 ? -12.995 3.609   0.559   1.00 0.00 ? 142 ALA A N    1  
ATOM   1195  C  CA   . ALA A 1 78 ? -13.200 4.699   -0.386  1.00 0.00 ? 142 ALA A CA   1  
ATOM   1196  C  C    . ALA A 1 78 ? -13.663 4.172   -1.740  1.00 0.00 ? 142 ALA A C    1  
ATOM   1197  O  O    . ALA A 1 78 ? -14.344 4.873   -2.490  1.00 0.00 ? 142 ALA A O    1  
ATOM   1198  C  CB   . ALA A 1 78 ? -11.923 5.510   -0.542  1.00 0.00 ? 142 ALA A CB   1  
ATOM   1199  H  H    . ALA A 1 78 ? -12.422 2.856   0.304   1.00 0.00 ? 142 ALA A H    1  
ATOM   1200  H  HA   . ALA A 1 78 ? -13.964 5.350   0.015   1.00 0.00 ? 142 ALA A HA   1  
ATOM   1201  H  HB1  . ALA A 1 78 ? -11.069 4.877   -0.348  1.00 0.00 ? 142 ALA A HB1  1  
ATOM   1202  H  HB2  . ALA A 1 78 ? -11.863 5.897   -1.549  1.00 0.00 ? 142 ALA A HB2  1  
ATOM   1203  H  HB3  . ALA A 1 78 ? -11.929 6.331   0.160   1.00 0.00 ? 142 ALA A HB3  1  
ATOM   1204  N  N    . ILE A 1 79 ? -13.288 2.935   -2.048  1.00 0.00 ? 143 ILE A N    1  
ATOM   1205  C  CA   . ILE A 1 79 ? -13.666 2.315   -3.312  1.00 0.00 ? 143 ILE A CA   1  
ATOM   1206  C  C    . ILE A 1 79 ? -15.133 2.573   -3.634  1.00 0.00 ? 143 ILE A C    1  
ATOM   1207  O  O    . ILE A 1 79 ? -15.487 2.857   -4.779  1.00 0.00 ? 143 ILE A O    1  
ATOM   1208  C  CB   . ILE A 1 79 ? -13.416 0.795   -3.290  1.00 0.00 ? 143 ILE A CB   1  
ATOM   1209  C  CG1  . ILE A 1 79 ? -11.938 0.503   -3.025  1.00 0.00 ? 143 ILE A CG1  1  
ATOM   1210  C  CG2  . ILE A 1 79 ? -13.858 0.167   -4.603  1.00 0.00 ? 143 ILE A CG2  1  
ATOM   1211  C  CD1  . ILE A 1 79 ? -11.032 0.871   -4.179  1.00 0.00 ? 143 ILE A CD1  1  
ATOM   1212  H  H    . ILE A 1 79 ? -12.746 2.427   -1.409  1.00 0.00 ? 143 ILE A H    1  
ATOM   1213  H  HA   . ILE A 1 79 ? -13.055 2.749   -4.090  1.00 0.00 ? 143 ILE A HA   1  
ATOM   1214  H  HB   . ILE A 1 79 ? -14.008 0.367   -2.496  1.00 0.00 ? 143 ILE A HB   1  
ATOM   1215  H  HG12 . ILE A 1 79 ? -11.616 1.062   -2.161  1.00 0.00 ? 143 ILE A HG12 1  
ATOM   1216  H  HG13 . ILE A 1 79 ? -11.816 -0.553  -2.830  1.00 0.00 ? 143 ILE A HG13 1  
ATOM   1217  H  HG21 . ILE A 1 79 ? -13.833 0.912   -5.385  1.00 0.00 ? 143 ILE A HG21 1  
ATOM   1218  H  HG22 . ILE A 1 79 ? -13.191 -0.643  -4.857  1.00 0.00 ? 143 ILE A HG22 1  
ATOM   1219  H  HG23 . ILE A 1 79 ? -14.863 -0.213  -4.500  1.00 0.00 ? 143 ILE A HG23 1  
ATOM   1220  H  HD11 . ILE A 1 79 ? -11.410 1.760   -4.664  1.00 0.00 ? 143 ILE A HD11 1  
ATOM   1221  H  HD12 . ILE A 1 79 ? -10.035 1.060   -3.810  1.00 0.00 ? 143 ILE A HD12 1  
ATOM   1222  H  HD13 . ILE A 1 79 ? -11.006 0.058   -4.890  1.00 0.00 ? 143 ILE A HD13 1  
ATOM   1223  N  N    . ARG A 1 80 ? -15.983 2.474   -2.617  1.00 0.00 ? 144 ARG A N    1  
ATOM   1224  C  CA   . ARG A 1 80 ? -17.413 2.698   -2.792  1.00 0.00 ? 144 ARG A CA   1  
ATOM   1225  C  C    . ARG A 1 80 ? -17.720 4.187   -2.913  1.00 0.00 ? 144 ARG A C    1  
ATOM   1226  O  O    . ARG A 1 80 ? -18.055 4.845   -1.928  1.00 0.00 ? 144 ARG A O    1  
ATOM   1227  C  CB   . ARG A 1 80 ? -18.192 2.100   -1.619  1.00 0.00 ? 144 ARG A CB   1  
ATOM   1228  C  CG   . ARG A 1 80 ? -19.698 2.261   -1.742  1.00 0.00 ? 144 ARG A CG   1  
ATOM   1229  C  CD   . ARG A 1 80 ? -20.322 1.102   -2.504  1.00 0.00 ? 144 ARG A CD   1  
ATOM   1230  N  NE   . ARG A 1 80 ? -21.762 1.013   -2.283  1.00 0.00 ? 144 ARG A NE   1  
ATOM   1231  C  CZ   . ARG A 1 80 ? -22.649 1.797   -2.887  1.00 0.00 ? 144 ARG A CZ   1  
ATOM   1232  N  NH1  . ARG A 1 80 ? -22.243 2.722   -3.745  1.00 0.00 ? 144 ARG A NH1  1  
ATOM   1233  N  NH2  . ARG A 1 80 ? -23.943 1.655   -2.633  1.00 0.00 ? 144 ARG A NH2  1  
ATOM   1234  H  H    . ARG A 1 80 ? -15.641 2.245   -1.728  1.00 0.00 ? 144 ARG A H    1  
ATOM   1235  H  HA   . ARG A 1 80 ? -17.717 2.204   -3.703  1.00 0.00 ? 144 ARG A HA   1  
ATOM   1236  H  HB2  . ARG A 1 80 ? -17.969 1.045   -1.554  1.00 0.00 ? 144 ARG A HB2  1  
ATOM   1237  H  HB3  . ARG A 1 80 ? -17.873 2.583   -0.708  1.00 0.00 ? 144 ARG A HB3  1  
ATOM   1238  H  HG2  . ARG A 1 80 ? -20.129 2.299   -0.752  1.00 0.00 ? 144 ARG A HG2  1  
ATOM   1239  H  HG3  . ARG A 1 80 ? -19.911 3.181   -2.265  1.00 0.00 ? 144 ARG A HG3  1  
ATOM   1240  H  HD2  . ARG A 1 80 ? -20.137 1.242   -3.559  1.00 0.00 ? 144 ARG A HD2  1  
ATOM   1241  H  HD3  . ARG A 1 80 ? -19.859 0.183   -2.177  1.00 0.00 ? 144 ARG A HD3  1  
ATOM   1242  H  HE   . ARG A 1 80 ? -22.084 0.336   -1.652  1.00 0.00 ? 144 ARG A HE   1  
ATOM   1243  H  HH11 . ARG A 1 80 ? -21.269 2.831   -3.939  1.00 0.00 ? 144 ARG A HH11 1  
ATOM   1244  H  HH12 . ARG A 1 80 ? -22.913 3.310   -4.200  1.00 0.00 ? 144 ARG A HH12 1  
ATOM   1245  H  HH21 . ARG A 1 80 ? -24.252 0.958   -1.987  1.00 0.00 ? 144 ARG A HH21 1  
ATOM   1246  H  HH22 . ARG A 1 80 ? -24.609 2.245   -3.088  1.00 0.00 ? 144 ARG A HH22 1  
ATOM   1247  N  N    . PHE A 1 81 ? -17.602 4.714   -4.128  1.00 0.00 ? 145 PHE A N    1  
ATOM   1248  C  CA   . PHE A 1 81 ? -17.866 6.126   -4.378  1.00 0.00 ? 145 PHE A CA   1  
ATOM   1249  C  C    . PHE A 1 81 ? -18.192 6.366   -5.849  1.00 0.00 ? 145 PHE A C    1  
ATOM   1250  O  O    . PHE A 1 81 ? -17.350 6.167   -6.724  1.00 0.00 ? 145 PHE A O    1  
ATOM   1251  C  CB   . PHE A 1 81 ? -16.659 6.972   -3.967  1.00 0.00 ? 145 PHE A CB   1  
ATOM   1252  C  CG   . PHE A 1 81 ? -16.945 8.446   -3.930  1.00 0.00 ? 145 PHE A CG   1  
ATOM   1253  C  CD1  . PHE A 1 81 ? -16.823 9.218   -5.074  1.00 0.00 ? 145 PHE A CD1  1  
ATOM   1254  C  CD2  . PHE A 1 81 ? -17.336 9.060   -2.751  1.00 0.00 ? 145 PHE A CD2  1  
ATOM   1255  C  CE1  . PHE A 1 81 ? -17.085 10.574  -5.042  1.00 0.00 ? 145 PHE A CE1  1  
ATOM   1256  C  CE2  . PHE A 1 81 ? -17.599 10.416  -2.713  1.00 0.00 ? 145 PHE A CE2  1  
ATOM   1257  C  CZ   . PHE A 1 81 ? -17.474 11.174  -3.860  1.00 0.00 ? 145 PHE A CZ   1  
ATOM   1258  H  H    . PHE A 1 81 ? -17.332 4.138   -4.874  1.00 0.00 ? 145 PHE A H    1  
ATOM   1259  H  HA   . PHE A 1 81 ? -18.717 6.414   -3.781  1.00 0.00 ? 145 PHE A HA   1  
ATOM   1260  H  HB2  . PHE A 1 81 ? -16.337 6.672   -2.981  1.00 0.00 ? 145 PHE A HB2  1  
ATOM   1261  H  HB3  . PHE A 1 81 ? -15.856 6.806   -4.670  1.00 0.00 ? 145 PHE A HB3  1  
ATOM   1262  H  HD1  . PHE A 1 81 ? -16.519 8.750   -5.999  1.00 0.00 ? 145 PHE A HD1  1  
ATOM   1263  H  HD2  . PHE A 1 81 ? -17.434 8.467   -1.852  1.00 0.00 ? 145 PHE A HD2  1  
ATOM   1264  H  HE1  . PHE A 1 81 ? -16.987 11.165  -5.941  1.00 0.00 ? 145 PHE A HE1  1  
ATOM   1265  H  HE2  . PHE A 1 81 ? -17.904 10.881  -1.787  1.00 0.00 ? 145 PHE A HE2  1  
ATOM   1266  H  HZ   . PHE A 1 81 ? -17.679 12.234  -3.833  1.00 0.00 ? 145 PHE A HZ   1  
ATOM   1267  N  N    . GLY A 1 82 ? -19.422 6.796   -6.114  1.00 0.00 ? 146 GLY A N    1  
ATOM   1268  C  CA   . GLY A 1 82 ? -19.840 7.056   -7.479  1.00 0.00 ? 146 GLY A CA   1  
ATOM   1269  C  C    . GLY A 1 82 ? -19.522 5.904   -8.412  1.00 0.00 ? 146 GLY A C    1  
ATOM   1270  O  O    . GLY A 1 82 ? -18.515 5.929   -9.119  1.00 0.00 ? 146 GLY A O    1  
ATOM   1271  H  H    . GLY A 1 82 ? -20.052 6.938   -5.376  1.00 0.00 ? 146 GLY A H    1  
ATOM   1272  H  HA2  . GLY A 1 82 ? -20.905 7.232   -7.491  1.00 0.00 ? 146 GLY A HA2  1  
ATOM   1273  H  HA3  . GLY A 1 82 ? -19.335 7.942   -7.835  1.00 0.00 ? 146 GLY A HA3  1  
ATOM   1274  N  N    . SER A 1 83 ? -20.381 4.890   -8.412  1.00 0.00 ? 147 SER A N    1  
ATOM   1275  C  CA   . SER A 1 83 ? -20.184 3.721   -9.261  1.00 0.00 ? 147 SER A CA   1  
ATOM   1276  C  C    . SER A 1 83 ? -21.464 3.375   -10.016 1.00 0.00 ? 147 SER A C    1  
ATOM   1277  O  O    . SER A 1 83 ? -22.565 3.708   -9.579  1.00 0.00 ? 147 SER A O    1  
ATOM   1278  C  CB   . SER A 1 83 ? -19.736 2.524   -8.420  1.00 0.00 ? 147 SER A CB   1  
ATOM   1279  O  OG   . SER A 1 83 ? -20.610 2.314   -7.324  1.00 0.00 ? 147 SER A OG   1  
ATOM   1280  H  H    . SER A 1 83 ? -21.166 4.929   -7.825  1.00 0.00 ? 147 SER A H    1  
ATOM   1281  H  HA   . SER A 1 83 ? -19.411 3.957   -9.976  1.00 0.00 ? 147 SER A HA   1  
ATOM   1282  H  HB2  . SER A 1 83 ? -19.730 1.637   -9.035  1.00 0.00 ? 147 SER A HB2  1  
ATOM   1283  H  HB3  . SER A 1 83 ? -18.740 2.706   -8.041  1.00 0.00 ? 147 SER A HB3  1  
ATOM   1284  H  HG   . SER A 1 83 ? -21.004 1.441   -7.392  1.00 0.00 ? 147 SER A HG   1  
ATOM   1285  N  N    . GLY A 1 84 ? -21.310 2.706   -11.154 1.00 0.00 ? 148 GLY A N    1  
ATOM   1286  C  CA   . GLY A 1 84 ? -22.460 2.326   -11.953 1.00 0.00 ? 148 GLY A CA   1  
ATOM   1287  C  C    . GLY A 1 84 ? -23.400 1.397   -11.211 1.00 0.00 ? 148 GLY A C    1  
ATOM   1288  O  O    . GLY A 1 84 ? -22.979 0.565   -10.407 1.00 0.00 ? 148 GLY A O    1  
ATOM   1289  H  H    . GLY A 1 84 ? -20.407 2.467   -11.454 1.00 0.00 ? 148 GLY A H    1  
ATOM   1290  H  HA2  . GLY A 1 84 ? -23.000 3.218   -12.234 1.00 0.00 ? 148 GLY A HA2  1  
ATOM   1291  H  HA3  . GLY A 1 84 ? -22.114 1.829   -12.848 1.00 0.00 ? 148 GLY A HA3  1  
ATOM   1292  N  N    . PRO A 1 85 ? -24.708 1.535   -11.477 1.00 0.00 ? 149 PRO A N    1  
ATOM   1293  C  CA   . PRO A 1 85 ? -25.737 0.711   -10.838 1.00 0.00 ? 149 PRO A CA   1  
ATOM   1294  C  C    . PRO A 1 85 ? -25.695 -0.739  -11.309 1.00 0.00 ? 149 PRO A C    1  
ATOM   1295  O  O    . PRO A 1 85 ? -26.034 -1.039  -12.454 1.00 0.00 ? 149 PRO A O    1  
ATOM   1296  C  CB   . PRO A 1 85 ? -27.045 1.377   -11.273 1.00 0.00 ? 149 PRO A CB   1  
ATOM   1297  C  CG   . PRO A 1 85 ? -26.713 2.065   -12.552 1.00 0.00 ? 149 PRO A CG   1  
ATOM   1298  C  CD   . PRO A 1 85 ? -25.281 2.507   -12.424 1.00 0.00 ? 149 PRO A CD   1  
ATOM   1299  H  HA   . PRO A 1 85 ? -25.657 0.741   -9.761  1.00 0.00 ? 149 PRO A HA   1  
ATOM   1300  H  HB2  . PRO A 1 85 ? -27.806 0.622   -11.417 1.00 0.00 ? 149 PRO A HB2  1  
ATOM   1301  H  HB3  . PRO A 1 85 ? -27.365 2.079   -10.518 1.00 0.00 ? 149 PRO A HB3  1  
ATOM   1302  H  HG2  . PRO A 1 85 ? -26.821 1.379   -13.378 1.00 0.00 ? 149 PRO A HG2  1  
ATOM   1303  H  HG3  . PRO A 1 85 ? -27.358 2.921   -12.686 1.00 0.00 ? 149 PRO A HG3  1  
ATOM   1304  H  HD2  . PRO A 1 85 ? -24.783 2.454   -13.380 1.00 0.00 ? 149 PRO A HD2  1  
ATOM   1305  H  HD3  . PRO A 1 85 ? -25.230 3.509   -12.025 1.00 0.00 ? 149 PRO A HD3  1  
ATOM   1306  N  N    . SER A 1 86 ? -25.277 -1.633  -10.419 1.00 0.00 ? 150 SER A N    1  
ATOM   1307  C  CA   . SER A 1 86 ? -25.187 -3.052  -10.746 1.00 0.00 ? 150 SER A CA   1  
ATOM   1308  C  C    . SER A 1 86 ? -26.155 -3.867  -9.895  1.00 0.00 ? 150 SER A C    1  
ATOM   1309  O  O    . SER A 1 86 ? -26.499 -3.477  -8.779  1.00 0.00 ? 150 SER A O    1  
ATOM   1310  C  CB   . SER A 1 86 ? -23.757 -3.555  -10.536 1.00 0.00 ? 150 SER A CB   1  
ATOM   1311  O  OG   . SER A 1 86 ? -22.870 -2.977  -11.477 1.00 0.00 ? 150 SER A OG   1  
ATOM   1312  H  H    . SER A 1 86 ? -25.020 -1.331  -9.523  1.00 0.00 ? 150 SER A H    1  
ATOM   1313  H  HA   . SER A 1 86 ? -25.452 -3.170  -11.786 1.00 0.00 ? 150 SER A HA   1  
ATOM   1314  H  HB2  . SER A 1 86 ? -23.429 -3.294  -9.542  1.00 0.00 ? 150 SER A HB2  1  
ATOM   1315  H  HB3  . SER A 1 86 ? -23.737 -4.629  -10.652 1.00 0.00 ? 150 SER A HB3  1  
ATOM   1316  H  HG   . SER A 1 86 ? -22.236 -3.637  -11.767 1.00 0.00 ? 150 SER A HG   1  
ATOM   1317  N  N    . SER A 1 87 ? -26.592 -5.003  -10.431 1.00 0.00 ? 151 SER A N    1  
ATOM   1318  C  CA   . SER A 1 87 ? -27.525 -5.873  -9.724  1.00 0.00 ? 151 SER A CA   1  
ATOM   1319  C  C    . SER A 1 87 ? -27.157 -5.977  -8.247  1.00 0.00 ? 151 SER A C    1  
ATOM   1320  O  O    . SER A 1 87 ? -26.166 -6.610  -7.885  1.00 0.00 ? 151 SER A O    1  
ATOM   1321  C  CB   . SER A 1 87 ? -27.536 -7.265  -10.357 1.00 0.00 ? 151 SER A CB   1  
ATOM   1322  O  OG   . SER A 1 87 ? -26.251 -7.859  -10.306 1.00 0.00 ? 151 SER A OG   1  
ATOM   1323  H  H    . SER A 1 87 ? -26.282 -5.259  -11.325 1.00 0.00 ? 151 SER A H    1  
ATOM   1324  H  HA   . SER A 1 87 ? -28.510 -5.440  -9.808  1.00 0.00 ? 151 SER A HA   1  
ATOM   1325  H  HB2  . SER A 1 87 ? -28.232 -7.895  -9.824  1.00 0.00 ? 151 SER A HB2  1  
ATOM   1326  H  HB3  . SER A 1 87 ? -27.842 -7.185  -11.390 1.00 0.00 ? 151 SER A HB3  1  
ATOM   1327  H  HG   . SER A 1 87 ? -26.322 -8.748  -9.950  1.00 0.00 ? 151 SER A HG   1  
ATOM   1328  N  N    . GLY A 1 88 ? -27.964 -5.349  -7.397  1.00 0.00 ? 152 GLY A N    1  
ATOM   1329  C  CA   . GLY A 1 88 ? -27.707 -5.382  -5.969  1.00 0.00 ? 152 GLY A CA   1  
ATOM   1330  C  C    . GLY A 1 88 ? -28.195 -6.663  -5.322  1.00 0.00 ? 152 GLY A C    1  
ATOM   1331  O  O    . GLY A 1 88 ? -29.383 -6.978  -5.372  1.00 0.00 ? 152 GLY A O    1  
ATOM   1332  H  H    . GLY A 1 88 ? -28.739 -4.859  -7.742  1.00 0.00 ? 152 GLY A H    1  
ATOM   1333  H  HA2  . GLY A 1 88 ? -26.645 -5.288  -5.802  1.00 0.00 ? 152 GLY A HA2  1  
ATOM   1334  H  HA3  . GLY A 1 88 ? -28.209 -4.545  -5.505  1.00 0.00 ? 152 GLY A HA3  1  
HETATM 1335  ZN ZN   . ZN  B 2 .  ? 3.244   2.374   -8.943  1.00 0.00 ? 200 ZN  A ZN   1  
HETATM 1336  ZN ZN   . ZN  C 2 .  ? 6.661   -11.231 -1.265  1.00 0.00 ? 300 ZN  A ZN   1  
ATOM   1337  N  N    . GLY A 1 1  ? 15.883  9.040   -17.953 1.00 0.00 ? 65  GLY A N    2  
ATOM   1338  C  CA   . GLY A 1 1  ? 14.862  9.118   -18.982 1.00 0.00 ? 65  GLY A CA   2  
ATOM   1339  C  C    . GLY A 1 1  ? 13.717  10.033  -18.595 1.00 0.00 ? 65  GLY A C    2  
ATOM   1340  O  O    . GLY A 1 1  ? 12.584  9.584   -18.429 1.00 0.00 ? 65  GLY A O    2  
ATOM   1341  H  H1   . GLY A 1 1  ? 15.623  8.917   -17.016 1.00 0.00 ? 65  GLY A H1   2  
ATOM   1342  H  HA2  . GLY A 1 1  ? 15.312  9.487   -19.892 1.00 0.00 ? 65  GLY A HA2  2  
ATOM   1343  H  HA3  . GLY A 1 1  ? 14.471  8.128   -19.161 1.00 0.00 ? 65  GLY A HA3  2  
ATOM   1344  N  N    . SER A 1 2  ? 14.014  11.320  -18.448 1.00 0.00 ? 66  SER A N    2  
ATOM   1345  C  CA   . SER A 1 2  ? 13.002  12.300  -18.072 1.00 0.00 ? 66  SER A CA   2  
ATOM   1346  C  C    . SER A 1 2  ? 13.153  13.579  -18.890 1.00 0.00 ? 66  SER A C    2  
ATOM   1347  O  O    . SER A 1 2  ? 14.240  13.896  -19.371 1.00 0.00 ? 66  SER A O    2  
ATOM   1348  C  CB   . SER A 1 2  ? 13.103  12.621  -16.579 1.00 0.00 ? 66  SER A CB   2  
ATOM   1349  O  OG   . SER A 1 2  ? 12.986  11.447  -15.796 1.00 0.00 ? 66  SER A OG   2  
ATOM   1350  H  H    . SER A 1 2  ? 14.937  11.617  -18.594 1.00 0.00 ? 66  SER A H    2  
ATOM   1351  H  HA   . SER A 1 2  ? 12.033  11.869  -18.274 1.00 0.00 ? 66  SER A HA   2  
ATOM   1352  H  HB2  . SER A 1 2  ? 14.058  13.081  -16.376 1.00 0.00 ? 66  SER A HB2  2  
ATOM   1353  H  HB3  . SER A 1 2  ? 12.309  13.302  -16.306 1.00 0.00 ? 66  SER A HB3  2  
ATOM   1354  H  HG   . SER A 1 2  ? 13.830  11.253  -15.381 1.00 0.00 ? 66  SER A HG   2  
ATOM   1355  N  N    . SER A 1 3  ? 12.053  14.309  -19.043 1.00 0.00 ? 67  SER A N    2  
ATOM   1356  C  CA   . SER A 1 3  ? 12.060  15.552  -19.807 1.00 0.00 ? 67  SER A CA   2  
ATOM   1357  C  C    . SER A 1 3  ? 12.104  16.760  -18.876 1.00 0.00 ? 67  SER A C    2  
ATOM   1358  O  O    . SER A 1 3  ? 11.414  17.754  -19.099 1.00 0.00 ? 67  SER A O    2  
ATOM   1359  C  CB   . SER A 1 3  ? 10.825  15.630  -20.706 1.00 0.00 ? 67  SER A CB   2  
ATOM   1360  O  OG   . SER A 1 3  ? 11.008  14.873  -21.890 1.00 0.00 ? 67  SER A OG   2  
ATOM   1361  H  H    . SER A 1 3  ? 11.216  14.003  -18.635 1.00 0.00 ? 67  SER A H    2  
ATOM   1362  H  HA   . SER A 1 3  ? 12.946  15.556  -20.424 1.00 0.00 ? 67  SER A HA   2  
ATOM   1363  H  HB2  . SER A 1 3  ? 9.970   15.242  -20.174 1.00 0.00 ? 67  SER A HB2  2  
ATOM   1364  H  HB3  . SER A 1 3  ? 10.645  16.661  -20.976 1.00 0.00 ? 67  SER A HB3  2  
ATOM   1365  H  HG   . SER A 1 3  ? 10.171  14.482  -22.152 1.00 0.00 ? 67  SER A HG   2  
ATOM   1366  N  N    . GLY A 1 4  ? 12.920  16.666  -17.831 1.00 0.00 ? 68  GLY A N    2  
ATOM   1367  C  CA   . GLY A 1 4  ? 13.039  17.757  -16.882 1.00 0.00 ? 68  GLY A CA   2  
ATOM   1368  C  C    . GLY A 1 4  ? 13.255  17.270  -15.463 1.00 0.00 ? 68  GLY A C    2  
ATOM   1369  O  O    . GLY A 1 4  ? 13.712  16.148  -15.247 1.00 0.00 ? 68  GLY A O    2  
ATOM   1370  H  H    . GLY A 1 4  ? 13.446  15.849  -17.704 1.00 0.00 ? 68  GLY A H    2  
ATOM   1371  H  HA2  . GLY A 1 4  ? 13.874  18.380  -17.169 1.00 0.00 ? 68  GLY A HA2  2  
ATOM   1372  H  HA3  . GLY A 1 4  ? 12.135  18.347  -16.914 1.00 0.00 ? 68  GLY A HA3  2  
ATOM   1373  N  N    . SER A 1 5  ? 12.927  18.117  -14.492 1.00 0.00 ? 69  SER A N    2  
ATOM   1374  C  CA   . SER A 1 5  ? 13.092  17.769  -13.086 1.00 0.00 ? 69  SER A CA   2  
ATOM   1375  C  C    . SER A 1 5  ? 12.138  16.646  -12.688 1.00 0.00 ? 69  SER A C    2  
ATOM   1376  O  O    . SER A 1 5  ? 11.157  16.377  -13.381 1.00 0.00 ? 69  SER A O    2  
ATOM   1377  C  CB   . SER A 1 5  ? 12.851  18.995  -12.203 1.00 0.00 ? 69  SER A CB   2  
ATOM   1378  O  OG   . SER A 1 5  ? 11.563  19.541  -12.430 1.00 0.00 ? 69  SER A OG   2  
ATOM   1379  H  H    . SER A 1 5  ? 12.567  18.998  -14.728 1.00 0.00 ? 69  SER A H    2  
ATOM   1380  H  HA   . SER A 1 5  ? 14.108  17.429  -12.946 1.00 0.00 ? 69  SER A HA   2  
ATOM   1381  H  HB2  . SER A 1 5  ? 12.930  18.709  -11.165 1.00 0.00 ? 69  SER A HB2  2  
ATOM   1382  H  HB3  . SER A 1 5  ? 13.593  19.748  -12.427 1.00 0.00 ? 69  SER A HB3  2  
ATOM   1383  H  HG   . SER A 1 5  ? 10.980  18.858  -12.768 1.00 0.00 ? 69  SER A HG   2  
ATOM   1384  N  N    . SER A 1 6  ? 12.435  15.996  -11.568 1.00 0.00 ? 70  SER A N    2  
ATOM   1385  C  CA   . SER A 1 6  ? 11.607  14.899  -11.079 1.00 0.00 ? 70  SER A CA   2  
ATOM   1386  C  C    . SER A 1 6  ? 10.494  15.421  -10.175 1.00 0.00 ? 70  SER A C    2  
ATOM   1387  O  O    . SER A 1 6  ? 10.692  16.361  -9.407  1.00 0.00 ? 70  SER A O    2  
ATOM   1388  C  CB   . SER A 1 6  ? 12.463  13.885  -10.319 1.00 0.00 ? 70  SER A CB   2  
ATOM   1389  O  OG   . SER A 1 6  ? 11.685  12.784  -9.885  1.00 0.00 ? 70  SER A OG   2  
ATOM   1390  H  H    . SER A 1 6  ? 13.231  16.257  -11.060 1.00 0.00 ? 70  SER A H    2  
ATOM   1391  H  HA   . SER A 1 6  ? 11.162  14.413  -11.934 1.00 0.00 ? 70  SER A HA   2  
ATOM   1392  H  HB2  . SER A 1 6  ? 13.247  13.523  -10.966 1.00 0.00 ? 70  SER A HB2  2  
ATOM   1393  H  HB3  . SER A 1 6  ? 12.902  14.364  -9.455  1.00 0.00 ? 70  SER A HB3  2  
ATOM   1394  H  HG   . SER A 1 6  ? 10.782  13.071  -9.730  1.00 0.00 ? 70  SER A HG   2  
ATOM   1395  N  N    . GLY A 1 7  ? 9.321   14.802  -10.273 1.00 0.00 ? 71  GLY A N    2  
ATOM   1396  C  CA   . GLY A 1 7  ? 8.193   15.216  -9.459  1.00 0.00 ? 71  GLY A CA   2  
ATOM   1397  C  C    . GLY A 1 7  ? 7.410   14.040  -8.912  1.00 0.00 ? 71  GLY A C    2  
ATOM   1398  O  O    . GLY A 1 7  ? 7.992   13.045  -8.480  1.00 0.00 ? 71  GLY A O    2  
ATOM   1399  H  H    . GLY A 1 7  ? 9.221   14.058  -10.903 1.00 0.00 ? 71  GLY A H    2  
ATOM   1400  H  HA2  . GLY A 1 7  ? 8.557   15.809  -8.634  1.00 0.00 ? 71  GLY A HA2  2  
ATOM   1401  H  HA3  . GLY A 1 7  ? 7.533   15.823  -10.062 1.00 0.00 ? 71  GLY A HA3  2  
ATOM   1402  N  N    . MET A 1 8  ? 6.086   14.153  -8.927  1.00 0.00 ? 72  MET A N    2  
ATOM   1403  C  CA   . MET A 1 8  ? 5.222   13.090  -8.427  1.00 0.00 ? 72  MET A CA   2  
ATOM   1404  C  C    . MET A 1 8  ? 5.738   11.722  -8.860  1.00 0.00 ? 72  MET A C    2  
ATOM   1405  O  O    . MET A 1 8  ? 5.994   11.491  -10.042 1.00 0.00 ? 72  MET A O    2  
ATOM   1406  C  CB   . MET A 1 8  ? 3.790   13.290  -8.927  1.00 0.00 ? 72  MET A CB   2  
ATOM   1407  C  CG   . MET A 1 8  ? 2.947   14.170  -8.018  1.00 0.00 ? 72  MET A CG   2  
ATOM   1408  S  SD   . MET A 1 8  ? 3.208   15.929  -8.317  1.00 0.00 ? 72  MET A SD   2  
ATOM   1409  C  CE   . MET A 1 8  ? 2.095   16.207  -9.692  1.00 0.00 ? 72  MET A CE   2  
ATOM   1410  H  H    . MET A 1 8  ? 5.680   14.971  -9.283  1.00 0.00 ? 72  MET A H    2  
ATOM   1411  H  HA   . MET A 1 8  ? 5.228   13.139  -7.348  1.00 0.00 ? 72  MET A HA   2  
ATOM   1412  H  HB2  . MET A 1 8  ? 3.823   13.746  -9.905  1.00 0.00 ? 72  MET A HB2  2  
ATOM   1413  H  HB3  . MET A 1 8  ? 3.310   12.326  -9.004  1.00 0.00 ? 72  MET A HB3  2  
ATOM   1414  H  HG2  . MET A 1 8  ? 1.904   13.942  -8.185  1.00 0.00 ? 72  MET A HG2  2  
ATOM   1415  H  HG3  . MET A 1 8  ? 3.201   13.951  -6.992  1.00 0.00 ? 72  MET A HG3  2  
ATOM   1416  H  HE1  . MET A 1 8  ? 2.150   17.243  -9.995  1.00 0.00 ? 72  MET A HE1  2  
ATOM   1417  H  HE2  . MET A 1 8  ? 2.380   15.575  -10.520 1.00 0.00 ? 72  MET A HE2  2  
ATOM   1418  H  HE3  . MET A 1 8  ? 1.085   15.973  -9.391  1.00 0.00 ? 72  MET A HE3  2  
ATOM   1419  N  N    . GLU A 1 9  ? 5.888   10.818  -7.897  1.00 0.00 ? 73  GLU A N    2  
ATOM   1420  C  CA   . GLU A 1 9  ? 6.375   9.473   -8.180  1.00 0.00 ? 73  GLU A CA   2  
ATOM   1421  C  C    . GLU A 1 9  ? 5.691   8.446   -7.282  1.00 0.00 ? 73  GLU A C    2  
ATOM   1422  O  O    . GLU A 1 9  ? 5.689   8.579   -6.058  1.00 0.00 ? 73  GLU A O    2  
ATOM   1423  C  CB   . GLU A 1 9  ? 7.892   9.405   -7.989  1.00 0.00 ? 73  GLU A CB   2  
ATOM   1424  C  CG   . GLU A 1 9  ? 8.317   9.292   -6.535  1.00 0.00 ? 73  GLU A CG   2  
ATOM   1425  C  CD   . GLU A 1 9  ? 9.677   9.910   -6.275  1.00 0.00 ? 73  GLU A CD   2  
ATOM   1426  O  OE1  . GLU A 1 9  ? 9.754   11.153  -6.179  1.00 0.00 ? 73  GLU A OE1  2  
ATOM   1427  O  OE2  . GLU A 1 9  ? 10.664  9.153   -6.169  1.00 0.00 ? 73  GLU A OE2  2  
ATOM   1428  H  H    . GLU A 1 9  ? 5.667   11.062  -6.974  1.00 0.00 ? 73  GLU A H    2  
ATOM   1429  H  HA   . GLU A 1 9  ? 6.141   9.246   -9.209  1.00 0.00 ? 73  GLU A HA   2  
ATOM   1430  H  HB2  . GLU A 1 9  ? 8.271   8.545   -8.522  1.00 0.00 ? 73  GLU A HB2  2  
ATOM   1431  H  HB3  . GLU A 1 9  ? 8.335   10.298  -8.403  1.00 0.00 ? 73  GLU A HB3  2  
ATOM   1432  H  HG2  . GLU A 1 9  ? 7.587   9.795   -5.919  1.00 0.00 ? 73  GLU A HG2  2  
ATOM   1433  H  HG3  . GLU A 1 9  ? 8.355   8.247   -6.264  1.00 0.00 ? 73  GLU A HG3  2  
ATOM   1434  N  N    . CYS A 1 10 ? 5.111   7.423   -7.900  1.00 0.00 ? 74  CYS A N    2  
ATOM   1435  C  CA   . CYS A 1 10 ? 4.422   6.373   -7.159  1.00 0.00 ? 74  CYS A CA   2  
ATOM   1436  C  C    . CYS A 1 10 ? 5.250   5.921   -5.959  1.00 0.00 ? 74  CYS A C    2  
ATOM   1437  O  O    . CYS A 1 10 ? 6.480   5.960   -5.991  1.00 0.00 ? 74  CYS A O    2  
ATOM   1438  C  CB   . CYS A 1 10 ? 4.134   5.180   -8.072  1.00 0.00 ? 74  CYS A CB   2  
ATOM   1439  S  SG   . CYS A 1 10 ? 2.990   3.956   -7.357  1.00 0.00 ? 74  CYS A SG   2  
ATOM   1440  H  H    . CYS A 1 10 ? 5.146   7.372   -8.879  1.00 0.00 ? 74  CYS A H    2  
ATOM   1441  H  HA   . CYS A 1 10 ? 3.486   6.777   -6.803  1.00 0.00 ? 74  CYS A HA   2  
ATOM   1442  H  HB2  . CYS A 1 10 ? 3.696   5.539   -8.992  1.00 0.00 ? 74  CYS A HB2  2  
ATOM   1443  H  HB3  . CYS A 1 10 ? 5.061   4.674   -8.294  1.00 0.00 ? 74  CYS A HB3  2  
ATOM   1444  N  N    . ARG A 1 11 ? 4.567   5.493   -4.903  1.00 0.00 ? 75  ARG A N    2  
ATOM   1445  C  CA   . ARG A 1 11 ? 5.239   5.034   -3.693  1.00 0.00 ? 75  ARG A CA   2  
ATOM   1446  C  C    . ARG A 1 11 ? 5.302   3.510   -3.651  1.00 0.00 ? 75  ARG A C    2  
ATOM   1447  O  O    . ARG A 1 11 ? 6.223   2.932   -3.074  1.00 0.00 ? 75  ARG A O    2  
ATOM   1448  C  CB   . ARG A 1 11 ? 4.515   5.560   -2.452  1.00 0.00 ? 75  ARG A CB   2  
ATOM   1449  C  CG   . ARG A 1 11 ? 4.535   7.075   -2.331  1.00 0.00 ? 75  ARG A CG   2  
ATOM   1450  C  CD   . ARG A 1 11 ? 5.840   7.568   -1.727  1.00 0.00 ? 75  ARG A CD   2  
ATOM   1451  N  NE   . ARG A 1 11 ? 5.676   8.844   -1.036  1.00 0.00 ? 75  ARG A NE   2  
ATOM   1452  C  CZ   . ARG A 1 11 ? 5.586   10.013  -1.661  1.00 0.00 ? 75  ARG A CZ   2  
ATOM   1453  N  NH1  . ARG A 1 11 ? 5.644   10.066  -2.985  1.00 0.00 ? 75  ARG A NH1  2  
ATOM   1454  N  NH2  . ARG A 1 11 ? 5.437   11.131  -0.963  1.00 0.00 ? 75  ARG A NH2  2  
ATOM   1455  H  H    . ARG A 1 11 ? 3.587   5.486   -4.938  1.00 0.00 ? 75  ARG A H    2  
ATOM   1456  H  HA   . ARG A 1 11 ? 6.245   5.424   -3.704  1.00 0.00 ? 75  ARG A HA   2  
ATOM   1457  H  HB2  . ARG A 1 11 ? 3.485   5.237   -2.486  1.00 0.00 ? 75  ARG A HB2  2  
ATOM   1458  H  HB3  . ARG A 1 11 ? 4.985   5.144   -1.573  1.00 0.00 ? 75  ARG A HB3  2  
ATOM   1459  H  HG2  . ARG A 1 11 ? 4.421   7.507   -3.315  1.00 0.00 ? 75  ARG A HG2  2  
ATOM   1460  H  HG3  . ARG A 1 11 ? 3.716   7.387   -1.701  1.00 0.00 ? 75  ARG A HG3  2  
ATOM   1461  H  HD2  . ARG A 1 11 ? 6.197   6.832   -1.022  1.00 0.00 ? 75  ARG A HD2  2  
ATOM   1462  H  HD3  . ARG A 1 11 ? 6.565   7.689   -2.518  1.00 0.00 ? 75  ARG A HD3  2  
ATOM   1463  H  HE   . ARG A 1 11 ? 5.630   8.828   -0.057  1.00 0.00 ? 75  ARG A HE   2  
ATOM   1464  H  HH11 . ARG A 1 11 ? 5.756   9.225   -3.514  1.00 0.00 ? 75  ARG A HH11 2  
ATOM   1465  H  HH12 . ARG A 1 11 ? 5.575   10.947  -3.453  1.00 0.00 ? 75  ARG A HH12 2  
ATOM   1466  H  HH21 . ARG A 1 11 ? 5.393   11.095  0.035   1.00 0.00 ? 75  ARG A HH21 2  
ATOM   1467  H  HH22 . ARG A 1 11 ? 5.370   12.010  -1.434  1.00 0.00 ? 75  ARG A HH22 2  
ATOM   1468  N  N    . VAL A 1 12 ? 4.316   2.865   -4.265  1.00 0.00 ? 76  VAL A N    2  
ATOM   1469  C  CA   . VAL A 1 12 ? 4.259   1.408   -4.298  1.00 0.00 ? 76  VAL A CA   2  
ATOM   1470  C  C    . VAL A 1 12 ? 5.381   0.834   -5.157  1.00 0.00 ? 76  VAL A C    2  
ATOM   1471  O  O    . VAL A 1 12 ? 6.114   -0.057  -4.726  1.00 0.00 ? 76  VAL A O    2  
ATOM   1472  C  CB   . VAL A 1 12 ? 2.906   0.911   -4.841  1.00 0.00 ? 76  VAL A CB   2  
ATOM   1473  C  CG1  . VAL A 1 12 ? 2.864   -0.609  -4.860  1.00 0.00 ? 76  VAL A CG1  2  
ATOM   1474  C  CG2  . VAL A 1 12 ? 1.761   1.475   -4.013  1.00 0.00 ? 76  VAL A CG2  2  
ATOM   1475  H  H    . VAL A 1 12 ? 3.609   3.381   -4.707  1.00 0.00 ? 76  VAL A H    2  
ATOM   1476  H  HA   . VAL A 1 12 ? 4.372   1.046   -3.287  1.00 0.00 ? 76  VAL A HA   2  
ATOM   1477  H  HB   . VAL A 1 12 ? 2.797   1.265   -5.856  1.00 0.00 ? 76  VAL A HB   2  
ATOM   1478  H  HG11 . VAL A 1 12 ? 2.583   -0.973  -3.882  1.00 0.00 ? 76  VAL A HG11 2  
ATOM   1479  H  HG12 . VAL A 1 12 ? 2.141   -0.941  -5.590  1.00 0.00 ? 76  VAL A HG12 2  
ATOM   1480  H  HG13 . VAL A 1 12 ? 3.840   -0.993  -5.119  1.00 0.00 ? 76  VAL A HG13 2  
ATOM   1481  H  HG21 . VAL A 1 12 ? 2.136   2.243   -3.355  1.00 0.00 ? 76  VAL A HG21 2  
ATOM   1482  H  HG22 . VAL A 1 12 ? 1.015   1.896   -4.671  1.00 0.00 ? 76  VAL A HG22 2  
ATOM   1483  H  HG23 . VAL A 1 12 ? 1.317   0.683   -3.426  1.00 0.00 ? 76  VAL A HG23 2  
ATOM   1484  N  N    . CYS A 1 13 ? 5.510   1.351   -6.374  1.00 0.00 ? 77  CYS A N    2  
ATOM   1485  C  CA   . CYS A 1 13 ? 6.542   0.890   -7.295  1.00 0.00 ? 77  CYS A CA   2  
ATOM   1486  C  C    . CYS A 1 13 ? 7.683   1.900   -7.381  1.00 0.00 ? 77  CYS A C    2  
ATOM   1487  O  O    . CYS A 1 13 ? 8.856   1.534   -7.308  1.00 0.00 ? 77  CYS A O    2  
ATOM   1488  C  CB   . CYS A 1 13 ? 5.947   0.657   -8.686  1.00 0.00 ? 77  CYS A CB   2  
ATOM   1489  S  SG   . CYS A 1 13 ? 5.351   2.172   -9.503  1.00 0.00 ? 77  CYS A SG   2  
ATOM   1490  H  H    . CYS A 1 13 ? 4.895   2.059   -6.661  1.00 0.00 ? 77  CYS A H    2  
ATOM   1491  H  HA   . CYS A 1 13 ? 6.931   -0.043  -6.918  1.00 0.00 ? 77  CYS A HA   2  
ATOM   1492  H  HB2  . CYS A 1 13 ? 6.701   0.216   -9.322  1.00 0.00 ? 77  CYS A HB2  2  
ATOM   1493  H  HB3  . CYS A 1 13 ? 5.112   -0.023  -8.602  1.00 0.00 ? 77  CYS A HB3  2  
ATOM   1494  N  N    . GLY A 1 14 ? 7.331   3.172   -7.536  1.00 0.00 ? 78  GLY A N    2  
ATOM   1495  C  CA   . GLY A 1 14 ? 8.336   4.215   -7.629  1.00 0.00 ? 78  GLY A CA   2  
ATOM   1496  C  C    . GLY A 1 14 ? 8.219   5.021   -8.907  1.00 0.00 ? 78  GLY A C    2  
ATOM   1497  O  O    . GLY A 1 14 ? 8.499   6.220   -8.921  1.00 0.00 ? 78  GLY A O    2  
ATOM   1498  H  H    . GLY A 1 14 ? 6.380   3.405   -7.588  1.00 0.00 ? 78  GLY A H    2  
ATOM   1499  H  HA2  . GLY A 1 14 ? 8.229   4.879   -6.785  1.00 0.00 ? 78  GLY A HA2  2  
ATOM   1500  H  HA3  . GLY A 1 14 ? 9.315   3.759   -7.594  1.00 0.00 ? 78  GLY A HA3  2  
ATOM   1501  N  N    . ASP A 1 15 ? 7.805   4.363   -9.984  1.00 0.00 ? 79  ASP A N    2  
ATOM   1502  C  CA   . ASP A 1 15 ? 7.652   5.026   -11.274 1.00 0.00 ? 79  ASP A CA   2  
ATOM   1503  C  C    . ASP A 1 15 ? 6.848   6.314   -11.130 1.00 0.00 ? 79  ASP A C    2  
ATOM   1504  O  O    . ASP A 1 15 ? 6.318   6.613   -10.060 1.00 0.00 ? 79  ASP A O    2  
ATOM   1505  C  CB   . ASP A 1 15 ? 6.967   4.092   -12.273 1.00 0.00 ? 79  ASP A CB   2  
ATOM   1506  C  CG   . ASP A 1 15 ? 7.202   4.511   -13.711 1.00 0.00 ? 79  ASP A CG   2  
ATOM   1507  O  OD1  . ASP A 1 15 ? 8.327   4.952   -14.024 1.00 0.00 ? 79  ASP A OD1  2  
ATOM   1508  O  OD2  . ASP A 1 15 ? 6.259   4.399   -14.524 1.00 0.00 ? 79  ASP A OD2  2  
ATOM   1509  H  H    . ASP A 1 15 ? 7.597   3.407   -9.910  1.00 0.00 ? 79  ASP A H    2  
ATOM   1510  H  HA   . ASP A 1 15 ? 8.637   5.270   -11.640 1.00 0.00 ? 79  ASP A HA   2  
ATOM   1511  H  HB2  . ASP A 1 15 ? 7.352   3.091   -12.143 1.00 0.00 ? 79  ASP A HB2  2  
ATOM   1512  H  HB3  . ASP A 1 15 ? 5.904   4.092   -12.086 1.00 0.00 ? 79  ASP A HB3  2  
ATOM   1513  N  N    . LYS A 1 16 ? 6.763   7.077   -12.215 1.00 0.00 ? 80  LYS A N    2  
ATOM   1514  C  CA   . LYS A 1 16 ? 6.024   8.334   -12.212 1.00 0.00 ? 80  LYS A CA   2  
ATOM   1515  C  C    . LYS A 1 16 ? 4.529   8.086   -12.036 1.00 0.00 ? 80  LYS A C    2  
ATOM   1516  O  O    . LYS A 1 16 ? 3.875   7.530   -12.917 1.00 0.00 ? 80  LYS A O    2  
ATOM   1517  C  CB   . LYS A 1 16 ? 6.275   9.100   -13.512 1.00 0.00 ? 80  LYS A CB   2  
ATOM   1518  C  CG   . LYS A 1 16 ? 5.240   10.176  -13.794 1.00 0.00 ? 80  LYS A CG   2  
ATOM   1519  C  CD   . LYS A 1 16 ? 5.837   11.331  -14.580 1.00 0.00 ? 80  LYS A CD   2  
ATOM   1520  C  CE   . LYS A 1 16 ? 6.729   12.199  -13.705 1.00 0.00 ? 80  LYS A CE   2  
ATOM   1521  N  NZ   . LYS A 1 16 ? 7.656   13.036  -14.516 1.00 0.00 ? 80  LYS A NZ   2  
ATOM   1522  H  H    . LYS A 1 16 ? 7.207   6.785   -13.040 1.00 0.00 ? 80  LYS A H    2  
ATOM   1523  H  HA   . LYS A 1 16 ? 6.379   8.925   -11.381 1.00 0.00 ? 80  LYS A HA   2  
ATOM   1524  H  HB2  . LYS A 1 16 ? 7.246   9.570   -13.457 1.00 0.00 ? 80  LYS A HB2  2  
ATOM   1525  H  HB3  . LYS A 1 16 ? 6.269   8.400   -14.335 1.00 0.00 ? 80  LYS A HB3  2  
ATOM   1526  H  HG2  . LYS A 1 16 ? 4.432   9.745   -14.366 1.00 0.00 ? 80  LYS A HG2  2  
ATOM   1527  H  HG3  . LYS A 1 16 ? 4.859   10.550  -12.854 1.00 0.00 ? 80  LYS A HG3  2  
ATOM   1528  H  HD2  . LYS A 1 16 ? 6.426   10.936  -15.394 1.00 0.00 ? 80  LYS A HD2  2  
ATOM   1529  H  HD3  . LYS A 1 16 ? 5.035   11.939  -14.975 1.00 0.00 ? 80  LYS A HD3  2  
ATOM   1530  H  HE2  . LYS A 1 16 ? 6.105   12.845  -13.106 1.00 0.00 ? 80  LYS A HE2  2  
ATOM   1531  H  HE3  . LYS A 1 16 ? 7.309   11.558  -13.058 1.00 0.00 ? 80  LYS A HE3  2  
ATOM   1532  H  HZ1  . LYS A 1 16 ? 8.405   13.429  -13.911 1.00 0.00 ? 80  LYS A HZ1  2  
ATOM   1533  H  HZ2  . LYS A 1 16 ? 7.134   13.820  -14.958 1.00 0.00 ? 80  LYS A HZ2  2  
ATOM   1534  H  HZ3  . LYS A 1 16 ? 8.094   12.462  -15.264 1.00 0.00 ? 80  LYS A HZ3  2  
ATOM   1535  N  N    . ALA A 1 17 ? 3.995   8.503   -10.893 1.00 0.00 ? 81  ALA A N    2  
ATOM   1536  C  CA   . ALA A 1 17 ? 2.577   8.330   -10.604 1.00 0.00 ? 81  ALA A CA   2  
ATOM   1537  C  C    . ALA A 1 17 ? 1.714   9.044   -11.639 1.00 0.00 ? 81  ALA A C    2  
ATOM   1538  O  O    . ALA A 1 17 ? 2.228   9.723   -12.527 1.00 0.00 ? 81  ALA A O    2  
ATOM   1539  C  CB   . ALA A 1 17 ? 2.257   8.838   -9.206  1.00 0.00 ? 81  ALA A CB   2  
ATOM   1540  H  H    . ALA A 1 17 ? 4.568   8.940   -10.229 1.00 0.00 ? 81  ALA A H    2  
ATOM   1541  H  HA   . ALA A 1 17 ? 2.357   7.272   -10.634 1.00 0.00 ? 81  ALA A HA   2  
ATOM   1542  H  HB1  . ALA A 1 17 ? 2.344   8.027   -8.499  1.00 0.00 ? 81  ALA A HB1  2  
ATOM   1543  H  HB2  . ALA A 1 17 ? 2.952   9.623   -8.941  1.00 0.00 ? 81  ALA A HB2  2  
ATOM   1544  H  HB3  . ALA A 1 17 ? 1.250   9.227   -9.186  1.00 0.00 ? 81  ALA A HB3  2  
ATOM   1545  N  N    . SER A 1 18 ? 0.400   8.885   -11.518 1.00 0.00 ? 82  SER A N    2  
ATOM   1546  C  CA   . SER A 1 18 ? -0.534  9.511   -12.447 1.00 0.00 ? 82  SER A CA   2  
ATOM   1547  C  C    . SER A 1 18 ? -1.535  10.387  -11.701 1.00 0.00 ? 82  SER A C    2  
ATOM   1548  O  O    . SER A 1 18 ? -1.861  11.490  -12.140 1.00 0.00 ? 82  SER A O    2  
ATOM   1549  C  CB   . SER A 1 18 ? -1.275  8.444   -13.254 1.00 0.00 ? 82  SER A CB   2  
ATOM   1550  O  OG   . SER A 1 18 ? -2.255  7.794   -12.463 1.00 0.00 ? 82  SER A OG   2  
ATOM   1551  H  H    . SER A 1 18 ? 0.051   8.331   -10.789 1.00 0.00 ? 82  SER A H    2  
ATOM   1552  H  HA   . SER A 1 18 ? 0.036   10.131  -13.123 1.00 0.00 ? 82  SER A HA   2  
ATOM   1553  H  HB2  . SER A 1 18 ? -1.762  8.908   -14.098 1.00 0.00 ? 82  SER A HB2  2  
ATOM   1554  H  HB3  . SER A 1 18 ? -0.568  7.707   -13.607 1.00 0.00 ? 82  SER A HB3  2  
ATOM   1555  H  HG   . SER A 1 18 ? -3.077  7.736   -12.954 1.00 0.00 ? 82  SER A HG   2  
ATOM   1556  N  N    . GLY A 1 19 ? -2.021  9.888   -10.568 1.00 0.00 ? 83  GLY A N    2  
ATOM   1557  C  CA   . GLY A 1 19 ? -2.981  10.638  -9.779  1.00 0.00 ? 83  GLY A CA   2  
ATOM   1558  C  C    . GLY A 1 19 ? -2.870  10.341  -8.297  1.00 0.00 ? 83  GLY A C    2  
ATOM   1559  O  O    . GLY A 1 19 ? -2.156  9.424   -7.891  1.00 0.00 ? 83  GLY A O    2  
ATOM   1560  H  H    . GLY A 1 19 ? -1.726  9.004   -10.267 1.00 0.00 ? 83  GLY A H    2  
ATOM   1561  H  HA2  . GLY A 1 19 ? -2.815  11.693  -9.938  1.00 0.00 ? 83  GLY A HA2  2  
ATOM   1562  H  HA3  . GLY A 1 19 ? -3.978  10.386  -10.111 1.00 0.00 ? 83  GLY A HA3  2  
ATOM   1563  N  N    . PHE A 1 20 ? -3.578  11.119  -7.484  1.00 0.00 ? 84  PHE A N    2  
ATOM   1564  C  CA   . PHE A 1 20 ? -3.554  10.936  -6.038  1.00 0.00 ? 84  PHE A CA   2  
ATOM   1565  C  C    . PHE A 1 20 ? -4.784  10.167  -5.566  1.00 0.00 ? 84  PHE A C    2  
ATOM   1566  O  O    . PHE A 1 20 ? -5.811  10.759  -5.232  1.00 0.00 ? 84  PHE A O    2  
ATOM   1567  C  CB   . PHE A 1 20 ? -3.485  12.292  -5.332  1.00 0.00 ? 84  PHE A CB   2  
ATOM   1568  C  CG   . PHE A 1 20 ? -3.045  12.201  -3.899  1.00 0.00 ? 84  PHE A CG   2  
ATOM   1569  C  CD1  . PHE A 1 20 ? -1.874  11.542  -3.562  1.00 0.00 ? 84  PHE A CD1  2  
ATOM   1570  C  CD2  . PHE A 1 20 ? -3.801  12.775  -2.890  1.00 0.00 ? 84  PHE A CD2  2  
ATOM   1571  C  CE1  . PHE A 1 20 ? -1.466  11.456  -2.244  1.00 0.00 ? 84  PHE A CE1  2  
ATOM   1572  C  CE2  . PHE A 1 20 ? -3.398  12.693  -1.570  1.00 0.00 ? 84  PHE A CE2  2  
ATOM   1573  C  CZ   . PHE A 1 20 ? -2.229  12.033  -1.247  1.00 0.00 ? 84  PHE A CZ   2  
ATOM   1574  H  H    . PHE A 1 20 ? -4.129  11.834  -7.867  1.00 0.00 ? 84  PHE A H    2  
ATOM   1575  H  HA   . PHE A 1 20 ? -2.671  10.367  -5.791  1.00 0.00 ? 84  PHE A HA   2  
ATOM   1576  H  HB2  . PHE A 1 20 ? -2.785  12.927  -5.854  1.00 0.00 ? 84  PHE A HB2  2  
ATOM   1577  H  HB3  . PHE A 1 20 ? -4.463  12.750  -5.352  1.00 0.00 ? 84  PHE A HB3  2  
ATOM   1578  H  HD1  . PHE A 1 20 ? -1.275  11.091  -4.340  1.00 0.00 ? 84  PHE A HD1  2  
ATOM   1579  H  HD2  . PHE A 1 20 ? -4.716  13.292  -3.142  1.00 0.00 ? 84  PHE A HD2  2  
ATOM   1580  H  HE1  . PHE A 1 20 ? -0.551  10.940  -1.994  1.00 0.00 ? 84  PHE A HE1  2  
ATOM   1581  H  HE2  . PHE A 1 20 ? -3.997  13.145  -0.794  1.00 0.00 ? 84  PHE A HE2  2  
ATOM   1582  H  HZ   . PHE A 1 20 ? -1.913  11.967  -0.217  1.00 0.00 ? 84  PHE A HZ   2  
ATOM   1583  N  N    . HIS A 1 21 ? -4.673  8.842   -5.542  1.00 0.00 ? 85  HIS A N    2  
ATOM   1584  C  CA   . HIS A 1 21 ? -5.776  7.990   -5.112  1.00 0.00 ? 85  HIS A CA   2  
ATOM   1585  C  C    . HIS A 1 21 ? -5.510  7.417   -3.723  1.00 0.00 ? 85  HIS A C    2  
ATOM   1586  O  O    . HIS A 1 21 ? -4.371  7.098   -3.380  1.00 0.00 ? 85  HIS A O    2  
ATOM   1587  C  CB   . HIS A 1 21 ? -5.992  6.855   -6.112  1.00 0.00 ? 85  HIS A CB   2  
ATOM   1588  C  CG   . HIS A 1 21 ? -6.030  7.312   -7.538  1.00 0.00 ? 85  HIS A CG   2  
ATOM   1589  N  ND1  . HIS A 1 21 ? -7.204  7.502   -8.236  1.00 0.00 ? 85  HIS A ND1  2  
ATOM   1590  C  CD2  . HIS A 1 21 ? -5.029  7.619   -8.396  1.00 0.00 ? 85  HIS A CD2  2  
ATOM   1591  C  CE1  . HIS A 1 21 ? -6.923  7.904   -9.463  1.00 0.00 ? 85  HIS A CE1  2  
ATOM   1592  N  NE2  . HIS A 1 21 ? -5.611  7.984   -9.586  1.00 0.00 ? 85  HIS A NE2  2  
ATOM   1593  H  H    . HIS A 1 21 ? -3.830  8.429   -5.820  1.00 0.00 ? 85  HIS A H    2  
ATOM   1594  H  HA   . HIS A 1 21 ? -6.668  8.597   -5.072  1.00 0.00 ? 85  HIS A HA   2  
ATOM   1595  H  HB2  . HIS A 1 21 ? -5.187  6.140   -6.015  1.00 0.00 ? 85  HIS A HB2  2  
ATOM   1596  H  HB3  . HIS A 1 21 ? -6.930  6.365   -5.895  1.00 0.00 ? 85  HIS A HB3  2  
ATOM   1597  H  HD1  . HIS A 1 21 ? -8.107  7.361   -7.886  1.00 0.00 ? 85  HIS A HD1  2  
ATOM   1598  H  HD2  . HIS A 1 21 ? -3.969  7.583   -8.186  1.00 0.00 ? 85  HIS A HD2  2  
ATOM   1599  H  HE1  . HIS A 1 21 ? -7.644  8.130   -10.234 1.00 0.00 ? 85  HIS A HE1  2  
ATOM   1600  N  N    . TYR A 1 22 ? -6.566  7.290   -2.928  1.00 0.00 ? 86  TYR A N    2  
ATOM   1601  C  CA   . TYR A 1 22 ? -6.446  6.758   -1.576  1.00 0.00 ? 86  TYR A CA   2  
ATOM   1602  C  C    . TYR A 1 22 ? -5.520  7.626   -0.730  1.00 0.00 ? 86  TYR A C    2  
ATOM   1603  O  O    . TYR A 1 22 ? -4.903  7.151   0.223   1.00 0.00 ? 86  TYR A O    2  
ATOM   1604  C  CB   . TYR A 1 22 ? -5.922  5.322   -1.615  1.00 0.00 ? 86  TYR A CB   2  
ATOM   1605  C  CG   . TYR A 1 22 ? -6.670  4.430   -2.581  1.00 0.00 ? 86  TYR A CG   2  
ATOM   1606  C  CD1  . TYR A 1 22 ? -6.348  4.412   -3.932  1.00 0.00 ? 86  TYR A CD1  2  
ATOM   1607  C  CD2  . TYR A 1 22 ? -7.699  3.606   -2.141  1.00 0.00 ? 86  TYR A CD2  2  
ATOM   1608  C  CE1  . TYR A 1 22 ? -7.030  3.600   -4.818  1.00 0.00 ? 86  TYR A CE1  2  
ATOM   1609  C  CE2  . TYR A 1 22 ? -8.384  2.789   -3.020  1.00 0.00 ? 86  TYR A CE2  2  
ATOM   1610  C  CZ   . TYR A 1 22 ? -8.047  2.791   -4.357  1.00 0.00 ? 86  TYR A CZ   2  
ATOM   1611  O  OH   . TYR A 1 22 ? -8.727  1.979   -5.236  1.00 0.00 ? 86  TYR A OH   2  
ATOM   1612  H  H    . TYR A 1 22 ? -7.448  7.561   -3.258  1.00 0.00 ? 86  TYR A H    2  
ATOM   1613  H  HA   . TYR A 1 22 ? -7.430  6.760   -1.130  1.00 0.00 ? 86  TYR A HA   2  
ATOM   1614  H  HB2  . TYR A 1 22 ? -4.884  5.332   -1.910  1.00 0.00 ? 86  TYR A HB2  2  
ATOM   1615  H  HB3  . TYR A 1 22 ? -6.007  4.888   -0.629  1.00 0.00 ? 86  TYR A HB3  2  
ATOM   1616  H  HD1  . TYR A 1 22 ? -5.551  5.048   -4.290  1.00 0.00 ? 86  TYR A HD1  2  
ATOM   1617  H  HD2  . TYR A 1 22 ? -7.961  3.607   -1.093  1.00 0.00 ? 86  TYR A HD2  2  
ATOM   1618  H  HE1  . TYR A 1 22 ? -6.765  3.601   -5.865  1.00 0.00 ? 86  TYR A HE1  2  
ATOM   1619  H  HE2  . TYR A 1 22 ? -9.181  2.155   -2.659  1.00 0.00 ? 86  TYR A HE2  2  
ATOM   1620  H  HH   . TYR A 1 22 ? -9.029  1.192   -4.776  1.00 0.00 ? 86  TYR A HH   2  
ATOM   1621  N  N    . GLY A 1 23 ? -5.427  8.904   -1.086  1.00 0.00 ? 87  GLY A N    2  
ATOM   1622  C  CA   . GLY A 1 23 ? -4.575  9.820   -0.350  1.00 0.00 ? 87  GLY A CA   2  
ATOM   1623  C  C    . GLY A 1 23 ? -3.111  9.436   -0.425  1.00 0.00 ? 87  GLY A C    2  
ATOM   1624  O  O    . GLY A 1 23 ? -2.315  9.822   0.432   1.00 0.00 ? 87  GLY A O    2  
ATOM   1625  H  H    . GLY A 1 23 ? -5.942  9.227   -1.855  1.00 0.00 ? 87  GLY A H    2  
ATOM   1626  H  HA2  . GLY A 1 23 ? -4.698  10.813  -0.755  1.00 0.00 ? 87  GLY A HA2  2  
ATOM   1627  H  HA3  . GLY A 1 23 ? -4.881  9.824   0.686   1.00 0.00 ? 87  GLY A HA3  2  
ATOM   1628  N  N    . VAL A 1 24 ? -2.752  8.672   -1.452  1.00 0.00 ? 88  VAL A N    2  
ATOM   1629  C  CA   . VAL A 1 24 ? -1.374  8.235   -1.636  1.00 0.00 ? 88  VAL A CA   2  
ATOM   1630  C  C    . VAL A 1 24 ? -0.965  8.306   -3.103  1.00 0.00 ? 88  VAL A C    2  
ATOM   1631  O  O    . VAL A 1 24 ? -1.627  7.736   -3.971  1.00 0.00 ? 88  VAL A O    2  
ATOM   1632  C  CB   . VAL A 1 24 ? -1.168  6.796   -1.126  1.00 0.00 ? 88  VAL A CB   2  
ATOM   1633  C  CG1  . VAL A 1 24 ? -2.033  5.822   -1.912  1.00 0.00 ? 88  VAL A CG1  2  
ATOM   1634  C  CG2  . VAL A 1 24 ? 0.299   6.406   -1.210  1.00 0.00 ? 88  VAL A CG2  2  
ATOM   1635  H  H    . VAL A 1 24 ? -3.432  8.396   -2.103  1.00 0.00 ? 88  VAL A H    2  
ATOM   1636  H  HA   . VAL A 1 24 ? -0.736  8.892   -1.062  1.00 0.00 ? 88  VAL A HA   2  
ATOM   1637  H  HB   . VAL A 1 24 ? -1.471  6.756   -0.090  1.00 0.00 ? 88  VAL A HB   2  
ATOM   1638  H  HG11 . VAL A 1 24 ? -3.061  6.152   -1.885  1.00 0.00 ? 88  VAL A HG11 2  
ATOM   1639  H  HG12 . VAL A 1 24 ? -1.693  5.784   -2.937  1.00 0.00 ? 88  VAL A HG12 2  
ATOM   1640  H  HG13 . VAL A 1 24 ? -1.960  4.839   -1.472  1.00 0.00 ? 88  VAL A HG13 2  
ATOM   1641  H  HG21 . VAL A 1 24 ? 0.872   7.004   -0.517  1.00 0.00 ? 88  VAL A HG21 2  
ATOM   1642  H  HG22 . VAL A 1 24 ? 0.408   5.361   -0.960  1.00 0.00 ? 88  VAL A HG22 2  
ATOM   1643  H  HG23 . VAL A 1 24 ? 0.660   6.574   -2.215  1.00 0.00 ? 88  VAL A HG23 2  
ATOM   1644  N  N    . HIS A 1 25 ? 0.130   9.009   -3.373  1.00 0.00 ? 89  HIS A N    2  
ATOM   1645  C  CA   . HIS A 1 25 ? 0.628   9.154   -4.736  1.00 0.00 ? 89  HIS A CA   2  
ATOM   1646  C  C    . HIS A 1 25 ? 0.883   7.790   -5.370  1.00 0.00 ? 89  HIS A C    2  
ATOM   1647  O  O    . HIS A 1 25 ? 1.938   7.190   -5.171  1.00 0.00 ? 89  HIS A O    2  
ATOM   1648  C  CB   . HIS A 1 25 ? 1.914   9.982   -4.747  1.00 0.00 ? 89  HIS A CB   2  
ATOM   1649  C  CG   . HIS A 1 25 ? 1.674   11.460  -4.724  1.00 0.00 ? 89  HIS A CG   2  
ATOM   1650  N  ND1  . HIS A 1 25 ? 1.504   12.177  -3.558  1.00 0.00 ? 89  HIS A ND1  2  
ATOM   1651  C  CD2  . HIS A 1 25 ? 1.578   12.357  -5.733  1.00 0.00 ? 89  HIS A CD2  2  
ATOM   1652  C  CE1  . HIS A 1 25 ? 1.313   13.451  -3.851  1.00 0.00 ? 89  HIS A CE1  2  
ATOM   1653  N  NE2  . HIS A 1 25 ? 1.353   13.587  -5.164  1.00 0.00 ? 89  HIS A NE2  2  
ATOM   1654  H  H    . HIS A 1 25 ? 0.614   9.440   -2.639  1.00 0.00 ? 89  HIS A H    2  
ATOM   1655  H  HA   . HIS A 1 25 ? -0.126  9.669   -5.312  1.00 0.00 ? 89  HIS A HA   2  
ATOM   1656  H  HB2  . HIS A 1 25 ? 2.504   9.729   -3.879  1.00 0.00 ? 89  HIS A HB2  2  
ATOM   1657  H  HB3  . HIS A 1 25 ? 2.477   9.750   -5.639  1.00 0.00 ? 89  HIS A HB3  2  
ATOM   1658  H  HD1  . HIS A 1 25 ? 1.520   11.807  -2.651  1.00 0.00 ? 89  HIS A HD1  2  
ATOM   1659  H  HD2  . HIS A 1 25 ? 1.663   12.146  -6.790  1.00 0.00 ? 89  HIS A HD2  2  
ATOM   1660  H  HE1  . HIS A 1 25 ? 1.150   14.246  -3.139  1.00 0.00 ? 89  HIS A HE1  2  
ATOM   1661  N  N    . ALA A 1 26 ? -0.092  7.306   -6.133  1.00 0.00 ? 90  ALA A N    2  
ATOM   1662  C  CA   . ALA A 1 26 ? 0.027   6.013   -6.796  1.00 0.00 ? 90  ALA A CA   2  
ATOM   1663  C  C    . ALA A 1 26 ? -0.129  6.155   -8.306  1.00 0.00 ? 90  ALA A C    2  
ATOM   1664  O  O    . ALA A 1 26 ? -0.728  7.115   -8.792  1.00 0.00 ? 90  ALA A O    2  
ATOM   1665  C  CB   . ALA A 1 26 ? -1.005  5.040   -6.245  1.00 0.00 ? 90  ALA A CB   2  
ATOM   1666  H  H    . ALA A 1 26 ? -0.910  7.831   -6.253  1.00 0.00 ? 90  ALA A H    2  
ATOM   1667  H  HA   . ALA A 1 26 ? 1.010   5.617   -6.581  1.00 0.00 ? 90  ALA A HA   2  
ATOM   1668  H  HB1  . ALA A 1 26 ? -1.975  5.514   -6.234  1.00 0.00 ? 90  ALA A HB1  2  
ATOM   1669  H  HB2  . ALA A 1 26 ? -1.040  4.161   -6.872  1.00 0.00 ? 90  ALA A HB2  2  
ATOM   1670  H  HB3  . ALA A 1 26 ? -0.731  4.756   -5.240  1.00 0.00 ? 90  ALA A HB3  2  
ATOM   1671  N  N    . CYS A 1 27 ? 0.414   5.193   -9.045  1.00 0.00 ? 91  CYS A N    2  
ATOM   1672  C  CA   . CYS A 1 27 ? 0.336   5.210   -10.501 1.00 0.00 ? 91  CYS A CA   2  
ATOM   1673  C  C    . CYS A 1 27 ? -0.819  4.344   -10.994 1.00 0.00 ? 91  CYS A C    2  
ATOM   1674  O  O    . CYS A 1 27 ? -1.262  3.429   -10.300 1.00 0.00 ? 91  CYS A O    2  
ATOM   1675  C  CB   . CYS A 1 27 ? 1.652   4.719   -11.108 1.00 0.00 ? 91  CYS A CB   2  
ATOM   1676  S  SG   . CYS A 1 27 ? 1.942   2.931   -10.907 1.00 0.00 ? 91  CYS A SG   2  
ATOM   1677  H  H    . CYS A 1 27 ? 0.879   4.452   -8.600  1.00 0.00 ? 91  CYS A H    2  
ATOM   1678  H  HA   . CYS A 1 27 ? 0.164   6.229   -10.812 1.00 0.00 ? 91  CYS A HA   2  
ATOM   1679  H  HB2  . CYS A 1 27 ? 1.653   4.934   -12.167 1.00 0.00 ? 91  CYS A HB2  2  
ATOM   1680  H  HB3  . CYS A 1 27 ? 2.473   5.240   -10.639 1.00 0.00 ? 91  CYS A HB3  2  
ATOM   1681  N  N    . GLU A 1 28 ? -1.302  4.640   -12.197 1.00 0.00 ? 92  GLU A N    2  
ATOM   1682  C  CA   . GLU A 1 28 ? -2.406  3.889   -12.782 1.00 0.00 ? 92  GLU A CA   2  
ATOM   1683  C  C    . GLU A 1 28 ? -2.240  2.393   -12.532 1.00 0.00 ? 92  GLU A C    2  
ATOM   1684  O  O    . GLU A 1 28 ? -3.190  1.705   -12.161 1.00 0.00 ? 92  GLU A O    2  
ATOM   1685  C  CB   . GLU A 1 28 ? -2.495  4.159   -14.286 1.00 0.00 ? 92  GLU A CB   2  
ATOM   1686  C  CG   . GLU A 1 28 ? -1.266  3.711   -15.058 1.00 0.00 ? 92  GLU A CG   2  
ATOM   1687  C  CD   . GLU A 1 28 ? -1.422  3.888   -16.556 1.00 0.00 ? 92  GLU A CD   2  
ATOM   1688  O  OE1  . GLU A 1 28 ? -1.487  5.049   -17.013 1.00 0.00 ? 92  GLU A OE1  2  
ATOM   1689  O  OE2  . GLU A 1 28 ? -1.479  2.866   -17.272 1.00 0.00 ? 92  GLU A OE2  2  
ATOM   1690  H  H    . GLU A 1 28 ? -0.907  5.381   -12.702 1.00 0.00 ? 92  GLU A H    2  
ATOM   1691  H  HA   . GLU A 1 28 ? -3.319  4.221   -12.312 1.00 0.00 ? 92  GLU A HA   2  
ATOM   1692  H  HB2  . GLU A 1 28 ? -3.354  3.638   -14.683 1.00 0.00 ? 92  GLU A HB2  2  
ATOM   1693  H  HB3  . GLU A 1 28 ? -2.626  5.219   -14.441 1.00 0.00 ? 92  GLU A HB3  2  
ATOM   1694  H  HG2  . GLU A 1 28 ? -0.418  4.294   -14.729 1.00 0.00 ? 92  GLU A HG2  2  
ATOM   1695  H  HG3  . GLU A 1 28 ? -1.086  2.667   -14.851 1.00 0.00 ? 92  GLU A HG3  2  
ATOM   1696  N  N    . GLY A 1 29 ? -1.024  1.896   -12.739 1.00 0.00 ? 93  GLY A N    2  
ATOM   1697  C  CA   . GLY A 1 29 ? -0.754  0.485   -12.531 1.00 0.00 ? 93  GLY A CA   2  
ATOM   1698  C  C    . GLY A 1 29 ? -1.117  0.024   -11.134 1.00 0.00 ? 93  GLY A C    2  
ATOM   1699  O  O    . GLY A 1 29 ? -2.105  -0.687  -10.944 1.00 0.00 ? 93  GLY A O    2  
ATOM   1700  H  H    . GLY A 1 29 ? -0.304  2.492   -13.034 1.00 0.00 ? 93  GLY A H    2  
ATOM   1701  H  HA2  . GLY A 1 29 ? -1.323  -0.088  -13.248 1.00 0.00 ? 93  GLY A HA2  2  
ATOM   1702  H  HA3  . GLY A 1 29 ? 0.299   0.304   -12.695 1.00 0.00 ? 93  GLY A HA3  2  
ATOM   1703  N  N    . CYS A 1 30 ? -0.318  0.428   -10.153 1.00 0.00 ? 94  CYS A N    2  
ATOM   1704  C  CA   . CYS A 1 30 ? -0.558  0.051   -8.765  1.00 0.00 ? 94  CYS A CA   2  
ATOM   1705  C  C    . CYS A 1 30 ? -1.986  0.394   -8.348  1.00 0.00 ? 94  CYS A C    2  
ATOM   1706  O  O    . CYS A 1 30 ? -2.739  -0.472  -7.902  1.00 0.00 ? 94  CYS A O    2  
ATOM   1707  C  CB   . CYS A 1 30 ? 0.438   0.757   -7.843  1.00 0.00 ? 94  CYS A CB   2  
ATOM   1708  S  SG   . CYS A 1 30 ? 2.184   0.413   -8.232  1.00 0.00 ? 94  CYS A SG   2  
ATOM   1709  H  H    . CYS A 1 30 ? 0.454   0.994   -10.367 1.00 0.00 ? 94  CYS A H    2  
ATOM   1710  H  HA   . CYS A 1 30 ? -0.419  -1.016  -8.682  1.00 0.00 ? 94  CYS A HA   2  
ATOM   1711  H  HB2  . CYS A 1 30 ? 0.290   1.825   -7.916  1.00 0.00 ? 94  CYS A HB2  2  
ATOM   1712  H  HB3  . CYS A 1 30 ? 0.259   0.443   -6.825  1.00 0.00 ? 94  CYS A HB3  2  
ATOM   1713  N  N    . LYS A 1 31 ? -2.351  1.663   -8.496  1.00 0.00 ? 95  LYS A N    2  
ATOM   1714  C  CA   . LYS A 1 31 ? -3.687  2.122   -8.137  1.00 0.00 ? 95  LYS A CA   2  
ATOM   1715  C  C    . LYS A 1 31 ? -4.730  1.051   -8.440  1.00 0.00 ? 95  LYS A C    2  
ATOM   1716  O  O    . LYS A 1 31 ? -5.534  0.692   -7.581  1.00 0.00 ? 95  LYS A O    2  
ATOM   1717  C  CB   . LYS A 1 31 ? -4.027  3.409   -8.892  1.00 0.00 ? 95  LYS A CB   2  
ATOM   1718  C  CG   . LYS A 1 31 ? -5.365  4.009   -8.499  1.00 0.00 ? 95  LYS A CG   2  
ATOM   1719  C  CD   . LYS A 1 31 ? -6.493  3.473   -9.364  1.00 0.00 ? 95  LYS A CD   2  
ATOM   1720  C  CE   . LYS A 1 31 ? -6.709  4.335   -10.598 1.00 0.00 ? 95  LYS A CE   2  
ATOM   1721  N  NZ   . LYS A 1 31 ? -7.222  3.540   -11.748 1.00 0.00 ? 95  LYS A NZ   2  
ATOM   1722  H  H    . LYS A 1 31 ? -1.705  2.307   -8.856  1.00 0.00 ? 95  LYS A H    2  
ATOM   1723  H  HA   . LYS A 1 31 ? -3.695  2.324   -7.076  1.00 0.00 ? 95  LYS A HA   2  
ATOM   1724  H  HB2  . LYS A 1 31 ? -3.256  4.140   -8.698  1.00 0.00 ? 95  LYS A HB2  2  
ATOM   1725  H  HB3  . LYS A 1 31 ? -4.050  3.195   -9.951  1.00 0.00 ? 95  LYS A HB3  2  
ATOM   1726  H  HG2  . LYS A 1 31 ? -5.570  3.765   -7.467  1.00 0.00 ? 95  LYS A HG2  2  
ATOM   1727  H  HG3  . LYS A 1 31 ? -5.315  5.083   -8.614  1.00 0.00 ? 95  LYS A HG3  2  
ATOM   1728  H  HD2  . LYS A 1 31 ? -6.248  2.469   -9.679  1.00 0.00 ? 95  LYS A HD2  2  
ATOM   1729  H  HD3  . LYS A 1 31 ? -7.405  3.457   -8.783  1.00 0.00 ? 95  LYS A HD3  2  
ATOM   1730  H  HE2  . LYS A 1 31 ? -7.422  5.110   -10.360 1.00 0.00 ? 95  LYS A HE2  2  
ATOM   1731  H  HE3  . LYS A 1 31 ? -5.767  4.786   -10.874 1.00 0.00 ? 95  LYS A HE3  2  
ATOM   1732  H  HZ1  . LYS A 1 31 ? -7.923  2.847   -11.419 1.00 0.00 ? 95  LYS A HZ1  2  
ATOM   1733  H  HZ2  . LYS A 1 31 ? -6.439  3.034   -12.209 1.00 0.00 ? 95  LYS A HZ2  2  
ATOM   1734  H  HZ3  . LYS A 1 31 ? -7.671  4.168   -12.444 1.00 0.00 ? 95  LYS A HZ3  2  
ATOM   1735  N  N    . GLY A 1 32 ? -4.710  0.543   -9.669  1.00 0.00 ? 96  GLY A N    2  
ATOM   1736  C  CA   . GLY A 1 32 ? -5.658  -0.482  -10.063 1.00 0.00 ? 96  GLY A CA   2  
ATOM   1737  C  C    . GLY A 1 32 ? -5.528  -1.743  -9.231  1.00 0.00 ? 96  GLY A C    2  
ATOM   1738  O  O    . GLY A 1 32 ? -6.523  -2.277  -8.741  1.00 0.00 ? 96  GLY A O    2  
ATOM   1739  H  H    . GLY A 1 32 ? -4.047  0.868   -10.313 1.00 0.00 ? 96  GLY A H    2  
ATOM   1740  H  HA2  . GLY A 1 32 ? -6.659  -0.093  -9.954  1.00 0.00 ? 96  GLY A HA2  2  
ATOM   1741  H  HA3  . GLY A 1 32 ? -5.491  -0.732  -11.101 1.00 0.00 ? 96  GLY A HA3  2  
ATOM   1742  N  N    . PHE A 1 33 ? -4.298  -2.220  -9.072  1.00 0.00 ? 97  PHE A N    2  
ATOM   1743  C  CA   . PHE A 1 33 ? -4.042  -3.428  -8.295  1.00 0.00 ? 97  PHE A CA   2  
ATOM   1744  C  C    . PHE A 1 33 ? -4.828  -3.411  -6.988  1.00 0.00 ? 97  PHE A C    2  
ATOM   1745  O  O    . PHE A 1 33 ? -5.726  -4.227  -6.779  1.00 0.00 ? 97  PHE A O    2  
ATOM   1746  C  CB   . PHE A 1 33 ? -2.546  -3.563  -8.003  1.00 0.00 ? 97  PHE A CB   2  
ATOM   1747  C  CG   . PHE A 1 33 ? -2.210  -4.738  -7.129  1.00 0.00 ? 97  PHE A CG   2  
ATOM   1748  C  CD1  . PHE A 1 33 ? -2.194  -4.610  -5.750  1.00 0.00 ? 97  PHE A CD1  2  
ATOM   1749  C  CD2  . PHE A 1 33 ? -1.910  -5.970  -7.688  1.00 0.00 ? 97  PHE A CD2  2  
ATOM   1750  C  CE1  . PHE A 1 33 ? -1.886  -5.689  -4.943  1.00 0.00 ? 97  PHE A CE1  2  
ATOM   1751  C  CE2  . PHE A 1 33 ? -1.601  -7.053  -6.886  1.00 0.00 ? 97  PHE A CE2  2  
ATOM   1752  C  CZ   . PHE A 1 33 ? -1.588  -6.912  -5.512  1.00 0.00 ? 97  PHE A CZ   2  
ATOM   1753  H  H    . PHE A 1 33 ? -3.545  -1.749  -9.487  1.00 0.00 ? 97  PHE A H    2  
ATOM   1754  H  HA   . PHE A 1 33 ? -4.363  -4.273  -8.883  1.00 0.00 ? 97  PHE A HA   2  
ATOM   1755  H  HB2  . PHE A 1 33 ? -2.013  -3.680  -8.934  1.00 0.00 ? 97  PHE A HB2  2  
ATOM   1756  H  HB3  . PHE A 1 33 ? -2.202  -2.669  -7.506  1.00 0.00 ? 97  PHE A HB3  2  
ATOM   1757  H  HD1  . PHE A 1 33 ? -2.427  -3.653  -5.303  1.00 0.00 ? 97  PHE A HD1  2  
ATOM   1758  H  HD2  . PHE A 1 33 ? -1.918  -6.081  -8.762  1.00 0.00 ? 97  PHE A HD2  2  
ATOM   1759  H  HE1  . PHE A 1 33 ? -1.877  -5.575  -3.869  1.00 0.00 ? 97  PHE A HE1  2  
ATOM   1760  H  HE2  . PHE A 1 33 ? -1.368  -8.007  -7.333  1.00 0.00 ? 97  PHE A HE2  2  
ATOM   1761  H  HZ   . PHE A 1 33 ? -1.347  -7.756  -4.884  1.00 0.00 ? 97  PHE A HZ   2  
ATOM   1762  N  N    . PHE A 1 34 ? -4.483  -2.475  -6.109  1.00 0.00 ? 98  PHE A N    2  
ATOM   1763  C  CA   . PHE A 1 34 ? -5.154  -2.352  -4.820  1.00 0.00 ? 98  PHE A CA   2  
ATOM   1764  C  C    . PHE A 1 34 ? -6.659  -2.554  -4.970  1.00 0.00 ? 98  PHE A C    2  
ATOM   1765  O  O    . PHE A 1 34 ? -7.218  -3.527  -4.463  1.00 0.00 ? 98  PHE A O    2  
ATOM   1766  C  CB   . PHE A 1 34 ? -4.872  -0.980  -4.204  1.00 0.00 ? 98  PHE A CB   2  
ATOM   1767  C  CG   . PHE A 1 34 ? -5.366  -0.845  -2.792  1.00 0.00 ? 98  PHE A CG   2  
ATOM   1768  C  CD1  . PHE A 1 34 ? -4.760  -1.546  -1.762  1.00 0.00 ? 98  PHE A CD1  2  
ATOM   1769  C  CD2  . PHE A 1 34 ? -6.436  -0.016  -2.495  1.00 0.00 ? 98  PHE A CD2  2  
ATOM   1770  C  CE1  . PHE A 1 34 ? -5.212  -1.424  -0.461  1.00 0.00 ? 98  PHE A CE1  2  
ATOM   1771  C  CE2  . PHE A 1 34 ? -6.892  0.111   -1.196  1.00 0.00 ? 98  PHE A CE2  2  
ATOM   1772  C  CZ   . PHE A 1 34 ? -6.280  -0.595  -0.178  1.00 0.00 ? 98  PHE A CZ   2  
ATOM   1773  H  H    . PHE A 1 34 ? -3.759  -1.853  -6.333  1.00 0.00 ? 98  PHE A H    2  
ATOM   1774  H  HA   . PHE A 1 34 ? -4.763  -3.118  -4.169  1.00 0.00 ? 98  PHE A HA   2  
ATOM   1775  H  HB2  . PHE A 1 34 ? -3.806  -0.808  -4.200  1.00 0.00 ? 98  PHE A HB2  2  
ATOM   1776  H  HB3  . PHE A 1 34 ? -5.353  -0.220  -4.800  1.00 0.00 ? 98  PHE A HB3  2  
ATOM   1777  H  HD1  . PHE A 1 34 ? -3.925  -2.196  -1.982  1.00 0.00 ? 98  PHE A HD1  2  
ATOM   1778  H  HD2  . PHE A 1 34 ? -6.916  0.535   -3.290  1.00 0.00 ? 98  PHE A HD2  2  
ATOM   1779  H  HE1  . PHE A 1 34 ? -4.732  -1.977  0.332   1.00 0.00 ? 98  PHE A HE1  2  
ATOM   1780  H  HE2  . PHE A 1 34 ? -7.727  0.759   -0.978  1.00 0.00 ? 98  PHE A HE2  2  
ATOM   1781  H  HZ   . PHE A 1 34 ? -6.634  -0.497  0.837   1.00 0.00 ? 98  PHE A HZ   2  
ATOM   1782  N  N    . ARG A 1 35 ? -7.309  -1.629  -5.668  1.00 0.00 ? 99  ARG A N    2  
ATOM   1783  C  CA   . ARG A 1 35 ? -8.749  -1.704  -5.883  1.00 0.00 ? 99  ARG A CA   2  
ATOM   1784  C  C    . ARG A 1 35 ? -9.162  -3.110  -6.306  1.00 0.00 ? 99  ARG A C    2  
ATOM   1785  O  O    . ARG A 1 35 ? -9.951  -3.767  -5.626  1.00 0.00 ? 99  ARG A O    2  
ATOM   1786  C  CB   . ARG A 1 35 ? -9.181  -0.692  -6.945  1.00 0.00 ? 99  ARG A CB   2  
ATOM   1787  C  CG   . ARG A 1 35 ? -10.683 -0.466  -6.996  1.00 0.00 ? 99  ARG A CG   2  
ATOM   1788  C  CD   . ARG A 1 35 ? -11.029 0.817   -7.734  1.00 0.00 ? 99  ARG A CD   2  
ATOM   1789  N  NE   . ARG A 1 35 ? -10.956 1.987   -6.863  1.00 0.00 ? 99  ARG A NE   2  
ATOM   1790  C  CZ   . ARG A 1 35 ? -11.319 3.208   -7.240  1.00 0.00 ? 99  ARG A CZ   2  
ATOM   1791  N  NH1  . ARG A 1 35 ? -11.777 3.418   -8.466  1.00 0.00 ? 99  ARG A NH1  2  
ATOM   1792  N  NH2  . ARG A 1 35 ? -11.223 4.222   -6.389  1.00 0.00 ? 99  ARG A NH2  2  
ATOM   1793  H  H    . ARG A 1 35 ? -6.808  -0.876  -6.047  1.00 0.00 ? 99  ARG A H    2  
ATOM   1794  H  HA   . ARG A 1 35 ? -9.236  -1.464  -4.950  1.00 0.00 ? 99  ARG A HA   2  
ATOM   1795  H  HB2  . ARG A 1 35 ? -8.704  0.255   -6.739  1.00 0.00 ? 99  ARG A HB2  2  
ATOM   1796  H  HB3  . ARG A 1 35 ? -8.859  -1.045  -7.913  1.00 0.00 ? 99  ARG A HB3  2  
ATOM   1797  H  HG2  . ARG A 1 35 ? -11.146 -1.298  -7.506  1.00 0.00 ? 99  ARG A HG2  2  
ATOM   1798  H  HG3  . ARG A 1 35 ? -11.062 -0.404  -5.986  1.00 0.00 ? 99  ARG A HG3  2  
ATOM   1799  H  HD2  . ARG A 1 35 ? -10.334 0.945   -8.551  1.00 0.00 ? 99  ARG A HD2  2  
ATOM   1800  H  HD3  . ARG A 1 35 ? -12.032 0.733   -8.125  1.00 0.00 ? 99  ARG A HD3  2  
ATOM   1801  H  HE   . ARG A 1 35 ? -10.621 1.854   -5.952  1.00 0.00 ? 99  ARG A HE   2  
ATOM   1802  H  HH11 . ARG A 1 35 ? -11.851 2.656   -9.109  1.00 0.00 ? 99  ARG A HH11 2  
ATOM   1803  H  HH12 . ARG A 1 35 ? -12.050 4.339   -8.747  1.00 0.00 ? 99  ARG A HH12 2  
ATOM   1804  H  HH21 . ARG A 1 35 ? -10.879 4.068   -5.464  1.00 0.00 ? 99  ARG A HH21 2  
ATOM   1805  H  HH22 . ARG A 1 35 ? -11.496 5.141   -6.674  1.00 0.00 ? 99  ARG A HH22 2  
ATOM   1806  N  N    . ARG A 1 36 ? -8.625  -3.565  -7.434  1.00 0.00 ? 100 ARG A N    2  
ATOM   1807  C  CA   . ARG A 1 36 ? -8.940  -4.892  -7.949  1.00 0.00 ? 100 ARG A CA   2  
ATOM   1808  C  C    . ARG A 1 36 ? -9.022  -5.910  -6.815  1.00 0.00 ? 100 ARG A C    2  
ATOM   1809  O  O    . ARG A 1 36 ? -10.003 -6.646  -6.696  1.00 0.00 ? 100 ARG A O    2  
ATOM   1810  C  CB   . ARG A 1 36 ? -7.886  -5.331  -8.967  1.00 0.00 ? 100 ARG A CB   2  
ATOM   1811  C  CG   . ARG A 1 36 ? -8.114  -6.729  -9.517  1.00 0.00 ? 100 ARG A CG   2  
ATOM   1812  C  CD   . ARG A 1 36 ? -7.441  -6.913  -10.867 1.00 0.00 ? 100 ARG A CD   2  
ATOM   1813  N  NE   . ARG A 1 36 ? -8.123  -6.173  -11.925 1.00 0.00 ? 100 ARG A NE   2  
ATOM   1814  C  CZ   . ARG A 1 36 ? -9.169  -6.643  -12.595 1.00 0.00 ? 100 ARG A CZ   2  
ATOM   1815  N  NH1  . ARG A 1 36 ? -9.651  -7.847  -12.317 1.00 0.00 ? 100 ARG A NH1  2  
ATOM   1816  N  NH2  . ARG A 1 36 ? -9.736  -5.909  -13.544 1.00 0.00 ? 100 ARG A NH2  2  
ATOM   1817  H  H    . ARG A 1 36 ? -8.004  -2.994  -7.932  1.00 0.00 ? 100 ARG A H    2  
ATOM   1818  H  HA   . ARG A 1 36 ? -9.900  -4.839  -8.439  1.00 0.00 ? 100 ARG A HA   2  
ATOM   1819  H  HB2  . ARG A 1 36 ? -7.891  -4.637  -9.795  1.00 0.00 ? 100 ARG A HB2  2  
ATOM   1820  H  HB3  . ARG A 1 36 ? -6.915  -5.307  -8.494  1.00 0.00 ? 100 ARG A HB3  2  
ATOM   1821  H  HG2  . ARG A 1 36 ? -7.708  -7.450  -8.823  1.00 0.00 ? 100 ARG A HG2  2  
ATOM   1822  H  HG3  . ARG A 1 36 ? -9.176  -6.892  -9.628  1.00 0.00 ? 100 ARG A HG3  2  
ATOM   1823  H  HD2  . ARG A 1 36 ? -6.421  -6.565  -10.797 1.00 0.00 ? 100 ARG A HD2  2  
ATOM   1824  H  HD3  . ARG A 1 36 ? -7.445  -7.964  -11.116 1.00 0.00 ? 100 ARG A HD3  2  
ATOM   1825  H  HE   . ARG A 1 36 ? -7.783  -5.281  -12.146 1.00 0.00 ? 100 ARG A HE   2  
ATOM   1826  H  HH11 . ARG A 1 36 ? -9.227  -8.402  -11.602 1.00 0.00 ? 100 ARG A HH11 2  
ATOM   1827  H  HH12 . ARG A 1 36 ? -10.440 -8.198  -12.822 1.00 0.00 ? 100 ARG A HH12 2  
ATOM   1828  H  HH21 . ARG A 1 36 ? -9.375  -5.001  -13.755 1.00 0.00 ? 100 ARG A HH21 2  
ATOM   1829  H  HH22 . ARG A 1 36 ? -10.523 -6.264  -14.047 1.00 0.00 ? 100 ARG A HH22 2  
ATOM   1830  N  N    . THR A 1 37 ? -7.985  -5.947  -5.984  1.00 0.00 ? 101 THR A N    2  
ATOM   1831  C  CA   . THR A 1 37 ? -7.939  -6.875  -4.861  1.00 0.00 ? 101 THR A CA   2  
ATOM   1832  C  C    . THR A 1 37 ? -9.145  -6.693  -3.947  1.00 0.00 ? 101 THR A C    2  
ATOM   1833  O  O    . THR A 1 37 ? -9.704  -7.666  -3.440  1.00 0.00 ? 101 THR A O    2  
ATOM   1834  C  CB   . THR A 1 37 ? -6.651  -6.695  -4.035  1.00 0.00 ? 101 THR A CB   2  
ATOM   1835  O  OG1  . THR A 1 37 ? -5.505  -6.797  -4.887  1.00 0.00 ? 101 THR A OG1  2  
ATOM   1836  C  CG2  . THR A 1 37 ? -6.564  -7.738  -2.932  1.00 0.00 ? 101 THR A CG2  2  
ATOM   1837  H  H    . THR A 1 37 ? -7.234  -5.336  -6.131  1.00 0.00 ? 101 THR A H    2  
ATOM   1838  H  HA   . THR A 1 37 ? -7.949  -7.880  -5.258  1.00 0.00 ? 101 THR A HA   2  
ATOM   1839  H  HB   . THR A 1 37 ? -6.667  -5.714  -3.582  1.00 0.00 ? 101 THR A HB   2  
ATOM   1840  H  HG1  . THR A 1 37 ? -5.471  -6.036  -5.472  1.00 0.00 ? 101 THR A HG1  2  
ATOM   1841  H  HG21 . THR A 1 37 ? -6.686  -8.723  -3.359  1.00 0.00 ? 101 THR A HG21 2  
ATOM   1842  H  HG22 . THR A 1 37 ? -7.345  -7.562  -2.207  1.00 0.00 ? 101 THR A HG22 2  
ATOM   1843  H  HG23 . THR A 1 37 ? -5.601  -7.672  -2.449  1.00 0.00 ? 101 THR A HG23 2  
ATOM   1844  N  N    . ILE A 1 38 ? -9.541  -5.442  -3.740  1.00 0.00 ? 102 ILE A N    2  
ATOM   1845  C  CA   . ILE A 1 38 ? -10.682 -5.133  -2.888  1.00 0.00 ? 102 ILE A CA   2  
ATOM   1846  C  C    . ILE A 1 38 ? -11.992 -5.541  -3.554  1.00 0.00 ? 102 ILE A C    2  
ATOM   1847  O  O    . ILE A 1 38 ? -12.752 -6.343  -3.012  1.00 0.00 ? 102 ILE A O    2  
ATOM   1848  C  CB   . ILE A 1 38 ? -10.739 -3.633  -2.545  1.00 0.00 ? 102 ILE A CB   2  
ATOM   1849  C  CG1  . ILE A 1 38 ? -9.392  -3.162  -1.992  1.00 0.00 ? 102 ILE A CG1  2  
ATOM   1850  C  CG2  . ILE A 1 38 ? -11.853 -3.360  -1.545  1.00 0.00 ? 102 ILE A CG2  2  
ATOM   1851  C  CD1  . ILE A 1 38 ? -9.069  -3.728  -0.626  1.00 0.00 ? 102 ILE A CD1  2  
ATOM   1852  H  H    . ILE A 1 38 ? -9.055  -4.709  -4.172  1.00 0.00 ? 102 ILE A H    2  
ATOM   1853  H  HA   . ILE A 1 38 ? -10.571 -5.688  -1.968  1.00 0.00 ? 102 ILE A HA   2  
ATOM   1854  H  HB   . ILE A 1 38 ? -10.959 -3.087  -3.450  1.00 0.00 ? 102 ILE A HB   2  
ATOM   1855  H  HG12 . ILE A 1 38 ? -8.608  -3.462  -2.668  1.00 0.00 ? 102 ILE A HG12 2  
ATOM   1856  H  HG13 . ILE A 1 38 ? -9.401  -2.085  -1.912  1.00 0.00 ? 102 ILE A HG13 2  
ATOM   1857  H  HG21 . ILE A 1 38 ? -12.301 -2.401  -1.758  1.00 0.00 ? 102 ILE A HG21 2  
ATOM   1858  H  HG22 . ILE A 1 38 ? -12.604 -4.132  -1.623  1.00 0.00 ? 102 ILE A HG22 2  
ATOM   1859  H  HG23 . ILE A 1 38 ? -11.446 -3.353  -0.545  1.00 0.00 ? 102 ILE A HG23 2  
ATOM   1860  H  HD11 . ILE A 1 38 ? -9.308  -2.996  0.132   1.00 0.00 ? 102 ILE A HD11 2  
ATOM   1861  H  HD12 . ILE A 1 38 ? -9.653  -4.621  -0.459  1.00 0.00 ? 102 ILE A HD12 2  
ATOM   1862  H  HD13 . ILE A 1 38 ? -8.018  -3.968  -0.575  1.00 0.00 ? 102 ILE A HD13 2  
ATOM   1863  N  N    . ARG A 1 39 ? -12.248 -4.983  -4.733  1.00 0.00 ? 103 ARG A N    2  
ATOM   1864  C  CA   . ARG A 1 39 ? -13.466 -5.289  -5.474  1.00 0.00 ? 103 ARG A CA   2  
ATOM   1865  C  C    . ARG A 1 39 ? -13.575 -6.787  -5.746  1.00 0.00 ? 103 ARG A C    2  
ATOM   1866  O  O    . ARG A 1 39 ? -14.675 -7.332  -5.836  1.00 0.00 ? 103 ARG A O    2  
ATOM   1867  C  CB   . ARG A 1 39 ? -13.493 -4.517  -6.794  1.00 0.00 ? 103 ARG A CB   2  
ATOM   1868  C  CG   . ARG A 1 39 ? -12.248 -4.718  -7.643  1.00 0.00 ? 103 ARG A CG   2  
ATOM   1869  C  CD   . ARG A 1 39 ? -12.488 -4.316  -9.090  1.00 0.00 ? 103 ARG A CD   2  
ATOM   1870  N  NE   . ARG A 1 39 ? -12.210 -2.901  -9.318  1.00 0.00 ? 103 ARG A NE   2  
ATOM   1871  C  CZ   . ARG A 1 39 ? -11.761 -2.417  -10.471 1.00 0.00 ? 103 ARG A CZ   2  
ATOM   1872  N  NH1  . ARG A 1 39 ? -11.542 -3.230  -11.495 1.00 0.00 ? 103 ARG A NH1  2  
ATOM   1873  N  NH2  . ARG A 1 39 ? -11.532 -1.117  -10.601 1.00 0.00 ? 103 ARG A NH2  2  
ATOM   1874  H  H    . ARG A 1 39 ? -11.604 -4.350  -5.113  1.00 0.00 ? 103 ARG A H    2  
ATOM   1875  H  HA   . ARG A 1 39 ? -14.308 -4.983  -4.871  1.00 0.00 ? 103 ARG A HA   2  
ATOM   1876  H  HB2  . ARG A 1 39 ? -14.349 -4.838  -7.369  1.00 0.00 ? 103 ARG A HB2  2  
ATOM   1877  H  HB3  . ARG A 1 39 ? -13.588 -3.463  -6.579  1.00 0.00 ? 103 ARG A HB3  2  
ATOM   1878  H  HG2  . ARG A 1 39 ? -11.448 -4.114  -7.241  1.00 0.00 ? 103 ARG A HG2  2  
ATOM   1879  H  HG3  . ARG A 1 39 ? -11.966 -5.760  -7.610  1.00 0.00 ? 103 ARG A HG3  2  
ATOM   1880  H  HD2  . ARG A 1 39 ? -11.846 -4.907  -9.725  1.00 0.00 ? 103 ARG A HD2  2  
ATOM   1881  H  HD3  . ARG A 1 39 ? -13.520 -4.516  -9.337  1.00 0.00 ? 103 ARG A HD3  2  
ATOM   1882  H  HE   . ARG A 1 39 ? -12.365 -2.282  -8.575  1.00 0.00 ? 103 ARG A HE   2  
ATOM   1883  H  HH11 . ARG A 1 39 ? -11.715 -4.210  -11.399 1.00 0.00 ? 103 ARG A HH11 2  
ATOM   1884  H  HH12 . ARG A 1 39 ? -11.205 -2.863  -12.362 1.00 0.00 ? 103 ARG A HH12 2  
ATOM   1885  H  HH21 . ARG A 1 39 ? -11.696 -0.500  -9.832  1.00 0.00 ? 103 ARG A HH21 2  
ATOM   1886  H  HH22 . ARG A 1 39 ? -11.194 -0.753  -11.469 1.00 0.00 ? 103 ARG A HH22 2  
ATOM   1887  N  N    . MET A 1 40 ? -12.428 -7.444  -5.877  1.00 0.00 ? 104 MET A N    2  
ATOM   1888  C  CA   . MET A 1 40 ? -12.395 -8.879  -6.138  1.00 0.00 ? 104 MET A CA   2  
ATOM   1889  C  C    . MET A 1 40 ? -12.023 -9.652  -4.877  1.00 0.00 ? 104 MET A C    2  
ATOM   1890  O  O    . MET A 1 40 ? -11.927 -10.880 -4.894  1.00 0.00 ? 104 MET A O    2  
ATOM   1891  C  CB   . MET A 1 40 ? -11.398 -9.193  -7.255  1.00 0.00 ? 104 MET A CB   2  
ATOM   1892  C  CG   . MET A 1 40 ? -11.739 -8.526  -8.578  1.00 0.00 ? 104 MET A CG   2  
ATOM   1893  S  SD   . MET A 1 40 ? -10.915 -9.305  -9.980  1.00 0.00 ? 104 MET A SD   2  
ATOM   1894  C  CE   . MET A 1 40 ? -11.506 -10.989 -9.827  1.00 0.00 ? 104 MET A CE   2  
ATOM   1895  H  H    . MET A 1 40 ? -11.583 -6.954  -5.795  1.00 0.00 ? 104 MET A H    2  
ATOM   1896  H  HA   . MET A 1 40 ? -13.382 -9.180  -6.453  1.00 0.00 ? 104 MET A HA   2  
ATOM   1897  H  HB2  . MET A 1 40 ? -10.417 -8.859  -6.950  1.00 0.00 ? 104 MET A HB2  2  
ATOM   1898  H  HB3  . MET A 1 40 ? -11.374 -10.261 -7.411  1.00 0.00 ? 104 MET A HB3  2  
ATOM   1899  H  HG2  . MET A 1 40 ? -12.806 -8.582  -8.730  1.00 0.00 ? 104 MET A HG2  2  
ATOM   1900  H  HG3  . MET A 1 40 ? -11.438 -7.490  -8.531  1.00 0.00 ? 104 MET A HG3  2  
ATOM   1901  H  HE1  . MET A 1 40 ? -11.818 -11.350 -10.797 1.00 0.00 ? 104 MET A HE1  2  
ATOM   1902  H  HE2  . MET A 1 40 ? -10.713 -11.616 -9.447  1.00 0.00 ? 104 MET A HE2  2  
ATOM   1903  H  HE3  . MET A 1 40 ? -12.344 -11.015 -9.147  1.00 0.00 ? 104 MET A HE3  2  
ATOM   1904  N  N    . LYS A 1 41 ? -11.815 -8.927  -3.783  1.00 0.00 ? 105 LYS A N    2  
ATOM   1905  C  CA   . LYS A 1 41 ? -11.454 -9.545  -2.512  1.00 0.00 ? 105 LYS A CA   2  
ATOM   1906  C  C    . LYS A 1 41 ? -10.436 -10.661 -2.719  1.00 0.00 ? 105 LYS A C    2  
ATOM   1907  O  O    . LYS A 1 41 ? -10.459 -11.674 -2.018  1.00 0.00 ? 105 LYS A O    2  
ATOM   1908  C  CB   . LYS A 1 41 ? -12.701 -10.100 -1.819  1.00 0.00 ? 105 LYS A CB   2  
ATOM   1909  C  CG   . LYS A 1 41 ? -13.432 -11.152 -2.635  1.00 0.00 ? 105 LYS A CG   2  
ATOM   1910  C  CD   . LYS A 1 41 ? -14.682 -11.641 -1.921  1.00 0.00 ? 105 LYS A CD   2  
ATOM   1911  C  CE   . LYS A 1 41 ? -14.369 -12.787 -0.971  1.00 0.00 ? 105 LYS A CE   2  
ATOM   1912  N  NZ   . LYS A 1 41 ? -14.017 -12.298 0.390   1.00 0.00 ? 105 LYS A NZ   2  
ATOM   1913  H  H    . LYS A 1 41 ? -11.906 -7.952  -3.831  1.00 0.00 ? 105 LYS A H    2  
ATOM   1914  H  HA   . LYS A 1 41 ? -11.014 -8.784  -1.886  1.00 0.00 ? 105 LYS A HA   2  
ATOM   1915  H  HB2  . LYS A 1 41 ? -12.409 -10.542 -0.879  1.00 0.00 ? 105 LYS A HB2  2  
ATOM   1916  H  HB3  . LYS A 1 41 ? -13.384 -9.284  -1.628  1.00 0.00 ? 105 LYS A HB3  2  
ATOM   1917  H  HG2  . LYS A 1 41 ? -13.717 -10.725 -3.585  1.00 0.00 ? 105 LYS A HG2  2  
ATOM   1918  H  HG3  . LYS A 1 41 ? -12.771 -11.991 -2.799  1.00 0.00 ? 105 LYS A HG3  2  
ATOM   1919  H  HD2  . LYS A 1 41 ? -15.106 -10.825 -1.356  1.00 0.00 ? 105 LYS A HD2  2  
ATOM   1920  H  HD3  . LYS A 1 41 ? -15.397 -11.981 -2.658  1.00 0.00 ? 105 LYS A HD3  2  
ATOM   1921  H  HE2  . LYS A 1 41 ? -15.235 -13.427 -0.902  1.00 0.00 ? 105 LYS A HE2  2  
ATOM   1922  H  HE3  . LYS A 1 41 ? -13.537 -13.350 -1.369  1.00 0.00 ? 105 LYS A HE3  2  
ATOM   1923  H  HZ1  . LYS A 1 41 ? -14.733 -11.622 0.724   1.00 0.00 ? 105 LYS A HZ1  2  
ATOM   1924  H  HZ2  . LYS A 1 41 ? -13.091 -11.824 0.371   1.00 0.00 ? 105 LYS A HZ2  2  
ATOM   1925  H  HZ3  . LYS A 1 41 ? -13.971 -13.096 1.056   1.00 0.00 ? 105 LYS A HZ3  2  
ATOM   1926  N  N    . LEU A 1 42 ? -9.543  -10.470 -3.684  1.00 0.00 ? 106 LEU A N    2  
ATOM   1927  C  CA   . LEU A 1 42 ? -8.514  -11.460 -3.982  1.00 0.00 ? 106 LEU A CA   2  
ATOM   1928  C  C    . LEU A 1 42 ? -7.662  -11.748 -2.750  1.00 0.00 ? 106 LEU A C    2  
ATOM   1929  O  O    . LEU A 1 42 ? -7.118  -10.832 -2.134  1.00 0.00 ? 106 LEU A O    2  
ATOM   1930  C  CB   . LEU A 1 42 ? -7.627  -10.973 -5.128  1.00 0.00 ? 106 LEU A CB   2  
ATOM   1931  C  CG   . LEU A 1 42 ? -8.313  -10.808 -6.485  1.00 0.00 ? 106 LEU A CG   2  
ATOM   1932  C  CD1  . LEU A 1 42 ? -7.528  -9.849  -7.367  1.00 0.00 ? 106 LEU A CD1  2  
ATOM   1933  C  CD2  . LEU A 1 42 ? -8.470  -12.158 -7.171  1.00 0.00 ? 106 LEU A CD2  2  
ATOM   1934  H  H    . LEU A 1 42 ? -9.575  -9.643  -4.208  1.00 0.00 ? 106 LEU A H    2  
ATOM   1935  H  HA   . LEU A 1 42 ? -9.009  -12.372 -4.283  1.00 0.00 ? 106 LEU A HA   2  
ATOM   1936  H  HB2  . LEU A 1 42 ? -7.218  -10.015 -4.846  1.00 0.00 ? 106 LEU A HB2  2  
ATOM   1937  H  HB3  . LEU A 1 42 ? -6.822  -11.685 -5.248  1.00 0.00 ? 106 LEU A HB3  2  
ATOM   1938  H  HG   . LEU A 1 42 ? -9.299  -10.392 -6.334  1.00 0.00 ? 106 LEU A HG   2  
ATOM   1939  H  HD11 . LEU A 1 42 ? -6.482  -10.115 -7.347  1.00 0.00 ? 106 LEU A HD11 2  
ATOM   1940  H  HD12 . LEU A 1 42 ? -7.651  -8.841  -7.000  1.00 0.00 ? 106 LEU A HD12 2  
ATOM   1941  H  HD13 . LEU A 1 42 ? -7.896  -9.910  -8.381  1.00 0.00 ? 106 LEU A HD13 2  
ATOM   1942  H  HD21 . LEU A 1 42 ? -8.094  -12.095 -8.181  1.00 0.00 ? 106 LEU A HD21 2  
ATOM   1943  H  HD22 . LEU A 1 42 ? -9.515  -12.431 -7.191  1.00 0.00 ? 106 LEU A HD22 2  
ATOM   1944  H  HD23 . LEU A 1 42 ? -7.914  -12.906 -6.624  1.00 0.00 ? 106 LEU A HD23 2  
ATOM   1945  N  N    . GLU A 1 43 ? -7.549  -13.025 -2.400  1.00 0.00 ? 107 GLU A N    2  
ATOM   1946  C  CA   . GLU A 1 43 ? -6.761  -13.432 -1.242  1.00 0.00 ? 107 GLU A CA   2  
ATOM   1947  C  C    . GLU A 1 43 ? -5.380  -13.923 -1.669  1.00 0.00 ? 107 GLU A C    2  
ATOM   1948  O  O    . GLU A 1 43 ? -5.251  -14.693 -2.621  1.00 0.00 ? 107 GLU A O    2  
ATOM   1949  C  CB   . GLU A 1 43 ? -7.487  -14.531 -0.464  1.00 0.00 ? 107 GLU A CB   2  
ATOM   1950  C  CG   . GLU A 1 43 ? -6.886  -14.807 0.904   1.00 0.00 ? 107 GLU A CG   2  
ATOM   1951  C  CD   . GLU A 1 43 ? -7.224  -16.192 1.421   1.00 0.00 ? 107 GLU A CD   2  
ATOM   1952  O  OE1  . GLU A 1 43 ? -7.279  -17.134 0.604   1.00 0.00 ? 107 GLU A OE1  2  
ATOM   1953  O  OE2  . GLU A 1 43 ? -7.434  -16.332 2.645   1.00 0.00 ? 107 GLU A OE2  2  
ATOM   1954  H  H    . GLU A 1 43 ? -8.006  -13.709 -2.931  1.00 0.00 ? 107 GLU A H    2  
ATOM   1955  H  HA   . GLU A 1 43 ? -6.641  -12.570 -0.603  1.00 0.00 ? 107 GLU A HA   2  
ATOM   1956  H  HB2  . GLU A 1 43 ? -8.518  -14.239 -0.329  1.00 0.00 ? 107 GLU A HB2  2  
ATOM   1957  H  HB3  . GLU A 1 43 ? -7.453  -15.444 -1.039  1.00 0.00 ? 107 GLU A HB3  2  
ATOM   1958  H  HG2  . GLU A 1 43 ? -5.812  -14.718 0.836   1.00 0.00 ? 107 GLU A HG2  2  
ATOM   1959  H  HG3  . GLU A 1 43 ? -7.263  -14.075 1.603   1.00 0.00 ? 107 GLU A HG3  2  
ATOM   1960  N  N    . TYR A 1 44 ? -4.353  -13.471 -0.959  1.00 0.00 ? 108 TYR A N    2  
ATOM   1961  C  CA   . TYR A 1 44 ? -2.982  -13.862 -1.266  1.00 0.00 ? 108 TYR A CA   2  
ATOM   1962  C  C    . TYR A 1 44 ? -2.372  -14.658 -0.116  1.00 0.00 ? 108 TYR A C    2  
ATOM   1963  O  O    . TYR A 1 44 ? -2.937  -14.724 0.975   1.00 0.00 ? 108 TYR A O    2  
ATOM   1964  C  CB   . TYR A 1 44 ? -2.129  -12.625 -1.553  1.00 0.00 ? 108 TYR A CB   2  
ATOM   1965  C  CG   . TYR A 1 44 ? -2.653  -11.779 -2.692  1.00 0.00 ? 108 TYR A CG   2  
ATOM   1966  C  CD1  . TYR A 1 44 ? -2.853  -12.325 -3.954  1.00 0.00 ? 108 TYR A CD1  2  
ATOM   1967  C  CD2  . TYR A 1 44 ? -2.948  -10.434 -2.506  1.00 0.00 ? 108 TYR A CD2  2  
ATOM   1968  C  CE1  . TYR A 1 44 ? -3.331  -11.556 -4.997  1.00 0.00 ? 108 TYR A CE1  2  
ATOM   1969  C  CE2  . TYR A 1 44 ? -3.428  -9.658  -3.543  1.00 0.00 ? 108 TYR A CE2  2  
ATOM   1970  C  CZ   . TYR A 1 44 ? -3.617  -10.223 -4.787  1.00 0.00 ? 108 TYR A CZ   2  
ATOM   1971  O  OH   . TYR A 1 44 ? -4.094  -9.454  -5.823  1.00 0.00 ? 108 TYR A OH   2  
ATOM   1972  H  H    . TYR A 1 44 ? -4.519  -12.860 -0.212  1.00 0.00 ? 108 TYR A H    2  
ATOM   1973  H  HA   . TYR A 1 44 ? -3.003  -14.485 -2.148  1.00 0.00 ? 108 TYR A HA   2  
ATOM   1974  H  HB2  . TYR A 1 44 ? -2.096  -12.006 -0.670  1.00 0.00 ? 108 TYR A HB2  2  
ATOM   1975  H  HB3  . TYR A 1 44 ? -1.127  -12.938 -1.805  1.00 0.00 ? 108 TYR A HB3  2  
ATOM   1976  H  HD1  . TYR A 1 44 ? -2.629  -13.370 -4.115  1.00 0.00 ? 108 TYR A HD1  2  
ATOM   1977  H  HD2  . TYR A 1 44 ? -2.799  -9.994  -1.530  1.00 0.00 ? 108 TYR A HD2  2  
ATOM   1978  H  HE1  . TYR A 1 44 ? -3.480  -11.999 -5.971  1.00 0.00 ? 108 TYR A HE1  2  
ATOM   1979  H  HE2  . TYR A 1 44 ? -3.652  -8.614  -3.379  1.00 0.00 ? 108 TYR A HE2  2  
ATOM   1980  H  HH   . TYR A 1 44 ? -4.455  -10.026 -6.505  1.00 0.00 ? 108 TYR A HH   2  
ATOM   1981  N  N    . GLU A 1 45 ? -1.215  -15.260 -0.370  1.00 0.00 ? 109 GLU A N    2  
ATOM   1982  C  CA   . GLU A 1 45 ? -0.527  -16.052 0.643   1.00 0.00 ? 109 GLU A CA   2  
ATOM   1983  C  C    . GLU A 1 45 ? 0.430   -15.184 1.455   1.00 0.00 ? 109 GLU A C    2  
ATOM   1984  O  O    . GLU A 1 45 ? 1.237   -14.440 0.898   1.00 0.00 ? 109 GLU A O    2  
ATOM   1985  C  CB   . GLU A 1 45 ? 0.240   -17.203 -0.011  1.00 0.00 ? 109 GLU A CB   2  
ATOM   1986  C  CG   . GLU A 1 45 ? 1.138   -17.961 0.953   1.00 0.00 ? 109 GLU A CG   2  
ATOM   1987  C  CD   . GLU A 1 45 ? 1.895   -19.090 0.280   1.00 0.00 ? 109 GLU A CD   2  
ATOM   1988  O  OE1  . GLU A 1 45 ? 2.929   -18.809 -0.363  1.00 0.00 ? 109 GLU A OE1  2  
ATOM   1989  O  OE2  . GLU A 1 45 ? 1.453   -20.252 0.394   1.00 0.00 ? 109 GLU A OE2  2  
ATOM   1990  H  H    . GLU A 1 45 ? -0.814  -15.170 -1.260  1.00 0.00 ? 109 GLU A H    2  
ATOM   1991  H  HA   . GLU A 1 45 ? -1.274  -16.461 1.307   1.00 0.00 ? 109 GLU A HA   2  
ATOM   1992  H  HB2  . GLU A 1 45 ? -0.469  -17.899 -0.434  1.00 0.00 ? 109 GLU A HB2  2  
ATOM   1993  H  HB3  . GLU A 1 45 ? 0.855   -16.804 -0.804  1.00 0.00 ? 109 GLU A HB3  2  
ATOM   1994  H  HG2  . GLU A 1 45 ? 1.852   -17.272 1.377   1.00 0.00 ? 109 GLU A HG2  2  
ATOM   1995  H  HG3  . GLU A 1 45 ? 0.528   -18.377 1.741   1.00 0.00 ? 109 GLU A HG3  2  
ATOM   1996  N  N    . LYS A 1 46 ? 0.333   -15.285 2.777   1.00 0.00 ? 110 LYS A N    2  
ATOM   1997  C  CA   . LYS A 1 46 ? 1.189   -14.511 3.668   1.00 0.00 ? 110 LYS A CA   2  
ATOM   1998  C  C    . LYS A 1 46 ? 2.652   -14.621 3.248   1.00 0.00 ? 110 LYS A C    2  
ATOM   1999  O  O    . LYS A 1 46 ? 3.197   -15.720 3.141   1.00 0.00 ? 110 LYS A O    2  
ATOM   2000  C  CB   . LYS A 1 46 ? 1.024   -14.992 5.111   1.00 0.00 ? 110 LYS A CB   2  
ATOM   2001  C  CG   . LYS A 1 46 ? 1.472   -13.974 6.146   1.00 0.00 ? 110 LYS A CG   2  
ATOM   2002  C  CD   . LYS A 1 46 ? 1.670   -14.614 7.510   1.00 0.00 ? 110 LYS A CD   2  
ATOM   2003  C  CE   . LYS A 1 46 ? 2.210   -13.616 8.522   1.00 0.00 ? 110 LYS A CE   2  
ATOM   2004  N  NZ   . LYS A 1 46 ? 1.128   -12.771 9.099   1.00 0.00 ? 110 LYS A NZ   2  
ATOM   2005  H  H    . LYS A 1 46 ? -0.330  -15.896 3.162   1.00 0.00 ? 110 LYS A H    2  
ATOM   2006  H  HA   . LYS A 1 46 ? 0.886   -13.477 3.605   1.00 0.00 ? 110 LYS A HA   2  
ATOM   2007  H  HB2  . LYS A 1 46 ? -0.017  -15.218 5.286   1.00 0.00 ? 110 LYS A HB2  2  
ATOM   2008  H  HB3  . LYS A 1 46 ? 1.607   -15.891 5.247   1.00 0.00 ? 110 LYS A HB3  2  
ATOM   2009  H  HG2  . LYS A 1 46 ? 2.406   -13.536 5.827   1.00 0.00 ? 110 LYS A HG2  2  
ATOM   2010  H  HG3  . LYS A 1 46 ? 0.719   -13.202 6.227   1.00 0.00 ? 110 LYS A HG3  2  
ATOM   2011  H  HD2  . LYS A 1 46 ? 0.721   -14.990 7.863   1.00 0.00 ? 110 LYS A HD2  2  
ATOM   2012  H  HD3  . LYS A 1 46 ? 2.370   -15.432 7.415   1.00 0.00 ? 110 LYS A HD3  2  
ATOM   2013  H  HE2  . LYS A 1 46 ? 2.696   -14.158 9.319   1.00 0.00 ? 110 LYS A HE2  2  
ATOM   2014  H  HE3  . LYS A 1 46 ? 2.930   -12.978 8.029   1.00 0.00 ? 110 LYS A HE3  2  
ATOM   2015  H  HZ1  . LYS A 1 46 ? 1.523   -12.117 9.804   1.00 0.00 ? 110 LYS A HZ1  2  
ATOM   2016  H  HZ2  . LYS A 1 46 ? 0.414   -13.370 9.559   1.00 0.00 ? 110 LYS A HZ2  2  
ATOM   2017  H  HZ3  . LYS A 1 46 ? 0.668   -12.217 8.348   1.00 0.00 ? 110 LYS A HZ3  2  
ATOM   2018  N  N    . CYS A 1 47 ? 3.282   -13.475 3.013   1.00 0.00 ? 111 CYS A N    2  
ATOM   2019  C  CA   . CYS A 1 47 ? 4.682   -13.441 2.607   1.00 0.00 ? 111 CYS A CA   2  
ATOM   2020  C  C    . CYS A 1 47 ? 5.531   -12.707 3.640   1.00 0.00 ? 111 CYS A C    2  
ATOM   2021  O  O    . CYS A 1 47 ? 5.589   -11.478 3.649   1.00 0.00 ? 111 CYS A O    2  
ATOM   2022  C  CB   . CYS A 1 47 ? 4.822   -12.765 1.241   1.00 0.00 ? 111 CYS A CB   2  
ATOM   2023  S  SG   . CYS A 1 47 ? 6.480   -12.918 0.503   1.00 0.00 ? 111 CYS A SG   2  
ATOM   2024  H  H    . CYS A 1 47 ? 2.794   -12.630 3.116   1.00 0.00 ? 111 CYS A H    2  
ATOM   2025  H  HA   . CYS A 1 47 ? 5.030   -14.460 2.531   1.00 0.00 ? 111 CYS A HA   2  
ATOM   2026  H  HB2  . CYS A 1 47 ? 4.115   -13.208 0.555   1.00 0.00 ? 111 CYS A HB2  2  
ATOM   2027  H  HB3  . CYS A 1 47 ? 4.604   -11.713 1.345   1.00 0.00 ? 111 CYS A HB3  2  
ATOM   2028  N  N    . GLU A 1 48 ? 6.188   -13.469 4.508   1.00 0.00 ? 112 GLU A N    2  
ATOM   2029  C  CA   . GLU A 1 48 ? 7.034   -12.890 5.546   1.00 0.00 ? 112 GLU A CA   2  
ATOM   2030  C  C    . GLU A 1 48 ? 8.222   -12.156 4.932   1.00 0.00 ? 112 GLU A C    2  
ATOM   2031  O  O    . GLU A 1 48 ? 8.587   -11.066 5.374   1.00 0.00 ? 112 GLU A O    2  
ATOM   2032  C  CB   . GLU A 1 48 ? 7.531   -13.981 6.497   1.00 0.00 ? 112 GLU A CB   2  
ATOM   2033  C  CG   . GLU A 1 48 ? 6.411   -14.761 7.166   1.00 0.00 ? 112 GLU A CG   2  
ATOM   2034  C  CD   . GLU A 1 48 ? 6.812   -16.185 7.501   1.00 0.00 ? 112 GLU A CD   2  
ATOM   2035  O  OE1  . GLU A 1 48 ? 7.262   -16.906 6.586   1.00 0.00 ? 112 GLU A OE1  2  
ATOM   2036  O  OE2  . GLU A 1 48 ? 6.677   -16.577 8.679   1.00 0.00 ? 112 GLU A OE2  2  
ATOM   2037  H  H    . GLU A 1 48 ? 6.102   -14.444 4.450   1.00 0.00 ? 112 GLU A H    2  
ATOM   2038  H  HA   . GLU A 1 48 ? 6.438   -12.184 6.103   1.00 0.00 ? 112 GLU A HA   2  
ATOM   2039  H  HB2  . GLU A 1 48 ? 8.144   -14.675 5.942   1.00 0.00 ? 112 GLU A HB2  2  
ATOM   2040  H  HB3  . GLU A 1 48 ? 8.131   -13.522 7.268   1.00 0.00 ? 112 GLU A HB3  2  
ATOM   2041  H  HG2  . GLU A 1 48 ? 6.134   -14.257 8.080   1.00 0.00 ? 112 GLU A HG2  2  
ATOM   2042  H  HG3  . GLU A 1 48 ? 5.562   -14.789 6.500   1.00 0.00 ? 112 GLU A HG3  2  
ATOM   2043  N  N    . ARG A 1 49 ? 8.821   -12.760 3.912   1.00 0.00 ? 113 ARG A N    2  
ATOM   2044  C  CA   . ARG A 1 49 ? 9.969   -12.165 3.238   1.00 0.00 ? 113 ARG A CA   2  
ATOM   2045  C  C    . ARG A 1 49 ? 9.847   -10.645 3.196   1.00 0.00 ? 113 ARG A C    2  
ATOM   2046  O  O    . ARG A 1 49 ? 10.818  -9.927  3.434   1.00 0.00 ? 113 ARG A O    2  
ATOM   2047  C  CB   . ARG A 1 49 ? 10.096  -12.717 1.817   1.00 0.00 ? 113 ARG A CB   2  
ATOM   2048  C  CG   . ARG A 1 49 ? 10.570  -14.160 1.764   1.00 0.00 ? 113 ARG A CG   2  
ATOM   2049  C  CD   . ARG A 1 49 ? 10.679  -14.659 0.331   1.00 0.00 ? 113 ARG A CD   2  
ATOM   2050  N  NE   . ARG A 1 49 ? 9.369   -14.808 -0.298  1.00 0.00 ? 113 ARG A NE   2  
ATOM   2051  C  CZ   . ARG A 1 49 ? 8.575   -15.854 -0.101  1.00 0.00 ? 113 ARG A CZ   2  
ATOM   2052  N  NH1  . ARG A 1 49 ? 8.954   -16.837 0.704   1.00 0.00 ? 113 ARG A NH1  2  
ATOM   2053  N  NH2  . ARG A 1 49 ? 7.397   -15.918 -0.709  1.00 0.00 ? 113 ARG A NH2  2  
ATOM   2054  H  H    . ARG A 1 49 ? 8.484   -13.628 3.605   1.00 0.00 ? 113 ARG A H    2  
ATOM   2055  H  HA   . ARG A 1 49 ? 10.855  -12.428 3.797   1.00 0.00 ? 113 ARG A HA   2  
ATOM   2056  H  HB2  . ARG A 1 49 ? 9.132   -12.660 1.333   1.00 0.00 ? 113 ARG A HB2  2  
ATOM   2057  H  HB3  . ARG A 1 49 ? 10.801  -12.109 1.269   1.00 0.00 ? 113 ARG A HB3  2  
ATOM   2058  H  HG2  . ARG A 1 49 ? 11.541  -14.228 2.232   1.00 0.00 ? 113 ARG A HG2  2  
ATOM   2059  H  HG3  . ARG A 1 49 ? 9.866   -14.780 2.299   1.00 0.00 ? 113 ARG A HG3  2  
ATOM   2060  H  HD2  . ARG A 1 49 ? 11.262  -13.951 -0.239  1.00 0.00 ? 113 ARG A HD2  2  
ATOM   2061  H  HD3  . ARG A 1 49 ? 11.178  -15.616 0.335   1.00 0.00 ? 113 ARG A HD3  2  
ATOM   2062  H  HE   . ARG A 1 49 ? 9.068   -14.093 -0.896  1.00 0.00 ? 113 ARG A HE   2  
ATOM   2063  H  HH11 . ARG A 1 49 ? 9.841   -16.791 1.164   1.00 0.00 ? 113 ARG A HH11 2  
ATOM   2064  H  HH12 . ARG A 1 49 ? 8.354   -17.624 0.851   1.00 0.00 ? 113 ARG A HH12 2  
ATOM   2065  H  HH21 . ARG A 1 49 ? 7.107   -15.179 -1.316  1.00 0.00 ? 113 ARG A HH21 2  
ATOM   2066  H  HH22 . ARG A 1 49 ? 6.800   -16.706 -0.560  1.00 0.00 ? 113 ARG A HH22 2  
ATOM   2067  N  N    . SER A 1 50 ? 8.647   -10.161 2.890   1.00 0.00 ? 114 SER A N    2  
ATOM   2068  C  CA   . SER A 1 50 ? 8.398   -8.726  2.812   1.00 0.00 ? 114 SER A CA   2  
ATOM   2069  C  C    . SER A 1 50 ? 9.039   -8.131  1.562   1.00 0.00 ? 114 SER A C    2  
ATOM   2070  O  O    . SER A 1 50 ? 9.595   -7.033  1.598   1.00 0.00 ? 114 SER A O    2  
ATOM   2071  C  CB   . SER A 1 50 ? 8.939   -8.025  4.060   1.00 0.00 ? 114 SER A CB   2  
ATOM   2072  O  OG   . SER A 1 50 ? 8.398   -6.721  4.186   1.00 0.00 ? 114 SER A OG   2  
ATOM   2073  H  H    . SER A 1 50 ? 7.912   -10.785 2.710   1.00 0.00 ? 114 SER A H    2  
ATOM   2074  H  HA   . SER A 1 50 ? 7.330   -8.578  2.760   1.00 0.00 ? 114 SER A HA   2  
ATOM   2075  H  HB2  . SER A 1 50 ? 8.673   -8.598  4.935   1.00 0.00 ? 114 SER A HB2  2  
ATOM   2076  H  HB3  . SER A 1 50 ? 10.014  -7.951  3.990   1.00 0.00 ? 114 SER A HB3  2  
ATOM   2077  H  HG   . SER A 1 50 ? 8.665   -6.190  3.433   1.00 0.00 ? 114 SER A HG   2  
ATOM   2078  N  N    . CYS A 1 51 ? 8.958   -8.864  0.457   1.00 0.00 ? 115 CYS A N    2  
ATOM   2079  C  CA   . CYS A 1 51 ? 9.530   -8.411  -0.806  1.00 0.00 ? 115 CYS A CA   2  
ATOM   2080  C  C    . CYS A 1 51 ? 9.357   -6.904  -0.971  1.00 0.00 ? 115 CYS A C    2  
ATOM   2081  O  O    . CYS A 1 51 ? 8.388   -6.321  -0.485  1.00 0.00 ? 115 CYS A O    2  
ATOM   2082  C  CB   . CYS A 1 51 ? 8.874   -9.143  -1.978  1.00 0.00 ? 115 CYS A CB   2  
ATOM   2083  S  SG   . CYS A 1 51 ? 8.651   -10.931 -1.709  1.00 0.00 ? 115 CYS A SG   2  
ATOM   2084  H  H    . CYS A 1 51 ? 8.502   -9.732  0.491   1.00 0.00 ? 115 CYS A H    2  
ATOM   2085  H  HA   . CYS A 1 51 ? 10.584  -8.641  -0.794  1.00 0.00 ? 115 CYS A HA   2  
ATOM   2086  H  HB2  . CYS A 1 51 ? 7.898   -8.715  -2.159  1.00 0.00 ? 115 CYS A HB2  2  
ATOM   2087  H  HB3  . CYS A 1 51 ? 9.486   -9.016  -2.859  1.00 0.00 ? 115 CYS A HB3  2  
ATOM   2088  N  N    . LYS A 1 52 ? 10.304  -6.278  -1.662  1.00 0.00 ? 116 LYS A N    2  
ATOM   2089  C  CA   . LYS A 1 52 ? 10.258  -4.840  -1.894  1.00 0.00 ? 116 LYS A CA   2  
ATOM   2090  C  C    . LYS A 1 52 ? 9.808   -4.533  -3.319  1.00 0.00 ? 116 LYS A C    2  
ATOM   2091  O  O    . LYS A 1 52 ? 10.535  -4.792  -4.279  1.00 0.00 ? 116 LYS A O    2  
ATOM   2092  C  CB   . LYS A 1 52 ? 11.632  -4.216  -1.636  1.00 0.00 ? 116 LYS A CB   2  
ATOM   2093  C  CG   . LYS A 1 52 ? 11.872  -3.854  -0.181  1.00 0.00 ? 116 LYS A CG   2  
ATOM   2094  C  CD   . LYS A 1 52 ? 11.202  -2.540  0.184   1.00 0.00 ? 116 LYS A CD   2  
ATOM   2095  C  CE   . LYS A 1 52 ? 12.088  -1.350  -0.151  1.00 0.00 ? 116 LYS A CE   2  
ATOM   2096  N  NZ   . LYS A 1 52 ? 13.229  -1.224  0.798   1.00 0.00 ? 116 LYS A NZ   2  
ATOM   2097  H  H    . LYS A 1 52 ? 11.053  -6.798  -2.025  1.00 0.00 ? 116 LYS A H    2  
ATOM   2098  H  HA   . LYS A 1 52 ? 9.545   -4.415  -1.205  1.00 0.00 ? 116 LYS A HA   2  
ATOM   2099  H  HB2  . LYS A 1 52 ? 12.395  -4.917  -1.942  1.00 0.00 ? 116 LYS A HB2  2  
ATOM   2100  H  HB3  . LYS A 1 52 ? 11.723  -3.317  -2.229  1.00 0.00 ? 116 LYS A HB3  2  
ATOM   2101  H  HG2  . LYS A 1 52 ? 11.472  -4.636  0.446   1.00 0.00 ? 116 LYS A HG2  2  
ATOM   2102  H  HG3  . LYS A 1 52 ? 12.936  -3.764  -0.013  1.00 0.00 ? 116 LYS A HG3  2  
ATOM   2103  H  HD2  . LYS A 1 52 ? 10.277  -2.452  -0.367  1.00 0.00 ? 116 LYS A HD2  2  
ATOM   2104  H  HD3  . LYS A 1 52 ? 10.993  -2.535  1.245   1.00 0.00 ? 116 LYS A HD3  2  
ATOM   2105  H  HE2  . LYS A 1 52 ? 12.475  -1.476  -1.151  1.00 0.00 ? 116 LYS A HE2  2  
ATOM   2106  H  HE3  . LYS A 1 52 ? 11.492  -0.451  -0.106  1.00 0.00 ? 116 LYS A HE3  2  
ATOM   2107  H  HZ1  . LYS A 1 52 ? 13.905  -0.514  0.451   1.00 0.00 ? 116 LYS A HZ1  2  
ATOM   2108  H  HZ2  . LYS A 1 52 ? 13.718  -2.137  0.891   1.00 0.00 ? 116 LYS A HZ2  2  
ATOM   2109  H  HZ3  . LYS A 1 52 ? 12.885  -0.931  1.734   1.00 0.00 ? 116 LYS A HZ3  2  
ATOM   2110  N  N    . ILE A 1 53 ? 8.608   -3.979  -3.449  1.00 0.00 ? 117 ILE A N    2  
ATOM   2111  C  CA   . ILE A 1 53 ? 8.063   -3.635  -4.757  1.00 0.00 ? 117 ILE A CA   2  
ATOM   2112  C  C    . ILE A 1 53 ? 8.901   -2.556  -5.434  1.00 0.00 ? 117 ILE A C    2  
ATOM   2113  O  O    . ILE A 1 53 ? 8.870   -1.392  -5.038  1.00 0.00 ? 117 ILE A O    2  
ATOM   2114  C  CB   . ILE A 1 53 ? 6.607   -3.146  -4.649  1.00 0.00 ? 117 ILE A CB   2  
ATOM   2115  C  CG1  . ILE A 1 53 ? 5.764   -4.152  -3.863  1.00 0.00 ? 117 ILE A CG1  2  
ATOM   2116  C  CG2  . ILE A 1 53 ? 6.019   -2.923  -6.035  1.00 0.00 ? 117 ILE A CG2  2  
ATOM   2117  C  CD1  . ILE A 1 53 ? 5.398   -5.386  -4.658  1.00 0.00 ? 117 ILE A CD1  2  
ATOM   2118  H  H    . ILE A 1 53 ? 8.076   -3.797  -2.647  1.00 0.00 ? 117 ILE A H    2  
ATOM   2119  H  HA   . ILE A 1 53 ? 8.078   -4.525  -5.368  1.00 0.00 ? 117 ILE A HA   2  
ATOM   2120  H  HB   . ILE A 1 53 ? 6.606   -2.201  -4.128  1.00 0.00 ? 117 ILE A HB   2  
ATOM   2121  H  HG12 . ILE A 1 53 ? 6.315   -4.471  -2.992  1.00 0.00 ? 117 ILE A HG12 2  
ATOM   2122  H  HG13 . ILE A 1 53 ? 4.847   -3.675  -3.548  1.00 0.00 ? 117 ILE A HG13 2  
ATOM   2123  H  HG21 . ILE A 1 53 ? 6.192   -1.901  -6.338  1.00 0.00 ? 117 ILE A HG21 2  
ATOM   2124  H  HG22 . ILE A 1 53 ? 6.493   -3.591  -6.738  1.00 0.00 ? 117 ILE A HG22 2  
ATOM   2125  H  HG23 . ILE A 1 53 ? 4.958   -3.117  -6.011  1.00 0.00 ? 117 ILE A HG23 2  
ATOM   2126  H  HD11 . ILE A 1 53 ? 6.229   -5.666  -5.290  1.00 0.00 ? 117 ILE A HD11 2  
ATOM   2127  H  HD12 . ILE A 1 53 ? 5.172   -6.197  -3.982  1.00 0.00 ? 117 ILE A HD12 2  
ATOM   2128  H  HD13 . ILE A 1 53 ? 4.535   -5.176  -5.272  1.00 0.00 ? 117 ILE A HD13 2  
ATOM   2129  N  N    . GLN A 1 54 ? 9.649   -2.953  -6.460  1.00 0.00 ? 118 GLN A N    2  
ATOM   2130  C  CA   . GLN A 1 54 ? 10.494  -2.019  -7.194  1.00 0.00 ? 118 GLN A CA   2  
ATOM   2131  C  C    . GLN A 1 54 ? 9.960   -1.793  -8.604  1.00 0.00 ? 118 GLN A C    2  
ATOM   2132  O  O    . GLN A 1 54 ? 9.106   -2.539  -9.083  1.00 0.00 ? 118 GLN A O    2  
ATOM   2133  C  CB   . GLN A 1 54 ? 11.931  -2.541  -7.258  1.00 0.00 ? 118 GLN A CB   2  
ATOM   2134  C  CG   . GLN A 1 54 ? 12.781  -2.130  -6.067  1.00 0.00 ? 118 GLN A CG   2  
ATOM   2135  C  CD   . GLN A 1 54 ? 12.695  -0.645  -5.772  1.00 0.00 ? 118 GLN A CD   2  
ATOM   2136  O  OE1  . GLN A 1 54 ? 13.305  0.172   -6.461  1.00 0.00 ? 118 GLN A OE1  2  
ATOM   2137  N  NE2  . GLN A 1 54 ? 11.934  -0.289  -4.744  1.00 0.00 ? 118 GLN A NE2  2  
ATOM   2138  H  H    . GLN A 1 54 ? 9.631   -3.894  -6.728  1.00 0.00 ? 118 GLN A H    2  
ATOM   2139  H  HA   . GLN A 1 54 ? 10.486  -1.078  -6.664  1.00 0.00 ? 118 GLN A HA   2  
ATOM   2140  H  HB2  . GLN A 1 54 ? 11.907  -3.620  -7.302  1.00 0.00 ? 118 GLN A HB2  2  
ATOM   2141  H  HB3  . GLN A 1 54 ? 12.399  -2.162  -8.154  1.00 0.00 ? 118 GLN A HB3  2  
ATOM   2142  H  HG2  . GLN A 1 54 ? 12.445  -2.674  -5.196  1.00 0.00 ? 118 GLN A HG2  2  
ATOM   2143  H  HG3  . GLN A 1 54 ? 13.811  -2.382  -6.272  1.00 0.00 ? 118 GLN A HG3  2  
ATOM   2144  H  HE21 . GLN A 1 54 ? 11.478  -0.995  -4.239  1.00 0.00 ? 118 GLN A HE21 2  
ATOM   2145  H  HE22 . GLN A 1 54 ? 11.860  0.664   -4.531  1.00 0.00 ? 118 GLN A HE22 2  
ATOM   2146  N  N    . LYS A 1 55 ? 10.467  -0.758  -9.265  1.00 0.00 ? 119 LYS A N    2  
ATOM   2147  C  CA   . LYS A 1 55 ? 10.042  -0.433  -10.621 1.00 0.00 ? 119 LYS A CA   2  
ATOM   2148  C  C    . LYS A 1 55 ? 10.340  -1.585  -11.576 1.00 0.00 ? 119 LYS A C    2  
ATOM   2149  O  O    . LYS A 1 55 ? 9.470   -2.022  -12.329 1.00 0.00 ? 119 LYS A O    2  
ATOM   2150  C  CB   . LYS A 1 55 ? 10.741  0.839   -11.106 1.00 0.00 ? 119 LYS A CB   2  
ATOM   2151  C  CG   . LYS A 1 55 ? 10.438  1.186   -12.553 1.00 0.00 ? 119 LYS A CG   2  
ATOM   2152  C  CD   . LYS A 1 55 ? 10.963  2.565   -12.918 1.00 0.00 ? 119 LYS A CD   2  
ATOM   2153  C  CE   . LYS A 1 55 ? 12.450  2.528   -13.236 1.00 0.00 ? 119 LYS A CE   2  
ATOM   2154  N  NZ   . LYS A 1 55 ? 12.717  1.931   -14.574 1.00 0.00 ? 119 LYS A NZ   2  
ATOM   2155  H  H    . LYS A 1 55 ? 11.145  -0.199  -8.830  1.00 0.00 ? 119 LYS A H    2  
ATOM   2156  H  HA   . LYS A 1 55 ? 8.976   -0.263  -10.603 1.00 0.00 ? 119 LYS A HA   2  
ATOM   2157  H  HB2  . LYS A 1 55 ? 10.428  1.666   -10.486 1.00 0.00 ? 119 LYS A HB2  2  
ATOM   2158  H  HB3  . LYS A 1 55 ? 11.809  0.709   -11.005 1.00 0.00 ? 119 LYS A HB3  2  
ATOM   2159  H  HG2  . LYS A 1 55 ? 10.905  0.454   -13.195 1.00 0.00 ? 119 LYS A HG2  2  
ATOM   2160  H  HG3  . LYS A 1 55 ? 9.368   1.167   -12.702 1.00 0.00 ? 119 LYS A HG3  2  
ATOM   2161  H  HD2  . LYS A 1 55 ? 10.430  2.926   -13.785 1.00 0.00 ? 119 LYS A HD2  2  
ATOM   2162  H  HD3  . LYS A 1 55 ? 10.798  3.235   -12.086 1.00 0.00 ? 119 LYS A HD3  2  
ATOM   2163  H  HE2  . LYS A 1 55 ? 12.833  3.537   -13.219 1.00 0.00 ? 119 LYS A HE2  2  
ATOM   2164  H  HE3  . LYS A 1 55 ? 12.952  1.940   -12.482 1.00 0.00 ? 119 LYS A HE3  2  
ATOM   2165  H  HZ1  . LYS A 1 55 ? 13.605  2.308   -14.963 1.00 0.00 ? 119 LYS A HZ1  2  
ATOM   2166  H  HZ2  . LYS A 1 55 ? 11.940  2.159   -15.228 1.00 0.00 ? 119 LYS A HZ2  2  
ATOM   2167  H  HZ3  . LYS A 1 55 ? 12.796  0.898   -14.495 1.00 0.00 ? 119 LYS A HZ3  2  
ATOM   2168  N  N    . LYS A 1 56 ? 11.575  -2.074  -11.538 1.00 0.00 ? 120 LYS A N    2  
ATOM   2169  C  CA   . LYS A 1 56 ? 11.988  -3.177  -12.397 1.00 0.00 ? 120 LYS A CA   2  
ATOM   2170  C  C    . LYS A 1 56 ? 11.123  -4.409  -12.154 1.00 0.00 ? 120 LYS A C    2  
ATOM   2171  O  O    . LYS A 1 56 ? 10.598  -5.006  -13.093 1.00 0.00 ? 120 LYS A O    2  
ATOM   2172  C  CB   . LYS A 1 56 ? 13.460  -3.517  -12.153 1.00 0.00 ? 120 LYS A CB   2  
ATOM   2173  C  CG   . LYS A 1 56 ? 14.419  -2.431  -12.607 1.00 0.00 ? 120 LYS A CG   2  
ATOM   2174  C  CD   . LYS A 1 56 ? 14.588  -2.432  -14.117 1.00 0.00 ? 120 LYS A CD   2  
ATOM   2175  C  CE   . LYS A 1 56 ? 15.849  -1.693  -14.537 1.00 0.00 ? 120 LYS A CE   2  
ATOM   2176  N  NZ   . LYS A 1 56 ? 15.629  -0.222  -14.617 1.00 0.00 ? 120 LYS A NZ   2  
ATOM   2177  H  H    . LYS A 1 56 ? 12.225  -1.683  -10.916 1.00 0.00 ? 120 LYS A H    2  
ATOM   2178  H  HA   . LYS A 1 56 ? 11.865  -2.863  -13.423 1.00 0.00 ? 120 LYS A HA   2  
ATOM   2179  H  HB2  . LYS A 1 56 ? 13.608  -3.680  -11.095 1.00 0.00 ? 120 LYS A HB2  2  
ATOM   2180  H  HB3  . LYS A 1 56 ? 13.700  -4.426  -12.686 1.00 0.00 ? 120 LYS A HB3  2  
ATOM   2181  H  HG2  . LYS A 1 56 ? 14.032  -1.470  -12.300 1.00 0.00 ? 120 LYS A HG2  2  
ATOM   2182  H  HG3  . LYS A 1 56 ? 15.382  -2.597  -12.146 1.00 0.00 ? 120 LYS A HG3  2  
ATOM   2183  H  HD2  . LYS A 1 56 ? 14.651  -3.453  -14.463 1.00 0.00 ? 120 LYS A HD2  2  
ATOM   2184  H  HD3  . LYS A 1 56 ? 13.732  -1.950  -14.567 1.00 0.00 ? 120 LYS A HD3  2  
ATOM   2185  H  HE2  . LYS A 1 56 ? 16.626  -1.893  -13.816 1.00 0.00 ? 120 LYS A HE2  2  
ATOM   2186  H  HE3  . LYS A 1 56 ? 16.157  -2.055  -15.507 1.00 0.00 ? 120 LYS A HE3  2  
ATOM   2187  H  HZ1  . LYS A 1 56 ? 16.535  0.268   -14.763 1.00 0.00 ? 120 LYS A HZ1  2  
ATOM   2188  H  HZ2  . LYS A 1 56 ? 15.199  0.123   -13.735 1.00 0.00 ? 120 LYS A HZ2  2  
ATOM   2189  H  HZ3  . LYS A 1 56 ? 14.995  0.002   -15.409 1.00 0.00 ? 120 LYS A HZ3  2  
ATOM   2190  N  N    . ASN A 1 57 ? 10.979  -4.785  -10.887 1.00 0.00 ? 121 ASN A N    2  
ATOM   2191  C  CA   . ASN A 1 57 ? 10.177  -5.946  -10.520 1.00 0.00 ? 121 ASN A CA   2  
ATOM   2192  C  C    . ASN A 1 57 ? 8.995   -5.537  -9.646  1.00 0.00 ? 121 ASN A C    2  
ATOM   2193  O  O    . ASN A 1 57 ? 9.038   -5.676  -8.423  1.00 0.00 ? 121 ASN A O    2  
ATOM   2194  C  CB   . ASN A 1 57 ? 11.038  -6.976  -9.786  1.00 0.00 ? 121 ASN A CB   2  
ATOM   2195  C  CG   . ASN A 1 57 ? 11.994  -7.698  -10.715 1.00 0.00 ? 121 ASN A CG   2  
ATOM   2196  O  OD1  . ASN A 1 57 ? 11.581  -8.284  -11.715 1.00 0.00 ? 121 ASN A OD1  2  
ATOM   2197  N  ND2  . ASN A 1 57 ? 13.280  -7.659  -10.386 1.00 0.00 ? 121 ASN A ND2  2  
ATOM   2198  H  H    . ASN A 1 57 ? 11.423  -4.269  -10.182 1.00 0.00 ? 121 ASN A H    2  
ATOM   2199  H  HA   . ASN A 1 57 ? 9.800   -6.389  -11.430 1.00 0.00 ? 121 ASN A HA   2  
ATOM   2200  H  HB2  . ASN A 1 57 ? 11.616  -6.474  -9.024  1.00 0.00 ? 121 ASN A HB2  2  
ATOM   2201  H  HB3  . ASN A 1 57 ? 10.395  -7.707  -9.320  1.00 0.00 ? 121 ASN A HB3  2  
ATOM   2202  H  HD21 . ASN A 1 57 ? 13.537  -7.173  -9.574  1.00 0.00 ? 121 ASN A HD21 2  
ATOM   2203  H  HD22 . ASN A 1 57 ? 13.921  -8.117  -10.970 1.00 0.00 ? 121 ASN A HD22 2  
ATOM   2204  N  N    . ARG A 1 58 ? 7.943   -5.033  -10.281 1.00 0.00 ? 122 ARG A N    2  
ATOM   2205  C  CA   . ARG A 1 58 ? 6.750   -4.603  -9.561  1.00 0.00 ? 122 ARG A CA   2  
ATOM   2206  C  C    . ARG A 1 58 ? 5.769   -5.760  -9.394  1.00 0.00 ? 122 ARG A C    2  
ATOM   2207  O  O    . ARG A 1 58 ? 5.167   -5.929  -8.334  1.00 0.00 ? 122 ARG A O    2  
ATOM   2208  C  CB   . ARG A 1 58 ? 6.072   -3.447  -10.298 1.00 0.00 ? 122 ARG A CB   2  
ATOM   2209  C  CG   . ARG A 1 58 ? 5.817   -3.730  -11.770 1.00 0.00 ? 122 ARG A CG   2  
ATOM   2210  C  CD   . ARG A 1 58 ? 5.074   -2.583  -12.437 1.00 0.00 ? 122 ARG A CD   2  
ATOM   2211  N  NE   . ARG A 1 58 ? 4.673   -2.912  -13.803 1.00 0.00 ? 122 ARG A NE   2  
ATOM   2212  C  CZ   . ARG A 1 58 ? 4.193   -2.020  -14.662 1.00 0.00 ? 122 ARG A CZ   2  
ATOM   2213  N  NH1  . ARG A 1 58 ? 4.055   -0.752  -14.300 1.00 0.00 ? 122 ARG A NH1  2  
ATOM   2214  N  NH2  . ARG A 1 58 ? 3.850   -2.396  -15.888 1.00 0.00 ? 122 ARG A NH2  2  
ATOM   2215  H  H    . ARG A 1 58 ? 7.969   -4.947  -11.256 1.00 0.00 ? 122 ARG A H    2  
ATOM   2216  H  HA   . ARG A 1 58 ? 7.057   -4.263  -8.583  1.00 0.00 ? 122 ARG A HA   2  
ATOM   2217  H  HB2  . ARG A 1 58 ? 5.123   -3.241  -9.825  1.00 0.00 ? 122 ARG A HB2  2  
ATOM   2218  H  HB3  . ARG A 1 58 ? 6.699   -2.572  -10.226 1.00 0.00 ? 122 ARG A HB3  2  
ATOM   2219  H  HG2  . ARG A 1 58 ? 6.765   -3.869  -12.269 1.00 0.00 ? 122 ARG A HG2  2  
ATOM   2220  H  HG3  . ARG A 1 58 ? 5.226   -4.630  -11.857 1.00 0.00 ? 122 ARG A HG3  2  
ATOM   2221  H  HD2  . ARG A 1 58 ? 4.192   -2.358  -11.858 1.00 0.00 ? 122 ARG A HD2  2  
ATOM   2222  H  HD3  . ARG A 1 58 ? 5.720   -1.718  -12.460 1.00 0.00 ? 122 ARG A HD3  2  
ATOM   2223  H  HE   . ARG A 1 58 ? 4.767   -3.843  -14.092 1.00 0.00 ? 122 ARG A HE   2  
ATOM   2224  H  HH11 . ARG A 1 58 ? 4.313   -0.466  -13.377 1.00 0.00 ? 122 ARG A HH11 2  
ATOM   2225  H  HH12 . ARG A 1 58 ? 3.694   -0.083  -14.949 1.00 0.00 ? 122 ARG A HH12 2  
ATOM   2226  H  HH21 . ARG A 1 58 ? 3.953   -3.351  -16.165 1.00 0.00 ? 122 ARG A HH21 2  
ATOM   2227  H  HH22 . ARG A 1 58 ? 3.488   -1.725  -16.534 1.00 0.00 ? 122 ARG A HH22 2  
ATOM   2228  N  N    . ASN A 1 59 ? 5.613   -6.554  -10.449 1.00 0.00 ? 123 ASN A N    2  
ATOM   2229  C  CA   . ASN A 1 59 ? 4.705   -7.694  -10.420 1.00 0.00 ? 123 ASN A CA   2  
ATOM   2230  C  C    . ASN A 1 59 ? 5.418   -8.945  -9.914  1.00 0.00 ? 123 ASN A C    2  
ATOM   2231  O  O    . ASN A 1 59 ? 5.203   -10.045 -10.423 1.00 0.00 ? 123 ASN A O    2  
ATOM   2232  C  CB   . ASN A 1 59 ? 4.130   -7.950  -11.814 1.00 0.00 ? 123 ASN A CB   2  
ATOM   2233  C  CG   . ASN A 1 59 ? 3.439   -6.728  -12.388 1.00 0.00 ? 123 ASN A CG   2  
ATOM   2234  O  OD1  . ASN A 1 59 ? 3.109   -5.790  -11.662 1.00 0.00 ? 123 ASN A OD1  2  
ATOM   2235  N  ND2  . ASN A 1 59 ? 3.215   -6.735  -13.697 1.00 0.00 ? 123 ASN A ND2  2  
ATOM   2236  H  H    . ASN A 1 59 ? 6.121   -6.368  -11.266 1.00 0.00 ? 123 ASN A H    2  
ATOM   2237  H  HA   . ASN A 1 59 ? 3.897   -7.457  -9.745  1.00 0.00 ? 123 ASN A HA   2  
ATOM   2238  H  HB2  . ASN A 1 59 ? 4.931   -8.233  -12.481 1.00 0.00 ? 123 ASN A HB2  2  
ATOM   2239  H  HB3  . ASN A 1 59 ? 3.412   -8.755  -11.759 1.00 0.00 ? 123 ASN A HB3  2  
ATOM   2240  H  HD21 . ASN A 1 59 ? 3.505   -7.517  -14.212 1.00 0.00 ? 123 ASN A HD21 2  
ATOM   2241  H  HD22 . ASN A 1 59 ? 2.770   -5.957  -14.094 1.00 0.00 ? 123 ASN A HD22 2  
ATOM   2242  N  N    . LYS A 1 60 ? 6.267   -8.769  -8.907  1.00 0.00 ? 124 LYS A N    2  
ATOM   2243  C  CA   . LYS A 1 60 ? 7.011   -9.882  -8.329  1.00 0.00 ? 124 LYS A CA   2  
ATOM   2244  C  C    . LYS A 1 60 ? 6.158   -10.639 -7.316  1.00 0.00 ? 124 LYS A C    2  
ATOM   2245  O  O    . LYS A 1 60 ? 5.812   -11.801 -7.526  1.00 0.00 ? 124 LYS A O    2  
ATOM   2246  C  CB   . LYS A 1 60 ? 8.289   -9.374  -7.658  1.00 0.00 ? 124 LYS A CB   2  
ATOM   2247  C  CG   . LYS A 1 60 ? 9.256   -10.481 -7.275  1.00 0.00 ? 124 LYS A CG   2  
ATOM   2248  C  CD   . LYS A 1 60 ? 9.802   -11.193 -8.501  1.00 0.00 ? 124 LYS A CD   2  
ATOM   2249  C  CE   . LYS A 1 60 ? 11.042  -12.008 -8.166  1.00 0.00 ? 124 LYS A CE   2  
ATOM   2250  N  NZ   . LYS A 1 60 ? 11.412  -12.935 -9.271  1.00 0.00 ? 124 LYS A NZ   2  
ATOM   2251  H  H    . LYS A 1 60 ? 6.396   -7.867  -8.543  1.00 0.00 ? 124 LYS A H    2  
ATOM   2252  H  HA   . LYS A 1 60 ? 7.277   -10.554 -9.131  1.00 0.00 ? 124 LYS A HA   2  
ATOM   2253  H  HB2  . LYS A 1 60 ? 8.794   -8.702  -8.336  1.00 0.00 ? 124 LYS A HB2  2  
ATOM   2254  H  HB3  . LYS A 1 60 ? 8.020   -8.833  -6.762  1.00 0.00 ? 124 LYS A HB3  2  
ATOM   2255  H  HG2  . LYS A 1 60 ? 10.079  -10.053 -6.724  1.00 0.00 ? 124 LYS A HG2  2  
ATOM   2256  H  HG3  . LYS A 1 60 ? 8.739   -11.199 -6.654  1.00 0.00 ? 124 LYS A HG3  2  
ATOM   2257  H  HD2  . LYS A 1 60 ? 9.044   -11.856 -8.890  1.00 0.00 ? 124 LYS A HD2  2  
ATOM   2258  H  HD3  . LYS A 1 60 ? 10.058  -10.457 -9.250  1.00 0.00 ? 124 LYS A HD3  2  
ATOM   2259  H  HE2  . LYS A 1 60 ? 11.863  -11.332 -7.984  1.00 0.00 ? 124 LYS A HE2  2  
ATOM   2260  H  HE3  . LYS A 1 60 ? 10.847  -12.585 -7.274  1.00 0.00 ? 124 LYS A HE3  2  
ATOM   2261  H  HZ1  . LYS A 1 60 ? 10.879  -12.697 -10.131 1.00 0.00 ? 124 LYS A HZ1  2  
ATOM   2262  H  HZ2  . LYS A 1 60 ? 11.197  -13.916 -9.002  1.00 0.00 ? 124 LYS A HZ2  2  
ATOM   2263  H  HZ3  . LYS A 1 60 ? 12.429  -12.859 -9.475  1.00 0.00 ? 124 LYS A HZ3  2  
ATOM   2264  N  N    . CYS A 1 61 ? 5.821   -9.971  -6.217  1.00 0.00 ? 125 CYS A N    2  
ATOM   2265  C  CA   . CYS A 1 61 ? 5.008   -10.580 -5.172  1.00 0.00 ? 125 CYS A CA   2  
ATOM   2266  C  C    . CYS A 1 61 ? 3.638   -9.913  -5.091  1.00 0.00 ? 125 CYS A C    2  
ATOM   2267  O  O    . CYS A 1 61 ? 3.534   -8.687  -5.064  1.00 0.00 ? 125 CYS A O    2  
ATOM   2268  C  CB   . CYS A 1 61 ? 5.718   -10.477 -3.820  1.00 0.00 ? 125 CYS A CB   2  
ATOM   2269  S  SG   . CYS A 1 61 ? 4.961   -11.485 -2.505  1.00 0.00 ? 125 CYS A SG   2  
ATOM   2270  H  H    . CYS A 1 61 ? 6.128   -9.046  -6.107  1.00 0.00 ? 125 CYS A H    2  
ATOM   2271  H  HA   . CYS A 1 61 ? 4.874   -11.622 -5.419  1.00 0.00 ? 125 CYS A HA   2  
ATOM   2272  H  HB2  . CYS A 1 61 ? 6.742   -10.803 -3.934  1.00 0.00 ? 125 CYS A HB2  2  
ATOM   2273  H  HB3  . CYS A 1 61 ? 5.707   -9.448  -3.494  1.00 0.00 ? 125 CYS A HB3  2  
ATOM   2274  N  N    . GLN A 1 62 ? 2.590   -10.730 -5.052  1.00 0.00 ? 126 GLN A N    2  
ATOM   2275  C  CA   . GLN A 1 62 ? 1.227   -10.219 -4.975  1.00 0.00 ? 126 GLN A CA   2  
ATOM   2276  C  C    . GLN A 1 62 ? 0.893   -9.770  -3.556  1.00 0.00 ? 126 GLN A C    2  
ATOM   2277  O  O    . GLN A 1 62 ? 0.484   -8.630  -3.334  1.00 0.00 ? 126 GLN A O    2  
ATOM   2278  C  CB   . GLN A 1 62 ? 0.232   -11.288 -5.431  1.00 0.00 ? 126 GLN A CB   2  
ATOM   2279  C  CG   . GLN A 1 62 ? 0.134   -11.421 -6.943  1.00 0.00 ? 126 GLN A CG   2  
ATOM   2280  C  CD   . GLN A 1 62 ? -0.891  -12.453 -7.372  1.00 0.00 ? 126 GLN A CD   2  
ATOM   2281  O  OE1  . GLN A 1 62 ? -1.973  -12.109 -7.848  1.00 0.00 ? 126 GLN A OE1  2  
ATOM   2282  N  NE2  . GLN A 1 62 ? -0.555  -13.726 -7.206  1.00 0.00 ? 126 GLN A NE2  2  
ATOM   2283  H  H    . GLN A 1 62 ? 2.737   -11.698 -5.076  1.00 0.00 ? 126 GLN A H    2  
ATOM   2284  H  HA   . GLN A 1 62 ? 1.154   -9.368  -5.634  1.00 0.00 ? 126 GLN A HA   2  
ATOM   2285  H  HB2  . GLN A 1 62 ? 0.536   -12.242 -5.026  1.00 0.00 ? 126 GLN A HB2  2  
ATOM   2286  H  HB3  . GLN A 1 62 ? -0.747  -11.039 -5.049  1.00 0.00 ? 126 GLN A HB3  2  
ATOM   2287  H  HG2  . GLN A 1 62 ? -0.146  -10.464 -7.358  1.00 0.00 ? 126 GLN A HG2  2  
ATOM   2288  H  HG3  . GLN A 1 62 ? 1.099   -11.712 -7.329  1.00 0.00 ? 126 GLN A HG3  2  
ATOM   2289  H  HE21 . GLN A 1 62 ? 0.324   -13.926 -6.819  1.00 0.00 ? 126 GLN A HE21 2  
ATOM   2290  H  HE22 . GLN A 1 62 ? -1.198  -14.414 -7.474  1.00 0.00 ? 126 GLN A HE22 2  
ATOM   2291  N  N    . TYR A 1 63 ? 1.069   -10.674 -2.598  1.00 0.00 ? 127 TYR A N    2  
ATOM   2292  C  CA   . TYR A 1 63 ? 0.784   -10.372 -1.201  1.00 0.00 ? 127 TYR A CA   2  
ATOM   2293  C  C    . TYR A 1 63 ? 1.458   -9.071  -0.776  1.00 0.00 ? 127 TYR A C    2  
ATOM   2294  O  O    . TYR A 1 63 ? 0.790   -8.085  -0.464  1.00 0.00 ? 127 TYR A O    2  
ATOM   2295  C  CB   . TYR A 1 63 ? 1.253   -11.519 -0.303  1.00 0.00 ? 127 TYR A CB   2  
ATOM   2296  C  CG   . TYR A 1 63 ? 0.766   -11.409 1.124   1.00 0.00 ? 127 TYR A CG   2  
ATOM   2297  C  CD1  . TYR A 1 63 ? 1.458   -10.649 2.058   1.00 0.00 ? 127 TYR A CD1  2  
ATOM   2298  C  CD2  . TYR A 1 63 ? -0.385  -12.067 1.538   1.00 0.00 ? 127 TYR A CD2  2  
ATOM   2299  C  CE1  . TYR A 1 63 ? 1.018   -10.546 3.363   1.00 0.00 ? 127 TYR A CE1  2  
ATOM   2300  C  CE2  . TYR A 1 63 ? -0.834  -11.969 2.841   1.00 0.00 ? 127 TYR A CE2  2  
ATOM   2301  C  CZ   . TYR A 1 63 ? -0.129  -11.207 3.750   1.00 0.00 ? 127 TYR A CZ   2  
ATOM   2302  O  OH   . TYR A 1 63 ? -0.572  -11.108 5.049   1.00 0.00 ? 127 TYR A OH   2  
ATOM   2303  H  H    . TYR A 1 63 ? 1.398   -11.566 -2.837  1.00 0.00 ? 127 TYR A H    2  
ATOM   2304  H  HA   . TYR A 1 63 ? -0.285  -10.261 -1.097  1.00 0.00 ? 127 TYR A HA   2  
ATOM   2305  H  HB2  . TYR A 1 63 ? 0.892   -12.453 -0.706  1.00 0.00 ? 127 TYR A HB2  2  
ATOM   2306  H  HB3  . TYR A 1 63 ? 2.333   -11.535 -0.285  1.00 0.00 ? 127 TYR A HB3  2  
ATOM   2307  H  HD1  . TYR A 1 63 ? 2.356   -10.131 1.752   1.00 0.00 ? 127 TYR A HD1  2  
ATOM   2308  H  HD2  . TYR A 1 63 ? -0.935  -12.663 0.824   1.00 0.00 ? 127 TYR A HD2  2  
ATOM   2309  H  HE1  . TYR A 1 63 ? 1.569   -9.950  4.075   1.00 0.00 ? 127 TYR A HE1  2  
ATOM   2310  H  HE2  . TYR A 1 63 ? -1.732  -12.487 3.144   1.00 0.00 ? 127 TYR A HE2  2  
ATOM   2311  H  HH   . TYR A 1 63 ? -0.230  -10.302 5.443   1.00 0.00 ? 127 TYR A HH   2  
ATOM   2312  N  N    . CYS A 1 64 ? 2.787   -9.077  -0.766  1.00 0.00 ? 128 CYS A N    2  
ATOM   2313  C  CA   . CYS A 1 64 ? 3.554   -7.898  -0.380  1.00 0.00 ? 128 CYS A CA   2  
ATOM   2314  C  C    . CYS A 1 64 ? 3.015   -6.648  -1.069  1.00 0.00 ? 128 CYS A C    2  
ATOM   2315  O  O    . CYS A 1 64 ? 2.781   -5.625  -0.426  1.00 0.00 ? 128 CYS A O    2  
ATOM   2316  C  CB   . CYS A 1 64 ? 5.032   -8.089  -0.730  1.00 0.00 ? 128 CYS A CB   2  
ATOM   2317  S  SG   . CYS A 1 64 ? 5.916   -9.232  0.378   1.00 0.00 ? 128 CYS A SG   2  
ATOM   2318  H  H    . CYS A 1 64 ? 3.264   -9.894  -1.025  1.00 0.00 ? 128 CYS A H    2  
ATOM   2319  H  HA   . CYS A 1 64 ? 3.459   -7.775  0.688   1.00 0.00 ? 128 CYS A HA   2  
ATOM   2320  H  HB2  . CYS A 1 64 ? 5.108   -8.481  -1.734  1.00 0.00 ? 128 CYS A HB2  2  
ATOM   2321  H  HB3  . CYS A 1 64 ? 5.531   -7.133  -0.683  1.00 0.00 ? 128 CYS A HB3  2  
ATOM   2322  N  N    . ARG A 1 65 ? 2.819   -6.740  -2.380  1.00 0.00 ? 129 ARG A N    2  
ATOM   2323  C  CA   . ARG A 1 65 ? 2.308   -5.617  -3.157  1.00 0.00 ? 129 ARG A CA   2  
ATOM   2324  C  C    . ARG A 1 65 ? 1.114   -4.972  -2.459  1.00 0.00 ? 129 ARG A C    2  
ATOM   2325  O  O    . ARG A 1 65 ? 1.019   -3.747  -2.372  1.00 0.00 ? 129 ARG A O    2  
ATOM   2326  C  CB   . ARG A 1 65 ? 1.904   -6.079  -4.558  1.00 0.00 ? 129 ARG A CB   2  
ATOM   2327  C  CG   . ARG A 1 65 ? 1.502   -4.942  -5.483  1.00 0.00 ? 129 ARG A CG   2  
ATOM   2328  C  CD   . ARG A 1 65 ? 1.623   -5.343  -6.945  1.00 0.00 ? 129 ARG A CD   2  
ATOM   2329  N  NE   . ARG A 1 65 ? 0.975   -4.381  -7.832  1.00 0.00 ? 129 ARG A NE   2  
ATOM   2330  C  CZ   . ARG A 1 65 ? 0.838   -4.565  -9.140  1.00 0.00 ? 129 ARG A CZ   2  
ATOM   2331  N  NH1  . ARG A 1 65 ? 1.301   -5.668  -9.710  1.00 0.00 ? 129 ARG A NH1  2  
ATOM   2332  N  NH2  . ARG A 1 65 ? 0.235   -3.643  -9.881  1.00 0.00 ? 129 ARG A NH2  2  
ATOM   2333  H  H    . ARG A 1 65 ? 3.024   -7.582  -2.837  1.00 0.00 ? 129 ARG A H    2  
ATOM   2334  H  HA   . ARG A 1 65 ? 3.097   -4.885  -3.242  1.00 0.00 ? 129 ARG A HA   2  
ATOM   2335  H  HB2  . ARG A 1 65 ? 2.737   -6.601  -5.006  1.00 0.00 ? 129 ARG A HB2  2  
ATOM   2336  H  HB3  . ARG A 1 65 ? 1.069   -6.758  -4.473  1.00 0.00 ? 129 ARG A HB3  2  
ATOM   2337  H  HG2  . ARG A 1 65 ? 0.477   -4.670  -5.279  1.00 0.00 ? 129 ARG A HG2  2  
ATOM   2338  H  HG3  . ARG A 1 65 ? 2.145   -4.095  -5.296  1.00 0.00 ? 129 ARG A HG3  2  
ATOM   2339  H  HD2  . ARG A 1 65 ? 2.670   -5.406  -7.201  1.00 0.00 ? 129 ARG A HD2  2  
ATOM   2340  H  HD3  . ARG A 1 65 ? 1.162   -6.310  -7.078  1.00 0.00 ? 129 ARG A HD3  2  
ATOM   2341  H  HE   . ARG A 1 65 ? 0.625   -3.559  -7.431  1.00 0.00 ? 129 ARG A HE   2  
ATOM   2342  H  HH11 . ARG A 1 65 ? 1.754   -6.365  -9.154  1.00 0.00 ? 129 ARG A HH11 2  
ATOM   2343  H  HH12 . ARG A 1 65 ? 1.195   -5.805  -10.696 1.00 0.00 ? 129 ARG A HH12 2  
ATOM   2344  H  HH21 . ARG A 1 65 ? -0.116  -2.810  -9.455  1.00 0.00 ? 129 ARG A HH21 2  
ATOM   2345  H  HH22 . ARG A 1 65 ? 0.133   -3.782  -10.865 1.00 0.00 ? 129 ARG A HH22 2  
ATOM   2346  N  N    . PHE A 1 66 ? 0.204   -5.805  -1.963  1.00 0.00 ? 130 PHE A N    2  
ATOM   2347  C  CA   . PHE A 1 66 ? -0.985  -5.316  -1.274  1.00 0.00 ? 130 PHE A CA   2  
ATOM   2348  C  C    . PHE A 1 66 ? -0.623  -4.738  0.091   1.00 0.00 ? 130 PHE A C    2  
ATOM   2349  O  O    . PHE A 1 66 ? -0.989  -3.608  0.414   1.00 0.00 ? 130 PHE A O    2  
ATOM   2350  C  CB   . PHE A 1 66 ? -2.004  -6.445  -1.109  1.00 0.00 ? 130 PHE A CB   2  
ATOM   2351  C  CG   . PHE A 1 66 ? -3.302  -5.996  -0.502  1.00 0.00 ? 130 PHE A CG   2  
ATOM   2352  C  CD1  . PHE A 1 66 ? -3.397  -5.748  0.858   1.00 0.00 ? 130 PHE A CD1  2  
ATOM   2353  C  CD2  . PHE A 1 66 ? -4.428  -5.822  -1.290  1.00 0.00 ? 130 PHE A CD2  2  
ATOM   2354  C  CE1  . PHE A 1 66 ? -4.590  -5.335  1.420   1.00 0.00 ? 130 PHE A CE1  2  
ATOM   2355  C  CE2  . PHE A 1 66 ? -5.625  -5.410  -0.734  1.00 0.00 ? 130 PHE A CE2  2  
ATOM   2356  C  CZ   . PHE A 1 66 ? -5.705  -5.165  0.623   1.00 0.00 ? 130 PHE A CZ   2  
ATOM   2357  H  H    . PHE A 1 66 ? 0.336   -6.771  -2.064  1.00 0.00 ? 130 PHE A H    2  
ATOM   2358  H  HA   . PHE A 1 66 ? -1.420  -4.535  -1.879  1.00 0.00 ? 130 PHE A HA   2  
ATOM   2359  H  HB2  . PHE A 1 66 ? -2.221  -6.869  -2.078  1.00 0.00 ? 130 PHE A HB2  2  
ATOM   2360  H  HB3  . PHE A 1 66 ? -1.585  -7.209  -0.472  1.00 0.00 ? 130 PHE A HB3  2  
ATOM   2361  H  HD1  . PHE A 1 66 ? -2.525  -5.879  1.483   1.00 0.00 ? 130 PHE A HD1  2  
ATOM   2362  H  HD2  . PHE A 1 66 ? -4.366  -6.014  -2.352  1.00 0.00 ? 130 PHE A HD2  2  
ATOM   2363  H  HE1  . PHE A 1 66 ? -4.651  -5.144  2.481   1.00 0.00 ? 130 PHE A HE1  2  
ATOM   2364  H  HE2  . PHE A 1 66 ? -6.494  -5.278  -1.361  1.00 0.00 ? 130 PHE A HE2  2  
ATOM   2365  H  HZ   . PHE A 1 66 ? -6.639  -4.843  1.059   1.00 0.00 ? 130 PHE A HZ   2  
ATOM   2366  N  N    . GLN A 1 67 ? 0.096   -5.523  0.887   1.00 0.00 ? 131 GLN A N    2  
ATOM   2367  C  CA   . GLN A 1 67 ? 0.506   -5.089  2.218   1.00 0.00 ? 131 GLN A CA   2  
ATOM   2368  C  C    . GLN A 1 67 ? 1.068   -3.672  2.180   1.00 0.00 ? 131 GLN A C    2  
ATOM   2369  O  O    . GLN A 1 67 ? 0.639   -2.802  2.939   1.00 0.00 ? 131 GLN A O    2  
ATOM   2370  C  CB   . GLN A 1 67 ? 1.549   -6.050  2.791   1.00 0.00 ? 131 GLN A CB   2  
ATOM   2371  C  CG   . GLN A 1 67 ? 0.988   -7.417  3.145   1.00 0.00 ? 131 GLN A CG   2  
ATOM   2372  C  CD   . GLN A 1 67 ? -0.080  -7.350  4.219   1.00 0.00 ? 131 GLN A CD   2  
ATOM   2373  O  OE1  . GLN A 1 67 ? -1.275  -7.398  3.927   1.00 0.00 ? 131 GLN A OE1  2  
ATOM   2374  N  NE2  . GLN A 1 67 ? 0.346   -7.237  5.472   1.00 0.00 ? 131 GLN A NE2  2  
ATOM   2375  H  H    . GLN A 1 67 ? 0.357   -6.413  0.573   1.00 0.00 ? 131 GLN A H    2  
ATOM   2376  H  HA   . GLN A 1 67 ? -0.367  -5.100  2.853   1.00 0.00 ? 131 GLN A HA   2  
ATOM   2377  H  HB2  . GLN A 1 67 ? 2.335   -6.184  2.063   1.00 0.00 ? 131 GLN A HB2  2  
ATOM   2378  H  HB3  . GLN A 1 67 ? 1.969   -5.614  3.686   1.00 0.00 ? 131 GLN A HB3  2  
ATOM   2379  H  HG2  . GLN A 1 67 ? 0.556   -7.856  2.258   1.00 0.00 ? 131 GLN A HG2  2  
ATOM   2380  H  HG3  . GLN A 1 67 ? 1.795   -8.042  3.499   1.00 0.00 ? 131 GLN A HG3  2  
ATOM   2381  H  HE21 . GLN A 1 67 ? 1.314   -7.203  5.630   1.00 0.00 ? 131 GLN A HE21 2  
ATOM   2382  H  HE22 . GLN A 1 67 ? -0.322  -7.191  6.186   1.00 0.00 ? 131 GLN A HE22 2  
ATOM   2383  N  N    . LYS A 1 68 ? 2.030   -3.446  1.292   1.00 0.00 ? 132 LYS A N    2  
ATOM   2384  C  CA   . LYS A 1 68 ? 2.652   -2.135  1.154   1.00 0.00 ? 132 LYS A CA   2  
ATOM   2385  C  C    . LYS A 1 68 ? 1.599   -1.031  1.156   1.00 0.00 ? 132 LYS A C    2  
ATOM   2386  O  O    . LYS A 1 68 ? 1.708   -0.058  1.903   1.00 0.00 ? 132 LYS A O    2  
ATOM   2387  C  CB   . LYS A 1 68 ? 3.472   -2.070  -0.137  1.00 0.00 ? 132 LYS A CB   2  
ATOM   2388  C  CG   . LYS A 1 68 ? 4.265   -0.783  -0.289  1.00 0.00 ? 132 LYS A CG   2  
ATOM   2389  C  CD   . LYS A 1 68 ? 5.490   -0.984  -1.165  1.00 0.00 ? 132 LYS A CD   2  
ATOM   2390  C  CE   . LYS A 1 68 ? 6.201   0.332   -1.440  1.00 0.00 ? 132 LYS A CE   2  
ATOM   2391  N  NZ   . LYS A 1 68 ? 7.115   0.712   -0.328  1.00 0.00 ? 132 LYS A NZ   2  
ATOM   2392  H  H    . LYS A 1 68 ? 2.329   -4.180  0.715   1.00 0.00 ? 132 LYS A H    2  
ATOM   2393  H  HA   . LYS A 1 68 ? 3.310   -1.989  1.997   1.00 0.00 ? 132 LYS A HA   2  
ATOM   2394  H  HB2  . LYS A 1 68 ? 4.164   -2.899  -0.151  1.00 0.00 ? 132 LYS A HB2  2  
ATOM   2395  H  HB3  . LYS A 1 68 ? 2.801   -2.157  -0.980  1.00 0.00 ? 132 LYS A HB3  2  
ATOM   2396  H  HG2  . LYS A 1 68 ? 3.633   -0.033  -0.740  1.00 0.00 ? 132 LYS A HG2  2  
ATOM   2397  H  HG3  . LYS A 1 68 ? 4.583   -0.449  0.688   1.00 0.00 ? 132 LYS A HG3  2  
ATOM   2398  H  HD2  . LYS A 1 68 ? 6.175   -1.652  -0.663  1.00 0.00 ? 132 LYS A HD2  2  
ATOM   2399  H  HD3  . LYS A 1 68 ? 5.183   -1.421  -2.104  1.00 0.00 ? 132 LYS A HD3  2  
ATOM   2400  H  HE2  . LYS A 1 68 ? 6.775   0.233   -2.348  1.00 0.00 ? 132 LYS A HE2  2  
ATOM   2401  H  HE3  . LYS A 1 68 ? 5.459   1.107   -1.565  1.00 0.00 ? 132 LYS A HE3  2  
ATOM   2402  H  HZ1  . LYS A 1 68 ? 7.761   -0.074  -0.112  1.00 0.00 ? 132 LYS A HZ1  2  
ATOM   2403  H  HZ2  . LYS A 1 68 ? 6.565   0.939   0.525   1.00 0.00 ? 132 LYS A HZ2  2  
ATOM   2404  H  HZ3  . LYS A 1 68 ? 7.677   1.545   -0.596  1.00 0.00 ? 132 LYS A HZ3  2  
ATOM   2405  N  N    . CYS A 1 69 ? 0.581   -1.189  0.317   1.00 0.00 ? 133 CYS A N    2  
ATOM   2406  C  CA   . CYS A 1 69 ? -0.492  -0.206  0.223   1.00 0.00 ? 133 CYS A CA   2  
ATOM   2407  C  C    . CYS A 1 69 ? -1.019  0.158   1.607   1.00 0.00 ? 133 CYS A C    2  
ATOM   2408  O  O    . CYS A 1 69 ? -1.063  1.332   1.978   1.00 0.00 ? 133 CYS A O    2  
ATOM   2409  C  CB   . CYS A 1 69 ? -1.631  -0.745  -0.644  1.00 0.00 ? 133 CYS A CB   2  
ATOM   2410  S  SG   . CYS A 1 69 ? -1.219  -0.887  -2.399  1.00 0.00 ? 133 CYS A SG   2  
ATOM   2411  H  H    . CYS A 1 69 ? 0.550   -1.986  -0.253  1.00 0.00 ? 133 CYS A H    2  
ATOM   2412  H  HA   . CYS A 1 69 ? -0.088  0.681   -0.239  1.00 0.00 ? 133 CYS A HA   2  
ATOM   2413  H  HB2  . CYS A 1 69 ? -1.908  -1.727  -0.292  1.00 0.00 ? 133 CYS A HB2  2  
ATOM   2414  H  HB3  . CYS A 1 69 ? -2.482  -0.086  -0.557  1.00 0.00 ? 133 CYS A HB3  2  
ATOM   2415  H  HG   . CYS A 1 69 ? 0.029   -1.321  -2.492  1.00 0.00 ? 133 CYS A HG   2  
ATOM   2416  N  N    . LEU A 1 70 ? -1.420  -0.855  2.367   1.00 0.00 ? 134 LEU A N    2  
ATOM   2417  C  CA   . LEU A 1 70 ? -1.946  -0.643  3.711   1.00 0.00 ? 134 LEU A CA   2  
ATOM   2418  C  C    . LEU A 1 70 ? -1.024  0.265   4.519   1.00 0.00 ? 134 LEU A C    2  
ATOM   2419  O  O    . LEU A 1 70 ? -1.463  1.265   5.087   1.00 0.00 ? 134 LEU A O    2  
ATOM   2420  C  CB   . LEU A 1 70 ? -2.121  -1.982  4.429   1.00 0.00 ? 134 LEU A CB   2  
ATOM   2421  C  CG   . LEU A 1 70 ? -3.216  -2.898  3.883   1.00 0.00 ? 134 LEU A CG   2  
ATOM   2422  C  CD1  . LEU A 1 70 ? -3.182  -4.247  4.585   1.00 0.00 ? 134 LEU A CD1  2  
ATOM   2423  C  CD2  . LEU A 1 70 ? -4.583  -2.248  4.040   1.00 0.00 ? 134 LEU A CD2  2  
ATOM   2424  H  H    . LEU A 1 70 ? -1.360  -1.769  2.017   1.00 0.00 ? 134 LEU A H    2  
ATOM   2425  H  HA   . LEU A 1 70 ? -2.910  -0.165  3.617   1.00 0.00 ? 134 LEU A HA   2  
ATOM   2426  H  HB2  . LEU A 1 70 ? -1.184  -2.514  4.369   1.00 0.00 ? 134 LEU A HB2  2  
ATOM   2427  H  HB3  . LEU A 1 70 ? -2.348  -1.773  5.465   1.00 0.00 ? 134 LEU A HB3  2  
ATOM   2428  H  HG   . LEU A 1 70 ? -3.044  -3.067  2.829   1.00 0.00 ? 134 LEU A HG   2  
ATOM   2429  H  HD11 . LEU A 1 70 ? -4.122  -4.755  4.433   1.00 0.00 ? 134 LEU A HD11 2  
ATOM   2430  H  HD12 . LEU A 1 70 ? -3.019  -4.099  5.642   1.00 0.00 ? 134 LEU A HD12 2  
ATOM   2431  H  HD13 . LEU A 1 70 ? -2.380  -4.845  4.177   1.00 0.00 ? 134 LEU A HD13 2  
ATOM   2432  H  HD21 . LEU A 1 70 ? -4.460  -1.228  4.371   1.00 0.00 ? 134 LEU A HD21 2  
ATOM   2433  H  HD22 . LEU A 1 70 ? -5.161  -2.797  4.769   1.00 0.00 ? 134 LEU A HD22 2  
ATOM   2434  H  HD23 . LEU A 1 70 ? -5.098  -2.260  3.090   1.00 0.00 ? 134 LEU A HD23 2  
ATOM   2435  N  N    . ALA A 1 71 ? 0.256   -0.091  4.565   1.00 0.00 ? 135 ALA A N    2  
ATOM   2436  C  CA   . ALA A 1 71 ? 1.240   0.694   5.300   1.00 0.00 ? 135 ALA A CA   2  
ATOM   2437  C  C    . ALA A 1 71 ? 1.284   2.132   4.796   1.00 0.00 ? 135 ALA A C    2  
ATOM   2438  O  O    . ALA A 1 71 ? 1.367   3.075   5.584   1.00 0.00 ? 135 ALA A O    2  
ATOM   2439  C  CB   . ALA A 1 71 ? 2.615   0.052   5.190   1.00 0.00 ? 135 ALA A CB   2  
ATOM   2440  H  H    . ALA A 1 71 ? 0.545   -0.899  4.093   1.00 0.00 ? 135 ALA A H    2  
ATOM   2441  H  HA   . ALA A 1 71 ? 0.954   0.697   6.342   1.00 0.00 ? 135 ALA A HA   2  
ATOM   2442  H  HB1  . ALA A 1 71 ? 3.194   0.568   4.438   1.00 0.00 ? 135 ALA A HB1  2  
ATOM   2443  H  HB2  . ALA A 1 71 ? 3.121   0.119   6.143   1.00 0.00 ? 135 ALA A HB2  2  
ATOM   2444  H  HB3  . ALA A 1 71 ? 2.507   -0.986  4.912   1.00 0.00 ? 135 ALA A HB3  2  
ATOM   2445  N  N    . LEU A 1 72 ? 1.228   2.294   3.479   1.00 0.00 ? 136 LEU A N    2  
ATOM   2446  C  CA   . LEU A 1 72 ? 1.262   3.619   2.869   1.00 0.00 ? 136 LEU A CA   2  
ATOM   2447  C  C    . LEU A 1 72 ? 0.113   4.482   3.379   1.00 0.00 ? 136 LEU A C    2  
ATOM   2448  O  O    . LEU A 1 72 ? 0.213   5.708   3.417   1.00 0.00 ? 136 LEU A O    2  
ATOM   2449  C  CB   . LEU A 1 72 ? 1.190   3.502   1.345   1.00 0.00 ? 136 LEU A CB   2  
ATOM   2450  C  CG   . LEU A 1 72 ? 2.451   2.986   0.651   1.00 0.00 ? 136 LEU A CG   2  
ATOM   2451  C  CD1  . LEU A 1 72 ? 2.179   2.717   -0.820  1.00 0.00 ? 136 LEU A CD1  2  
ATOM   2452  C  CD2  . LEU A 1 72 ? 3.592   3.980   0.812   1.00 0.00 ? 136 LEU A CD2  2  
ATOM   2453  H  H    . LEU A 1 72 ? 1.163   1.505   2.902   1.00 0.00 ? 136 LEU A H    2  
ATOM   2454  H  HA   . LEU A 1 72 ? 2.196   4.086   3.142   1.00 0.00 ? 136 LEU A HA   2  
ATOM   2455  H  HB2  . LEU A 1 72 ? 0.381   2.830   1.103   1.00 0.00 ? 136 LEU A HB2  2  
ATOM   2456  H  HB3  . LEU A 1 72 ? 0.971   4.484   0.949   1.00 0.00 ? 136 LEU A HB3  2  
ATOM   2457  H  HG   . LEU A 1 72 ? 2.752   2.054   1.110   1.00 0.00 ? 136 LEU A HG   2  
ATOM   2458  H  HD11 . LEU A 1 72 ? 1.736   1.739   -0.932  1.00 0.00 ? 136 LEU A HD11 2  
ATOM   2459  H  HD12 . LEU A 1 72 ? 3.107   2.757   -1.371  1.00 0.00 ? 136 LEU A HD12 2  
ATOM   2460  H  HD13 . LEU A 1 72 ? 1.501   3.466   -1.204  1.00 0.00 ? 136 LEU A HD13 2  
ATOM   2461  H  HD21 . LEU A 1 72 ? 4.500   3.450   1.059   1.00 0.00 ? 136 LEU A HD21 2  
ATOM   2462  H  HD22 . LEU A 1 72 ? 3.354   4.677   1.602   1.00 0.00 ? 136 LEU A HD22 2  
ATOM   2463  H  HD23 . LEU A 1 72 ? 3.731   4.521   -0.114  1.00 0.00 ? 136 LEU A HD23 2  
ATOM   2464  N  N    . GLY A 1 73 ? -0.980  3.834   3.771   1.00 0.00 ? 137 GLY A N    2  
ATOM   2465  C  CA   . GLY A 1 73 ? -2.131  4.558   4.276   1.00 0.00 ? 137 GLY A CA   2  
ATOM   2466  C  C    . GLY A 1 73 ? -3.287  4.567   3.294   1.00 0.00 ? 137 GLY A C    2  
ATOM   2467  O  O    . GLY A 1 73 ? -4.082  5.506   3.270   1.00 0.00 ? 137 GLY A O    2  
ATOM   2468  H  H    . GLY A 1 73 ? -1.003  2.855   3.718   1.00 0.00 ? 137 GLY A H    2  
ATOM   2469  H  HA2  . GLY A 1 73 ? -2.458  4.098   5.196   1.00 0.00 ? 137 GLY A HA2  2  
ATOM   2470  H  HA3  . GLY A 1 73 ? -1.840  5.578   4.479   1.00 0.00 ? 137 GLY A HA3  2  
ATOM   2471  N  N    . MET A 1 74 ? -3.378  3.519   2.482   1.00 0.00 ? 138 MET A N    2  
ATOM   2472  C  CA   . MET A 1 74 ? -4.445  3.411   1.493   1.00 0.00 ? 138 MET A CA   2  
ATOM   2473  C  C    . MET A 1 74 ? -5.765  3.033   2.157   1.00 0.00 ? 138 MET A C    2  
ATOM   2474  O  O    . MET A 1 74 ? -5.894  1.953   2.733   1.00 0.00 ? 138 MET A O    2  
ATOM   2475  C  CB   . MET A 1 74 ? -4.080  2.373   0.430   1.00 0.00 ? 138 MET A CB   2  
ATOM   2476  C  CG   . MET A 1 74 ? -3.328  2.957   -0.756  1.00 0.00 ? 138 MET A CG   2  
ATOM   2477  S  SD   . MET A 1 74 ? -3.368  1.880   -2.202  1.00 0.00 ? 138 MET A SD   2  
ATOM   2478  C  CE   . MET A 1 74 ? -2.985  3.048   -3.505  1.00 0.00 ? 138 MET A CE   2  
ATOM   2479  H  H    . MET A 1 74 ? -2.714  2.802   2.548   1.00 0.00 ? 138 MET A H    2  
ATOM   2480  H  HA   . MET A 1 74 ? -4.556  4.374   1.019   1.00 0.00 ? 138 MET A HA   2  
ATOM   2481  H  HB2  . MET A 1 74 ? -3.460  1.614   0.882   1.00 0.00 ? 138 MET A HB2  2  
ATOM   2482  H  HB3  . MET A 1 74 ? -4.986  1.916   0.063   1.00 0.00 ? 138 MET A HB3  2  
ATOM   2483  H  HG2  . MET A 1 74 ? -3.776  3.904   -1.019  1.00 0.00 ? 138 MET A HG2  2  
ATOM   2484  H  HG3  . MET A 1 74 ? -2.299  3.114   -0.470  1.00 0.00 ? 138 MET A HG3  2  
ATOM   2485  H  HE1  . MET A 1 74 ? -3.149  4.054   -3.145  1.00 0.00 ? 138 MET A HE1  2  
ATOM   2486  H  HE2  . MET A 1 74 ? -1.952  2.934   -3.798  1.00 0.00 ? 138 MET A HE2  2  
ATOM   2487  H  HE3  . MET A 1 74 ? -3.624  2.860   -4.355  1.00 0.00 ? 138 MET A HE3  2  
ATOM   2488  N  N    . SER A 1 75 ? -6.743  3.929   2.072   1.00 0.00 ? 139 SER A N    2  
ATOM   2489  C  CA   . SER A 1 75 ? -8.052  3.691   2.668   1.00 0.00 ? 139 SER A CA   2  
ATOM   2490  C  C    . SER A 1 75 ? -8.840  2.667   1.857   1.00 0.00 ? 139 SER A C    2  
ATOM   2491  O  O    . SER A 1 75 ? -9.336  2.967   0.770   1.00 0.00 ? 139 SER A O    2  
ATOM   2492  C  CB   . SER A 1 75 ? -8.839  4.999   2.762   1.00 0.00 ? 139 SER A CB   2  
ATOM   2493  O  OG   . SER A 1 75 ? -8.368  5.803   3.830   1.00 0.00 ? 139 SER A OG   2  
ATOM   2494  H  H    . SER A 1 75 ? -6.579  4.772   1.599   1.00 0.00 ? 139 SER A H    2  
ATOM   2495  H  HA   . SER A 1 75 ? -7.897  3.302   3.664   1.00 0.00 ? 139 SER A HA   2  
ATOM   2496  H  HB2  . SER A 1 75 ? -8.730  5.549   1.840   1.00 0.00 ? 139 SER A HB2  2  
ATOM   2497  H  HB3  . SER A 1 75 ? -9.883  4.777   2.928   1.00 0.00 ? 139 SER A HB3  2  
ATOM   2498  H  HG   . SER A 1 75 ? -9.047  5.868   4.506   1.00 0.00 ? 139 SER A HG   2  
ATOM   2499  N  N    . HIS A 1 76 ? -8.952  1.456   2.393   1.00 0.00 ? 140 HIS A N    2  
ATOM   2500  C  CA   . HIS A 1 76 ? -9.681  0.386   1.720   1.00 0.00 ? 140 HIS A CA   2  
ATOM   2501  C  C    . HIS A 1 76 ? -11.184 0.648   1.754   1.00 0.00 ? 140 HIS A C    2  
ATOM   2502  O  O    . HIS A 1 76 ? -11.885 0.422   0.769   1.00 0.00 ? 140 HIS A O    2  
ATOM   2503  C  CB   . HIS A 1 76 ? -9.371  -0.960  2.374   1.00 0.00 ? 140 HIS A CB   2  
ATOM   2504  C  CG   . HIS A 1 76 ? -9.648  -0.990  3.845   1.00 0.00 ? 140 HIS A CG   2  
ATOM   2505  N  ND1  . HIS A 1 76 ? -8.716  -0.626  4.794   1.00 0.00 ? 140 HIS A ND1  2  
ATOM   2506  C  CD2  . HIS A 1 76 ? -10.762 -1.341  4.529   1.00 0.00 ? 140 HIS A CD2  2  
ATOM   2507  C  CE1  . HIS A 1 76 ? -9.244  -0.754  5.998   1.00 0.00 ? 140 HIS A CE1  2  
ATOM   2508  N  NE2  . HIS A 1 76 ? -10.486 -1.186  5.865   1.00 0.00 ? 140 HIS A NE2  2  
ATOM   2509  H  H    . HIS A 1 76 ? -8.536  1.278   3.262   1.00 0.00 ? 140 HIS A H    2  
ATOM   2510  H  HA   . HIS A 1 76 ? -9.356  0.360   0.691   1.00 0.00 ? 140 HIS A HA   2  
ATOM   2511  H  HB2  . HIS A 1 76 ? -9.973  -1.726  1.908   1.00 0.00 ? 140 HIS A HB2  2  
ATOM   2512  H  HB3  . HIS A 1 76 ? -8.326  -1.192  2.228   1.00 0.00 ? 140 HIS A HB3  2  
ATOM   2513  H  HD1  . HIS A 1 76 ? -7.803  -0.322  4.612   1.00 0.00 ? 140 HIS A HD1  2  
ATOM   2514  H  HD2  . HIS A 1 76 ? -11.696 -1.681  4.104   1.00 0.00 ? 140 HIS A HD2  2  
ATOM   2515  H  HE1  . HIS A 1 76 ? -8.747  -0.542  6.933   1.00 0.00 ? 140 HIS A HE1  2  
ATOM   2516  N  N    . ASN A 1 77 ? -11.671 1.124   2.895   1.00 0.00 ? 141 ASN A N    2  
ATOM   2517  C  CA   . ASN A 1 77 ? -13.091 1.415   3.058   1.00 0.00 ? 141 ASN A CA   2  
ATOM   2518  C  C    . ASN A 1 77 ? -13.448 2.755   2.423   1.00 0.00 ? 141 ASN A C    2  
ATOM   2519  O  O    . ASN A 1 77 ? -14.169 3.560   3.012   1.00 0.00 ? 141 ASN A O    2  
ATOM   2520  C  CB   . ASN A 1 77 ? -13.464 1.424   4.541   1.00 0.00 ? 141 ASN A CB   2  
ATOM   2521  C  CG   . ASN A 1 77 ? -14.962 1.521   4.760   1.00 0.00 ? 141 ASN A CG   2  
ATOM   2522  O  OD1  . ASN A 1 77 ? -15.464 2.532   5.252   1.00 0.00 ? 141 ASN A OD1  2  
ATOM   2523  N  ND2  . ASN A 1 77 ? -15.683 0.467   4.395   1.00 0.00 ? 141 ASN A ND2  2  
ATOM   2524  H  H    . ASN A 1 77 ? -11.062 1.284   3.646   1.00 0.00 ? 141 ASN A H    2  
ATOM   2525  H  HA   . ASN A 1 77 ? -13.648 0.635   2.561   1.00 0.00 ? 141 ASN A HA   2  
ATOM   2526  H  HB2  . ASN A 1 77 ? -13.111 0.512   5.001   1.00 0.00 ? 141 ASN A HB2  2  
ATOM   2527  H  HB3  . ASN A 1 77 ? -12.993 2.269   5.020   1.00 0.00 ? 141 ASN A HB3  2  
ATOM   2528  H  HD21 . ASN A 1 77 ? -15.214 -0.303  4.010   1.00 0.00 ? 141 ASN A HD21 2  
ATOM   2529  H  HD22 . ASN A 1 77 ? -16.653 0.503   4.524   1.00 0.00 ? 141 ASN A HD22 2  
ATOM   2530  N  N    . ALA A 1 78 ? -12.938 2.988   1.218   1.00 0.00 ? 142 ALA A N    2  
ATOM   2531  C  CA   . ALA A 1 78 ? -13.205 4.229   0.502   1.00 0.00 ? 142 ALA A CA   2  
ATOM   2532  C  C    . ALA A 1 78 ? -13.803 3.953   -0.873  1.00 0.00 ? 142 ALA A C    2  
ATOM   2533  O  O    . ALA A 1 78 ? -14.619 4.727   -1.372  1.00 0.00 ? 142 ALA A O    2  
ATOM   2534  C  CB   . ALA A 1 78 ? -11.929 5.047   0.370   1.00 0.00 ? 142 ALA A CB   2  
ATOM   2535  H  H    . ALA A 1 78 ? -12.370 2.308   0.800   1.00 0.00 ? 142 ALA A H    2  
ATOM   2536  H  HA   . ALA A 1 78 ? -13.913 4.804   1.083   1.00 0.00 ? 142 ALA A HA   2  
ATOM   2537  H  HB1  . ALA A 1 78 ? -11.162 4.622   1.000   1.00 0.00 ? 142 ALA A HB1  2  
ATOM   2538  H  HB2  . ALA A 1 78 ? -11.599 5.035   -0.658  1.00 0.00 ? 142 ALA A HB2  2  
ATOM   2539  H  HB3  . ALA A 1 78 ? -12.121 6.065   0.675   1.00 0.00 ? 142 ALA A HB3  2  
ATOM   2540  N  N    . ILE A 1 79 ? -13.391 2.845   -1.480  1.00 0.00 ? 143 ILE A N    2  
ATOM   2541  C  CA   . ILE A 1 79 ? -13.886 2.466   -2.797  1.00 0.00 ? 143 ILE A CA   2  
ATOM   2542  C  C    . ILE A 1 79 ? -15.407 2.345   -2.799  1.00 0.00 ? 143 ILE A C    2  
ATOM   2543  O  O    . ILE A 1 79 ? -15.972 1.489   -2.117  1.00 0.00 ? 143 ILE A O    2  
ATOM   2544  C  CB   . ILE A 1 79 ? -13.276 1.133   -3.267  1.00 0.00 ? 143 ILE A CB   2  
ATOM   2545  C  CG1  . ILE A 1 79 ? -11.749 1.228   -3.293  1.00 0.00 ? 143 ILE A CG1  2  
ATOM   2546  C  CG2  . ILE A 1 79 ? -13.812 0.760   -4.641  1.00 0.00 ? 143 ILE A CG2  2  
ATOM   2547  C  CD1  . ILE A 1 79 ? -11.058 -0.104  -3.098  1.00 0.00 ? 143 ILE A CD1  2  
ATOM   2548  H  H    . ILE A 1 79 ? -12.739 2.268   -1.031  1.00 0.00 ? 143 ILE A H    2  
ATOM   2549  H  HA   . ILE A 1 79 ? -13.597 3.238   -3.496  1.00 0.00 ? 143 ILE A HA   2  
ATOM   2550  H  HB   . ILE A 1 79 ? -13.570 0.363   -2.571  1.00 0.00 ? 143 ILE A HB   2  
ATOM   2551  H  HG12 . ILE A 1 79 ? -11.435 1.627   -4.245  1.00 0.00 ? 143 ILE A HG12 2  
ATOM   2552  H  HG13 . ILE A 1 79 ? -11.423 1.890   -2.504  1.00 0.00 ? 143 ILE A HG13 2  
ATOM   2553  H  HG21 . ILE A 1 79 ? -13.073 0.994   -5.392  1.00 0.00 ? 143 ILE A HG21 2  
ATOM   2554  H  HG22 . ILE A 1 79 ? -14.028 -0.298  -4.667  1.00 0.00 ? 143 ILE A HG22 2  
ATOM   2555  H  HG23 . ILE A 1 79 ? -14.716 1.317   -4.838  1.00 0.00 ? 143 ILE A HG23 2  
ATOM   2556  H  HD11 . ILE A 1 79 ? -10.002 0.060   -2.933  1.00 0.00 ? 143 ILE A HD11 2  
ATOM   2557  H  HD12 . ILE A 1 79 ? -11.480 -0.607  -2.242  1.00 0.00 ? 143 ILE A HD12 2  
ATOM   2558  H  HD13 . ILE A 1 79 ? -11.194 -0.713  -3.979  1.00 0.00 ? 143 ILE A HD13 2  
ATOM   2559  N  N    . ARG A 1 80 ? -16.063 3.206   -3.570  1.00 0.00 ? 144 ARG A N    2  
ATOM   2560  C  CA   . ARG A 1 80 ? -17.518 3.195   -3.660  1.00 0.00 ? 144 ARG A CA   2  
ATOM   2561  C  C    . ARG A 1 80 ? -18.012 1.905   -4.308  1.00 0.00 ? 144 ARG A C    2  
ATOM   2562  O  O    . ARG A 1 80 ? -17.428 1.422   -5.279  1.00 0.00 ? 144 ARG A O    2  
ATOM   2563  C  CB   . ARG A 1 80 ? -18.009 4.402   -4.462  1.00 0.00 ? 144 ARG A CB   2  
ATOM   2564  C  CG   . ARG A 1 80 ? -19.458 4.767   -4.186  1.00 0.00 ? 144 ARG A CG   2  
ATOM   2565  C  CD   . ARG A 1 80 ? -19.621 5.399   -2.812  1.00 0.00 ? 144 ARG A CD   2  
ATOM   2566  N  NE   . ARG A 1 80 ? -19.451 6.849   -2.853  1.00 0.00 ? 144 ARG A NE   2  
ATOM   2567  C  CZ   . ARG A 1 80 ? -19.212 7.591   -1.777  1.00 0.00 ? 144 ARG A CZ   2  
ATOM   2568  N  NH1  . ARG A 1 80 ? -19.116 7.022   -0.583  1.00 0.00 ? 144 ARG A NH1  2  
ATOM   2569  N  NH2  . ARG A 1 80 ? -19.069 8.905   -1.895  1.00 0.00 ? 144 ARG A NH2  2  
ATOM   2570  H  H    . ARG A 1 80 ? -15.557 3.865   -4.089  1.00 0.00 ? 144 ARG A H    2  
ATOM   2571  H  HA   . ARG A 1 80 ? -17.913 3.255   -2.658  1.00 0.00 ? 144 ARG A HA   2  
ATOM   2572  H  HB2  . ARG A 1 80 ? -17.393 5.255   -4.220  1.00 0.00 ? 144 ARG A HB2  2  
ATOM   2573  H  HB3  . ARG A 1 80 ? -17.910 4.183   -5.515  1.00 0.00 ? 144 ARG A HB3  2  
ATOM   2574  H  HG2  . ARG A 1 80 ? -19.792 5.470   -4.935  1.00 0.00 ? 144 ARG A HG2  2  
ATOM   2575  H  HG3  . ARG A 1 80 ? -20.061 3.872   -4.235  1.00 0.00 ? 144 ARG A HG3  2  
ATOM   2576  H  HD2  . ARG A 1 80 ? -20.610 5.172   -2.441  1.00 0.00 ? 144 ARG A HD2  2  
ATOM   2577  H  HD3  . ARG A 1 80 ? -18.883 4.977   -2.147  1.00 0.00 ? 144 ARG A HD3  2  
ATOM   2578  H  HE   . ARG A 1 80 ? -19.519 7.289   -3.725  1.00 0.00 ? 144 ARG A HE   2  
ATOM   2579  H  HH11 . ARG A 1 80 ? -19.222 6.032   -0.492  1.00 0.00 ? 144 ARG A HH11 2  
ATOM   2580  H  HH12 . ARG A 1 80 ? -18.934 7.583   0.225   1.00 0.00 ? 144 ARG A HH12 2  
ATOM   2581  H  HH21 . ARG A 1 80 ? -19.141 9.337   -2.793  1.00 0.00 ? 144 ARG A HH21 2  
ATOM   2582  H  HH22 . ARG A 1 80 ? -18.889 9.462   -1.085  1.00 0.00 ? 144 ARG A HH22 2  
ATOM   2583  N  N    . PHE A 1 81 ? -19.091 1.352   -3.765  1.00 0.00 ? 145 PHE A N    2  
ATOM   2584  C  CA   . PHE A 1 81 ? -19.663 0.117   -4.289  1.00 0.00 ? 145 PHE A CA   2  
ATOM   2585  C  C    . PHE A 1 81 ? -20.250 0.336   -5.680  1.00 0.00 ? 145 PHE A C    2  
ATOM   2586  O  O    . PHE A 1 81 ? -21.084 1.218   -5.882  1.00 0.00 ? 145 PHE A O    2  
ATOM   2587  C  CB   . PHE A 1 81 ? -20.746 -0.410  -3.344  1.00 0.00 ? 145 PHE A CB   2  
ATOM   2588  C  CG   . PHE A 1 81 ? -20.196 -1.103  -2.130  1.00 0.00 ? 145 PHE A CG   2  
ATOM   2589  C  CD1  . PHE A 1 81 ? -19.520 -0.388  -1.154  1.00 0.00 ? 145 PHE A CD1  2  
ATOM   2590  C  CD2  . PHE A 1 81 ? -20.356 -2.469  -1.964  1.00 0.00 ? 145 PHE A CD2  2  
ATOM   2591  C  CE1  . PHE A 1 81 ? -19.013 -1.023  -0.036  1.00 0.00 ? 145 PHE A CE1  2  
ATOM   2592  C  CE2  . PHE A 1 81 ? -19.852 -3.109  -0.848  1.00 0.00 ? 145 PHE A CE2  2  
ATOM   2593  C  CZ   . PHE A 1 81 ? -19.179 -2.386  0.117   1.00 0.00 ? 145 PHE A CZ   2  
ATOM   2594  H  H    . PHE A 1 81 ? -19.512 1.784   -2.992  1.00 0.00 ? 145 PHE A H    2  
ATOM   2595  H  HA   . PHE A 1 81 ? -18.871 -0.612  -4.356  1.00 0.00 ? 145 PHE A HA   2  
ATOM   2596  H  HB2  . PHE A 1 81 ? -21.353 0.417   -3.007  1.00 0.00 ? 145 PHE A HB2  2  
ATOM   2597  H  HB3  . PHE A 1 81 ? -21.367 -1.114  -3.876  1.00 0.00 ? 145 PHE A HB3  2  
ATOM   2598  H  HD1  . PHE A 1 81 ? -19.389 0.678   -1.273  1.00 0.00 ? 145 PHE A HD1  2  
ATOM   2599  H  HD2  . PHE A 1 81 ? -20.881 -3.037  -2.718  1.00 0.00 ? 145 PHE A HD2  2  
ATOM   2600  H  HE1  . PHE A 1 81 ? -18.487 -0.454  0.716   1.00 0.00 ? 145 PHE A HE1  2  
ATOM   2601  H  HE2  . PHE A 1 81 ? -19.982 -4.175  -0.731  1.00 0.00 ? 145 PHE A HE2  2  
ATOM   2602  H  HZ   . PHE A 1 81 ? -18.784 -2.883  0.990   1.00 0.00 ? 145 PHE A HZ   2  
ATOM   2603  N  N    . GLY A 1 82 ? -19.807 -0.473  -6.637  1.00 0.00 ? 146 GLY A N    2  
ATOM   2604  C  CA   . GLY A 1 82 ? -20.298 -0.351  -7.998  1.00 0.00 ? 146 GLY A CA   2  
ATOM   2605  C  C    . GLY A 1 82 ? -21.473 -1.268  -8.274  1.00 0.00 ? 146 GLY A C    2  
ATOM   2606  O  O    . GLY A 1 82 ? -21.385 -2.164  -9.114  1.00 0.00 ? 146 GLY A O    2  
ATOM   2607  H  H    . GLY A 1 82 ? -19.142 -1.158  -6.418  1.00 0.00 ? 146 GLY A H    2  
ATOM   2608  H  HA2  . GLY A 1 82 ? -20.603 0.670   -8.168  1.00 0.00 ? 146 GLY A HA2  2  
ATOM   2609  H  HA3  . GLY A 1 82 ? -19.497 -0.596  -8.680  1.00 0.00 ? 146 GLY A HA3  2  
ATOM   2610  N  N    . SER A 1 83 ? -22.575 -1.046  -7.566  1.00 0.00 ? 147 SER A N    2  
ATOM   2611  C  CA   . SER A 1 83 ? -23.771 -1.863  -7.736  1.00 0.00 ? 147 SER A CA   2  
ATOM   2612  C  C    . SER A 1 83 ? -24.434 -1.582  -9.081  1.00 0.00 ? 147 SER A C    2  
ATOM   2613  O  O    . SER A 1 83 ? -24.868 -0.463  -9.350  1.00 0.00 ? 147 SER A O    2  
ATOM   2614  C  CB   . SER A 1 83 ? -24.761 -1.596  -6.601  1.00 0.00 ? 147 SER A CB   2  
ATOM   2615  O  OG   . SER A 1 83 ? -25.970 -2.308  -6.801  1.00 0.00 ? 147 SER A OG   2  
ATOM   2616  H  H    . SER A 1 83 ? -22.583 -0.316  -6.911  1.00 0.00 ? 147 SER A H    2  
ATOM   2617  H  HA   . SER A 1 83 ? -23.471 -2.900  -7.704  1.00 0.00 ? 147 SER A HA   2  
ATOM   2618  H  HB2  . SER A 1 83 ? -24.325 -1.909  -5.664  1.00 0.00 ? 147 SER A HB2  2  
ATOM   2619  H  HB3  . SER A 1 83 ? -24.982 -0.539  -6.560  1.00 0.00 ? 147 SER A HB3  2  
ATOM   2620  H  HG   . SER A 1 83 ? -26.638 -1.714  -7.152  1.00 0.00 ? 147 SER A HG   2  
ATOM   2621  N  N    . GLY A 1 84 ? -24.507 -2.609  -9.922  1.00 0.00 ? 148 GLY A N    2  
ATOM   2622  C  CA   . GLY A 1 84 ? -25.118 -2.454  -11.230 1.00 0.00 ? 148 GLY A CA   2  
ATOM   2623  C  C    . GLY A 1 84 ? -26.514 -1.868  -11.152 1.00 0.00 ? 148 GLY A C    2  
ATOM   2624  O  O    . GLY A 1 84 ? -27.127 -1.811  -10.086 1.00 0.00 ? 148 GLY A O    2  
ATOM   2625  H  H    . GLY A 1 84 ? -24.144 -3.479  -9.653  1.00 0.00 ? 148 GLY A H    2  
ATOM   2626  H  HA2  . GLY A 1 84 ? -24.499 -1.804  -11.829 1.00 0.00 ? 148 GLY A HA2  2  
ATOM   2627  H  HA3  . GLY A 1 84 ? -25.173 -3.422  -11.706 1.00 0.00 ? 148 GLY A HA3  2  
ATOM   2628  N  N    . PRO A 1 85 ? -27.037 -1.419  -12.303 1.00 0.00 ? 149 PRO A N    2  
ATOM   2629  C  CA   . PRO A 1 85 ? -28.374 -0.826  -12.386 1.00 0.00 ? 149 PRO A CA   2  
ATOM   2630  C  C    . PRO A 1 85 ? -29.479 -1.855  -12.173 1.00 0.00 ? 149 PRO A C    2  
ATOM   2631  O  O    . PRO A 1 85 ? -29.975 -2.455  -13.127 1.00 0.00 ? 149 PRO A O    2  
ATOM   2632  C  CB   . PRO A 1 85 ? -28.428 -0.271  -13.812 1.00 0.00 ? 149 PRO A CB   2  
ATOM   2633  C  CG   . PRO A 1 85 ? -27.457 -1.102  -14.578 1.00 0.00 ? 149 PRO A CG   2  
ATOM   2634  C  CD   . PRO A 1 85 ? -26.362 -1.456  -13.611 1.00 0.00 ? 149 PRO A CD   2  
ATOM   2635  H  HA   . PRO A 1 85 ? -28.495 -0.018  -11.679 1.00 0.00 ? 149 PRO A HA   2  
ATOM   2636  H  HB2  . PRO A 1 85 ? -29.431 -0.373  -14.203 1.00 0.00 ? 149 PRO A HB2  2  
ATOM   2637  H  HB3  . PRO A 1 85 ? -28.141 0.769   -13.809 1.00 0.00 ? 149 PRO A HB3  2  
ATOM   2638  H  HG2  . PRO A 1 85 ? -27.943 -1.996  -14.939 1.00 0.00 ? 149 PRO A HG2  2  
ATOM   2639  H  HG3  . PRO A 1 85 ? -27.058 -0.531  -15.404 1.00 0.00 ? 149 PRO A HG3  2  
ATOM   2640  H  HD2  . PRO A 1 85 ? -25.979 -2.444  -13.820 1.00 0.00 ? 149 PRO A HD2  2  
ATOM   2641  H  HD3  . PRO A 1 85 ? -25.568 -0.725  -13.655 1.00 0.00 ? 149 PRO A HD3  2  
ATOM   2642  N  N    . SER A 1 86 ? -29.861 -2.053  -10.915 1.00 0.00 ? 150 SER A N    2  
ATOM   2643  C  CA   . SER A 1 86 ? -30.906 -3.013  -10.576 1.00 0.00 ? 150 SER A CA   2  
ATOM   2644  C  C    . SER A 1 86 ? -30.525 -4.416  -11.037 1.00 0.00 ? 150 SER A C    2  
ATOM   2645  O  O    . SER A 1 86 ? -31.358 -5.158  -11.558 1.00 0.00 ? 150 SER A O    2  
ATOM   2646  C  CB   . SER A 1 86 ? -32.234 -2.598  -11.212 1.00 0.00 ? 150 SER A CB   2  
ATOM   2647  O  OG   . SER A 1 86 ? -32.646 -1.324  -10.748 1.00 0.00 ? 150 SER A OG   2  
ATOM   2648  H  H    . SER A 1 86 ? -29.428 -1.544  -10.198 1.00 0.00 ? 150 SER A H    2  
ATOM   2649  H  HA   . SER A 1 86 ? -31.017 -3.017  -9.502  1.00 0.00 ? 150 SER A HA   2  
ATOM   2650  H  HB2  . SER A 1 86 ? -32.120 -2.557  -12.285 1.00 0.00 ? 150 SER A HB2  2  
ATOM   2651  H  HB3  . SER A 1 86 ? -32.994 -3.323  -10.958 1.00 0.00 ? 150 SER A HB3  2  
ATOM   2652  H  HG   . SER A 1 86 ? -32.795 -0.743  -11.498 1.00 0.00 ? 150 SER A HG   2  
ATOM   2653  N  N    . SER A 1 87 ? -29.260 -4.773  -10.841 1.00 0.00 ? 151 SER A N    2  
ATOM   2654  C  CA   . SER A 1 87 ? -28.766 -6.086  -11.240 1.00 0.00 ? 151 SER A CA   2  
ATOM   2655  C  C    . SER A 1 87 ? -28.694 -7.026  -10.040 1.00 0.00 ? 151 SER A C    2  
ATOM   2656  O  O    . SER A 1 87 ? -28.586 -6.585  -8.897  1.00 0.00 ? 151 SER A O    2  
ATOM   2657  C  CB   . SER A 1 87 ? -27.385 -5.960  -11.887 1.00 0.00 ? 151 SER A CB   2  
ATOM   2658  O  OG   . SER A 1 87 ? -27.485 -5.456  -13.207 1.00 0.00 ? 151 SER A OG   2  
ATOM   2659  H  H    . SER A 1 87 ? -28.643 -4.137  -10.421 1.00 0.00 ? 151 SER A H    2  
ATOM   2660  H  HA   . SER A 1 87 ? -29.456 -6.495  -11.962 1.00 0.00 ? 151 SER A HA   2  
ATOM   2661  H  HB2  . SER A 1 87 ? -26.777 -5.287  -11.303 1.00 0.00 ? 151 SER A HB2  2  
ATOM   2662  H  HB3  . SER A 1 87 ? -26.916 -6.933  -11.920 1.00 0.00 ? 151 SER A HB3  2  
ATOM   2663  H  HG   . SER A 1 87 ? -26.605 -5.310  -13.562 1.00 0.00 ? 151 SER A HG   2  
ATOM   2664  N  N    . GLY A 1 88 ? -28.754 -8.327  -10.311 1.00 0.00 ? 152 GLY A N    2  
ATOM   2665  C  CA   . GLY A 1 88 ? -28.694 -9.310  -9.246  1.00 0.00 ? 152 GLY A CA   2  
ATOM   2666  C  C    . GLY A 1 88 ? -27.389 -10.081 -9.241  1.00 0.00 ? 152 GLY A C    2  
ATOM   2667  O  O    . GLY A 1 88 ? -27.239 -11.066 -9.964  1.00 0.00 ? 152 GLY A O    2  
ATOM   2668  H  H    . GLY A 1 88 ? -28.839 -8.621  -11.243 1.00 0.00 ? 152 GLY A H    2  
ATOM   2669  H  HA2  . GLY A 1 88 ? -28.806 -8.805  -8.298  1.00 0.00 ? 152 GLY A HA2  2  
ATOM   2670  H  HA3  . GLY A 1 88 ? -29.510 -10.007 -9.369  1.00 0.00 ? 152 GLY A HA3  2  
HETATM 2671  ZN ZN   . ZN  B 2 .  ? 3.067   2.432   -9.027  1.00 0.00 ? 200 ZN  A ZN   2  
HETATM 2672  ZN ZN   . ZN  C 2 .  ? 6.545   -11.076 -0.867  1.00 0.00 ? 300 ZN  A ZN   2  
ATOM   2673  N  N    . GLY A 1 1  ? 20.841  8.218   -17.246 1.00 0.00 ? 65  GLY A N    3  
ATOM   2674  C  CA   . GLY A 1 1  ? 20.475  9.610   -17.438 1.00 0.00 ? 65  GLY A CA   3  
ATOM   2675  C  C    . GLY A 1 1  ? 19.471  10.092  -16.410 1.00 0.00 ? 65  GLY A C    3  
ATOM   2676  O  O    . GLY A 1 1  ? 19.089  9.346   -15.508 1.00 0.00 ? 65  GLY A O    3  
ATOM   2677  H  H1   . GLY A 1 1  ? 21.096  7.899   -16.355 1.00 0.00 ? 65  GLY A H1   3  
ATOM   2678  H  HA2  . GLY A 1 1  ? 21.365  10.217  -17.369 1.00 0.00 ? 65  GLY A HA2  3  
ATOM   2679  H  HA3  . GLY A 1 1  ? 20.048  9.725   -18.423 1.00 0.00 ? 65  GLY A HA3  3  
ATOM   2680  N  N    . SER A 1 2  ? 19.043  11.343  -16.545 1.00 0.00 ? 66  SER A N    3  
ATOM   2681  C  CA   . SER A 1 2  ? 18.081  11.926  -15.617 1.00 0.00 ? 66  SER A CA   3  
ATOM   2682  C  C    . SER A 1 2  ? 16.657  11.514  -15.980 1.00 0.00 ? 66  SER A C    3  
ATOM   2683  O  O    . SER A 1 2  ? 16.181  11.791  -17.081 1.00 0.00 ? 66  SER A O    3  
ATOM   2684  C  CB   . SER A 1 2  ? 18.198  13.451  -15.619 1.00 0.00 ? 66  SER A CB   3  
ATOM   2685  O  OG   . SER A 1 2  ? 17.085  14.049  -14.978 1.00 0.00 ? 66  SER A OG   3  
ATOM   2686  H  H    . SER A 1 2  ? 19.384  11.888  -17.285 1.00 0.00 ? 66  SER A H    3  
ATOM   2687  H  HA   . SER A 1 2  ? 18.309  11.557  -14.628 1.00 0.00 ? 66  SER A HA   3  
ATOM   2688  H  HB2  . SER A 1 2  ? 19.097  13.741  -15.097 1.00 0.00 ? 66  SER A HB2  3  
ATOM   2689  H  HB3  . SER A 1 2  ? 18.244  13.805  -16.639 1.00 0.00 ? 66  SER A HB3  3  
ATOM   2690  H  HG   . SER A 1 2  ? 17.380  14.798  -14.455 1.00 0.00 ? 66  SER A HG   3  
ATOM   2691  N  N    . SER A 1 3  ? 15.984  10.850  -15.046 1.00 0.00 ? 67  SER A N    3  
ATOM   2692  C  CA   . SER A 1 3  ? 14.616  10.396  -15.267 1.00 0.00 ? 67  SER A CA   3  
ATOM   2693  C  C    . SER A 1 3  ? 13.817  11.436  -16.047 1.00 0.00 ? 67  SER A C    3  
ATOM   2694  O  O    . SER A 1 3  ? 13.137  11.112  -17.020 1.00 0.00 ? 67  SER A O    3  
ATOM   2695  C  CB   . SER A 1 3  ? 13.929  10.106  -13.931 1.00 0.00 ? 67  SER A CB   3  
ATOM   2696  O  OG   . SER A 1 3  ? 14.566  9.038   -13.252 1.00 0.00 ? 67  SER A OG   3  
ATOM   2697  H  H    . SER A 1 3  ? 16.418  10.660  -14.188 1.00 0.00 ? 67  SER A H    3  
ATOM   2698  H  HA   . SER A 1 3  ? 14.659  9.485   -15.845 1.00 0.00 ? 67  SER A HA   3  
ATOM   2699  H  HB2  . SER A 1 3  ? 13.971  10.987  -13.309 1.00 0.00 ? 67  SER A HB2  3  
ATOM   2700  H  HB3  . SER A 1 3  ? 12.898  9.840   -14.110 1.00 0.00 ? 67  SER A HB3  3  
ATOM   2701  H  HG   . SER A 1 3  ? 15.500  9.235   -13.149 1.00 0.00 ? 67  SER A HG   3  
ATOM   2702  N  N    . GLY A 1 4  ? 13.906  12.689  -15.611 1.00 0.00 ? 68  GLY A N    3  
ATOM   2703  C  CA   . GLY A 1 4  ? 13.187  13.759  -16.279 1.00 0.00 ? 68  GLY A CA   3  
ATOM   2704  C  C    . GLY A 1 4  ? 12.303  14.544  -15.330 1.00 0.00 ? 68  GLY A C    3  
ATOM   2705  O  O    . GLY A 1 4  ? 12.677  15.623  -14.871 1.00 0.00 ? 68  GLY A O    3  
ATOM   2706  H  H    . GLY A 1 4  ? 14.463  12.889  -14.831 1.00 0.00 ? 68  GLY A H    3  
ATOM   2707  H  HA2  . GLY A 1 4  ? 13.901  14.432  -16.728 1.00 0.00 ? 68  GLY A HA2  3  
ATOM   2708  H  HA3  . GLY A 1 4  ? 12.571  13.332  -17.057 1.00 0.00 ? 68  GLY A HA3  3  
ATOM   2709  N  N    . SER A 1 5  ? 11.125  14.001  -15.036 1.00 0.00 ? 69  SER A N    3  
ATOM   2710  C  CA   . SER A 1 5  ? 10.183  14.660  -14.139 1.00 0.00 ? 69  SER A CA   3  
ATOM   2711  C  C    . SER A 1 5  ? 10.431  14.248  -12.692 1.00 0.00 ? 69  SER A C    3  
ATOM   2712  O  O    . SER A 1 5  ? 10.042  13.159  -12.270 1.00 0.00 ? 69  SER A O    3  
ATOM   2713  C  CB   . SER A 1 5  ? 8.745   14.322  -14.539 1.00 0.00 ? 69  SER A CB   3  
ATOM   2714  O  OG   . SER A 1 5  ? 7.841   15.310  -14.075 1.00 0.00 ? 69  SER A OG   3  
ATOM   2715  H  H    . SER A 1 5  ? 10.884  13.138  -15.433 1.00 0.00 ? 69  SER A H    3  
ATOM   2716  H  HA   . SER A 1 5  ? 10.331  15.726  -14.228 1.00 0.00 ? 69  SER A HA   3  
ATOM   2717  H  HB2  . SER A 1 5  ? 8.677   14.266  -15.615 1.00 0.00 ? 69  SER A HB2  3  
ATOM   2718  H  HB3  . SER A 1 5  ? 8.470   13.369  -14.110 1.00 0.00 ? 69  SER A HB3  3  
ATOM   2719  H  HG   . SER A 1 5  ? 8.185   16.182  -14.283 1.00 0.00 ? 69  SER A HG   3  
ATOM   2720  N  N    . SER A 1 6  ? 11.080  15.127  -11.935 1.00 0.00 ? 70  SER A N    3  
ATOM   2721  C  CA   . SER A 1 6  ? 11.384  14.854  -10.536 1.00 0.00 ? 70  SER A CA   3  
ATOM   2722  C  C    . SER A 1 6  ? 10.196  15.203  -9.644  1.00 0.00 ? 70  SER A C    3  
ATOM   2723  O  O    . SER A 1 6  ? 9.986   16.365  -9.296  1.00 0.00 ? 70  SER A O    3  
ATOM   2724  C  CB   . SER A 1 6  ? 12.617  15.647  -10.096 1.00 0.00 ? 70  SER A CB   3  
ATOM   2725  O  OG   . SER A 1 6  ? 12.875  15.463  -8.714  1.00 0.00 ? 70  SER A OG   3  
ATOM   2726  H  H    . SER A 1 6  ? 11.364  15.979  -12.330 1.00 0.00 ? 70  SER A H    3  
ATOM   2727  H  HA   . SER A 1 6  ? 11.592  13.799  -10.441 1.00 0.00 ? 70  SER A HA   3  
ATOM   2728  H  HB2  . SER A 1 6  ? 13.476  15.312  -10.657 1.00 0.00 ? 70  SER A HB2  3  
ATOM   2729  H  HB3  . SER A 1 6  ? 12.451  16.698  -10.283 1.00 0.00 ? 70  SER A HB3  3  
ATOM   2730  H  HG   . SER A 1 6  ? 12.252  15.983  -8.201  1.00 0.00 ? 70  SER A HG   3  
ATOM   2731  N  N    . GLY A 1 7  ? 9.421   14.187  -9.277  1.00 0.00 ? 71  GLY A N    3  
ATOM   2732  C  CA   . GLY A 1 7  ? 8.264   14.406  -8.429  1.00 0.00 ? 71  GLY A CA   3  
ATOM   2733  C  C    . GLY A 1 7  ? 7.071   13.570  -8.849  1.00 0.00 ? 71  GLY A C    3  
ATOM   2734  O  O    . GLY A 1 7  ? 6.996   13.114  -9.990  1.00 0.00 ? 71  GLY A O    3  
ATOM   2735  H  H    . GLY A 1 7  ? 9.637   13.282  -9.584  1.00 0.00 ? 71  GLY A H    3  
ATOM   2736  H  HA2  . GLY A 1 7  ? 8.524   14.157  -7.411  1.00 0.00 ? 71  GLY A HA2  3  
ATOM   2737  H  HA3  . GLY A 1 7  ? 7.990   15.450  -8.475  1.00 0.00 ? 71  GLY A HA3  3  
ATOM   2738  N  N    . MET A 1 8  ? 6.138   13.367  -7.925  1.00 0.00 ? 72  MET A N    3  
ATOM   2739  C  CA   . MET A 1 8  ? 4.943   12.579  -8.206  1.00 0.00 ? 72  MET A CA   3  
ATOM   2740  C  C    . MET A 1 8  ? 5.313   11.155  -8.607  1.00 0.00 ? 72  MET A C    3  
ATOM   2741  O  O    . MET A 1 8  ? 4.864   10.654  -9.637  1.00 0.00 ? 72  MET A O    3  
ATOM   2742  C  CB   . MET A 1 8  ? 4.122   13.237  -9.318  1.00 0.00 ? 72  MET A CB   3  
ATOM   2743  C  CG   . MET A 1 8  ? 3.751   14.682  -9.025  1.00 0.00 ? 72  MET A CG   3  
ATOM   2744  S  SD   . MET A 1 8  ? 3.555   15.666  -10.523 1.00 0.00 ? 72  MET A SD   3  
ATOM   2745  C  CE   . MET A 1 8  ? 5.260   15.825  -11.049 1.00 0.00 ? 72  MET A CE   3  
ATOM   2746  H  H    . MET A 1 8  ? 6.254   13.757  -7.033  1.00 0.00 ? 72  MET A H    3  
ATOM   2747  H  HA   . MET A 1 8  ? 4.349   12.545  -7.305  1.00 0.00 ? 72  MET A HA   3  
ATOM   2748  H  HB2  . MET A 1 8  ? 4.694   13.213  -10.233 1.00 0.00 ? 72  MET A HB2  3  
ATOM   2749  H  HB3  . MET A 1 8  ? 3.211   12.675  -9.457  1.00 0.00 ? 72  MET A HB3  3  
ATOM   2750  H  HG2  . MET A 1 8  ? 2.820   14.697  -8.478  1.00 0.00 ? 72  MET A HG2  3  
ATOM   2751  H  HG3  . MET A 1 8  ? 4.529   15.123  -8.420  1.00 0.00 ? 72  MET A HG3  3  
ATOM   2752  H  HE1  . MET A 1 8  ? 5.661   14.847  -11.269 1.00 0.00 ? 72  MET A HE1  3  
ATOM   2753  H  HE2  . MET A 1 8  ? 5.307   16.441  -11.935 1.00 0.00 ? 72  MET A HE2  3  
ATOM   2754  H  HE3  . MET A 1 8  ? 5.838   16.284  -10.261 1.00 0.00 ? 72  MET A HE3  3  
ATOM   2755  N  N    . GLU A 1 9  ? 6.134   10.508  -7.785  1.00 0.00 ? 73  GLU A N    3  
ATOM   2756  C  CA   . GLU A 1 9  ? 6.564   9.141   -8.056  1.00 0.00 ? 73  GLU A CA   3  
ATOM   2757  C  C    . GLU A 1 9  ? 5.804   8.148   -7.181  1.00 0.00 ? 73  GLU A C    3  
ATOM   2758  O  O    . GLU A 1 9  ? 5.867   8.211   -5.953  1.00 0.00 ? 73  GLU A O    3  
ATOM   2759  C  CB   . GLU A 1 9  ? 8.069   9.000   -7.818  1.00 0.00 ? 73  GLU A CB   3  
ATOM   2760  C  CG   . GLU A 1 9  ? 8.445   8.881   -6.350  1.00 0.00 ? 73  GLU A CG   3  
ATOM   2761  C  CD   . GLU A 1 9  ? 9.840   9.401   -6.061  1.00 0.00 ? 73  GLU A CD   3  
ATOM   2762  O  OE1  . GLU A 1 9  ? 10.323  10.259  -6.829  1.00 0.00 ? 73  GLU A OE1  3  
ATOM   2763  O  OE2  . GLU A 1 9  ? 10.447  8.949   -5.068  1.00 0.00 ? 73  GLU A OE2  3  
ATOM   2764  H  H    . GLU A 1 9  ? 6.458   10.961  -6.979  1.00 0.00 ? 73  GLU A H    3  
ATOM   2765  H  HA   . GLU A 1 9  ? 6.351   8.926   -9.092  1.00 0.00 ? 73  GLU A HA   3  
ATOM   2766  H  HB2  . GLU A 1 9  ? 8.422   8.118   -8.331  1.00 0.00 ? 73  GLU A HB2  3  
ATOM   2767  H  HB3  . GLU A 1 9  ? 8.568   9.867   -8.226  1.00 0.00 ? 73  GLU A HB3  3  
ATOM   2768  H  HG2  . GLU A 1 9  ? 7.737   9.448   -5.764  1.00 0.00 ? 73  GLU A HG2  3  
ATOM   2769  H  HG3  . GLU A 1 9  ? 8.397   7.841   -6.063  1.00 0.00 ? 73  GLU A HG3  3  
ATOM   2770  N  N    . CYS A 1 10 ? 5.086   7.233   -7.823  1.00 0.00 ? 74  CYS A N    3  
ATOM   2771  C  CA   . CYS A 1 10 ? 4.312   6.227   -7.105  1.00 0.00 ? 74  CYS A CA   3  
ATOM   2772  C  C    . CYS A 1 10 ? 5.062   5.745   -5.867  1.00 0.00 ? 74  CYS A C    3  
ATOM   2773  O  O    . CYS A 1 10 ? 6.290   5.648   -5.871  1.00 0.00 ? 74  CYS A O    3  
ATOM   2774  C  CB   . CYS A 1 10 ? 4.003   5.042   -8.022  1.00 0.00 ? 74  CYS A CB   3  
ATOM   2775  S  SG   . CYS A 1 10 ? 2.782   3.874   -7.342  1.00 0.00 ? 74  CYS A SG   3  
ATOM   2776  H  H    . CYS A 1 10 ? 5.075   7.234   -8.803  1.00 0.00 ? 74  CYS A H    3  
ATOM   2777  H  HA   . CYS A 1 10 ? 3.384   6.681   -6.794  1.00 0.00 ? 74  CYS A HA   3  
ATOM   2778  H  HB2  . CYS A 1 10 ? 3.615   5.413   -8.959  1.00 0.00 ? 74  CYS A HB2  3  
ATOM   2779  H  HB3  . CYS A 1 10 ? 4.915   4.493   -8.208  1.00 0.00 ? 74  CYS A HB3  3  
ATOM   2780  N  N    . ARG A 1 11 ? 4.316   5.443   -4.810  1.00 0.00 ? 75  ARG A N    3  
ATOM   2781  C  CA   . ARG A 1 11 ? 4.910   4.972   -3.565  1.00 0.00 ? 75  ARG A CA   3  
ATOM   2782  C  C    . ARG A 1 11 ? 4.879   3.448   -3.490  1.00 0.00 ? 75  ARG A C    3  
ATOM   2783  O  O    . ARG A 1 11 ? 5.548   2.843   -2.652  1.00 0.00 ? 75  ARG A O    3  
ATOM   2784  C  CB   . ARG A 1 11 ? 4.171   5.567   -2.365  1.00 0.00 ? 75  ARG A CB   3  
ATOM   2785  C  CG   . ARG A 1 11 ? 4.293   7.078   -2.263  1.00 0.00 ? 75  ARG A CG   3  
ATOM   2786  C  CD   . ARG A 1 11 ? 5.522   7.485   -1.464  1.00 0.00 ? 75  ARG A CD   3  
ATOM   2787  N  NE   . ARG A 1 11 ? 5.536   6.879   -0.136  1.00 0.00 ? 75  ARG A NE   3  
ATOM   2788  C  CZ   . ARG A 1 11 ? 4.853   7.358   0.898   1.00 0.00 ? 75  ARG A CZ   3  
ATOM   2789  N  NH1  . ARG A 1 11 ? 4.105   8.444   0.757   1.00 0.00 ? 75  ARG A NH1  3  
ATOM   2790  N  NH2  . ARG A 1 11 ? 4.918   6.751   2.076   1.00 0.00 ? 75  ARG A NH2  3  
ATOM   2791  H  H    . ARG A 1 11 ? 3.343   5.541   -4.868  1.00 0.00 ? 75  ARG A H    3  
ATOM   2792  H  HA   . ARG A 1 11 ? 5.938   5.301   -3.542  1.00 0.00 ? 75  ARG A HA   3  
ATOM   2793  H  HB2  . ARG A 1 11 ? 3.123   5.317   -2.442  1.00 0.00 ? 75  ARG A HB2  3  
ATOM   2794  H  HB3  . ARG A 1 11 ? 4.570   5.133   -1.460  1.00 0.00 ? 75  ARG A HB3  3  
ATOM   2795  H  HG2  . ARG A 1 11 ? 4.371   7.492   -3.257  1.00 0.00 ? 75  ARG A HG2  3  
ATOM   2796  H  HG3  . ARG A 1 11 ? 3.412   7.469   -1.776  1.00 0.00 ? 75  ARG A HG3  3  
ATOM   2797  H  HD2  . ARG A 1 11 ? 6.404   7.172   -2.002  1.00 0.00 ? 75  ARG A HD2  3  
ATOM   2798  H  HD3  . ARG A 1 11 ? 5.527   8.560   -1.360  1.00 0.00 ? 75  ARG A HD3  3  
ATOM   2799  H  HE   . ARG A 1 11 ? 6.083   6.076   -0.009  1.00 0.00 ? 75  ARG A HE   3  
ATOM   2800  H  HH11 . ARG A 1 11 ? 4.054   8.903   -0.130  1.00 0.00 ? 75  ARG A HH11 3  
ATOM   2801  H  HH12 . ARG A 1 11 ? 3.591   8.802   1.537   1.00 0.00 ? 75  ARG A HH12 3  
ATOM   2802  H  HH21 . ARG A 1 11 ? 5.480   5.933   2.186   1.00 0.00 ? 75  ARG A HH21 3  
ATOM   2803  H  HH22 . ARG A 1 11 ? 4.403   7.112   2.853   1.00 0.00 ? 75  ARG A HH22 3  
ATOM   2804  N  N    . VAL A 1 12 ? 4.098   2.833   -4.373  1.00 0.00 ? 76  VAL A N    3  
ATOM   2805  C  CA   . VAL A 1 12 ? 3.980   1.380   -4.408  1.00 0.00 ? 76  VAL A CA   3  
ATOM   2806  C  C    . VAL A 1 12 ? 5.082   0.760   -5.259  1.00 0.00 ? 76  VAL A C    3  
ATOM   2807  O  O    . VAL A 1 12 ? 5.844   -0.085  -4.789  1.00 0.00 ? 76  VAL A O    3  
ATOM   2808  C  CB   . VAL A 1 12 ? 2.611   0.942   -4.960  1.00 0.00 ? 76  VAL A CB   3  
ATOM   2809  C  CG1  . VAL A 1 12 ? 2.547   -0.573  -5.088  1.00 0.00 ? 76  VAL A CG1  3  
ATOM   2810  C  CG2  . VAL A 1 12 ? 1.488   1.458   -4.072  1.00 0.00 ? 76  VAL A CG2  3  
ATOM   2811  H  H    . VAL A 1 12 ? 3.590   3.370   -5.016  1.00 0.00 ? 76  VAL A H    3  
ATOM   2812  H  HA   . VAL A 1 12 ? 4.071   1.013   -3.396  1.00 0.00 ? 76  VAL A HA   3  
ATOM   2813  H  HB   . VAL A 1 12 ? 2.488   1.369   -5.944  1.00 0.00 ? 76  VAL A HB   3  
ATOM   2814  H  HG11 . VAL A 1 12 ? 3.508   -0.996  -4.834  1.00 0.00 ? 76  VAL A HG11 3  
ATOM   2815  H  HG12 . VAL A 1 12 ? 1.793   -0.960  -4.418  1.00 0.00 ? 76  VAL A HG12 3  
ATOM   2816  H  HG13 . VAL A 1 12 ? 2.296   -0.837  -6.105  1.00 0.00 ? 76  VAL A HG13 3  
ATOM   2817  H  HG21 . VAL A 1 12 ? 1.349   0.784   -3.239  1.00 0.00 ? 76  VAL A HG21 3  
ATOM   2818  H  HG22 . VAL A 1 12 ? 1.745   2.439   -3.703  1.00 0.00 ? 76  VAL A HG22 3  
ATOM   2819  H  HG23 . VAL A 1 12 ? 0.574   1.516   -4.644  1.00 0.00 ? 76  VAL A HG23 3  
ATOM   2820  N  N    . CYS A 1 13 ? 5.161   1.185   -6.516  1.00 0.00 ? 77  CYS A N    3  
ATOM   2821  C  CA   . CYS A 1 13 ? 6.169   0.672   -7.435  1.00 0.00 ? 77  CYS A CA   3  
ATOM   2822  C  C    . CYS A 1 13 ? 7.373   1.607   -7.499  1.00 0.00 ? 77  CYS A C    3  
ATOM   2823  O  O    . CYS A 1 13 ? 8.520   1.163   -7.484  1.00 0.00 ? 77  CYS A O    3  
ATOM   2824  C  CB   . CYS A 1 13 ? 5.572   0.494   -8.833  1.00 0.00 ? 77  CYS A CB   3  
ATOM   2825  S  SG   . CYS A 1 13 ? 5.062   2.052   -9.627  1.00 0.00 ? 77  CYS A SG   3  
ATOM   2826  H  H    . CYS A 1 13 ? 4.524   1.860   -6.833  1.00 0.00 ? 77  CYS A H    3  
ATOM   2827  H  HA   . CYS A 1 13 ? 6.495   -0.289  -7.068  1.00 0.00 ? 77  CYS A HA   3  
ATOM   2828  H  HB2  . CYS A 1 13 ? 6.306   0.026   -9.472  1.00 0.00 ? 77  CYS A HB2  3  
ATOM   2829  H  HB3  . CYS A 1 13 ? 4.702   -0.142  -8.766  1.00 0.00 ? 77  CYS A HB3  3  
ATOM   2830  N  N    . GLY A 1 14 ? 7.102   2.907   -7.572  1.00 0.00 ? 78  GLY A N    3  
ATOM   2831  C  CA   . GLY A 1 14 ? 8.172   3.885   -7.637  1.00 0.00 ? 78  GLY A CA   3  
ATOM   2832  C  C    . GLY A 1 14 ? 8.113   4.727   -8.897  1.00 0.00 ? 78  GLY A C    3  
ATOM   2833  O  O    . GLY A 1 14 ? 8.528   5.886   -8.898  1.00 0.00 ? 78  GLY A O    3  
ATOM   2834  H  H    . GLY A 1 14 ? 6.168   3.204   -7.581  1.00 0.00 ? 78  GLY A H    3  
ATOM   2835  H  HA2  . GLY A 1 14 ? 8.103   4.536   -6.779  1.00 0.00 ? 78  GLY A HA2  3  
ATOM   2836  H  HA3  . GLY A 1 14 ? 9.120   3.368   -7.609  1.00 0.00 ? 78  GLY A HA3  3  
ATOM   2837  N  N    . ASP A 1 15 ? 7.596   4.143   -9.972  1.00 0.00 ? 79  ASP A N    3  
ATOM   2838  C  CA   . ASP A 1 15 ? 7.484   4.846   -11.245 1.00 0.00 ? 79  ASP A CA   3  
ATOM   2839  C  C    . ASP A 1 15 ? 6.799   6.196   -11.061 1.00 0.00 ? 79  ASP A C    3  
ATOM   2840  O  O    . ASP A 1 15 ? 6.336   6.527   -9.969  1.00 0.00 ? 79  ASP A O    3  
ATOM   2841  C  CB   . ASP A 1 15 ? 6.707   3.999   -12.254 1.00 0.00 ? 79  ASP A CB   3  
ATOM   2842  C  CG   . ASP A 1 15 ? 7.118   4.281   -13.685 1.00 0.00 ? 79  ASP A CG   3  
ATOM   2843  O  OD1  . ASP A 1 15 ? 8.333   4.417   -13.938 1.00 0.00 ? 79  ASP A OD1  3  
ATOM   2844  O  OD2  . ASP A 1 15 ? 6.224   4.368   -14.554 1.00 0.00 ? 79  ASP A OD2  3  
ATOM   2845  H  H    . ASP A 1 15 ? 7.282   3.216   -9.909  1.00 0.00 ? 79  ASP A H    3  
ATOM   2846  H  HA   . ASP A 1 15 ? 8.482   5.012   -11.621 1.00 0.00 ? 79  ASP A HA   3  
ATOM   2847  H  HB2  . ASP A 1 15 ? 6.884   2.953   -12.048 1.00 0.00 ? 79  ASP A HB2  3  
ATOM   2848  H  HB3  . ASP A 1 15 ? 5.652   4.208   -12.153 1.00 0.00 ? 79  ASP A HB3  3  
ATOM   2849  N  N    . LYS A 1 16 ? 6.738   6.975   -12.136 1.00 0.00 ? 80  LYS A N    3  
ATOM   2850  C  CA   . LYS A 1 16 ? 6.110   8.290   -12.095 1.00 0.00 ? 80  LYS A CA   3  
ATOM   2851  C  C    . LYS A 1 16 ? 4.599   8.166   -11.920 1.00 0.00 ? 80  LYS A C    3  
ATOM   2852  O  O    . LYS A 1 16 ? 3.895   7.719   -12.825 1.00 0.00 ? 80  LYS A O    3  
ATOM   2853  C  CB   . LYS A 1 16 ? 6.423   9.068   -13.375 1.00 0.00 ? 80  LYS A CB   3  
ATOM   2854  C  CG   . LYS A 1 16 ? 5.435   10.185  -13.665 1.00 0.00 ? 80  LYS A CG   3  
ATOM   2855  C  CD   . LYS A 1 16 ? 6.050   11.257  -14.549 1.00 0.00 ? 80  LYS A CD   3  
ATOM   2856  C  CE   . LYS A 1 16 ? 5.972   10.880  -16.020 1.00 0.00 ? 80  LYS A CE   3  
ATOM   2857  N  NZ   . LYS A 1 16 ? 7.023   11.562  -16.824 1.00 0.00 ? 80  LYS A NZ   3  
ATOM   2858  H  H    . LYS A 1 16 ? 7.125   6.656   -12.979 1.00 0.00 ? 80  LYS A H    3  
ATOM   2859  H  HA   . LYS A 1 16 ? 6.515   8.825   -11.250 1.00 0.00 ? 80  LYS A HA   3  
ATOM   2860  H  HB2  . LYS A 1 16 ? 7.409   9.501   -13.286 1.00 0.00 ? 80  LYS A HB2  3  
ATOM   2861  H  HB3  . LYS A 1 16 ? 6.415   8.382   -14.210 1.00 0.00 ? 80  LYS A HB3  3  
ATOM   2862  H  HG2  . LYS A 1 16 ? 4.574   9.770   -14.168 1.00 0.00 ? 80  LYS A HG2  3  
ATOM   2863  H  HG3  . LYS A 1 16 ? 5.128   10.633  -12.731 1.00 0.00 ? 80  LYS A HG3  3  
ATOM   2864  H  HD2  . LYS A 1 16 ? 5.517   12.184  -14.398 1.00 0.00 ? 80  LYS A HD2  3  
ATOM   2865  H  HD3  . LYS A 1 16 ? 7.087   11.387  -14.273 1.00 0.00 ? 80  LYS A HD3  3  
ATOM   2866  H  HE2  . LYS A 1 16 ? 6.098   9.812   -16.111 1.00 0.00 ? 80  LYS A HE2  3  
ATOM   2867  H  HE3  . LYS A 1 16 ? 5.001   11.161  -16.399 1.00 0.00 ? 80  LYS A HE3  3  
ATOM   2868  H  HZ1  . LYS A 1 16 ? 7.081   12.566  -16.559 1.00 0.00 ? 80  LYS A HZ1  3  
ATOM   2869  H  HZ2  . LYS A 1 16 ? 6.797   11.495  -17.837 1.00 0.00 ? 80  LYS A HZ2  3  
ATOM   2870  H  HZ3  . LYS A 1 16 ? 7.947   11.116  -16.656 1.00 0.00 ? 80  LYS A HZ3  3  
ATOM   2871  N  N    . ALA A 1 17 ? 4.109   8.565   -10.751 1.00 0.00 ? 81  ALA A N    3  
ATOM   2872  C  CA   . ALA A 1 17 ? 2.682   8.501   -10.459 1.00 0.00 ? 81  ALA A CA   3  
ATOM   2873  C  C    . ALA A 1 17 ? 1.872   9.244   -11.516 1.00 0.00 ? 81  ALA A C    3  
ATOM   2874  O  O    . ALA A 1 17 ? 2.432   9.821   -12.449 1.00 0.00 ? 81  ALA A O    3  
ATOM   2875  C  CB   . ALA A 1 17 ? 2.400   9.072   -9.077  1.00 0.00 ? 81  ALA A CB   3  
ATOM   2876  H  H    . ALA A 1 17 ? 4.721   8.911   -10.069 1.00 0.00 ? 81  ALA A H    3  
ATOM   2877  H  HA   . ALA A 1 17 ? 2.388   7.462   -10.459 1.00 0.00 ? 81  ALA A HA   3  
ATOM   2878  H  HB1  . ALA A 1 17 ? 2.290   10.144  -9.147  1.00 0.00 ? 81  ALA A HB1  3  
ATOM   2879  H  HB2  . ALA A 1 17 ? 1.489   8.641   -8.690  1.00 0.00 ? 81  ALA A HB2  3  
ATOM   2880  H  HB3  . ALA A 1 17 ? 3.220   8.836   -8.416  1.00 0.00 ? 81  ALA A HB3  3  
ATOM   2881  N  N    . SER A 1 18 ? 0.552   9.226   -11.365 1.00 0.00 ? 82  SER A N    3  
ATOM   2882  C  CA   . SER A 1 18 ? -0.335  9.894   -12.309 1.00 0.00 ? 82  SER A CA   3  
ATOM   2883  C  C    . SER A 1 18 ? -1.160  10.971  -11.611 1.00 0.00 ? 82  SER A C    3  
ATOM   2884  O  O    . SER A 1 18 ? -1.485  12.001  -12.201 1.00 0.00 ? 82  SER A O    3  
ATOM   2885  C  CB   . SER A 1 18 ? -1.263  8.878   -12.977 1.00 0.00 ? 82  SER A CB   3  
ATOM   2886  O  OG   . SER A 1 18 ? -0.605  8.206   -14.037 1.00 0.00 ? 82  SER A OG   3  
ATOM   2887  H  H    . SER A 1 18 ? 0.166   8.749   -10.600 1.00 0.00 ? 82  SER A H    3  
ATOM   2888  H  HA   . SER A 1 18 ? 0.277   10.361  -13.066 1.00 0.00 ? 82  SER A HA   3  
ATOM   2889  H  HB2  . SER A 1 18 ? -1.579  8.149   -12.246 1.00 0.00 ? 82  SER A HB2  3  
ATOM   2890  H  HB3  . SER A 1 18 ? -2.128  9.390   -13.373 1.00 0.00 ? 82  SER A HB3  3  
ATOM   2891  H  HG   . SER A 1 18 ? -1.240  7.994   -14.725 1.00 0.00 ? 82  SER A HG   3  
ATOM   2892  N  N    . GLY A 1 19 ? -1.497  10.724  -10.348 1.00 0.00 ? 83  GLY A N    3  
ATOM   2893  C  CA   . GLY A 1 19 ? -2.282  11.680  -9.589  1.00 0.00 ? 83  GLY A CA   3  
ATOM   2894  C  C    . GLY A 1 19 ? -2.284  11.379  -8.104  1.00 0.00 ? 83  GLY A C    3  
ATOM   2895  O  O    . GLY A 1 19 ? -1.328  10.809  -7.577  1.00 0.00 ? 83  GLY A O    3  
ATOM   2896  H  H    . GLY A 1 19 ? -1.211  9.886   -9.929  1.00 0.00 ? 83  GLY A H    3  
ATOM   2897  H  HA2  . GLY A 1 19 ? -1.874  12.668  -9.745  1.00 0.00 ? 83  GLY A HA2  3  
ATOM   2898  H  HA3  . GLY A 1 19 ? -3.299  11.660  -9.950  1.00 0.00 ? 83  GLY A HA3  3  
ATOM   2899  N  N    . PHE A 1 20 ? -3.360  11.763  -7.425  1.00 0.00 ? 84  PHE A N    3  
ATOM   2900  C  CA   . PHE A 1 20 ? -3.481  11.533  -5.990  1.00 0.00 ? 84  PHE A CA   3  
ATOM   2901  C  C    . PHE A 1 20 ? -4.730  10.715  -5.674  1.00 0.00 ? 84  PHE A C    3  
ATOM   2902  O  O    . PHE A 1 20 ? -5.851  11.134  -5.966  1.00 0.00 ? 84  PHE A O    3  
ATOM   2903  C  CB   . PHE A 1 20 ? -3.528  12.866  -5.241  1.00 0.00 ? 84  PHE A CB   3  
ATOM   2904  C  CG   . PHE A 1 20 ? -4.150  12.766  -3.877  1.00 0.00 ? 84  PHE A CG   3  
ATOM   2905  C  CD1  . PHE A 1 20 ? -5.527  12.791  -3.725  1.00 0.00 ? 84  PHE A CD1  3  
ATOM   2906  C  CD2  . PHE A 1 20 ? -3.357  12.647  -2.747  1.00 0.00 ? 84  PHE A CD2  3  
ATOM   2907  C  CE1  . PHE A 1 20 ? -6.102  12.698  -2.472  1.00 0.00 ? 84  PHE A CE1  3  
ATOM   2908  C  CE2  . PHE A 1 20 ? -3.927  12.553  -1.491  1.00 0.00 ? 84  PHE A CE2  3  
ATOM   2909  C  CZ   . PHE A 1 20 ? -5.301  12.580  -1.354  1.00 0.00 ? 84  PHE A CZ   3  
ATOM   2910  H  H    . PHE A 1 20 ? -4.090  12.213  -7.901  1.00 0.00 ? 84  PHE A H    3  
ATOM   2911  H  HA   . PHE A 1 20 ? -2.613  10.980  -5.669  1.00 0.00 ? 84  PHE A HA   3  
ATOM   2912  H  HB2  . PHE A 1 20 ? -2.522  13.238  -5.119  1.00 0.00 ? 84  PHE A HB2  3  
ATOM   2913  H  HB3  . PHE A 1 20 ? -4.103  13.575  -5.818  1.00 0.00 ? 84  PHE A HB3  3  
ATOM   2914  H  HD1  . PHE A 1 20 ? -6.155  12.883  -4.601  1.00 0.00 ? 84  PHE A HD1  3  
ATOM   2915  H  HD2  . PHE A 1 20 ? -2.282  12.627  -2.853  1.00 0.00 ? 84  PHE A HD2  3  
ATOM   2916  H  HE1  . PHE A 1 20 ? -7.177  12.720  -2.368  1.00 0.00 ? 84  PHE A HE1  3  
ATOM   2917  H  HE2  . PHE A 1 20 ? -3.298  12.462  -0.618  1.00 0.00 ? 84  PHE A HE2  3  
ATOM   2918  H  HZ   . PHE A 1 20 ? -5.748  12.507  -0.374  1.00 0.00 ? 84  PHE A HZ   3  
ATOM   2919  N  N    . HIS A 1 21 ? -4.528  9.545   -5.077  1.00 0.00 ? 85  HIS A N    3  
ATOM   2920  C  CA   . HIS A 1 21 ? -5.638  8.667   -4.721  1.00 0.00 ? 85  HIS A CA   3  
ATOM   2921  C  C    . HIS A 1 21 ? -5.340  7.913   -3.428  1.00 0.00 ? 85  HIS A C    3  
ATOM   2922  O  O    . HIS A 1 21 ? -4.184  7.632   -3.114  1.00 0.00 ? 85  HIS A O    3  
ATOM   2923  C  CB   . HIS A 1 21 ? -5.914  7.675   -5.851  1.00 0.00 ? 85  HIS A CB   3  
ATOM   2924  C  CG   . HIS A 1 21 ? -5.861  8.292   -7.215  1.00 0.00 ? 85  HIS A CG   3  
ATOM   2925  N  ND1  . HIS A 1 21 ? -6.810  9.180   -7.677  1.00 0.00 ? 85  HIS A ND1  3  
ATOM   2926  C  CD2  . HIS A 1 21 ? -4.964  8.146   -8.219  1.00 0.00 ? 85  HIS A CD2  3  
ATOM   2927  C  CE1  . HIS A 1 21 ? -6.500  9.552   -8.906  1.00 0.00 ? 85  HIS A CE1  3  
ATOM   2928  N  NE2  . HIS A 1 21 ? -5.384  8.939   -9.259  1.00 0.00 ? 85  HIS A NE2  3  
ATOM   2929  H  H    . HIS A 1 21 ? -3.612  9.266   -4.870  1.00 0.00 ? 85  HIS A H    3  
ATOM   2930  H  HA   . HIS A 1 21 ? -6.512  9.282   -4.571  1.00 0.00 ? 85  HIS A HA   3  
ATOM   2931  H  HB2  . HIS A 1 21 ? -5.178  6.886   -5.816  1.00 0.00 ? 85  HIS A HB2  3  
ATOM   2932  H  HB3  . HIS A 1 21 ? -6.898  7.250   -5.717  1.00 0.00 ? 85  HIS A HB3  3  
ATOM   2933  H  HD1  . HIS A 1 21 ? -7.594  9.490   -7.179  1.00 0.00 ? 85  HIS A HD1  3  
ATOM   2934  H  HD2  . HIS A 1 21 ? -4.082  7.521   -8.206  1.00 0.00 ? 85  HIS A HD2  3  
ATOM   2935  H  HE1  . HIS A 1 21 ? -7.062  10.240  -9.520  1.00 0.00 ? 85  HIS A HE1  3  
ATOM   2936  N  N    . TYR A 1 22 ? -6.391  7.589   -2.683  1.00 0.00 ? 86  TYR A N    3  
ATOM   2937  C  CA   . TYR A 1 22 ? -6.243  6.871   -1.423  1.00 0.00 ? 86  TYR A CA   3  
ATOM   2938  C  C    . TYR A 1 22 ? -5.266  7.591   -0.498  1.00 0.00 ? 86  TYR A C    3  
ATOM   2939  O  O    . TYR A 1 22 ? -4.516  6.959   0.245   1.00 0.00 ? 86  TYR A O    3  
ATOM   2940  C  CB   . TYR A 1 22 ? -5.760  5.442   -1.680  1.00 0.00 ? 86  TYR A CB   3  
ATOM   2941  C  CG   . TYR A 1 22 ? -6.561  4.713   -2.736  1.00 0.00 ? 86  TYR A CG   3  
ATOM   2942  C  CD1  . TYR A 1 22 ? -7.718  4.021   -2.403  1.00 0.00 ? 86  TYR A CD1  3  
ATOM   2943  C  CD2  . TYR A 1 22 ? -6.159  4.716   -4.066  1.00 0.00 ? 86  TYR A CD2  3  
ATOM   2944  C  CE1  . TYR A 1 22 ? -8.453  3.353   -3.363  1.00 0.00 ? 86  TYR A CE1  3  
ATOM   2945  C  CE2  . TYR A 1 22 ? -6.888  4.052   -5.033  1.00 0.00 ? 86  TYR A CE2  3  
ATOM   2946  C  CZ   . TYR A 1 22 ? -8.034  3.372   -4.677  1.00 0.00 ? 86  TYR A CZ   3  
ATOM   2947  O  OH   . TYR A 1 22 ? -8.762  2.708   -5.638  1.00 0.00 ? 86  TYR A OH   3  
ATOM   2948  H  H    . TYR A 1 22 ? -7.289  7.840   -2.987  1.00 0.00 ? 86  TYR A H    3  
ATOM   2949  H  HA   . TYR A 1 22 ? -7.211  6.833   -0.947  1.00 0.00 ? 86  TYR A HA   3  
ATOM   2950  H  HB2  . TYR A 1 22 ? -4.732  5.470   -2.005  1.00 0.00 ? 86  TYR A HB2  3  
ATOM   2951  H  HB3  . TYR A 1 22 ? -5.827  4.876   -0.763  1.00 0.00 ? 86  TYR A HB3  3  
ATOM   2952  H  HD1  . TYR A 1 22 ? -8.044  4.008   -1.372  1.00 0.00 ? 86  TYR A HD1  3  
ATOM   2953  H  HD2  . TYR A 1 22 ? -5.261  5.250   -4.341  1.00 0.00 ? 86  TYR A HD2  3  
ATOM   2954  H  HE1  . TYR A 1 22 ? -9.350  2.820   -3.085  1.00 0.00 ? 86  TYR A HE1  3  
ATOM   2955  H  HE2  . TYR A 1 22 ? -6.560  4.067   -6.062  1.00 0.00 ? 86  TYR A HE2  3  
ATOM   2956  H  HH   . TYR A 1 22 ? -8.191  2.091   -6.102  1.00 0.00 ? 86  TYR A HH   3  
ATOM   2957  N  N    . GLY A 1 23 ? -5.283  8.919   -0.548  1.00 0.00 ? 87  GLY A N    3  
ATOM   2958  C  CA   . GLY A 1 23 ? -4.397  9.705   0.290   1.00 0.00 ? 87  GLY A CA   3  
ATOM   2959  C  C    . GLY A 1 23 ? -2.936  9.374   0.058   1.00 0.00 ? 87  GLY A C    3  
ATOM   2960  O  O    . GLY A 1 23 ? -2.070  9.772   0.838   1.00 0.00 ? 87  GLY A O    3  
ATOM   2961  H  H    . GLY A 1 23 ? -5.903  9.370   -1.159  1.00 0.00 ? 87  GLY A H    3  
ATOM   2962  H  HA2  . GLY A 1 23 ? -4.556  10.752  0.081   1.00 0.00 ? 87  GLY A HA2  3  
ATOM   2963  H  HA3  . GLY A 1 23 ? -4.637  9.514   1.326   1.00 0.00 ? 87  GLY A HA3  3  
ATOM   2964  N  N    . VAL A 1 24 ? -2.660  8.641   -1.016  1.00 0.00 ? 88  VAL A N    3  
ATOM   2965  C  CA   . VAL A 1 24 ? -1.293  8.256   -1.348  1.00 0.00 ? 88  VAL A CA   3  
ATOM   2966  C  C    . VAL A 1 24 ? -1.030  8.401   -2.843  1.00 0.00 ? 88  VAL A C    3  
ATOM   2967  O  O    . VAL A 1 24 ? -1.819  7.945   -3.671  1.00 0.00 ? 88  VAL A O    3  
ATOM   2968  C  CB   . VAL A 1 24 ? -1.000  6.804   -0.924  1.00 0.00 ? 88  VAL A CB   3  
ATOM   2969  C  CG1  . VAL A 1 24 ? -1.920  5.839   -1.656  1.00 0.00 ? 88  VAL A CG1  3  
ATOM   2970  C  CG2  . VAL A 1 24 ? 0.459   6.460   -1.179  1.00 0.00 ? 88  VAL A CG2  3  
ATOM   2971  H  H    . VAL A 1 24 ? -3.393  8.353   -1.599  1.00 0.00 ? 88  VAL A H    3  
ATOM   2972  H  HA   . VAL A 1 24 ? -0.622  8.909   -0.809  1.00 0.00 ? 88  VAL A HA   3  
ATOM   2973  H  HB   . VAL A 1 24 ? -1.190  6.715   0.135   1.00 0.00 ? 88  VAL A HB   3  
ATOM   2974  H  HG11 . VAL A 1 24 ? -1.948  4.897   -1.126  1.00 0.00 ? 88  VAL A HG11 3  
ATOM   2975  H  HG12 . VAL A 1 24 ? -2.916  6.255   -1.703  1.00 0.00 ? 88  VAL A HG12 3  
ATOM   2976  H  HG13 . VAL A 1 24 ? -1.549  5.677   -2.657  1.00 0.00 ? 88  VAL A HG13 3  
ATOM   2977  H  HG21 . VAL A 1 24 ? 0.565   5.389   -1.274  1.00 0.00 ? 88  VAL A HG21 3  
ATOM   2978  H  HG22 . VAL A 1 24 ? 0.787   6.936   -2.091  1.00 0.00 ? 88  VAL A HG22 3  
ATOM   2979  H  HG23 . VAL A 1 24 ? 1.062   6.809   -0.353  1.00 0.00 ? 88  VAL A HG23 3  
ATOM   2980  N  N    . HIS A 1 25 ? 0.087   9.038   -3.182  1.00 0.00 ? 89  HIS A N    3  
ATOM   2981  C  CA   . HIS A 1 25 ? 0.456   9.242   -4.579  1.00 0.00 ? 89  HIS A CA   3  
ATOM   2982  C  C    . HIS A 1 25 ? 0.730   7.909   -5.268  1.00 0.00 ? 89  HIS A C    3  
ATOM   2983  O  O    . HIS A 1 25 ? 1.830   7.365   -5.174  1.00 0.00 ? 89  HIS A O    3  
ATOM   2984  C  CB   . HIS A 1 25 ? 1.688   10.142  -4.676  1.00 0.00 ? 89  HIS A CB   3  
ATOM   2985  C  CG   . HIS A 1 25 ? 1.376   11.600  -4.531  1.00 0.00 ? 89  HIS A CG   3  
ATOM   2986  N  ND1  . HIS A 1 25 ? 1.162   12.206  -3.311  1.00 0.00 ? 89  HIS A ND1  3  
ATOM   2987  C  CD2  . HIS A 1 25 ? 1.245   12.574  -5.462  1.00 0.00 ? 89  HIS A CD2  3  
ATOM   2988  C  CE1  . HIS A 1 25 ? 0.911   13.490  -3.498  1.00 0.00 ? 89  HIS A CE1  3  
ATOM   2989  N  NE2  . HIS A 1 25 ? 0.956   13.739  -4.794  1.00 0.00 ? 89  HIS A NE2  3  
ATOM   2990  H  H    . HIS A 1 25 ? 0.676   9.378   -2.477  1.00 0.00 ? 89  HIS A H    3  
ATOM   2991  H  HA   . HIS A 1 25 ? -0.373  9.725   -5.074  1.00 0.00 ? 89  HIS A HA   3  
ATOM   2992  H  HB2  . HIS A 1 25 ? 2.385   9.873   -3.896  1.00 0.00 ? 89  HIS A HB2  3  
ATOM   2993  H  HB3  . HIS A 1 25 ? 2.157   9.996   -5.638  1.00 0.00 ? 89  HIS A HB3  3  
ATOM   2994  H  HD1  . HIS A 1 25 ? 1.189   11.761  -2.439  1.00 0.00 ? 89  HIS A HD1  3  
ATOM   2995  H  HD2  . HIS A 1 25 ? 1.348   12.458  -6.532  1.00 0.00 ? 89  HIS A HD2  3  
ATOM   2996  H  HE1  . HIS A 1 25 ? 0.705   14.213  -2.723  1.00 0.00 ? 89  HIS A HE1  3  
ATOM   2997  N  N    . ALA A 1 26 ? -0.278  7.388   -5.961  1.00 0.00 ? 90  ALA A N    3  
ATOM   2998  C  CA   . ALA A 1 26 ? -0.144  6.120   -6.667  1.00 0.00 ? 90  ALA A CA   3  
ATOM   2999  C  C    . ALA A 1 26 ? -0.284  6.313   -8.173  1.00 0.00 ? 90  ALA A C    3  
ATOM   3000  O  O    . ALA A 1 26 ? -0.864  7.298   -8.632  1.00 0.00 ? 90  ALA A O    3  
ATOM   3001  C  CB   . ALA A 1 26 ? -1.178  5.124   -6.163  1.00 0.00 ? 90  ALA A CB   3  
ATOM   3002  H  H    . ALA A 1 26 ? -1.130  7.869   -5.999  1.00 0.00 ? 90  ALA A H    3  
ATOM   3003  H  HA   . ALA A 1 26 ? 0.837   5.721   -6.455  1.00 0.00 ? 90  ALA A HA   3  
ATOM   3004  H  HB1  . ALA A 1 26 ? -1.359  4.378   -6.922  1.00 0.00 ? 90  ALA A HB1  3  
ATOM   3005  H  HB2  . ALA A 1 26 ? -0.808  4.645   -5.268  1.00 0.00 ? 90  ALA A HB2  3  
ATOM   3006  H  HB3  . ALA A 1 26 ? -2.099  5.642   -5.940  1.00 0.00 ? 90  ALA A HB3  3  
ATOM   3007  N  N    . CYS A 1 27 ? 0.251   5.367   -8.939  1.00 0.00 ? 91  CYS A N    3  
ATOM   3008  C  CA   . CYS A 1 27 ? 0.187   5.434   -10.394 1.00 0.00 ? 91  CYS A CA   3  
ATOM   3009  C  C    . CYS A 1 27 ? -1.007  4.643   -10.922 1.00 0.00 ? 91  CYS A C    3  
ATOM   3010  O  O    . CYS A 1 27 ? -1.561  3.796   -10.223 1.00 0.00 ? 91  CYS A O    3  
ATOM   3011  C  CB   . CYS A 1 27 ? 1.481   4.895   -11.007 1.00 0.00 ? 91  CYS A CB   3  
ATOM   3012  S  SG   . CYS A 1 27 ? 1.648   3.083   -10.919 1.00 0.00 ? 91  CYS A SG   3  
ATOM   3013  H  H    . CYS A 1 27 ? 0.700   4.606   -8.514  1.00 0.00 ? 91  CYS A H    3  
ATOM   3014  H  HA   . CYS A 1 27 ? 0.070   6.469   -10.674 1.00 0.00 ? 91  CYS A HA   3  
ATOM   3015  H  HB2  . CYS A 1 27 ? 1.522   5.178   -12.049 1.00 0.00 ? 91  CYS A HB2  3  
ATOM   3016  H  HB3  . CYS A 1 27 ? 2.324   5.329   -10.489 1.00 0.00 ? 91  CYS A HB3  3  
ATOM   3017  N  N    . GLU A 1 28 ? -1.395  4.927   -12.162 1.00 0.00 ? 92  GLU A N    3  
ATOM   3018  C  CA   . GLU A 1 28 ? -2.523  4.243   -12.783 1.00 0.00 ? 92  GLU A CA   3  
ATOM   3019  C  C    . GLU A 1 28 ? -2.422  2.733   -12.582 1.00 0.00 ? 92  GLU A C    3  
ATOM   3020  O  O    . GLU A 1 28 ? -3.325  2.108   -12.029 1.00 0.00 ? 92  GLU A O    3  
ATOM   3021  C  CB   . GLU A 1 28 ? -2.583  4.566   -14.278 1.00 0.00 ? 92  GLU A CB   3  
ATOM   3022  C  CG   . GLU A 1 28 ? -3.340  5.845   -14.594 1.00 0.00 ? 92  GLU A CG   3  
ATOM   3023  C  CD   . GLU A 1 28 ? -4.831  5.618   -14.748 1.00 0.00 ? 92  GLU A CD   3  
ATOM   3024  O  OE1  . GLU A 1 28 ? -5.553  5.711   -13.734 1.00 0.00 ? 92  GLU A OE1  3  
ATOM   3025  O  OE2  . GLU A 1 28 ? -5.276  5.346   -15.883 1.00 0.00 ? 92  GLU A OE2  3  
ATOM   3026  H  H    . GLU A 1 28 ? -0.912  5.612   -12.669 1.00 0.00 ? 92  GLU A H    3  
ATOM   3027  H  HA   . GLU A 1 28 ? -3.427  4.597   -12.311 1.00 0.00 ? 92  GLU A HA   3  
ATOM   3028  H  HB2  . GLU A 1 28 ? -1.575  4.666   -14.653 1.00 0.00 ? 92  GLU A HB2  3  
ATOM   3029  H  HB3  . GLU A 1 28 ? -3.069  3.749   -14.791 1.00 0.00 ? 92  GLU A HB3  3  
ATOM   3030  H  HG2  . GLU A 1 28 ? -3.180  6.550   -13.792 1.00 0.00 ? 92  GLU A HG2  3  
ATOM   3031  H  HG3  . GLU A 1 28 ? -2.956  6.257   -15.515 1.00 0.00 ? 92  GLU A HG3  3  
ATOM   3032  N  N    . GLY A 1 29 ? -1.314  2.154   -13.036 1.00 0.00 ? 93  GLY A N    3  
ATOM   3033  C  CA   . GLY A 1 29 ? -1.115  0.723   -12.898 1.00 0.00 ? 93  GLY A CA   3  
ATOM   3034  C  C    . GLY A 1 29 ? -1.465  0.221   -11.511 1.00 0.00 ? 93  GLY A C    3  
ATOM   3035  O  O    . GLY A 1 29 ? -2.484  -0.445  -11.323 1.00 0.00 ? 93  GLY A O    3  
ATOM   3036  H  H    . GLY A 1 29 ? -0.627  2.703   -13.469 1.00 0.00 ? 93  GLY A H    3  
ATOM   3037  H  HA2  . GLY A 1 29 ? -1.733  0.213   -13.621 1.00 0.00 ? 93  GLY A HA2  3  
ATOM   3038  H  HA3  . GLY A 1 29 ? -0.079  0.495   -13.100 1.00 0.00 ? 93  GLY A HA3  3  
ATOM   3039  N  N    . CYS A 1 30 ? -0.618  0.538   -10.538 1.00 0.00 ? 94  CYS A N    3  
ATOM   3040  C  CA   . CYS A 1 30 ? -0.841  0.113   -9.161  1.00 0.00 ? 94  CYS A CA   3  
ATOM   3041  C  C    . CYS A 1 30 ? -2.294  0.338   -8.751  1.00 0.00 ? 94  CYS A C    3  
ATOM   3042  O  O    . CYS A 1 30 ? -2.963  -0.576  -8.268  1.00 0.00 ? 94  CYS A O    3  
ATOM   3043  C  CB   . CYS A 1 30 ? 0.091   0.870   -8.214  1.00 0.00 ? 94  CYS A CB   3  
ATOM   3044  S  SG   . CYS A 1 30 ? 1.850   0.433   -8.395  1.00 0.00 ? 94  CYS A SG   3  
ATOM   3045  H  H    . CYS A 1 30 ? 0.177   1.071   -10.750 1.00 0.00 ? 94  CYS A H    3  
ATOM   3046  H  HA   . CYS A 1 30 ? -0.622  -0.943  -9.100  1.00 0.00 ? 94  CYS A HA   3  
ATOM   3047  H  HB2  . CYS A 1 30 ? -0.004  1.930   -8.399  1.00 0.00 ? 94  CYS A HB2  3  
ATOM   3048  H  HB3  . CYS A 1 30 ? -0.196  0.661   -7.194  1.00 0.00 ? 94  CYS A HB3  3  
ATOM   3049  N  N    . LYS A 1 31 ? -2.775  1.561   -8.946  1.00 0.00 ? 95  LYS A N    3  
ATOM   3050  C  CA   . LYS A 1 31 ? -4.148  1.908   -8.599  1.00 0.00 ? 95  LYS A CA   3  
ATOM   3051  C  C    . LYS A 1 31 ? -5.092  0.746   -8.887  1.00 0.00 ? 95  LYS A C    3  
ATOM   3052  O  O    . LYS A 1 31 ? -5.787  0.261   -7.995  1.00 0.00 ? 95  LYS A O    3  
ATOM   3053  C  CB   . LYS A 1 31 ? -4.595  3.148   -9.377  1.00 0.00 ? 95  LYS A CB   3  
ATOM   3054  C  CG   . LYS A 1 31 ? -5.943  3.690   -8.935  1.00 0.00 ? 95  LYS A CG   3  
ATOM   3055  C  CD   . LYS A 1 31 ? -6.426  4.799   -9.854  1.00 0.00 ? 95  LYS A CD   3  
ATOM   3056  C  CE   . LYS A 1 31 ? -7.371  5.749   -9.132  1.00 0.00 ? 95  LYS A CE   3  
ATOM   3057  N  NZ   . LYS A 1 31 ? -8.521  5.027   -8.521  1.00 0.00 ? 95  LYS A NZ   3  
ATOM   3058  H  H    . LYS A 1 31 ? -2.192  2.247   -9.335  1.00 0.00 ? 95  LYS A H    3  
ATOM   3059  H  HA   . LYS A 1 31 ? -4.177  2.126   -7.542  1.00 0.00 ? 95  LYS A HA   3  
ATOM   3060  H  HB2  . LYS A 1 31 ? -3.857  3.926   -9.246  1.00 0.00 ? 95  LYS A HB2  3  
ATOM   3061  H  HB3  . LYS A 1 31 ? -4.657  2.896   -10.426 1.00 0.00 ? 95  LYS A HB3  3  
ATOM   3062  H  HG2  . LYS A 1 31 ? -6.665  2.887   -8.948  1.00 0.00 ? 95  LYS A HG2  3  
ATOM   3063  H  HG3  . LYS A 1 31 ? -5.853  4.079   -7.931  1.00 0.00 ? 95  LYS A HG3  3  
ATOM   3064  H  HD2  . LYS A 1 31 ? -5.573  5.359   -10.208 1.00 0.00 ? 95  LYS A HD2  3  
ATOM   3065  H  HD3  . LYS A 1 31 ? -6.944  4.359   -10.694 1.00 0.00 ? 95  LYS A HD3  3  
ATOM   3066  H  HE2  . LYS A 1 31 ? -6.823  6.259   -8.355  1.00 0.00 ? 95  LYS A HE2  3  
ATOM   3067  H  HE3  . LYS A 1 31 ? -7.745  6.471   -9.842  1.00 0.00 ? 95  LYS A HE3  3  
ATOM   3068  H  HZ1  . LYS A 1 31 ? -8.191  4.423   -7.742  1.00 0.00 ? 95  LYS A HZ1  3  
ATOM   3069  H  HZ2  . LYS A 1 31 ? -8.988  4.431   -9.234  1.00 0.00 ? 95  LYS A HZ2  3  
ATOM   3070  H  HZ3  . LYS A 1 31 ? -9.213  5.709   -8.149  1.00 0.00 ? 95  LYS A HZ3  3  
ATOM   3071  N  N    . GLY A 1 32 ? -5.112  0.302   -10.141 1.00 0.00 ? 96  GLY A N    3  
ATOM   3072  C  CA   . GLY A 1 32 ? -5.974  -0.801  -10.524 1.00 0.00 ? 96  GLY A CA   3  
ATOM   3073  C  C    . GLY A 1 32 ? -5.759  -2.031  -9.664  1.00 0.00 ? 96  GLY A C    3  
ATOM   3074  O  O    . GLY A 1 32 ? -6.718  -2.649  -9.201  1.00 0.00 ? 96  GLY A O    3  
ATOM   3075  H  H    . GLY A 1 32 ? -4.537  0.727   -10.811 1.00 0.00 ? 96  GLY A H    3  
ATOM   3076  H  HA2  . GLY A 1 32 ? -7.004  -0.487  -10.434 1.00 0.00 ? 96  GLY A HA2  3  
ATOM   3077  H  HA3  . GLY A 1 32 ? -5.775  -1.057  -11.554 1.00 0.00 ? 96  GLY A HA3  3  
ATOM   3078  N  N    . PHE A 1 33 ? -4.497  -2.388  -9.450  1.00 0.00 ? 97  PHE A N    3  
ATOM   3079  C  CA   . PHE A 1 33 ? -4.159  -3.554  -8.643  1.00 0.00 ? 97  PHE A CA   3  
ATOM   3080  C  C    . PHE A 1 33 ? -4.861  -3.500  -7.289  1.00 0.00 ? 97  PHE A C    3  
ATOM   3081  O  O    . PHE A 1 33 ? -5.745  -4.308  -7.003  1.00 0.00 ? 97  PHE A O    3  
ATOM   3082  C  CB   . PHE A 1 33 ? -2.645  -3.639  -8.441  1.00 0.00 ? 97  PHE A CB   3  
ATOM   3083  C  CG   . PHE A 1 33 ? -2.226  -4.730  -7.497  1.00 0.00 ? 97  PHE A CG   3  
ATOM   3084  C  CD1  . PHE A 1 33 ? -2.166  -4.498  -6.132  1.00 0.00 ? 97  PHE A CD1  3  
ATOM   3085  C  CD2  . PHE A 1 33 ? -1.891  -5.987  -7.975  1.00 0.00 ? 97  PHE A CD2  3  
ATOM   3086  C  CE1  . PHE A 1 33 ? -1.782  -5.500  -5.261  1.00 0.00 ? 97  PHE A CE1  3  
ATOM   3087  C  CE2  . PHE A 1 33 ? -1.507  -6.992  -7.108  1.00 0.00 ? 97  PHE A CE2  3  
ATOM   3088  C  CZ   . PHE A 1 33 ? -1.451  -6.749  -5.750  1.00 0.00 ? 97  PHE A CZ   3  
ATOM   3089  H  H    . PHE A 1 33 ? -3.776  -1.855  -9.846  1.00 0.00 ? 97  PHE A H    3  
ATOM   3090  H  HA   . PHE A 1 33 ? -4.493  -4.432  -9.173  1.00 0.00 ? 97  PHE A HA   3  
ATOM   3091  H  HB2  . PHE A 1 33 ? -2.172  -3.825  -9.393  1.00 0.00 ? 97  PHE A HB2  3  
ATOM   3092  H  HB3  . PHE A 1 33 ? -2.288  -2.700  -8.044  1.00 0.00 ? 97  PHE A HB3  3  
ATOM   3093  H  HD1  . PHE A 1 33 ? -2.425  -3.521  -5.749  1.00 0.00 ? 97  PHE A HD1  3  
ATOM   3094  H  HD2  . PHE A 1 33 ? -1.934  -6.179  -9.037  1.00 0.00 ? 97  PHE A HD2  3  
ATOM   3095  H  HE1  . PHE A 1 33 ? -1.739  -5.306  -4.200  1.00 0.00 ? 97  PHE A HE1  3  
ATOM   3096  H  HE2  . PHE A 1 33 ? -1.248  -7.968  -7.493  1.00 0.00 ? 97  PHE A HE2  3  
ATOM   3097  H  HZ   . PHE A 1 33 ? -1.151  -7.533  -5.071  1.00 0.00 ? 97  PHE A HZ   3  
ATOM   3098  N  N    . PHE A 1 34 ? -4.461  -2.543  -6.459  1.00 0.00 ? 98  PHE A N    3  
ATOM   3099  C  CA   . PHE A 1 34 ? -5.050  -2.383  -5.135  1.00 0.00 ? 98  PHE A CA   3  
ATOM   3100  C  C    . PHE A 1 34 ? -6.568  -2.528  -5.194  1.00 0.00 ? 98  PHE A C    3  
ATOM   3101  O  O    . PHE A 1 34 ? -7.133  -3.478  -4.650  1.00 0.00 ? 98  PHE A O    3  
ATOM   3102  C  CB   . PHE A 1 34 ? -4.679  -1.019  -4.549  1.00 0.00 ? 98  PHE A CB   3  
ATOM   3103  C  CG   . PHE A 1 34 ? -5.142  -0.830  -3.132  1.00 0.00 ? 98  PHE A CG   3  
ATOM   3104  C  CD1  . PHE A 1 34 ? -4.547  -1.530  -2.096  1.00 0.00 ? 98  PHE A CD1  3  
ATOM   3105  C  CD2  . PHE A 1 34 ? -6.172  0.049   -2.838  1.00 0.00 ? 98  PHE A CD2  3  
ATOM   3106  C  CE1  . PHE A 1 34 ? -4.970  -1.358  -0.791  1.00 0.00 ? 98  PHE A CE1  3  
ATOM   3107  C  CE2  . PHE A 1 34 ? -6.599  0.226   -1.535  1.00 0.00 ? 98  PHE A CE2  3  
ATOM   3108  C  CZ   . PHE A 1 34 ? -5.998  -0.479  -0.511  1.00 0.00 ? 98  PHE A CZ   3  
ATOM   3109  H  H    . PHE A 1 34 ? -3.752  -1.929  -6.744  1.00 0.00 ? 98  PHE A H    3  
ATOM   3110  H  HA   . PHE A 1 34 ? -4.651  -3.159  -4.500  1.00 0.00 ? 98  PHE A HA   3  
ATOM   3111  H  HB2  . PHE A 1 34 ? -3.606  -0.909  -4.564  1.00 0.00 ? 98  PHE A HB2  3  
ATOM   3112  H  HB3  . PHE A 1 34 ? -5.126  -0.243  -5.152  1.00 0.00 ? 98  PHE A HB3  3  
ATOM   3113  H  HD1  . PHE A 1 34 ? -3.742  -2.218  -2.314  1.00 0.00 ? 98  PHE A HD1  3  
ATOM   3114  H  HD2  . PHE A 1 34 ? -6.644  0.600   -3.638  1.00 0.00 ? 98  PHE A HD2  3  
ATOM   3115  H  HE1  . PHE A 1 34 ? -4.497  -1.911  0.007   1.00 0.00 ? 98  PHE A HE1  3  
ATOM   3116  H  HE2  . PHE A 1 34 ? -7.403  0.913   -1.319  1.00 0.00 ? 98  PHE A HE2  3  
ATOM   3117  H  HZ   . PHE A 1 34 ? -6.329  -0.342  0.508   1.00 0.00 ? 98  PHE A HZ   3  
ATOM   3118  N  N    . ARG A 1 35 ? -7.222  -1.580  -5.857  1.00 0.00 ? 99  ARG A N    3  
ATOM   3119  C  CA   . ARG A 1 35 ? -8.674  -1.600  -5.986  1.00 0.00 ? 99  ARG A CA   3  
ATOM   3120  C  C    . ARG A 1 35 ? -9.170  -3.003  -6.325  1.00 0.00 ? 99  ARG A C    3  
ATOM   3121  O  O    . ARG A 1 35 ? -9.927  -3.606  -5.563  1.00 0.00 ? 99  ARG A O    3  
ATOM   3122  C  CB   . ARG A 1 35 ? -9.125  -0.613  -7.064  1.00 0.00 ? 99  ARG A CB   3  
ATOM   3123  C  CG   . ARG A 1 35 ? -10.618 -0.329  -7.042  1.00 0.00 ? 99  ARG A CG   3  
ATOM   3124  C  CD   . ARG A 1 35 ? -11.052 0.463   -8.266  1.00 0.00 ? 99  ARG A CD   3  
ATOM   3125  N  NE   . ARG A 1 35 ? -12.474 0.793   -8.228  1.00 0.00 ? 99  ARG A NE   3  
ATOM   3126  C  CZ   . ARG A 1 35 ? -13.431 -0.026  -8.650  1.00 0.00 ? 99  ARG A CZ   3  
ATOM   3127  N  NH1  . ARG A 1 35 ? -13.119 -1.219  -9.138  1.00 0.00 ? 99  ARG A NH1  3  
ATOM   3128  N  NH2  . ARG A 1 35 ? -14.703 0.347   -8.583  1.00 0.00 ? 99  ARG A NH2  3  
ATOM   3129  H  H    . ARG A 1 35 ? -6.716  -0.849  -6.268  1.00 0.00 ? 99  ARG A H    3  
ATOM   3130  H  HA   . ARG A 1 35 ? -9.096  -1.302  -5.037  1.00 0.00 ? 99  ARG A HA   3  
ATOM   3131  H  HB2  . ARG A 1 35 ? -8.602  0.321   -6.922  1.00 0.00 ? 99  ARG A HB2  3  
ATOM   3132  H  HB3  . ARG A 1 35 ? -8.872  -1.016  -8.032  1.00 0.00 ? 99  ARG A HB3  3  
ATOM   3133  H  HG2  . ARG A 1 35 ? -11.154 -1.267  -7.026  1.00 0.00 ? 99  ARG A HG2  3  
ATOM   3134  H  HG3  . ARG A 1 35 ? -10.854 0.239   -6.154  1.00 0.00 ? 99  ARG A HG3  3  
ATOM   3135  H  HD2  . ARG A 1 35 ? -10.481 1.378   -8.307  1.00 0.00 ? 99  ARG A HD2  3  
ATOM   3136  H  HD3  . ARG A 1 35 ? -10.852 -0.127  -9.148  1.00 0.00 ? 99  ARG A HD3  3  
ATOM   3137  H  HE   . ARG A 1 35 ? -12.727 1.670   -7.871  1.00 0.00 ? 99  ARG A HE   3  
ATOM   3138  H  HH11 . ARG A 1 35 ? -12.162 -1.503  -9.189  1.00 0.00 ? 99  ARG A HH11 3  
ATOM   3139  H  HH12 . ARG A 1 35 ? -13.842 -1.834  -9.454  1.00 0.00 ? 99  ARG A HH12 3  
ATOM   3140  H  HH21 . ARG A 1 35 ? -14.941 1.245   -8.215  1.00 0.00 ? 99  ARG A HH21 3  
ATOM   3141  H  HH22 . ARG A 1 35 ? -15.422 -0.271  -8.900  1.00 0.00 ? 99  ARG A HH22 3  
ATOM   3142  N  N    . ARG A 1 36 ? -8.739  -3.516  -7.473  1.00 0.00 ? 100 ARG A N    3  
ATOM   3143  C  CA   . ARG A 1 36 ? -9.141  -4.846  -7.914  1.00 0.00 ? 100 ARG A CA   3  
ATOM   3144  C  C    . ARG A 1 36 ? -9.024  -5.855  -6.775  1.00 0.00 ? 100 ARG A C    3  
ATOM   3145  O  O    . ARG A 1 36 ? -9.954  -6.616  -6.506  1.00 0.00 ? 100 ARG A O    3  
ATOM   3146  C  CB   . ARG A 1 36 ? -8.282  -5.295  -9.098  1.00 0.00 ? 100 ARG A CB   3  
ATOM   3147  C  CG   . ARG A 1 36 ? -8.461  -6.760  -9.459  1.00 0.00 ? 100 ARG A CG   3  
ATOM   3148  C  CD   . ARG A 1 36 ? -8.026  -7.039  -10.889 1.00 0.00 ? 100 ARG A CD   3  
ATOM   3149  N  NE   . ARG A 1 36 ? -6.607  -7.371  -10.975 1.00 0.00 ? 100 ARG A NE   3  
ATOM   3150  C  CZ   . ARG A 1 36 ? -5.995  -7.697  -12.108 1.00 0.00 ? 100 ARG A CZ   3  
ATOM   3151  N  NH1  . ARG A 1 36 ? -6.676  -7.732  -13.246 1.00 0.00 ? 100 ARG A NH1  3  
ATOM   3152  N  NH2  . ARG A 1 36 ? -4.701  -7.987  -12.106 1.00 0.00 ? 100 ARG A NH2  3  
ATOM   3153  H  H    . ARG A 1 36 ? -8.137  -2.987  -8.037  1.00 0.00 ? 100 ARG A H    3  
ATOM   3154  H  HA   . ARG A 1 36 ? -10.172 -4.794  -8.228  1.00 0.00 ? 100 ARG A HA   3  
ATOM   3155  H  HB2  . ARG A 1 36 ? -8.540  -4.700  -9.961  1.00 0.00 ? 100 ARG A HB2  3  
ATOM   3156  H  HB3  . ARG A 1 36 ? -7.243  -5.131  -8.855  1.00 0.00 ? 100 ARG A HB3  3  
ATOM   3157  H  HG2  . ARG A 1 36 ? -7.864  -7.362  -8.790  1.00 0.00 ? 100 ARG A HG2  3  
ATOM   3158  H  HG3  . ARG A 1 36 ? -9.503  -7.023  -9.351  1.00 0.00 ? 100 ARG A HG3  3  
ATOM   3159  H  HD2  . ARG A 1 36 ? -8.604  -7.867  -11.272 1.00 0.00 ? 100 ARG A HD2  3  
ATOM   3160  H  HD3  . ARG A 1 36 ? -8.217  -6.160  -11.487 1.00 0.00 ? 100 ARG A HD3  3  
ATOM   3161  H  HE   . ARG A 1 36 ? -6.085  -7.351  -10.146 1.00 0.00 ? 100 ARG A HE   3  
ATOM   3162  H  HH11 . ARG A 1 36 ? -7.651  -7.513  -13.251 1.00 0.00 ? 100 ARG A HH11 3  
ATOM   3163  H  HH12 . ARG A 1 36 ? -6.213  -7.977  -14.098 1.00 0.00 ? 100 ARG A HH12 3  
ATOM   3164  H  HH21 . ARG A 1 36 ? -4.184  -7.961  -11.250 1.00 0.00 ? 100 ARG A HH21 3  
ATOM   3165  H  HH22 . ARG A 1 36 ? -4.241  -8.232  -12.959 1.00 0.00 ? 100 ARG A HH22 3  
ATOM   3166  N  N    . THR A 1 37 ? -7.874  -5.856  -6.108  1.00 0.00 ? 101 THR A N    3  
ATOM   3167  C  CA   . THR A 1 37 ? -7.634  -6.772  -5.000  1.00 0.00 ? 101 THR A CA   3  
ATOM   3168  C  C    . THR A 1 37 ? -8.709  -6.632  -3.929  1.00 0.00 ? 101 THR A C    3  
ATOM   3169  O  O    . THR A 1 37 ? -9.004  -7.582  -3.204  1.00 0.00 ? 101 THR A O    3  
ATOM   3170  C  CB   . THR A 1 37 ? -6.253  -6.530  -4.361  1.00 0.00 ? 101 THR A CB   3  
ATOM   3171  O  OG1  . THR A 1 37 ? -5.228  -6.637  -5.354  1.00 0.00 ? 101 THR A OG1  3  
ATOM   3172  C  CG2  . THR A 1 37 ? -5.991  -7.530  -3.245  1.00 0.00 ? 101 THR A CG2  3  
ATOM   3173  H  H    . THR A 1 37 ? -7.170  -5.226  -6.370  1.00 0.00 ? 101 THR A H    3  
ATOM   3174  H  HA   . THR A 1 37 ? -7.656  -7.779  -5.389  1.00 0.00 ? 101 THR A HA   3  
ATOM   3175  H  HB   . THR A 1 37 ? -6.236  -5.534  -3.942  1.00 0.00 ? 101 THR A HB   3  
ATOM   3176  H  HG1  . THR A 1 37 ? -5.199  -5.829  -5.872  1.00 0.00 ? 101 THR A HG1  3  
ATOM   3177  H  HG21 . THR A 1 37 ? -6.761  -7.440  -2.493  1.00 0.00 ? 101 THR A HG21 3  
ATOM   3178  H  HG22 . THR A 1 37 ? -5.028  -7.329  -2.800  1.00 0.00 ? 101 THR A HG22 3  
ATOM   3179  H  HG23 . THR A 1 37 ? -6.000  -8.531  -3.650  1.00 0.00 ? 101 THR A HG23 3  
ATOM   3180  N  N    . ILE A 1 38 ? -9.292  -5.441  -3.834  1.00 0.00 ? 102 ILE A N    3  
ATOM   3181  C  CA   . ILE A 1 38 ? -10.336 -5.179  -2.852  1.00 0.00 ? 102 ILE A CA   3  
ATOM   3182  C  C    . ILE A 1 38 ? -11.694 -5.662  -3.350  1.00 0.00 ? 102 ILE A C    3  
ATOM   3183  O  O    . ILE A 1 38 ? -12.317 -6.531  -2.740  1.00 0.00 ? 102 ILE A O    3  
ATOM   3184  C  CB   . ILE A 1 38 ? -10.429 -3.678  -2.516  1.00 0.00 ? 102 ILE A CB   3  
ATOM   3185  C  CG1  . ILE A 1 38 ? -9.076  -3.158  -2.029  1.00 0.00 ? 102 ILE A CG1  3  
ATOM   3186  C  CG2  . ILE A 1 38 ? -11.505 -3.435  -1.469  1.00 0.00 ? 102 ILE A CG2  3  
ATOM   3187  C  CD1  . ILE A 1 38 ? -8.532  -3.913  -0.836  1.00 0.00 ? 102 ILE A CD1  3  
ATOM   3188  H  H    . ILE A 1 38 ? -9.014  -4.723  -4.440  1.00 0.00 ? 102 ILE A H    3  
ATOM   3189  H  HA   . ILE A 1 38 ? -10.085 -5.714  -1.948  1.00 0.00 ? 102 ILE A HA   3  
ATOM   3190  H  HB   . ILE A 1 38 ? -10.709 -3.148  -3.414  1.00 0.00 ? 102 ILE A HB   3  
ATOM   3191  H  HG12 . ILE A 1 38 ? -8.356  -3.239  -2.828  1.00 0.00 ? 102 ILE A HG12 3  
ATOM   3192  H  HG13 . ILE A 1 38 ? -9.179  -2.120  -1.746  1.00 0.00 ? 102 ILE A HG13 3  
ATOM   3193  H  HG21 . ILE A 1 38 ? -11.087 -2.872  -0.648  1.00 0.00 ? 102 ILE A HG21 3  
ATOM   3194  H  HG22 . ILE A 1 38 ? -12.318 -2.878  -1.910  1.00 0.00 ? 102 ILE A HG22 3  
ATOM   3195  H  HG23 . ILE A 1 38 ? -11.874 -4.383  -1.105  1.00 0.00 ? 102 ILE A HG23 3  
ATOM   3196  H  HD11 . ILE A 1 38 ? -8.166  -4.878  -1.158  1.00 0.00 ? 102 ILE A HD11 3  
ATOM   3197  H  HD12 . ILE A 1 38 ? -7.722  -3.352  -0.393  1.00 0.00 ? 102 ILE A HD12 3  
ATOM   3198  H  HD13 . ILE A 1 38 ? -9.317  -4.051  -0.108  1.00 0.00 ? 102 ILE A HD13 3  
ATOM   3199  N  N    . ARG A 1 39 ? -12.146 -5.094  -4.463  1.00 0.00 ? 103 ARG A N    3  
ATOM   3200  C  CA   . ARG A 1 39 ? -13.430 -5.467  -5.045  1.00 0.00 ? 103 ARG A CA   3  
ATOM   3201  C  C    . ARG A 1 39 ? -13.483 -6.965  -5.329  1.00 0.00 ? 103 ARG A C    3  
ATOM   3202  O  O    . ARG A 1 39 ? -14.561 -7.555  -5.403  1.00 0.00 ? 103 ARG A O    3  
ATOM   3203  C  CB   . ARG A 1 39 ? -13.676 -4.684  -6.335  1.00 0.00 ? 103 ARG A CB   3  
ATOM   3204  C  CG   . ARG A 1 39 ? -12.552 -4.812  -7.350  1.00 0.00 ? 103 ARG A CG   3  
ATOM   3205  C  CD   . ARG A 1 39 ? -12.822 -5.934  -8.340  1.00 0.00 ? 103 ARG A CD   3  
ATOM   3206  N  NE   . ARG A 1 39 ? -13.992 -5.663  -9.171  1.00 0.00 ? 103 ARG A NE   3  
ATOM   3207  C  CZ   . ARG A 1 39 ? -13.993 -4.800  -10.180 1.00 0.00 ? 103 ARG A CZ   3  
ATOM   3208  N  NH1  . ARG A 1 39 ? -12.890 -4.129  -10.484 1.00 0.00 ? 103 ARG A NH1  3  
ATOM   3209  N  NH2  . ARG A 1 39 ? -15.097 -4.607  -10.890 1.00 0.00 ? 103 ARG A NH2  3  
ATOM   3210  H  H    . ARG A 1 39 ? -11.603 -4.407  -4.904  1.00 0.00 ? 103 ARG A H    3  
ATOM   3211  H  HA   . ARG A 1 39 ? -14.201 -5.220  -4.331  1.00 0.00 ? 103 ARG A HA   3  
ATOM   3212  H  HB2  . ARG A 1 39 ? -14.587 -5.043  -6.792  1.00 0.00 ? 103 ARG A HB2  3  
ATOM   3213  H  HB3  . ARG A 1 39 ? -13.793 -3.639  -6.091  1.00 0.00 ? 103 ARG A HB3  3  
ATOM   3214  H  HG2  . ARG A 1 39 ? -12.461 -3.883  -7.893  1.00 0.00 ? 103 ARG A HG2  3  
ATOM   3215  H  HG3  . ARG A 1 39 ? -11.630 -5.018  -6.828  1.00 0.00 ? 103 ARG A HG3  3  
ATOM   3216  H  HD2  . ARG A 1 39 ? -11.958 -6.048  -8.979  1.00 0.00 ? 103 ARG A HD2  3  
ATOM   3217  H  HD3  . ARG A 1 39 ? -12.986 -6.849  -7.791  1.00 0.00 ? 103 ARG A HD3  3  
ATOM   3218  H  HE   . ARG A 1 39 ? -14.818 -6.148  -8.964  1.00 0.00 ? 103 ARG A HE   3  
ATOM   3219  H  HH11 . ARG A 1 39 ? -12.056 -4.273  -9.952  1.00 0.00 ? 103 ARG A HH11 3  
ATOM   3220  H  HH12 . ARG A 1 39 ? -12.893 -3.481  -11.246 1.00 0.00 ? 103 ARG A HH12 3  
ATOM   3221  H  HH21 . ARG A 1 39 ? -15.930 -5.112  -10.664 1.00 0.00 ? 103 ARG A HH21 3  
ATOM   3222  H  HH22 . ARG A 1 39 ? -15.097 -3.958  -11.649 1.00 0.00 ? 103 ARG A HH22 3  
ATOM   3223  N  N    . MET A 1 40 ? -12.312 -7.575  -5.487  1.00 0.00 ? 104 MET A N    3  
ATOM   3224  C  CA   . MET A 1 40 ? -12.226 -9.004  -5.762  1.00 0.00 ? 104 MET A CA   3  
ATOM   3225  C  C    . MET A 1 40 ? -11.949 -9.788  -4.483  1.00 0.00 ? 104 MET A C    3  
ATOM   3226  O  O    . MET A 1 40 ? -11.931 -11.019 -4.489  1.00 0.00 ? 104 MET A O    3  
ATOM   3227  C  CB   . MET A 1 40 ? -11.130 -9.282  -6.792  1.00 0.00 ? 104 MET A CB   3  
ATOM   3228  C  CG   . MET A 1 40 ? -11.393 -8.644  -8.147  1.00 0.00 ? 104 MET A CG   3  
ATOM   3229  S  SD   . MET A 1 40 ? -10.510 -9.469  -9.486  1.00 0.00 ? 104 MET A SD   3  
ATOM   3230  C  CE   . MET A 1 40 ? -11.855 -10.327 -10.300 1.00 0.00 ? 104 MET A CE   3  
ATOM   3231  H  H    . MET A 1 40 ? -11.487 -7.051  -5.416  1.00 0.00 ? 104 MET A H    3  
ATOM   3232  H  HA   . MET A 1 40 ? -13.176 -9.321  -6.166  1.00 0.00 ? 104 MET A HA   3  
ATOM   3233  H  HB2  . MET A 1 40 ? -10.193 -8.900  -6.415  1.00 0.00 ? 104 MET A HB2  3  
ATOM   3234  H  HB3  . MET A 1 40 ? -11.044 -10.349 -6.931  1.00 0.00 ? 104 MET A HB3  3  
ATOM   3235  H  HG2  . MET A 1 40 ? -12.452 -8.691  -8.352  1.00 0.00 ? 104 MET A HG2  3  
ATOM   3236  H  HG3  . MET A 1 40 ? -11.081 -7.611  -8.110  1.00 0.00 ? 104 MET A HG3  3  
ATOM   3237  H  HE1  . MET A 1 40 ? -12.197 -11.137 -9.672  1.00 0.00 ? 104 MET A HE1  3  
ATOM   3238  H  HE2  . MET A 1 40 ? -12.669 -9.639  -10.474 1.00 0.00 ? 104 MET A HE2  3  
ATOM   3239  H  HE3  . MET A 1 40 ? -11.510 -10.723 -11.243 1.00 0.00 ? 104 MET A HE3  3  
ATOM   3240  N  N    . LYS A 1 41 ? -11.732 -9.068  -3.388  1.00 0.00 ? 105 LYS A N    3  
ATOM   3241  C  CA   . LYS A 1 41 ? -11.456 -9.695  -2.101  1.00 0.00 ? 105 LYS A CA   3  
ATOM   3242  C  C    . LYS A 1 41 ? -10.531 -10.896 -2.268  1.00 0.00 ? 105 LYS A C    3  
ATOM   3243  O  O    . LYS A 1 41 ? -10.687 -11.912 -1.590  1.00 0.00 ? 105 LYS A O    3  
ATOM   3244  C  CB   . LYS A 1 41 ? -12.762 -10.133 -1.434  1.00 0.00 ? 105 LYS A CB   3  
ATOM   3245  C  CG   . LYS A 1 41 ? -13.675 -10.930 -2.349  1.00 0.00 ? 105 LYS A CG   3  
ATOM   3246  C  CD   . LYS A 1 41 ? -14.988 -11.273 -1.665  1.00 0.00 ? 105 LYS A CD   3  
ATOM   3247  C  CE   . LYS A 1 41 ? -16.029 -10.184 -1.879  1.00 0.00 ? 105 LYS A CE   3  
ATOM   3248  N  NZ   . LYS A 1 41 ? -15.883 -9.077  -0.894  1.00 0.00 ? 105 LYS A NZ   3  
ATOM   3249  H  H    . LYS A 1 41 ? -11.759 -8.089  -3.447  1.00 0.00 ? 105 LYS A H    3  
ATOM   3250  H  HA   . LYS A 1 41 ? -10.968 -8.964  -1.474  1.00 0.00 ? 105 LYS A HA   3  
ATOM   3251  H  HB2  . LYS A 1 41 ? -12.526 -10.743 -0.574  1.00 0.00 ? 105 LYS A HB2  3  
ATOM   3252  H  HB3  . LYS A 1 41 ? -13.296 -9.253  -1.104  1.00 0.00 ? 105 LYS A HB3  3  
ATOM   3253  H  HG2  . LYS A 1 41 ? -13.884 -10.345 -3.232  1.00 0.00 ? 105 LYS A HG2  3  
ATOM   3254  H  HG3  . LYS A 1 41 ? -13.176 -11.846 -2.631  1.00 0.00 ? 105 LYS A HG3  3  
ATOM   3255  H  HD2  . LYS A 1 41 ? -15.365 -12.199 -2.072  1.00 0.00 ? 105 LYS A HD2  3  
ATOM   3256  H  HD3  . LYS A 1 41 ? -14.812 -11.388 -0.605  1.00 0.00 ? 105 LYS A HD3  3  
ATOM   3257  H  HE2  . LYS A 1 41 ? -15.915 -9.786  -2.875  1.00 0.00 ? 105 LYS A HE2  3  
ATOM   3258  H  HE3  . LYS A 1 41 ? -17.012 -10.620 -1.775  1.00 0.00 ? 105 LYS A HE3  3  
ATOM   3259  H  HZ1  . LYS A 1 41 ? -15.273 -8.330  -1.284  1.00 0.00 ? 105 LYS A HZ1  3  
ATOM   3260  H  HZ2  . LYS A 1 41 ? -15.457 -9.434  -0.015  1.00 0.00 ? 105 LYS A HZ2  3  
ATOM   3261  H  HZ3  . LYS A 1 41 ? -16.814 -8.669  -0.674  1.00 0.00 ? 105 LYS A HZ3  3  
ATOM   3262  N  N    . LEU A 1 42 ? -9.566  -10.772 -3.173  1.00 0.00 ? 106 LEU A N    3  
ATOM   3263  C  CA   . LEU A 1 42 ? -8.614  -11.847 -3.428  1.00 0.00 ? 106 LEU A CA   3  
ATOM   3264  C  C    . LEU A 1 42 ? -7.704  -12.066 -2.223  1.00 0.00 ? 106 LEU A C    3  
ATOM   3265  O  O    . LEU A 1 42 ? -7.190  -11.112 -1.641  1.00 0.00 ? 106 LEU A O    3  
ATOM   3266  C  CB   . LEU A 1 42 ? -7.772  -11.527 -4.665  1.00 0.00 ? 106 LEU A CB   3  
ATOM   3267  C  CG   . LEU A 1 42 ? -8.549  -11.261 -5.955  1.00 0.00 ? 106 LEU A CG   3  
ATOM   3268  C  CD1  . LEU A 1 42 ? -7.734  -10.392 -6.899  1.00 0.00 ? 106 LEU A CD1  3  
ATOM   3269  C  CD2  . LEU A 1 42 ? -8.930  -12.572 -6.628  1.00 0.00 ? 106 LEU A CD2  3  
ATOM   3270  H  H    . LEU A 1 42 ? -9.491  -9.938  -3.682  1.00 0.00 ? 106 LEU A H    3  
ATOM   3271  H  HA   . LEU A 1 42 ? -9.176  -12.751 -3.609  1.00 0.00 ? 106 LEU A HA   3  
ATOM   3272  H  HB2  . LEU A 1 42 ? -7.184  -10.649 -4.447  1.00 0.00 ? 106 LEU A HB2  3  
ATOM   3273  H  HB3  . LEU A 1 42 ? -7.113  -12.365 -4.841  1.00 0.00 ? 106 LEU A HB3  3  
ATOM   3274  H  HG   . LEU A 1 42 ? -9.461  -10.730 -5.716  1.00 0.00 ? 106 LEU A HG   3  
ATOM   3275  H  HD11 . LEU A 1 42 ? -6.685  -10.610 -6.774  1.00 0.00 ? 106 LEU A HD11 3  
ATOM   3276  H  HD12 . LEU A 1 42 ? -7.915  -9.351  -6.676  1.00 0.00 ? 106 LEU A HD12 3  
ATOM   3277  H  HD13 . LEU A 1 42 ? -8.026  -10.597 -7.919  1.00 0.00 ? 106 LEU A HD13 3  
ATOM   3278  H  HD21 . LEU A 1 42 ? -8.816  -12.474 -7.697  1.00 0.00 ? 106 LEU A HD21 3  
ATOM   3279  H  HD22 . LEU A 1 42 ? -9.957  -12.810 -6.396  1.00 0.00 ? 106 LEU A HD22 3  
ATOM   3280  H  HD23 . LEU A 1 42 ? -8.287  -13.362 -6.267  1.00 0.00 ? 106 LEU A HD23 3  
ATOM   3281  N  N    . GLU A 1 43 ? -7.509  -13.329 -1.857  1.00 0.00 ? 107 GLU A N    3  
ATOM   3282  C  CA   . GLU A 1 43 ? -6.660  -13.673 -0.723  1.00 0.00 ? 107 GLU A CA   3  
ATOM   3283  C  C    . GLU A 1 43 ? -5.245  -14.006 -1.184  1.00 0.00 ? 107 GLU A C    3  
ATOM   3284  O  O    . GLU A 1 43 ? -5.044  -14.533 -2.279  1.00 0.00 ? 107 GLU A O    3  
ATOM   3285  C  CB   . GLU A 1 43 ? -7.251  -14.858 0.044   1.00 0.00 ? 107 GLU A CB   3  
ATOM   3286  C  CG   . GLU A 1 43 ? -6.451  -15.245 1.276   1.00 0.00 ? 107 GLU A CG   3  
ATOM   3287  C  CD   . GLU A 1 43 ? -7.089  -16.380 2.054   1.00 0.00 ? 107 GLU A CD   3  
ATOM   3288  O  OE1  . GLU A 1 43 ? -8.335  -16.428 2.116   1.00 0.00 ? 107 GLU A OE1  3  
ATOM   3289  O  OE2  . GLU A 1 43 ? -6.343  -17.219 2.600   1.00 0.00 ? 107 GLU A OE2  3  
ATOM   3290  H  H    . GLU A 1 43 ? -7.947  -14.047 -2.362  1.00 0.00 ? 107 GLU A H    3  
ATOM   3291  H  HA   . GLU A 1 43 ? -6.620  -12.816 -0.067  1.00 0.00 ? 107 GLU A HA   3  
ATOM   3292  H  HB2  . GLU A 1 43 ? -8.254  -14.606 0.356   1.00 0.00 ? 107 GLU A HB2  3  
ATOM   3293  H  HB3  . GLU A 1 43 ? -7.293  -15.712 -0.615  1.00 0.00 ? 107 GLU A HB3  3  
ATOM   3294  H  HG2  . GLU A 1 43 ? -5.463  -15.553 0.967   1.00 0.00 ? 107 GLU A HG2  3  
ATOM   3295  H  HG3  . GLU A 1 43 ? -6.372  -14.384 1.924   1.00 0.00 ? 107 GLU A HG3  3  
ATOM   3296  N  N    . TYR A 1 44 ? -4.266  -13.696 -0.341  1.00 0.00 ? 108 TYR A N    3  
ATOM   3297  C  CA   . TYR A 1 44 ? -2.868  -13.959 -0.663  1.00 0.00 ? 108 TYR A CA   3  
ATOM   3298  C  C    . TYR A 1 44 ? -2.186  -14.729 0.464   1.00 0.00 ? 108 TYR A C    3  
ATOM   3299  O  O    . TYR A 1 44 ? -2.735  -14.866 1.557   1.00 0.00 ? 108 TYR A O    3  
ATOM   3300  C  CB   . TYR A 1 44 ? -2.126  -12.646 -0.920  1.00 0.00 ? 108 TYR A CB   3  
ATOM   3301  C  CG   . TYR A 1 44 ? -2.604  -11.913 -2.153  1.00 0.00 ? 108 TYR A CG   3  
ATOM   3302  C  CD1  . TYR A 1 44 ? -2.731  -12.569 -3.371  1.00 0.00 ? 108 TYR A CD1  3  
ATOM   3303  C  CD2  . TYR A 1 44 ? -2.930  -10.563 -2.099  1.00 0.00 ? 108 TYR A CD2  3  
ATOM   3304  C  CE1  . TYR A 1 44 ? -3.167  -11.903 -4.500  1.00 0.00 ? 108 TYR A CE1  3  
ATOM   3305  C  CE2  . TYR A 1 44 ? -3.368  -9.889  -3.223  1.00 0.00 ? 108 TYR A CE2  3  
ATOM   3306  C  CZ   . TYR A 1 44 ? -3.484  -10.563 -4.421  1.00 0.00 ? 108 TYR A CZ   3  
ATOM   3307  O  OH   . TYR A 1 44 ? -3.920  -9.895  -5.543  1.00 0.00 ? 108 TYR A OH   3  
ATOM   3308  H  H    . TYR A 1 44 ? -4.488  -13.278 0.517   1.00 0.00 ? 108 TYR A H    3  
ATOM   3309  H  HA   . TYR A 1 44 ? -2.842  -14.559 -1.561  1.00 0.00 ? 108 TYR A HA   3  
ATOM   3310  H  HB2  . TYR A 1 44 ? -2.261  -11.992 -0.073  1.00 0.00 ? 108 TYR A HB2  3  
ATOM   3311  H  HB3  . TYR A 1 44 ? -1.074  -12.854 -1.045  1.00 0.00 ? 108 TYR A HB3  3  
ATOM   3312  H  HD1  . TYR A 1 44 ? -2.483  -13.619 -3.429  1.00 0.00 ? 108 TYR A HD1  3  
ATOM   3313  H  HD2  . TYR A 1 44 ? -2.838  -10.038 -1.160  1.00 0.00 ? 108 TYR A HD2  3  
ATOM   3314  H  HE1  . TYR A 1 44 ? -3.259  -12.430 -5.438  1.00 0.00 ? 108 TYR A HE1  3  
ATOM   3315  H  HE2  . TYR A 1 44 ? -3.616  -8.839  -3.162  1.00 0.00 ? 108 TYR A HE2  3  
ATOM   3316  H  HH   . TYR A 1 44 ? -4.624  -9.289  -5.301  1.00 0.00 ? 108 TYR A HH   3  
ATOM   3317  N  N    . GLU A 1 45 ? -0.985  -15.228 0.188   1.00 0.00 ? 109 GLU A N    3  
ATOM   3318  C  CA   . GLU A 1 45 ? -0.227  -15.984 1.178   1.00 0.00 ? 109 GLU A CA   3  
ATOM   3319  C  C    . GLU A 1 45 ? 0.772   -15.086 1.902   1.00 0.00 ? 109 GLU A C    3  
ATOM   3320  O  O    . GLU A 1 45 ? 1.439   -14.256 1.284   1.00 0.00 ? 109 GLU A O    3  
ATOM   3321  C  CB   . GLU A 1 45 ? 0.508   -17.148 0.510   1.00 0.00 ? 109 GLU A CB   3  
ATOM   3322  C  CG   . GLU A 1 45 ? 1.686   -16.714 -0.344  1.00 0.00 ? 109 GLU A CG   3  
ATOM   3323  C  CD   . GLU A 1 45 ? 2.528   -17.883 -0.816  1.00 0.00 ? 109 GLU A CD   3  
ATOM   3324  O  OE1  . GLU A 1 45 ? 1.956   -18.827 -1.401  1.00 0.00 ? 109 GLU A OE1  3  
ATOM   3325  O  OE2  . GLU A 1 45 ? 3.757   -17.856 -0.600  1.00 0.00 ? 109 GLU A OE2  3  
ATOM   3326  H  H    . GLU A 1 45 ? -0.600  -15.085 -0.701  1.00 0.00 ? 109 GLU A H    3  
ATOM   3327  H  HA   . GLU A 1 45 ? -0.926  -16.379 1.900   1.00 0.00 ? 109 GLU A HA   3  
ATOM   3328  H  HB2  . GLU A 1 45 ? 0.872   -17.816 1.277   1.00 0.00 ? 109 GLU A HB2  3  
ATOM   3329  H  HB3  . GLU A 1 45 ? -0.188  -17.683 -0.119  1.00 0.00 ? 109 GLU A HB3  3  
ATOM   3330  H  HG2  . GLU A 1 45 ? 1.313   -16.187 -1.210  1.00 0.00 ? 109 GLU A HG2  3  
ATOM   3331  H  HG3  . GLU A 1 45 ? 2.311   -16.051 0.237   1.00 0.00 ? 109 GLU A HG3  3  
ATOM   3332  N  N    . LYS A 1 46 ? 0.869   -15.257 3.216   1.00 0.00 ? 110 LYS A N    3  
ATOM   3333  C  CA   . LYS A 1 46 ? 1.786   -14.464 4.025   1.00 0.00 ? 110 LYS A CA   3  
ATOM   3334  C  C    . LYS A 1 46 ? 3.217   -14.596 3.514   1.00 0.00 ? 110 LYS A C    3  
ATOM   3335  O  O    . LYS A 1 46 ? 3.752   -15.701 3.414   1.00 0.00 ? 110 LYS A O    3  
ATOM   3336  C  CB   . LYS A 1 46 ? 1.714   -14.901 5.490   1.00 0.00 ? 110 LYS A CB   3  
ATOM   3337  C  CG   . LYS A 1 46 ? 2.366   -13.920 6.450   1.00 0.00 ? 110 LYS A CG   3  
ATOM   3338  C  CD   . LYS A 1 46 ? 1.952   -14.188 7.887   1.00 0.00 ? 110 LYS A CD   3  
ATOM   3339  C  CE   . LYS A 1 46 ? 2.286   -13.012 8.792   1.00 0.00 ? 110 LYS A CE   3  
ATOM   3340  N  NZ   . LYS A 1 46 ? 3.721   -13.008 9.190   1.00 0.00 ? 110 LYS A NZ   3  
ATOM   3341  H  H    . LYS A 1 46 ? 0.311   -15.935 3.652   1.00 0.00 ? 110 LYS A H    3  
ATOM   3342  H  HA   . LYS A 1 46 ? 1.484   -13.430 3.951   1.00 0.00 ? 110 LYS A HA   3  
ATOM   3343  H  HB2  . LYS A 1 46 ? 0.677   -15.011 5.770   1.00 0.00 ? 110 LYS A HB2  3  
ATOM   3344  H  HB3  . LYS A 1 46 ? 2.209   -15.855 5.593   1.00 0.00 ? 110 LYS A HB3  3  
ATOM   3345  H  HG2  . LYS A 1 46 ? 3.439   -14.013 6.372   1.00 0.00 ? 110 LYS A HG2  3  
ATOM   3346  H  HG3  . LYS A 1 46 ? 2.069   -12.916 6.181   1.00 0.00 ? 110 LYS A HG3  3  
ATOM   3347  H  HD2  . LYS A 1 46 ? 0.887   -14.361 7.920   1.00 0.00 ? 110 LYS A HD2  3  
ATOM   3348  H  HD3  . LYS A 1 46 ? 2.473   -15.066 8.245   1.00 0.00 ? 110 LYS A HD3  3  
ATOM   3349  H  HE2  . LYS A 1 46 ? 2.065   -12.096 8.266   1.00 0.00 ? 110 LYS A HE2  3  
ATOM   3350  H  HE3  . LYS A 1 46 ? 1.675   -13.074 9.680   1.00 0.00 ? 110 LYS A HE3  3  
ATOM   3351  H  HZ1  . LYS A 1 46 ? 3.805   -12.960 10.225  1.00 0.00 ? 110 LYS A HZ1  3  
ATOM   3352  H  HZ2  . LYS A 1 46 ? 4.205   -12.187 8.774   1.00 0.00 ? 110 LYS A HZ2  3  
ATOM   3353  H  HZ3  . LYS A 1 46 ? 4.187   -13.876 8.855   1.00 0.00 ? 110 LYS A HZ3  3  
ATOM   3354  N  N    . CYS A 1 47 ? 3.833   -13.463 3.193   1.00 0.00 ? 111 CYS A N    3  
ATOM   3355  C  CA   . CYS A 1 47 ? 5.202   -13.452 2.693   1.00 0.00 ? 111 CYS A CA   3  
ATOM   3356  C  C    . CYS A 1 47 ? 6.132   -12.735 3.668   1.00 0.00 ? 111 CYS A C    3  
ATOM   3357  O  O    . CYS A 1 47 ? 6.189   -11.506 3.696   1.00 0.00 ? 111 CYS A O    3  
ATOM   3358  C  CB   . CYS A 1 47 ? 5.262   -12.774 1.323   1.00 0.00 ? 111 CYS A CB   3  
ATOM   3359  S  SG   . CYS A 1 47 ? 6.882   -12.900 0.500   1.00 0.00 ? 111 CYS A SG   3  
ATOM   3360  H  H    . CYS A 1 47 ? 3.354   -12.613 3.294   1.00 0.00 ? 111 CYS A H    3  
ATOM   3361  H  HA   . CYS A 1 47 ? 5.528   -14.476 2.592   1.00 0.00 ? 111 CYS A HA   3  
ATOM   3362  H  HB2  . CYS A 1 47 ? 4.528   -13.228 0.673   1.00 0.00 ? 111 CYS A HB2  3  
ATOM   3363  H  HB3  . CYS A 1 47 ? 5.032   -11.725 1.439   1.00 0.00 ? 111 CYS A HB3  3  
ATOM   3364  N  N    . GLU A 1 48 ? 6.857   -13.512 4.466   1.00 0.00 ? 112 GLU A N    3  
ATOM   3365  C  CA   . GLU A 1 48 ? 7.783   -12.951 5.443   1.00 0.00 ? 112 GLU A CA   3  
ATOM   3366  C  C    . GLU A 1 48 ? 8.937   -12.233 4.749   1.00 0.00 ? 112 GLU A C    3  
ATOM   3367  O  O    . GLU A 1 48 ? 9.404   -11.193 5.214   1.00 0.00 ? 112 GLU A O    3  
ATOM   3368  C  CB   . GLU A 1 48 ? 8.327   -14.053 6.355   1.00 0.00 ? 112 GLU A CB   3  
ATOM   3369  C  CG   . GLU A 1 48 ? 7.255   -14.748 7.176   1.00 0.00 ? 112 GLU A CG   3  
ATOM   3370  C  CD   . GLU A 1 48 ? 7.813   -15.863 8.040   1.00 0.00 ? 112 GLU A CD   3  
ATOM   3371  O  OE1  . GLU A 1 48 ? 8.149   -16.931 7.488   1.00 0.00 ? 112 GLU A OE1  3  
ATOM   3372  O  OE2  . GLU A 1 48 ? 7.914   -15.665 9.269   1.00 0.00 ? 112 GLU A OE2  3  
ATOM   3373  H  H    . GLU A 1 48 ? 6.767   -14.486 4.397   1.00 0.00 ? 112 GLU A H    3  
ATOM   3374  H  HA   . GLU A 1 48 ? 7.239   -12.237 6.043   1.00 0.00 ? 112 GLU A HA   3  
ATOM   3375  H  HB2  . GLU A 1 48 ? 8.823   -14.794 5.746   1.00 0.00 ? 112 GLU A HB2  3  
ATOM   3376  H  HB3  . GLU A 1 48 ? 9.046   -13.618 7.034   1.00 0.00 ? 112 GLU A HB3  3  
ATOM   3377  H  HG2  . GLU A 1 48 ? 6.781   -14.020 7.817   1.00 0.00 ? 112 GLU A HG2  3  
ATOM   3378  H  HG3  . GLU A 1 48 ? 6.520   -15.167 6.505   1.00 0.00 ? 112 GLU A HG3  3  
ATOM   3379  N  N    . ARG A 1 49 ? 9.391   -12.796 3.635   1.00 0.00 ? 113 ARG A N    3  
ATOM   3380  C  CA   . ARG A 1 49 ? 10.491  -12.212 2.877   1.00 0.00 ? 113 ARG A CA   3  
ATOM   3381  C  C    . ARG A 1 49 ? 10.305  -10.705 2.723   1.00 0.00 ? 113 ARG A C    3  
ATOM   3382  O  O    . ARG A 1 49 ? 11.270  -9.967  2.524   1.00 0.00 ? 113 ARG A O    3  
ATOM   3383  C  CB   . ARG A 1 49 ? 10.595  -12.867 1.499   1.00 0.00 ? 113 ARG A CB   3  
ATOM   3384  C  CG   . ARG A 1 49 ? 11.333  -14.196 1.510   1.00 0.00 ? 113 ARG A CG   3  
ATOM   3385  C  CD   . ARG A 1 49 ? 11.775  -14.600 0.112   1.00 0.00 ? 113 ARG A CD   3  
ATOM   3386  N  NE   . ARG A 1 49 ? 12.342  -15.945 0.085   1.00 0.00 ? 113 ARG A NE   3  
ATOM   3387  C  CZ   . ARG A 1 49 ? 12.855  -16.504 -1.006  1.00 0.00 ? 113 ARG A CZ   3  
ATOM   3388  N  NH1  . ARG A 1 49 ? 12.873  -15.837 -2.151  1.00 0.00 ? 113 ARG A NH1  3  
ATOM   3389  N  NH2  . ARG A 1 49 ? 13.353  -17.733 -0.951  1.00 0.00 ? 113 ARG A NH2  3  
ATOM   3390  H  H    . ARG A 1 49 ? 8.977   -13.625 3.314   1.00 0.00 ? 113 ARG A H    3  
ATOM   3391  H  HA   . ARG A 1 49 ? 11.405  -12.396 3.423   1.00 0.00 ? 113 ARG A HA   3  
ATOM   3392  H  HB2  . ARG A 1 49 ? 9.598   -13.038 1.118   1.00 0.00 ? 113 ARG A HB2  3  
ATOM   3393  H  HB3  . ARG A 1 49 ? 11.116  -12.196 0.833   1.00 0.00 ? 113 ARG A HB3  3  
ATOM   3394  H  HG2  . ARG A 1 49 ? 12.206  -14.107 2.140   1.00 0.00 ? 113 ARG A HG2  3  
ATOM   3395  H  HG3  . ARG A 1 49 ? 10.678  -14.958 1.905   1.00 0.00 ? 113 ARG A HG3  3  
ATOM   3396  H  HD2  . ARG A 1 49 ? 10.919  -14.567 -0.545  1.00 0.00 ? 113 ARG A HD2  3  
ATOM   3397  H  HD3  . ARG A 1 49 ? 12.520  -13.897 -0.232  1.00 0.00 ? 113 ARG A HD3  3  
ATOM   3398  H  HE   . ARG A 1 49 ? 12.340  -16.456 0.920   1.00 0.00 ? 113 ARG A HE   3  
ATOM   3399  H  HH11 . ARG A 1 49 ? 12.499  -14.911 -2.195  1.00 0.00 ? 113 ARG A HH11 3  
ATOM   3400  H  HH12 . ARG A 1 49 ? 13.261  -16.260 -2.971  1.00 0.00 ? 113 ARG A HH12 3  
ATOM   3401  H  HH21 . ARG A 1 49 ? 13.342  -18.239 -0.089  1.00 0.00 ? 113 ARG A HH21 3  
ATOM   3402  H  HH22 . ARG A 1 49 ? 13.739  -18.153 -1.772  1.00 0.00 ? 113 ARG A HH22 3  
ATOM   3403  N  N    . SER A 1 50 ? 9.058   -10.255 2.816   1.00 0.00 ? 114 SER A N    3  
ATOM   3404  C  CA   . SER A 1 50 ? 8.744   -8.838  2.682   1.00 0.00 ? 114 SER A CA   3  
ATOM   3405  C  C    . SER A 1 50 ? 9.421   -8.245  1.449   1.00 0.00 ? 114 SER A C    3  
ATOM   3406  O  O    . SER A 1 50 ? 10.007  -7.164  1.507   1.00 0.00 ? 114 SER A O    3  
ATOM   3407  C  CB   . SER A 1 50 ? 9.184   -8.076  3.934   1.00 0.00 ? 114 SER A CB   3  
ATOM   3408  O  OG   . SER A 1 50 ? 8.523   -8.566  5.088   1.00 0.00 ? 114 SER A OG   3  
ATOM   3409  H  H    . SER A 1 50 ? 8.331   -10.893 2.975   1.00 0.00 ? 114 SER A H    3  
ATOM   3410  H  HA   . SER A 1 50 ? 7.674   -8.744  2.572   1.00 0.00 ? 114 SER A HA   3  
ATOM   3411  H  HB2  . SER A 1 50 ? 10.249  -8.193  4.068   1.00 0.00 ? 114 SER A HB2  3  
ATOM   3412  H  HB3  . SER A 1 50 ? 8.949   -7.028  3.816   1.00 0.00 ? 114 SER A HB3  3  
ATOM   3413  H  HG   . SER A 1 50 ? 7.646   -8.873  4.848   1.00 0.00 ? 114 SER A HG   3  
ATOM   3414  N  N    . CYS A 1 51 ? 9.335   -8.962  0.334   1.00 0.00 ? 115 CYS A N    3  
ATOM   3415  C  CA   . CYS A 1 51 ? 9.937   -8.511  -0.915  1.00 0.00 ? 115 CYS A CA   3  
ATOM   3416  C  C    . CYS A 1 51 ? 9.799   -6.999  -1.070  1.00 0.00 ? 115 CYS A C    3  
ATOM   3417  O  O    . CYS A 1 51 ? 8.885   -6.388  -0.516  1.00 0.00 ? 115 CYS A O    3  
ATOM   3418  C  CB   . CYS A 1 51 ? 9.287   -9.218  -2.105  1.00 0.00 ? 115 CYS A CB   3  
ATOM   3419  S  SG   . CYS A 1 51 ? 9.045   -11.008 -1.864  1.00 0.00 ? 115 CYS A SG   3  
ATOM   3420  H  H    . CYS A 1 51 ? 8.854   -9.817  0.350   1.00 0.00 ? 115 CYS A H    3  
ATOM   3421  H  HA   . CYS A 1 51 ? 10.987  -8.762  -0.887  1.00 0.00 ? 115 CYS A HA   3  
ATOM   3422  H  HB2  . CYS A 1 51 ? 8.317   -8.778  -2.289  1.00 0.00 ? 115 CYS A HB2  3  
ATOM   3423  H  HB3  . CYS A 1 51 ? 9.909   -9.084  -2.977  1.00 0.00 ? 115 CYS A HB3  3  
ATOM   3424  N  N    . LYS A 1 52 ? 10.713  -6.401  -1.827  1.00 0.00 ? 116 LYS A N    3  
ATOM   3425  C  CA   . LYS A 1 52 ? 10.693  -4.962  -2.057  1.00 0.00 ? 116 LYS A CA   3  
ATOM   3426  C  C    . LYS A 1 52 ? 10.096  -4.637  -3.423  1.00 0.00 ? 116 LYS A C    3  
ATOM   3427  O  O    . LYS A 1 52 ? 10.676  -4.965  -4.458  1.00 0.00 ? 116 LYS A O    3  
ATOM   3428  C  CB   . LYS A 1 52 ? 12.109  -4.390  -1.960  1.00 0.00 ? 116 LYS A CB   3  
ATOM   3429  C  CG   . LYS A 1 52 ? 12.202  -2.925  -2.352  1.00 0.00 ? 116 LYS A CG   3  
ATOM   3430  C  CD   . LYS A 1 52 ? 13.632  -2.418  -2.277  1.00 0.00 ? 116 LYS A CD   3  
ATOM   3431  C  CE   . LYS A 1 52 ? 13.679  -0.920  -2.017  1.00 0.00 ? 116 LYS A CE   3  
ATOM   3432  N  NZ   . LYS A 1 52 ? 13.182  -0.578  -0.655  1.00 0.00 ? 116 LYS A NZ   3  
ATOM   3433  H  H    . LYS A 1 52 ? 11.417  -6.942  -2.242  1.00 0.00 ? 116 LYS A H    3  
ATOM   3434  H  HA   . LYS A 1 52 ? 10.079  -4.511  -1.293  1.00 0.00 ? 116 LYS A HA   3  
ATOM   3435  H  HB2  . LYS A 1 52 ? 12.456  -4.491  -0.942  1.00 0.00 ? 116 LYS A HB2  3  
ATOM   3436  H  HB3  . LYS A 1 52 ? 12.759  -4.957  -2.611  1.00 0.00 ? 116 LYS A HB3  3  
ATOM   3437  H  HG2  . LYS A 1 52 ? 11.842  -2.809  -3.363  1.00 0.00 ? 116 LYS A HG2  3  
ATOM   3438  H  HG3  . LYS A 1 52 ? 11.588  -2.343  -1.680  1.00 0.00 ? 116 LYS A HG3  3  
ATOM   3439  H  HD2  . LYS A 1 52 ? 14.145  -2.927  -1.475  1.00 0.00 ? 116 LYS A HD2  3  
ATOM   3440  H  HD3  . LYS A 1 52 ? 14.128  -2.627  -3.215  1.00 0.00 ? 116 LYS A HD3  3  
ATOM   3441  H  HE2  . LYS A 1 52 ? 14.700  -0.583  -2.113  1.00 0.00 ? 116 LYS A HE2  3  
ATOM   3442  H  HE3  . LYS A 1 52 ? 13.065  -0.420  -2.751  1.00 0.00 ? 116 LYS A HE3  3  
ATOM   3443  H  HZ1  . LYS A 1 52 ? 13.461  -1.315  0.023   1.00 0.00 ? 116 LYS A HZ1  3  
ATOM   3444  H  HZ2  . LYS A 1 52 ? 12.145  -0.503  -0.662  1.00 0.00 ? 116 LYS A HZ2  3  
ATOM   3445  H  HZ3  . LYS A 1 52 ? 13.582  0.331   -0.347  1.00 0.00 ? 116 LYS A HZ3  3  
ATOM   3446  N  N    . ILE A 1 53 ? 8.935   -3.991  -3.417  1.00 0.00 ? 117 ILE A N    3  
ATOM   3447  C  CA   . ILE A 1 53 ? 8.261   -3.621  -4.656  1.00 0.00 ? 117 ILE A CA   3  
ATOM   3448  C  C    . ILE A 1 53 ? 9.005   -2.498  -5.371  1.00 0.00 ? 117 ILE A C    3  
ATOM   3449  O  O    . ILE A 1 53 ? 8.803   -1.321  -5.076  1.00 0.00 ? 117 ILE A O    3  
ATOM   3450  C  CB   . ILE A 1 53 ? 6.810   -3.176  -4.396  1.00 0.00 ? 117 ILE A CB   3  
ATOM   3451  C  CG1  . ILE A 1 53 ? 6.095   -4.189  -3.499  1.00 0.00 ? 117 ILE A CG1  3  
ATOM   3452  C  CG2  . ILE A 1 53 ? 6.064   -3.006  -5.711  1.00 0.00 ? 117 ILE A CG2  3  
ATOM   3453  C  CD1  . ILE A 1 53 ? 5.722   -5.470  -4.213  1.00 0.00 ? 117 ILE A CD1  3  
ATOM   3454  H  H    . ILE A 1 53 ? 8.522   -3.757  -2.560  1.00 0.00 ? 117 ILE A H    3  
ATOM   3455  H  HA   . ILE A 1 53 ? 8.241   -4.491  -5.297  1.00 0.00 ? 117 ILE A HA   3  
ATOM   3456  H  HB   . ILE A 1 53 ? 6.834   -2.219  -3.897  1.00 0.00 ? 117 ILE A HB   3  
ATOM   3457  H  HG12 . ILE A 1 53 ? 6.739   -4.447  -2.673  1.00 0.00 ? 117 ILE A HG12 3  
ATOM   3458  H  HG13 . ILE A 1 53 ? 5.188   -3.744  -3.118  1.00 0.00 ? 117 ILE A HG13 3  
ATOM   3459  H  HG21 . ILE A 1 53 ? 6.521   -3.629  -6.466  1.00 0.00 ? 117 ILE A HG21 3  
ATOM   3460  H  HG22 . ILE A 1 53 ? 5.033   -3.298  -5.580  1.00 0.00 ? 117 ILE A HG22 3  
ATOM   3461  H  HG23 . ILE A 1 53 ? 6.110   -1.973  -6.020  1.00 0.00 ? 117 ILE A HG23 3  
ATOM   3462  H  HD11 . ILE A 1 53 ? 6.605   -5.904  -4.659  1.00 0.00 ? 117 ILE A HD11 3  
ATOM   3463  H  HD12 . ILE A 1 53 ? 5.298   -6.167  -3.505  1.00 0.00 ? 117 ILE A HD12 3  
ATOM   3464  H  HD13 . ILE A 1 53 ? 4.998   -5.254  -4.985  1.00 0.00 ? 117 ILE A HD13 3  
ATOM   3465  N  N    . GLN A 1 54 ? 9.863   -2.872  -6.315  1.00 0.00 ? 118 GLN A N    3  
ATOM   3466  C  CA   . GLN A 1 54 ? 10.636  -1.896  -7.074  1.00 0.00 ? 118 GLN A CA   3  
ATOM   3467  C  C    . GLN A 1 54 ? 9.975   -1.604  -8.417  1.00 0.00 ? 118 GLN A C    3  
ATOM   3468  O  O    . GLN A 1 54 ? 9.148   -2.380  -8.896  1.00 0.00 ? 118 GLN A O    3  
ATOM   3469  C  CB   . GLN A 1 54 ? 12.062  -2.402  -7.293  1.00 0.00 ? 118 GLN A CB   3  
ATOM   3470  C  CG   . GLN A 1 54 ? 12.817  -2.673  -6.001  1.00 0.00 ? 118 GLN A CG   3  
ATOM   3471  C  CD   . GLN A 1 54 ? 14.125  -3.404  -6.232  1.00 0.00 ? 118 GLN A CD   3  
ATOM   3472  O  OE1  . GLN A 1 54 ? 14.141  -4.613  -6.467  1.00 0.00 ? 118 GLN A OE1  3  
ATOM   3473  N  NE2  . GLN A 1 54 ? 15.231  -2.674  -6.165  1.00 0.00 ? 118 GLN A NE2  3  
ATOM   3474  H  H    . GLN A 1 54 ? 9.980   -3.826  -6.504  1.00 0.00 ? 118 GLN A H    3  
ATOM   3475  H  HA   . GLN A 1 54 ? 10.672  -0.983  -6.499  1.00 0.00 ? 118 GLN A HA   3  
ATOM   3476  H  HB2  . GLN A 1 54 ? 12.023  -3.319  -7.861  1.00 0.00 ? 118 GLN A HB2  3  
ATOM   3477  H  HB3  . GLN A 1 54 ? 12.612  -1.663  -7.856  1.00 0.00 ? 118 GLN A HB3  3  
ATOM   3478  H  HG2  . GLN A 1 54 ? 13.030  -1.731  -5.519  1.00 0.00 ? 118 GLN A HG2  3  
ATOM   3479  H  HG3  . GLN A 1 54 ? 12.194  -3.274  -5.355  1.00 0.00 ? 118 GLN A HG3  3  
ATOM   3480  H  HE21 . GLN A 1 54 ? 15.143  -1.716  -5.971  1.00 0.00 ? 118 GLN A HE21 3  
ATOM   3481  H  HE22 . GLN A 1 54 ? 16.091  -3.121  -6.309  1.00 0.00 ? 118 GLN A HE22 3  
ATOM   3482  N  N    . LYS A 1 55 ? 10.346  -0.480  -9.021  1.00 0.00 ? 119 LYS A N    3  
ATOM   3483  C  CA   . LYS A 1 55 ? 9.790   -0.085  -10.310 1.00 0.00 ? 119 LYS A CA   3  
ATOM   3484  C  C    . LYS A 1 55 ? 10.134  -1.109  -11.387 1.00 0.00 ? 119 LYS A C    3  
ATOM   3485  O  O    . LYS A 1 55 ? 9.348   -1.347  -12.305 1.00 0.00 ? 119 LYS A O    3  
ATOM   3486  C  CB   . LYS A 1 55 ? 10.318  1.293   -10.715 1.00 0.00 ? 119 LYS A CB   3  
ATOM   3487  C  CG   . LYS A 1 55 ? 11.832  1.357   -10.823 1.00 0.00 ? 119 LYS A CG   3  
ATOM   3488  C  CD   . LYS A 1 55 ? 12.294  2.682   -11.405 1.00 0.00 ? 119 LYS A CD   3  
ATOM   3489  C  CE   . LYS A 1 55 ? 12.339  3.772   -10.344 1.00 0.00 ? 119 LYS A CE   3  
ATOM   3490  N  NZ   . LYS A 1 55 ? 13.309  4.846   -10.693 1.00 0.00 ? 119 LYS A NZ   3  
ATOM   3491  H  H    . LYS A 1 55 ? 11.010  0.098   -8.589  1.00 0.00 ? 119 LYS A H    3  
ATOM   3492  H  HA   . LYS A 1 55 ? 8.717   -0.034  -10.208 1.00 0.00 ? 119 LYS A HA   3  
ATOM   3493  H  HB2  . LYS A 1 55 ? 9.898   1.559   -11.674 1.00 0.00 ? 119 LYS A HB2  3  
ATOM   3494  H  HB3  . LYS A 1 55 ? 10.000  2.018   -9.979  1.00 0.00 ? 119 LYS A HB3  3  
ATOM   3495  H  HG2  . LYS A 1 55 ? 12.259  1.240   -9.838  1.00 0.00 ? 119 LYS A HG2  3  
ATOM   3496  H  HG3  . LYS A 1 55 ? 12.172  0.555   -11.463 1.00 0.00 ? 119 LYS A HG3  3  
ATOM   3497  H  HD2  . LYS A 1 55 ? 13.284  2.559   -11.819 1.00 0.00 ? 119 LYS A HD2  3  
ATOM   3498  H  HD3  . LYS A 1 55 ? 11.610  2.981   -12.186 1.00 0.00 ? 119 LYS A HD3  3  
ATOM   3499  H  HE2  . LYS A 1 55 ? 11.355  4.204   -10.250 1.00 0.00 ? 119 LYS A HE2  3  
ATOM   3500  H  HE3  . LYS A 1 55 ? 12.629  3.328   -9.403  1.00 0.00 ? 119 LYS A HE3  3  
ATOM   3501  H  HZ1  . LYS A 1 55 ? 13.742  4.651   -11.618 1.00 0.00 ? 119 LYS A HZ1  3  
ATOM   3502  H  HZ2  . LYS A 1 55 ? 14.060  4.895   -9.974  1.00 0.00 ? 119 LYS A HZ2  3  
ATOM   3503  H  HZ3  . LYS A 1 55 ? 12.825  5.765   -10.735 1.00 0.00 ? 119 LYS A HZ3  3  
ATOM   3504  N  N    . LYS A 1 56 ? 11.311  -1.714  -11.269 1.00 0.00 ? 120 LYS A N    3  
ATOM   3505  C  CA   . LYS A 1 56 ? 11.757  -2.715  -12.230 1.00 0.00 ? 120 LYS A CA   3  
ATOM   3506  C  C    . LYS A 1 56 ? 11.325  -4.113  -11.801 1.00 0.00 ? 120 LYS A C    3  
ATOM   3507  O  O    . LYS A 1 56 ? 11.149  -5.002  -12.633 1.00 0.00 ? 120 LYS A O    3  
ATOM   3508  C  CB   . LYS A 1 56 ? 13.280  -2.664  -12.380 1.00 0.00 ? 120 LYS A CB   3  
ATOM   3509  C  CG   . LYS A 1 56 ? 14.028  -2.980  -11.097 1.00 0.00 ? 120 LYS A CG   3  
ATOM   3510  C  CD   . LYS A 1 56 ? 15.530  -2.844  -11.280 1.00 0.00 ? 120 LYS A CD   3  
ATOM   3511  C  CE   . LYS A 1 56 ? 16.157  -4.151  -11.740 1.00 0.00 ? 120 LYS A CE   3  
ATOM   3512  N  NZ   . LYS A 1 56 ? 17.466  -3.931  -12.415 1.00 0.00 ? 120 LYS A NZ   3  
ATOM   3513  H  H    . LYS A 1 56 ? 11.893  -1.481  -10.515 1.00 0.00 ? 120 LYS A H    3  
ATOM   3514  H  HA   . LYS A 1 56 ? 11.302  -2.487  -13.182 1.00 0.00 ? 120 LYS A HA   3  
ATOM   3515  H  HB2  . LYS A 1 56 ? 13.579  -3.379  -13.133 1.00 0.00 ? 120 LYS A HB2  3  
ATOM   3516  H  HB3  . LYS A 1 56 ? 13.564  -1.673  -12.704 1.00 0.00 ? 120 LYS A HB3  3  
ATOM   3517  H  HG2  . LYS A 1 56 ? 13.707  -2.297  -10.326 1.00 0.00 ? 120 LYS A HG2  3  
ATOM   3518  H  HG3  . LYS A 1 56 ? 13.802  -3.994  -10.800 1.00 0.00 ? 120 LYS A HG3  3  
ATOM   3519  H  HD2  . LYS A 1 56 ? 15.727  -2.083  -12.021 1.00 0.00 ? 120 LYS A HD2  3  
ATOM   3520  H  HD3  . LYS A 1 56 ? 15.974  -2.554  -10.338 1.00 0.00 ? 120 LYS A HD3  3  
ATOM   3521  H  HE2  . LYS A 1 56 ? 16.307  -4.786  -10.880 1.00 0.00 ? 120 LYS A HE2  3  
ATOM   3522  H  HE3  . LYS A 1 56 ? 15.482  -4.635  -12.431 1.00 0.00 ? 120 LYS A HE3  3  
ATOM   3523  H  HZ1  . LYS A 1 56 ? 18.013  -4.816  -12.431 1.00 0.00 ? 120 LYS A HZ1  3  
ATOM   3524  H  HZ2  . LYS A 1 56 ? 18.013  -3.207  -11.906 1.00 0.00 ? 120 LYS A HZ2  3  
ATOM   3525  H  HZ3  . LYS A 1 56 ? 17.315  -3.611  -13.393 1.00 0.00 ? 120 LYS A HZ3  3  
ATOM   3526  N  N    . ASN A 1 57 ? 11.153  -4.300  -10.496 1.00 0.00 ? 121 ASN A N    3  
ATOM   3527  C  CA   . ASN A 1 57 ? 10.740  -5.590  -9.956  1.00 0.00 ? 121 ASN A CA   3  
ATOM   3528  C  C    . ASN A 1 57 ? 9.406   -5.472  -9.225  1.00 0.00 ? 121 ASN A C    3  
ATOM   3529  O  O    . ASN A 1 57 ? 9.285   -5.868  -8.066  1.00 0.00 ? 121 ASN A O    3  
ATOM   3530  C  CB   . ASN A 1 57 ? 11.808  -6.135  -9.007  1.00 0.00 ? 121 ASN A CB   3  
ATOM   3531  C  CG   . ASN A 1 57 ? 12.940  -6.824  -9.744  1.00 0.00 ? 121 ASN A CG   3  
ATOM   3532  O  OD1  . ASN A 1 57 ? 14.094  -6.401  -9.668  1.00 0.00 ? 121 ASN A OD1  3  
ATOM   3533  N  ND2  . ASN A 1 57 ? 12.614  -7.892  -10.463 1.00 0.00 ? 121 ASN A ND2  3  
ATOM   3534  H  H    . ASN A 1 57 ? 11.308  -3.552  -9.881  1.00 0.00 ? 121 ASN A H    3  
ATOM   3535  H  HA   . ASN A 1 57 ? 10.624  -6.273  -10.784 1.00 0.00 ? 121 ASN A HA   3  
ATOM   3536  H  HB2  . ASN A 1 57 ? 12.223  -5.318  -8.434  1.00 0.00 ? 121 ASN A HB2  3  
ATOM   3537  H  HB3  . ASN A 1 57 ? 11.355  -6.847  -8.334  1.00 0.00 ? 121 ASN A HB3  3  
ATOM   3538  H  HD21 . ASN A 1 57 ? 11.674  -8.171  -10.478 1.00 0.00 ? 121 ASN A HD21 3  
ATOM   3539  H  HD22 . ASN A 1 57 ? 13.326  -8.357  -10.950 1.00 0.00 ? 121 ASN A HD22 3  
ATOM   3540  N  N    . ARG A 1 58 ? 8.408   -4.924  -9.911  1.00 0.00 ? 122 ARG A N    3  
ATOM   3541  C  CA   . ARG A 1 58 ? 7.083   -4.753  -9.326  1.00 0.00 ? 122 ARG A CA   3  
ATOM   3542  C  C    . ARG A 1 58 ? 6.250   -6.021  -9.488  1.00 0.00 ? 122 ARG A C    3  
ATOM   3543  O  O    . ARG A 1 58 ? 5.565   -6.448  -8.559  1.00 0.00 ? 122 ARG A O    3  
ATOM   3544  C  CB   . ARG A 1 58 ? 6.364   -3.571  -9.979  1.00 0.00 ? 122 ARG A CB   3  
ATOM   3545  C  CG   . ARG A 1 58 ? 5.902   -3.848  -11.400 1.00 0.00 ? 122 ARG A CG   3  
ATOM   3546  C  CD   . ARG A 1 58 ? 5.131   -2.670  -11.975 1.00 0.00 ? 122 ARG A CD   3  
ATOM   3547  N  NE   . ARG A 1 58 ? 4.508   -2.996  -13.255 1.00 0.00 ? 122 ARG A NE   3  
ATOM   3548  C  CZ   . ARG A 1 58 ? 3.801   -2.128  -13.970 1.00 0.00 ? 122 ARG A CZ   3  
ATOM   3549  N  NH1  . ARG A 1 58 ? 3.630   -0.887  -13.534 1.00 0.00 ? 122 ARG A NH1  3  
ATOM   3550  N  NH2  . ARG A 1 58 ? 3.265   -2.499  -15.126 1.00 0.00 ? 122 ARG A NH2  3  
ATOM   3551  H  H    . ARG A 1 58 ? 8.566   -4.627  -10.831 1.00 0.00 ? 122 ARG A H    3  
ATOM   3552  H  HA   . ARG A 1 58 ? 7.208   -4.550  -8.273  1.00 0.00 ? 122 ARG A HA   3  
ATOM   3553  H  HB2  . ARG A 1 58 ? 5.497   -3.319  -9.385  1.00 0.00 ? 122 ARG A HB2  3  
ATOM   3554  H  HB3  . ARG A 1 58 ? 7.034   -2.725  -9.999  1.00 0.00 ? 122 ARG A HB3  3  
ATOM   3555  H  HG2  . ARG A 1 58 ? 6.766   -4.035  -12.020 1.00 0.00 ? 122 ARG A HG2  3  
ATOM   3556  H  HG3  . ARG A 1 58 ? 5.263   -4.719  -11.397 1.00 0.00 ? 122 ARG A HG3  3  
ATOM   3557  H  HD2  . ARG A 1 58 ? 4.361   -2.384  -11.273 1.00 0.00 ? 122 ARG A HD2  3  
ATOM   3558  H  HD3  . ARG A 1 58 ? 5.813   -1.845  -12.116 1.00 0.00 ? 122 ARG A HD3  3  
ATOM   3559  H  HE   . ARG A 1 58 ? 4.621   -3.907  -13.596 1.00 0.00 ? 122 ARG A HE   3  
ATOM   3560  H  HH11 . ARG A 1 58 ? 4.034   -0.604  -12.664 1.00 0.00 ? 122 ARG A HH11 3  
ATOM   3561  H  HH12 . ARG A 1 58 ? 3.099   -0.235  -14.075 1.00 0.00 ? 122 ARG A HH12 3  
ATOM   3562  H  HH21 . ARG A 1 58 ? 3.393   -3.433  -15.458 1.00 0.00 ? 122 ARG A HH21 3  
ATOM   3563  H  HH22 . ARG A 1 58 ? 2.734   -1.845  -15.664 1.00 0.00 ? 122 ARG A HH22 3  
ATOM   3564  N  N    . ASN A 1 59 ? 6.314   -6.618  -10.673 1.00 0.00 ? 123 ASN A N    3  
ATOM   3565  C  CA   . ASN A 1 59 ? 5.565   -7.837  -10.957 1.00 0.00 ? 123 ASN A CA   3  
ATOM   3566  C  C    . ASN A 1 59 ? 6.324   -9.068  -10.471 1.00 0.00 ? 123 ASN A C    3  
ATOM   3567  O  O    . ASN A 1 59 ? 6.558   -10.007 -11.232 1.00 0.00 ? 123 ASN A O    3  
ATOM   3568  C  CB   . ASN A 1 59 ? 5.288   -7.953  -12.457 1.00 0.00 ? 123 ASN A CB   3  
ATOM   3569  C  CG   . ASN A 1 59 ? 4.624   -6.712  -13.021 1.00 0.00 ? 123 ASN A CG   3  
ATOM   3570  O  OD1  . ASN A 1 59 ? 5.268   -5.892  -13.675 1.00 0.00 ? 123 ASN A OD1  3  
ATOM   3571  N  ND2  . ASN A 1 59 ? 3.328   -6.568  -12.767 1.00 0.00 ? 123 ASN A ND2  3  
ATOM   3572  H  H    . ASN A 1 59 ? 6.878   -6.230  -11.375 1.00 0.00 ? 123 ASN A H    3  
ATOM   3573  H  HA   . ASN A 1 59 ? 4.624   -7.777  -10.430 1.00 0.00 ? 123 ASN A HA   3  
ATOM   3574  H  HB2  . ASN A 1 59 ? 6.222   -8.105  -12.978 1.00 0.00 ? 123 ASN A HB2  3  
ATOM   3575  H  HB3  . ASN A 1 59 ? 4.640   -8.798  -12.634 1.00 0.00 ? 123 ASN A HB3  3  
ATOM   3576  H  HD21 . ASN A 1 59 ? 2.879   -7.261  -12.239 1.00 0.00 ? 123 ASN A HD21 3  
ATOM   3577  H  HD22 . ASN A 1 59 ? 2.873   -5.775  -13.120 1.00 0.00 ? 123 ASN A HD22 3  
ATOM   3578  N  N    . LYS A 1 60 ? 6.707   -9.056  -9.199  1.00 0.00 ? 124 LYS A N    3  
ATOM   3579  C  CA   . LYS A 1 60 ? 7.438   -10.171 -8.610  1.00 0.00 ? 124 LYS A CA   3  
ATOM   3580  C  C    . LYS A 1 60 ? 6.595   -10.878 -7.554  1.00 0.00 ? 124 LYS A C    3  
ATOM   3581  O  O    . LYS A 1 60 ? 6.240   -12.047 -7.708  1.00 0.00 ? 124 LYS A O    3  
ATOM   3582  C  CB   . LYS A 1 60 ? 8.746   -9.678  -7.986  1.00 0.00 ? 124 LYS A CB   3  
ATOM   3583  C  CG   . LYS A 1 60 ? 9.909   -9.640  -8.962  1.00 0.00 ? 124 LYS A CG   3  
ATOM   3584  C  CD   . LYS A 1 60 ? 11.244  -9.744  -8.243  1.00 0.00 ? 124 LYS A CD   3  
ATOM   3585  C  CE   . LYS A 1 60 ? 11.474  -11.144 -7.695  1.00 0.00 ? 124 LYS A CE   3  
ATOM   3586  N  NZ   . LYS A 1 60 ? 12.917  -11.409 -7.439  1.00 0.00 ? 124 LYS A NZ   3  
ATOM   3587  H  H    . LYS A 1 60 ? 6.491   -8.278  -8.642  1.00 0.00 ? 124 LYS A H    3  
ATOM   3588  H  HA   . LYS A 1 60 ? 7.668   -10.872 -9.398  1.00 0.00 ? 124 LYS A HA   3  
ATOM   3589  H  HB2  . LYS A 1 60 ? 8.593   -8.680  -7.602  1.00 0.00 ? 124 LYS A HB2  3  
ATOM   3590  H  HB3  . LYS A 1 60 ? 9.011   -10.333 -7.168  1.00 0.00 ? 124 LYS A HB3  3  
ATOM   3591  H  HG2  . LYS A 1 60 ? 9.818   -10.468 -9.650  1.00 0.00 ? 124 LYS A HG2  3  
ATOM   3592  H  HG3  . LYS A 1 60 ? 9.877   -8.709  -9.511  1.00 0.00 ? 124 LYS A HG3  3  
ATOM   3593  H  HD2  . LYS A 1 60 ? 12.036  -9.507  -8.938  1.00 0.00 ? 124 LYS A HD2  3  
ATOM   3594  H  HD3  . LYS A 1 60 ? 11.257  -9.039  -7.424  1.00 0.00 ? 124 LYS A HD3  3  
ATOM   3595  H  HE2  . LYS A 1 60 ? 10.928  -11.248 -6.770  1.00 0.00 ? 124 LYS A HE2  3  
ATOM   3596  H  HE3  . LYS A 1 60 ? 11.107  -11.862 -8.413  1.00 0.00 ? 124 LYS A HE3  3  
ATOM   3597  H  HZ1  . LYS A 1 60 ? 13.159  -11.155 -6.460  1.00 0.00 ? 124 LYS A HZ1  3  
ATOM   3598  H  HZ2  . LYS A 1 60 ? 13.504  -10.845 -8.087  1.00 0.00 ? 124 LYS A HZ2  3  
ATOM   3599  H  HZ3  . LYS A 1 60 ? 13.127  -12.416 -7.587  1.00 0.00 ? 124 LYS A HZ3  3  
ATOM   3600  N  N    . CYS A 1 61 ? 6.274   -10.161 -6.482  1.00 0.00 ? 125 CYS A N    3  
ATOM   3601  C  CA   . CYS A 1 61 ? 5.471   -10.719 -5.400  1.00 0.00 ? 125 CYS A CA   3  
ATOM   3602  C  C    . CYS A 1 61 ? 4.104   -10.044 -5.334  1.00 0.00 ? 125 CYS A C    3  
ATOM   3603  O  O    . CYS A 1 61 ? 3.999   -8.823  -5.445  1.00 0.00 ? 125 CYS A O    3  
ATOM   3604  C  CB   . CYS A 1 61 ? 6.197   -10.558 -4.063  1.00 0.00 ? 125 CYS A CB   3  
ATOM   3605  S  SG   . CYS A 1 61 ? 5.356   -11.361 -2.660  1.00 0.00 ? 125 CYS A SG   3  
ATOM   3606  H  H    . CYS A 1 61 ? 6.586   -9.234  -6.416  1.00 0.00 ? 125 CYS A H    3  
ATOM   3607  H  HA   . CYS A 1 61 ? 5.330   -11.770 -5.600  1.00 0.00 ? 125 CYS A HA   3  
ATOM   3608  H  HB2  . CYS A 1 61 ? 7.184   -10.990 -4.144  1.00 0.00 ? 125 CYS A HB2  3  
ATOM   3609  H  HB3  . CYS A 1 61 ? 6.287   -9.506  -3.835  1.00 0.00 ? 125 CYS A HB3  3  
ATOM   3610  N  N    . GLN A 1 62 ? 3.061   -10.848 -5.153  1.00 0.00 ? 126 GLN A N    3  
ATOM   3611  C  CA   . GLN A 1 62 ? 1.702   -10.328 -5.072  1.00 0.00 ? 126 GLN A CA   3  
ATOM   3612  C  C    . GLN A 1 62 ? 1.394   -9.823  -3.667  1.00 0.00 ? 126 GLN A C    3  
ATOM   3613  O  O    . GLN A 1 62 ? 1.079   -8.648  -3.473  1.00 0.00 ? 126 GLN A O    3  
ATOM   3614  C  CB   . GLN A 1 62 ? 0.695   -11.409 -5.470  1.00 0.00 ? 126 GLN A CB   3  
ATOM   3615  C  CG   . GLN A 1 62 ? 0.574   -11.604 -6.973  1.00 0.00 ? 126 GLN A CG   3  
ATOM   3616  C  CD   . GLN A 1 62 ? 0.004   -12.960 -7.341  1.00 0.00 ? 126 GLN A CD   3  
ATOM   3617  O  OE1  . GLN A 1 62 ? 0.724   -13.842 -7.811  1.00 0.00 ? 126 GLN A OE1  3  
ATOM   3618  N  NE2  . GLN A 1 62 ? -1.295  -13.134 -7.129  1.00 0.00 ? 126 GLN A NE2  3  
ATOM   3619  H  H    . GLN A 1 62 ? 3.210   -11.812 -5.071  1.00 0.00 ? 126 GLN A H    3  
ATOM   3620  H  HA   . GLN A 1 62 ? 1.621   -9.503  -5.764  1.00 0.00 ? 126 GLN A HA   3  
ATOM   3621  H  HB2  . GLN A 1 62 ? 1.000   -12.347 -5.030  1.00 0.00 ? 126 GLN A HB2  3  
ATOM   3622  H  HB3  . GLN A 1 62 ? -0.277  -11.139 -5.085  1.00 0.00 ? 126 GLN A HB3  3  
ATOM   3623  H  HG2  . GLN A 1 62 ? -0.075  -10.838 -7.371  1.00 0.00 ? 126 GLN A HG2  3  
ATOM   3624  H  HG3  . GLN A 1 62 ? 1.555   -11.510 -7.415  1.00 0.00 ? 126 GLN A HG3  3  
ATOM   3625  H  HE21 . GLN A 1 62 ? -1.806  -12.386 -6.753  1.00 0.00 ? 126 GLN A HE21 3  
ATOM   3626  H  HE22 . GLN A 1 62 ? -1.690  -14.000 -7.359  1.00 0.00 ? 126 GLN A HE22 3  
ATOM   3627  N  N    . TYR A 1 63 ? 1.487   -10.717 -2.689  1.00 0.00 ? 127 TYR A N    3  
ATOM   3628  C  CA   . TYR A 1 63 ? 1.216   -10.362 -1.301  1.00 0.00 ? 127 TYR A CA   3  
ATOM   3629  C  C    . TYR A 1 63 ? 1.884   -9.040  -0.936  1.00 0.00 ? 127 TYR A C    3  
ATOM   3630  O  O    . TYR A 1 63 ? 1.213   -8.026  -0.740  1.00 0.00 ? 127 TYR A O    3  
ATOM   3631  C  CB   . TYR A 1 63 ? 1.706   -11.469 -0.365  1.00 0.00 ? 127 TYR A CB   3  
ATOM   3632  C  CG   . TYR A 1 63 ? 1.344   -11.240 1.085   1.00 0.00 ? 127 TYR A CG   3  
ATOM   3633  C  CD1  . TYR A 1 63 ? 2.196   -10.542 1.932   1.00 0.00 ? 127 TYR A CD1  3  
ATOM   3634  C  CD2  . TYR A 1 63 ? 0.150   -11.722 1.608   1.00 0.00 ? 127 TYR A CD2  3  
ATOM   3635  C  CE1  . TYR A 1 63 ? 1.870   -10.331 3.258   1.00 0.00 ? 127 TYR A CE1  3  
ATOM   3636  C  CE2  . TYR A 1 63 ? -0.185  -11.514 2.932   1.00 0.00 ? 127 TYR A CE2  3  
ATOM   3637  C  CZ   . TYR A 1 63 ? 0.678   -10.818 3.753   1.00 0.00 ? 127 TYR A CZ   3  
ATOM   3638  O  OH   . TYR A 1 63 ? 0.349   -10.610 5.073   1.00 0.00 ? 127 TYR A OH   3  
ATOM   3639  H  H    . TYR A 1 63 ? 1.743   -11.638 -2.905  1.00 0.00 ? 127 TYR A H    3  
ATOM   3640  H  HA   . TYR A 1 63 ? 0.147   -10.256 -1.188  1.00 0.00 ? 127 TYR A HA   3  
ATOM   3641  H  HB2  . TYR A 1 63 ? 1.271   -12.408 -0.670  1.00 0.00 ? 127 TYR A HB2  3  
ATOM   3642  H  HB3  . TYR A 1 63 ? 2.782   -11.537 -0.432  1.00 0.00 ? 127 TYR A HB3  3  
ATOM   3643  H  HD1  . TYR A 1 63 ? 3.129   -10.161 1.542   1.00 0.00 ? 127 TYR A HD1  3  
ATOM   3644  H  HD2  . TYR A 1 63 ? -0.523  -12.267 0.963   1.00 0.00 ? 127 TYR A HD2  3  
ATOM   3645  H  HE1  . TYR A 1 63 ? 2.545   -9.785  3.901   1.00 0.00 ? 127 TYR A HE1  3  
ATOM   3646  H  HE2  . TYR A 1 63 ? -1.117  -11.896 3.320   1.00 0.00 ? 127 TYR A HE2  3  
ATOM   3647  H  HH   . TYR A 1 63 ? 0.228   -9.671  5.228   1.00 0.00 ? 127 TYR A HH   3  
ATOM   3648  N  N    . CYS A 1 64 ? 3.209   -9.058  -0.847  1.00 0.00 ? 128 CYS A N    3  
ATOM   3649  C  CA   . CYS A 1 64 ? 3.970   -7.862  -0.507  1.00 0.00 ? 128 CYS A CA   3  
ATOM   3650  C  C    . CYS A 1 64 ? 3.408   -6.637  -1.222  1.00 0.00 ? 128 CYS A C    3  
ATOM   3651  O  O    . CYS A 1 64 ? 3.344   -5.548  -0.653  1.00 0.00 ? 128 CYS A O    3  
ATOM   3652  C  CB   . CYS A 1 64 ? 5.444   -8.048  -0.873  1.00 0.00 ? 128 CYS A CB   3  
ATOM   3653  S  SG   . CYS A 1 64 ? 6.332   -9.228  0.195   1.00 0.00 ? 128 CYS A SG   3  
ATOM   3654  H  H    . CYS A 1 64 ? 3.688   -9.898  -1.015  1.00 0.00 ? 128 CYS A H    3  
ATOM   3655  H  HA   . CYS A 1 64 ? 3.889   -7.710  0.559   1.00 0.00 ? 128 CYS A HA   3  
ATOM   3656  H  HB2  . CYS A 1 64 ? 5.512   -8.410  -1.888  1.00 0.00 ? 128 CYS A HB2  3  
ATOM   3657  H  HB3  . CYS A 1 64 ? 5.948   -7.096  -0.801  1.00 0.00 ? 128 CYS A HB3  3  
ATOM   3658  N  N    . ARG A 1 65 ? 3.001   -6.825  -2.474  1.00 0.00 ? 129 ARG A N    3  
ATOM   3659  C  CA   . ARG A 1 65 ? 2.445   -5.736  -3.268  1.00 0.00 ? 129 ARG A CA   3  
ATOM   3660  C  C    . ARG A 1 65 ? 1.256   -5.097  -2.557  1.00 0.00 ? 129 ARG A C    3  
ATOM   3661  O  O    . ARG A 1 65 ? 1.230   -3.886  -2.335  1.00 0.00 ? 129 ARG A O    3  
ATOM   3662  C  CB   . ARG A 1 65 ? 2.015   -6.248  -4.644  1.00 0.00 ? 129 ARG A CB   3  
ATOM   3663  C  CG   . ARG A 1 65 ? 1.906   -5.154  -5.694  1.00 0.00 ? 129 ARG A CG   3  
ATOM   3664  C  CD   . ARG A 1 65 ? 1.840   -5.735  -7.098  1.00 0.00 ? 129 ARG A CD   3  
ATOM   3665  N  NE   . ARG A 1 65 ? 1.364   -4.756  -8.072  1.00 0.00 ? 129 ARG A NE   3  
ATOM   3666  C  CZ   . ARG A 1 65 ? 2.080   -3.711  -8.474  1.00 0.00 ? 129 ARG A CZ   3  
ATOM   3667  N  NH1  . ARG A 1 65 ? 3.296   -3.510  -7.987  1.00 0.00 ? 129 ARG A NH1  3  
ATOM   3668  N  NH2  . ARG A 1 65 ? 1.578   -2.865  -9.364  1.00 0.00 ? 129 ARG A NH2  3  
ATOM   3669  H  H    . ARG A 1 65 ? 3.078   -7.717  -2.873  1.00 0.00 ? 129 ARG A H    3  
ATOM   3670  H  HA   . ARG A 1 65 ? 3.216   -4.991  -3.395  1.00 0.00 ? 129 ARG A HA   3  
ATOM   3671  H  HB2  . ARG A 1 65 ? 2.737   -6.975  -4.987  1.00 0.00 ? 129 ARG A HB2  3  
ATOM   3672  H  HB3  . ARG A 1 65 ? 1.052   -6.726  -4.552  1.00 0.00 ? 129 ARG A HB3  3  
ATOM   3673  H  HG2  . ARG A 1 65 ? 1.009   -4.581  -5.511  1.00 0.00 ? 129 ARG A HG2  3  
ATOM   3674  H  HG3  . ARG A 1 65 ? 2.769   -4.510  -5.620  1.00 0.00 ? 129 ARG A HG3  3  
ATOM   3675  H  HD2  . ARG A 1 65 ? 2.828   -6.063  -7.384  1.00 0.00 ? 129 ARG A HD2  3  
ATOM   3676  H  HD3  . ARG A 1 65 ? 1.168   -6.579  -7.092  1.00 0.00 ? 129 ARG A HD3  3  
ATOM   3677  H  HE   . ARG A 1 65 ? 0.468   -4.886  -8.445  1.00 0.00 ? 129 ARG A HE   3  
ATOM   3678  H  HH11 . ARG A 1 65 ? 3.677   -4.147  -7.316  1.00 0.00 ? 129 ARG A HH11 3  
ATOM   3679  H  HH12 . ARG A 1 65 ? 3.833   -2.723  -8.291  1.00 0.00 ? 129 ARG A HH12 3  
ATOM   3680  H  HH21 . ARG A 1 65 ? 0.661   -3.013  -9.733  1.00 0.00 ? 129 ARG A HH21 3  
ATOM   3681  H  HH22 . ARG A 1 65 ? 2.117   -2.079  -9.665  1.00 0.00 ? 129 ARG A HH22 3  
ATOM   3682  N  N    . PHE A 1 66 ? 0.274   -5.918  -2.202  1.00 0.00 ? 130 PHE A N    3  
ATOM   3683  C  CA   . PHE A 1 66 ? -0.919  -5.433  -1.518  1.00 0.00 ? 130 PHE A CA   3  
ATOM   3684  C  C    . PHE A 1 66 ? -0.564  -4.851  -0.153  1.00 0.00 ? 130 PHE A C    3  
ATOM   3685  O  O    . PHE A 1 66 ? -0.967  -3.738  0.182   1.00 0.00 ? 130 PHE A O    3  
ATOM   3686  C  CB   . PHE A 1 66 ? -1.934  -6.566  -1.353  1.00 0.00 ? 130 PHE A CB   3  
ATOM   3687  C  CG   . PHE A 1 66 ? -3.230  -6.124  -0.734  1.00 0.00 ? 130 PHE A CG   3  
ATOM   3688  C  CD1  . PHE A 1 66 ? -4.031  -5.187  -1.366  1.00 0.00 ? 130 PHE A CD1  3  
ATOM   3689  C  CD2  . PHE A 1 66 ? -3.646  -6.646  0.480   1.00 0.00 ? 130 PHE A CD2  3  
ATOM   3690  C  CE1  . PHE A 1 66 ? -5.224  -4.779  -0.800  1.00 0.00 ? 130 PHE A CE1  3  
ATOM   3691  C  CE2  . PHE A 1 66 ? -4.838  -6.242  1.051   1.00 0.00 ? 130 PHE A CE2  3  
ATOM   3692  C  CZ   . PHE A 1 66 ? -5.627  -5.306  0.411   1.00 0.00 ? 130 PHE A CZ   3  
ATOM   3693  H  H    . PHE A 1 66 ? 0.353   -6.874  -2.407  1.00 0.00 ? 130 PHE A H    3  
ATOM   3694  H  HA   . PHE A 1 66 ? -1.355  -4.656  -2.125  1.00 0.00 ? 130 PHE A HA   3  
ATOM   3695  H  HB2  . PHE A 1 66 ? -2.156  -6.985  -2.323  1.00 0.00 ? 130 PHE A HB2  3  
ATOM   3696  H  HB3  . PHE A 1 66 ? -1.508  -7.332  -0.723  1.00 0.00 ? 130 PHE A HB3  3  
ATOM   3697  H  HD1  . PHE A 1 66 ? -3.715  -4.773  -2.314  1.00 0.00 ? 130 PHE A HD1  3  
ATOM   3698  H  HD2  . PHE A 1 66 ? -3.030  -7.377  0.982   1.00 0.00 ? 130 PHE A HD2  3  
ATOM   3699  H  HE1  . PHE A 1 66 ? -5.838  -4.047  -1.303  1.00 0.00 ? 130 PHE A HE1  3  
ATOM   3700  H  HE2  . PHE A 1 66 ? -5.152  -6.656  1.998   1.00 0.00 ? 130 PHE A HE2  3  
ATOM   3701  H  HZ   . PHE A 1 66 ? -6.559  -4.989  0.855   1.00 0.00 ? 130 PHE A HZ   3  
ATOM   3702  N  N    . GLN A 1 67 ? 0.193   -5.613  0.630   1.00 0.00 ? 131 GLN A N    3  
ATOM   3703  C  CA   . GLN A 1 67 ? 0.602   -5.173  1.959   1.00 0.00 ? 131 GLN A CA   3  
ATOM   3704  C  C    . GLN A 1 67 ? 1.142   -3.748  1.918   1.00 0.00 ? 131 GLN A C    3  
ATOM   3705  O  O    . GLN A 1 67 ? 0.704   -2.884  2.678   1.00 0.00 ? 131 GLN A O    3  
ATOM   3706  C  CB   . GLN A 1 67 ? 1.662   -6.117  2.528   1.00 0.00 ? 131 GLN A CB   3  
ATOM   3707  C  CG   . GLN A 1 67 ? 1.082   -7.277  3.321   1.00 0.00 ? 131 GLN A CG   3  
ATOM   3708  C  CD   . GLN A 1 67 ? 0.018   -6.835  4.307   1.00 0.00 ? 131 GLN A CD   3  
ATOM   3709  O  OE1  . GLN A 1 67 ? -1.178  -6.940  4.036   1.00 0.00 ? 131 GLN A OE1  3  
ATOM   3710  N  NE2  . GLN A 1 67 ? 0.450   -6.338  5.460   1.00 0.00 ? 131 GLN A NE2  3  
ATOM   3711  H  H    . GLN A 1 67 ? 0.483   -6.491  0.307   1.00 0.00 ? 131 GLN A H    3  
ATOM   3712  H  HA   . GLN A 1 67 ? -0.268  -5.197  2.597   1.00 0.00 ? 131 GLN A HA   3  
ATOM   3713  H  HB2  . GLN A 1 67 ? 2.242   -6.522  1.712   1.00 0.00 ? 131 GLN A HB2  3  
ATOM   3714  H  HB3  . GLN A 1 67 ? 2.315   -5.555  3.179   1.00 0.00 ? 131 GLN A HB3  3  
ATOM   3715  H  HG2  . GLN A 1 67 ? 0.641   -7.983  2.633   1.00 0.00 ? 131 GLN A HG2  3  
ATOM   3716  H  HG3  . GLN A 1 67 ? 1.880   -7.759  3.866   1.00 0.00 ? 131 GLN A HG3  3  
ATOM   3717  H  HE21 . GLN A 1 67 ? 1.418   -6.284  5.607   1.00 0.00 ? 131 GLN A HE21 3  
ATOM   3718  H  HE22 . GLN A 1 67 ? -0.215  -6.044  6.116   1.00 0.00 ? 131 GLN A HE22 3  
ATOM   3719  N  N    . LYS A 1 68 ? 2.098   -3.508  1.027   1.00 0.00 ? 132 LYS A N    3  
ATOM   3720  C  CA   . LYS A 1 68 ? 2.699   -2.187  0.885   1.00 0.00 ? 132 LYS A CA   3  
ATOM   3721  C  C    . LYS A 1 68 ? 1.626   -1.104  0.829   1.00 0.00 ? 132 LYS A C    3  
ATOM   3722  O  O    . LYS A 1 68 ? 1.741   -0.068  1.485   1.00 0.00 ? 132 LYS A O    3  
ATOM   3723  C  CB   . LYS A 1 68 ? 3.563   -2.129  -0.376  1.00 0.00 ? 132 LYS A CB   3  
ATOM   3724  C  CG   . LYS A 1 68 ? 4.249   -0.790  -0.583  1.00 0.00 ? 132 LYS A CG   3  
ATOM   3725  C  CD   . LYS A 1 68 ? 5.523   -0.936  -1.398  1.00 0.00 ? 132 LYS A CD   3  
ATOM   3726  C  CE   . LYS A 1 68 ? 6.450   0.254   -1.202  1.00 0.00 ? 132 LYS A CE   3  
ATOM   3727  N  NZ   . LYS A 1 68 ? 7.298   0.103   0.013   1.00 0.00 ? 132 LYS A NZ   3  
ATOM   3728  H  H    . LYS A 1 68 ? 2.406   -4.237  0.448   1.00 0.00 ? 132 LYS A H    3  
ATOM   3729  H  HA   . LYS A 1 68 ? 3.324   -2.013  1.748   1.00 0.00 ? 132 LYS A HA   3  
ATOM   3730  H  HB2  . LYS A 1 68 ? 4.323   -2.894  -0.313  1.00 0.00 ? 132 LYS A HB2  3  
ATOM   3731  H  HB3  . LYS A 1 68 ? 2.938   -2.326  -1.236  1.00 0.00 ? 132 LYS A HB3  3  
ATOM   3732  H  HG2  . LYS A 1 68 ? 3.575   -0.127  -1.106  1.00 0.00 ? 132 LYS A HG2  3  
ATOM   3733  H  HG3  . LYS A 1 68 ? 4.495   -0.369  0.381   1.00 0.00 ? 132 LYS A HG3  3  
ATOM   3734  H  HD2  . LYS A 1 68 ? 6.038   -1.833  -1.087  1.00 0.00 ? 132 LYS A HD2  3  
ATOM   3735  H  HD3  . LYS A 1 68 ? 5.265   -1.012  -2.444  1.00 0.00 ? 132 LYS A HD3  3  
ATOM   3736  H  HE2  . LYS A 1 68 ? 7.088   0.343   -2.067  1.00 0.00 ? 132 LYS A HE2  3  
ATOM   3737  H  HE3  . LYS A 1 68 ? 5.850   1.147   -1.103  1.00 0.00 ? 132 LYS A HE3  3  
ATOM   3738  H  HZ1  . LYS A 1 68 ? 6.803   0.482   0.845   1.00 0.00 ? 132 LYS A HZ1  3  
ATOM   3739  H  HZ2  . LYS A 1 68 ? 8.193   0.618   -0.110  1.00 0.00 ? 132 LYS A HZ2  3  
ATOM   3740  H  HZ3  . LYS A 1 68 ? 7.510   -0.902  0.177   1.00 0.00 ? 132 LYS A HZ3  3  
ATOM   3741  N  N    . CYS A 1 69 ? 0.583   -1.351  0.043   1.00 0.00 ? 133 CYS A N    3  
ATOM   3742  C  CA   . CYS A 1 69 ? -0.511  -0.397  -0.098  1.00 0.00 ? 133 CYS A CA   3  
ATOM   3743  C  C    . CYS A 1 69 ? -1.112  -0.055  1.261   1.00 0.00 ? 133 CYS A C    3  
ATOM   3744  O  O    . CYS A 1 69 ? -1.211  1.116   1.632   1.00 0.00 ? 133 CYS A O    3  
ATOM   3745  C  CB   . CYS A 1 69 ? -1.592  -0.962  -1.020  1.00 0.00 ? 133 CYS A CB   3  
ATOM   3746  S  SG   . CYS A 1 69 ? -1.045  -1.228  -2.723  1.00 0.00 ? 133 CYS A SG   3  
ATOM   3747  H  H    . CYS A 1 69 ? 0.548   -2.194  -0.455  1.00 0.00 ? 133 CYS A H    3  
ATOM   3748  H  HA   . CYS A 1 69 ? -0.110  0.504   -0.537  1.00 0.00 ? 133 CYS A HA   3  
ATOM   3749  H  HB2  . CYS A 1 69 ? -1.926  -1.912  -0.631  1.00 0.00 ? 133 CYS A HB2  3  
ATOM   3750  H  HB3  . CYS A 1 69 ? -2.427  -0.277  -1.045  1.00 0.00 ? 133 CYS A HB3  3  
ATOM   3751  H  HG   . CYS A 1 69 ? -0.762  -2.514  -2.864  1.00 0.00 ? 133 CYS A HG   3  
ATOM   3752  N  N    . LEU A 1 70 ? -1.515  -1.083  2.000   1.00 0.00 ? 134 LEU A N    3  
ATOM   3753  C  CA   . LEU A 1 70 ? -2.109  -0.892  3.318   1.00 0.00 ? 134 LEU A CA   3  
ATOM   3754  C  C    . LEU A 1 70 ? -1.173  -0.102  4.228   1.00 0.00 ? 134 LEU A C    3  
ATOM   3755  O  O    . LEU A 1 70 ? -1.598  0.823   4.919   1.00 0.00 ? 134 LEU A O    3  
ATOM   3756  C  CB   . LEU A 1 70 ? -2.435  -2.244  3.954   1.00 0.00 ? 134 LEU A CB   3  
ATOM   3757  C  CG   . LEU A 1 70 ? -3.455  -3.107  3.210   1.00 0.00 ? 134 LEU A CG   3  
ATOM   3758  C  CD1  . LEU A 1 70 ? -3.467  -4.521  3.768   1.00 0.00 ? 134 LEU A CD1  3  
ATOM   3759  C  CD2  . LEU A 1 70 ? -4.842  -2.486  3.297   1.00 0.00 ? 134 LEU A CD2  3  
ATOM   3760  H  H    . LEU A 1 70 ? -1.410  -1.992  1.651   1.00 0.00 ? 134 LEU A H    3  
ATOM   3761  H  HA   . LEU A 1 70 ? -3.024  -0.333  3.192   1.00 0.00 ? 134 LEU A HA   3  
ATOM   3762  H  HB2  . LEU A 1 70 ? -1.517  -2.806  4.024   1.00 0.00 ? 134 LEU A HB2  3  
ATOM   3763  H  HB3  . LEU A 1 70 ? -2.818  -2.059  4.947   1.00 0.00 ? 134 LEU A HB3  3  
ATOM   3764  H  HG   . LEU A 1 70 ? -3.178  -3.162  2.166   1.00 0.00 ? 134 LEU A HG   3  
ATOM   3765  H  HD11 . LEU A 1 70 ? -3.919  -4.518  4.748   1.00 0.00 ? 134 LEU A HD11 3  
ATOM   3766  H  HD12 . LEU A 1 70 ? -2.454  -4.888  3.840   1.00 0.00 ? 134 LEU A HD12 3  
ATOM   3767  H  HD13 . LEU A 1 70 ? -4.035  -5.163  3.110   1.00 0.00 ? 134 LEU A HD13 3  
ATOM   3768  H  HD21 . LEU A 1 70 ? -5.520  -3.183  3.768   1.00 0.00 ? 134 LEU A HD21 3  
ATOM   3769  H  HD22 . LEU A 1 70 ? -5.196  -2.256  2.302   1.00 0.00 ? 134 LEU A HD22 3  
ATOM   3770  H  HD23 . LEU A 1 70 ? -4.794  -1.578  3.881   1.00 0.00 ? 134 LEU A HD23 3  
ATOM   3771  N  N    . ALA A 1 71 ? 0.103   -0.473  4.221   1.00 0.00 ? 135 ALA A N    3  
ATOM   3772  C  CA   . ALA A 1 71 ? 1.100   0.203   5.042   1.00 0.00 ? 135 ALA A CA   3  
ATOM   3773  C  C    . ALA A 1 71 ? 1.177   1.687   4.700   1.00 0.00 ? 135 ALA A C    3  
ATOM   3774  O  O    . ALA A 1 71 ? 1.260   2.535   5.589   1.00 0.00 ? 135 ALA A O    3  
ATOM   3775  C  CB   . ALA A 1 71 ? 2.462   -0.453  4.866   1.00 0.00 ? 135 ALA A CB   3  
ATOM   3776  H  H    . ALA A 1 71 ? 0.381   -1.219  3.648   1.00 0.00 ? 135 ALA A H    3  
ATOM   3777  H  HA   . ALA A 1 71 ? 0.808   0.096   6.077   1.00 0.00 ? 135 ALA A HA   3  
ATOM   3778  H  HB1  . ALA A 1 71 ? 2.556   -1.277  5.557   1.00 0.00 ? 135 ALA A HB1  3  
ATOM   3779  H  HB2  . ALA A 1 71 ? 2.555   -0.820  3.853   1.00 0.00 ? 135 ALA A HB2  3  
ATOM   3780  H  HB3  . ALA A 1 71 ? 3.238   0.272   5.060   1.00 0.00 ? 135 ALA A HB3  3  
ATOM   3781  N  N    . LEU A 1 72 ? 1.151   1.994   3.408   1.00 0.00 ? 136 LEU A N    3  
ATOM   3782  C  CA   . LEU A 1 72 ? 1.219   3.377   2.949   1.00 0.00 ? 136 LEU A CA   3  
ATOM   3783  C  C    . LEU A 1 72 ? 0.076   4.201   3.532   1.00 0.00 ? 136 LEU A C    3  
ATOM   3784  O  O    . LEU A 1 72 ? 0.209   5.406   3.741   1.00 0.00 ? 136 LEU A O    3  
ATOM   3785  C  CB   . LEU A 1 72 ? 1.174   3.430   1.421   1.00 0.00 ? 136 LEU A CB   3  
ATOM   3786  C  CG   . LEU A 1 72 ? 2.429   2.943   0.695   1.00 0.00 ? 136 LEU A CG   3  
ATOM   3787  C  CD1  . LEU A 1 72 ? 2.153   2.771   -0.790  1.00 0.00 ? 136 LEU A CD1  3  
ATOM   3788  C  CD2  . LEU A 1 72 ? 3.583   3.910   0.917   1.00 0.00 ? 136 LEU A CD2  3  
ATOM   3789  H  H    . LEU A 1 72 ? 1.085   1.275   2.747   1.00 0.00 ? 136 LEU A H    3  
ATOM   3790  H  HA   . LEU A 1 72 ? 2.156   3.793   3.288   1.00 0.00 ? 136 LEU A HA   3  
ATOM   3791  H  HB2  . LEU A 1 72 ? 0.346   2.822   1.093   1.00 0.00 ? 136 LEU A HB2  3  
ATOM   3792  H  HB3  . LEU A 1 72 ? 1.001   4.457   1.132   1.00 0.00 ? 136 LEU A HB3  3  
ATOM   3793  H  HG   . LEU A 1 72 ? 2.717   1.980   1.094   1.00 0.00 ? 136 LEU A HG   3  
ATOM   3794  H  HD11 . LEU A 1 72 ? 2.270   3.721   -1.290  1.00 0.00 ? 136 LEU A HD11 3  
ATOM   3795  H  HD12 . LEU A 1 72 ? 1.144   2.413   -0.930  1.00 0.00 ? 136 LEU A HD12 3  
ATOM   3796  H  HD13 . LEU A 1 72 ? 2.850   2.057   -1.205  1.00 0.00 ? 136 LEU A HD13 3  
ATOM   3797  H  HD21 . LEU A 1 72 ? 3.312   4.886   0.541   1.00 0.00 ? 136 LEU A HD21 3  
ATOM   3798  H  HD22 . LEU A 1 72 ? 4.458   3.552   0.395   1.00 0.00 ? 136 LEU A HD22 3  
ATOM   3799  H  HD23 . LEU A 1 72 ? 3.797   3.978   1.974   1.00 0.00 ? 136 LEU A HD23 3  
ATOM   3800  N  N    . GLY A 1 73 ? -1.049  3.541   3.795   1.00 0.00 ? 137 GLY A N    3  
ATOM   3801  C  CA   . GLY A 1 73 ? -2.199  4.228   4.353   1.00 0.00 ? 137 GLY A CA   3  
ATOM   3802  C  C    . GLY A 1 73 ? -3.374  4.264   3.396   1.00 0.00 ? 137 GLY A C    3  
ATOM   3803  O  O    . GLY A 1 73 ? -4.206  5.168   3.459   1.00 0.00 ? 137 GLY A O    3  
ATOM   3804  H  H    . GLY A 1 73 ? -1.097  2.581   3.607   1.00 0.00 ? 137 GLY A H    3  
ATOM   3805  H  HA2  . GLY A 1 73 ? -2.500  3.724   5.259   1.00 0.00 ? 137 GLY A HA2  3  
ATOM   3806  H  HA3  . GLY A 1 73 ? -1.915  5.242   4.595   1.00 0.00 ? 137 GLY A HA3  3  
ATOM   3807  N  N    . MET A 1 74 ? -3.440  3.279   2.506   1.00 0.00 ? 138 MET A N    3  
ATOM   3808  C  CA   . MET A 1 74 ? -4.522  3.202   1.532   1.00 0.00 ? 138 MET A CA   3  
ATOM   3809  C  C    . MET A 1 74 ? -5.847  2.875   2.214   1.00 0.00 ? 138 MET A C    3  
ATOM   3810  O  O    . MET A 1 74 ? -5.952  1.891   2.946   1.00 0.00 ? 138 MET A O    3  
ATOM   3811  C  CB   . MET A 1 74 ? -4.208  2.146   0.471   1.00 0.00 ? 138 MET A CB   3  
ATOM   3812  C  CG   . MET A 1 74 ? -3.344  2.667   -0.667  1.00 0.00 ? 138 MET A CG   3  
ATOM   3813  S  SD   . MET A 1 74 ? -3.616  1.773   -2.210  1.00 0.00 ? 138 MET A SD   3  
ATOM   3814  C  CE   . MET A 1 74 ? -3.113  3.006   -3.408  1.00 0.00 ? 138 MET A CE   3  
ATOM   3815  H  H    . MET A 1 74 ? -2.747  2.587   2.505   1.00 0.00 ? 138 MET A H    3  
ATOM   3816  H  HA   . MET A 1 74 ? -4.606  4.167   1.053   1.00 0.00 ? 138 MET A HA   3  
ATOM   3817  H  HB2  . MET A 1 74 ? -3.689  1.324   0.941   1.00 0.00 ? 138 MET A HB2  3  
ATOM   3818  H  HB3  . MET A 1 74 ? -5.135  1.784   0.053   1.00 0.00 ? 138 MET A HB3  3  
ATOM   3819  H  HG2  . MET A 1 74 ? -3.573  3.710   -0.828  1.00 0.00 ? 138 MET A HG2  3  
ATOM   3820  H  HG3  . MET A 1 74 ? -2.306  2.567   -0.387  1.00 0.00 ? 138 MET A HG3  3  
ATOM   3821  H  HE1  . MET A 1 74 ? -3.555  3.957   -3.152  1.00 0.00 ? 138 MET A HE1  3  
ATOM   3822  H  HE2  . MET A 1 74 ? -2.037  3.095   -3.403  1.00 0.00 ? 138 MET A HE2  3  
ATOM   3823  H  HE3  . MET A 1 74 ? -3.445  2.707   -4.392  1.00 0.00 ? 138 MET A HE3  3  
ATOM   3824  N  N    . SER A 1 75 ? -6.855  3.707   1.970   1.00 0.00 ? 139 SER A N    3  
ATOM   3825  C  CA   . SER A 1 75 ? -8.171  3.508   2.564   1.00 0.00 ? 139 SER A CA   3  
ATOM   3826  C  C    . SER A 1 75 ? -9.073  2.705   1.631   1.00 0.00 ? 139 SER A C    3  
ATOM   3827  O  O    . SER A 1 75 ? -9.292  3.087   0.481   1.00 0.00 ? 139 SER A O    3  
ATOM   3828  C  CB   . SER A 1 75 ? -8.819  4.856   2.883   1.00 0.00 ? 139 SER A CB   3  
ATOM   3829  O  OG   . SER A 1 75 ? -9.978  4.689   3.682   1.00 0.00 ? 139 SER A OG   3  
ATOM   3830  H  H    . SER A 1 75 ? -6.708  4.474   1.377   1.00 0.00 ? 139 SER A H    3  
ATOM   3831  H  HA   . SER A 1 75 ? -8.040  2.955   3.482   1.00 0.00 ? 139 SER A HA   3  
ATOM   3832  H  HB2  . SER A 1 75 ? -8.114  5.474   3.418   1.00 0.00 ? 139 SER A HB2  3  
ATOM   3833  H  HB3  . SER A 1 75 ? -9.099  5.345   1.961   1.00 0.00 ? 139 SER A HB3  3  
ATOM   3834  H  HG   . SER A 1 75 ? -10.343 3.814   3.536   1.00 0.00 ? 139 SER A HG   3  
ATOM   3835  N  N    . HIS A 1 76 ? -9.594  1.591   2.135   1.00 0.00 ? 140 HIS A N    3  
ATOM   3836  C  CA   . HIS A 1 76 ? -10.473 0.734   1.348   1.00 0.00 ? 140 HIS A CA   3  
ATOM   3837  C  C    . HIS A 1 76 ? -11.916 1.225   1.417   1.00 0.00 ? 140 HIS A C    3  
ATOM   3838  O  O    . HIS A 1 76 ? -12.845 0.432   1.564   1.00 0.00 ? 140 HIS A O    3  
ATOM   3839  C  CB   . HIS A 1 76 ? -10.389 -0.710  1.844   1.00 0.00 ? 140 HIS A CB   3  
ATOM   3840  C  CG   . HIS A 1 76 ? -10.960 -0.908  3.214   1.00 0.00 ? 140 HIS A CG   3  
ATOM   3841  N  ND1  . HIS A 1 76 ? -10.362 -0.419  4.356   1.00 0.00 ? 140 HIS A ND1  3  
ATOM   3842  C  CD2  . HIS A 1 76 ? -12.084 -1.543  3.622   1.00 0.00 ? 140 HIS A CD2  3  
ATOM   3843  C  CE1  . HIS A 1 76 ? -11.091 -0.747  5.408   1.00 0.00 ? 140 HIS A CE1  3  
ATOM   3844  N  NE2  . HIS A 1 76 ? -12.142 -1.429  4.989   1.00 0.00 ? 140 HIS A NE2  3  
ATOM   3845  H  H    . HIS A 1 76 ? -9.382  1.340   3.058   1.00 0.00 ? 140 HIS A H    3  
ATOM   3846  H  HA   . HIS A 1 76 ? -10.141 0.772   0.322   1.00 0.00 ? 140 HIS A HA   3  
ATOM   3847  H  HB2  . HIS A 1 76 ? -10.932 -1.349  1.163   1.00 0.00 ? 140 HIS A HB2  3  
ATOM   3848  H  HB3  . HIS A 1 76 ? -9.353  -1.017  1.868   1.00 0.00 ? 140 HIS A HB3  3  
ATOM   3849  H  HD1  . HIS A 1 76 ? -9.526  0.090   4.391   1.00 0.00 ? 140 HIS A HD1  3  
ATOM   3850  H  HD2  . HIS A 1 76 ? -12.801 -2.047  2.990   1.00 0.00 ? 140 HIS A HD2  3  
ATOM   3851  H  HE1  . HIS A 1 76 ? -10.868 -0.500  6.434   1.00 0.00 ? 140 HIS A HE1  3  
ATOM   3852  N  N    . ASN A 1 77 ? -12.094 2.538   1.311   1.00 0.00 ? 141 ASN A N    3  
ATOM   3853  C  CA   . ASN A 1 77 ? -13.424 3.135   1.363   1.00 0.00 ? 141 ASN A CA   3  
ATOM   3854  C  C    . ASN A 1 77 ? -13.702 3.954   0.107   1.00 0.00 ? 141 ASN A C    3  
ATOM   3855  O  O    . ASN A 1 77 ? -14.747 3.805   -0.525  1.00 0.00 ? 141 ASN A O    3  
ATOM   3856  C  CB   . ASN A 1 77 ? -13.560 4.020   2.604   1.00 0.00 ? 141 ASN A CB   3  
ATOM   3857  C  CG   . ASN A 1 77 ? -14.897 4.733   2.661   1.00 0.00 ? 141 ASN A CG   3  
ATOM   3858  O  OD1  . ASN A 1 77 ? -15.952 4.108   2.543   1.00 0.00 ? 141 ASN A OD1  3  
ATOM   3859  N  ND2  . ASN A 1 77 ? -14.860 6.047   2.844   1.00 0.00 ? 141 ASN A ND2  3  
ATOM   3860  H  H    . ASN A 1 77 ? -11.314 3.119   1.196   1.00 0.00 ? 141 ASN A H    3  
ATOM   3861  H  HA   . ASN A 1 77 ? -14.145 2.333   1.423   1.00 0.00 ? 141 ASN A HA   3  
ATOM   3862  H  HB2  . ASN A 1 77 ? -13.462 3.408   3.488   1.00 0.00 ? 141 ASN A HB2  3  
ATOM   3863  H  HB3  . ASN A 1 77 ? -12.777 4.763   2.596   1.00 0.00 ? 141 ASN A HB3  3  
ATOM   3864  H  HD21 . ASN A 1 77 ? -13.984 6.478   2.931   1.00 0.00 ? 141 ASN A HD21 3  
ATOM   3865  H  HD22 . ASN A 1 77 ? -15.710 6.533   2.886   1.00 0.00 ? 141 ASN A HD22 3  
ATOM   3866  N  N    . ALA A 1 78 ? -12.758 4.819   -0.250  1.00 0.00 ? 142 ALA A N    3  
ATOM   3867  C  CA   . ALA A 1 78 ? -12.900 5.660   -1.432  1.00 0.00 ? 142 ALA A CA   3  
ATOM   3868  C  C    . ALA A 1 78 ? -13.538 4.888   -2.582  1.00 0.00 ? 142 ALA A C    3  
ATOM   3869  O  O    . ALA A 1 78 ? -14.346 5.433   -3.335  1.00 0.00 ? 142 ALA A O    3  
ATOM   3870  C  CB   . ALA A 1 78 ? -11.546 6.212   -1.852  1.00 0.00 ? 142 ALA A CB   3  
ATOM   3871  H  H    . ALA A 1 78 ? -11.947 4.892   0.294   1.00 0.00 ? 142 ALA A H    3  
ATOM   3872  H  HA   . ALA A 1 78 ? -13.537 6.494   -1.174  1.00 0.00 ? 142 ALA A HA   3  
ATOM   3873  H  HB1  . ALA A 1 78 ? -11.609 7.286   -1.947  1.00 0.00 ? 142 ALA A HB1  3  
ATOM   3874  H  HB2  . ALA A 1 78 ? -10.807 5.959   -1.106  1.00 0.00 ? 142 ALA A HB2  3  
ATOM   3875  H  HB3  . ALA A 1 78 ? -11.261 5.783   -2.801  1.00 0.00 ? 142 ALA A HB3  3  
ATOM   3876  N  N    . ILE A 1 79 ? -13.171 3.617   -2.711  1.00 0.00 ? 143 ILE A N    3  
ATOM   3877  C  CA   . ILE A 1 79 ? -13.709 2.771   -3.769  1.00 0.00 ? 143 ILE A CA   3  
ATOM   3878  C  C    . ILE A 1 79 ? -15.234 2.747   -3.731  1.00 0.00 ? 143 ILE A C    3  
ATOM   3879  O  O    . ILE A 1 79 ? -15.895 3.134   -4.695  1.00 0.00 ? 143 ILE A O    3  
ATOM   3880  C  CB   . ILE A 1 79 ? -13.181 1.329   -3.659  1.00 0.00 ? 143 ILE A CB   3  
ATOM   3881  C  CG1  . ILE A 1 79 ? -11.651 1.320   -3.679  1.00 0.00 ? 143 ILE A CG1  3  
ATOM   3882  C  CG2  . ILE A 1 79 ? -13.736 0.474   -4.789  1.00 0.00 ? 143 ILE A CG2  3  
ATOM   3883  C  CD1  . ILE A 1 79 ? -11.049 0.000   -3.250  1.00 0.00 ? 143 ILE A CD1  3  
ATOM   3884  H  H    . ILE A 1 79 ? -12.524 3.240   -2.079  1.00 0.00 ? 143 ILE A H    3  
ATOM   3885  H  HA   . ILE A 1 79 ? -13.390 3.180   -4.717  1.00 0.00 ? 143 ILE A HA   3  
ATOM   3886  H  HB   . ILE A 1 79 ? -13.524 0.913   -2.724  1.00 0.00 ? 143 ILE A HB   3  
ATOM   3887  H  HG12 . ILE A 1 79 ? -11.309 1.530   -4.680  1.00 0.00 ? 143 ILE A HG12 3  
ATOM   3888  H  HG13 . ILE A 1 79 ? -11.286 2.086   -3.010  1.00 0.00 ? 143 ILE A HG13 3  
ATOM   3889  H  HG21 . ILE A 1 79 ? -14.695 0.864   -5.098  1.00 0.00 ? 143 ILE A HG21 3  
ATOM   3890  H  HG22 . ILE A 1 79 ? -13.053 0.497   -5.626  1.00 0.00 ? 143 ILE A HG22 3  
ATOM   3891  H  HG23 . ILE A 1 79 ? -13.853 -0.543  -4.448  1.00 0.00 ? 143 ILE A HG23 3  
ATOM   3892  H  HD11 . ILE A 1 79 ? -11.011 -0.044  -2.170  1.00 0.00 ? 143 ILE A HD11 3  
ATOM   3893  H  HD12 . ILE A 1 79 ? -11.657 -0.811  -3.620  1.00 0.00 ? 143 ILE A HD12 3  
ATOM   3894  H  HD13 . ILE A 1 79 ? -10.050 -0.087  -3.648  1.00 0.00 ? 143 ILE A HD13 3  
ATOM   3895  N  N    . ARG A 1 80 ? -15.785 2.290   -2.612  1.00 0.00 ? 144 ARG A N    3  
ATOM   3896  C  CA   . ARG A 1 80 ? -17.232 2.216   -2.448  1.00 0.00 ? 144 ARG A CA   3  
ATOM   3897  C  C    . ARG A 1 80 ? -17.758 3.435   -1.696  1.00 0.00 ? 144 ARG A C    3  
ATOM   3898  O  O    . ARG A 1 80 ? -18.157 3.337   -0.536  1.00 0.00 ? 144 ARG A O    3  
ATOM   3899  C  CB   . ARG A 1 80 ? -17.617 0.937   -1.701  1.00 0.00 ? 144 ARG A CB   3  
ATOM   3900  C  CG   . ARG A 1 80 ? -16.649 0.567   -0.589  1.00 0.00 ? 144 ARG A CG   3  
ATOM   3901  C  CD   . ARG A 1 80 ? -17.174 -0.593  0.243   1.00 0.00 ? 144 ARG A CD   3  
ATOM   3902  N  NE   . ARG A 1 80 ? -16.783 -1.886  -0.312  1.00 0.00 ? 144 ARG A NE   3  
ATOM   3903  C  CZ   . ARG A 1 80 ? -17.056 -3.048  0.269   1.00 0.00 ? 144 ARG A CZ   3  
ATOM   3904  N  NH1  . ARG A 1 80 ? -17.719 -3.080  1.417   1.00 0.00 ? 144 ARG A NH1  3  
ATOM   3905  N  NH2  . ARG A 1 80 ? -16.667 -4.183  -0.298  1.00 0.00 ? 144 ARG A NH2  3  
ATOM   3906  H  H    . ARG A 1 80 ? -15.206 1.996   -1.878  1.00 0.00 ? 144 ARG A H    3  
ATOM   3907  H  HA   . ARG A 1 80 ? -17.677 2.195   -3.432  1.00 0.00 ? 144 ARG A HA   3  
ATOM   3908  H  HB2  . ARG A 1 80 ? -18.597 1.069   -1.266  1.00 0.00 ? 144 ARG A HB2  3  
ATOM   3909  H  HB3  . ARG A 1 80 ? -17.652 0.120   -2.406  1.00 0.00 ? 144 ARG A HB3  3  
ATOM   3910  H  HG2  . ARG A 1 80 ? -15.704 0.282   -1.027  1.00 0.00 ? 144 ARG A HG2  3  
ATOM   3911  H  HG3  . ARG A 1 80 ? -16.507 1.424   0.052   1.00 0.00 ? 144 ARG A HG3  3  
ATOM   3912  H  HD2  . ARG A 1 80 ? -16.780 -0.508  1.244   1.00 0.00 ? 144 ARG A HD2  3  
ATOM   3913  H  HD3  . ARG A 1 80 ? -18.252 -0.536  0.275   1.00 0.00 ? 144 ARG A HD3  3  
ATOM   3914  H  HE   . ARG A 1 80 ? -16.292 -1.886  -1.160  1.00 0.00 ? 144 ARG A HE   3  
ATOM   3915  H  HH11 . ARG A 1 80 ? -18.015 -2.226  1.846   1.00 0.00 ? 144 ARG A HH11 3  
ATOM   3916  H  HH12 . ARG A 1 80 ? -17.925 -3.956  1.852   1.00 0.00 ? 144 ARG A HH12 3  
ATOM   3917  H  HH21 . ARG A 1 80 ? -16.167 -4.164  -1.163  1.00 0.00 ? 144 ARG A HH21 3  
ATOM   3918  H  HH22 . ARG A 1 80 ? -16.873 -5.057  0.141   1.00 0.00 ? 144 ARG A HH22 3  
ATOM   3919  N  N    . PHE A 1 81 ? -17.754 4.583   -2.365  1.00 0.00 ? 145 PHE A N    3  
ATOM   3920  C  CA   . PHE A 1 81 ? -18.228 5.822   -1.760  1.00 0.00 ? 145 PHE A CA   3  
ATOM   3921  C  C    . PHE A 1 81 ? -18.728 6.792   -2.827  1.00 0.00 ? 145 PHE A C    3  
ATOM   3922  O  O    . PHE A 1 81 ? -18.195 6.843   -3.934  1.00 0.00 ? 145 PHE A O    3  
ATOM   3923  C  CB   . PHE A 1 81 ? -17.112 6.476   -0.943  1.00 0.00 ? 145 PHE A CB   3  
ATOM   3924  C  CG   . PHE A 1 81 ? -17.585 7.616   -0.086  1.00 0.00 ? 145 PHE A CG   3  
ATOM   3925  C  CD1  . PHE A 1 81 ? -18.257 7.375   1.101   1.00 0.00 ? 145 PHE A CD1  3  
ATOM   3926  C  CD2  . PHE A 1 81 ? -17.358 8.928   -0.469  1.00 0.00 ? 145 PHE A CD2  3  
ATOM   3927  C  CE1  . PHE A 1 81 ? -18.693 8.422   1.892   1.00 0.00 ? 145 PHE A CE1  3  
ATOM   3928  C  CE2  . PHE A 1 81 ? -17.791 9.978   0.317   1.00 0.00 ? 145 PHE A CE2  3  
ATOM   3929  C  CZ   . PHE A 1 81 ? -18.460 9.725   1.498   1.00 0.00 ? 145 PHE A CZ   3  
ATOM   3930  H  H    . PHE A 1 81 ? -17.423 4.598   -3.288  1.00 0.00 ? 145 PHE A H    3  
ATOM   3931  H  HA   . PHE A 1 81 ? -19.048 5.576   -1.102  1.00 0.00 ? 145 PHE A HA   3  
ATOM   3932  H  HB2  . PHE A 1 81 ? -16.670 5.735   -0.294  1.00 0.00 ? 145 PHE A HB2  3  
ATOM   3933  H  HB3  . PHE A 1 81 ? -16.358 6.855   -1.616  1.00 0.00 ? 145 PHE A HB3  3  
ATOM   3934  H  HD1  . PHE A 1 81 ? -18.439 6.355   1.410   1.00 0.00 ? 145 PHE A HD1  3  
ATOM   3935  H  HD2  . PHE A 1 81 ? -16.835 9.128   -1.394  1.00 0.00 ? 145 PHE A HD2  3  
ATOM   3936  H  HE1  . PHE A 1 81 ? -19.216 8.220   2.815   1.00 0.00 ? 145 PHE A HE1  3  
ATOM   3937  H  HE2  . PHE A 1 81 ? -17.608 10.997  0.007   1.00 0.00 ? 145 PHE A HE2  3  
ATOM   3938  H  HZ   . PHE A 1 81 ? -18.800 10.544  2.115   1.00 0.00 ? 145 PHE A HZ   3  
ATOM   3939  N  N    . GLY A 1 82 ? -19.758 7.560   -2.484  1.00 0.00 ? 146 GLY A N    3  
ATOM   3940  C  CA   . GLY A 1 82 ? -20.313 8.518   -3.422  1.00 0.00 ? 146 GLY A CA   3  
ATOM   3941  C  C    . GLY A 1 82 ? -21.770 8.242   -3.737  1.00 0.00 ? 146 GLY A C    3  
ATOM   3942  O  O    . GLY A 1 82 ? -22.089 7.660   -4.774  1.00 0.00 ? 146 GLY A O    3  
ATOM   3943  H  H    . GLY A 1 82 ? -20.143 7.477   -1.586  1.00 0.00 ? 146 GLY A H    3  
ATOM   3944  H  HA2  . GLY A 1 82 ? -20.228 9.509   -3.002  1.00 0.00 ? 146 GLY A HA2  3  
ATOM   3945  H  HA3  . GLY A 1 82 ? -19.745 8.477   -4.340  1.00 0.00 ? 146 GLY A HA3  3  
ATOM   3946  N  N    . SER A 1 83 ? -22.658 8.659   -2.840  1.00 0.00 ? 147 SER A N    3  
ATOM   3947  C  CA   . SER A 1 83 ? -24.089 8.449   -3.025  1.00 0.00 ? 147 SER A CA   3  
ATOM   3948  C  C    . SER A 1 83 ? -24.867 9.730   -2.742  1.00 0.00 ? 147 SER A C    3  
ATOM   3949  O  O    . SER A 1 83 ? -25.722 10.137  -3.527  1.00 0.00 ? 147 SER A O    3  
ATOM   3950  C  CB   . SER A 1 83 ? -24.583 7.326   -2.110  1.00 0.00 ? 147 SER A CB   3  
ATOM   3951  O  OG   . SER A 1 83 ? -25.975 7.113   -2.271  1.00 0.00 ? 147 SER A OG   3  
ATOM   3952  H  H    . SER A 1 83 ? -22.341 9.117   -2.033  1.00 0.00 ? 147 SER A H    3  
ATOM   3953  H  HA   . SER A 1 83 ? -24.251 8.162   -4.053  1.00 0.00 ? 147 SER A HA   3  
ATOM   3954  H  HB2  . SER A 1 83 ? -24.061 6.412   -2.352  1.00 0.00 ? 147 SER A HB2  3  
ATOM   3955  H  HB3  . SER A 1 83 ? -24.387 7.591   -1.081  1.00 0.00 ? 147 SER A HB3  3  
ATOM   3956  H  HG   . SER A 1 83 ? -26.239 7.374   -3.156  1.00 0.00 ? 147 SER A HG   3  
ATOM   3957  N  N    . GLY A 1 84 ? -24.564 10.362  -1.612  1.00 0.00 ? 148 GLY A N    3  
ATOM   3958  C  CA   . GLY A 1 84 ? -25.243 11.591  -1.244  1.00 0.00 ? 148 GLY A CA   3  
ATOM   3959  C  C    . GLY A 1 84 ? -25.670 11.604  0.211   1.00 0.00 ? 148 GLY A C    3  
ATOM   3960  O  O    . GLY A 1 84 ? -25.072 10.944  1.061   1.00 0.00 ? 148 GLY A O    3  
ATOM   3961  H  H    . GLY A 1 84 ? -23.873 9.991   -1.023  1.00 0.00 ? 148 GLY A H    3  
ATOM   3962  H  HA2  . GLY A 1 84 ? -24.579 12.423  -1.421  1.00 0.00 ? 148 GLY A HA2  3  
ATOM   3963  H  HA3  . GLY A 1 84 ? -26.120 11.704  -1.865  1.00 0.00 ? 148 GLY A HA3  3  
ATOM   3964  N  N    . PRO A 1 85 ? -26.728 12.370  0.514   1.00 0.00 ? 149 PRO A N    3  
ATOM   3965  C  CA   . PRO A 1 85 ? -27.257 12.486  1.876   1.00 0.00 ? 149 PRO A CA   3  
ATOM   3966  C  C    . PRO A 1 85 ? -27.930 11.202  2.348   1.00 0.00 ? 149 PRO A C    3  
ATOM   3967  O  O    . PRO A 1 85 ? -28.465 11.140  3.454   1.00 0.00 ? 149 PRO A O    3  
ATOM   3968  C  CB   . PRO A 1 85 ? -28.283 13.616  1.763   1.00 0.00 ? 149 PRO A CB   3  
ATOM   3969  C  CG   . PRO A 1 85 ? -28.701 13.607  0.333   1.00 0.00 ? 149 PRO A CG   3  
ATOM   3970  C  CD   . PRO A 1 85 ? -27.489 13.183  -0.449  1.00 0.00 ? 149 PRO A CD   3  
ATOM   3971  H  HA   . PRO A 1 85 ? -26.486 12.767  2.579   1.00 0.00 ? 149 PRO A HA   3  
ATOM   3972  H  HB2  . PRO A 1 85 ? -29.117 13.416  2.421   1.00 0.00 ? 149 PRO A HB2  3  
ATOM   3973  H  HB3  . PRO A 1 85 ? -27.822 14.554  2.034   1.00 0.00 ? 149 PRO A HB3  3  
ATOM   3974  H  HG2  . PRO A 1 85 ? -29.506 12.902  0.190   1.00 0.00 ? 149 PRO A HG2  3  
ATOM   3975  H  HG3  . PRO A 1 85 ? -29.011 14.598  0.036   1.00 0.00 ? 149 PRO A HG3  3  
ATOM   3976  H  HD2  . PRO A 1 85 ? -27.780 12.594  -1.306  1.00 0.00 ? 149 PRO A HD2  3  
ATOM   3977  H  HD3  . PRO A 1 85 ? -26.919 14.047  -0.760  1.00 0.00 ? 149 PRO A HD3  3  
ATOM   3978  N  N    . SER A 1 86 ? -27.897 10.177  1.502   1.00 0.00 ? 150 SER A N    3  
ATOM   3979  C  CA   . SER A 1 86 ? -28.507 8.894   1.831   1.00 0.00 ? 150 SER A CA   3  
ATOM   3980  C  C    . SER A 1 86 ? -27.449 7.798   1.927   1.00 0.00 ? 150 SER A C    3  
ATOM   3981  O  O    . SER A 1 86 ? -26.309 7.982   1.501   1.00 0.00 ? 150 SER A O    3  
ATOM   3982  C  CB   . SER A 1 86 ? -29.554 8.518   0.781   1.00 0.00 ? 150 SER A CB   3  
ATOM   3983  O  OG   . SER A 1 86 ? -30.209 7.309   1.124   1.00 0.00 ? 150 SER A OG   3  
ATOM   3984  H  H    . SER A 1 86 ? -27.455 10.288  0.634   1.00 0.00 ? 150 SER A H    3  
ATOM   3985  H  HA   . SER A 1 86 ? -28.992 8.994   2.791   1.00 0.00 ? 150 SER A HA   3  
ATOM   3986  H  HB2  . SER A 1 86 ? -30.290 9.305   0.712   1.00 0.00 ? 150 SER A HB2  3  
ATOM   3987  H  HB3  . SER A 1 86 ? -29.070 8.393   -0.177  1.00 0.00 ? 150 SER A HB3  3  
ATOM   3988  H  HG   . SER A 1 86 ? -31.126 7.351   0.845   1.00 0.00 ? 150 SER A HG   3  
ATOM   3989  N  N    . SER A 1 87 ? -27.837 6.658   2.488   1.00 0.00 ? 151 SER A N    3  
ATOM   3990  C  CA   . SER A 1 87 ? -26.922 5.533   2.644   1.00 0.00 ? 151 SER A CA   3  
ATOM   3991  C  C    . SER A 1 87 ? -27.511 4.265   2.032   1.00 0.00 ? 151 SER A C    3  
ATOM   3992  O  O    . SER A 1 87 ? -26.842 3.554   1.284   1.00 0.00 ? 151 SER A O    3  
ATOM   3993  C  CB   . SER A 1 87 ? -26.611 5.302   4.124   1.00 0.00 ? 151 SER A CB   3  
ATOM   3994  O  OG   . SER A 1 87 ? -27.789 4.997   4.851   1.00 0.00 ? 151 SER A OG   3  
ATOM   3995  H  H    . SER A 1 87 ? -28.759 6.572   2.808   1.00 0.00 ? 151 SER A H    3  
ATOM   3996  H  HA   . SER A 1 87 ? -26.006 5.776   2.126   1.00 0.00 ? 151 SER A HA   3  
ATOM   3997  H  HB2  . SER A 1 87 ? -25.920 4.478   4.220   1.00 0.00 ? 151 SER A HB2  3  
ATOM   3998  H  HB3  . SER A 1 87 ? -26.166 6.195   4.539   1.00 0.00 ? 151 SER A HB3  3  
ATOM   3999  H  HG   . SER A 1 87 ? -27.767 5.447   5.699   1.00 0.00 ? 151 SER A HG   3  
ATOM   4000  N  N    . GLY A 1 88 ? -28.770 3.989   2.358   1.00 0.00 ? 152 GLY A N    3  
ATOM   4001  C  CA   . GLY A 1 88 ? -29.430 2.807   1.833   1.00 0.00 ? 152 GLY A CA   3  
ATOM   4002  C  C    . GLY A 1 88 ? -28.709 1.527   2.206   1.00 0.00 ? 152 GLY A C    3  
ATOM   4003  O  O    . GLY A 1 88 ? -28.745 1.099   3.359   1.00 0.00 ? 152 GLY A O    3  
ATOM   4004  H  H    . GLY A 1 88 ? -29.255 4.592   2.959   1.00 0.00 ? 152 GLY A H    3  
ATOM   4005  H  HA2  . GLY A 1 88 ? -30.436 2.767   2.221   1.00 0.00 ? 152 GLY A HA2  3  
ATOM   4006  H  HA3  . GLY A 1 88 ? -29.473 2.882   0.756   1.00 0.00 ? 152 GLY A HA3  3  
HETATM 4007  ZN ZN   . ZN  B 2 .  ? 2.800   2.402   -9.112  1.00 0.00 ? 200 ZN  A ZN   3  
HETATM 4008  ZN ZN   . ZN  C 2 .  ? 6.871   -11.115 -1.015  1.00 0.00 ? 300 ZN  A ZN   3  
ATOM   4009  N  N    . GLY A 1 1  ? 14.522  6.947   -18.925 1.00 0.00 ? 65  GLY A N    4  
ATOM   4010  C  CA   . GLY A 1 1  ? 14.012  7.892   -17.948 1.00 0.00 ? 65  GLY A CA   4  
ATOM   4011  C  C    . GLY A 1 1  ? 14.725  7.790   -16.615 1.00 0.00 ? 65  GLY A C    4  
ATOM   4012  O  O    . GLY A 1 1  ? 14.197  7.217   -15.662 1.00 0.00 ? 65  GLY A O    4  
ATOM   4013  H  H1   . GLY A 1 1  ? 13.999  6.150   -19.153 1.00 0.00 ? 65  GLY A H1   4  
ATOM   4014  H  HA2  . GLY A 1 1  ? 14.133  8.893   -18.334 1.00 0.00 ? 65  GLY A HA2  4  
ATOM   4015  H  HA3  . GLY A 1 1  ? 12.959  7.701   -17.795 1.00 0.00 ? 65  GLY A HA3  4  
ATOM   4016  N  N    . SER A 1 2  ? 15.931  8.346   -16.547 1.00 0.00 ? 66  SER A N    4  
ATOM   4017  C  CA   . SER A 1 2  ? 16.721  8.310   -15.322 1.00 0.00 ? 66  SER A CA   4  
ATOM   4018  C  C    . SER A 1 2  ? 16.227  9.355   -14.326 1.00 0.00 ? 66  SER A C    4  
ATOM   4019  O  O    . SER A 1 2  ? 15.688  10.392  -14.713 1.00 0.00 ? 66  SER A O    4  
ATOM   4020  C  CB   . SER A 1 2  ? 18.199  8.547   -15.636 1.00 0.00 ? 66  SER A CB   4  
ATOM   4021  O  OG   . SER A 1 2  ? 18.842  7.340   -16.009 1.00 0.00 ? 66  SER A OG   4  
ATOM   4022  H  H    . SER A 1 2  ? 16.298  8.788   -17.340 1.00 0.00 ? 66  SER A H    4  
ATOM   4023  H  HA   . SER A 1 2  ? 16.608  7.330   -14.883 1.00 0.00 ? 66  SER A HA   4  
ATOM   4024  H  HB2  . SER A 1 2  ? 18.283  9.251   -16.449 1.00 0.00 ? 66  SER A HB2  4  
ATOM   4025  H  HB3  . SER A 1 2  ? 18.691  8.948   -14.761 1.00 0.00 ? 66  SER A HB3  4  
ATOM   4026  H  HG   . SER A 1 2  ? 18.435  6.605   -15.545 1.00 0.00 ? 66  SER A HG   4  
ATOM   4027  N  N    . SER A 1 3  ? 16.415  9.074   -13.040 1.00 0.00 ? 67  SER A N    4  
ATOM   4028  C  CA   . SER A 1 3  ? 15.985  9.986   -11.987 1.00 0.00 ? 67  SER A CA   4  
ATOM   4029  C  C    . SER A 1 3  ? 16.520  11.393  -12.237 1.00 0.00 ? 67  SER A C    4  
ATOM   4030  O  O    . SER A 1 3  ? 17.721  11.639  -12.141 1.00 0.00 ? 67  SER A O    4  
ATOM   4031  C  CB   . SER A 1 3  ? 16.459  9.483   -10.623 1.00 0.00 ? 67  SER A CB   4  
ATOM   4032  O  OG   . SER A 1 3  ? 16.060  8.141   -10.407 1.00 0.00 ? 67  SER A OG   4  
ATOM   4033  H  H    . SER A 1 3  ? 16.850  8.231   -12.795 1.00 0.00 ? 67  SER A H    4  
ATOM   4034  H  HA   . SER A 1 3  ? 14.906  10.017  -11.996 1.00 0.00 ? 67  SER A HA   4  
ATOM   4035  H  HB2  . SER A 1 3  ? 17.536  9.538   -10.575 1.00 0.00 ? 67  SER A HB2  4  
ATOM   4036  H  HB3  . SER A 1 3  ? 16.032  10.102  -9.846  1.00 0.00 ? 67  SER A HB3  4  
ATOM   4037  H  HG   . SER A 1 3  ? 16.519  7.567   -11.025 1.00 0.00 ? 67  SER A HG   4  
ATOM   4038  N  N    . GLY A 1 4  ? 15.616  12.315  -12.559 1.00 0.00 ? 68  GLY A N    4  
ATOM   4039  C  CA   . GLY A 1 4  ? 16.015  13.686  -12.817 1.00 0.00 ? 68  GLY A CA   4  
ATOM   4040  C  C    . GLY A 1 4  ? 14.976  14.689  -12.357 1.00 0.00 ? 68  GLY A C    4  
ATOM   4041  O  O    . GLY A 1 4  ? 14.614  14.722  -11.181 1.00 0.00 ? 68  GLY A O    4  
ATOM   4042  H  H    . GLY A 1 4  ? 14.672  12.061  -12.621 1.00 0.00 ? 68  GLY A H    4  
ATOM   4043  H  HA2  . GLY A 1 4  ? 16.943  13.883  -12.302 1.00 0.00 ? 68  GLY A HA2  4  
ATOM   4044  H  HA3  . GLY A 1 4  ? 16.171  13.809  -13.879 1.00 0.00 ? 68  GLY A HA3  4  
ATOM   4045  N  N    . SER A 1 5  ? 14.496  15.510  -13.285 1.00 0.00 ? 69  SER A N    4  
ATOM   4046  C  CA   . SER A 1 5  ? 13.496  16.522  -12.967 1.00 0.00 ? 69  SER A CA   4  
ATOM   4047  C  C    . SER A 1 5  ? 12.094  15.920  -12.967 1.00 0.00 ? 69  SER A C    4  
ATOM   4048  O  O    . SER A 1 5  ? 11.156  16.505  -13.509 1.00 0.00 ? 69  SER A O    4  
ATOM   4049  C  CB   . SER A 1 5  ? 13.569  17.675  -13.970 1.00 0.00 ? 69  SER A CB   4  
ATOM   4050  O  OG   . SER A 1 5  ? 12.789  18.776  -13.539 1.00 0.00 ? 69  SER A OG   4  
ATOM   4051  H  H    . SER A 1 5  ? 14.824  15.434  -14.206 1.00 0.00 ? 69  SER A H    4  
ATOM   4052  H  HA   . SER A 1 5  ? 13.711  16.902  -11.979 1.00 0.00 ? 69  SER A HA   4  
ATOM   4053  H  HB2  . SER A 1 5  ? 14.594  17.994  -14.073 1.00 0.00 ? 69  SER A HB2  4  
ATOM   4054  H  HB3  . SER A 1 5  ? 13.198  17.339  -14.927 1.00 0.00 ? 69  SER A HB3  4  
ATOM   4055  H  HG   . SER A 1 5  ? 11.859  18.536  -13.554 1.00 0.00 ? 69  SER A HG   4  
ATOM   4056  N  N    . SER A 1 6  ? 11.960  14.748  -12.356 1.00 0.00 ? 70  SER A N    4  
ATOM   4057  C  CA   . SER A 1 6  ? 10.674  14.063  -12.289 1.00 0.00 ? 70  SER A CA   4  
ATOM   4058  C  C    . SER A 1 6  ? 9.858   14.557  -11.098 1.00 0.00 ? 70  SER A C    4  
ATOM   4059  O  O    . SER A 1 6  ? 10.346  14.595  -9.969  1.00 0.00 ? 70  SER A O    4  
ATOM   4060  C  CB   . SER A 1 6  ? 10.882  12.551  -12.187 1.00 0.00 ? 70  SER A CB   4  
ATOM   4061  O  OG   . SER A 1 6  ? 11.160  11.988  -13.458 1.00 0.00 ? 70  SER A OG   4  
ATOM   4062  H  H    . SER A 1 6  ? 12.745  14.332  -11.942 1.00 0.00 ? 70  SER A H    4  
ATOM   4063  H  HA   . SER A 1 6  ? 10.133  14.284  -13.197 1.00 0.00 ? 70  SER A HA   4  
ATOM   4064  H  HB2  . SER A 1 6  ? 11.711  12.348  -11.527 1.00 0.00 ? 70  SER A HB2  4  
ATOM   4065  H  HB3  . SER A 1 6  ? 9.986   12.093  -11.792 1.00 0.00 ? 70  SER A HB3  4  
ATOM   4066  H  HG   . SER A 1 6  ? 10.467  11.368  -13.692 1.00 0.00 ? 70  SER A HG   4  
ATOM   4067  N  N    . GLY A 1 7  ? 8.609   14.934  -11.359 1.00 0.00 ? 71  GLY A N    4  
ATOM   4068  C  CA   . GLY A 1 7  ? 7.744   15.420  -10.300 1.00 0.00 ? 71  GLY A CA   4  
ATOM   4069  C  C    . GLY A 1 7  ? 7.340   14.325  -9.333  1.00 0.00 ? 71  GLY A C    4  
ATOM   4070  O  O    . GLY A 1 7  ? 8.194   13.664  -8.742  1.00 0.00 ? 71  GLY A O    4  
ATOM   4071  H  H    . GLY A 1 7  ? 8.274   14.881  -12.279 1.00 0.00 ? 71  GLY A H    4  
ATOM   4072  H  HA2  . GLY A 1 7  ? 8.262   16.195  -9.755  1.00 0.00 ? 71  GLY A HA2  4  
ATOM   4073  H  HA3  . GLY A 1 7  ? 6.853   15.839  -10.744 1.00 0.00 ? 71  GLY A HA3  4  
ATOM   4074  N  N    . MET A 1 8  ? 6.035   14.134  -9.169  1.00 0.00 ? 72  MET A N    4  
ATOM   4075  C  CA   . MET A 1 8  ? 5.520   13.112  -8.266  1.00 0.00 ? 72  MET A CA   4  
ATOM   4076  C  C    . MET A 1 8  ? 5.866   11.715  -8.772  1.00 0.00 ? 72  MET A C    4  
ATOM   4077  O  O    . MET A 1 8  ? 5.944   11.485  -9.978  1.00 0.00 ? 72  MET A O    4  
ATOM   4078  C  CB   . MET A 1 8  ? 4.005   13.252  -8.114  1.00 0.00 ? 72  MET A CB   4  
ATOM   4079  C  CG   . MET A 1 8  ? 3.590   14.243  -7.039  1.00 0.00 ? 72  MET A CG   4  
ATOM   4080  S  SD   . MET A 1 8  ? 4.062   15.937  -7.437  1.00 0.00 ? 72  MET A SD   4  
ATOM   4081  C  CE   . MET A 1 8  ? 5.460   16.165  -6.341  1.00 0.00 ? 72  MET A CE   4  
ATOM   4082  H  H    . MET A 1 8  ? 5.403   14.693  -9.668  1.00 0.00 ? 72  MET A H    4  
ATOM   4083  H  HA   . MET A 1 8  ? 5.984   13.258  -7.302  1.00 0.00 ? 72  MET A HA   4  
ATOM   4084  H  HB2  . MET A 1 8  ? 3.589   13.580  -9.055  1.00 0.00 ? 72  MET A HB2  4  
ATOM   4085  H  HB3  . MET A 1 8  ? 3.589   12.287  -7.863  1.00 0.00 ? 72  MET A HB3  4  
ATOM   4086  H  HG2  . MET A 1 8  ? 2.517   14.201  -6.923  1.00 0.00 ? 72  MET A HG2  4  
ATOM   4087  H  HG3  . MET A 1 8  ? 4.061   13.961  -6.109  1.00 0.00 ? 72  MET A HG3  4  
ATOM   4088  H  HE1  . MET A 1 8  ? 5.136   16.677  -5.446  1.00 0.00 ? 72  MET A HE1  4  
ATOM   4089  H  HE2  . MET A 1 8  ? 5.871   15.202  -6.076  1.00 0.00 ? 72  MET A HE2  4  
ATOM   4090  H  HE3  . MET A 1 8  ? 6.216   16.754  -6.839  1.00 0.00 ? 72  MET A HE3  4  
ATOM   4091  N  N    . GLU A 1 9  ? 6.072   10.787  -7.842  1.00 0.00 ? 73  GLU A N    4  
ATOM   4092  C  CA   . GLU A 1 9  ? 6.410   9.414   -8.196  1.00 0.00 ? 73  GLU A CA   4  
ATOM   4093  C  C    . GLU A 1 9  ? 5.640   8.423   -7.329  1.00 0.00 ? 73  GLU A C    4  
ATOM   4094  O  O    . GLU A 1 9  ? 5.534   8.595   -6.114  1.00 0.00 ? 73  GLU A O    4  
ATOM   4095  C  CB   . GLU A 1 9  ? 7.915   9.180   -8.043  1.00 0.00 ? 73  GLU A CB   4  
ATOM   4096  C  CG   . GLU A 1 9  ? 8.360   9.010   -6.600  1.00 0.00 ? 73  GLU A CG   4  
ATOM   4097  C  CD   . GLU A 1 9  ? 9.820   9.366   -6.394  1.00 0.00 ? 73  GLU A CD   4  
ATOM   4098  O  OE1  . GLU A 1 9  ? 10.113  10.562  -6.181  1.00 0.00 ? 73  GLU A OE1  4  
ATOM   4099  O  OE2  . GLU A 1 9  ? 10.668  8.452   -6.446  1.00 0.00 ? 73  GLU A OE2  4  
ATOM   4100  H  H    . GLU A 1 9  ? 5.995   11.033  -6.897  1.00 0.00 ? 73  GLU A H    4  
ATOM   4101  H  HA   . GLU A 1 9  ? 6.135   9.260   -9.229  1.00 0.00 ? 73  GLU A HA   4  
ATOM   4102  H  HB2  . GLU A 1 9  ? 8.186   8.289   -8.590  1.00 0.00 ? 73  GLU A HB2  4  
ATOM   4103  H  HB3  . GLU A 1 9  ? 8.442   10.024  -8.463  1.00 0.00 ? 73  GLU A HB3  4  
ATOM   4104  H  HG2  . GLU A 1 9  ? 7.758   9.649   -5.973  1.00 0.00 ? 73  GLU A HG2  4  
ATOM   4105  H  HG3  . GLU A 1 9  ? 8.213   7.980   -6.311  1.00 0.00 ? 73  GLU A HG3  4  
ATOM   4106  N  N    . CYS A 1 10 ? 5.102   7.386   -7.962  1.00 0.00 ? 74  CYS A N    4  
ATOM   4107  C  CA   . CYS A 1 10 ? 4.339   6.367   -7.250  1.00 0.00 ? 74  CYS A CA   4  
ATOM   4108  C  C    . CYS A 1 10 ? 5.068   5.928   -5.983  1.00 0.00 ? 74  CYS A C    4  
ATOM   4109  O  O    . CYS A 1 10 ? 6.298   5.931   -5.930  1.00 0.00 ? 74  CYS A O    4  
ATOM   4110  C  CB   . CYS A 1 10 ? 4.095   5.158   -8.156  1.00 0.00 ? 74  CYS A CB   4  
ATOM   4111  S  SG   . CYS A 1 10 ? 3.027   3.880   -7.418  1.00 0.00 ? 74  CYS A SG   4  
ATOM   4112  H  H    . CYS A 1 10 ? 5.220   7.303   -8.932  1.00 0.00 ? 74  CYS A H    4  
ATOM   4113  H  HA   . CYS A 1 10 ? 3.389   6.796   -6.973  1.00 0.00 ? 74  CYS A HA   4  
ATOM   4114  H  HB2  . CYS A 1 10 ? 3.623   5.492   -9.069  1.00 0.00 ? 74  CYS A HB2  4  
ATOM   4115  H  HB3  . CYS A 1 10 ? 5.043   4.698   -8.394  1.00 0.00 ? 74  CYS A HB3  4  
ATOM   4116  N  N    . ARG A 1 11 ? 4.300   5.551   -4.966  1.00 0.00 ? 75  ARG A N    4  
ATOM   4117  C  CA   . ARG A 1 11 ? 4.872   5.110   -3.700  1.00 0.00 ? 75  ARG A CA   4  
ATOM   4118  C  C    . ARG A 1 11 ? 4.938   3.587   -3.633  1.00 0.00 ? 75  ARG A C    4  
ATOM   4119  O  O    . ARG A 1 11 ? 5.809   3.021   -2.973  1.00 0.00 ? 75  ARG A O    4  
ATOM   4120  C  CB   . ARG A 1 11 ? 4.046   5.647   -2.529  1.00 0.00 ? 75  ARG A CB   4  
ATOM   4121  C  CG   . ARG A 1 11 ? 3.924   7.162   -2.513  1.00 0.00 ? 75  ARG A CG   4  
ATOM   4122  C  CD   . ARG A 1 11 ? 5.172   7.816   -1.942  1.00 0.00 ? 75  ARG A CD   4  
ATOM   4123  N  NE   . ARG A 1 11 ? 6.285   7.791   -2.888  1.00 0.00 ? 75  ARG A NE   4  
ATOM   4124  C  CZ   . ARG A 1 11 ? 7.561   7.852   -2.523  1.00 0.00 ? 75  ARG A CZ   4  
ATOM   4125  N  NH1  . ARG A 1 11 ? 7.884   7.940   -1.240  1.00 0.00 ? 75  ARG A NH1  4  
ATOM   4126  N  NH2  . ARG A 1 11 ? 8.517   7.824   -3.443  1.00 0.00 ? 75  ARG A NH2  4  
ATOM   4127  H  H    . ARG A 1 11 ? 3.326   5.571   -5.070  1.00 0.00 ? 75  ARG A H    4  
ATOM   4128  H  HA   . ARG A 1 11 ? 5.874   5.506   -3.633  1.00 0.00 ? 75  ARG A HA   4  
ATOM   4129  H  HB2  . ARG A 1 11 ? 3.052   5.228   -2.583  1.00 0.00 ? 75  ARG A HB2  4  
ATOM   4130  H  HB3  . ARG A 1 11 ? 4.509   5.336   -1.605  1.00 0.00 ? 75  ARG A HB3  4  
ATOM   4131  H  HG2  . ARG A 1 11 ? 3.779   7.513   -3.525  1.00 0.00 ? 75  ARG A HG2  4  
ATOM   4132  H  HG3  . ARG A 1 11 ? 3.073   7.439   -1.909  1.00 0.00 ? 75  ARG A HG3  4  
ATOM   4133  H  HD2  . ARG A 1 11 ? 4.944   8.842   -1.695  1.00 0.00 ? 75  ARG A HD2  4  
ATOM   4134  H  HD3  . ARG A 1 11 ? 5.461   7.286   -1.046  1.00 0.00 ? 75  ARG A HD3  4  
ATOM   4135  H  HE   . ARG A 1 11 ? 6.069   7.727   -3.841  1.00 0.00 ? 75  ARG A HE   4  
ATOM   4136  H  HH11 . ARG A 1 11 ? 7.165   7.959   -0.545  1.00 0.00 ? 75  ARG A HH11 4  
ATOM   4137  H  HH12 . ARG A 1 11 ? 8.845   7.984   -0.968  1.00 0.00 ? 75  ARG A HH12 4  
ATOM   4138  H  HH21 . ARG A 1 11 ? 8.277   7.758   -4.411  1.00 0.00 ? 75  ARG A HH21 4  
ATOM   4139  H  HH22 . ARG A 1 11 ? 9.477   7.870   -3.167  1.00 0.00 ? 75  ARG A HH22 4  
ATOM   4140  N  N    . VAL A 1 12 ? 4.011   2.929   -4.323  1.00 0.00 ? 76  VAL A N    4  
ATOM   4141  C  CA   . VAL A 1 12 ? 3.964   1.472   -4.343  1.00 0.00 ? 76  VAL A CA   4  
ATOM   4142  C  C    . VAL A 1 12 ? 5.126   0.896   -5.144  1.00 0.00 ? 76  VAL A C    4  
ATOM   4143  O  O    . VAL A 1 12 ? 5.979   0.192   -4.602  1.00 0.00 ? 76  VAL A O    4  
ATOM   4144  C  CB   . VAL A 1 12 ? 2.639   0.962   -4.941  1.00 0.00 ? 76  VAL A CB   4  
ATOM   4145  C  CG1  . VAL A 1 12 ? 2.615   -0.559  -4.965  1.00 0.00 ? 76  VAL A CG1  4  
ATOM   4146  C  CG2  . VAL A 1 12 ? 1.455   1.510   -4.159  1.00 0.00 ? 76  VAL A CG2  4  
ATOM   4147  H  H    . VAL A 1 12 ? 3.343   3.436   -4.830  1.00 0.00 ? 76  VAL A H    4  
ATOM   4148  H  HA   . VAL A 1 12 ? 4.033   1.122   -3.323  1.00 0.00 ? 76  VAL A HA   4  
ATOM   4149  H  HB   . VAL A 1 12 ? 2.567   1.317   -5.959  1.00 0.00 ? 76  VAL A HB   4  
ATOM   4150  H  HG11 . VAL A 1 12 ? 1.801   -0.915  -4.351  1.00 0.00 ? 76  VAL A HG11 4  
ATOM   4151  H  HG12 . VAL A 1 12 ? 2.479   -0.901  -5.980  1.00 0.00 ? 76  VAL A HG12 4  
ATOM   4152  H  HG13 . VAL A 1 12 ? 3.549   -0.940  -4.578  1.00 0.00 ? 76  VAL A HG13 4  
ATOM   4153  H  HG21 . VAL A 1 12 ? 1.068   0.742   -3.506  1.00 0.00 ? 76  VAL A HG21 4  
ATOM   4154  H  HG22 . VAL A 1 12 ? 1.775   2.357   -3.570  1.00 0.00 ? 76  VAL A HG22 4  
ATOM   4155  H  HG23 . VAL A 1 12 ? 0.682   1.821   -4.846  1.00 0.00 ? 76  VAL A HG23 4  
ATOM   4156  N  N    . CYS A 1 13 ? 5.154   1.200   -6.437  1.00 0.00 ? 77  CYS A N    4  
ATOM   4157  C  CA   . CYS A 1 13 ? 6.212   0.712   -7.314  1.00 0.00 ? 77  CYS A CA   4  
ATOM   4158  C  C    . CYS A 1 13 ? 7.341   1.734   -7.424  1.00 0.00 ? 77  CYS A C    4  
ATOM   4159  O  O    . CYS A 1 13 ? 8.517   1.386   -7.337  1.00 0.00 ? 77  CYS A O    4  
ATOM   4160  C  CB   . CYS A 1 13 ? 5.650   0.405   -8.704  1.00 0.00 ? 77  CYS A CB   4  
ATOM   4161  S  SG   . CYS A 1 13 ? 5.193   1.884   -9.664  1.00 0.00 ? 77  CYS A SG   4  
ATOM   4162  H  H    . CYS A 1 13 ? 4.446   1.765   -6.811  1.00 0.00 ? 77  CYS A H    4  
ATOM   4163  H  HA   . CYS A 1 13 ? 6.606   -0.197  -6.886  1.00 0.00 ? 77  CYS A HA   4  
ATOM   4164  H  HB2  . CYS A 1 13 ? 6.391   -0.138  -9.271  1.00 0.00 ? 77  CYS A HB2  4  
ATOM   4165  H  HB3  . CYS A 1 13 ? 4.765   -0.205  -8.599  1.00 0.00 ? 77  CYS A HB3  4  
ATOM   4166  N  N    . GLY A 1 14 ? 6.972   2.997   -7.617  1.00 0.00 ? 78  GLY A N    4  
ATOM   4167  C  CA   . GLY A 1 14 ? 7.964   4.049   -7.736  1.00 0.00 ? 78  GLY A CA   4  
ATOM   4168  C  C    . GLY A 1 14 ? 7.807   4.853   -9.011  1.00 0.00 ? 78  GLY A C    4  
ATOM   4169  O  O    . GLY A 1 14 ? 7.955   6.075   -9.005  1.00 0.00 ? 78  GLY A O    4  
ATOM   4170  H  H    . GLY A 1 14 ? 6.019   3.215   -7.678  1.00 0.00 ? 78  GLY A H    4  
ATOM   4171  H  HA2  . GLY A 1 14 ? 7.871   4.713   -6.890  1.00 0.00 ? 78  GLY A HA2  4  
ATOM   4172  H  HA3  . GLY A 1 14 ? 8.948   3.603   -7.724  1.00 0.00 ? 78  GLY A HA3  4  
ATOM   4173  N  N    . ASP A 1 15 ? 7.507   4.166   -10.108 1.00 0.00 ? 79  ASP A N    4  
ATOM   4174  C  CA   . ASP A 1 15 ? 7.330   4.824   -11.397 1.00 0.00 ? 79  ASP A CA   4  
ATOM   4175  C  C    . ASP A 1 15 ? 6.538   6.118   -11.243 1.00 0.00 ? 79  ASP A C    4  
ATOM   4176  O  O    . ASP A 1 15 ? 5.755   6.271   -10.305 1.00 0.00 ? 79  ASP A O    4  
ATOM   4177  C  CB   . ASP A 1 15 ? 6.619   3.889   -12.377 1.00 0.00 ? 79  ASP A CB   4  
ATOM   4178  C  CG   . ASP A 1 15 ? 6.511   4.483   -13.768 1.00 0.00 ? 79  ASP A CG   4  
ATOM   4179  O  OD1  . ASP A 1 15 ? 7.466   4.322   -14.557 1.00 0.00 ? 79  ASP A OD1  4  
ATOM   4180  O  OD2  . ASP A 1 15 ? 5.472   5.108   -14.068 1.00 0.00 ? 79  ASP A OD2  4  
ATOM   4181  H  H    . ASP A 1 15 ? 7.402   3.193   -10.049 1.00 0.00 ? 79  ASP A H    4  
ATOM   4182  H  HA   . ASP A 1 15 ? 8.309   5.060   -11.786 1.00 0.00 ? 79  ASP A HA   4  
ATOM   4183  H  HB2  . ASP A 1 15 ? 7.169   2.962   -12.444 1.00 0.00 ? 79  ASP A HB2  4  
ATOM   4184  H  HB3  . ASP A 1 15 ? 5.623   3.687   -12.013 1.00 0.00 ? 79  ASP A HB3  4  
ATOM   4185  N  N    . LYS A 1 16 ? 6.747   7.048   -12.169 1.00 0.00 ? 80  LYS A N    4  
ATOM   4186  C  CA   . LYS A 1 16 ? 6.053   8.330   -12.137 1.00 0.00 ? 80  LYS A CA   4  
ATOM   4187  C  C    . LYS A 1 16 ? 4.641   8.170   -11.583 1.00 0.00 ? 80  LYS A C    4  
ATOM   4188  O  O    . LYS A 1 16 ? 3.970   7.172   -11.845 1.00 0.00 ? 80  LYS A O    4  
ATOM   4189  C  CB   . LYS A 1 16 ? 5.996   8.937   -13.540 1.00 0.00 ? 80  LYS A CB   4  
ATOM   4190  C  CG   . LYS A 1 16 ? 5.843   10.448  -13.543 1.00 0.00 ? 80  LYS A CG   4  
ATOM   4191  C  CD   . LYS A 1 16 ? 5.310   10.952  -14.874 1.00 0.00 ? 80  LYS A CD   4  
ATOM   4192  C  CE   . LYS A 1 16 ? 6.434   11.184  -15.872 1.00 0.00 ? 80  LYS A CE   4  
ATOM   4193  N  NZ   . LYS A 1 16 ? 6.820   9.929   -16.575 1.00 0.00 ? 80  LYS A NZ   4  
ATOM   4194  H  H    . LYS A 1 16 ? 7.384   6.867   -12.892 1.00 0.00 ? 80  LYS A H    4  
ATOM   4195  H  HA   . LYS A 1 16 ? 6.608   8.992   -11.490 1.00 0.00 ? 80  LYS A HA   4  
ATOM   4196  H  HB2  . LYS A 1 16 ? 6.906   8.687   -14.065 1.00 0.00 ? 80  LYS A HB2  4  
ATOM   4197  H  HB3  . LYS A 1 16 ? 5.157   8.510   -14.071 1.00 0.00 ? 80  LYS A HB3  4  
ATOM   4198  H  HG2  . LYS A 1 16 ? 5.154   10.733  -12.762 1.00 0.00 ? 80  LYS A HG2  4  
ATOM   4199  H  HG3  . LYS A 1 16 ? 6.807   10.899  -13.358 1.00 0.00 ? 80  LYS A HG3  4  
ATOM   4200  H  HD2  . LYS A 1 16 ? 4.629   10.220  -15.281 1.00 0.00 ? 80  LYS A HD2  4  
ATOM   4201  H  HD3  . LYS A 1 16 ? 4.786   11.884  -14.713 1.00 0.00 ? 80  LYS A HD3  4  
ATOM   4202  H  HE2  . LYS A 1 16 ? 6.106   11.909  -16.602 1.00 0.00 ? 80  LYS A HE2  4  
ATOM   4203  H  HE3  . LYS A 1 16 ? 7.294   11.570  -15.344 1.00 0.00 ? 80  LYS A HE3  4  
ATOM   4204  H  HZ1  . LYS A 1 16 ? 6.611   9.105   -15.976 1.00 0.00 ? 80  LYS A HZ1  4  
ATOM   4205  H  HZ2  . LYS A 1 16 ? 7.838   9.939   -16.790 1.00 0.00 ? 80  LYS A HZ2  4  
ATOM   4206  H  HZ3  . LYS A 1 16 ? 6.290   9.841   -17.465 1.00 0.00 ? 80  LYS A HZ3  4  
ATOM   4207  N  N    . ALA A 1 17 ? 4.195   9.160   -10.817 1.00 0.00 ? 81  ALA A N    4  
ATOM   4208  C  CA   . ALA A 1 17 ? 2.861   9.131   -10.230 1.00 0.00 ? 81  ALA A CA   4  
ATOM   4209  C  C    . ALA A 1 17 ? 1.850   9.838   -11.127 1.00 0.00 ? 81  ALA A C    4  
ATOM   4210  O  O    . ALA A 1 17 ? 2.165   10.847  -11.757 1.00 0.00 ? 81  ALA A O    4  
ATOM   4211  C  CB   . ALA A 1 17 ? 2.879   9.767   -8.848  1.00 0.00 ? 81  ALA A CB   4  
ATOM   4212  H  H    . ALA A 1 17 ? 4.776   9.930   -10.645 1.00 0.00 ? 81  ALA A H    4  
ATOM   4213  H  HA   . ALA A 1 17 ? 2.568   8.097   -10.120 1.00 0.00 ? 81  ALA A HA   4  
ATOM   4214  H  HB1  . ALA A 1 17 ? 3.882   10.090  -8.614  1.00 0.00 ? 81  ALA A HB1  4  
ATOM   4215  H  HB2  . ALA A 1 17 ? 2.213   10.618  -8.836  1.00 0.00 ? 81  ALA A HB2  4  
ATOM   4216  H  HB3  . ALA A 1 17 ? 2.552   9.044   -8.115  1.00 0.00 ? 81  ALA A HB3  4  
ATOM   4217  N  N    . SER A 1 18 ? 0.636   9.300   -11.180 1.00 0.00 ? 82  SER A N    4  
ATOM   4218  C  CA   . SER A 1 18 ? -0.420  9.878   -12.003 1.00 0.00 ? 82  SER A CA   4  
ATOM   4219  C  C    . SER A 1 18 ? -1.165  10.971  -11.244 1.00 0.00 ? 82  SER A C    4  
ATOM   4220  O  O    . SER A 1 18 ? -1.244  12.113  -11.695 1.00 0.00 ? 82  SER A O    4  
ATOM   4221  C  CB   . SER A 1 18 ? -1.401  8.791   -12.448 1.00 0.00 ? 82  SER A CB   4  
ATOM   4222  O  OG   . SER A 1 18 ? -2.495  9.349   -13.155 1.00 0.00 ? 82  SER A OG   4  
ATOM   4223  H  H    . SER A 1 18 ? 0.446   8.495   -10.654 1.00 0.00 ? 82  SER A H    4  
ATOM   4224  H  HA   . SER A 1 18 ? 0.041   10.313  -12.877 1.00 0.00 ? 82  SER A HA   4  
ATOM   4225  H  HB2  . SER A 1 18 ? -0.891  8.091   -13.092 1.00 0.00 ? 82  SER A HB2  4  
ATOM   4226  H  HB3  . SER A 1 18 ? -1.777  8.272   -11.578 1.00 0.00 ? 82  SER A HB3  4  
ATOM   4227  H  HG   . SER A 1 18 ? -3.237  8.741   -13.130 1.00 0.00 ? 82  SER A HG   4  
ATOM   4228  N  N    . GLY A 1 19 ? -1.712  10.612  -10.086 1.00 0.00 ? 83  GLY A N    4  
ATOM   4229  C  CA   . GLY A 1 19 ? -2.444  11.572  -9.282  1.00 0.00 ? 83  GLY A CA   4  
ATOM   4230  C  C    . GLY A 1 19 ? -2.371  11.263  -7.800  1.00 0.00 ? 83  GLY A C    4  
ATOM   4231  O  O    . GLY A 1 19 ? -1.379  10.712  -7.321  1.00 0.00 ? 83  GLY A O    4  
ATOM   4232  H  H    . GLY A 1 19 ? -1.617  9.687   -9.776  1.00 0.00 ? 83  GLY A H    4  
ATOM   4233  H  HA2  . GLY A 1 19 ? -2.034  12.556  -9.454  1.00 0.00 ? 83  GLY A HA2  4  
ATOM   4234  H  HA3  . GLY A 1 19 ? -3.480  11.566  -9.588  1.00 0.00 ? 83  GLY A HA3  4  
ATOM   4235  N  N    . PHE A 1 20 ? -3.423  11.619  -7.070  1.00 0.00 ? 84  PHE A N    4  
ATOM   4236  C  CA   . PHE A 1 20 ? -3.473  11.378  -5.633  1.00 0.00 ? 84  PHE A CA   4  
ATOM   4237  C  C    . PHE A 1 20 ? -4.699  10.548  -5.263  1.00 0.00 ? 84  PHE A C    4  
ATOM   4238  O  O    . PHE A 1 20 ? -5.783  11.086  -5.040  1.00 0.00 ? 84  PHE A O    4  
ATOM   4239  C  CB   . PHE A 1 20 ? -3.494  12.705  -4.872  1.00 0.00 ? 84  PHE A CB   4  
ATOM   4240  C  CG   . PHE A 1 20 ? -3.193  12.562  -3.408  1.00 0.00 ? 84  PHE A CG   4  
ATOM   4241  C  CD1  . PHE A 1 20 ? -1.990  12.019  -2.984  1.00 0.00 ? 84  PHE A CD1  4  
ATOM   4242  C  CD2  . PHE A 1 20 ? -4.111  12.971  -2.454  1.00 0.00 ? 84  PHE A CD2  4  
ATOM   4243  C  CE1  . PHE A 1 20 ? -1.711  11.885  -1.637  1.00 0.00 ? 84  PHE A CE1  4  
ATOM   4244  C  CE2  . PHE A 1 20 ? -3.837  12.840  -1.106  1.00 0.00 ? 84  PHE A CE2  4  
ATOM   4245  C  CZ   . PHE A 1 20 ? -2.635  12.298  -0.697  1.00 0.00 ? 84  PHE A CZ   4  
ATOM   4246  H  H    . PHE A 1 20 ? -4.184  12.055  -7.509  1.00 0.00 ? 84  PHE A H    4  
ATOM   4247  H  HA   . PHE A 1 20 ? -2.585  10.830  -5.358  1.00 0.00 ? 84  PHE A HA   4  
ATOM   4248  H  HB2  . PHE A 1 20 ? -2.756  13.368  -5.299  1.00 0.00 ? 84  PHE A HB2  4  
ATOM   4249  H  HB3  . PHE A 1 20 ? -4.472  13.152  -4.969  1.00 0.00 ? 84  PHE A HB3  4  
ATOM   4250  H  HD1  . PHE A 1 20 ? -1.266  11.697  -3.718  1.00 0.00 ? 84  PHE A HD1  4  
ATOM   4251  H  HD2  . PHE A 1 20 ? -5.052  13.397  -2.774  1.00 0.00 ? 84  PHE A HD2  4  
ATOM   4252  H  HE1  . PHE A 1 20 ? -0.770  11.460  -1.320  1.00 0.00 ? 84  PHE A HE1  4  
ATOM   4253  H  HE2  . PHE A 1 20 ? -4.562  13.164  -0.374  1.00 0.00 ? 84  PHE A HE2  4  
ATOM   4254  H  HZ   . PHE A 1 20 ? -2.419  12.194  0.356   1.00 0.00 ? 84  PHE A HZ   4  
ATOM   4255  N  N    . HIS A 1 21 ? -4.518  9.232   -5.200  1.00 0.00 ? 85  HIS A N    4  
ATOM   4256  C  CA   . HIS A 1 21 ? -5.608  8.326   -4.857  1.00 0.00 ? 85  HIS A CA   4  
ATOM   4257  C  C    . HIS A 1 21 ? -5.335  7.624   -3.530  1.00 0.00 ? 85  HIS A C    4  
ATOM   4258  O  O    . HIS A 1 21 ? -4.190  7.300   -3.213  1.00 0.00 ? 85  HIS A O    4  
ATOM   4259  C  CB   . HIS A 1 21 ? -5.806  7.290   -5.964  1.00 0.00 ? 85  HIS A CB   4  
ATOM   4260  C  CG   . HIS A 1 21 ? -5.799  7.877   -7.342  1.00 0.00 ? 85  HIS A CG   4  
ATOM   4261  N  ND1  . HIS A 1 21 ? -6.778  8.734   -7.800  1.00 0.00 ? 85  HIS A ND1  4  
ATOM   4262  C  CD2  . HIS A 1 21 ? -4.923  7.728   -8.364  1.00 0.00 ? 85  HIS A CD2  4  
ATOM   4263  C  CE1  . HIS A 1 21 ? -6.505  9.085   -9.044  1.00 0.00 ? 85  HIS A CE1  4  
ATOM   4264  N  NE2  . HIS A 1 21 ? -5.385  8.488   -9.410  1.00 0.00 ? 85  HIS A NE2  4  
ATOM   4265  H  H    . HIS A 1 21 ? -3.630  8.862   -5.388  1.00 0.00 ? 85  HIS A H    4  
ATOM   4266  H  HA   . HIS A 1 21 ? -6.509  8.913   -4.761  1.00 0.00 ? 85  HIS A HA   4  
ATOM   4267  H  HB2  . HIS A 1 21 ? -5.011  6.560   -5.911  1.00 0.00 ? 85  HIS A HB2  4  
ATOM   4268  H  HB3  . HIS A 1 21 ? -6.754  6.794   -5.819  1.00 0.00 ? 85  HIS A HB3  4  
ATOM   4269  H  HD1  . HIS A 1 21 ? -7.556  9.038   -7.290  1.00 0.00 ? 85  HIS A HD1  4  
ATOM   4270  H  HD2  . HIS A 1 21 ? -4.028  7.123   -8.358  1.00 0.00 ? 85  HIS A HD2  4  
ATOM   4271  H  HE1  . HIS A 1 21 ? -7.097  9.747   -9.658  1.00 0.00 ? 85  HIS A HE1  4  
ATOM   4272  N  N    . TYR A 1 22 ? -6.392  7.394   -2.760  1.00 0.00 ? 86  TYR A N    4  
ATOM   4273  C  CA   . TYR A 1 22 ? -6.265  6.734   -1.466  1.00 0.00 ? 86  TYR A CA   4  
ATOM   4274  C  C    . TYR A 1 22 ? -5.302  7.493   -0.559  1.00 0.00 ? 86  TYR A C    4  
ATOM   4275  O  O    . TYR A 1 22 ? -4.636  6.904   0.292   1.00 0.00 ? 86  TYR A O    4  
ATOM   4276  C  CB   . TYR A 1 22 ? -5.782  5.294   -1.650  1.00 0.00 ? 86  TYR A CB   4  
ATOM   4277  C  CG   . TYR A 1 22 ? -6.428  4.583   -2.817  1.00 0.00 ? 86  TYR A CG   4  
ATOM   4278  C  CD1  . TYR A 1 22 ? -5.917  4.710   -4.103  1.00 0.00 ? 86  TYR A CD1  4  
ATOM   4279  C  CD2  . TYR A 1 22 ? -7.550  3.783   -2.634  1.00 0.00 ? 86  TYR A CD2  4  
ATOM   4280  C  CE1  . TYR A 1 22 ? -6.505  4.063   -5.172  1.00 0.00 ? 86  TYR A CE1  4  
ATOM   4281  C  CE2  . TYR A 1 22 ? -8.143  3.131   -3.698  1.00 0.00 ? 86  TYR A CE2  4  
ATOM   4282  C  CZ   . TYR A 1 22 ? -7.617  3.275   -4.965  1.00 0.00 ? 86  TYR A CZ   4  
ATOM   4283  O  OH   . TYR A 1 22 ? -8.204  2.627   -6.028  1.00 0.00 ? 86  TYR A OH   4  
ATOM   4284  H  H    . TYR A 1 22 ? -7.279  7.676   -3.067  1.00 0.00 ? 86  TYR A H    4  
ATOM   4285  H  HA   . TYR A 1 22 ? -7.241  6.719   -1.004  1.00 0.00 ? 86  TYR A HA   4  
ATOM   4286  H  HB2  . TYR A 1 22 ? -4.716  5.297   -1.813  1.00 0.00 ? 86  TYR A HB2  4  
ATOM   4287  H  HB3  . TYR A 1 22 ? -6.003  4.731   -0.755  1.00 0.00 ? 86  TYR A HB3  4  
ATOM   4288  H  HD1  . TYR A 1 22 ? -5.045  5.329   -4.262  1.00 0.00 ? 86  TYR A HD1  4  
ATOM   4289  H  HD2  . TYR A 1 22 ? -7.959  3.672   -1.641  1.00 0.00 ? 86  TYR A HD2  4  
ATOM   4290  H  HE1  . TYR A 1 22 ? -6.093  4.175   -6.165  1.00 0.00 ? 86  TYR A HE1  4  
ATOM   4291  H  HE2  . TYR A 1 22 ? -9.014  2.513   -3.536  1.00 0.00 ? 86  TYR A HE2  4  
ATOM   4292  H  HH   . TYR A 1 22 ? -9.123  2.440   -5.821  1.00 0.00 ? 86  TYR A HH   4  
ATOM   4293  N  N    . GLY A 1 23 ? -5.234  8.808   -0.747  1.00 0.00 ? 87  GLY A N    4  
ATOM   4294  C  CA   . GLY A 1 23 ? -4.351  9.628   0.061   1.00 0.00 ? 87  GLY A CA   4  
ATOM   4295  C  C    . GLY A 1 23 ? -2.891  9.266   -0.126  1.00 0.00 ? 87  GLY A C    4  
ATOM   4296  O  O    . GLY A 1 23 ? -2.045  9.623   0.694   1.00 0.00 ? 87  GLY A O    4  
ATOM   4297  H  H    . GLY A 1 23 ? -5.788  9.224   -1.440  1.00 0.00 ? 87  GLY A H    4  
ATOM   4298  H  HA2  . GLY A 1 23 ? -4.492  10.664  -0.209  1.00 0.00 ? 87  GLY A HA2  4  
ATOM   4299  H  HA3  . GLY A 1 23 ? -4.610  9.499   1.102   1.00 0.00 ? 87  GLY A HA3  4  
ATOM   4300  N  N    . VAL A 1 24 ? -2.593  8.553   -1.208  1.00 0.00 ? 88  VAL A N    4  
ATOM   4301  C  CA   . VAL A 1 24 ? -1.225  8.142   -1.501  1.00 0.00 ? 88  VAL A CA   4  
ATOM   4302  C  C    . VAL A 1 24 ? -0.918  8.274   -2.988  1.00 0.00 ? 88  VAL A C    4  
ATOM   4303  O  O    . VAL A 1 24 ? -1.727  7.898   -3.836  1.00 0.00 ? 88  VAL A O    4  
ATOM   4304  C  CB   . VAL A 1 24 ? -0.971  6.687   -1.062  1.00 0.00 ? 88  VAL A CB   4  
ATOM   4305  C  CG1  . VAL A 1 24 ? -1.575  5.715   -2.064  1.00 0.00 ? 88  VAL A CG1  4  
ATOM   4306  C  CG2  . VAL A 1 24 ? 0.520   6.435   -0.894  1.00 0.00 ? 88  VAL A CG2  4  
ATOM   4307  H  H    . VAL A 1 24 ? -3.311  8.299   -1.825  1.00 0.00 ? 88  VAL A H    4  
ATOM   4308  H  HA   . VAL A 1 24 ? -0.558  8.785   -0.946  1.00 0.00 ? 88  VAL A HA   4  
ATOM   4309  H  HB   . VAL A 1 24 ? -1.451  6.531   -0.108  1.00 0.00 ? 88  VAL A HB   4  
ATOM   4310  H  HG11 . VAL A 1 24 ? -0.859  5.516   -2.848  1.00 0.00 ? 88  VAL A HG11 4  
ATOM   4311  H  HG12 . VAL A 1 24 ? -1.827  4.791   -1.563  1.00 0.00 ? 88  VAL A HG12 4  
ATOM   4312  H  HG13 . VAL A 1 24 ? -2.467  6.147   -2.492  1.00 0.00 ? 88  VAL A HG13 4  
ATOM   4313  H  HG21 . VAL A 1 24 ? 1.069   7.027   -1.611  1.00 0.00 ? 88  VAL A HG21 4  
ATOM   4314  H  HG22 . VAL A 1 24 ? 0.820   6.710   0.106   1.00 0.00 ? 88  VAL A HG22 4  
ATOM   4315  H  HG23 . VAL A 1 24 ? 0.729   5.388   -1.057  1.00 0.00 ? 88  VAL A HG23 4  
ATOM   4316  N  N    . HIS A 1 25 ? 0.258   8.812   -3.298  1.00 0.00 ? 89  HIS A N    4  
ATOM   4317  C  CA   . HIS A 1 25 ? 0.674   8.993   -4.684  1.00 0.00 ? 89  HIS A CA   4  
ATOM   4318  C  C    . HIS A 1 25 ? 0.933   7.647   -5.354  1.00 0.00 ? 89  HIS A C    4  
ATOM   4319  O  O    . HIS A 1 25 ? 2.008   7.066   -5.207  1.00 0.00 ? 89  HIS A O    4  
ATOM   4320  C  CB   . HIS A 1 25 ? 1.932   9.860   -4.752  1.00 0.00 ? 89  HIS A CB   4  
ATOM   4321  C  CG   . HIS A 1 25 ? 1.649   11.330  -4.714  1.00 0.00 ? 89  HIS A CG   4  
ATOM   4322  N  ND1  . HIS A 1 25 ? 1.424   12.024  -3.544  1.00 0.00 ? 89  HIS A ND1  4  
ATOM   4323  C  CD2  . HIS A 1 25 ? 1.556   12.239  -5.713  1.00 0.00 ? 89  HIS A CD2  4  
ATOM   4324  C  CE1  . HIS A 1 25 ? 1.204   13.296  -3.824  1.00 0.00 ? 89  HIS A CE1  4  
ATOM   4325  N  NE2  . HIS A 1 25 ? 1.279   13.453  -5.133  1.00 0.00 ? 89  HIS A NE2  4  
ATOM   4326  H  H    . HIS A 1 25 ? 0.860   9.092   -2.577  1.00 0.00 ? 89  HIS A H    4  
ATOM   4327  H  HA   . HIS A 1 25 ? -0.126  9.494   -5.207  1.00 0.00 ? 89  HIS A HA   4  
ATOM   4328  H  HB2  . HIS A 1 25 ? 2.569   9.624   -3.912  1.00 0.00 ? 89  HIS A HB2  4  
ATOM   4329  H  HB3  . HIS A 1 25 ? 2.460   9.646   -5.670  1.00 0.00 ? 89  HIS A HB3  4  
ATOM   4330  H  HD1  . HIS A 1 25 ? 1.424   11.640  -2.643  1.00 0.00 ? 89  HIS A HD1  4  
ATOM   4331  H  HD2  . HIS A 1 25 ? 1.678   12.047  -6.770  1.00 0.00 ? 89  HIS A HD2  4  
ATOM   4332  H  HE1  . HIS A 1 25 ? 0.998   14.075  -3.106  1.00 0.00 ? 89  HIS A HE1  4  
ATOM   4333  N  N    . ALA A 1 26 ? -0.060  7.157   -6.089  1.00 0.00 ? 90  ALA A N    4  
ATOM   4334  C  CA   . ALA A 1 26 ? 0.061   5.880   -6.782  1.00 0.00 ? 90  ALA A CA   4  
ATOM   4335  C  C    . ALA A 1 26 ? -0.085  6.058   -8.290  1.00 0.00 ? 90  ALA A C    4  
ATOM   4336  O  O    . ALA A 1 26 ? -0.649  7.049   -8.757  1.00 0.00 ? 90  ALA A O    4  
ATOM   4337  C  CB   . ALA A 1 26 ? -0.977  4.897   -6.262  1.00 0.00 ? 90  ALA A CB   4  
ATOM   4338  H  H    . ALA A 1 26 ? -0.893  7.667   -6.168  1.00 0.00 ? 90  ALA A H    4  
ATOM   4339  H  HA   . ALA A 1 26 ? 1.040   5.477   -6.571  1.00 0.00 ? 90  ALA A HA   4  
ATOM   4340  H  HB1  . ALA A 1 26 ? -1.159  4.138   -7.008  1.00 0.00 ? 90  ALA A HB1  4  
ATOM   4341  H  HB2  . ALA A 1 26 ? -0.611  4.433   -5.358  1.00 0.00 ? 90  ALA A HB2  4  
ATOM   4342  H  HB3  . ALA A 1 26 ? -1.897  5.422   -6.051  1.00 0.00 ? 90  ALA A HB3  4  
ATOM   4343  N  N    . CYS A 1 27 ? 0.426   5.094   -9.047  1.00 0.00 ? 91  CYS A N    4  
ATOM   4344  C  CA   . CYS A 1 27 ? 0.354   5.144   -10.502 1.00 0.00 ? 91  CYS A CA   4  
ATOM   4345  C  C    . CYS A 1 27 ? -0.853  4.363   -11.014 1.00 0.00 ? 91  CYS A C    4  
ATOM   4346  O  O    . CYS A 1 27 ? -1.577  3.742   -10.238 1.00 0.00 ? 91  CYS A O    4  
ATOM   4347  C  CB   . CYS A 1 27 ? 1.637   4.581   -11.117 1.00 0.00 ? 91  CYS A CB   4  
ATOM   4348  S  SG   . CYS A 1 27 ? 1.835   2.783   -10.908 1.00 0.00 ? 91  CYS A SG   4  
ATOM   4349  H  H    . CYS A 1 27 ? 0.863   4.329   -8.617  1.00 0.00 ? 91  CYS A H    4  
ATOM   4350  H  HA   . CYS A 1 27 ? 0.248   6.178   -10.794 1.00 0.00 ? 91  CYS A HA   4  
ATOM   4351  H  HB2  . CYS A 1 27 ? 1.641   4.791   -12.177 1.00 0.00 ? 91  CYS A HB2  4  
ATOM   4352  H  HB3  . CYS A 1 27 ? 2.488   5.062   -10.658 1.00 0.00 ? 91  CYS A HB3  4  
ATOM   4353  N  N    . GLU A 1 28 ? -1.062  4.401   -12.327 1.00 0.00 ? 92  GLU A N    4  
ATOM   4354  C  CA   . GLU A 1 28 ? -2.182  3.697   -12.942 1.00 0.00 ? 92  GLU A CA   4  
ATOM   4355  C  C    . GLU A 1 28 ? -2.137  2.209   -12.610 1.00 0.00 ? 92  GLU A C    4  
ATOM   4356  O  O    . GLU A 1 28 ? -3.128  1.630   -12.168 1.00 0.00 ? 92  GLU A O    4  
ATOM   4357  C  CB   . GLU A 1 28 ? -2.164  3.894   -14.459 1.00 0.00 ? 92  GLU A CB   4  
ATOM   4358  C  CG   . GLU A 1 28 ? -1.994  5.343   -14.883 1.00 0.00 ? 92  GLU A CG   4  
ATOM   4359  C  CD   . GLU A 1 28 ? -0.538  5.749   -15.005 1.00 0.00 ? 92  GLU A CD   4  
ATOM   4360  O  OE1  . GLU A 1 28 ? 0.337   4.891   -14.766 1.00 0.00 ? 92  GLU A OE1  4  
ATOM   4361  O  OE2  . GLU A 1 28 ? -0.275  6.923   -15.337 1.00 0.00 ? 92  GLU A OE2  4  
ATOM   4362  H  H    . GLU A 1 28 ? -0.450  4.914   -12.894 1.00 0.00 ? 92  GLU A H    4  
ATOM   4363  H  HA   . GLU A 1 28 ? -3.094  4.115   -12.545 1.00 0.00 ? 92  GLU A HA   4  
ATOM   4364  H  HB2  . GLU A 1 28 ? -1.349  3.320   -14.875 1.00 0.00 ? 92  GLU A HB2  4  
ATOM   4365  H  HB3  . GLU A 1 28 ? -3.095  3.528   -14.868 1.00 0.00 ? 92  GLU A HB3  4  
ATOM   4366  H  HG2  . GLU A 1 28 ? -2.472  5.483   -15.842 1.00 0.00 ? 92  GLU A HG2  4  
ATOM   4367  H  HG3  . GLU A 1 28 ? -2.470  5.978   -14.150 1.00 0.00 ? 92  GLU A HG3  4  
ATOM   4368  N  N    . GLY A 1 29 ? -0.978  1.594   -12.829 1.00 0.00 ? 93  GLY A N    4  
ATOM   4369  C  CA   . GLY A 1 29 ? -0.825  0.178   -12.549 1.00 0.00 ? 93  GLY A CA   4  
ATOM   4370  C  C    . GLY A 1 29 ? -1.231  -0.180  -11.133 1.00 0.00 ? 93  GLY A C    4  
ATOM   4371  O  O    . GLY A 1 29 ? -2.254  -0.831  -10.919 1.00 0.00 ? 93  GLY A O    4  
ATOM   4372  H  H    . GLY A 1 29 ? -0.221  2.106   -13.183 1.00 0.00 ? 93  GLY A H    4  
ATOM   4373  H  HA2  . GLY A 1 29 ? -1.435  -0.382  -13.240 1.00 0.00 ? 93  GLY A HA2  4  
ATOM   4374  H  HA3  . GLY A 1 29 ? 0.210   -0.095  -12.694 1.00 0.00 ? 93  GLY A HA3  4  
ATOM   4375  N  N    . CYS A 1 30 ? -0.428  0.244   -10.163 1.00 0.00 ? 94  CYS A N    4  
ATOM   4376  C  CA   . CYS A 1 30 ? -0.707  -0.037  -8.760  1.00 0.00 ? 94  CYS A CA   4  
ATOM   4377  C  C    . CYS A 1 30 ? -2.113  0.420   -8.383  1.00 0.00 ? 94  CYS A C    4  
ATOM   4378  O  O    . CYS A 1 30 ? -2.845  -0.289  -7.692  1.00 0.00 ? 94  CYS A O    4  
ATOM   4379  C  CB   . CYS A 1 30 ? 0.323   0.654   -7.865  1.00 0.00 ? 94  CYS A CB   4  
ATOM   4380  S  SG   . CYS A 1 30 ? 2.053   0.259   -8.280  1.00 0.00 ? 94  CYS A SG   4  
ATOM   4381  H  H    . CYS A 1 30 ? 0.374   0.759   -10.397 1.00 0.00 ? 94  CYS A H    4  
ATOM   4382  H  HA   . CYS A 1 30 ? -0.638  -1.105  -8.616  1.00 0.00 ? 94  CYS A HA   4  
ATOM   4383  H  HB2  . CYS A 1 30 ? 0.202   1.724   -7.949  1.00 0.00 ? 94  CYS A HB2  4  
ATOM   4384  H  HB3  . CYS A 1 30 ? 0.155   0.357   -6.840  1.00 0.00 ? 94  CYS A HB3  4  
ATOM   4385  N  N    . LYS A 1 31 ? -2.485  1.610   -8.843  1.00 0.00 ? 95  LYS A N    4  
ATOM   4386  C  CA   . LYS A 1 31 ? -3.803  2.163   -8.557  1.00 0.00 ? 95  LYS A CA   4  
ATOM   4387  C  C    . LYS A 1 31 ? -4.889  1.108   -8.744  1.00 0.00 ? 95  LYS A C    4  
ATOM   4388  O  O    . LYS A 1 31 ? -5.755  0.935   -7.888  1.00 0.00 ? 95  LYS A O    4  
ATOM   4389  C  CB   . LYS A 1 31 ? -4.083  3.365   -9.462  1.00 0.00 ? 95  LYS A CB   4  
ATOM   4390  C  CG   . LYS A 1 31 ? -5.525  3.839   -9.417  1.00 0.00 ? 95  LYS A CG   4  
ATOM   4391  C  CD   . LYS A 1 31 ? -5.893  4.627   -10.663 1.00 0.00 ? 95  LYS A CD   4  
ATOM   4392  C  CE   . LYS A 1 31 ? -7.345  5.077   -10.629 1.00 0.00 ? 95  LYS A CE   4  
ATOM   4393  N  NZ   . LYS A 1 31 ? -7.771  5.674   -11.925 1.00 0.00 ? 95  LYS A NZ   4  
ATOM   4394  H  H    . LYS A 1 31 ? -1.858  2.129   -9.389  1.00 0.00 ? 95  LYS A H    4  
ATOM   4395  H  HA   . LYS A 1 31 ? -3.810  2.490   -7.528  1.00 0.00 ? 95  LYS A HA   4  
ATOM   4396  H  HB2  . LYS A 1 31 ? -3.447  4.184   -9.161  1.00 0.00 ? 95  LYS A HB2  4  
ATOM   4397  H  HB3  . LYS A 1 31 ? -3.847  3.094   -10.482 1.00 0.00 ? 95  LYS A HB3  4  
ATOM   4398  H  HG2  . LYS A 1 31 ? -6.175  2.980   -9.343  1.00 0.00 ? 95  LYS A HG2  4  
ATOM   4399  H  HG3  . LYS A 1 31 ? -5.659  4.470   -8.550  1.00 0.00 ? 95  LYS A HG3  4  
ATOM   4400  H  HD2  . LYS A 1 31 ? -5.259  5.499   -10.727 1.00 0.00 ? 95  LYS A HD2  4  
ATOM   4401  H  HD3  . LYS A 1 31 ? -5.738  4.003   -11.532 1.00 0.00 ? 95  LYS A HD3  4  
ATOM   4402  H  HE2  . LYS A 1 31 ? -7.968  4.222   -10.415 1.00 0.00 ? 95  LYS A HE2  4  
ATOM   4403  H  HE3  . LYS A 1 31 ? -7.463  5.812   -9.847  1.00 0.00 ? 95  LYS A HE3  4  
ATOM   4404  H  HZ1  . LYS A 1 31 ? -7.586  6.698   -11.925 1.00 0.00 ? 95  LYS A HZ1  4  
ATOM   4405  H  HZ2  . LYS A 1 31 ? -8.789  5.517   -12.073 1.00 0.00 ? 95  LYS A HZ2  4  
ATOM   4406  H  HZ3  . LYS A 1 31 ? -7.246  5.238   -12.709 1.00 0.00 ? 95  LYS A HZ3  4  
ATOM   4407  N  N    . GLY A 1 32 ? -4.835  0.404   -9.871  1.00 0.00 ? 96  GLY A N    4  
ATOM   4408  C  CA   . GLY A 1 32 ? -5.819  -0.626  -10.150 1.00 0.00 ? 96  GLY A CA   4  
ATOM   4409  C  C    . GLY A 1 32 ? -5.619  -1.863  -9.298  1.00 0.00 ? 96  GLY A C    4  
ATOM   4410  O  O    . GLY A 1 32 ? -6.571  -2.386  -8.716  1.00 0.00 ? 96  GLY A O    4  
ATOM   4411  H  H    . GLY A 1 32 ? -4.122  0.586   -10.518 1.00 0.00 ? 96  GLY A H    4  
ATOM   4412  H  HA2  . GLY A 1 32 ? -6.805  -0.227  -9.962  1.00 0.00 ? 96  GLY A HA2  4  
ATOM   4413  H  HA3  . GLY A 1 32 ? -5.746  -0.904  -11.191 1.00 0.00 ? 96  GLY A HA3  4  
ATOM   4414  N  N    . PHE A 1 33 ? -4.379  -2.336  -9.224  1.00 0.00 ? 97  PHE A N    4  
ATOM   4415  C  CA   . PHE A 1 33 ? -4.058  -3.522  -8.439  1.00 0.00 ? 97  PHE A CA   4  
ATOM   4416  C  C    . PHE A 1 33 ? -4.776  -3.494  -7.093  1.00 0.00 ? 97  PHE A C    4  
ATOM   4417  O  O    . PHE A 1 33 ? -5.535  -4.405  -6.762  1.00 0.00 ? 97  PHE A O    4  
ATOM   4418  C  CB   . PHE A 1 33 ? -2.547  -3.622  -8.221  1.00 0.00 ? 97  PHE A CB   4  
ATOM   4419  C  CG   . PHE A 1 33 ? -2.160  -4.592  -7.142  1.00 0.00 ? 97  PHE A CG   4  
ATOM   4420  C  CD1  . PHE A 1 33 ? -2.451  -5.941  -7.267  1.00 0.00 ? 97  PHE A CD1  4  
ATOM   4421  C  CD2  . PHE A 1 33 ? -1.503  -4.155  -6.003  1.00 0.00 ? 97  PHE A CD2  4  
ATOM   4422  C  CE1  . PHE A 1 33 ? -2.097  -6.835  -6.275  1.00 0.00 ? 97  PHE A CE1  4  
ATOM   4423  C  CE2  . PHE A 1 33 ? -1.146  -5.045  -5.007  1.00 0.00 ? 97  PHE A CE2  4  
ATOM   4424  C  CZ   . PHE A 1 33 ? -1.442  -6.387  -5.145  1.00 0.00 ? 97  PHE A CZ   4  
ATOM   4425  H  H    . PHE A 1 33 ? -3.663  -1.875  -9.710  1.00 0.00 ? 97  PHE A H    4  
ATOM   4426  H  HA   . PHE A 1 33 ? -4.392  -4.385  -8.993  1.00 0.00 ? 97  PHE A HA   4  
ATOM   4427  H  HB2  . PHE A 1 33 ? -2.079  -3.943  -9.139  1.00 0.00 ? 97  PHE A HB2  4  
ATOM   4428  H  HB3  . PHE A 1 33 ? -2.165  -2.650  -7.948  1.00 0.00 ? 97  PHE A HB3  4  
ATOM   4429  H  HD1  . PHE A 1 33 ? -2.962  -6.293  -8.151  1.00 0.00 ? 97  PHE A HD1  4  
ATOM   4430  H  HD2  . PHE A 1 33 ? -1.271  -3.105  -5.894  1.00 0.00 ? 97  PHE A HD2  4  
ATOM   4431  H  HE1  . PHE A 1 33 ? -2.329  -7.884  -6.385  1.00 0.00 ? 97  PHE A HE1  4  
ATOM   4432  H  HE2  . PHE A 1 33 ? -0.634  -4.692  -4.125  1.00 0.00 ? 97  PHE A HE2  4  
ATOM   4433  H  HZ   . PHE A 1 33 ? -1.164  -7.084  -4.368  1.00 0.00 ? 97  PHE A HZ   4  
ATOM   4434  N  N    . PHE A 1 34 ? -4.530  -2.441  -6.319  1.00 0.00 ? 98  PHE A N    4  
ATOM   4435  C  CA   . PHE A 1 34 ? -5.152  -2.294  -5.008  1.00 0.00 ? 98  PHE A CA   4  
ATOM   4436  C  C    . PHE A 1 34 ? -6.667  -2.441  -5.105  1.00 0.00 ? 98  PHE A C    4  
ATOM   4437  O  O    . PHE A 1 34 ? -7.253  -3.344  -4.509  1.00 0.00 ? 98  PHE A O    4  
ATOM   4438  C  CB   . PHE A 1 34 ? -4.797  -0.935  -4.402  1.00 0.00 ? 98  PHE A CB   4  
ATOM   4439  C  CG   . PHE A 1 34 ? -5.310  -0.750  -3.003  1.00 0.00 ? 98  PHE A CG   4  
ATOM   4440  C  CD1  . PHE A 1 34 ? -4.666  -1.345  -1.930  1.00 0.00 ? 98  PHE A CD1  4  
ATOM   4441  C  CD2  . PHE A 1 34 ? -6.437  0.018   -2.760  1.00 0.00 ? 98  PHE A CD2  4  
ATOM   4442  C  CE1  . PHE A 1 34 ? -5.135  -1.177  -0.641  1.00 0.00 ? 98  PHE A CE1  4  
ATOM   4443  C  CE2  . PHE A 1 34 ? -6.911  0.190   -1.473  1.00 0.00 ? 98  PHE A CE2  4  
ATOM   4444  C  CZ   . PHE A 1 34 ? -6.260  -0.409  -0.412  1.00 0.00 ? 98  PHE A CZ   4  
ATOM   4445  H  H    . PHE A 1 34 ? -3.916  -1.747  -6.638  1.00 0.00 ? 98  PHE A H    4  
ATOM   4446  H  HA   . PHE A 1 34 ? -4.766  -3.075  -4.370  1.00 0.00 ? 98  PHE A HA   4  
ATOM   4447  H  HB2  . PHE A 1 34 ? -3.723  -0.828  -4.378  1.00 0.00 ? 98  PHE A HB2  4  
ATOM   4448  H  HB3  . PHE A 1 34 ? -5.218  -0.154  -5.017  1.00 0.00 ? 98  PHE A HB3  4  
ATOM   4449  H  HD1  . PHE A 1 34 ? -3.785  -1.946  -2.108  1.00 0.00 ? 98  PHE A HD1  4  
ATOM   4450  H  HD2  . PHE A 1 34 ? -6.949  0.486   -3.588  1.00 0.00 ? 98  PHE A HD2  4  
ATOM   4451  H  HE1  . PHE A 1 34 ? -4.623  -1.647  0.186   1.00 0.00 ? 98  PHE A HE1  4  
ATOM   4452  H  HE2  . PHE A 1 34 ? -7.791  0.791   -1.297  1.00 0.00 ? 98  PHE A HE2  4  
ATOM   4453  H  HZ   . PHE A 1 34 ? -6.628  -0.276  0.594   1.00 0.00 ? 98  PHE A HZ   4  
ATOM   4454  N  N    . ARG A 1 35 ? -7.295  -1.545  -5.860  1.00 0.00 ? 99  ARG A N    4  
ATOM   4455  C  CA   . ARG A 1 35 ? -8.743  -1.573  -6.034  1.00 0.00 ? 99  ARG A CA   4  
ATOM   4456  C  C    . ARG A 1 35 ? -9.223  -2.982  -6.368  1.00 0.00 ? 99  ARG A C    4  
ATOM   4457  O  O    . ARG A 1 35 ? -9.993  -3.581  -5.616  1.00 0.00 ? 99  ARG A O    4  
ATOM   4458  C  CB   . ARG A 1 35 ? -9.164  -0.604  -7.140  1.00 0.00 ? 99  ARG A CB   4  
ATOM   4459  C  CG   . ARG A 1 35 ? -10.666 -0.552  -7.365  1.00 0.00 ? 99  ARG A CG   4  
ATOM   4460  C  CD   . ARG A 1 35 ? -11.023 0.358   -8.530  1.00 0.00 ? 99  ARG A CD   4  
ATOM   4461  N  NE   . ARG A 1 35 ? -12.391 0.141   -8.994  1.00 0.00 ? 99  ARG A NE   4  
ATOM   4462  C  CZ   . ARG A 1 35 ? -13.065 1.019   -9.729  1.00 0.00 ? 99  ARG A CZ   4  
ATOM   4463  N  NH1  . ARG A 1 35 ? -12.501 2.165   -10.082 1.00 0.00 ? 99  ARG A NH1  4  
ATOM   4464  N  NH2  . ARG A 1 35 ? -14.307 0.749   -10.113 1.00 0.00 ? 99  ARG A NH2  4  
ATOM   4465  H  H    . ARG A 1 35 ? -6.773  -0.849  -6.310  1.00 0.00 ? 99  ARG A H    4  
ATOM   4466  H  HA   . ARG A 1 35 ? -9.195  -1.263  -5.104  1.00 0.00 ? 99  ARG A HA   4  
ATOM   4467  H  HB2  . ARG A 1 35 ? -8.827  0.389   -6.880  1.00 0.00 ? 99  ARG A HB2  4  
ATOM   4468  H  HB3  . ARG A 1 35 ? -8.693  -0.905  -8.064  1.00 0.00 ? 99  ARG A HB3  4  
ATOM   4469  H  HG2  . ARG A 1 35 ? -11.023 -1.549  -7.579  1.00 0.00 ? 99  ARG A HG2  4  
ATOM   4470  H  HG3  . ARG A 1 35 ? -11.142 -0.181  -6.470  1.00 0.00 ? 99  ARG A HG3  4  
ATOM   4471  H  HD2  . ARG A 1 35 ? -10.920 1.384   -8.212  1.00 0.00 ? 99  ARG A HD2  4  
ATOM   4472  H  HD3  . ARG A 1 35 ? -10.341 0.163   -9.344  1.00 0.00 ? 99  ARG A HD3  4  
ATOM   4473  H  HE   . ARG A 1 35 ? -12.827 -0.700  -8.745  1.00 0.00 ? 99  ARG A HE   4  
ATOM   4474  H  HH11 . ARG A 1 35 ? -11.566 2.370   -9.795  1.00 0.00 ? 99  ARG A HH11 4  
ATOM   4475  H  HH12 . ARG A 1 35 ? -13.011 2.824   -10.636 1.00 0.00 ? 99  ARG A HH12 4  
ATOM   4476  H  HH21 . ARG A 1 35 ? -14.735 -0.114  -9.849  1.00 0.00 ? 99  ARG A HH21 4  
ATOM   4477  H  HH22 . ARG A 1 35 ? -14.813 1.410   -10.665 1.00 0.00 ? 99  ARG A HH22 4  
ATOM   4478  N  N    . ARG A 1 36 ? -8.764  -3.506  -7.500  1.00 0.00 ? 100 ARG A N    4  
ATOM   4479  C  CA   . ARG A 1 36 ? -9.148  -4.843  -7.935  1.00 0.00 ? 100 ARG A CA   4  
ATOM   4480  C  C    . ARG A 1 36 ? -9.099  -5.828  -6.770  1.00 0.00 ? 100 ARG A C    4  
ATOM   4481  O  O    . ARG A 1 36 ? -10.066 -6.543  -6.505  1.00 0.00 ? 100 ARG A O    4  
ATOM   4482  C  CB   . ARG A 1 36 ? -8.228  -5.321  -9.060  1.00 0.00 ? 100 ARG A CB   4  
ATOM   4483  C  CG   . ARG A 1 36 ? -8.444  -6.775  -9.447  1.00 0.00 ? 100 ARG A CG   4  
ATOM   4484  C  CD   . ARG A 1 36 ? -7.892  -7.070  -10.833 1.00 0.00 ? 100 ARG A CD   4  
ATOM   4485  N  NE   . ARG A 1 36 ? -7.660  -8.497  -11.037 1.00 0.00 ? 100 ARG A NE   4  
ATOM   4486  C  CZ   . ARG A 1 36 ? -6.747  -8.981  -11.872 1.00 0.00 ? 100 ARG A CZ   4  
ATOM   4487  N  NH1  . ARG A 1 36 ? -5.985  -8.156  -12.577 1.00 0.00 ? 100 ARG A NH1  4  
ATOM   4488  N  NH2  . ARG A 1 36 ? -6.595  -10.293 -12.003 1.00 0.00 ? 100 ARG A NH2  4  
ATOM   4489  H  H    . ARG A 1 36 ? -8.153  -2.979  -8.057  1.00 0.00 ? 100 ARG A H    4  
ATOM   4490  H  HA   . ARG A 1 36 ? -10.161 -4.794  -8.306  1.00 0.00 ? 100 ARG A HA   4  
ATOM   4491  H  HB2  . ARG A 1 36 ? -8.400  -4.709  -9.933  1.00 0.00 ? 100 ARG A HB2  4  
ATOM   4492  H  HB3  . ARG A 1 36 ? -7.203  -5.204  -8.744  1.00 0.00 ? 100 ARG A HB3  4  
ATOM   4493  H  HG2  . ARG A 1 36 ? -7.943  -7.407  -8.730  1.00 0.00 ? 100 ARG A HG2  4  
ATOM   4494  H  HG3  . ARG A 1 36 ? -9.503  -6.986  -9.438  1.00 0.00 ? 100 ARG A HG3  4  
ATOM   4495  H  HD2  . ARG A 1 36 ? -8.601  -6.722  -11.570 1.00 0.00 ? 100 ARG A HD2  4  
ATOM   4496  H  HD3  . ARG A 1 36 ? -6.959  -6.541  -10.954 1.00 0.00 ? 100 ARG A HD3  4  
ATOM   4497  H  HE   . ARG A 1 36 ? -8.212  -9.124  -10.526 1.00 0.00 ? 100 ARG A HE   4  
ATOM   4498  H  HH11 . ARG A 1 36 ? -6.097  -7.167  -12.480 1.00 0.00 ? 100 ARG A HH11 4  
ATOM   4499  H  HH12 . ARG A 1 36 ? -5.298  -8.523  -13.205 1.00 0.00 ? 100 ARG A HH12 4  
ATOM   4500  H  HH21 . ARG A 1 36 ? -7.167  -10.917 -11.473 1.00 0.00 ? 100 ARG A HH21 4  
ATOM   4501  H  HH22 . ARG A 1 36 ? -5.908  -10.656 -12.632 1.00 0.00 ? 100 ARG A HH22 4  
ATOM   4502  N  N    . THR A 1 37 ? -7.965  -5.861  -6.077  1.00 0.00 ? 101 THR A N    4  
ATOM   4503  C  CA   . THR A 1 37 ? -7.788  -6.759  -4.942  1.00 0.00 ? 101 THR A CA   4  
ATOM   4504  C  C    . THR A 1 37 ? -8.913  -6.590  -3.928  1.00 0.00 ? 101 THR A C    4  
ATOM   4505  O  O    . THR A 1 37 ? -9.298  -7.543  -3.249  1.00 0.00 ? 101 THR A O    4  
ATOM   4506  C  CB   . THR A 1 37 ? -6.439  -6.518  -4.240  1.00 0.00 ? 101 THR A CB   4  
ATOM   4507  O  OG1  . THR A 1 37 ? -5.366  -6.657  -5.179  1.00 0.00 ? 101 THR A OG1  4  
ATOM   4508  C  CG2  . THR A 1 37 ? -6.244  -7.496  -3.092  1.00 0.00 ? 101 THR A CG2  4  
ATOM   4509  H  H    . THR A 1 37 ? -7.230  -5.267  -6.337  1.00 0.00 ? 101 THR A H    4  
ATOM   4510  H  HA   . THR A 1 37 ? -7.801  -7.773  -5.314  1.00 0.00 ? 101 THR A HA   4  
ATOM   4511  H  HB   . THR A 1 37 ? -6.431  -5.513  -3.843  1.00 0.00 ? 101 THR A HB   4  
ATOM   4512  H  HG1  . THR A 1 37 ? -5.354  -5.897  -5.766  1.00 0.00 ? 101 THR A HG1  4  
ATOM   4513  H  HG21 . THR A 1 37 ? -5.201  -7.521  -2.813  1.00 0.00 ? 101 THR A HG21 4  
ATOM   4514  H  HG22 . THR A 1 37 ? -6.556  -8.483  -3.402  1.00 0.00 ? 101 THR A HG22 4  
ATOM   4515  H  HG23 . THR A 1 37 ? -6.836  -7.181  -2.246  1.00 0.00 ? 101 THR A HG23 4  
ATOM   4516  N  N    . ILE A 1 38 ? -9.437  -5.373  -3.829  1.00 0.00 ? 102 ILE A N    4  
ATOM   4517  C  CA   . ILE A 1 38 ? -10.520 -5.081  -2.898  1.00 0.00 ? 102 ILE A CA   4  
ATOM   4518  C  C    . ILE A 1 38 ? -11.865 -5.527  -3.461  1.00 0.00 ? 102 ILE A C    4  
ATOM   4519  O  O    . ILE A 1 38 ? -12.514 -6.418  -2.913  1.00 0.00 ? 102 ILE A O    4  
ATOM   4520  C  CB   . ILE A 1 38 ? -10.587 -3.579  -2.566  1.00 0.00 ? 102 ILE A CB   4  
ATOM   4521  C  CG1  . ILE A 1 38 ? -9.248  -3.097  -2.006  1.00 0.00 ? 102 ILE A CG1  4  
ATOM   4522  C  CG2  . ILE A 1 38 ? -11.711 -3.305  -1.577  1.00 0.00 ? 102 ILE A CG2  4  
ATOM   4523  C  CD1  . ILE A 1 38 ? -8.942  -3.634  -0.625  1.00 0.00 ? 102 ILE A CD1  4  
ATOM   4524  H  H    . ILE A 1 38 ? -9.088  -4.655  -4.396  1.00 0.00 ? 102 ILE A H    4  
ATOM   4525  H  HA   . ILE A 1 38 ? -10.327 -5.623  -1.983  1.00 0.00 ? 102 ILE A HA   4  
ATOM   4526  H  HB   . ILE A 1 38 ? -10.803 -3.041  -3.477  1.00 0.00 ? 102 ILE A HB   4  
ATOM   4527  H  HG12 . ILE A 1 38 ? -8.455  -3.411  -2.666  1.00 0.00 ? 102 ILE A HG12 4  
ATOM   4528  H  HG13 . ILE A 1 38 ? -9.257  -2.018  -1.949  1.00 0.00 ? 102 ILE A HG13 4  
ATOM   4529  H  HG21 . ILE A 1 38 ? -12.392 -4.142  -1.566  1.00 0.00 ? 102 ILE A HG21 4  
ATOM   4530  H  HG22 . ILE A 1 38 ? -11.295 -3.166  -0.590  1.00 0.00 ? 102 ILE A HG22 4  
ATOM   4531  H  HG23 . ILE A 1 38 ? -12.242 -2.412  -1.873  1.00 0.00 ? 102 ILE A HG23 4  
ATOM   4532  H  HD11 . ILE A 1 38 ? -7.874  -3.619  -0.462  1.00 0.00 ? 102 ILE A HD11 4  
ATOM   4533  H  HD12 . ILE A 1 38 ? -9.427  -3.017  0.117   1.00 0.00 ? 102 ILE A HD12 4  
ATOM   4534  H  HD13 . ILE A 1 38 ? -9.304  -4.648  -0.544  1.00 0.00 ? 102 ILE A HD13 4  
ATOM   4535  N  N    . ARG A 1 39 ? -12.276 -4.903  -4.560  1.00 0.00 ? 103 ARG A N    4  
ATOM   4536  C  CA   . ARG A 1 39 ? -13.544 -5.236  -5.198  1.00 0.00 ? 103 ARG A CA   4  
ATOM   4537  C  C    . ARG A 1 39 ? -13.641 -6.735  -5.466  1.00 0.00 ? 103 ARG A C    4  
ATOM   4538  O  O    . ARG A 1 39 ? -14.735 -7.292  -5.547  1.00 0.00 ? 103 ARG A O    4  
ATOM   4539  C  CB   . ARG A 1 39 ? -13.698 -4.462  -6.509  1.00 0.00 ? 103 ARG A CB   4  
ATOM   4540  C  CG   . ARG A 1 39 ? -12.534 -4.651  -7.468  1.00 0.00 ? 103 ARG A CG   4  
ATOM   4541  C  CD   . ARG A 1 39 ? -12.790 -5.796  -8.435  1.00 0.00 ? 103 ARG A CD   4  
ATOM   4542  N  NE   . ARG A 1 39 ? -13.888 -5.503  -9.353  1.00 0.00 ? 103 ARG A NE   4  
ATOM   4543  C  CZ   . ARG A 1 39 ? -13.748 -4.780  -10.458 1.00 0.00 ? 103 ARG A CZ   4  
ATOM   4544  N  NH1  . ARG A 1 39 ? -12.564 -4.280  -10.783 1.00 0.00 ? 103 ARG A NH1  4  
ATOM   4545  N  NH2  . ARG A 1 39 ? -14.795 -4.557  -11.243 1.00 0.00 ? 103 ARG A NH2  4  
ATOM   4546  H  H    . ARG A 1 39 ? -11.714 -4.201  -4.950  1.00 0.00 ? 103 ARG A H    4  
ATOM   4547  H  HA   . ARG A 1 39 ? -14.339 -4.950  -4.526  1.00 0.00 ? 103 ARG A HA   4  
ATOM   4548  H  HB2  . ARG A 1 39 ? -14.600 -4.791  -7.004  1.00 0.00 ? 103 ARG A HB2  4  
ATOM   4549  H  HB3  . ARG A 1 39 ? -13.783 -3.410  -6.284  1.00 0.00 ? 103 ARG A HB3  4  
ATOM   4550  H  HG2  . ARG A 1 39 ? -12.394 -3.742  -8.033  1.00 0.00 ? 103 ARG A HG2  4  
ATOM   4551  H  HG3  . ARG A 1 39 ? -11.642 -4.865  -6.898  1.00 0.00 ? 103 ARG A HG3  4  
ATOM   4552  H  HD2  . ARG A 1 39 ? -11.892 -5.973  -9.009  1.00 0.00 ? 103 ARG A HD2  4  
ATOM   4553  H  HD3  . ARG A 1 39 ? -13.034 -6.682  -7.868  1.00 0.00 ? 103 ARG A HD3  4  
ATOM   4554  H  HE   . ARG A 1 39 ? -14.772 -5.863  -9.132  1.00 0.00 ? 103 ARG A HE   4  
ATOM   4555  H  HH11 . ARG A 1 39 ? -11.773 -4.448  -10.194 1.00 0.00 ? 103 ARG A HH11 4  
ATOM   4556  H  HH12 . ARG A 1 39 ? -12.461 -3.737  -11.617 1.00 0.00 ? 103 ARG A HH12 4  
ATOM   4557  H  HH21 . ARG A 1 39 ? -15.689 -4.932  -11.002 1.00 0.00 ? 103 ARG A HH21 4  
ATOM   4558  H  HH22 . ARG A 1 39 ? -14.689 -4.012  -12.074 1.00 0.00 ? 103 ARG A HH22 4  
ATOM   4559  N  N    . MET A 1 40 ? -12.488 -7.382  -5.601  1.00 0.00 ? 104 MET A N    4  
ATOM   4560  C  CA   . MET A 1 40 ? -12.443 -8.817  -5.859  1.00 0.00 ? 104 MET A CA   4  
ATOM   4561  C  C    . MET A 1 40 ? -12.296 -9.599  -4.557  1.00 0.00 ? 104 MET A C    4  
ATOM   4562  O  O    . MET A 1 40 ? -12.663 -10.772 -4.480  1.00 0.00 ? 104 MET A O    4  
ATOM   4563  C  CB   . MET A 1 40 ? -11.286 -9.152  -6.802  1.00 0.00 ? 104 MET A CB   4  
ATOM   4564  C  CG   . MET A 1 40 ? -11.484 -8.629  -8.216  1.00 0.00 ? 104 MET A CG   4  
ATOM   4565  S  SD   . MET A 1 40 ? -10.694 -9.670  -9.458  1.00 0.00 ? 104 MET A SD   4  
ATOM   4566  C  CE   . MET A 1 40 ? -12.125 -10.298 -10.333 1.00 0.00 ? 104 MET A CE   4  
ATOM   4567  H  H    . MET A 1 40 ? -11.647 -6.884  -5.526  1.00 0.00 ? 104 MET A H    4  
ATOM   4568  H  HA   . MET A 1 40 ? -13.373 -9.098  -6.330  1.00 0.00 ? 104 MET A HA   4  
ATOM   4569  H  HB2  . MET A 1 40 ? -10.378 -8.722  -6.406  1.00 0.00 ? 104 MET A HB2  4  
ATOM   4570  H  HB3  . MET A 1 40 ? -11.175 -10.225 -6.851  1.00 0.00 ? 104 MET A HB3  4  
ATOM   4571  H  HG2  . MET A 1 40 ? -12.542 -8.585  -8.425  1.00 0.00 ? 104 MET A HG2  4  
ATOM   4572  H  HG3  . MET A 1 40 ? -11.065 -7.636  -8.279  1.00 0.00 ? 104 MET A HG3  4  
ATOM   4573  H  HE1  . MET A 1 40 ? -11.815 -10.699 -11.287 1.00 0.00 ? 104 MET A HE1  4  
ATOM   4574  H  HE2  . MET A 1 40 ? -12.591 -11.078 -9.749  1.00 0.00 ? 104 MET A HE2  4  
ATOM   4575  H  HE3  . MET A 1 40 ? -12.830 -9.496  -10.491 1.00 0.00 ? 104 MET A HE3  4  
ATOM   4576  N  N    . LYS A 1 41 ? -11.756 -8.942  -3.536  1.00 0.00 ? 105 LYS A N    4  
ATOM   4577  C  CA   . LYS A 1 41 ? -11.561 -9.575  -2.236  1.00 0.00 ? 105 LYS A CA   4  
ATOM   4578  C  C    . LYS A 1 41 ? -10.609 -10.761 -2.346  1.00 0.00 ? 105 LYS A C    4  
ATOM   4579  O  O    . LYS A 1 41 ? -10.802 -11.788 -1.694  1.00 0.00 ? 105 LYS A O    4  
ATOM   4580  C  CB   . LYS A 1 41 ? -12.903 -10.036 -1.664  1.00 0.00 ? 105 LYS A CB   4  
ATOM   4581  C  CG   . LYS A 1 41 ? -13.769 -8.898  -1.152  1.00 0.00 ? 105 LYS A CG   4  
ATOM   4582  C  CD   . LYS A 1 41 ? -13.241 -8.341  0.159   1.00 0.00 ? 105 LYS A CD   4  
ATOM   4583  C  CE   . LYS A 1 41 ? -13.575 -9.255  1.328   1.00 0.00 ? 105 LYS A CE   4  
ATOM   4584  N  NZ   . LYS A 1 41 ? -12.619 -9.083  2.457   1.00 0.00 ? 105 LYS A NZ   4  
ATOM   4585  H  H    . LYS A 1 41 ? -11.483 -8.009  -3.659  1.00 0.00 ? 105 LYS A H    4  
ATOM   4586  H  HA   . LYS A 1 41 ? -11.129 -8.842  -1.572  1.00 0.00 ? 105 LYS A HA   4  
ATOM   4587  H  HB2  . LYS A 1 41 ? -13.450 -10.558 -2.435  1.00 0.00 ? 105 LYS A HB2  4  
ATOM   4588  H  HB3  . LYS A 1 41 ? -12.717 -10.715 -0.844  1.00 0.00 ? 105 LYS A HB3  4  
ATOM   4589  H  HG2  . LYS A 1 41 ? -13.781 -8.107  -1.888  1.00 0.00 ? 105 LYS A HG2  4  
ATOM   4590  H  HG3  . LYS A 1 41 ? -14.774 -9.264  -0.998  1.00 0.00 ? 105 LYS A HG3  4  
ATOM   4591  H  HD2  . LYS A 1 41 ? -12.168 -8.240  0.091   1.00 0.00 ? 105 LYS A HD2  4  
ATOM   4592  H  HD3  . LYS A 1 41 ? -13.685 -7.371  0.333   1.00 0.00 ? 105 LYS A HD3  4  
ATOM   4593  H  HE2  . LYS A 1 41 ? -14.571 -9.026  1.673   1.00 0.00 ? 105 LYS A HE2  4  
ATOM   4594  H  HE3  . LYS A 1 41 ? -13.538 -10.280 0.989   1.00 0.00 ? 105 LYS A HE3  4  
ATOM   4595  H  HZ1  . LYS A 1 41 ? -13.128 -9.112  3.364   1.00 0.00 ? 105 LYS A HZ1  4  
ATOM   4596  H  HZ2  . LYS A 1 41 ? -12.129 -8.170  2.375   1.00 0.00 ? 105 LYS A HZ2  4  
ATOM   4597  H  HZ3  . LYS A 1 41 ? -11.912 -9.845  2.445   1.00 0.00 ? 105 LYS A HZ3  4  
ATOM   4598  N  N    . LEU A 1 42 ? -9.580  -10.613 -3.174  1.00 0.00 ? 106 LEU A N    4  
ATOM   4599  C  CA   . LEU A 1 42 ? -8.596  -11.673 -3.368  1.00 0.00 ? 106 LEU A CA   4  
ATOM   4600  C  C    . LEU A 1 42 ? -7.598  -11.707 -2.215  1.00 0.00 ? 106 LEU A C    4  
ATOM   4601  O  O    . LEU A 1 42 ? -7.168  -10.664 -1.724  1.00 0.00 ? 106 LEU A O    4  
ATOM   4602  C  CB   . LEU A 1 42 ? -7.857  -11.473 -4.692  1.00 0.00 ? 106 LEU A CB   4  
ATOM   4603  C  CG   . LEU A 1 42 ? -8.732  -11.190 -5.914  1.00 0.00 ? 106 LEU A CG   4  
ATOM   4604  C  CD1  . LEU A 1 42 ? -7.888  -10.667 -7.066  1.00 0.00 ? 106 LEU A CD1  4  
ATOM   4605  C  CD2  . LEU A 1 42 ? -9.488  -12.443 -6.330  1.00 0.00 ? 106 LEU A CD2  4  
ATOM   4606  H  H    . LEU A 1 42 ? -9.479  -9.773  -3.667  1.00 0.00 ? 106 LEU A H    4  
ATOM   4607  H  HA   . LEU A 1 42 ? -9.125  -12.614 -3.399  1.00 0.00 ? 106 LEU A HA   4  
ATOM   4608  H  HB2  . LEU A 1 42 ? -7.180  -10.641 -4.571  1.00 0.00 ? 106 LEU A HB2  4  
ATOM   4609  H  HB3  . LEU A 1 42 ? -7.288  -12.370 -4.892  1.00 0.00 ? 106 LEU A HB3  4  
ATOM   4610  H  HG   . LEU A 1 42 ? -9.458  -10.429 -5.661  1.00 0.00 ? 106 LEU A HG   4  
ATOM   4611  H  HD11 . LEU A 1 42 ? -8.217  -11.120 -7.988  1.00 0.00 ? 106 LEU A HD11 4  
ATOM   4612  H  HD12 . LEU A 1 42 ? -6.851  -10.913 -6.893  1.00 0.00 ? 106 LEU A HD12 4  
ATOM   4613  H  HD13 . LEU A 1 42 ? -7.996  -9.594  -7.133  1.00 0.00 ? 106 LEU A HD13 4  
ATOM   4614  H  HD21 . LEU A 1 42 ? -9.029  -12.863 -7.213  1.00 0.00 ? 106 LEU A HD21 4  
ATOM   4615  H  HD22 . LEU A 1 42 ? -10.515 -12.189 -6.545  1.00 0.00 ? 106 LEU A HD22 4  
ATOM   4616  H  HD23 . LEU A 1 42 ? -9.456  -13.166 -5.528  1.00 0.00 ? 106 LEU A HD23 4  
ATOM   4617  N  N    . GLU A 1 43 ? -7.234  -12.913 -1.790  1.00 0.00 ? 107 GLU A N    4  
ATOM   4618  C  CA   . GLU A 1 43 ? -6.285  -13.081 -0.696  1.00 0.00 ? 107 GLU A CA   4  
ATOM   4619  C  C    . GLU A 1 43 ? -5.099  -13.938 -1.131  1.00 0.00 ? 107 GLU A C    4  
ATOM   4620  O  O    . GLU A 1 43 ? -5.226  -14.794 -2.007  1.00 0.00 ? 107 GLU A O    4  
ATOM   4621  C  CB   . GLU A 1 43 ? -6.974  -13.721 0.511   1.00 0.00 ? 107 GLU A CB   4  
ATOM   4622  C  CG   . GLU A 1 43 ? -6.072  -13.852 1.727   1.00 0.00 ? 107 GLU A CG   4  
ATOM   4623  C  CD   . GLU A 1 43 ? -6.851  -13.925 3.026   1.00 0.00 ? 107 GLU A CD   4  
ATOM   4624  O  OE1  . GLU A 1 43 ? -8.012  -14.386 2.997   1.00 0.00 ? 107 GLU A OE1  4  
ATOM   4625  O  OE2  . GLU A 1 43 ? -6.300  -13.523 4.072   1.00 0.00 ? 107 GLU A OE2  4  
ATOM   4626  H  H    . GLU A 1 43 ? -7.612  -13.707 -2.222  1.00 0.00 ? 107 GLU A H    4  
ATOM   4627  H  HA   . GLU A 1 43 ? -5.924  -12.103 -0.417  1.00 0.00 ? 107 GLU A HA   4  
ATOM   4628  H  HB2  . GLU A 1 43 ? -7.827  -13.118 0.785   1.00 0.00 ? 107 GLU A HB2  4  
ATOM   4629  H  HB3  . GLU A 1 43 ? -7.315  -14.707 0.235   1.00 0.00 ? 107 GLU A HB3  4  
ATOM   4630  H  HG2  . GLU A 1 43 ? -5.483  -14.751 1.628   1.00 0.00 ? 107 GLU A HG2  4  
ATOM   4631  H  HG3  . GLU A 1 43 ? -5.415  -12.995 1.767   1.00 0.00 ? 107 GLU A HG3  4  
ATOM   4632  N  N    . TYR A 1 44 ? -3.947  -13.700 -0.514  1.00 0.00 ? 108 TYR A N    4  
ATOM   4633  C  CA   . TYR A 1 44 ? -2.738  -14.447 -0.838  1.00 0.00 ? 108 TYR A CA   4  
ATOM   4634  C  C    . TYR A 1 44 ? -2.118  -15.053 0.417   1.00 0.00 ? 108 TYR A C    4  
ATOM   4635  O  O    . TYR A 1 44 ? -2.622  -14.864 1.524   1.00 0.00 ? 108 TYR A O    4  
ATOM   4636  C  CB   . TYR A 1 44 ? -1.723  -13.537 -1.534  1.00 0.00 ? 108 TYR A CB   4  
ATOM   4637  C  CG   . TYR A 1 44 ? -2.342  -12.609 -2.555  1.00 0.00 ? 108 TYR A CG   4  
ATOM   4638  C  CD1  . TYR A 1 44 ? -2.924  -13.108 -3.714  1.00 0.00 ? 108 TYR A CD1  4  
ATOM   4639  C  CD2  . TYR A 1 44 ? -2.345  -11.233 -2.359  1.00 0.00 ? 108 TYR A CD2  4  
ATOM   4640  C  CE1  . TYR A 1 44 ? -3.489  -12.263 -4.649  1.00 0.00 ? 108 TYR A CE1  4  
ATOM   4641  C  CE2  . TYR A 1 44 ? -2.910  -10.381 -3.289  1.00 0.00 ? 108 TYR A CE2  4  
ATOM   4642  C  CZ   . TYR A 1 44 ? -3.480  -10.901 -4.432  1.00 0.00 ? 108 TYR A CZ   4  
ATOM   4643  O  OH   . TYR A 1 44 ? -4.044  -10.057 -5.361  1.00 0.00 ? 108 TYR A OH   4  
ATOM   4644  H  H    . TYR A 1 44 ? -3.909  -13.005 0.176   1.00 0.00 ? 108 TYR A H    4  
ATOM   4645  H  HA   . TYR A 1 44 ? -3.012  -15.245 -1.512  1.00 0.00 ? 108 TYR A HA   4  
ATOM   4646  H  HB2  . TYR A 1 44 ? -1.227  -12.930 -0.793  1.00 0.00 ? 108 TYR A HB2  4  
ATOM   4647  H  HB3  . TYR A 1 44 ? -0.991  -14.148 -2.041  1.00 0.00 ? 108 TYR A HB3  4  
ATOM   4648  H  HD1  . TYR A 1 44 ? -2.930  -14.175 -3.880  1.00 0.00 ? 108 TYR A HD1  4  
ATOM   4649  H  HD2  . TYR A 1 44 ? -1.898  -10.829 -1.463  1.00 0.00 ? 108 TYR A HD2  4  
ATOM   4650  H  HE1  . TYR A 1 44 ? -3.937  -12.670 -5.544  1.00 0.00 ? 108 TYR A HE1  4  
ATOM   4651  H  HE2  . TYR A 1 44 ? -2.903  -9.315  -3.120  1.00 0.00 ? 108 TYR A HE2  4  
ATOM   4652  H  HH   . TYR A 1 44 ? -4.710  -10.532 -5.863  1.00 0.00 ? 108 TYR A HH   4  
ATOM   4653  N  N    . GLU A 1 45 ? -1.021  -15.781 0.235   1.00 0.00 ? 109 GLU A N    4  
ATOM   4654  C  CA   . GLU A 1 45 ? -0.331  -16.415 1.353   1.00 0.00 ? 109 GLU A CA   4  
ATOM   4655  C  C    . GLU A 1 45 ? 0.724   -15.483 1.940   1.00 0.00 ? 109 GLU A C    4  
ATOM   4656  O  O    . GLU A 1 45 ? 1.335   -14.688 1.225   1.00 0.00 ? 109 GLU A O    4  
ATOM   4657  C  CB   . GLU A 1 45 ? 0.322   -17.723 0.902   1.00 0.00 ? 109 GLU A CB   4  
ATOM   4658  C  CG   . GLU A 1 45 ? 1.573   -17.522 0.064   1.00 0.00 ? 109 GLU A CG   4  
ATOM   4659  C  CD   . GLU A 1 45 ? 1.283   -16.853 -1.265  1.00 0.00 ? 109 GLU A CD   4  
ATOM   4660  O  OE1  . GLU A 1 45 ? 1.129   -15.613 -1.284  1.00 0.00 ? 109 GLU A OE1  4  
ATOM   4661  O  OE2  . GLU A 1 45 ? 1.211   -17.567 -2.286  1.00 0.00 ? 109 GLU A OE2  4  
ATOM   4662  H  H    . GLU A 1 45 ? -0.667  -15.895 -0.672  1.00 0.00 ? 109 GLU A H    4  
ATOM   4663  H  HA   . GLU A 1 45 ? -1.065  -16.633 2.114   1.00 0.00 ? 109 GLU A HA   4  
ATOM   4664  H  HB2  . GLU A 1 45 ? 0.587   -18.299 1.777   1.00 0.00 ? 109 GLU A HB2  4  
ATOM   4665  H  HB3  . GLU A 1 45 ? -0.392  -18.284 0.316   1.00 0.00 ? 109 GLU A HB3  4  
ATOM   4666  H  HG2  . GLU A 1 45 ? 2.265   -16.905 0.617   1.00 0.00 ? 109 GLU A HG2  4  
ATOM   4667  H  HG3  . GLU A 1 45 ? 2.023   -18.485 -0.125  1.00 0.00 ? 109 GLU A HG3  4  
ATOM   4668  N  N    . LYS A 1 46 ? 0.933   -15.585 3.249   1.00 0.00 ? 110 LYS A N    4  
ATOM   4669  C  CA   . LYS A 1 46 ? 1.915   -14.753 3.934   1.00 0.00 ? 110 LYS A CA   4  
ATOM   4670  C  C    . LYS A 1 46 ? 3.303   -14.940 3.331   1.00 0.00 ? 110 LYS A C    4  
ATOM   4671  O  O    . LYS A 1 46 ? 3.831   -16.052 3.295   1.00 0.00 ? 110 LYS A O    4  
ATOM   4672  C  CB   . LYS A 1 46 ? 1.946   -15.090 5.427   1.00 0.00 ? 110 LYS A CB   4  
ATOM   4673  C  CG   . LYS A 1 46 ? 3.051   -14.380 6.188   1.00 0.00 ? 110 LYS A CG   4  
ATOM   4674  C  CD   . LYS A 1 46 ? 2.694   -14.203 7.655   1.00 0.00 ? 110 LYS A CD   4  
ATOM   4675  C  CE   . LYS A 1 46 ? 3.939   -14.123 8.526   1.00 0.00 ? 110 LYS A CE   4  
ATOM   4676  N  NZ   . LYS A 1 46 ? 4.559   -15.461 8.731   1.00 0.00 ? 110 LYS A NZ   4  
ATOM   4677  H  H    . LYS A 1 46 ? 0.415   -16.237 3.766   1.00 0.00 ? 110 LYS A H    4  
ATOM   4678  H  HA   . LYS A 1 46 ? 1.618   -13.722 3.813   1.00 0.00 ? 110 LYS A HA   4  
ATOM   4679  H  HB2  . LYS A 1 46 ? 0.999   -14.813 5.866   1.00 0.00 ? 110 LYS A HB2  4  
ATOM   4680  H  HB3  . LYS A 1 46 ? 2.087   -16.156 5.540   1.00 0.00 ? 110 LYS A HB3  4  
ATOM   4681  H  HG2  . LYS A 1 46 ? 3.957   -14.963 6.117   1.00 0.00 ? 110 LYS A HG2  4  
ATOM   4682  H  HG3  . LYS A 1 46 ? 3.212   -13.406 5.747   1.00 0.00 ? 110 LYS A HG3  4  
ATOM   4683  H  HD2  . LYS A 1 46 ? 2.128   -13.292 7.771   1.00 0.00 ? 110 LYS A HD2  4  
ATOM   4684  H  HD3  . LYS A 1 46 ? 2.095   -15.045 7.974   1.00 0.00 ? 110 LYS A HD3  4  
ATOM   4685  H  HE2  . LYS A 1 46 ? 4.655   -13.473 8.047   1.00 0.00 ? 110 LYS A HE2  4  
ATOM   4686  H  HE3  . LYS A 1 46 ? 3.664   -13.711 9.485   1.00 0.00 ? 110 LYS A HE3  4  
ATOM   4687  H  HZ1  . LYS A 1 46 ? 3.856   -16.127 9.111   1.00 0.00 ? 110 LYS A HZ1  4  
ATOM   4688  H  HZ2  . LYS A 1 46 ? 5.350   -15.388 9.403   1.00 0.00 ? 110 LYS A HZ2  4  
ATOM   4689  H  HZ3  . LYS A 1 46 ? 4.918   -15.831 7.828   1.00 0.00 ? 110 LYS A HZ3  4  
ATOM   4690  N  N    . CYS A 1 47 ? 3.891   -13.845 2.860   1.00 0.00 ? 111 CYS A N    4  
ATOM   4691  C  CA   . CYS A 1 47 ? 5.218   -13.888 2.259   1.00 0.00 ? 111 CYS A CA   4  
ATOM   4692  C  C    . CYS A 1 47 ? 6.271   -13.359 3.229   1.00 0.00 ? 111 CYS A C    4  
ATOM   4693  O  O    . CYS A 1 47 ? 6.385   -12.152 3.438   1.00 0.00 ? 111 CYS A O    4  
ATOM   4694  C  CB   . CYS A 1 47 ? 5.243   -13.069 0.967   1.00 0.00 ? 111 CYS A CB   4  
ATOM   4695  S  SG   . CYS A 1 47 ? 6.813   -13.175 0.049   1.00 0.00 ? 111 CYS A SG   4  
ATOM   4696  H  H    . CYS A 1 47 ? 3.419   -12.987 2.917   1.00 0.00 ? 111 CYS A H    4  
ATOM   4697  H  HA   . CYS A 1 47 ? 5.445   -14.917 2.027   1.00 0.00 ? 111 CYS A HA   4  
ATOM   4698  H  HB2  . CYS A 1 47 ? 4.457   -13.420 0.313   1.00 0.00 ? 111 CYS A HB2  4  
ATOM   4699  H  HB3  . CYS A 1 47 ? 5.069   -12.030 1.204   1.00 0.00 ? 111 CYS A HB3  4  
ATOM   4700  N  N    . GLU A 1 48 ? 7.038   -14.272 3.817   1.00 0.00 ? 112 GLU A N    4  
ATOM   4701  C  CA   . GLU A 1 48 ? 8.081   -13.898 4.765   1.00 0.00 ? 112 GLU A CA   4  
ATOM   4702  C  C    . GLU A 1 48 ? 9.200   -13.130 4.067   1.00 0.00 ? 112 GLU A C    4  
ATOM   4703  O  O    . GLU A 1 48 ? 9.696   -12.128 4.583   1.00 0.00 ? 112 GLU A O    4  
ATOM   4704  C  CB   . GLU A 1 48 ? 8.650   -15.142 5.449   1.00 0.00 ? 112 GLU A CB   4  
ATOM   4705  C  CG   . GLU A 1 48 ? 7.737   -15.722 6.515   1.00 0.00 ? 112 GLU A CG   4  
ATOM   4706  C  CD   . GLU A 1 48 ? 8.111   -17.142 6.895   1.00 0.00 ? 112 GLU A CD   4  
ATOM   4707  O  OE1  . GLU A 1 48 ? 7.810   -18.065 6.110   1.00 0.00 ? 112 GLU A OE1  4  
ATOM   4708  O  OE2  . GLU A 1 48 ? 8.705   -17.329 7.977   1.00 0.00 ? 112 GLU A OE2  4  
ATOM   4709  H  H    . GLU A 1 48 ? 6.898   -15.220 3.609   1.00 0.00 ? 112 GLU A H    4  
ATOM   4710  H  HA   . GLU A 1 48 ? 7.635   -13.259 5.513   1.00 0.00 ? 112 GLU A HA   4  
ATOM   4711  H  HB2  . GLU A 1 48 ? 8.825   -15.901 4.701   1.00 0.00 ? 112 GLU A HB2  4  
ATOM   4712  H  HB3  . GLU A 1 48 ? 9.591   -14.884 5.912   1.00 0.00 ? 112 GLU A HB3  4  
ATOM   4713  H  HG2  . GLU A 1 48 ? 7.796   -15.103 7.398   1.00 0.00 ? 112 GLU A HG2  4  
ATOM   4714  H  HG3  . GLU A 1 48 ? 6.723   -15.720 6.143   1.00 0.00 ? 112 GLU A HG3  4  
ATOM   4715  N  N    . ARG A 1 49 ? 9.593   -13.609 2.891   1.00 0.00 ? 113 ARG A N    4  
ATOM   4716  C  CA   . ARG A 1 49 ? 10.655  -12.970 2.122   1.00 0.00 ? 113 ARG A CA   4  
ATOM   4717  C  C    . ARG A 1 49 ? 10.496  -11.452 2.133   1.00 0.00 ? 113 ARG A C    4  
ATOM   4718  O  O    . ARG A 1 49 ? 11.475  -10.715 2.022   1.00 0.00 ? 113 ARG A O    4  
ATOM   4719  C  CB   . ARG A 1 49 ? 10.651  -13.484 0.682   1.00 0.00 ? 113 ARG A CB   4  
ATOM   4720  C  CG   . ARG A 1 49 ? 10.864  -14.985 0.570   1.00 0.00 ? 113 ARG A CG   4  
ATOM   4721  C  CD   . ARG A 1 49 ? 11.351  -15.377 -0.816  1.00 0.00 ? 113 ARG A CD   4  
ATOM   4722  N  NE   . ARG A 1 49 ? 12.772  -15.095 -0.997  1.00 0.00 ? 113 ARG A NE   4  
ATOM   4723  C  CZ   . ARG A 1 49 ? 13.347  -14.946 -2.185  1.00 0.00 ? 113 ARG A CZ   4  
ATOM   4724  N  NH1  . ARG A 1 49 ? 12.624  -15.051 -3.292  1.00 0.00 ? 113 ARG A NH1  4  
ATOM   4725  N  NH2  . ARG A 1 49 ? 14.646  -14.691 -2.268  1.00 0.00 ? 113 ARG A NH2  4  
ATOM   4726  H  H    . ARG A 1 49 ? 9.160   -14.411 2.532   1.00 0.00 ? 113 ARG A H    4  
ATOM   4727  H  HA   . ARG A 1 49 ? 11.598  -13.224 2.584   1.00 0.00 ? 113 ARG A HA   4  
ATOM   4728  H  HB2  . ARG A 1 49 ? 9.701   -13.243 0.228   1.00 0.00 ? 113 ARG A HB2  4  
ATOM   4729  H  HB3  . ARG A 1 49 ? 11.439  -12.989 0.134   1.00 0.00 ? 113 ARG A HB3  4  
ATOM   4730  H  HG2  . ARG A 1 49 ? 11.601  -15.290 1.298   1.00 0.00 ? 113 ARG A HG2  4  
ATOM   4731  H  HG3  . ARG A 1 49 ? 9.929   -15.487 0.770   1.00 0.00 ? 113 ARG A HG3  4  
ATOM   4732  H  HD2  . ARG A 1 49 ? 11.183  -16.435 -0.956  1.00 0.00 ? 113 ARG A HD2  4  
ATOM   4733  H  HD3  . ARG A 1 49 ? 10.787  -14.823 -1.551  1.00 0.00 ? 113 ARG A HD3  4  
ATOM   4734  H  HE   . ARG A 1 49 ? 13.325  -15.013 -0.192  1.00 0.00 ? 113 ARG A HE   4  
ATOM   4735  H  HH11 . ARG A 1 49 ? 11.645  -15.243 -3.233  1.00 0.00 ? 113 ARG A HH11 4  
ATOM   4736  H  HH12 . ARG A 1 49 ? 13.059  -14.937 -4.186  1.00 0.00 ? 113 ARG A HH12 4  
ATOM   4737  H  HH21 . ARG A 1 49 ? 15.194  -14.611 -1.436  1.00 0.00 ? 113 ARG A HH21 4  
ATOM   4738  H  HH22 . ARG A 1 49 ? 15.077  -14.579 -3.163  1.00 0.00 ? 113 ARG A HH22 4  
ATOM   4739  N  N    . SER A 1 50 ? 9.255   -10.994 2.266   1.00 0.00 ? 114 SER A N    4  
ATOM   4740  C  CA   . SER A 1 50 ? 8.967   -9.564  2.286   1.00 0.00 ? 114 SER A CA   4  
ATOM   4741  C  C    . SER A 1 50 ? 9.575   -8.870  1.071   1.00 0.00 ? 114 SER A C    4  
ATOM   4742  O  O    . SER A 1 50 ? 10.233  -7.837  1.196   1.00 0.00 ? 114 SER A O    4  
ATOM   4743  C  CB   . SER A 1 50 ? 9.505   -8.932  3.571   1.00 0.00 ? 114 SER A CB   4  
ATOM   4744  O  OG   . SER A 1 50 ? 8.744   -9.337  4.696   1.00 0.00 ? 114 SER A OG   4  
ATOM   4745  H  H    . SER A 1 50 ? 8.516   -11.632 2.350   1.00 0.00 ? 114 SER A H    4  
ATOM   4746  H  HA   . SER A 1 50 ? 7.895   -9.442  2.257   1.00 0.00 ? 114 SER A HA   4  
ATOM   4747  H  HB2  . SER A 1 50 ? 10.530  -9.236  3.717   1.00 0.00 ? 114 SER A HB2  4  
ATOM   4748  H  HB3  . SER A 1 50 ? 9.457   -7.856  3.487   1.00 0.00 ? 114 SER A HB3  4  
ATOM   4749  H  HG   . SER A 1 50 ? 9.329   -9.704  5.363   1.00 0.00 ? 114 SER A HG   4  
ATOM   4750  N  N    . CYS A 1 51 ? 9.349   -9.446  -0.105  1.00 0.00 ? 115 CYS A N    4  
ATOM   4751  C  CA   . CYS A 1 51 ? 9.874   -8.885  -1.345  1.00 0.00 ? 115 CYS A CA   4  
ATOM   4752  C  C    . CYS A 1 51 ? 9.754   -7.363  -1.347  1.00 0.00 ? 115 CYS A C    4  
ATOM   4753  O  O    . CYS A 1 51 ? 8.808   -6.803  -0.793  1.00 0.00 ? 115 CYS A O    4  
ATOM   4754  C  CB   . CYS A 1 51 ? 9.130   -9.468  -2.548  1.00 0.00 ? 115 CYS A CB   4  
ATOM   4755  S  SG   . CYS A 1 51 ? 8.826   -11.260 -2.437  1.00 0.00 ? 115 CYS A SG   4  
ATOM   4756  H  H    . CYS A 1 51 ? 8.817   -10.268 -0.141  1.00 0.00 ? 115 CYS A H    4  
ATOM   4757  H  HA   . CYS A 1 51 ? 10.918  -9.151  -1.414  1.00 0.00 ? 115 CYS A HA   4  
ATOM   4758  H  HB2  . CYS A 1 51 ? 8.172   -8.978  -2.641  1.00 0.00 ? 115 CYS A HB2  4  
ATOM   4759  H  HB3  . CYS A 1 51 ? 9.709   -9.287  -3.441  1.00 0.00 ? 115 CYS A HB3  4  
ATOM   4760  N  N    . LYS A 1 52 ? 10.720  -6.700  -1.974  1.00 0.00 ? 116 LYS A N    4  
ATOM   4761  C  CA   . LYS A 1 52 ? 10.724  -5.244  -2.051  1.00 0.00 ? 116 LYS A CA   4  
ATOM   4762  C  C    . LYS A 1 52 ? 10.144  -4.768  -3.379  1.00 0.00 ? 116 LYS A C    4  
ATOM   4763  O  O    . LYS A 1 52 ? 10.768  -4.919  -4.429  1.00 0.00 ? 116 LYS A O    4  
ATOM   4764  C  CB   . LYS A 1 52 ? 12.147  -4.708  -1.882  1.00 0.00 ? 116 LYS A CB   4  
ATOM   4765  C  CG   . LYS A 1 52 ? 12.777  -5.064  -0.547  1.00 0.00 ? 116 LYS A CG   4  
ATOM   4766  C  CD   . LYS A 1 52 ? 14.217  -4.585  -0.464  1.00 0.00 ? 116 LYS A CD   4  
ATOM   4767  C  CE   . LYS A 1 52 ? 14.294  -3.070  -0.357  1.00 0.00 ? 116 LYS A CE   4  
ATOM   4768  N  NZ   . LYS A 1 52 ? 15.599  -2.619  0.202   1.00 0.00 ? 116 LYS A NZ   4  
ATOM   4769  H  H    . LYS A 1 52 ? 11.448  -7.203  -2.396  1.00 0.00 ? 116 LYS A H    4  
ATOM   4770  H  HA   . LYS A 1 52 ? 10.109  -4.868  -1.247  1.00 0.00 ? 116 LYS A HA   4  
ATOM   4771  H  HB2  . LYS A 1 52 ? 12.767  -5.113  -2.669  1.00 0.00 ? 116 LYS A HB2  4  
ATOM   4772  H  HB3  . LYS A 1 52 ? 12.126  -3.631  -1.970  1.00 0.00 ? 116 LYS A HB3  4  
ATOM   4773  H  HG2  . LYS A 1 52 ? 12.209  -4.600  0.245   1.00 0.00 ? 116 LYS A HG2  4  
ATOM   4774  H  HG3  . LYS A 1 52 ? 12.757  -6.138  -0.425  1.00 0.00 ? 116 LYS A HG3  4  
ATOM   4775  H  HD2  . LYS A 1 52 ? 14.683  -5.020  0.407   1.00 0.00 ? 116 LYS A HD2  4  
ATOM   4776  H  HD3  . LYS A 1 52 ? 14.744  -4.902  -1.353  1.00 0.00 ? 116 LYS A HD3  4  
ATOM   4777  H  HE2  . LYS A 1 52 ? 14.169  -2.646  -1.342  1.00 0.00 ? 116 LYS A HE2  4  
ATOM   4778  H  HE3  . LYS A 1 52 ? 13.498  -2.726  0.287   1.00 0.00 ? 116 LYS A HE3  4  
ATOM   4779  H  HZ1  . LYS A 1 52 ? 15.940  -3.302  0.908   1.00 0.00 ? 116 LYS A HZ1  4  
ATOM   4780  H  HZ2  . LYS A 1 52 ? 15.490  -1.690  0.657   1.00 0.00 ? 116 LYS A HZ2  4  
ATOM   4781  H  HZ3  . LYS A 1 52 ? 16.305  -2.540  -0.558  1.00 0.00 ? 116 LYS A HZ3  4  
ATOM   4782  N  N    . ILE A 1 53 ? 8.947   -4.192  -3.324  1.00 0.00 ? 117 ILE A N    4  
ATOM   4783  C  CA   . ILE A 1 53 ? 8.285   -3.692  -4.522  1.00 0.00 ? 117 ILE A CA   4  
ATOM   4784  C  C    . ILE A 1 53 ? 9.073   -2.546  -5.147  1.00 0.00 ? 117 ILE A C    4  
ATOM   4785  O  O    . ILE A 1 53 ? 8.856   -1.380  -4.819  1.00 0.00 ? 117 ILE A O    4  
ATOM   4786  C  CB   . ILE A 1 53 ? 6.855   -3.210  -4.216  1.00 0.00 ? 117 ILE A CB   4  
ATOM   4787  C  CG1  . ILE A 1 53 ? 6.076   -4.297  -3.471  1.00 0.00 ? 117 ILE A CG1  4  
ATOM   4788  C  CG2  . ILE A 1 53 ? 6.139   -2.825  -5.501  1.00 0.00 ? 117 ILE A CG2  4  
ATOM   4789  C  CD1  . ILE A 1 53 ? 5.834   -5.541  -4.297  1.00 0.00 ? 117 ILE A CD1  4  
ATOM   4790  H  H    . ILE A 1 53 ? 8.500   -4.101  -2.457  1.00 0.00 ? 117 ILE A H    4  
ATOM   4791  H  HA   . ILE A 1 53 ? 8.226   -4.504  -5.233  1.00 0.00 ? 117 ILE A HA   4  
ATOM   4792  H  HB   . ILE A 1 53 ? 6.921   -2.332  -3.592  1.00 0.00 ? 117 ILE A HB   4  
ATOM   4793  H  HG12 . ILE A 1 53 ? 6.627   -4.586  -2.590  1.00 0.00 ? 117 ILE A HG12 4  
ATOM   4794  H  HG13 . ILE A 1 53 ? 5.115   -3.901  -3.176  1.00 0.00 ? 117 ILE A HG13 4  
ATOM   4795  H  HG21 . ILE A 1 53 ? 5.573   -1.920  -5.340  1.00 0.00 ? 117 ILE A HG21 4  
ATOM   4796  H  HG22 . ILE A 1 53 ? 6.866   -2.659  -6.282  1.00 0.00 ? 117 ILE A HG22 4  
ATOM   4797  H  HG23 . ILE A 1 53 ? 5.471   -3.621  -5.794  1.00 0.00 ? 117 ILE A HG23 4  
ATOM   4798  H  HD11 . ILE A 1 53 ? 4.999   -5.374  -4.961  1.00 0.00 ? 117 ILE A HD11 4  
ATOM   4799  H  HD12 . ILE A 1 53 ? 6.716   -5.764  -4.879  1.00 0.00 ? 117 ILE A HD12 4  
ATOM   4800  H  HD13 . ILE A 1 53 ? 5.614   -6.370  -3.642  1.00 0.00 ? 117 ILE A HD13 4  
ATOM   4801  N  N    . GLN A 1 54 ? 9.986   -2.886  -6.051  1.00 0.00 ? 118 GLN A N    4  
ATOM   4802  C  CA   . GLN A 1 54 ? 10.805  -1.884  -6.723  1.00 0.00 ? 118 GLN A CA   4  
ATOM   4803  C  C    . GLN A 1 54 ? 10.320  -1.653  -8.150  1.00 0.00 ? 118 GLN A C    4  
ATOM   4804  O  O    . GLN A 1 54 ? 9.803   -2.564  -8.797  1.00 0.00 ? 118 GLN A O    4  
ATOM   4805  C  CB   . GLN A 1 54 ? 12.272  -2.318  -6.734  1.00 0.00 ? 118 GLN A CB   4  
ATOM   4806  C  CG   . GLN A 1 54 ? 13.008  -2.009  -5.440  1.00 0.00 ? 118 GLN A CG   4  
ATOM   4807  C  CD   . GLN A 1 54 ? 12.942  -0.541  -5.068  1.00 0.00 ? 118 GLN A CD   4  
ATOM   4808  O  OE1  . GLN A 1 54 ? 11.996  -0.095  -4.418  1.00 0.00 ? 118 GLN A OE1  4  
ATOM   4809  N  NE2  . GLN A 1 54 ? 13.949  0.220   -5.479  1.00 0.00 ? 118 GLN A NE2  4  
ATOM   4810  H  H    . GLN A 1 54 ? 10.112  -3.832  -6.270  1.00 0.00 ? 118 GLN A H    4  
ATOM   4811  H  HA   . GLN A 1 54 ? 10.717  -0.960  -6.172  1.00 0.00 ? 118 GLN A HA   4  
ATOM   4812  H  HB2  . GLN A 1 54 ? 12.319  -3.383  -6.904  1.00 0.00 ? 118 GLN A HB2  4  
ATOM   4813  H  HB3  . GLN A 1 54 ? 12.779  -1.810  -7.541  1.00 0.00 ? 118 GLN A HB3  4  
ATOM   4814  H  HG2  . GLN A 1 54 ? 12.565  -2.586  -4.642  1.00 0.00 ? 118 GLN A HG2  4  
ATOM   4815  H  HG3  . GLN A 1 54 ? 14.044  -2.290  -5.555  1.00 0.00 ? 118 GLN A HG3  4  
ATOM   4816  H  HE21 . GLN A 1 54 ? 14.669  -0.203  -5.994  1.00 0.00 ? 118 GLN A HE21 4  
ATOM   4817  H  HE22 . GLN A 1 54 ? 13.932  1.173   -5.253  1.00 0.00 ? 118 GLN A HE22 4  
ATOM   4818  N  N    . LYS A 1 55 ? 10.491  -0.429  -8.637  1.00 0.00 ? 119 LYS A N    4  
ATOM   4819  C  CA   . LYS A 1 55 ? 10.072  -0.077  -9.988  1.00 0.00 ? 119 LYS A CA   4  
ATOM   4820  C  C    . LYS A 1 55 ? 10.543  -1.122  -10.994 1.00 0.00 ? 119 LYS A C    4  
ATOM   4821  O  O    . LYS A 1 55 ? 9.776   -1.567  -11.849 1.00 0.00 ? 119 LYS A O    4  
ATOM   4822  C  CB   . LYS A 1 55 ? 10.621  1.299   -10.372 1.00 0.00 ? 119 LYS A CB   4  
ATOM   4823  C  CG   . LYS A 1 55 ? 12.137  1.383   -10.331 1.00 0.00 ? 119 LYS A CG   4  
ATOM   4824  C  CD   . LYS A 1 55 ? 12.620  2.818   -10.456 1.00 0.00 ? 119 LYS A CD   4  
ATOM   4825  C  CE   . LYS A 1 55 ? 12.534  3.553   -9.127  1.00 0.00 ? 119 LYS A CE   4  
ATOM   4826  N  NZ   . LYS A 1 55 ? 12.597  5.030   -9.306  1.00 0.00 ? 119 LYS A NZ   4  
ATOM   4827  H  H    . LYS A 1 55 ? 10.910  0.255   -8.073  1.00 0.00 ? 119 LYS A H    4  
ATOM   4828  H  HA   . LYS A 1 55 ? 8.993   -0.041  -10.003 1.00 0.00 ? 119 LYS A HA   4  
ATOM   4829  H  HB2  . LYS A 1 55 ? 10.295  1.537   -11.375 1.00 0.00 ? 119 LYS A HB2  4  
ATOM   4830  H  HB3  . LYS A 1 55 ? 10.222  2.036   -9.690  1.00 0.00 ? 119 LYS A HB3  4  
ATOM   4831  H  HG2  . LYS A 1 55 ? 12.485  0.978   -9.392  1.00 0.00 ? 119 LYS A HG2  4  
ATOM   4832  H  HG3  . LYS A 1 55 ? 12.543  0.803   -11.148 1.00 0.00 ? 119 LYS A HG3  4  
ATOM   4833  H  HD2  . LYS A 1 55 ? 13.648  2.815   -10.787 1.00 0.00 ? 119 LYS A HD2  4  
ATOM   4834  H  HD3  . LYS A 1 55 ? 12.008  3.333   -11.183 1.00 0.00 ? 119 LYS A HD3  4  
ATOM   4835  H  HE2  . LYS A 1 55 ? 11.601  3.296   -8.649  1.00 0.00 ? 119 LYS A HE2  4  
ATOM   4836  H  HE3  . LYS A 1 55 ? 13.357  3.238   -8.503  1.00 0.00 ? 119 LYS A HE3  4  
ATOM   4837  H  HZ1  . LYS A 1 55 ? 11.637  5.422   -9.380  1.00 0.00 ? 119 LYS A HZ1  4  
ATOM   4838  H  HZ2  . LYS A 1 55 ? 13.123  5.263   -10.172 1.00 0.00 ? 119 LYS A HZ2  4  
ATOM   4839  H  HZ3  . LYS A 1 55 ? 13.077  5.467   -8.494  1.00 0.00 ? 119 LYS A HZ3  4  
ATOM   4840  N  N    . LYS A 1 56 ? 11.808  -1.513  -10.886 1.00 0.00 ? 120 LYS A N    4  
ATOM   4841  C  CA   . LYS A 1 56 ? 12.382  -2.508  -11.783 1.00 0.00 ? 120 LYS A CA   4  
ATOM   4842  C  C    . LYS A 1 56 ? 11.530  -3.773  -11.809 1.00 0.00 ? 120 LYS A C    4  
ATOM   4843  O  O    . LYS A 1 56 ? 11.174  -4.272  -12.876 1.00 0.00 ? 120 LYS A O    4  
ATOM   4844  C  CB   . LYS A 1 56 ? 13.810  -2.852  -11.352 1.00 0.00 ? 120 LYS A CB   4  
ATOM   4845  C  CG   . LYS A 1 56 ? 13.912  -3.329  -9.914  1.00 0.00 ? 120 LYS A CG   4  
ATOM   4846  C  CD   . LYS A 1 56 ? 15.351  -3.323  -9.426  1.00 0.00 ? 120 LYS A CD   4  
ATOM   4847  C  CE   . LYS A 1 56 ? 15.828  -1.912  -9.114  1.00 0.00 ? 120 LYS A CE   4  
ATOM   4848  N  NZ   . LYS A 1 56 ? 17.276  -1.880  -8.768  1.00 0.00 ? 120 LYS A NZ   4  
ATOM   4849  H  H    . LYS A 1 56 ? 12.371  -1.122  -10.184 1.00 0.00 ? 120 LYS A H    4  
ATOM   4850  H  HA   . LYS A 1 56 ? 12.407  -2.085  -12.776 1.00 0.00 ? 120 LYS A HA   4  
ATOM   4851  H  HB2  . LYS A 1 56 ? 14.190  -3.630  -11.996 1.00 0.00 ? 120 LYS A HB2  4  
ATOM   4852  H  HB3  . LYS A 1 56 ? 14.427  -1.972  -11.462 1.00 0.00 ? 120 LYS A HB3  4  
ATOM   4853  H  HG2  . LYS A 1 56 ? 13.327  -2.676  -9.284  1.00 0.00 ? 120 LYS A HG2  4  
ATOM   4854  H  HG3  . LYS A 1 56 ? 13.525  -4.336  -9.850  1.00 0.00 ? 120 LYS A HG3  4  
ATOM   4855  H  HD2  . LYS A 1 56 ? 15.421  -3.920  -8.529  1.00 0.00 ? 120 LYS A HD2  4  
ATOM   4856  H  HD3  . LYS A 1 56 ? 15.984  -3.746  -10.193 1.00 0.00 ? 120 LYS A HD3  4  
ATOM   4857  H  HE2  . LYS A 1 56 ? 15.659  -1.290  -9.980  1.00 0.00 ? 120 LYS A HE2  4  
ATOM   4858  H  HE3  . LYS A 1 56 ? 15.259  -1.530  -8.280  1.00 0.00 ? 120 LYS A HE3  4  
ATOM   4859  H  HZ1  . LYS A 1 56 ? 17.407  -1.495  -7.811  1.00 0.00 ? 120 LYS A HZ1  4  
ATOM   4860  H  HZ2  . LYS A 1 56 ? 17.791  -1.281  -9.445  1.00 0.00 ? 120 LYS A HZ2  4  
ATOM   4861  H  HZ3  . LYS A 1 56 ? 17.673  -2.841  -8.802  1.00 0.00 ? 120 LYS A HZ3  4  
ATOM   4862  N  N    . ASN A 1 57 ? 11.204  -4.286  -10.627 1.00 0.00 ? 121 ASN A N    4  
ATOM   4863  C  CA   . ASN A 1 57 ? 10.392  -5.492  -10.514 1.00 0.00 ? 121 ASN A CA   4  
ATOM   4864  C  C    . ASN A 1 57 ? 9.214   -5.269  -9.570  1.00 0.00 ? 121 ASN A C    4  
ATOM   4865  O  O    . ASN A 1 57 ? 9.249   -5.681  -8.410  1.00 0.00 ? 121 ASN A O    4  
ATOM   4866  C  CB   . ASN A 1 57 ? 11.244  -6.661  -10.017 1.00 0.00 ? 121 ASN A CB   4  
ATOM   4867  C  CG   . ASN A 1 57 ? 12.199  -7.173  -11.079 1.00 0.00 ? 121 ASN A CG   4  
ATOM   4868  O  OD1  . ASN A 1 57 ? 12.811  -6.392  -11.807 1.00 0.00 ? 121 ASN A OD1  4  
ATOM   4869  N  ND2  . ASN A 1 57 ? 12.329  -8.491  -11.171 1.00 0.00 ? 121 ASN A ND2  4  
ATOM   4870  H  H    . ASN A 1 57 ? 11.517  -3.843  -9.810  1.00 0.00 ? 121 ASN A H    4  
ATOM   4871  H  HA   . ASN A 1 57 ? 10.011  -5.728  -11.496 1.00 0.00 ? 121 ASN A HA   4  
ATOM   4872  H  HB2  . ASN A 1 57 ? 11.825  -6.339  -9.165  1.00 0.00 ? 121 ASN A HB2  4  
ATOM   4873  H  HB3  . ASN A 1 57 ? 10.596  -7.472  -9.720  1.00 0.00 ? 121 ASN A HB3  4  
ATOM   4874  H  HD21 . ASN A 1 57 ? 11.809  -9.052  -10.557 1.00 0.00 ? 121 ASN A HD21 4  
ATOM   4875  H  HD22 . ASN A 1 57 ? 12.940  -8.850  -11.848 1.00 0.00 ? 121 ASN A HD22 4  
ATOM   4876  N  N    . ARG A 1 58 ? 8.173   -4.615  -10.075 1.00 0.00 ? 122 ARG A N    4  
ATOM   4877  C  CA   . ARG A 1 58 ? 6.986   -4.337  -9.277  1.00 0.00 ? 122 ARG A CA   4  
ATOM   4878  C  C    . ARG A 1 58 ? 5.989   -5.489  -9.365  1.00 0.00 ? 122 ARG A C    4  
ATOM   4879  O  O    . ARG A 1 58 ? 5.250   -5.757  -8.419  1.00 0.00 ? 122 ARG A O    4  
ATOM   4880  C  CB   . ARG A 1 58 ? 6.324   -3.039  -9.744  1.00 0.00 ? 122 ARG A CB   4  
ATOM   4881  C  CG   . ARG A 1 58 ? 5.865   -3.077  -11.193 1.00 0.00 ? 122 ARG A CG   4  
ATOM   4882  C  CD   . ARG A 1 58 ? 5.005   -1.871  -11.536 1.00 0.00 ? 122 ARG A CD   4  
ATOM   4883  N  NE   . ARG A 1 58 ? 4.507   -1.927  -12.908 1.00 0.00 ? 122 ARG A NE   4  
ATOM   4884  C  CZ   . ARG A 1 58 ? 5.216   -1.544  -13.964 1.00 0.00 ? 122 ARG A CZ   4  
ATOM   4885  N  NH1  . ARG A 1 58 ? 6.448   -1.080  -13.806 1.00 0.00 ? 122 ARG A NH1  4  
ATOM   4886  N  NH2  . ARG A 1 58 ? 4.694   -1.625  -15.181 1.00 0.00 ? 122 ARG A NH2  4  
ATOM   4887  H  H    . ARG A 1 58 ? 8.205   -4.312  -11.006 1.00 0.00 ? 122 ARG A H    4  
ATOM   4888  H  HA   . ARG A 1 58 ? 7.296   -4.222  -8.249  1.00 0.00 ? 122 ARG A HA   4  
ATOM   4889  H  HB2  . ARG A 1 58 ? 5.463   -2.843  -9.122  1.00 0.00 ? 122 ARG A HB2  4  
ATOM   4890  H  HB3  . ARG A 1 58 ? 7.029   -2.229  -9.634  1.00 0.00 ? 122 ARG A HB3  4  
ATOM   4891  H  HG2  . ARG A 1 58 ? 6.733   -3.081  -11.836 1.00 0.00 ? 122 ARG A HG2  4  
ATOM   4892  H  HG3  . ARG A 1 58 ? 5.290   -3.976  -11.355 1.00 0.00 ? 122 ARG A HG3  4  
ATOM   4893  H  HD2  . ARG A 1 58 ? 4.164   -1.840  -10.859 1.00 0.00 ? 122 ARG A HD2  4  
ATOM   4894  H  HD3  . ARG A 1 58 ? 5.597   -0.977  -11.414 1.00 0.00 ? 122 ARG A HD3  4  
ATOM   4895  H  HE   . ARG A 1 58 ? 3.598   -2.266  -13.047 1.00 0.00 ? 122 ARG A HE   4  
ATOM   4896  H  HH11 . ARG A 1 58 ? 6.845   -1.019  -12.890 1.00 0.00 ? 122 ARG A HH11 4  
ATOM   4897  H  HH12 . ARG A 1 58 ? 6.981   -0.794  -14.602 1.00 0.00 ? 122 ARG A HH12 4  
ATOM   4898  H  HH21 . ARG A 1 58 ? 3.765   -1.974  -15.304 1.00 0.00 ? 122 ARG A HH21 4  
ATOM   4899  H  HH22 . ARG A 1 58 ? 5.228   -1.336  -15.974 1.00 0.00 ? 122 ARG A HH22 4  
ATOM   4900  N  N    . ASN A 1 59 ? 5.976   -6.167  -10.508 1.00 0.00 ? 123 ASN A N    4  
ATOM   4901  C  CA   . ASN A 1 59 ? 5.069   -7.290  -10.720 1.00 0.00 ? 123 ASN A CA   4  
ATOM   4902  C  C    . ASN A 1 59 ? 5.757   -8.612  -10.397 1.00 0.00 ? 123 ASN A C    4  
ATOM   4903  O  O    . ASN A 1 59 ? 5.652   -9.580  -11.151 1.00 0.00 ? 123 ASN A O    4  
ATOM   4904  C  CB   . ASN A 1 59 ? 4.569   -7.302  -12.166 1.00 0.00 ? 123 ASN A CB   4  
ATOM   4905  C  CG   . ASN A 1 59 ? 3.701   -6.101  -12.488 1.00 0.00 ? 123 ASN A CG   4  
ATOM   4906  O  OD1  . ASN A 1 59 ? 2.995   -5.581  -11.623 1.00 0.00 ? 123 ASN A OD1  4  
ATOM   4907  N  ND2  . ASN A 1 59 ? 3.750   -5.654  -13.738 1.00 0.00 ? 123 ASN A ND2  4  
ATOM   4908  H  H    . ASN A 1 59 ? 6.589   -5.906  -11.226 1.00 0.00 ? 123 ASN A H    4  
ATOM   4909  H  HA   . ASN A 1 59 ? 4.226   -7.164  -10.058 1.00 0.00 ? 123 ASN A HA   4  
ATOM   4910  H  HB2  . ASN A 1 59 ? 5.418   -7.297  -12.835 1.00 0.00 ? 123 ASN A HB2  4  
ATOM   4911  H  HB3  . ASN A 1 59 ? 3.990   -8.197  -12.333 1.00 0.00 ? 123 ASN A HB3  4  
ATOM   4912  H  HD21 . ASN A 1 59 ? 4.335   -6.117  -14.373 1.00 0.00 ? 123 ASN A HD21 4  
ATOM   4913  H  HD22 . ASN A 1 59 ? 3.199   -4.878  -13.973 1.00 0.00 ? 123 ASN A HD22 4  
ATOM   4914  N  N    . LYS A 1 60 ? 6.461   -8.647  -9.271  1.00 0.00 ? 124 LYS A N    4  
ATOM   4915  C  CA   . LYS A 1 60 ? 7.166   -9.851  -8.845  1.00 0.00 ? 124 LYS A CA   4  
ATOM   4916  C  C    . LYS A 1 60 ? 6.316   -10.663 -7.873  1.00 0.00 ? 124 LYS A C    4  
ATOM   4917  O  O    . LYS A 1 60 ? 5.949   -11.804 -8.158  1.00 0.00 ? 124 LYS A O    4  
ATOM   4918  C  CB   . LYS A 1 60 ? 8.498   -9.482  -8.188  1.00 0.00 ? 124 LYS A CB   4  
ATOM   4919  C  CG   . LYS A 1 60 ? 9.575   -10.538 -8.363  1.00 0.00 ? 124 LYS A CG   4  
ATOM   4920  C  CD   . LYS A 1 60 ? 9.344   -11.727 -7.445  1.00 0.00 ? 124 LYS A CD   4  
ATOM   4921  C  CE   . LYS A 1 60 ? 10.440  -12.771 -7.599  1.00 0.00 ? 124 LYS A CE   4  
ATOM   4922  N  NZ   . LYS A 1 60 ? 10.184  -13.677 -8.753  1.00 0.00 ? 124 LYS A NZ   4  
ATOM   4923  H  H    . LYS A 1 60 ? 6.508   -7.843  -8.711  1.00 0.00 ? 124 LYS A H    4  
ATOM   4924  H  HA   . LYS A 1 60 ? 7.360   -10.449 -9.722  1.00 0.00 ? 124 LYS A HA   4  
ATOM   4925  H  HB2  . LYS A 1 60 ? 8.855   -8.558  -8.620  1.00 0.00 ? 124 LYS A HB2  4  
ATOM   4926  H  HB3  . LYS A 1 60 ? 8.335   -9.335  -7.130  1.00 0.00 ? 124 LYS A HB3  4  
ATOM   4927  H  HG2  . LYS A 1 60 ? 9.568   -10.880 -9.387  1.00 0.00 ? 124 LYS A HG2  4  
ATOM   4928  H  HG3  . LYS A 1 60 ? 10.536  -10.099 -8.134  1.00 0.00 ? 124 LYS A HG3  4  
ATOM   4929  H  HD2  . LYS A 1 60 ? 9.331   -11.384 -6.421  1.00 0.00 ? 124 LYS A HD2  4  
ATOM   4930  H  HD3  . LYS A 1 60 ? 8.392   -12.178 -7.688  1.00 0.00 ? 124 LYS A HD3  4  
ATOM   4931  H  HE2  . LYS A 1 60 ? 11.381  -12.266 -7.750  1.00 0.00 ? 124 LYS A HE2  4  
ATOM   4932  H  HE3  . LYS A 1 60 ? 10.488  -13.359 -6.695  1.00 0.00 ? 124 LYS A HE3  4  
ATOM   4933  H  HZ1  . LYS A 1 60 ? 9.214   -14.049 -8.708  1.00 0.00 ? 124 LYS A HZ1  4  
ATOM   4934  H  HZ2  . LYS A 1 60 ? 10.851  -14.474 -8.735  1.00 0.00 ? 124 LYS A HZ2  4  
ATOM   4935  H  HZ3  . LYS A 1 60 ? 10.305  -13.159 -9.647  1.00 0.00 ? 124 LYS A HZ3  4  
ATOM   4936  N  N    . CYS A 1 61 ? 6.004   -10.069 -6.727  1.00 0.00 ? 125 CYS A N    4  
ATOM   4937  C  CA   . CYS A 1 61 ? 5.197   -10.736 -5.713  1.00 0.00 ? 125 CYS A CA   4  
ATOM   4938  C  C    . CYS A 1 61 ? 3.859   -10.025 -5.529  1.00 0.00 ? 125 CYS A C    4  
ATOM   4939  O  O    . CYS A 1 61 ? 3.762   -8.811  -5.702  1.00 0.00 ? 125 CYS A O    4  
ATOM   4940  C  CB   . CYS A 1 61 ? 5.949   -10.784 -4.382  1.00 0.00 ? 125 CYS A CB   4  
ATOM   4941  S  SG   . CYS A 1 61 ? 5.095   -11.729 -3.079  1.00 0.00 ? 125 CYS A SG   4  
ATOM   4942  H  H    . CYS A 1 61 ? 6.326   -9.158  -6.557  1.00 0.00 ? 125 CYS A H    4  
ATOM   4943  H  HA   . CYS A 1 61 ? 5.011   -11.745 -6.048  1.00 0.00 ? 125 CYS A HA   4  
ATOM   4944  H  HB2  . CYS A 1 61 ? 6.915   -11.242 -4.539  1.00 0.00 ? 125 CYS A HB2  4  
ATOM   4945  H  HB3  . CYS A 1 61 ? 6.089   -9.777  -4.019  1.00 0.00 ? 125 CYS A HB3  4  
ATOM   4946  N  N    . GLN A 1 62 ? 2.832   -10.792 -5.176  1.00 0.00 ? 126 GLN A N    4  
ATOM   4947  C  CA   . GLN A 1 62 ? 1.500   -10.235 -4.969  1.00 0.00 ? 126 GLN A CA   4  
ATOM   4948  C  C    . GLN A 1 62 ? 1.322   -9.771  -3.527  1.00 0.00 ? 126 GLN A C    4  
ATOM   4949  O  O    . GLN A 1 62 ? 1.175   -8.578  -3.262  1.00 0.00 ? 126 GLN A O    4  
ATOM   4950  C  CB   . GLN A 1 62 ? 0.431   -11.272 -5.319  1.00 0.00 ? 126 GLN A CB   4  
ATOM   4951  C  CG   . GLN A 1 62 ? -0.008  -11.225 -6.773  1.00 0.00 ? 126 GLN A CG   4  
ATOM   4952  C  CD   . GLN A 1 62 ? -1.104  -12.226 -7.084  1.00 0.00 ? 126 GLN A CD   4  
ATOM   4953  O  OE1  . GLN A 1 62 ? -2.176  -11.860 -7.566  1.00 0.00 ? 126 GLN A OE1  4  
ATOM   4954  N  NE2  . GLN A 1 62 ? -0.839  -13.498 -6.810  1.00 0.00 ? 126 GLN A NE2  4  
ATOM   4955  H  H    . GLN A 1 62 ? 2.973   -11.753 -5.053  1.00 0.00 ? 126 GLN A H    4  
ATOM   4956  H  HA   . GLN A 1 62 ? 1.391   -9.384  -5.623  1.00 0.00 ? 126 GLN A HA   4  
ATOM   4957  H  HB2  . GLN A 1 62 ? 0.821   -12.257 -5.114  1.00 0.00 ? 126 GLN A HB2  4  
ATOM   4958  H  HB3  . GLN A 1 62 ? -0.436  -11.101 -4.698  1.00 0.00 ? 126 GLN A HB3  4  
ATOM   4959  H  HG2  . GLN A 1 62 ? -0.375  -10.234 -6.994  1.00 0.00 ? 126 GLN A HG2  4  
ATOM   4960  H  HG3  . GLN A 1 62 ? 0.845   -11.440 -7.400  1.00 0.00 ? 126 GLN A HG3  4  
ATOM   4961  H  HE21 . GLN A 1 62 ? 0.037   -13.716 -6.427  1.00 0.00 ? 126 GLN A HE21 4  
ATOM   4962  H  HE22 . GLN A 1 62 ? -1.529  -14.166 -7.001  1.00 0.00 ? 126 GLN A HE22 4  
ATOM   4963  N  N    . TYR A 1 63 ? 1.337   -10.722 -2.599  1.00 0.00 ? 127 TYR A N    4  
ATOM   4964  C  CA   . TYR A 1 63 ? 1.175   -10.411 -1.183  1.00 0.00 ? 127 TYR A CA   4  
ATOM   4965  C  C    . TYR A 1 63 ? 1.930   -9.137  -0.815  1.00 0.00 ? 127 TYR A C    4  
ATOM   4966  O  O    . TYR A 1 63 ? 1.339   -8.163  -0.348  1.00 0.00 ? 127 TYR A O    4  
ATOM   4967  C  CB   . TYR A 1 63 ? 1.668   -11.576 -0.324  1.00 0.00 ? 127 TYR A CB   4  
ATOM   4968  C  CG   . TYR A 1 63 ? 1.491   -11.350 1.161   1.00 0.00 ? 127 TYR A CG   4  
ATOM   4969  C  CD1  . TYR A 1 63 ? 0.277   -11.611 1.783   1.00 0.00 ? 127 TYR A CD1  4  
ATOM   4970  C  CD2  . TYR A 1 63 ? 2.539   -10.878 1.941   1.00 0.00 ? 127 TYR A CD2  4  
ATOM   4971  C  CE1  . TYR A 1 63 ? 0.111   -11.405 3.139   1.00 0.00 ? 127 TYR A CE1  4  
ATOM   4972  C  CE2  . TYR A 1 63 ? 2.383   -10.671 3.298   1.00 0.00 ? 127 TYR A CE2  4  
ATOM   4973  C  CZ   . TYR A 1 63 ? 1.167   -10.936 3.892   1.00 0.00 ? 127 TYR A CZ   4  
ATOM   4974  O  OH   . TYR A 1 63 ? 1.005   -10.731 5.244   1.00 0.00 ? 127 TYR A OH   4  
ATOM   4975  H  H    . TYR A 1 63 ? 1.458   -11.655 -2.872  1.00 0.00 ? 127 TYR A H    4  
ATOM   4976  H  HA   . TYR A 1 63 ? 0.122   -10.258 -0.996  1.00 0.00 ? 127 TYR A HA   4  
ATOM   4977  H  HB2  . TYR A 1 63 ? 1.122   -12.467 -0.591  1.00 0.00 ? 127 TYR A HB2  4  
ATOM   4978  H  HB3  . TYR A 1 63 ? 2.720   -11.733 -0.513  1.00 0.00 ? 127 TYR A HB3  4  
ATOM   4979  H  HD1  . TYR A 1 63 ? -0.548  -11.979 1.190   1.00 0.00 ? 127 TYR A HD1  4  
ATOM   4980  H  HD2  . TYR A 1 63 ? 3.491   -10.672 1.473   1.00 0.00 ? 127 TYR A HD2  4  
ATOM   4981  H  HE1  . TYR A 1 63 ? -0.842  -11.613 3.605   1.00 0.00 ? 127 TYR A HE1  4  
ATOM   4982  H  HE2  . TYR A 1 63 ? 3.209   -10.303 3.888   1.00 0.00 ? 127 TYR A HE2  4  
ATOM   4983  H  HH   . TYR A 1 63 ? 1.774   -11.067 5.712   1.00 0.00 ? 127 TYR A HH   4  
ATOM   4984  N  N    . CYS A 1 64 ? 3.241   -9.151  -1.031  1.00 0.00 ? 128 CYS A N    4  
ATOM   4985  C  CA   . CYS A 1 64 ? 4.080   -7.999  -0.723  1.00 0.00 ? 128 CYS A CA   4  
ATOM   4986  C  C    . CYS A 1 64 ? 3.496   -6.725  -1.327  1.00 0.00 ? 128 CYS A C    4  
ATOM   4987  O  O    . CYS A 1 64 ? 3.471   -5.676  -0.683  1.00 0.00 ? 128 CYS A O    4  
ATOM   4988  C  CB   . CYS A 1 64 ? 5.500   -8.221  -1.247  1.00 0.00 ? 128 CYS A CB   4  
ATOM   4989  S  SG   . CYS A 1 64 ? 6.458   -9.449  -0.303  1.00 0.00 ? 128 CYS A SG   4  
ATOM   4990  H  H    . CYS A 1 64 ? 3.656   -9.957  -1.406  1.00 0.00 ? 128 CYS A H    4  
ATOM   4991  H  HA   . CYS A 1 64 ? 4.114   -7.891  0.350   1.00 0.00 ? 128 CYS A HA   4  
ATOM   4992  H  HB2  . CYS A 1 64 ? 5.448   -8.563  -2.271  1.00 0.00 ? 128 CYS A HB2  4  
ATOM   4993  H  HB3  . CYS A 1 64 ? 6.038   -7.286  -1.213  1.00 0.00 ? 128 CYS A HB3  4  
ATOM   4994  N  N    . ARG A 1 65 ? 3.027   -6.825  -2.566  1.00 0.00 ? 129 ARG A N    4  
ATOM   4995  C  CA   . ARG A 1 65 ? 2.445   -5.681  -3.257  1.00 0.00 ? 129 ARG A CA   4  
ATOM   4996  C  C    . ARG A 1 65 ? 1.287   -5.093  -2.456  1.00 0.00 ? 129 ARG A C    4  
ATOM   4997  O  O    . ARG A 1 65 ? 1.344   -3.946  -2.012  1.00 0.00 ? 129 ARG A O    4  
ATOM   4998  C  CB   . ARG A 1 65 ? 1.960   -6.092  -4.649  1.00 0.00 ? 129 ARG A CB   4  
ATOM   4999  C  CG   . ARG A 1 65 ? 2.031   -4.972  -5.674  1.00 0.00 ? 129 ARG A CG   4  
ATOM   5000  C  CD   . ARG A 1 65 ? 2.259   -5.514  -7.076  1.00 0.00 ? 129 ARG A CD   4  
ATOM   5001  N  NE   . ARG A 1 65 ? 1.005   -5.872  -7.735  1.00 0.00 ? 129 ARG A NE   4  
ATOM   5002  C  CZ   . ARG A 1 65 ? 0.916   -6.777  -8.703  1.00 0.00 ? 129 ARG A CZ   4  
ATOM   5003  N  NH1  . ARG A 1 65 ? 2.002   -7.413  -9.123  1.00 0.00 ? 129 ARG A NH1  4  
ATOM   5004  N  NH2  . ARG A 1 65 ? -0.260  -7.049  -9.253  1.00 0.00 ? 129 ARG A NH2  4  
ATOM   5005  H  H    . ARG A 1 65 ? 3.075   -7.688  -3.028  1.00 0.00 ? 129 ARG A H    4  
ATOM   5006  H  HA   . ARG A 1 65 ? 3.213   -4.930  -3.361  1.00 0.00 ? 129 ARG A HA   4  
ATOM   5007  H  HB2  . ARG A 1 65 ? 2.567   -6.912  -5.002  1.00 0.00 ? 129 ARG A HB2  4  
ATOM   5008  H  HB3  . ARG A 1 65 ? 0.933   -6.419  -4.576  1.00 0.00 ? 129 ARG A HB3  4  
ATOM   5009  H  HG2  . ARG A 1 65 ? 1.101   -4.422  -5.659  1.00 0.00 ? 129 ARG A HG2  4  
ATOM   5010  H  HG3  . ARG A 1 65 ? 2.846   -4.312  -5.416  1.00 0.00 ? 129 ARG A HG3  4  
ATOM   5011  H  HD2  . ARG A 1 65 ? 2.759   -4.758  -7.663  1.00 0.00 ? 129 ARG A HD2  4  
ATOM   5012  H  HD3  . ARG A 1 65 ? 2.884   -6.392  -7.011  1.00 0.00 ? 129 ARG A HD3  4  
ATOM   5013  H  HE   . ARG A 1 65 ? 0.191   -5.415  -7.440  1.00 0.00 ? 129 ARG A HE   4  
ATOM   5014  H  HH11 . ARG A 1 65 ? 2.889   -7.211  -8.710  1.00 0.00 ? 129 ARG A HH11 4  
ATOM   5015  H  HH12 . ARG A 1 65 ? 1.932   -8.094  -9.851  1.00 0.00 ? 129 ARG A HH12 4  
ATOM   5016  H  HH21 . ARG A 1 65 ? -1.081  -6.572  -8.939  1.00 0.00 ? 129 ARG A HH21 4  
ATOM   5017  H  HH22 . ARG A 1 65 ? -0.327  -7.730  -9.982  1.00 0.00 ? 129 ARG A HH22 4  
ATOM   5018  N  N    . PHE A 1 66 ? 0.237   -5.887  -2.274  1.00 0.00 ? 130 PHE A N    4  
ATOM   5019  C  CA   . PHE A 1 66 ? -0.935  -5.446  -1.528  1.00 0.00 ? 130 PHE A CA   4  
ATOM   5020  C  C    . PHE A 1 66 ? -0.533  -4.877  -0.170  1.00 0.00 ? 130 PHE A C    4  
ATOM   5021  O  O    . PHE A 1 66 ? -0.933  -3.771  0.193   1.00 0.00 ? 130 PHE A O    4  
ATOM   5022  C  CB   . PHE A 1 66 ? -1.912  -6.608  -1.337  1.00 0.00 ? 130 PHE A CB   4  
ATOM   5023  C  CG   . PHE A 1 66 ? -3.271  -6.177  -0.863  1.00 0.00 ? 130 PHE A CG   4  
ATOM   5024  C  CD1  . PHE A 1 66 ? -4.127  -5.489  -1.707  1.00 0.00 ? 130 PHE A CD1  4  
ATOM   5025  C  CD2  . PHE A 1 66 ? -3.691  -6.460  0.427   1.00 0.00 ? 130 PHE A CD2  4  
ATOM   5026  C  CE1  . PHE A 1 66 ? -5.379  -5.092  -1.275  1.00 0.00 ? 130 PHE A CE1  4  
ATOM   5027  C  CE2  . PHE A 1 66 ? -4.941  -6.065  0.864   1.00 0.00 ? 130 PHE A CE2  4  
ATOM   5028  C  CZ   . PHE A 1 66 ? -5.786  -5.379  0.013   1.00 0.00 ? 130 PHE A CZ   4  
ATOM   5029  H  H    . PHE A 1 66 ? 0.251   -6.792  -2.652  1.00 0.00 ? 130 PHE A H    4  
ATOM   5030  H  HA   . PHE A 1 66 ? -1.419  -4.670  -2.101  1.00 0.00 ? 130 PHE A HA   4  
ATOM   5031  H  HB2  . PHE A 1 66 ? -2.037  -7.122  -2.278  1.00 0.00 ? 130 PHE A HB2  4  
ATOM   5032  H  HB3  . PHE A 1 66 ? -1.507  -7.293  -0.607  1.00 0.00 ? 130 PHE A HB3  4  
ATOM   5033  H  HD1  . PHE A 1 66 ? -3.809  -5.264  -2.716  1.00 0.00 ? 130 PHE A HD1  4  
ATOM   5034  H  HD2  . PHE A 1 66 ? -3.032  -6.995  1.094   1.00 0.00 ? 130 PHE A HD2  4  
ATOM   5035  H  HE1  . PHE A 1 66 ? -6.036  -4.556  -1.943  1.00 0.00 ? 130 PHE A HE1  4  
ATOM   5036  H  HE2  . PHE A 1 66 ? -5.257  -6.291  1.872   1.00 0.00 ? 130 PHE A HE2  4  
ATOM   5037  H  HZ   . PHE A 1 66 ? -6.763  -5.071  0.353   1.00 0.00 ? 130 PHE A HZ   4  
ATOM   5038  N  N    . GLN A 1 67 ? 0.260   -5.641  0.574   1.00 0.00 ? 131 GLN A N    4  
ATOM   5039  C  CA   . GLN A 1 67 ? 0.716   -5.213  1.891   1.00 0.00 ? 131 GLN A CA   4  
ATOM   5040  C  C    . GLN A 1 67 ? 1.199   -3.767  1.857   1.00 0.00 ? 131 GLN A C    4  
ATOM   5041  O  O    . GLN A 1 67 ? 0.749   -2.933  2.643   1.00 0.00 ? 131 GLN A O    4  
ATOM   5042  C  CB   . GLN A 1 67 ? 1.838   -6.127  2.387   1.00 0.00 ? 131 GLN A CB   4  
ATOM   5043  C  CG   . GLN A 1 67 ? 1.338   -7.410  3.032   1.00 0.00 ? 131 GLN A CG   4  
ATOM   5044  C  CD   . GLN A 1 67 ? 0.407   -7.151  4.200   1.00 0.00 ? 131 GLN A CD   4  
ATOM   5045  O  OE1  . GLN A 1 67 ? -0.782  -6.893  4.016   1.00 0.00 ? 131 GLN A OE1  4  
ATOM   5046  N  NE2  . GLN A 1 67 ? 0.945   -7.221  5.412   1.00 0.00 ? 131 GLN A NE2  4  
ATOM   5047  H  H    . GLN A 1 67 ? 0.545   -6.512  0.229   1.00 0.00 ? 131 GLN A H    4  
ATOM   5048  H  HA   . GLN A 1 67 ? -0.120  -5.285  2.570   1.00 0.00 ? 131 GLN A HA   4  
ATOM   5049  H  HB2  . GLN A 1 67 ? 2.467   -6.391  1.551   1.00 0.00 ? 131 GLN A HB2  4  
ATOM   5050  H  HB3  . GLN A 1 67 ? 2.428   -5.590  3.116   1.00 0.00 ? 131 GLN A HB3  4  
ATOM   5051  H  HG2  . GLN A 1 67 ? 0.807   -7.987  2.290   1.00 0.00 ? 131 GLN A HG2  4  
ATOM   5052  H  HG3  . GLN A 1 67 ? 2.188   -7.974  3.386   1.00 0.00 ? 131 GLN A HG3  4  
ATOM   5053  H  HE21 . GLN A 1 67 ? 1.900   -7.430  5.483   1.00 0.00 ? 131 GLN A HE21 4  
ATOM   5054  H  HE22 . GLN A 1 67 ? 0.366   -7.057  6.185   1.00 0.00 ? 131 GLN A HE22 4  
ATOM   5055  N  N    . LYS A 1 68 ? 2.118   -3.477  0.943   1.00 0.00 ? 132 LYS A N    4  
ATOM   5056  C  CA   . LYS A 1 68 ? 2.662   -2.131  0.805   1.00 0.00 ? 132 LYS A CA   4  
ATOM   5057  C  C    . LYS A 1 68 ? 1.548   -1.089  0.823   1.00 0.00 ? 132 LYS A C    4  
ATOM   5058  O  O    . LYS A 1 68 ? 1.625   -0.098  1.550   1.00 0.00 ? 132 LYS A O    4  
ATOM   5059  C  CB   . LYS A 1 68 ? 3.464   -2.014  -0.494  1.00 0.00 ? 132 LYS A CB   4  
ATOM   5060  C  CG   . LYS A 1 68 ? 4.365   -0.792  -0.544  1.00 0.00 ? 132 LYS A CG   4  
ATOM   5061  C  CD   . LYS A 1 68 ? 5.552   -1.012  -1.466  1.00 0.00 ? 132 LYS A CD   4  
ATOM   5062  C  CE   . LYS A 1 68 ? 6.417   0.235   -1.568  1.00 0.00 ? 132 LYS A CE   4  
ATOM   5063  N  NZ   . LYS A 1 68 ? 7.779   -0.076  -2.085  1.00 0.00 ? 132 LYS A NZ   4  
ATOM   5064  H  H    . LYS A 1 68 ? 2.437   -4.185  0.344   1.00 0.00 ? 132 LYS A H    4  
ATOM   5065  H  HA   . LYS A 1 68 ? 3.320   -1.952  1.642   1.00 0.00 ? 132 LYS A HA   4  
ATOM   5066  H  HB2  . LYS A 1 68 ? 4.079   -2.894  -0.604  1.00 0.00 ? 132 LYS A HB2  4  
ATOM   5067  H  HB3  . LYS A 1 68 ? 2.774   -1.961  -1.324  1.00 0.00 ? 132 LYS A HB3  4  
ATOM   5068  H  HG2  . LYS A 1 68 ? 3.794   0.051   -0.904  1.00 0.00 ? 132 LYS A HG2  4  
ATOM   5069  H  HG3  . LYS A 1 68 ? 4.728   -0.583  0.453   1.00 0.00 ? 132 LYS A HG3  4  
ATOM   5070  H  HD2  . LYS A 1 68 ? 6.152   -1.822  -1.079  1.00 0.00 ? 132 LYS A HD2  4  
ATOM   5071  H  HD3  . LYS A 1 68 ? 5.189   -1.270  -2.451  1.00 0.00 ? 132 LYS A HD3  4  
ATOM   5072  H  HE2  . LYS A 1 68 ? 5.939   0.935   -2.236  1.00 0.00 ? 132 LYS A HE2  4  
ATOM   5073  H  HE3  . LYS A 1 68 ? 6.506   0.677   -0.587  1.00 0.00 ? 132 LYS A HE3  4  
ATOM   5074  H  HZ1  . LYS A 1 68 ? 7.769   -0.106  -3.124  1.00 0.00 ? 132 LYS A HZ1  4  
ATOM   5075  H  HZ2  . LYS A 1 68 ? 8.095   -0.999  -1.725  1.00 0.00 ? 132 LYS A HZ2  4  
ATOM   5076  H  HZ3  . LYS A 1 68 ? 8.453   0.653   -1.776  1.00 0.00 ? 132 LYS A HZ3  4  
ATOM   5077  N  N    . CYS A 1 69 ? 0.515   -1.320  0.022   1.00 0.00 ? 133 CYS A N    4  
ATOM   5078  C  CA   . CYS A 1 69 ? -0.616  -0.401  -0.053  1.00 0.00 ? 133 CYS A CA   4  
ATOM   5079  C  C    . CYS A 1 69 ? -1.167  -0.103  1.337   1.00 0.00 ? 133 CYS A C    4  
ATOM   5080  O  O    . CYS A 1 69 ? -1.304  1.058   1.726   1.00 0.00 ? 133 CYS A O    4  
ATOM   5081  C  CB   . CYS A 1 69 ? -1.718  -0.987  -0.937  1.00 0.00 ? 133 CYS A CB   4  
ATOM   5082  S  SG   . CYS A 1 69 ? -1.245  -1.188  -2.671  1.00 0.00 ? 133 CYS A SG   4  
ATOM   5083  H  H    . CYS A 1 69 ? 0.511   -2.128  -0.534  1.00 0.00 ? 133 CYS A H    4  
ATOM   5084  H  HA   . CYS A 1 69 ? -0.264  0.520   -0.493  1.00 0.00 ? 133 CYS A HA   4  
ATOM   5085  H  HB2  . CYS A 1 69 ? -1.994  -1.960  -0.558  1.00 0.00 ? 133 CYS A HB2  4  
ATOM   5086  H  HB3  . CYS A 1 69 ? -2.579  -0.337  -0.903  1.00 0.00 ? 133 CYS A HB3  4  
ATOM   5087  H  HG   . CYS A 1 69 ? -0.879  -2.448  -2.851  1.00 0.00 ? 133 CYS A HG   4  
ATOM   5088  N  N    . LEU A 1 70 ? -1.482  -1.157  2.082   1.00 0.00 ? 134 LEU A N    4  
ATOM   5089  C  CA   . LEU A 1 70 ? -2.020  -1.008  3.429   1.00 0.00 ? 134 LEU A CA   4  
ATOM   5090  C  C    . LEU A 1 70 ? -1.159  -0.061  4.258   1.00 0.00 ? 134 LEU A C    4  
ATOM   5091  O  O    . LEU A 1 70 ? -1.666  0.876   4.875   1.00 0.00 ? 134 LEU A O    4  
ATOM   5092  C  CB   . LEU A 1 70 ? -2.107  -2.371  4.118   1.00 0.00 ? 134 LEU A CB   4  
ATOM   5093  C  CG   . LEU A 1 70 ? -3.034  -3.396  3.463   1.00 0.00 ? 134 LEU A CG   4  
ATOM   5094  C  CD1  . LEU A 1 70 ? -2.892  -4.752  4.138   1.00 0.00 ? 134 LEU A CD1  4  
ATOM   5095  C  CD2  . LEU A 1 70 ? -4.478  -2.920  3.516   1.00 0.00 ? 134 LEU A CD2  4  
ATOM   5096  H  H    . LEU A 1 70 ? -1.350  -2.057  1.717   1.00 0.00 ? 134 LEU A H    4  
ATOM   5097  H  HA   . LEU A 1 70 ? -3.013  -0.592  3.346   1.00 0.00 ? 134 LEU A HA   4  
ATOM   5098  H  HB2  . LEU A 1 70 ? -1.114  -2.792  4.144   1.00 0.00 ? 134 LEU A HB2  4  
ATOM   5099  H  HB3  . LEU A 1 70 ? -2.454  -2.208  5.129   1.00 0.00 ? 134 LEU A HB3  4  
ATOM   5100  H  HG   . LEU A 1 70 ? -2.756  -3.511  2.425   1.00 0.00 ? 134 LEU A HG   4  
ATOM   5101  H  HD11 . LEU A 1 70 ? -3.276  -5.521  3.486   1.00 0.00 ? 134 LEU A HD11 4  
ATOM   5102  H  HD12 . LEU A 1 70 ? -3.450  -4.753  5.063   1.00 0.00 ? 134 LEU A HD12 4  
ATOM   5103  H  HD13 . LEU A 1 70 ? -1.850  -4.943  4.347   1.00 0.00 ? 134 LEU A HD13 4  
ATOM   5104  H  HD21 . LEU A 1 70 ? -5.136  -3.737  3.258   1.00 0.00 ? 134 LEU A HD21 4  
ATOM   5105  H  HD22 . LEU A 1 70 ? -4.616  -2.111  2.815   1.00 0.00 ? 134 LEU A HD22 4  
ATOM   5106  H  HD23 . LEU A 1 70 ? -4.707  -2.574  4.514   1.00 0.00 ? 134 LEU A HD23 4  
ATOM   5107  N  N    . ALA A 1 71 ? 0.146   -0.310  4.267   1.00 0.00 ? 135 ALA A N    4  
ATOM   5108  C  CA   . ALA A 1 71 ? 1.079   0.523   5.016   1.00 0.00 ? 135 ALA A CA   4  
ATOM   5109  C  C    . ALA A 1 71 ? 1.089   1.951   4.483   1.00 0.00 ? 135 ALA A C    4  
ATOM   5110  O  O    . ALA A 1 71 ? 1.204   2.910   5.248   1.00 0.00 ? 135 ALA A O    4  
ATOM   5111  C  CB   . ALA A 1 71 ? 2.478   -0.072  4.963   1.00 0.00 ? 135 ALA A CB   4  
ATOM   5112  H  H    . ALA A 1 71 ? 0.491   -1.072  3.755   1.00 0.00 ? 135 ALA A H    4  
ATOM   5113  H  HA   . ALA A 1 71 ? 0.759   0.536   6.048   1.00 0.00 ? 135 ALA A HA   4  
ATOM   5114  H  HB1  . ALA A 1 71 ? 2.515   -0.837  4.201   1.00 0.00 ? 135 ALA A HB1  4  
ATOM   5115  H  HB2  . ALA A 1 71 ? 3.190   0.705   4.728   1.00 0.00 ? 135 ALA A HB2  4  
ATOM   5116  H  HB3  . ALA A 1 71 ? 2.721   -0.506  5.921   1.00 0.00 ? 135 ALA A HB3  4  
ATOM   5117  N  N    . LEU A 1 72 ? 0.968   2.088   3.167   1.00 0.00 ? 136 LEU A N    4  
ATOM   5118  C  CA   . LEU A 1 72 ? 0.964   3.401   2.531   1.00 0.00 ? 136 LEU A CA   4  
ATOM   5119  C  C    . LEU A 1 72 ? -0.181  4.259   3.061   1.00 0.00 ? 136 LEU A C    4  
ATOM   5120  O  O    . LEU A 1 72 ? -0.099  5.486   3.067   1.00 0.00 ? 136 LEU A O    4  
ATOM   5121  C  CB   . LEU A 1 72 ? 0.845   3.254   1.013   1.00 0.00 ? 136 LEU A CB   4  
ATOM   5122  C  CG   . LEU A 1 72 ? 2.086   2.727   0.291   1.00 0.00 ? 136 LEU A CG   4  
ATOM   5123  C  CD1  . LEU A 1 72 ? 1.767   2.419   -1.163  1.00 0.00 ? 136 LEU A CD1  4  
ATOM   5124  C  CD2  . LEU A 1 72 ? 3.225   3.732   0.388   1.00 0.00 ? 136 LEU A CD2  4  
ATOM   5125  H  H    . LEU A 1 72 ? 0.880   1.288   2.609   1.00 0.00 ? 136 LEU A H    4  
ATOM   5126  H  HA   . LEU A 1 72 ? 1.900   3.886   2.766   1.00 0.00 ? 136 LEU A HA   4  
ATOM   5127  H  HB2  . LEU A 1 72 ? 0.032   2.575   0.809   1.00 0.00 ? 136 LEU A HB2  4  
ATOM   5128  H  HB3  . LEU A 1 72 ? 0.611   4.227   0.605   1.00 0.00 ? 136 LEU A HB3  4  
ATOM   5129  H  HG   . LEU A 1 72 ? 2.407   1.809   0.763   1.00 0.00 ? 136 LEU A HG   4  
ATOM   5130  H  HD11 . LEU A 1 72 ? 1.007   3.099   -1.517  1.00 0.00 ? 136 LEU A HD11 4  
ATOM   5131  H  HD12 . LEU A 1 72 ? 1.408   1.404   -1.246  1.00 0.00 ? 136 LEU A HD12 4  
ATOM   5132  H  HD13 . LEU A 1 72 ? 2.660   2.534   -1.760  1.00 0.00 ? 136 LEU A HD13 4  
ATOM   5133  H  HD21 . LEU A 1 72 ? 4.091   3.345   -0.130  1.00 0.00 ? 136 LEU A HD21 4  
ATOM   5134  H  HD22 . LEU A 1 72 ? 3.471   3.898   1.426   1.00 0.00 ? 136 LEU A HD22 4  
ATOM   5135  H  HD23 . LEU A 1 72 ? 2.922   4.665   -0.064  1.00 0.00 ? 136 LEU A HD23 4  
ATOM   5136  N  N    . GLY A 1 73 ? -1.248  3.603   3.508   1.00 0.00 ? 137 GLY A N    4  
ATOM   5137  C  CA   . GLY A 1 73 ? -2.393  4.321   4.036   1.00 0.00 ? 137 GLY A CA   4  
ATOM   5138  C  C    . GLY A 1 73 ? -3.580  4.292   3.095   1.00 0.00 ? 137 GLY A C    4  
ATOM   5139  O  O    . GLY A 1 73 ? -4.471  5.136   3.182   1.00 0.00 ? 137 GLY A O    4  
ATOM   5140  H  H    . GLY A 1 73 ? -1.258  2.623   3.478   1.00 0.00 ? 137 GLY A H    4  
ATOM   5141  H  HA2  . GLY A 1 73 ? -2.681  3.877   4.977   1.00 0.00 ? 137 GLY A HA2  4  
ATOM   5142  H  HA3  . GLY A 1 73 ? -2.110  5.350   4.207   1.00 0.00 ? 137 GLY A HA3  4  
ATOM   5143  N  N    . MET A 1 74 ? -3.593  3.317   2.191   1.00 0.00 ? 138 MET A N    4  
ATOM   5144  C  CA   . MET A 1 74 ? -4.680  3.182   1.229   1.00 0.00 ? 138 MET A CA   4  
ATOM   5145  C  C    . MET A 1 74 ? -5.972  2.763   1.924   1.00 0.00 ? 138 MET A C    4  
ATOM   5146  O  O    . MET A 1 74 ? -6.096  1.634   2.396   1.00 0.00 ? 138 MET A O    4  
ATOM   5147  C  CB   . MET A 1 74 ? -4.313  2.159   0.152   1.00 0.00 ? 138 MET A CB   4  
ATOM   5148  C  CG   . MET A 1 74 ? -3.233  2.642   -0.802  1.00 0.00 ? 138 MET A CG   4  
ATOM   5149  S  SD   . MET A 1 74 ? -3.220  1.729   -2.357  1.00 0.00 ? 138 MET A SD   4  
ATOM   5150  C  CE   . MET A 1 74 ? -2.786  3.030   -3.509  1.00 0.00 ? 138 MET A CE   4  
ATOM   5151  H  H    . MET A 1 74 ? -2.854  2.673   2.170   1.00 0.00 ? 138 MET A H    4  
ATOM   5152  H  HA   . MET A 1 74 ? -4.831  4.143   0.762   1.00 0.00 ? 138 MET A HA   4  
ATOM   5153  H  HB2  . MET A 1 74 ? -3.961  1.258   0.633   1.00 0.00 ? 138 MET A HB2  4  
ATOM   5154  H  HB3  . MET A 1 74 ? -5.196  1.928   -0.425  1.00 0.00 ? 138 MET A HB3  4  
ATOM   5155  H  HG2  . MET A 1 74 ? -3.401  3.687   -1.016  1.00 0.00 ? 138 MET A HG2  4  
ATOM   5156  H  HG3  . MET A 1 74 ? -2.271  2.525   -0.324  1.00 0.00 ? 138 MET A HG3  4  
ATOM   5157  H  HE1  . MET A 1 74 ? -3.109  2.753   -4.502  1.00 0.00 ? 138 MET A HE1  4  
ATOM   5158  H  HE2  . MET A 1 74 ? -3.273  3.948   -3.216  1.00 0.00 ? 138 MET A HE2  4  
ATOM   5159  H  HE3  . MET A 1 74 ? -1.716  3.172   -3.505  1.00 0.00 ? 138 MET A HE3  4  
ATOM   5160  N  N    . SER A 1 75 ? -6.931  3.682   1.984   1.00 0.00 ? 139 SER A N    4  
ATOM   5161  C  CA   . SER A 1 75 ? -8.212  3.410   2.625   1.00 0.00 ? 139 SER A CA   4  
ATOM   5162  C  C    . SER A 1 75 ? -9.155  2.686   1.669   1.00 0.00 ? 139 SER A C    4  
ATOM   5163  O  O    . SER A 1 75 ? -9.308  3.080   0.512   1.00 0.00 ? 139 SER A O    4  
ATOM   5164  C  CB   . SER A 1 75 ? -8.854  4.713   3.104   1.00 0.00 ? 139 SER A CB   4  
ATOM   5165  O  OG   . SER A 1 75 ? -7.951  5.466   3.894   1.00 0.00 ? 139 SER A OG   4  
ATOM   5166  H  H    . SER A 1 75 ? -6.772  4.565   1.589   1.00 0.00 ? 139 SER A H    4  
ATOM   5167  H  HA   . SER A 1 75 ? -8.027  2.775   3.479   1.00 0.00 ? 139 SER A HA   4  
ATOM   5168  H  HB2  . SER A 1 75 ? -9.144  5.304   2.248   1.00 0.00 ? 139 SER A HB2  4  
ATOM   5169  H  HB3  . SER A 1 75 ? -9.728  4.484   3.696   1.00 0.00 ? 139 SER A HB3  4  
ATOM   5170  H  HG   . SER A 1 75 ? -7.576  4.904   4.577   1.00 0.00 ? 139 SER A HG   4  
ATOM   5171  N  N    . HIS A 1 76 ? -9.786  1.624   2.160   1.00 0.00 ? 140 HIS A N    4  
ATOM   5172  C  CA   . HIS A 1 76 ? -10.716 0.844   1.351   1.00 0.00 ? 140 HIS A CA   4  
ATOM   5173  C  C    . HIS A 1 76 ? -12.017 1.609   1.129   1.00 0.00 ? 140 HIS A C    4  
ATOM   5174  O  O    . HIS A 1 76 ? -12.461 1.783   -0.005  1.00 0.00 ? 140 HIS A O    4  
ATOM   5175  C  CB   . HIS A 1 76 ? -11.007 -0.498  2.022   1.00 0.00 ? 140 HIS A CB   4  
ATOM   5176  C  CG   . HIS A 1 76 ? -9.781  -1.317  2.280   1.00 0.00 ? 140 HIS A CG   4  
ATOM   5177  N  ND1  . HIS A 1 76 ? -8.638  -1.225  1.514   1.00 0.00 ? 140 HIS A ND1  4  
ATOM   5178  C  CD2  . HIS A 1 76 ? -9.521  -2.247  3.229   1.00 0.00 ? 140 HIS A CD2  4  
ATOM   5179  C  CE1  . HIS A 1 76 ? -7.730  -2.064  1.978   1.00 0.00 ? 140 HIS A CE1  4  
ATOM   5180  N  NE2  . HIS A 1 76 ? -8.240  -2.696  3.020   1.00 0.00 ? 140 HIS A NE2  4  
ATOM   5181  H  H    . HIS A 1 76 ? -9.623  1.359   3.090   1.00 0.00 ? 140 HIS A H    4  
ATOM   5182  H  HA   . HIS A 1 76 ? -10.251 0.665   0.393   1.00 0.00 ? 140 HIS A HA   4  
ATOM   5183  H  HB2  . HIS A 1 76 ? -11.493 -0.321  2.970   1.00 0.00 ? 140 HIS A HB2  4  
ATOM   5184  H  HB3  . HIS A 1 76 ? -11.665 -1.075  1.388   1.00 0.00 ? 140 HIS A HB3  4  
ATOM   5185  H  HD1  . HIS A 1 76 ? -8.513  -0.634  0.743   1.00 0.00 ? 140 HIS A HD1  4  
ATOM   5186  H  HD2  . HIS A 1 76 ? -10.196 -2.576  4.007   1.00 0.00 ? 140 HIS A HD2  4  
ATOM   5187  H  HE1  . HIS A 1 76 ? -6.738  -2.208  1.576   1.00 0.00 ? 140 HIS A HE1  4  
ATOM   5188  N  N    . ASN A 1 77 ? -12.624 2.064   2.221   1.00 0.00 ? 141 ASN A N    4  
ATOM   5189  C  CA   . ASN A 1 77 ? -13.875 2.809   2.146   1.00 0.00 ? 141 ASN A CA   4  
ATOM   5190  C  C    . ASN A 1 77 ? -13.856 3.788   0.976   1.00 0.00 ? 141 ASN A C    4  
ATOM   5191  O  O    . ASN A 1 77 ? -14.894 4.088   0.387   1.00 0.00 ? 141 ASN A O    4  
ATOM   5192  C  CB   . ASN A 1 77 ? -14.123 3.563   3.454   1.00 0.00 ? 141 ASN A CB   4  
ATOM   5193  C  CG   . ASN A 1 77 ? -15.451 4.296   3.456   1.00 0.00 ? 141 ASN A CG   4  
ATOM   5194  O  OD1  . ASN A 1 77 ? -15.818 4.942   2.475   1.00 0.00 ? 141 ASN A OD1  4  
ATOM   5195  N  ND2  . ASN A 1 77 ? -16.179 4.197   4.563   1.00 0.00 ? 141 ASN A ND2  4  
ATOM   5196  H  H    . ASN A 1 77 ? -12.221 1.894   3.098   1.00 0.00 ? 141 ASN A H    4  
ATOM   5197  H  HA   . ASN A 1 77 ? -14.675 2.099   1.993   1.00 0.00 ? 141 ASN A HA   4  
ATOM   5198  H  HB2  . ASN A 1 77 ? -14.120 2.860   4.274   1.00 0.00 ? 141 ASN A HB2  4  
ATOM   5199  H  HB3  . ASN A 1 77 ? -13.334 4.286   3.601   1.00 0.00 ? 141 ASN A HB3  4  
ATOM   5200  H  HD21 . ASN A 1 77 ? -15.823 3.665   5.305   1.00 0.00 ? 141 ASN A HD21 4  
ATOM   5201  H  HD22 . ASN A 1 77 ? -17.042 4.660   4.591   1.00 0.00 ? 141 ASN A HD22 4  
ATOM   5202  N  N    . ALA A 1 78 ? -12.668 4.283   0.646   1.00 0.00 ? 142 ALA A N    4  
ATOM   5203  C  CA   . ALA A 1 78 ? -12.512 5.226   -0.455  1.00 0.00 ? 142 ALA A CA   4  
ATOM   5204  C  C    . ALA A 1 78 ? -13.154 4.691   -1.731  1.00 0.00 ? 142 ALA A C    4  
ATOM   5205  O  O    . ALA A 1 78 ? -13.852 5.419   -2.437  1.00 0.00 ? 142 ALA A O    4  
ATOM   5206  C  CB   . ALA A 1 78 ? -11.039 5.526   -0.688  1.00 0.00 ? 142 ALA A CB   4  
ATOM   5207  H  H    . ALA A 1 78 ? -11.877 4.006   1.153   1.00 0.00 ? 142 ALA A H    4  
ATOM   5208  H  HA   . ALA A 1 78 ? -13.002 6.148   -0.176  1.00 0.00 ? 142 ALA A HA   4  
ATOM   5209  H  HB1  . ALA A 1 78 ? -10.464 5.187   0.160   1.00 0.00 ? 142 ALA A HB1  4  
ATOM   5210  H  HB2  . ALA A 1 78 ? -10.705 5.013   -1.578  1.00 0.00 ? 142 ALA A HB2  4  
ATOM   5211  H  HB3  . ALA A 1 78 ? -10.904 6.590   -0.814  1.00 0.00 ? 142 ALA A HB3  4  
ATOM   5212  N  N    . ILE A 1 79 ? -12.912 3.417   -2.020  1.00 0.00 ? 143 ILE A N    4  
ATOM   5213  C  CA   . ILE A 1 79 ? -13.467 2.787   -3.211  1.00 0.00 ? 143 ILE A CA   4  
ATOM   5214  C  C    . ILE A 1 79 ? -14.845 3.350   -3.540  1.00 0.00 ? 143 ILE A C    4  
ATOM   5215  O  O    . ILE A 1 79 ? -15.839 3.002   -2.902  1.00 0.00 ? 143 ILE A O    4  
ATOM   5216  C  CB   . ILE A 1 79 ? -13.577 1.260   -3.040  1.00 0.00 ? 143 ILE A CB   4  
ATOM   5217  C  CG1  . ILE A 1 79 ? -12.189 0.644   -2.855  1.00 0.00 ? 143 ILE A CG1  4  
ATOM   5218  C  CG2  . ILE A 1 79 ? -14.281 0.642   -4.239  1.00 0.00 ? 143 ILE A CG2  4  
ATOM   5219  C  CD1  . ILE A 1 79 ? -11.447 0.425   -4.155  1.00 0.00 ? 143 ILE A CD1  4  
ATOM   5220  H  H    . ILE A 1 79 ? -12.348 2.889   -1.418  1.00 0.00 ? 143 ILE A H    4  
ATOM   5221  H  HA   . ILE A 1 79 ? -12.801 2.989   -4.037  1.00 0.00 ? 143 ILE A HA   4  
ATOM   5222  H  HB   . ILE A 1 79 ? -14.172 1.060   -2.162  1.00 0.00 ? 143 ILE A HB   4  
ATOM   5223  H  HG12 . ILE A 1 79 ? -11.591 1.297   -2.239  1.00 0.00 ? 143 ILE A HG12 4  
ATOM   5224  H  HG13 . ILE A 1 79 ? -12.290 -0.313  -2.364  1.00 0.00 ? 143 ILE A HG13 4  
ATOM   5225  H  HG21 . ILE A 1 79 ? -13.635 0.695   -5.102  1.00 0.00 ? 143 ILE A HG21 4  
ATOM   5226  H  HG22 . ILE A 1 79 ? -14.513 -0.391  -4.027  1.00 0.00 ? 143 ILE A HG22 4  
ATOM   5227  H  HG23 . ILE A 1 79 ? -15.194 1.182   -4.438  1.00 0.00 ? 143 ILE A HG23 4  
ATOM   5228  H  HD11 . ILE A 1 79 ? -11.659 1.240   -4.832  1.00 0.00 ? 143 ILE A HD11 4  
ATOM   5229  H  HD12 . ILE A 1 79 ? -10.385 0.386   -3.962  1.00 0.00 ? 143 ILE A HD12 4  
ATOM   5230  H  HD13 . ILE A 1 79 ? -11.767 -0.505  -4.600  1.00 0.00 ? 143 ILE A HD13 4  
ATOM   5231  N  N    . ARG A 1 80 ? -14.898 4.223   -4.541  1.00 0.00 ? 144 ARG A N    4  
ATOM   5232  C  CA   . ARG A 1 80 ? -16.155 4.835   -4.956  1.00 0.00 ? 144 ARG A CA   4  
ATOM   5233  C  C    . ARG A 1 80 ? -16.140 5.148   -6.450  1.00 0.00 ? 144 ARG A C    4  
ATOM   5234  O  O    . ARG A 1 80 ? -15.083 5.389   -7.033  1.00 0.00 ? 144 ARG A O    4  
ATOM   5235  C  CB   . ARG A 1 80 ? -16.411 6.115   -4.158  1.00 0.00 ? 144 ARG A CB   4  
ATOM   5236  C  CG   . ARG A 1 80 ? -15.406 7.220   -4.440  1.00 0.00 ? 144 ARG A CG   4  
ATOM   5237  C  CD   . ARG A 1 80 ? -15.985 8.591   -4.129  1.00 0.00 ? 144 ARG A CD   4  
ATOM   5238  N  NE   . ARG A 1 80 ? -14.946 9.556   -3.778  1.00 0.00 ? 144 ARG A NE   4  
ATOM   5239  C  CZ   . ARG A 1 80 ? -14.219 9.483   -2.669  1.00 0.00 ? 144 ARG A CZ   4  
ATOM   5240  N  NH1  . ARG A 1 80 ? -14.416 8.494   -1.807  1.00 0.00 ? 144 ARG A NH1  4  
ATOM   5241  N  NH2  . ARG A 1 80 ? -13.293 10.399  -2.419  1.00 0.00 ? 144 ARG A NH2  4  
ATOM   5242  H  H    . ARG A 1 80 ? -14.072 4.461   -5.012  1.00 0.00 ? 144 ARG A H    4  
ATOM   5243  H  HA   . ARG A 1 80 ? -16.949 4.131   -4.756  1.00 0.00 ? 144 ARG A HA   4  
ATOM   5244  H  HB2  . ARG A 1 80 ? -17.397 6.484   -4.400  1.00 0.00 ? 144 ARG A HB2  4  
ATOM   5245  H  HB3  . ARG A 1 80 ? -16.371 5.882   -3.105  1.00 0.00 ? 144 ARG A HB3  4  
ATOM   5246  H  HG2  . ARG A 1 80 ? -14.531 7.063   -3.827  1.00 0.00 ? 144 ARG A HG2  4  
ATOM   5247  H  HG3  . ARG A 1 80 ? -15.129 7.183   -5.483  1.00 0.00 ? 144 ARG A HG3  4  
ATOM   5248  H  HD2  . ARG A 1 80 ? -16.516 8.949   -4.998  1.00 0.00 ? 144 ARG A HD2  4  
ATOM   5249  H  HD3  . ARG A 1 80 ? -16.671 8.498   -3.301  1.00 0.00 ? 144 ARG A HD3  4  
ATOM   5250  H  HE   . ARG A 1 80 ? -14.784 10.295  -4.401  1.00 0.00 ? 144 ARG A HE   4  
ATOM   5251  H  HH11 . ARG A 1 80 ? -15.113 7.802   -1.993  1.00 0.00 ? 144 ARG A HH11 4  
ATOM   5252  H  HH12 . ARG A 1 80 ? -13.867 8.441   -0.973  1.00 0.00 ? 144 ARG A HH12 4  
ATOM   5253  H  HH21 . ARG A 1 80 ? -13.141 11.146  -3.066  1.00 0.00 ? 144 ARG A HH21 4  
ATOM   5254  H  HH22 . ARG A 1 80 ? -12.746 10.343  -1.584  1.00 0.00 ? 144 ARG A HH22 4  
ATOM   5255  N  N    . PHE A 1 81 ? -17.319 5.142   -7.062  1.00 0.00 ? 145 PHE A N    4  
ATOM   5256  C  CA   . PHE A 1 81 ? -17.442 5.424   -8.487  1.00 0.00 ? 145 PHE A CA   4  
ATOM   5257  C  C    . PHE A 1 81 ? -18.191 6.733   -8.720  1.00 0.00 ? 145 PHE A C    4  
ATOM   5258  O  O    . PHE A 1 81 ? -19.394 6.736   -8.978  1.00 0.00 ? 145 PHE A O    4  
ATOM   5259  C  CB   . PHE A 1 81 ? -18.165 4.277   -9.195  1.00 0.00 ? 145 PHE A CB   4  
ATOM   5260  C  CG   . PHE A 1 81 ? -18.376 4.515   -10.663 1.00 0.00 ? 145 PHE A CG   4  
ATOM   5261  C  CD1  . PHE A 1 81 ? -17.304 4.800   -11.493 1.00 0.00 ? 145 PHE A CD1  4  
ATOM   5262  C  CD2  . PHE A 1 81 ? -19.646 4.456   -11.213 1.00 0.00 ? 145 PHE A CD2  4  
ATOM   5263  C  CE1  . PHE A 1 81 ? -17.494 5.020   -12.844 1.00 0.00 ? 145 PHE A CE1  4  
ATOM   5264  C  CE2  . PHE A 1 81 ? -19.843 4.675   -12.563 1.00 0.00 ? 145 PHE A CE2  4  
ATOM   5265  C  CZ   . PHE A 1 81 ? -18.765 4.959   -13.380 1.00 0.00 ? 145 PHE A CZ   4  
ATOM   5266  H  H    . PHE A 1 81 ? -18.126 4.943   -6.542  1.00 0.00 ? 145 PHE A H    4  
ATOM   5267  H  HA   . PHE A 1 81 ? -16.446 5.515   -8.893  1.00 0.00 ? 145 PHE A HA   4  
ATOM   5268  H  HB2  . PHE A 1 81 ? -17.585 3.373   -9.087  1.00 0.00 ? 145 PHE A HB2  4  
ATOM   5269  H  HB3  . PHE A 1 81 ? -19.133 4.135   -8.738  1.00 0.00 ? 145 PHE A HB3  4  
ATOM   5270  H  HD1  . PHE A 1 81 ? -16.308 4.849   -11.075 1.00 0.00 ? 145 PHE A HD1  4  
ATOM   5271  H  HD2  . PHE A 1 81 ? -20.490 4.236   -10.576 1.00 0.00 ? 145 PHE A HD2  4  
ATOM   5272  H  HE1  . PHE A 1 81 ? -16.649 5.241   -13.480 1.00 0.00 ? 145 PHE A HE1  4  
ATOM   5273  H  HE2  . PHE A 1 81 ? -20.838 4.627   -12.979 1.00 0.00 ? 145 PHE A HE2  4  
ATOM   5274  H  HZ   . PHE A 1 81 ? -18.916 5.129   -14.435 1.00 0.00 ? 145 PHE A HZ   4  
ATOM   5275  N  N    . GLY A 1 82 ? -17.469 7.846   -8.627  1.00 0.00 ? 146 GLY A N    4  
ATOM   5276  C  CA   . GLY A 1 82 ? -18.080 9.146   -8.830  1.00 0.00 ? 146 GLY A CA   4  
ATOM   5277  C  C    . GLY A 1 82 ? -19.274 9.373   -7.923  1.00 0.00 ? 146 GLY A C    4  
ATOM   5278  O  O    . GLY A 1 82 ? -19.596 8.529   -7.087  1.00 0.00 ? 146 GLY A O    4  
ATOM   5279  H  H    . GLY A 1 82 ? -16.513 7.783   -8.419  1.00 0.00 ? 146 GLY A H    4  
ATOM   5280  H  HA2  . GLY A 1 82 ? -17.344 9.912   -8.637  1.00 0.00 ? 146 GLY A HA2  4  
ATOM   5281  H  HA3  . GLY A 1 82 ? -18.404 9.223   -9.857  1.00 0.00 ? 146 GLY A HA3  4  
ATOM   5282  N  N    . SER A 1 83 ? -19.931 10.516  -8.087  1.00 0.00 ? 147 SER A N    4  
ATOM   5283  C  CA   . SER A 1 83 ? -21.092 10.854  -7.273  1.00 0.00 ? 147 SER A CA   4  
ATOM   5284  C  C    . SER A 1 83 ? -22.359 10.226  -7.846  1.00 0.00 ? 147 SER A C    4  
ATOM   5285  O  O    . SER A 1 83 ? -23.078 9.508   -7.152  1.00 0.00 ? 147 SER A O    4  
ATOM   5286  C  CB   . SER A 1 83 ? -21.256 12.373  -7.187  1.00 0.00 ? 147 SER A CB   4  
ATOM   5287  O  OG   . SER A 1 83 ? -22.475 12.719  -6.552  1.00 0.00 ? 147 SER A OG   4  
ATOM   5288  H  H    . SER A 1 83 ? -19.625 11.149  -8.771  1.00 0.00 ? 147 SER A H    4  
ATOM   5289  H  HA   . SER A 1 83 ? -20.927 10.462  -6.281  1.00 0.00 ? 147 SER A HA   4  
ATOM   5290  H  HB2  . SER A 1 83 ? -20.438 12.789  -6.619  1.00 0.00 ? 147 SER A HB2  4  
ATOM   5291  H  HB3  . SER A 1 83 ? -21.252 12.790  -8.183  1.00 0.00 ? 147 SER A HB3  4  
ATOM   5292  H  HG   . SER A 1 83 ? -22.706 12.042  -5.911  1.00 0.00 ? 147 SER A HG   4  
ATOM   5293  N  N    . GLY A 1 84 ? -22.625 10.503  -9.119  1.00 0.00 ? 148 GLY A N    4  
ATOM   5294  C  CA   . GLY A 1 84 ? -23.805 9.958   -9.765  1.00 0.00 ? 148 GLY A CA   4  
ATOM   5295  C  C    . GLY A 1 84 ? -24.153 10.687  -11.048 1.00 0.00 ? 148 GLY A C    4  
ATOM   5296  O  O    . GLY A 1 84 ? -24.759 11.759  -11.033 1.00 0.00 ? 148 GLY A O    4  
ATOM   5297  H  H    . GLY A 1 84 ? -22.016 11.081  -9.624  1.00 0.00 ? 148 GLY A H    4  
ATOM   5298  H  HA2  . GLY A 1 84 ? -23.630 8.917   -9.992  1.00 0.00 ? 148 GLY A HA2  4  
ATOM   5299  H  HA3  . GLY A 1 84 ? -24.641 10.032  -9.085  1.00 0.00 ? 148 GLY A HA3  4  
ATOM   5300  N  N    . PRO A 1 85 ? -23.762 10.102  -12.190 1.00 0.00 ? 149 PRO A N    4  
ATOM   5301  C  CA   . PRO A 1 85 ? -24.025 10.687  -13.509 1.00 0.00 ? 149 PRO A CA   4  
ATOM   5302  C  C    . PRO A 1 85 ? -25.504 10.645  -13.877 1.00 0.00 ? 149 PRO A C    4  
ATOM   5303  O  O    . PRO A 1 85 ? -25.898 11.097  -14.952 1.00 0.00 ? 149 PRO A O    4  
ATOM   5304  C  CB   . PRO A 1 85 ? -23.212 9.803   -14.457 1.00 0.00 ? 149 PRO A CB   4  
ATOM   5305  C  CG   . PRO A 1 85 ? -23.093 8.497   -13.749 1.00 0.00 ? 149 PRO A CG   4  
ATOM   5306  C  CD   . PRO A 1 85 ? -23.035 8.825   -12.283 1.00 0.00 ? 149 PRO A CD   4  
ATOM   5307  H  HA   . PRO A 1 85 ? -23.669 11.705  -13.569 1.00 0.00 ? 149 PRO A HA   4  
ATOM   5308  H  HB2  . PRO A 1 85 ? -23.738 9.698   -15.395 1.00 0.00 ? 149 PRO A HB2  4  
ATOM   5309  H  HB3  . PRO A 1 85 ? -22.243 10.248  -14.629 1.00 0.00 ? 149 PRO A HB3  4  
ATOM   5310  H  HG2  . PRO A 1 85 ? -23.954 7.884   -13.963 1.00 0.00 ? 149 PRO A HG2  4  
ATOM   5311  H  HG3  . PRO A 1 85 ? -22.187 7.995   -14.056 1.00 0.00 ? 149 PRO A HG3  4  
ATOM   5312  H  HD2  . PRO A 1 85 ? -23.529 8.058   -11.705 1.00 0.00 ? 149 PRO A HD2  4  
ATOM   5313  H  HD3  . PRO A 1 85 ? -22.011 8.942   -11.962 1.00 0.00 ? 149 PRO A HD3  4  
ATOM   5314  N  N    . SER A 1 86 ? -26.318 10.100  -12.979 1.00 0.00 ? 150 SER A N    4  
ATOM   5315  C  CA   . SER A 1 86 ? -27.753 9.995   -13.212 1.00 0.00 ? 150 SER A CA   4  
ATOM   5316  C  C    . SER A 1 86 ? -28.474 11.251  -12.731 1.00 0.00 ? 150 SER A C    4  
ATOM   5317  O  O    . SER A 1 86 ? -29.326 11.798  -13.432 1.00 0.00 ? 150 SER A O    4  
ATOM   5318  C  CB   . SER A 1 86 ? -28.319 8.765   -12.501 1.00 0.00 ? 150 SER A CB   4  
ATOM   5319  O  OG   . SER A 1 86 ? -28.218 8.898   -11.094 1.00 0.00 ? 150 SER A OG   4  
ATOM   5320  H  H    . SER A 1 86 ? -25.943 9.757   -12.141 1.00 0.00 ? 150 SER A H    4  
ATOM   5321  H  HA   . SER A 1 86 ? -27.910 9.890   -14.275 1.00 0.00 ? 150 SER A HA   4  
ATOM   5322  H  HB2  . SER A 1 86 ? -29.359 8.645   -12.765 1.00 0.00 ? 150 SER A HB2  4  
ATOM   5323  H  HB3  . SER A 1 86 ? -27.766 7.889   -12.809 1.00 0.00 ? 150 SER A HB3  4  
ATOM   5324  H  HG   . SER A 1 86 ? -27.332 9.187   -10.862 1.00 0.00 ? 150 SER A HG   4  
ATOM   5325  N  N    . SER A 1 87 ? -28.127 11.702  -11.530 1.00 0.00 ? 151 SER A N    4  
ATOM   5326  C  CA   . SER A 1 87 ? -28.742 12.890  -10.952 1.00 0.00 ? 151 SER A CA   4  
ATOM   5327  C  C    . SER A 1 87 ? -28.275 14.150  -11.674 1.00 0.00 ? 151 SER A C    4  
ATOM   5328  O  O    . SER A 1 87 ? -29.080 14.896  -12.230 1.00 0.00 ? 151 SER A O    4  
ATOM   5329  C  CB   . SER A 1 87 ? -28.410 12.990  -9.462  1.00 0.00 ? 151 SER A CB   4  
ATOM   5330  O  OG   . SER A 1 87 ? -29.431 13.673  -8.756  1.00 0.00 ? 151 SER A OG   4  
ATOM   5331  H  H    . SER A 1 87 ? -27.441 11.221  -11.019 1.00 0.00 ? 151 SER A H    4  
ATOM   5332  H  HA   . SER A 1 87 ? -29.812 12.799  -11.068 1.00 0.00 ? 151 SER A HA   4  
ATOM   5333  H  HB2  . SER A 1 87 ? -28.308 11.997  -9.051  1.00 0.00 ? 151 SER A HB2  4  
ATOM   5334  H  HB3  . SER A 1 87 ? -27.481 13.527  -9.338  1.00 0.00 ? 151 SER A HB3  4  
ATOM   5335  H  HG   . SER A 1 87 ? -29.310 13.543  -7.812  1.00 0.00 ? 151 SER A HG   4  
ATOM   5336  N  N    . GLY A 1 88 ? -26.965 14.381  -11.660 1.00 0.00 ? 152 GLY A N    4  
ATOM   5337  C  CA   . GLY A 1 88 ? -26.411 15.552  -12.316 1.00 0.00 ? 152 GLY A CA   4  
ATOM   5338  C  C    . GLY A 1 88 ? -24.927 15.714  -12.055 1.00 0.00 ? 152 GLY A C    4  
ATOM   5339  O  O    . GLY A 1 88 ? -24.460 16.812  -11.753 1.00 0.00 ? 152 GLY A O    4  
ATOM   5340  H  H    . GLY A 1 88 ? -26.370 13.752  -11.200 1.00 0.00 ? 152 GLY A H    4  
ATOM   5341  H  HA2  . GLY A 1 88 ? -26.572 15.464  -13.380 1.00 0.00 ? 152 GLY A HA2  4  
ATOM   5342  H  HA3  . GLY A 1 88 ? -26.927 16.430  -11.955 1.00 0.00 ? 152 GLY A HA3  4  
HETATM 5343  ZN ZN   . ZN  B 2 .  ? 2.994   2.275   -9.028  1.00 0.00 ? 200 ZN  A ZN   4  
HETATM 5344  ZN ZN   . ZN  C 2 .  ? 6.734   -11.381 -1.441  1.00 0.00 ? 300 ZN  A ZN   4  
ATOM   5345  N  N    . GLY A 1 1  ? 3.850   13.953  -26.521 1.00 0.00 ? 65  GLY A N    5  
ATOM   5346  C  CA   . GLY A 1 1  ? 5.186   14.160  -25.993 1.00 0.00 ? 65  GLY A CA   5  
ATOM   5347  C  C    . GLY A 1 1  ? 5.280   15.396  -25.122 1.00 0.00 ? 65  GLY A C    5  
ATOM   5348  O  O    . GLY A 1 1  ? 5.320   16.518  -25.627 1.00 0.00 ? 65  GLY A O    5  
ATOM   5349  H  H1   . GLY A 1 1  ? 3.725   13.777  -27.477 1.00 0.00 ? 65  GLY A H1   5  
ATOM   5350  H  HA2  . GLY A 1 1  ? 5.468   13.297  -25.408 1.00 0.00 ? 65  GLY A HA2  5  
ATOM   5351  H  HA3  . GLY A 1 1  ? 5.875   14.262  -26.818 1.00 0.00 ? 65  GLY A HA3  5  
ATOM   5352  N  N    . SER A 1 2  ? 5.313   15.192  -23.809 1.00 0.00 ? 66  SER A N    5  
ATOM   5353  C  CA   . SER A 1 2  ? 5.397   16.300  -22.865 1.00 0.00 ? 66  SER A CA   5  
ATOM   5354  C  C    . SER A 1 2  ? 6.832   16.501  -22.388 1.00 0.00 ? 66  SER A C    5  
ATOM   5355  O  O    . SER A 1 2  ? 7.380   15.670  -21.664 1.00 0.00 ? 66  SER A O    5  
ATOM   5356  C  CB   . SER A 1 2  ? 4.480   16.048  -21.666 1.00 0.00 ? 66  SER A CB   5  
ATOM   5357  O  OG   . SER A 1 2  ? 4.050   17.267  -21.087 1.00 0.00 ? 66  SER A OG   5  
ATOM   5358  H  H    . SER A 1 2  ? 5.278   14.274  -23.467 1.00 0.00 ? 66  SER A H    5  
ATOM   5359  H  HA   . SER A 1 2  ? 5.071   17.195  -23.374 1.00 0.00 ? 66  SER A HA   5  
ATOM   5360  H  HB2  . SER A 1 2  ? 3.614   15.491  -21.990 1.00 0.00 ? 66  SER A HB2  5  
ATOM   5361  H  HB3  . SER A 1 2  ? 5.016   15.478  -20.920 1.00 0.00 ? 66  SER A HB3  5  
ATOM   5362  H  HG   . SER A 1 2  ? 3.197   17.138  -20.666 1.00 0.00 ? 66  SER A HG   5  
ATOM   5363  N  N    . SER A 1 3  ? 7.437   17.611  -22.801 1.00 0.00 ? 67  SER A N    5  
ATOM   5364  C  CA   . SER A 1 3  ? 8.810   17.920  -22.420 1.00 0.00 ? 67  SER A CA   5  
ATOM   5365  C  C    . SER A 1 3  ? 8.842   18.848  -21.209 1.00 0.00 ? 67  SER A C    5  
ATOM   5366  O  O    . SER A 1 3  ? 8.505   20.026  -21.307 1.00 0.00 ? 67  SER A O    5  
ATOM   5367  C  CB   . SER A 1 3  ? 9.553   18.566  -23.592 1.00 0.00 ? 67  SER A CB   5  
ATOM   5368  O  OG   . SER A 1 3  ? 10.878  18.910  -23.227 1.00 0.00 ? 67  SER A OG   5  
ATOM   5369  H  H    . SER A 1 3  ? 6.947   18.235  -23.377 1.00 0.00 ? 67  SER A H    5  
ATOM   5370  H  HA   . SER A 1 3  ? 9.299   16.993  -22.162 1.00 0.00 ? 67  SER A HA   5  
ATOM   5371  H  HB2  . SER A 1 3  ? 9.588   17.872  -24.418 1.00 0.00 ? 67  SER A HB2  5  
ATOM   5372  H  HB3  . SER A 1 3  ? 9.031   19.462  -23.895 1.00 0.00 ? 67  SER A HB3  5  
ATOM   5373  H  HG   . SER A 1 3  ? 11.333  18.131  -22.899 1.00 0.00 ? 67  SER A HG   5  
ATOM   5374  N  N    . GLY A 1 4  ? 9.251   18.305  -20.067 1.00 0.00 ? 68  GLY A N    5  
ATOM   5375  C  CA   . GLY A 1 4  ? 9.321   19.096  -18.852 1.00 0.00 ? 68  GLY A CA   5  
ATOM   5376  C  C    . GLY A 1 4  ? 10.026  18.369  -17.725 1.00 0.00 ? 68  GLY A C    5  
ATOM   5377  O  O    . GLY A 1 4  ? 11.081  17.768  -17.930 1.00 0.00 ? 68  GLY A O    5  
ATOM   5378  H  H    . GLY A 1 4  ? 9.508   17.359  -20.048 1.00 0.00 ? 68  GLY A H    5  
ATOM   5379  H  HA2  . GLY A 1 4  ? 9.851   20.013  -19.063 1.00 0.00 ? 68  GLY A HA2  5  
ATOM   5380  H  HA3  . GLY A 1 4  ? 8.316   19.338  -18.536 1.00 0.00 ? 68  GLY A HA3  5  
ATOM   5381  N  N    . SER A 1 5  ? 9.444   18.423  -16.532 1.00 0.00 ? 69  SER A N    5  
ATOM   5382  C  CA   . SER A 1 5  ? 10.027  17.769  -15.366 1.00 0.00 ? 69  SER A CA   5  
ATOM   5383  C  C    . SER A 1 5  ? 9.018   17.695  -14.224 1.00 0.00 ? 69  SER A C    5  
ATOM   5384  O  O    . SER A 1 5  ? 8.030   18.428  -14.205 1.00 0.00 ? 69  SER A O    5  
ATOM   5385  C  CB   . SER A 1 5  ? 11.280  18.517  -14.908 1.00 0.00 ? 69  SER A CB   5  
ATOM   5386  O  OG   . SER A 1 5  ? 10.999  19.887  -14.675 1.00 0.00 ? 69  SER A OG   5  
ATOM   5387  H  H    . SER A 1 5  ? 8.604   18.918  -16.432 1.00 0.00 ? 69  SER A H    5  
ATOM   5388  H  HA   . SER A 1 5  ? 10.302  16.765  -15.653 1.00 0.00 ? 69  SER A HA   5  
ATOM   5389  H  HB2  . SER A 1 5  ? 11.645  18.077  -13.993 1.00 0.00 ? 69  SER A HB2  5  
ATOM   5390  H  HB3  . SER A 1 5  ? 12.040  18.442  -15.672 1.00 0.00 ? 69  SER A HB3  5  
ATOM   5391  H  HG   . SER A 1 5  ? 10.840  20.026  -13.739 1.00 0.00 ? 69  SER A HG   5  
ATOM   5392  N  N    . SER A 1 6  ? 9.277   16.804  -13.272 1.00 0.00 ? 70  SER A N    5  
ATOM   5393  C  CA   . SER A 1 6  ? 8.391   16.631  -12.126 1.00 0.00 ? 70  SER A CA   5  
ATOM   5394  C  C    . SER A 1 6  ? 9.088   15.855  -11.013 1.00 0.00 ? 70  SER A C    5  
ATOM   5395  O  O    . SER A 1 6  ? 10.048  15.126  -11.256 1.00 0.00 ? 70  SER A O    5  
ATOM   5396  C  CB   . SER A 1 6  ? 7.114   15.901  -12.549 1.00 0.00 ? 70  SER A CB   5  
ATOM   5397  O  OG   . SER A 1 6  ? 7.416   14.705  -13.246 1.00 0.00 ? 70  SER A OG   5  
ATOM   5398  H  H    . SER A 1 6  ? 10.081  16.249  -13.342 1.00 0.00 ? 70  SER A H    5  
ATOM   5399  H  HA   . SER A 1 6  ? 8.130   17.611  -11.758 1.00 0.00 ? 70  SER A HA   5  
ATOM   5400  H  HB2  . SER A 1 6  ? 6.535   15.656  -11.671 1.00 0.00 ? 70  SER A HB2  5  
ATOM   5401  H  HB3  . SER A 1 6  ? 6.533   16.544  -13.195 1.00 0.00 ? 70  SER A HB3  5  
ATOM   5402  H  HG   . SER A 1 6  ? 8.279   14.385  -12.973 1.00 0.00 ? 70  SER A HG   5  
ATOM   5403  N  N    . GLY A 1 7  ? 8.596   16.019  -9.788  1.00 0.00 ? 71  GLY A N    5  
ATOM   5404  C  CA   . GLY A 1 7  ? 9.183   15.329  -8.654  1.00 0.00 ? 71  GLY A CA   5  
ATOM   5405  C  C    . GLY A 1 7  ? 8.189   14.431  -7.944  1.00 0.00 ? 71  GLY A C    5  
ATOM   5406  O  O    . GLY A 1 7  ? 8.077   14.466  -6.719  1.00 0.00 ? 71  GLY A O    5  
ATOM   5407  H  H    . GLY A 1 7  ? 7.828   16.613  -9.654  1.00 0.00 ? 71  GLY A H    5  
ATOM   5408  H  HA2  . GLY A 1 7  ? 10.010  14.729  -9.001  1.00 0.00 ? 71  GLY A HA2  5  
ATOM   5409  H  HA3  . GLY A 1 7  ? 9.552   16.063  -7.953  1.00 0.00 ? 71  GLY A HA3  5  
ATOM   5410  N  N    . MET A 1 8  ? 7.465   13.627  -8.715  1.00 0.00 ? 72  MET A N    5  
ATOM   5411  C  CA   . MET A 1 8  ? 6.475   12.716  -8.152  1.00 0.00 ? 72  MET A CA   5  
ATOM   5412  C  C    . MET A 1 8  ? 6.685   11.297  -8.670  1.00 0.00 ? 72  MET A C    5  
ATOM   5413  O  O    . MET A 1 8  ? 6.689   11.062  -9.878  1.00 0.00 ? 72  MET A O    5  
ATOM   5414  C  CB   . MET A 1 8  ? 5.061   13.192  -8.492  1.00 0.00 ? 72  MET A CB   5  
ATOM   5415  C  CG   . MET A 1 8  ? 4.012   12.747  -7.486  1.00 0.00 ? 72  MET A CG   5  
ATOM   5416  S  SD   . MET A 1 8  ? 3.802   13.923  -6.135  1.00 0.00 ? 72  MET A SD   5  
ATOM   5417  C  CE   . MET A 1 8  ? 5.118   13.412  -5.033  1.00 0.00 ? 72  MET A CE   5  
ATOM   5418  H  H    . MET A 1 8  ? 7.599   13.645  -9.686  1.00 0.00 ? 72  MET A H    5  
ATOM   5419  H  HA   . MET A 1 8  ? 6.597   12.717  -7.079  1.00 0.00 ? 72  MET A HA   5  
ATOM   5420  H  HB2  . MET A 1 8  ? 5.057   14.271  -8.530  1.00 0.00 ? 72  MET A HB2  5  
ATOM   5421  H  HB3  . MET A 1 8  ? 4.786   12.803  -9.461  1.00 0.00 ? 72  MET A HB3  5  
ATOM   5422  H  HG2  . MET A 1 8  ? 3.067   12.635  -7.996  1.00 0.00 ? 72  MET A HG2  5  
ATOM   5423  H  HG3  . MET A 1 8  ? 4.311   11.795  -7.073  1.00 0.00 ? 72  MET A HG3  5  
ATOM   5424  H  HE1  . MET A 1 8  ? 4.860   13.676  -4.018  1.00 0.00 ? 72  MET A HE1  5  
ATOM   5425  H  HE2  . MET A 1 8  ? 5.253   12.343  -5.104  1.00 0.00 ? 72  MET A HE2  5  
ATOM   5426  H  HE3  . MET A 1 8  ? 6.035   13.910  -5.313  1.00 0.00 ? 72  MET A HE3  5  
ATOM   5427  N  N    . GLU A 1 9  ? 6.858   10.355  -7.748  1.00 0.00 ? 73  GLU A N    5  
ATOM   5428  C  CA   . GLU A 1 9  ? 7.070   8.959   -8.114  1.00 0.00 ? 73  GLU A CA   5  
ATOM   5429  C  C    . GLU A 1 9  ? 6.183   8.038   -7.280  1.00 0.00 ? 73  GLU A C    5  
ATOM   5430  O  O    . GLU A 1 9  ? 6.123   8.156   -6.056  1.00 0.00 ? 73  GLU A O    5  
ATOM   5431  C  CB   . GLU A 1 9  ? 8.539   8.577   -7.927  1.00 0.00 ? 73  GLU A CB   5  
ATOM   5432  C  CG   . GLU A 1 9  ? 9.378   8.751   -9.182  1.00 0.00 ? 73  GLU A CG   5  
ATOM   5433  C  CD   . GLU A 1 9  ? 10.832  9.053   -8.874  1.00 0.00 ? 73  GLU A CD   5  
ATOM   5434  O  OE1  . GLU A 1 9  ? 11.452  8.275   -8.119  1.00 0.00 ? 73  GLU A OE1  5  
ATOM   5435  O  OE2  . GLU A 1 9  ? 11.350  10.066  -9.389  1.00 0.00 ? 73  GLU A OE2  5  
ATOM   5436  H  H    . GLU A 1 9  ? 6.844   10.604  -6.800  1.00 0.00 ? 73  GLU A H    5  
ATOM   5437  H  HA   . GLU A 1 9  ? 6.808   8.846   -9.155  1.00 0.00 ? 73  GLU A HA   5  
ATOM   5438  H  HB2  . GLU A 1 9  ? 8.963   9.193   -7.147  1.00 0.00 ? 73  GLU A HB2  5  
ATOM   5439  H  HB3  . GLU A 1 9  ? 8.593   7.541   -7.624  1.00 0.00 ? 73  GLU A HB3  5  
ATOM   5440  H  HG2  . GLU A 1 9  ? 9.330   7.841   -9.760  1.00 0.00 ? 73  GLU A HG2  5  
ATOM   5441  H  HG3  . GLU A 1 9  ? 8.971   9.566   -9.761  1.00 0.00 ? 73  GLU A HG3  5  
ATOM   5442  N  N    . CYS A 1 10 ? 5.496   7.121   -7.953  1.00 0.00 ? 74  CYS A N    5  
ATOM   5443  C  CA   . CYS A 1 10 ? 4.612   6.179   -7.277  1.00 0.00 ? 74  CYS A CA   5  
ATOM   5444  C  C    . CYS A 1 10 ? 5.303   5.554   -6.069  1.00 0.00 ? 74  CYS A C    5  
ATOM   5445  O  O    . CYS A 1 10 ? 6.402   5.011   -6.182  1.00 0.00 ? 74  CYS A O    5  
ATOM   5446  C  CB   . CYS A 1 10 ? 4.163   5.083   -8.245  1.00 0.00 ? 74  CYS A CB   5  
ATOM   5447  S  SG   . CYS A 1 10 ? 2.990   3.889   -7.525  1.00 0.00 ? 74  CYS A SG   5  
ATOM   5448  H  H    . CYS A 1 10 ? 5.586   7.076   -8.928  1.00 0.00 ? 74  CYS A H    5  
ATOM   5449  H  HA   . CYS A 1 10 ? 3.744   6.724   -6.937  1.00 0.00 ? 74  CYS A HA   5  
ATOM   5450  H  HB2  . CYS A 1 10 ? 3.683   5.541   -9.098  1.00 0.00 ? 74  CYS A HB2  5  
ATOM   5451  H  HB3  . CYS A 1 10 ? 5.030   4.532   -8.580  1.00 0.00 ? 74  CYS A HB3  5  
ATOM   5452  N  N    . ARG A 1 11 ? 4.652   5.635   -4.913  1.00 0.00 ? 75  ARG A N    5  
ATOM   5453  C  CA   . ARG A 1 11 ? 5.204   5.079   -3.684  1.00 0.00 ? 75  ARG A CA   5  
ATOM   5454  C  C    . ARG A 1 11 ? 4.855   3.599   -3.552  1.00 0.00 ? 75  ARG A C    5  
ATOM   5455  O  O    . ARG A 1 11 ? 4.779   3.064   -2.446  1.00 0.00 ? 75  ARG A O    5  
ATOM   5456  C  CB   . ARG A 1 11 ? 4.679   5.847   -2.470  1.00 0.00 ? 75  ARG A CB   5  
ATOM   5457  C  CG   . ARG A 1 11 ? 4.889   7.350   -2.563  1.00 0.00 ? 75  ARG A CG   5  
ATOM   5458  C  CD   . ARG A 1 11 ? 6.231   7.762   -1.978  1.00 0.00 ? 75  ARG A CD   5  
ATOM   5459  N  NE   . ARG A 1 11 ? 6.301   9.199   -1.728  1.00 0.00 ? 75  ARG A NE   5  
ATOM   5460  C  CZ   . ARG A 1 11 ? 5.561   9.824   -0.820  1.00 0.00 ? 75  ARG A CZ   5  
ATOM   5461  N  NH1  . ARG A 1 11 ? 4.700   9.142   -0.077  1.00 0.00 ? 75  ARG A NH1  5  
ATOM   5462  N  NH2  . ARG A 1 11 ? 5.682   11.135  -0.651  1.00 0.00 ? 75  ARG A NH2  5  
ATOM   5463  H  H    . ARG A 1 11 ? 3.779   6.080   -4.886  1.00 0.00 ? 75  ARG A H    5  
ATOM   5464  H  HA   . ARG A 1 11 ? 6.278   5.181   -3.727  1.00 0.00 ? 75  ARG A HA   5  
ATOM   5465  H  HB2  . ARG A 1 11 ? 3.620   5.660   -2.370  1.00 0.00 ? 75  ARG A HB2  5  
ATOM   5466  H  HB3  . ARG A 1 11 ? 5.185   5.489   -1.586  1.00 0.00 ? 75  ARG A HB3  5  
ATOM   5467  H  HG2  . ARG A 1 11 ? 4.856   7.645   -3.601  1.00 0.00 ? 75  ARG A HG2  5  
ATOM   5468  H  HG3  . ARG A 1 11 ? 4.100   7.848   -2.019  1.00 0.00 ? 75  ARG A HG3  5  
ATOM   5469  H  HD2  . ARG A 1 11 ? 6.378   7.237   -1.046  1.00 0.00 ? 75  ARG A HD2  5  
ATOM   5470  H  HD3  . ARG A 1 11 ? 7.011   7.488   -2.673  1.00 0.00 ? 75  ARG A HD3  5  
ATOM   5471  H  HE   . ARG A 1 11 ? 6.931   9.723   -2.266  1.00 0.00 ? 75  ARG A HE   5  
ATOM   5472  H  HH11 . ARG A 1 11 ? 4.608   8.154   -0.201  1.00 0.00 ? 75  ARG A HH11 5  
ATOM   5473  H  HH12 . ARG A 1 11 ? 4.145   9.615   0.607   1.00 0.00 ? 75  ARG A HH12 5  
ATOM   5474  H  HH21 . ARG A 1 11 ? 6.330   11.653  -1.209  1.00 0.00 ? 75  ARG A HH21 5  
ATOM   5475  H  HH22 . ARG A 1 11 ? 5.125   11.604  0.033   1.00 0.00 ? 75  ARG A HH22 5  
ATOM   5476  N  N    . VAL A 1 12 ? 4.644   2.943   -4.689  1.00 0.00 ? 76  VAL A N    5  
ATOM   5477  C  CA   . VAL A 1 12 ? 4.304   1.525   -4.701  1.00 0.00 ? 76  VAL A CA   5  
ATOM   5478  C  C    . VAL A 1 12 ? 5.217   0.749   -5.644  1.00 0.00 ? 76  VAL A C    5  
ATOM   5479  O  O    . VAL A 1 12 ? 5.691   -0.338  -5.312  1.00 0.00 ? 76  VAL A O    5  
ATOM   5480  C  CB   . VAL A 1 12 ? 2.840   1.303   -5.124  1.00 0.00 ? 76  VAL A CB   5  
ATOM   5481  C  CG1  . VAL A 1 12 ? 2.530   -0.184  -5.216  1.00 0.00 ? 76  VAL A CG1  5  
ATOM   5482  C  CG2  . VAL A 1 12 ? 1.894   1.993   -4.152  1.00 0.00 ? 76  VAL A CG2  5  
ATOM   5483  H  H    . VAL A 1 12 ? 4.719   3.423   -5.540  1.00 0.00 ? 76  VAL A H    5  
ATOM   5484  H  HA   . VAL A 1 12 ? 4.429   1.143   -3.698  1.00 0.00 ? 76  VAL A HA   5  
ATOM   5485  H  HB   . VAL A 1 12 ? 2.698   1.738   -6.102  1.00 0.00 ? 76  VAL A HB   5  
ATOM   5486  H  HG11 . VAL A 1 12 ? 2.598   -0.627  -4.234  1.00 0.00 ? 76  VAL A HG11 5  
ATOM   5487  H  HG12 . VAL A 1 12 ? 1.532   -0.321  -5.607  1.00 0.00 ? 76  VAL A HG12 5  
ATOM   5488  H  HG13 . VAL A 1 12 ? 3.243   -0.659  -5.874  1.00 0.00 ? 76  VAL A HG13 5  
ATOM   5489  H  HG21 . VAL A 1 12 ? 0.898   2.009   -4.569  1.00 0.00 ? 76  VAL A HG21 5  
ATOM   5490  H  HG22 . VAL A 1 12 ? 1.886   1.455   -3.216  1.00 0.00 ? 76  VAL A HG22 5  
ATOM   5491  H  HG23 . VAL A 1 12 ? 2.229   3.006   -3.982  1.00 0.00 ? 76  VAL A HG23 5  
ATOM   5492  N  N    . CYS A 1 13 ? 5.460   1.314   -6.821  1.00 0.00 ? 77  CYS A N    5  
ATOM   5493  C  CA   . CYS A 1 13 ? 6.317   0.676   -7.814  1.00 0.00 ? 77  CYS A CA   5  
ATOM   5494  C  C    . CYS A 1 13 ? 7.511   1.564   -8.153  1.00 0.00 ? 77  CYS A C    5  
ATOM   5495  O  O    . CYS A 1 13 ? 8.649   1.100   -8.201  1.00 0.00 ? 77  CYS A O    5  
ATOM   5496  C  CB   . CYS A 1 13 ? 5.520   0.368   -9.083  1.00 0.00 ? 77  CYS A CB   5  
ATOM   5497  S  SG   . CYS A 1 13 ? 5.005   1.846   -10.015 1.00 0.00 ? 77  CYS A SG   5  
ATOM   5498  H  H    . CYS A 1 13 ? 5.053   2.182   -7.029  1.00 0.00 ? 77  CYS A H    5  
ATOM   5499  H  HA   . CYS A 1 13 ? 6.680   -0.249  -7.394  1.00 0.00 ? 77  CYS A HA   5  
ATOM   5500  H  HB2  . CYS A 1 13 ? 6.126   -0.239  -9.741  1.00 0.00 ? 77  CYS A HB2  5  
ATOM   5501  H  HB3  . CYS A 1 13 ? 4.629   -0.180  -8.815  1.00 0.00 ? 77  CYS A HB3  5  
ATOM   5502  N  N    . GLY A 1 14 ? 7.242   2.845   -8.387  1.00 0.00 ? 78  GLY A N    5  
ATOM   5503  C  CA   . GLY A 1 14 ? 8.303   3.778   -8.718  1.00 0.00 ? 78  GLY A CA   5  
ATOM   5504  C  C    . GLY A 1 14 ? 7.945   4.671   -9.889  1.00 0.00 ? 78  GLY A C    5  
ATOM   5505  O  O    . GLY A 1 14 ? 8.300   5.850   -9.910  1.00 0.00 ? 78  GLY A O    5  
ATOM   5506  H  H    . GLY A 1 14 ? 6.315   3.159   -8.334  1.00 0.00 ? 78  GLY A H    5  
ATOM   5507  H  HA2  . GLY A 1 14 ? 8.507   4.396   -7.856  1.00 0.00 ? 78  GLY A HA2  5  
ATOM   5508  H  HA3  . GLY A 1 14 ? 9.193   3.219   -8.966  1.00 0.00 ? 78  GLY A HA3  5  
ATOM   5509  N  N    . ASP A 1 15 ? 7.243   4.110   -10.866 1.00 0.00 ? 79  ASP A N    5  
ATOM   5510  C  CA   . ASP A 1 15 ? 6.837   4.863   -12.047 1.00 0.00 ? 79  ASP A CA   5  
ATOM   5511  C  C    . ASP A 1 15 ? 6.140   6.161   -11.650 1.00 0.00 ? 79  ASP A C    5  
ATOM   5512  O  O    . ASP A 1 15 ? 5.614   6.283   -10.544 1.00 0.00 ? 79  ASP A O    5  
ATOM   5513  C  CB   . ASP A 1 15 ? 5.911   4.019   -12.924 1.00 0.00 ? 79  ASP A CB   5  
ATOM   5514  C  CG   . ASP A 1 15 ? 5.669   4.647   -14.282 1.00 0.00 ? 79  ASP A CG   5  
ATOM   5515  O  OD1  . ASP A 1 15 ? 6.650   4.834   -15.032 1.00 0.00 ? 79  ASP A OD1  5  
ATOM   5516  O  OD2  . ASP A 1 15 ? 4.499   4.952   -14.596 1.00 0.00 ? 79  ASP A OD2  5  
ATOM   5517  H  H    . ASP A 1 15 ? 6.990   3.166   -10.792 1.00 0.00 ? 79  ASP A H    5  
ATOM   5518  H  HA   . ASP A 1 15 ? 7.727   5.105   -12.608 1.00 0.00 ? 79  ASP A HA   5  
ATOM   5519  H  HB2  . ASP A 1 15 ? 6.355   3.046   -13.072 1.00 0.00 ? 79  ASP A HB2  5  
ATOM   5520  H  HB3  . ASP A 1 15 ? 4.960   3.905   -12.425 1.00 0.00 ? 79  ASP A HB3  5  
ATOM   5521  N  N    . LYS A 1 16 ? 6.140   7.129   -12.560 1.00 0.00 ? 80  LYS A N    5  
ATOM   5522  C  CA   . LYS A 1 16 ? 5.508   8.418   -12.307 1.00 0.00 ? 80  LYS A CA   5  
ATOM   5523  C  C    . LYS A 1 16 ? 4.191   8.241   -11.559 1.00 0.00 ? 80  LYS A C    5  
ATOM   5524  O  O    . LYS A 1 16 ? 3.368   7.401   -11.922 1.00 0.00 ? 80  LYS A O    5  
ATOM   5525  C  CB   . LYS A 1 16 ? 5.262   9.157   -13.625 1.00 0.00 ? 80  LYS A CB   5  
ATOM   5526  C  CG   . LYS A 1 16 ? 5.160   10.664  -13.468 1.00 0.00 ? 80  LYS A CG   5  
ATOM   5527  C  CD   . LYS A 1 16 ? 4.444   11.300  -14.647 1.00 0.00 ? 80  LYS A CD   5  
ATOM   5528  C  CE   . LYS A 1 16 ? 4.882   12.742  -14.853 1.00 0.00 ? 80  LYS A CE   5  
ATOM   5529  N  NZ   . LYS A 1 16 ? 3.929   13.493  -15.718 1.00 0.00 ? 80  LYS A NZ   5  
ATOM   5530  H  H    . LYS A 1 16 ? 6.576   6.972   -13.425 1.00 0.00 ? 80  LYS A H    5  
ATOM   5531  H  HA   . LYS A 1 16 ? 6.179   9.003   -11.697 1.00 0.00 ? 80  LYS A HA   5  
ATOM   5532  H  HB2  . LYS A 1 16 ? 6.076   8.940   -14.302 1.00 0.00 ? 80  LYS A HB2  5  
ATOM   5533  H  HB3  . LYS A 1 16 ? 4.340   8.797   -14.058 1.00 0.00 ? 80  LYS A HB3  5  
ATOM   5534  H  HG2  . LYS A 1 16 ? 4.611   10.886  -12.565 1.00 0.00 ? 80  LYS A HG2  5  
ATOM   5535  H  HG3  . LYS A 1 16 ? 6.156   11.078  -13.397 1.00 0.00 ? 80  LYS A HG3  5  
ATOM   5536  H  HD2  . LYS A 1 16 ? 4.668   10.736  -15.541 1.00 0.00 ? 80  LYS A HD2  5  
ATOM   5537  H  HD3  . LYS A 1 16 ? 3.379   11.279  -14.464 1.00 0.00 ? 80  LYS A HD3  5  
ATOM   5538  H  HE2  . LYS A 1 16 ? 4.941   13.227  -13.892 1.00 0.00 ? 80  LYS A HE2  5  
ATOM   5539  H  HE3  . LYS A 1 16 ? 5.856   12.745  -15.319 1.00 0.00 ? 80  LYS A HE3  5  
ATOM   5540  H  HZ1  . LYS A 1 16 ? 4.434   13.915  -16.523 1.00 0.00 ? 80  LYS A HZ1  5  
ATOM   5541  H  HZ2  . LYS A 1 16 ? 3.474   14.252  -15.171 1.00 0.00 ? 80  LYS A HZ2  5  
ATOM   5542  H  HZ3  . LYS A 1 16 ? 3.194   12.853  -16.079 1.00 0.00 ? 80  LYS A HZ3  5  
ATOM   5543  N  N    . ALA A 1 17 ? 3.998   9.038   -10.513 1.00 0.00 ? 81  ALA A N    5  
ATOM   5544  C  CA   . ALA A 1 17 ? 2.779   8.970   -9.716  1.00 0.00 ? 81  ALA A CA   5  
ATOM   5545  C  C    . ALA A 1 17 ? 1.692   9.869   -10.298 1.00 0.00 ? 81  ALA A C    5  
ATOM   5546  O  O    . ALA A 1 17 ? 1.714   11.085  -10.111 1.00 0.00 ? 81  ALA A O    5  
ATOM   5547  C  CB   . ALA A 1 17 ? 3.070   9.357   -8.273  1.00 0.00 ? 81  ALA A CB   5  
ATOM   5548  H  H    . ALA A 1 17 ? 4.691   9.687   -10.273 1.00 0.00 ? 81  ALA A H    5  
ATOM   5549  H  HA   . ALA A 1 17 ? 2.430   7.948   -9.726  1.00 0.00 ? 81  ALA A HA   5  
ATOM   5550  H  HB1  . ALA A 1 17 ? 4.132   9.294   -8.091  1.00 0.00 ? 81  ALA A HB1  5  
ATOM   5551  H  HB2  . ALA A 1 17 ? 2.733   10.369  -8.098  1.00 0.00 ? 81  ALA A HB2  5  
ATOM   5552  H  HB3  . ALA A 1 17 ? 2.550   8.684   -7.609  1.00 0.00 ? 81  ALA A HB3  5  
ATOM   5553  N  N    . SER A 1 18 ? 0.744   9.261   -11.003 1.00 0.00 ? 82  SER A N    5  
ATOM   5554  C  CA   . SER A 1 18 ? -0.349  10.007  -11.616 1.00 0.00 ? 82  SER A CA   5  
ATOM   5555  C  C    . SER A 1 18 ? -0.749  11.196  -10.748 1.00 0.00 ? 82  SER A C    5  
ATOM   5556  O  O    . SER A 1 18 ? -0.778  12.336  -11.212 1.00 0.00 ? 82  SER A O    5  
ATOM   5557  C  CB   . SER A 1 18 ? -1.557  9.094   -11.837 1.00 0.00 ? 82  SER A CB   5  
ATOM   5558  O  OG   . SER A 1 18 ? -2.728  9.850   -12.092 1.00 0.00 ? 82  SER A OG   5  
ATOM   5559  H  H    . SER A 1 18 ? 0.782   8.288   -11.116 1.00 0.00 ? 82  SER A H    5  
ATOM   5560  H  HA   . SER A 1 18 ? -0.005  10.373  -12.572 1.00 0.00 ? 82  SER A HA   5  
ATOM   5561  H  HB2  . SER A 1 18 ? -1.368  8.449   -12.682 1.00 0.00 ? 82  SER A HB2  5  
ATOM   5562  H  HB3  . SER A 1 18 ? -1.716  8.493   -10.954 1.00 0.00 ? 82  SER A HB3  5  
ATOM   5563  H  HG   . SER A 1 18 ? -2.762  10.083  -13.023 1.00 0.00 ? 82  SER A HG   5  
ATOM   5564  N  N    . GLY A 1 19 ? -1.057  10.922  -9.484  1.00 0.00 ? 83  GLY A N    5  
ATOM   5565  C  CA   . GLY A 1 19 ? -1.451  11.979  -8.571  1.00 0.00 ? 83  GLY A CA   5  
ATOM   5566  C  C    . GLY A 1 19 ? -1.917  11.443  -7.232  1.00 0.00 ? 83  GLY A C    5  
ATOM   5567  O  O    . GLY A 1 19 ? -1.411  10.430  -6.749  1.00 0.00 ? 83  GLY A O    5  
ATOM   5568  H  H    . GLY A 1 19 ? -1.016  9.995   -9.169  1.00 0.00 ? 83  GLY A H    5  
ATOM   5569  H  HA2  . GLY A 1 19 ? -0.608  12.634  -8.411  1.00 0.00 ? 83  GLY A HA2  5  
ATOM   5570  H  HA3  . GLY A 1 19 ? -2.254  12.545  -9.018  1.00 0.00 ? 83  GLY A HA3  5  
ATOM   5571  N  N    . PHE A 1 20 ? -2.884  12.126  -6.628  1.00 0.00 ? 84  PHE A N    5  
ATOM   5572  C  CA   . PHE A 1 20 ? -3.417  11.714  -5.334  1.00 0.00 ? 84  PHE A CA   5  
ATOM   5573  C  C    . PHE A 1 20 ? -4.516  10.670  -5.506  1.00 0.00 ? 84  PHE A C    5  
ATOM   5574  O  O    . PHE A 1 20 ? -5.506  10.902  -6.201  1.00 0.00 ? 84  PHE A O    5  
ATOM   5575  C  CB   . PHE A 1 20 ? -3.964  12.925  -4.575  1.00 0.00 ? 84  PHE A CB   5  
ATOM   5576  C  CG   . PHE A 1 20 ? -4.562  12.577  -3.242  1.00 0.00 ? 84  PHE A CG   5  
ATOM   5577  C  CD1  . PHE A 1 20 ? -3.750  12.353  -2.141  1.00 0.00 ? 84  PHE A CD1  5  
ATOM   5578  C  CD2  . PHE A 1 20 ? -5.935  12.476  -3.089  1.00 0.00 ? 84  PHE A CD2  5  
ATOM   5579  C  CE1  . PHE A 1 20 ? -4.297  12.032  -0.914  1.00 0.00 ? 84  PHE A CE1  5  
ATOM   5580  C  CE2  . PHE A 1 20 ? -6.488  12.155  -1.863  1.00 0.00 ? 84  PHE A CE2  5  
ATOM   5581  C  CZ   . PHE A 1 20 ? -5.668  11.934  -0.774  1.00 0.00 ? 84  PHE A CZ   5  
ATOM   5582  H  H    . PHE A 1 20 ? -3.248  12.926  -7.062  1.00 0.00 ? 84  PHE A H    5  
ATOM   5583  H  HA   . PHE A 1 20 ? -2.609  11.279  -4.767  1.00 0.00 ? 84  PHE A HA   5  
ATOM   5584  H  HB2  . PHE A 1 20 ? -3.161  13.627  -4.405  1.00 0.00 ? 84  PHE A HB2  5  
ATOM   5585  H  HB3  . PHE A 1 20 ? -4.730  13.398  -5.171  1.00 0.00 ? 84  PHE A HB3  5  
ATOM   5586  H  HD1  . PHE A 1 20 ? -2.678  12.429  -2.249  1.00 0.00 ? 84  PHE A HD1  5  
ATOM   5587  H  HD2  . PHE A 1 20 ? -6.577  12.649  -3.941  1.00 0.00 ? 84  PHE A HD2  5  
ATOM   5588  H  HE1  . PHE A 1 20 ? -3.654  11.859  -0.064  1.00 0.00 ? 84  PHE A HE1  5  
ATOM   5589  H  HE2  . PHE A 1 20 ? -7.560  12.080  -1.758  1.00 0.00 ? 84  PHE A HE2  5  
ATOM   5590  H  HZ   . PHE A 1 20 ? -6.098  11.683  0.184   1.00 0.00 ? 84  PHE A HZ   5  
ATOM   5591  N  N    . HIS A 1 21 ? -4.334  9.517   -4.869  1.00 0.00 ? 85  HIS A N    5  
ATOM   5592  C  CA   . HIS A 1 21 ? -5.310  8.436   -4.951  1.00 0.00 ? 85  HIS A CA   5  
ATOM   5593  C  C    . HIS A 1 21 ? -5.258  7.562   -3.702  1.00 0.00 ? 85  HIS A C    5  
ATOM   5594  O  O    . HIS A 1 21 ? -4.184  7.145   -3.268  1.00 0.00 ? 85  HIS A O    5  
ATOM   5595  C  CB   . HIS A 1 21 ? -5.055  7.584   -6.195  1.00 0.00 ? 85  HIS A CB   5  
ATOM   5596  C  CG   . HIS A 1 21 ? -4.661  8.384   -7.398  1.00 0.00 ? 85  HIS A CG   5  
ATOM   5597  N  ND1  . HIS A 1 21 ? -5.560  9.125   -8.137  1.00 0.00 ? 85  HIS A ND1  5  
ATOM   5598  C  CD2  . HIS A 1 21 ? -3.456  8.558   -7.990  1.00 0.00 ? 85  HIS A CD2  5  
ATOM   5599  C  CE1  . HIS A 1 21 ? -4.925  9.718   -9.131  1.00 0.00 ? 85  HIS A CE1  5  
ATOM   5600  N  NE2  . HIS A 1 21 ? -3.647  9.391   -9.065  1.00 0.00 ? 85  HIS A NE2  5  
ATOM   5601  H  H    . HIS A 1 21 ? -3.526  9.392   -4.331  1.00 0.00 ? 85  HIS A H    5  
ATOM   5602  H  HA   . HIS A 1 21 ? -6.291  8.880   -5.024  1.00 0.00 ? 85  HIS A HA   5  
ATOM   5603  H  HB2  . HIS A 1 21 ? -4.259  6.885   -5.987  1.00 0.00 ? 85  HIS A HB2  5  
ATOM   5604  H  HB3  . HIS A 1 21 ? -5.954  7.037   -6.439  1.00 0.00 ? 85  HIS A HB3  5  
ATOM   5605  H  HD1  . HIS A 1 21 ? -6.520  9.203   -7.959  1.00 0.00 ? 85  HIS A HD1  5  
ATOM   5606  H  HD2  . HIS A 1 21 ? -2.518  8.122   -7.676  1.00 0.00 ? 85  HIS A HD2  5  
ATOM   5607  H  HE1  . HIS A 1 21 ? -5.373  10.362  -9.873  1.00 0.00 ? 85  HIS A HE1  5  
ATOM   5608  N  N    . TYR A 1 22 ? -6.425  7.289   -3.128  1.00 0.00 ? 86  TYR A N    5  
ATOM   5609  C  CA   . TYR A 1 22 ? -6.512  6.467   -1.927  1.00 0.00 ? 86  TYR A CA   5  
ATOM   5610  C  C    . TYR A 1 22 ? -5.611  7.016   -0.825  1.00 0.00 ? 86  TYR A C    5  
ATOM   5611  O  O    . TYR A 1 22 ? -5.170  6.279   0.057   1.00 0.00 ? 86  TYR A O    5  
ATOM   5612  C  CB   . TYR A 1 22 ? -6.126  5.021   -2.244  1.00 0.00 ? 86  TYR A CB   5  
ATOM   5613  C  CG   . TYR A 1 22 ? -6.936  4.410   -3.364  1.00 0.00 ? 86  TYR A CG   5  
ATOM   5614  C  CD1  . TYR A 1 22 ? -6.635  4.679   -4.693  1.00 0.00 ? 86  TYR A CD1  5  
ATOM   5615  C  CD2  . TYR A 1 22 ? -8.003  3.561   -3.093  1.00 0.00 ? 86  TYR A CD2  5  
ATOM   5616  C  CE1  . TYR A 1 22 ? -7.374  4.123   -5.720  1.00 0.00 ? 86  TYR A CE1  5  
ATOM   5617  C  CE2  . TYR A 1 22 ? -8.746  3.000   -4.113  1.00 0.00 ? 86  TYR A CE2  5  
ATOM   5618  C  CZ   . TYR A 1 22 ? -8.428  3.284   -5.425  1.00 0.00 ? 86  TYR A CZ   5  
ATOM   5619  O  OH   . TYR A 1 22 ? -9.165  2.727   -6.445  1.00 0.00 ? 86  TYR A OH   5  
ATOM   5620  H  H    . TYR A 1 22 ? -7.247  7.650   -3.520  1.00 0.00 ? 86  TYR A H    5  
ATOM   5621  H  HA   . TYR A 1 22 ? -7.536  6.489   -1.583  1.00 0.00 ? 86  TYR A HA   5  
ATOM   5622  H  HB2  . TYR A 1 22 ? -5.086  4.988   -2.531  1.00 0.00 ? 86  TYR A HB2  5  
ATOM   5623  H  HB3  . TYR A 1 22 ? -6.270  4.415   -1.361  1.00 0.00 ? 86  TYR A HB3  5  
ATOM   5624  H  HD1  . TYR A 1 22 ? -5.808  5.336   -4.921  1.00 0.00 ? 86  TYR A HD1  5  
ATOM   5625  H  HD2  . TYR A 1 22 ? -8.250  3.340   -2.065  1.00 0.00 ? 86  TYR A HD2  5  
ATOM   5626  H  HE1  . TYR A 1 22 ? -7.124  4.345   -6.747  1.00 0.00 ? 86  TYR A HE1  5  
ATOM   5627  H  HE2  . TYR A 1 22 ? -9.572  2.343   -3.883  1.00 0.00 ? 86  TYR A HE2  5  
ATOM   5628  H  HH   . TYR A 1 22 ? -9.147  1.770   -6.367  1.00 0.00 ? 86  TYR A HH   5  
ATOM   5629  N  N    . GLY A 1 23 ? -5.341  8.316   -0.882  1.00 0.00 ? 87  GLY A N    5  
ATOM   5630  C  CA   . GLY A 1 23 ? -4.495  8.944   0.116   1.00 0.00 ? 87  GLY A CA   5  
ATOM   5631  C  C    . GLY A 1 23 ? -3.020  8.796   -0.199  1.00 0.00 ? 87  GLY A C    5  
ATOM   5632  O  O    . GLY A 1 23 ? -2.194  9.574   0.279   1.00 0.00 ? 87  GLY A O    5  
ATOM   5633  H  H    . GLY A 1 23 ? -5.721  8.855   -1.608  1.00 0.00 ? 87  GLY A H    5  
ATOM   5634  H  HA2  . GLY A 1 23 ? -4.738  9.994   0.169   1.00 0.00 ? 87  GLY A HA2  5  
ATOM   5635  H  HA3  . GLY A 1 23 ? -4.693  8.490   1.076   1.00 0.00 ? 87  GLY A HA3  5  
ATOM   5636  N  N    . VAL A 1 24 ? -2.686  7.792   -1.004  1.00 0.00 ? 88  VAL A N    5  
ATOM   5637  C  CA   . VAL A 1 24 ? -1.300  7.544   -1.382  1.00 0.00 ? 88  VAL A CA   5  
ATOM   5638  C  C    . VAL A 1 24 ? -1.053  7.913   -2.840  1.00 0.00 ? 88  VAL A C    5  
ATOM   5639  O  O    . VAL A 1 24 ? -1.836  7.558   -3.723  1.00 0.00 ? 88  VAL A O    5  
ATOM   5640  C  CB   . VAL A 1 24 ? -0.914  6.069   -1.164  1.00 0.00 ? 88  VAL A CB   5  
ATOM   5641  C  CG1  . VAL A 1 24 ? -1.769  5.159   -2.034  1.00 0.00 ? 88  VAL A CG1  5  
ATOM   5642  C  CG2  . VAL A 1 24 ? 0.565   5.857   -1.451  1.00 0.00 ? 88  VAL A CG2  5  
ATOM   5643  H  H    . VAL A 1 24 ? -3.389  7.205   -1.353  1.00 0.00 ? 88  VAL A H    5  
ATOM   5644  H  HA   . VAL A 1 24 ? -0.668  8.155   -0.754  1.00 0.00 ? 88  VAL A HA   5  
ATOM   5645  H  HB   . VAL A 1 24 ? -1.099  5.818   -0.130  1.00 0.00 ? 88  VAL A HB   5  
ATOM   5646  H  HG11 . VAL A 1 24 ? -1.690  5.470   -3.065  1.00 0.00 ? 88  VAL A HG11 5  
ATOM   5647  H  HG12 . VAL A 1 24 ? -1.426  4.140   -1.936  1.00 0.00 ? 88  VAL A HG12 5  
ATOM   5648  H  HG13 . VAL A 1 24 ? -2.800  5.224   -1.717  1.00 0.00 ? 88  VAL A HG13 5  
ATOM   5649  H  HG21 . VAL A 1 24 ? 1.152   6.301   -0.661  1.00 0.00 ? 88  VAL A HG21 5  
ATOM   5650  H  HG22 . VAL A 1 24 ? 0.772   4.799   -1.503  1.00 0.00 ? 88  VAL A HG22 5  
ATOM   5651  H  HG23 . VAL A 1 24 ? 0.819   6.321   -2.393  1.00 0.00 ? 88  VAL A HG23 5  
ATOM   5652  N  N    . HIS A 1 25 ? 0.041   8.626   -3.088  1.00 0.00 ? 89  HIS A N    5  
ATOM   5653  C  CA   . HIS A 1 25 ? 0.392   9.042   -4.441  1.00 0.00 ? 89  HIS A CA   5  
ATOM   5654  C  C    . HIS A 1 25 ? 0.874   7.854   -5.267  1.00 0.00 ? 89  HIS A C    5  
ATOM   5655  O  O    . HIS A 1 25 ? 2.074   7.597   -5.361  1.00 0.00 ? 89  HIS A O    5  
ATOM   5656  C  CB   . HIS A 1 25 ? 1.473   10.123  -4.401  1.00 0.00 ? 89  HIS A CB   5  
ATOM   5657  C  CG   . HIS A 1 25 ? 0.946   11.486  -4.073  1.00 0.00 ? 89  HIS A CG   5  
ATOM   5658  N  ND1  . HIS A 1 25 ? 0.411   11.811  -2.844  1.00 0.00 ? 89  HIS A ND1  5  
ATOM   5659  C  CD2  . HIS A 1 25 ? 0.875   12.611  -4.822  1.00 0.00 ? 89  HIS A CD2  5  
ATOM   5660  C  CE1  . HIS A 1 25 ? 0.032   13.076  -2.852  1.00 0.00 ? 89  HIS A CE1  5  
ATOM   5661  N  NE2  . HIS A 1 25 ? 0.303   13.585  -4.041  1.00 0.00 ? 89  HIS A NE2  5  
ATOM   5662  H  H    . HIS A 1 25 ? 0.626   8.878   -2.343  1.00 0.00 ? 89  HIS A H    5  
ATOM   5663  H  HA   . HIS A 1 25 ? -0.495  9.450   -4.903  1.00 0.00 ? 89  HIS A HA   5  
ATOM   5664  H  HB2  . HIS A 1 25 ? 2.205   9.862   -3.651  1.00 0.00 ? 89  HIS A HB2  5  
ATOM   5665  H  HB3  . HIS A 1 25 ? 1.956   10.176  -5.366  1.00 0.00 ? 89  HIS A HB3  5  
ATOM   5666  H  HD1  . HIS A 1 25 ? 0.321   11.203  -2.081  1.00 0.00 ? 89  HIS A HD1  5  
ATOM   5667  H  HD2  . HIS A 1 25 ? 1.205   12.723  -5.845  1.00 0.00 ? 89  HIS A HD2  5  
ATOM   5668  H  HE1  . HIS A 1 25 ? -0.421  13.606  -2.028  1.00 0.00 ? 89  HIS A HE1  5  
ATOM   5669  N  N    . ALA A 1 26 ? -0.069  7.132   -5.863  1.00 0.00 ? 90  ALA A N    5  
ATOM   5670  C  CA   . ALA A 1 26 ? 0.260   5.972   -6.682  1.00 0.00 ? 90  ALA A CA   5  
ATOM   5671  C  C    . ALA A 1 26 ? 0.051   6.268   -8.163  1.00 0.00 ? 90  ALA A C    5  
ATOM   5672  O  O    . ALA A 1 26 ? -0.461  7.326   -8.529  1.00 0.00 ? 90  ALA A O    5  
ATOM   5673  C  CB   . ALA A 1 26 ? -0.575  4.772   -6.259  1.00 0.00 ? 90  ALA A CB   5  
ATOM   5674  H  H    . ALA A 1 26 ? -1.008  7.386   -5.751  1.00 0.00 ? 90  ALA A H    5  
ATOM   5675  H  HA   . ALA A 1 26 ? 1.301   5.731   -6.517  1.00 0.00 ? 90  ALA A HA   5  
ATOM   5676  H  HB1  . ALA A 1 26 ? -0.164  3.875   -6.697  1.00 0.00 ? 90  ALA A HB1  5  
ATOM   5677  H  HB2  . ALA A 1 26 ? -0.560  4.687   -5.182  1.00 0.00 ? 90  ALA A HB2  5  
ATOM   5678  H  HB3  . ALA A 1 26 ? -1.592  4.905   -6.596  1.00 0.00 ? 90  ALA A HB3  5  
ATOM   5679  N  N    . CYS A 1 27 ? 0.452   5.327   -9.012  1.00 0.00 ? 91  CYS A N    5  
ATOM   5680  C  CA   . CYS A 1 27 ? 0.309   5.487   -10.454 1.00 0.00 ? 91  CYS A CA   5  
ATOM   5681  C  C    . CYS A 1 27 ? -0.924  4.748   -10.965 1.00 0.00 ? 91  CYS A C    5  
ATOM   5682  O  O    . CYS A 1 27 ? -1.391  3.796   -10.341 1.00 0.00 ? 91  CYS A O    5  
ATOM   5683  C  CB   . CYS A 1 27 ? 1.559   4.973   -11.171 1.00 0.00 ? 91  CYS A CB   5  
ATOM   5684  S  SG   . CYS A 1 27 ? 1.762   3.163   -11.105 1.00 0.00 ? 91  CYS A SG   5  
ATOM   5685  H  H    . CYS A 1 27 ? 0.853   4.504   -8.660  1.00 0.00 ? 91  CYS A H    5  
ATOM   5686  H  HA   . CYS A 1 27 ? 0.194   6.540   -10.662 1.00 0.00 ? 91  CYS A HA   5  
ATOM   5687  H  HB2  . CYS A 1 27 ? 1.511   5.259   -12.212 1.00 0.00 ? 91  CYS A HB2  5  
ATOM   5688  H  HB3  . CYS A 1 27 ? 2.433   5.419   -10.721 1.00 0.00 ? 91  CYS A HB3  5  
ATOM   5689  N  N    . GLU A 1 28 ? -1.446  5.194   -12.103 1.00 0.00 ? 92  GLU A N    5  
ATOM   5690  C  CA   . GLU A 1 28 ? -2.625  4.575   -12.696 1.00 0.00 ? 92  GLU A CA   5  
ATOM   5691  C  C    . GLU A 1 28 ? -2.464  3.060   -12.774 1.00 0.00 ? 92  GLU A C    5  
ATOM   5692  O  O    . GLU A 1 28 ? -3.445  2.318   -12.754 1.00 0.00 ? 92  GLU A O    5  
ATOM   5693  C  CB   . GLU A 1 28 ? -2.879  5.144   -14.094 1.00 0.00 ? 92  GLU A CB   5  
ATOM   5694  C  CG   . GLU A 1 28 ? -1.662  5.090   -15.003 1.00 0.00 ? 92  GLU A CG   5  
ATOM   5695  C  CD   . GLU A 1 28 ? -1.964  5.564   -16.411 1.00 0.00 ? 92  GLU A CD   5  
ATOM   5696  O  OE1  . GLU A 1 28 ? -2.963  5.093   -16.994 1.00 0.00 ? 92  GLU A OE1  5  
ATOM   5697  O  OE2  . GLU A 1 28 ? -1.201  6.405   -16.930 1.00 0.00 ? 92  GLU A OE2  5  
ATOM   5698  H  H    . GLU A 1 28 ? -1.029  5.958   -12.554 1.00 0.00 ? 92  GLU A H    5  
ATOM   5699  H  HA   . GLU A 1 28 ? -3.472  4.803   -12.067 1.00 0.00 ? 92  GLU A HA   5  
ATOM   5700  H  HB2  . GLU A 1 28 ? -3.675  4.582   -14.559 1.00 0.00 ? 92  GLU A HB2  5  
ATOM   5701  H  HB3  . GLU A 1 28 ? -3.186  6.175   -13.999 1.00 0.00 ? 92  GLU A HB3  5  
ATOM   5702  H  HG2  . GLU A 1 28 ? -0.890  5.720   -14.586 1.00 0.00 ? 92  GLU A HG2  5  
ATOM   5703  H  HG3  . GLU A 1 28 ? -1.308  4.071   -15.049 1.00 0.00 ? 92  GLU A HG3  5  
ATOM   5704  N  N    . GLY A 1 29 ? -1.216  2.607   -12.862 1.00 0.00 ? 93  GLY A N    5  
ATOM   5705  C  CA   . GLY A 1 29 ? -0.948  1.183   -12.941 1.00 0.00 ? 93  GLY A CA   5  
ATOM   5706  C  C    . GLY A 1 29 ? -1.183  0.474   -11.622 1.00 0.00 ? 93  GLY A C    5  
ATOM   5707  O  O    . GLY A 1 29 ? -1.653  -0.664  -11.595 1.00 0.00 ? 93  GLY A O    5  
ATOM   5708  H  H    . GLY A 1 29 ? -0.473  3.245   -12.873 1.00 0.00 ? 93  GLY A H    5  
ATOM   5709  H  HA2  . GLY A 1 29 ? -1.591  0.748   -13.692 1.00 0.00 ? 93  GLY A HA2  5  
ATOM   5710  H  HA3  . GLY A 1 29 ? 0.081   1.038   -13.236 1.00 0.00 ? 93  GLY A HA3  5  
ATOM   5711  N  N    . CYS A 1 30 ? -0.854  1.146   -10.524 1.00 0.00 ? 94  CYS A N    5  
ATOM   5712  C  CA   . CYS A 1 30 ? -1.029  0.574   -9.195  1.00 0.00 ? 94  CYS A CA   5  
ATOM   5713  C  C    . CYS A 1 30 ? -2.447  0.811   -8.684  1.00 0.00 ? 94  CYS A C    5  
ATOM   5714  O  O    . CYS A 1 30 ? -3.021  -0.035  -7.997  1.00 0.00 ? 94  CYS A O    5  
ATOM   5715  C  CB   . CYS A 1 30 ? -0.016  1.176   -8.220  1.00 0.00 ? 94  CYS A CB   5  
ATOM   5716  S  SG   . CYS A 1 30 ? 1.696   0.611   -8.483  1.00 0.00 ? 94  CYS A SG   5  
ATOM   5717  H  H    . CYS A 1 30 ? -0.483  2.050   -10.610 1.00 0.00 ? 94  CYS A H    5  
ATOM   5718  H  HA   . CYS A 1 30 ? -0.859  -0.490  -9.267  1.00 0.00 ? 94  CYS A HA   5  
ATOM   5719  H  HB2  . CYS A 1 30 ? -0.025  2.251   -8.321  1.00 0.00 ? 94  CYS A HB2  5  
ATOM   5720  H  HB3  . CYS A 1 30 ? -0.298  0.912   -7.211  1.00 0.00 ? 94  CYS A HB3  5  
ATOM   5721  N  N    . LYS A 1 31 ? -3.007  1.967   -9.023  1.00 0.00 ? 95  LYS A N    5  
ATOM   5722  C  CA   . LYS A 1 31 ? -4.358  2.317   -8.600  1.00 0.00 ? 95  LYS A CA   5  
ATOM   5723  C  C    . LYS A 1 31 ? -5.333  1.182   -8.900  1.00 0.00 ? 95  LYS A C    5  
ATOM   5724  O  O    . LYS A 1 31 ? -6.139  0.803   -8.052  1.00 0.00 ? 95  LYS A O    5  
ATOM   5725  C  CB   . LYS A 1 31 ? -4.818  3.597   -9.301  1.00 0.00 ? 95  LYS A CB   5  
ATOM   5726  C  CG   . LYS A 1 31 ? -6.306  3.622   -9.607  1.00 0.00 ? 95  LYS A CG   5  
ATOM   5727  C  CD   . LYS A 1 31 ? -6.721  4.936   -10.247 1.00 0.00 ? 95  LYS A CD   5  
ATOM   5728  C  CE   . LYS A 1 31 ? -7.225  5.927   -9.209  1.00 0.00 ? 95  LYS A CE   5  
ATOM   5729  N  NZ   . LYS A 1 31 ? -8.684  5.770   -8.955  1.00 0.00 ? 95  LYS A NZ   5  
ATOM   5730  H  H    . LYS A 1 31 ? -2.499  2.601   -9.572  1.00 0.00 ? 95  LYS A H    5  
ATOM   5731  H  HA   . LYS A 1 31 ? -4.339  2.487   -7.535  1.00 0.00 ? 95  LYS A HA   5  
ATOM   5732  H  HB2  . LYS A 1 31 ? -4.587  4.442   -8.669  1.00 0.00 ? 95  LYS A HB2  5  
ATOM   5733  H  HB3  . LYS A 1 31 ? -4.279  3.698   -10.232 1.00 0.00 ? 95  LYS A HB3  5  
ATOM   5734  H  HG2  . LYS A 1 31 ? -6.538  2.815   -10.285 1.00 0.00 ? 95  LYS A HG2  5  
ATOM   5735  H  HG3  . LYS A 1 31 ? -6.855  3.491   -8.686  1.00 0.00 ? 95  LYS A HG3  5  
ATOM   5736  H  HD2  . LYS A 1 31 ? -5.870  5.365   -10.754 1.00 0.00 ? 95  LYS A HD2  5  
ATOM   5737  H  HD3  . LYS A 1 31 ? -7.509  4.745   -10.962 1.00 0.00 ? 95  LYS A HD3  5  
ATOM   5738  H  HE2  . LYS A 1 31 ? -6.688  5.766   -8.287  1.00 0.00 ? 95  LYS A HE2  5  
ATOM   5739  H  HE3  . LYS A 1 31 ? -7.036  6.929   -9.565  1.00 0.00 ? 95  LYS A HE3  5  
ATOM   5740  H  HZ1  . LYS A 1 31 ? -9.077  6.654   -8.574  1.00 0.00 ? 95  LYS A HZ1  5  
ATOM   5741  H  HZ2  . LYS A 1 31 ? -8.846  5.006   -8.268  1.00 0.00 ? 95  LYS A HZ2  5  
ATOM   5742  H  HZ3  . LYS A 1 31 ? -9.178  5.536   -9.839  1.00 0.00 ? 95  LYS A HZ3  5  
ATOM   5743  N  N    . GLY A 1 32 ? -5.252  0.643   -10.113 1.00 0.00 ? 96  GLY A N    5  
ATOM   5744  C  CA   . GLY A 1 32 ? -6.131  -0.443  -10.502 1.00 0.00 ? 96  GLY A CA   5  
ATOM   5745  C  C    . GLY A 1 32 ? -5.943  -1.678  -9.643  1.00 0.00 ? 96  GLY A C    5  
ATOM   5746  O  O    . GLY A 1 32 ? -6.906  -2.211  -9.091  1.00 0.00 ? 96  GLY A O    5  
ATOM   5747  H  H    . GLY A 1 32 ? -4.589  0.987   -10.749 1.00 0.00 ? 96  GLY A H    5  
ATOM   5748  H  HA2  . GLY A 1 32 ? -7.155  -0.111  -10.418 1.00 0.00 ? 96  GLY A HA2  5  
ATOM   5749  H  HA3  . GLY A 1 32 ? -5.931  -0.702  -11.532 1.00 0.00 ? 96  GLY A HA3  5  
ATOM   5750  N  N    . PHE A 1 33 ? -4.700  -2.134  -9.530  1.00 0.00 ? 97  PHE A N    5  
ATOM   5751  C  CA   . PHE A 1 33 ? -4.389  -3.315  -8.734  1.00 0.00 ? 97  PHE A CA   5  
ATOM   5752  C  C    . PHE A 1 33 ? -5.165  -3.305  -7.420  1.00 0.00 ? 97  PHE A C    5  
ATOM   5753  O  O    . PHE A 1 33 ? -6.044  -4.138  -7.198  1.00 0.00 ? 97  PHE A O    5  
ATOM   5754  C  CB   . PHE A 1 33 ? -2.887  -3.385  -8.452  1.00 0.00 ? 97  PHE A CB   5  
ATOM   5755  C  CG   . PHE A 1 33 ? -2.526  -4.358  -7.366  1.00 0.00 ? 97  PHE A CG   5  
ATOM   5756  C  CD1  . PHE A 1 33 ? -2.669  -5.722  -7.563  1.00 0.00 ? 97  PHE A CD1  5  
ATOM   5757  C  CD2  . PHE A 1 33 ? -2.042  -3.909  -6.147  1.00 0.00 ? 97  PHE A CD2  5  
ATOM   5758  C  CE1  . PHE A 1 33 ? -2.338  -6.619  -6.565  1.00 0.00 ? 97  PHE A CE1  5  
ATOM   5759  C  CE2  . PHE A 1 33 ? -1.709  -4.801  -5.146  1.00 0.00 ? 97  PHE A CE2  5  
ATOM   5760  C  CZ   . PHE A 1 33 ? -1.856  -6.158  -5.356  1.00 0.00 ? 97  PHE A CZ   5  
ATOM   5761  H  H    . PHE A 1 33 ? -3.975  -1.665  -9.993  1.00 0.00 ? 97  PHE A H    5  
ATOM   5762  H  HA   . PHE A 1 33 ? -4.681  -4.184  -9.303  1.00 0.00 ? 97  PHE A HA   5  
ATOM   5763  H  HB2  . PHE A 1 33 ? -2.373  -3.688  -9.351  1.00 0.00 ? 97  PHE A HB2  5  
ATOM   5764  H  HB3  . PHE A 1 33 ? -2.538  -2.408  -8.153  1.00 0.00 ? 97  PHE A HB3  5  
ATOM   5765  H  HD1  . PHE A 1 33 ? -3.044  -6.084  -8.509  1.00 0.00 ? 97  PHE A HD1  5  
ATOM   5766  H  HD2  . PHE A 1 33 ? -1.926  -2.846  -5.982  1.00 0.00 ? 97  PHE A HD2  5  
ATOM   5767  H  HE1  . PHE A 1 33 ? -2.454  -7.680  -6.732  1.00 0.00 ? 97  PHE A HE1  5  
ATOM   5768  H  HE2  . PHE A 1 33 ? -1.333  -4.437  -4.201  1.00 0.00 ? 97  PHE A HE2  5  
ATOM   5769  H  HZ   . PHE A 1 33 ? -1.597  -6.857  -4.574  1.00 0.00 ? 97  PHE A HZ   5  
ATOM   5770  N  N    . PHE A 1 34 ? -4.832  -2.356  -6.551  1.00 0.00 ? 98  PHE A N    5  
ATOM   5771  C  CA   . PHE A 1 34 ? -5.496  -2.238  -5.257  1.00 0.00 ? 98  PHE A CA   5  
ATOM   5772  C  C    . PHE A 1 34 ? -6.988  -2.532  -5.382  1.00 0.00 ? 98  PHE A C    5  
ATOM   5773  O  O    . PHE A 1 34 ? -7.474  -3.548  -4.886  1.00 0.00 ? 98  PHE A O    5  
ATOM   5774  C  CB   . PHE A 1 34 ? -5.288  -0.836  -4.680  1.00 0.00 ? 98  PHE A CB   5  
ATOM   5775  C  CG   . PHE A 1 34 ? -5.879  -0.658  -3.311  1.00 0.00 ? 98  PHE A CG   5  
ATOM   5776  C  CD1  . PHE A 1 34 ? -5.323  -1.296  -2.214  1.00 0.00 ? 98  PHE A CD1  5  
ATOM   5777  C  CD2  . PHE A 1 34 ? -6.990  0.148   -3.121  1.00 0.00 ? 98  PHE A CD2  5  
ATOM   5778  C  CE1  . PHE A 1 34 ? -5.864  -1.133  -0.952  1.00 0.00 ? 98  PHE A CE1  5  
ATOM   5779  C  CE2  . PHE A 1 34 ? -7.535  0.314   -1.862  1.00 0.00 ? 98  PHE A CE2  5  
ATOM   5780  C  CZ   . PHE A 1 34 ? -6.972  -0.328  -0.776  1.00 0.00 ? 98  PHE A CZ   5  
ATOM   5781  H  H    . PHE A 1 34 ? -4.123  -1.721  -6.784  1.00 0.00 ? 98  PHE A H    5  
ATOM   5782  H  HA   . PHE A 1 34 ? -5.053  -2.961  -4.591  1.00 0.00 ? 98  PHE A HA   5  
ATOM   5783  H  HB2  . PHE A 1 34 ? -4.229  -0.635  -4.613  1.00 0.00 ? 98  PHE A HB2  5  
ATOM   5784  H  HB3  . PHE A 1 34 ? -5.746  -0.112  -5.338  1.00 0.00 ? 98  PHE A HB3  5  
ATOM   5785  H  HD1  . PHE A 1 34 ? -4.456  -1.927  -2.351  1.00 0.00 ? 98  PHE A HD1  5  
ATOM   5786  H  HD2  . PHE A 1 34 ? -7.432  0.650   -3.969  1.00 0.00 ? 98  PHE A HD2  5  
ATOM   5787  H  HE1  . PHE A 1 34 ? -5.421  -1.637  -0.106  1.00 0.00 ? 98  PHE A HE1  5  
ATOM   5788  H  HE2  . PHE A 1 34 ? -8.401  0.944   -1.727  1.00 0.00 ? 98  PHE A HE2  5  
ATOM   5789  H  HZ   . PHE A 1 34 ? -7.396  -0.199  0.208   1.00 0.00 ? 98  PHE A HZ   5  
ATOM   5790  N  N    . ARG A 1 35 ? -7.708  -1.636  -6.049  1.00 0.00 ? 99  ARG A N    5  
ATOM   5791  C  CA   . ARG A 1 35 ? -9.145  -1.798  -6.238  1.00 0.00 ? 99  ARG A CA   5  
ATOM   5792  C  C    . ARG A 1 35 ? -9.490  -3.249  -6.560  1.00 0.00 ? 99  ARG A C    5  
ATOM   5793  O  O    . ARG A 1 35 ? -10.164 -3.924  -5.782  1.00 0.00 ? 99  ARG A O    5  
ATOM   5794  C  CB   . ARG A 1 35 ? -9.639  -0.883  -7.360  1.00 0.00 ? 99  ARG A CB   5  
ATOM   5795  C  CG   . ARG A 1 35 ? -11.108 -0.511  -7.239  1.00 0.00 ? 99  ARG A CG   5  
ATOM   5796  C  CD   . ARG A 1 35 ? -11.645 0.066   -8.540  1.00 0.00 ? 99  ARG A CD   5  
ATOM   5797  N  NE   . ARG A 1 35 ? -13.101 -0.015  -8.614  1.00 0.00 ? 99  ARG A NE   5  
ATOM   5798  C  CZ   . ARG A 1 35 ? -13.917 0.752   -7.899  1.00 0.00 ? 99  ARG A CZ   5  
ATOM   5799  N  NH1  . ARG A 1 35 ? -13.422 1.653   -7.062  1.00 0.00 ? 99  ARG A NH1  5  
ATOM   5800  N  NH2  . ARG A 1 35 ? -15.232 0.619   -8.022  1.00 0.00 ? 99  ARG A NH2  5  
ATOM   5801  H  H    . ARG A 1 35 ? -7.263  -0.846  -6.421  1.00 0.00 ? 99  ARG A H    5  
ATOM   5802  H  HA   . ARG A 1 35 ? -9.634  -1.520  -5.316  1.00 0.00 ? 99  ARG A HA   5  
ATOM   5803  H  HB2  . ARG A 1 35 ? -9.058  0.027   -7.349  1.00 0.00 ? 99  ARG A HB2  5  
ATOM   5804  H  HB3  . ARG A 1 35 ? -9.493  -1.383  -8.305  1.00 0.00 ? 99  ARG A HB3  5  
ATOM   5805  H  HG2  . ARG A 1 35 ? -11.675 -1.395  -6.990  1.00 0.00 ? 99  ARG A HG2  5  
ATOM   5806  H  HG3  . ARG A 1 35 ? -11.220 0.224   -6.456  1.00 0.00 ? 99  ARG A HG3  5  
ATOM   5807  H  HD2  . ARG A 1 35 ? -11.348 1.102   -8.608  1.00 0.00 ? 99  ARG A HD2  5  
ATOM   5808  H  HD3  . ARG A 1 35 ? -11.220 -0.486  -9.365  1.00 0.00 ? 99  ARG A HD3  5  
ATOM   5809  H  HE   . ARG A 1 35 ? -13.489 -0.673  -9.227  1.00 0.00 ? 99  ARG A HE   5  
ATOM   5810  H  HH11 . ARG A 1 35 ? -12.432 1.756   -6.968  1.00 0.00 ? 99  ARG A HH11 5  
ATOM   5811  H  HH12 . ARG A 1 35 ? -14.039 2.230   -6.526  1.00 0.00 ? 99  ARG A HH12 5  
ATOM   5812  H  HH21 . ARG A 1 35 ? -15.609 -0.058  -8.653  1.00 0.00 ? 99  ARG A HH21 5  
ATOM   5813  H  HH22 . ARG A 1 35 ? -15.845 1.197   -7.484  1.00 0.00 ? 99  ARG A HH22 5  
ATOM   5814  N  N    . ARG A 1 36 ? -9.024  -3.721  -7.712  1.00 0.00 ? 100 ARG A N    5  
ATOM   5815  C  CA   . ARG A 1 36 ? -9.286  -5.090  -8.138  1.00 0.00 ? 100 ARG A CA   5  
ATOM   5816  C  C    . ARG A 1 36 ? -9.201  -6.052  -6.957  1.00 0.00 ? 100 ARG A C    5  
ATOM   5817  O  O    . ARG A 1 36 ? -10.123 -6.830  -6.708  1.00 0.00 ? 100 ARG A O    5  
ATOM   5818  C  CB   . ARG A 1 36 ? -8.291  -5.508  -9.222  1.00 0.00 ? 100 ARG A CB   5  
ATOM   5819  C  CG   . ARG A 1 36 ? -8.382  -6.978  -9.599  1.00 0.00 ? 100 ARG A CG   5  
ATOM   5820  C  CD   . ARG A 1 36 ? -7.738  -7.248  -10.950 1.00 0.00 ? 100 ARG A CD   5  
ATOM   5821  N  NE   . ARG A 1 36 ? -7.642  -8.677  -11.235 1.00 0.00 ? 100 ARG A NE   5  
ATOM   5822  C  CZ   . ARG A 1 36 ? -7.021  -9.174  -12.299 1.00 0.00 ? 100 ARG A CZ   5  
ATOM   5823  N  NH1  . ARG A 1 36 ? -6.444  -8.362  -13.173 1.00 0.00 ? 100 ARG A NH1  5  
ATOM   5824  N  NH2  . ARG A 1 36 ? -6.976  -10.486 -12.489 1.00 0.00 ? 100 ARG A NH2  5  
ATOM   5825  H  H    . ARG A 1 36 ? -8.493  -3.134  -8.289  1.00 0.00 ? 100 ARG A H    5  
ATOM   5826  H  HA   . ARG A 1 36 ? -10.285 -5.126  -8.546  1.00 0.00 ? 100 ARG A HA   5  
ATOM   5827  H  HB2  . ARG A 1 36 ? -8.474  -4.920  -10.109 1.00 0.00 ? 100 ARG A HB2  5  
ATOM   5828  H  HB3  . ARG A 1 36 ? -7.289  -5.311  -8.870  1.00 0.00 ? 100 ARG A HB3  5  
ATOM   5829  H  HG2  . ARG A 1 36 ? -7.875  -7.565  -8.848  1.00 0.00 ? 100 ARG A HG2  5  
ATOM   5830  H  HG3  . ARG A 1 36 ? -9.422  -7.264  -9.642  1.00 0.00 ? 100 ARG A HG3  5  
ATOM   5831  H  HD2  . ARG A 1 36 ? -8.333  -6.777  -11.718 1.00 0.00 ? 100 ARG A HD2  5  
ATOM   5832  H  HD3  . ARG A 1 36 ? -6.746  -6.822  -10.952 1.00 0.00 ? 100 ARG A HD3  5  
ATOM   5833  H  HE   . ARG A 1 36 ? -8.062  -9.295  -10.601 1.00 0.00 ? 100 ARG A HE   5  
ATOM   5834  H  HH11 . ARG A 1 36 ? -6.475  -7.373  -13.032 1.00 0.00 ? 100 ARG A HH11 5  
ATOM   5835  H  HH12 . ARG A 1 36 ? -5.975  -8.739  -13.973 1.00 0.00 ? 100 ARG A HH12 5  
ATOM   5836  H  HH21 . ARG A 1 36 ? -7.410  -11.102 -11.832 1.00 0.00 ? 100 ARG A HH21 5  
ATOM   5837  H  HH22 . ARG A 1 36 ? -6.509  -10.860 -13.290 1.00 0.00 ? 100 ARG A HH22 5  
ATOM   5838  N  N    . THR A 1 37 ? -8.088  -5.995  -6.232  1.00 0.00 ? 101 THR A N    5  
ATOM   5839  C  CA   . THR A 1 37 ? -7.882  -6.862  -5.078  1.00 0.00 ? 101 THR A CA   5  
ATOM   5840  C  C    . THR A 1 37 ? -9.069  -6.797  -4.123  1.00 0.00 ? 101 THR A C    5  
ATOM   5841  O  O    . THR A 1 37 ? -9.549  -7.826  -3.645  1.00 0.00 ? 101 THR A O    5  
ATOM   5842  C  CB   . THR A 1 37 ? -6.601  -6.483  -4.313  1.00 0.00 ? 101 THR A CB   5  
ATOM   5843  O  OG1  . THR A 1 37 ? -5.490  -6.424  -5.215  1.00 0.00 ? 101 THR A OG1  5  
ATOM   5844  C  CG2  . THR A 1 37 ? -6.311  -7.490  -3.210  1.00 0.00 ? 101 THR A CG2  5  
ATOM   5845  H  H    . THR A 1 37 ? -7.390  -5.354  -6.480  1.00 0.00 ? 101 THR A H    5  
ATOM   5846  H  HA   . THR A 1 37 ? -7.776  -7.875  -5.437  1.00 0.00 ? 101 THR A HA   5  
ATOM   5847  H  HB   . THR A 1 37 ? -6.742  -5.510  -3.864  1.00 0.00 ? 101 THR A HB   5  
ATOM   5848  H  HG1  . THR A 1 37 ? -5.598  -5.675  -5.807  1.00 0.00 ? 101 THR A HG1  5  
ATOM   5849  H  HG21 . THR A 1 37 ? -5.246  -7.650  -3.139  1.00 0.00 ? 101 THR A HG21 5  
ATOM   5850  H  HG22 . THR A 1 37 ? -6.801  -8.425  -3.439  1.00 0.00 ? 101 THR A HG22 5  
ATOM   5851  H  HG23 . THR A 1 37 ? -6.682  -7.110  -2.269  1.00 0.00 ? 101 THR A HG23 5  
ATOM   5852  N  N    . ILE A 1 38 ? -9.537  -5.584  -3.850  1.00 0.00 ? 102 ILE A N    5  
ATOM   5853  C  CA   . ILE A 1 38 ? -10.669 -5.387  -2.953  1.00 0.00 ? 102 ILE A CA   5  
ATOM   5854  C  C    . ILE A 1 38 ? -11.952 -5.948  -3.556  1.00 0.00 ? 102 ILE A C    5  
ATOM   5855  O  O    . ILE A 1 38 ? -12.534 -6.897  -3.029  1.00 0.00 ? 102 ILE A O    5  
ATOM   5856  C  CB   . ILE A 1 38 ? -10.877 -3.896  -2.628  1.00 0.00 ? 102 ILE A CB   5  
ATOM   5857  C  CG1  . ILE A 1 38 ? -9.615  -3.310  -1.991  1.00 0.00 ? 102 ILE A CG1  5  
ATOM   5858  C  CG2  . ILE A 1 38 ? -12.074 -3.717  -1.707  1.00 0.00 ? 102 ILE A CG2  5  
ATOM   5859  C  CD1  . ILE A 1 38 ? -9.057  -4.154  -0.867  1.00 0.00 ? 102 ILE A CD1  5  
ATOM   5860  H  H    . ILE A 1 38 ? -9.112  -4.804  -4.262  1.00 0.00 ? 102 ILE A H    5  
ATOM   5861  H  HA   . ILE A 1 38 ? -10.458 -5.910  -2.031  1.00 0.00 ? 102 ILE A HA   5  
ATOM   5862  H  HB   . ILE A 1 38 ? -11.082 -3.375  -3.551  1.00 0.00 ? 102 ILE A HB   5  
ATOM   5863  H  HG12 . ILE A 1 38 ? -8.850  -3.215  -2.745  1.00 0.00 ? 102 ILE A HG12 5  
ATOM   5864  H  HG13 . ILE A 1 38 ? -9.844  -2.332  -1.592  1.00 0.00 ? 102 ILE A HG13 5  
ATOM   5865  H  HG21 . ILE A 1 38 ? -12.964 -4.080  -2.198  1.00 0.00 ? 102 ILE A HG21 5  
ATOM   5866  H  HG22 . ILE A 1 38 ? -11.914 -4.275  -0.796  1.00 0.00 ? 102 ILE A HG22 5  
ATOM   5867  H  HG23 . ILE A 1 38 ? -12.195 -2.670  -1.472  1.00 0.00 ? 102 ILE A HG23 5  
ATOM   5868  H  HD11 . ILE A 1 38 ? -8.390  -4.900  -1.275  1.00 0.00 ? 102 ILE A HD11 5  
ATOM   5869  H  HD12 . ILE A 1 38 ? -8.514  -3.524  -0.179  1.00 0.00 ? 102 ILE A HD12 5  
ATOM   5870  H  HD13 . ILE A 1 38 ? -9.867  -4.643  -0.347  1.00 0.00 ? 102 ILE A HD13 5  
ATOM   5871  N  N    . ARG A 1 39 ? -12.387 -5.357  -4.663  1.00 0.00 ? 103 ARG A N    5  
ATOM   5872  C  CA   . ARG A 1 39 ? -13.602 -5.798  -5.339  1.00 0.00 ? 103 ARG A CA   5  
ATOM   5873  C  C    . ARG A 1 39 ? -13.585 -7.308  -5.556  1.00 0.00 ? 103 ARG A C    5  
ATOM   5874  O  O    . ARG A 1 39 ? -14.634 -7.951  -5.598  1.00 0.00 ? 103 ARG A O    5  
ATOM   5875  C  CB   . ARG A 1 39 ? -13.753 -5.081  -6.681  1.00 0.00 ? 103 ARG A CB   5  
ATOM   5876  C  CG   . ARG A 1 39 ? -12.579 -5.295  -7.622  1.00 0.00 ? 103 ARG A CG   5  
ATOM   5877  C  CD   . ARG A 1 39 ? -13.015 -5.243  -9.078  1.00 0.00 ? 103 ARG A CD   5  
ATOM   5878  N  NE   . ARG A 1 39 ? -12.960 -3.887  -9.618  1.00 0.00 ? 103 ARG A NE   5  
ATOM   5879  C  CZ   . ARG A 1 39 ? -13.123 -3.601  -10.905 1.00 0.00 ? 103 ARG A CZ   5  
ATOM   5880  N  NH1  . ARG A 1 39 ? -13.350 -4.571  -11.779 1.00 0.00 ? 103 ARG A NH1  5  
ATOM   5881  N  NH2  . ARG A 1 39 ? -13.059 -2.342  -11.319 1.00 0.00 ? 103 ARG A NH2  5  
ATOM   5882  H  H    . ARG A 1 39 ? -11.880 -4.605  -5.035  1.00 0.00 ? 103 ARG A H    5  
ATOM   5883  H  HA   . ARG A 1 39 ? -14.442 -5.546  -4.709  1.00 0.00 ? 103 ARG A HA   5  
ATOM   5884  H  HB2  . ARG A 1 39 ? -14.647 -5.440  -7.170  1.00 0.00 ? 103 ARG A HB2  5  
ATOM   5885  H  HB3  . ARG A 1 39 ? -13.853 -4.021  -6.500  1.00 0.00 ? 103 ARG A HB3  5  
ATOM   5886  H  HG2  . ARG A 1 39 ? -11.845 -4.521  -7.450  1.00 0.00 ? 103 ARG A HG2  5  
ATOM   5887  H  HG3  . ARG A 1 39 ? -12.140 -6.261  -7.421  1.00 0.00 ? 103 ARG A HG3  5  
ATOM   5888  H  HD2  . ARG A 1 39 ? -12.362 -5.877  -9.659  1.00 0.00 ? 103 ARG A HD2  5  
ATOM   5889  H  HD3  . ARG A 1 39 ? -14.028 -5.608  -9.150  1.00 0.00 ? 103 ARG A HD3  5  
ATOM   5890  H  HE   . ARG A 1 39 ? -12.793 -3.155  -8.989  1.00 0.00 ? 103 ARG A HE   5  
ATOM   5891  H  HH11 . ARG A 1 39 ? -13.400 -5.520  -11.470 1.00 0.00 ? 103 ARG A HH11 5  
ATOM   5892  H  HH12 . ARG A 1 39 ? -13.474 -4.353  -12.748 1.00 0.00 ? 103 ARG A HH12 5  
ATOM   5893  H  HH21 . ARG A 1 39 ? -12.888 -1.608  -10.662 1.00 0.00 ? 103 ARG A HH21 5  
ATOM   5894  H  HH22 . ARG A 1 39 ? -13.182 -2.128  -12.287 1.00 0.00 ? 103 ARG A HH22 5  
ATOM   5895  N  N    . MET A 1 40 ? -12.387 -7.868  -5.692  1.00 0.00 ? 104 MET A N    5  
ATOM   5896  C  CA   . MET A 1 40 ? -12.235 -9.303  -5.904  1.00 0.00 ? 104 MET A CA   5  
ATOM   5897  C  C    . MET A 1 40 ? -11.957 -10.020 -4.587  1.00 0.00 ? 104 MET A C    5  
ATOM   5898  O  O    . MET A 1 40 ? -12.074 -11.243 -4.497  1.00 0.00 ? 104 MET A O    5  
ATOM   5899  C  CB   . MET A 1 40 ? -11.102 -9.576  -6.895  1.00 0.00 ? 104 MET A CB   5  
ATOM   5900  C  CG   . MET A 1 40 ? -11.381 -9.053  -8.295  1.00 0.00 ? 104 MET A CG   5  
ATOM   5901  S  SD   . MET A 1 40 ? -10.342 -9.830  -9.547  1.00 0.00 ? 104 MET A SD   5  
ATOM   5902  C  CE   . MET A 1 40 ? -11.549 -10.825 -10.419 1.00 0.00 ? 104 MET A CE   5  
ATOM   5903  H  H    . MET A 1 40 ? -11.587 -7.304  -5.649  1.00 0.00 ? 104 MET A H    5  
ATOM   5904  H  HA   . MET A 1 40 ? -13.160 -9.677  -6.316  1.00 0.00 ? 104 MET A HA   5  
ATOM   5905  H  HB2  . MET A 1 40 ? -10.200 -9.107  -6.532  1.00 0.00 ? 104 MET A HB2  5  
ATOM   5906  H  HB3  . MET A 1 40 ? -10.943 -10.642 -6.958  1.00 0.00 ? 104 MET A HB3  5  
ATOM   5907  H  HG2  . MET A 1 40 ? -12.415 -9.244  -8.538  1.00 0.00 ? 104 MET A HG2  5  
ATOM   5908  H  HG3  . MET A 1 40 ? -11.201 -7.988  -8.308  1.00 0.00 ? 104 MET A HG3  5  
ATOM   5909  H  HE1  . MET A 1 40 ? -12.026 -11.502 -9.725  1.00 0.00 ? 104 MET A HE1  5  
ATOM   5910  H  HE2  . MET A 1 40 ? -12.294 -10.181 -10.863 1.00 0.00 ? 104 MET A HE2  5  
ATOM   5911  H  HE3  . MET A 1 40 ? -11.055 -11.393 -11.194 1.00 0.00 ? 104 MET A HE3  5  
ATOM   5912  N  N    . LYS A 1 41 ? -11.588 -9.253  -3.567  1.00 0.00 ? 105 LYS A N    5  
ATOM   5913  C  CA   . LYS A 1 41 ? -11.294 -9.814  -2.253  1.00 0.00 ? 105 LYS A CA   5  
ATOM   5914  C  C    . LYS A 1 41 ? -10.311 -10.975 -2.365  1.00 0.00 ? 105 LYS A C    5  
ATOM   5915  O  O    . LYS A 1 41 ? -10.475 -12.007 -1.713  1.00 0.00 ? 105 LYS A O    5  
ATOM   5916  C  CB   . LYS A 1 41 ? -12.583 -10.288 -1.578  1.00 0.00 ? 105 LYS A CB   5  
ATOM   5917  C  CG   . LYS A 1 41 ? -13.363 -9.172  -0.905  1.00 0.00 ? 105 LYS A CG   5  
ATOM   5918  C  CD   . LYS A 1 41 ? -12.729 -8.766  0.414   1.00 0.00 ? 105 LYS A CD   5  
ATOM   5919  C  CE   . LYS A 1 41 ? -12.977 -9.806  1.496   1.00 0.00 ? 105 LYS A CE   5  
ATOM   5920  N  NZ   . LYS A 1 41 ? -12.490 -9.350  2.827   1.00 0.00 ? 105 LYS A NZ   5  
ATOM   5921  H  H    . LYS A 1 41 ? -11.512 -8.284  -3.700  1.00 0.00 ? 105 LYS A H    5  
ATOM   5922  H  HA   . LYS A 1 41 ? -10.848 -9.037  -1.652  1.00 0.00 ? 105 LYS A HA   5  
ATOM   5923  H  HB2  . LYS A 1 41 ? -13.219 -10.744 -2.323  1.00 0.00 ? 105 LYS A HB2  5  
ATOM   5924  H  HB3  . LYS A 1 41 ? -12.333 -11.026 -0.830  1.00 0.00 ? 105 LYS A HB3  5  
ATOM   5925  H  HG2  . LYS A 1 41 ? -13.385 -8.314  -1.561  1.00 0.00 ? 105 LYS A HG2  5  
ATOM   5926  H  HG3  . LYS A 1 41 ? -14.372 -9.511  -0.720  1.00 0.00 ? 105 LYS A HG3  5  
ATOM   5927  H  HD2  . LYS A 1 41 ? -11.664 -8.657  0.274   1.00 0.00 ? 105 LYS A HD2  5  
ATOM   5928  H  HD3  . LYS A 1 41 ? -13.150 -7.822  0.731   1.00 0.00 ? 105 LYS A HD3  5  
ATOM   5929  H  HE2  . LYS A 1 41 ? -14.037 -9.997  1.556   1.00 0.00 ? 105 LYS A HE2  5  
ATOM   5930  H  HE3  . LYS A 1 41 ? -12.462 -10.716 1.226   1.00 0.00 ? 105 LYS A HE3  5  
ATOM   5931  H  HZ1  . LYS A 1 41 ? -13.245 -8.841  3.329   1.00 0.00 ? 105 LYS A HZ1  5  
ATOM   5932  H  HZ2  . LYS A 1 41 ? -11.676 -8.712  2.710   1.00 0.00 ? 105 LYS A HZ2  5  
ATOM   5933  H  HZ3  . LYS A 1 41 ? -12.196 -10.167 3.399   1.00 0.00 ? 105 LYS A HZ3  5  
ATOM   5934  N  N    . LEU A 1 42 ? -9.288  -10.799 -3.194  1.00 0.00 ? 106 LEU A N    5  
ATOM   5935  C  CA   . LEU A 1 42 ? -8.276  -11.832 -3.391  1.00 0.00 ? 106 LEU A CA   5  
ATOM   5936  C  C    . LEU A 1 42 ? -7.401  -11.979 -2.150  1.00 0.00 ? 106 LEU A C    5  
ATOM   5937  O  O    . LEU A 1 42 ? -6.710  -11.043 -1.752  1.00 0.00 ? 106 LEU A O    5  
ATOM   5938  C  CB   . LEU A 1 42 ? -7.407  -11.498 -4.605  1.00 0.00 ? 106 LEU A CB   5  
ATOM   5939  C  CG   . LEU A 1 42 ? -8.152  -11.272 -5.921  1.00 0.00 ? 106 LEU A CG   5  
ATOM   5940  C  CD1  . LEU A 1 42 ? -7.230  -10.646 -6.955  1.00 0.00 ? 106 LEU A CD1  5  
ATOM   5941  C  CD2  . LEU A 1 42 ? -8.727  -12.582 -6.440  1.00 0.00 ? 106 LEU A CD2  5  
ATOM   5942  H  H    . LEU A 1 42 ? -9.210  -9.956  -3.687  1.00 0.00 ? 106 LEU A H    5  
ATOM   5943  H  HA   . LEU A 1 42 ? -8.787  -12.767 -3.569  1.00 0.00 ? 106 LEU A HA   5  
ATOM   5944  H  HB2  . LEU A 1 42 ? -6.855  -10.600 -4.379  1.00 0.00 ? 106 LEU A HB2  5  
ATOM   5945  H  HB3  . LEU A 1 42 ? -6.716  -12.317 -4.751  1.00 0.00 ? 106 LEU A HB3  5  
ATOM   5946  H  HG   . LEU A 1 42 ? -8.973  -10.590 -5.750  1.00 0.00 ? 106 LEU A HG   5  
ATOM   5947  H  HD11 . LEU A 1 42 ? -7.641  -10.795 -7.942  1.00 0.00 ? 106 LEU A HD11 5  
ATOM   5948  H  HD12 . LEU A 1 42 ? -6.256  -11.109 -6.897  1.00 0.00 ? 106 LEU A HD12 5  
ATOM   5949  H  HD13 . LEU A 1 42 ? -7.136  -9.587  -6.760  1.00 0.00 ? 106 LEU A HD13 5  
ATOM   5950  H  HD21 . LEU A 1 42 ? -8.022  -13.041 -7.117  1.00 0.00 ? 106 LEU A HD21 5  
ATOM   5951  H  HD22 . LEU A 1 42 ? -9.653  -12.386 -6.962  1.00 0.00 ? 106 LEU A HD22 5  
ATOM   5952  H  HD23 . LEU A 1 42 ? -8.916  -13.247 -5.610  1.00 0.00 ? 106 LEU A HD23 5  
ATOM   5953  N  N    . GLU A 1 43 ? -7.435  -13.163 -1.545  1.00 0.00 ? 107 GLU A N    5  
ATOM   5954  C  CA   . GLU A 1 43 ? -6.643  -13.433 -0.351  1.00 0.00 ? 107 GLU A CA   5  
ATOM   5955  C  C    . GLU A 1 43 ? -5.290  -14.034 -0.719  1.00 0.00 ? 107 GLU A C    5  
ATOM   5956  O  O    . GLU A 1 43 ? -5.208  -14.950 -1.538  1.00 0.00 ? 107 GLU A O    5  
ATOM   5957  C  CB   . GLU A 1 43 ? -7.397  -14.380 0.584   1.00 0.00 ? 107 GLU A CB   5  
ATOM   5958  C  CG   . GLU A 1 43 ? -7.041  -14.200 2.051   1.00 0.00 ? 107 GLU A CG   5  
ATOM   5959  C  CD   . GLU A 1 43 ? -5.552  -14.325 2.309   1.00 0.00 ? 107 GLU A CD   5  
ATOM   5960  O  OE1  . GLU A 1 43 ? -5.001  -15.422 2.080   1.00 0.00 ? 107 GLU A OE1  5  
ATOM   5961  O  OE2  . GLU A 1 43 ? -4.938  -13.326 2.739   1.00 0.00 ? 107 GLU A OE2  5  
ATOM   5962  H  H    . GLU A 1 43 ? -8.006  -13.870 -1.910  1.00 0.00 ? 107 GLU A H    5  
ATOM   5963  H  HA   . GLU A 1 43 ? -6.480  -12.495 0.158   1.00 0.00 ? 107 GLU A HA   5  
ATOM   5964  H  HB2  . GLU A 1 43 ? -8.458  -14.212 0.469   1.00 0.00 ? 107 GLU A HB2  5  
ATOM   5965  H  HB3  . GLU A 1 43 ? -7.171  -15.398 0.304   1.00 0.00 ? 107 GLU A HB3  5  
ATOM   5966  H  HG2  . GLU A 1 43 ? -7.365  -13.221 2.369   1.00 0.00 ? 107 GLU A HG2  5  
ATOM   5967  H  HG3  . GLU A 1 43 ? -7.556  -14.953 2.628   1.00 0.00 ? 107 GLU A HG3  5  
ATOM   5968  N  N    . TYR A 1 44 ? -4.232  -13.511 -0.110  1.00 0.00 ? 108 TYR A N    5  
ATOM   5969  C  CA   . TYR A 1 44 ? -2.882  -13.993 -0.375  1.00 0.00 ? 108 TYR A CA   5  
ATOM   5970  C  C    . TYR A 1 44 ? -2.242  -14.548 0.894   1.00 0.00 ? 108 TYR A C    5  
ATOM   5971  O  O    . TYR A 1 44 ? -2.793  -14.419 1.987   1.00 0.00 ? 108 TYR A O    5  
ATOM   5972  C  CB   . TYR A 1 44 ? -2.018  -12.867 -0.945  1.00 0.00 ? 108 TYR A CB   5  
ATOM   5973  C  CG   . TYR A 1 44 ? -2.590  -12.240 -2.196  1.00 0.00 ? 108 TYR A CG   5  
ATOM   5974  C  CD1  . TYR A 1 44 ? -2.742  -12.981 -3.361  1.00 0.00 ? 108 TYR A CD1  5  
ATOM   5975  C  CD2  . TYR A 1 44 ? -2.978  -10.906 -2.213  1.00 0.00 ? 108 TYR A CD2  5  
ATOM   5976  C  CE1  . TYR A 1 44 ? -3.263  -12.411 -4.507  1.00 0.00 ? 108 TYR A CE1  5  
ATOM   5977  C  CE2  . TYR A 1 44 ? -3.502  -10.328 -3.353  1.00 0.00 ? 108 TYR A CE2  5  
ATOM   5978  C  CZ   . TYR A 1 44 ? -3.642  -11.085 -4.498  1.00 0.00 ? 108 TYR A CZ   5  
ATOM   5979  O  OH   . TYR A 1 44 ? -4.163  -10.514 -5.637  1.00 0.00 ? 108 TYR A OH   5  
ATOM   5980  H  H    . TYR A 1 44 ? -4.361  -12.783 0.533   1.00 0.00 ? 108 TYR A H    5  
ATOM   5981  H  HA   . TYR A 1 44 ? -2.950  -14.786 -1.106  1.00 0.00 ? 108 TYR A HA   5  
ATOM   5982  H  HB2  . TYR A 1 44 ? -1.916  -12.090 -0.203  1.00 0.00 ? 108 TYR A HB2  5  
ATOM   5983  H  HB3  . TYR A 1 44 ? -1.041  -13.259 -1.186  1.00 0.00 ? 108 TYR A HB3  5  
ATOM   5984  H  HD1  . TYR A 1 44 ? -2.445  -14.020 -3.365  1.00 0.00 ? 108 TYR A HD1  5  
ATOM   5985  H  HD2  . TYR A 1 44 ? -2.867  -10.315 -1.315  1.00 0.00 ? 108 TYR A HD2  5  
ATOM   5986  H  HE1  . TYR A 1 44 ? -3.373  -13.004 -5.403  1.00 0.00 ? 108 TYR A HE1  5  
ATOM   5987  H  HE2  . TYR A 1 44 ? -3.798  -9.290  -3.347  1.00 0.00 ? 108 TYR A HE2  5  
ATOM   5988  H  HH   . TYR A 1 44 ? -3.643  -9.742  -5.874  1.00 0.00 ? 108 TYR A HH   5  
ATOM   5989  N  N    . GLU A 1 45 ? -1.074  -15.164 0.740   1.00 0.00 ? 109 GLU A N    5  
ATOM   5990  C  CA   . GLU A 1 45 ? -0.358  -15.738 1.874   1.00 0.00 ? 109 GLU A CA   5  
ATOM   5991  C  C    . GLU A 1 45 ? 0.681   -14.759 2.413   1.00 0.00 ? 109 GLU A C    5  
ATOM   5992  O  O    . GLU A 1 45 ? 1.271   -13.985 1.660   1.00 0.00 ? 109 GLU A O    5  
ATOM   5993  C  CB   . GLU A 1 45 ? 0.321   -17.047 1.466   1.00 0.00 ? 109 GLU A CB   5  
ATOM   5994  C  CG   . GLU A 1 45 ? 1.220   -17.627 2.545   1.00 0.00 ? 109 GLU A CG   5  
ATOM   5995  C  CD   . GLU A 1 45 ? 2.241   -18.602 1.991   1.00 0.00 ? 109 GLU A CD   5  
ATOM   5996  O  OE1  . GLU A 1 45 ? 2.802   -18.323 0.910   1.00 0.00 ? 109 GLU A OE1  5  
ATOM   5997  O  OE2  . GLU A 1 45 ? 2.479   -19.644 2.637   1.00 0.00 ? 109 GLU A OE2  5  
ATOM   5998  H  H    . GLU A 1 45 ? -0.685  -15.234 -0.156  1.00 0.00 ? 109 GLU A H    5  
ATOM   5999  H  HA   . GLU A 1 45 ? -1.079  -15.944 2.651   1.00 0.00 ? 109 GLU A HA   5  
ATOM   6000  H  HB2  . GLU A 1 45 ? -0.441  -17.776 1.231   1.00 0.00 ? 109 GLU A HB2  5  
ATOM   6001  H  HB3  . GLU A 1 45 ? 0.920   -16.868 0.586   1.00 0.00 ? 109 GLU A HB3  5  
ATOM   6002  H  HG2  . GLU A 1 45 ? 1.745   -16.819 3.032   1.00 0.00 ? 109 GLU A HG2  5  
ATOM   6003  H  HG3  . GLU A 1 45 ? 0.607   -18.144 3.268   1.00 0.00 ? 109 GLU A HG3  5  
ATOM   6004  N  N    . LYS A 1 46 ? 0.899   -14.800 3.723   1.00 0.00 ? 110 LYS A N    5  
ATOM   6005  C  CA   . LYS A 1 46 ? 1.867   -13.918 4.366   1.00 0.00 ? 110 LYS A CA   5  
ATOM   6006  C  C    . LYS A 1 46 ? 3.264   -14.136 3.794   1.00 0.00 ? 110 LYS A C    5  
ATOM   6007  O  O    . LYS A 1 46 ? 3.769   -15.258 3.773   1.00 0.00 ? 110 LYS A O    5  
ATOM   6008  C  CB   . LYS A 1 46 ? 1.879   -14.157 5.878   1.00 0.00 ? 110 LYS A CB   5  
ATOM   6009  C  CG   . LYS A 1 46 ? 3.022   -13.459 6.594   1.00 0.00 ? 110 LYS A CG   5  
ATOM   6010  C  CD   . LYS A 1 46 ? 2.685   -12.010 6.902   1.00 0.00 ? 110 LYS A CD   5  
ATOM   6011  C  CE   . LYS A 1 46 ? 1.715   -11.899 8.068   1.00 0.00 ? 110 LYS A CE   5  
ATOM   6012  N  NZ   . LYS A 1 46 ? 1.332   -10.486 8.339   1.00 0.00 ? 110 LYS A NZ   5  
ATOM   6013  H  H    . LYS A 1 46 ? 0.397   -15.439 4.272   1.00 0.00 ? 110 LYS A H    5  
ATOM   6014  H  HA   . LYS A 1 46 ? 1.566   -12.899 4.174   1.00 0.00 ? 110 LYS A HA   5  
ATOM   6015  H  HB2  . LYS A 1 46 ? 0.949   -13.800 6.294   1.00 0.00 ? 110 LYS A HB2  5  
ATOM   6016  H  HB3  . LYS A 1 46 ? 1.962   -15.219 6.061   1.00 0.00 ? 110 LYS A HB3  5  
ATOM   6017  H  HG2  . LYS A 1 46 ? 3.224   -13.976 7.521   1.00 0.00 ? 110 LYS A HG2  5  
ATOM   6018  H  HG3  . LYS A 1 46 ? 3.901   -13.489 5.965   1.00 0.00 ? 110 LYS A HG3  5  
ATOM   6019  H  HD2  . LYS A 1 46 ? 3.594   -11.483 7.154   1.00 0.00 ? 110 LYS A HD2  5  
ATOM   6020  H  HD3  . LYS A 1 46 ? 2.236   -11.560 6.028   1.00 0.00 ? 110 LYS A HD3  5  
ATOM   6021  H  HE2  . LYS A 1 46 ? 0.827   -12.466 7.835   1.00 0.00 ? 110 LYS A HE2  5  
ATOM   6022  H  HE3  . LYS A 1 46 ? 2.184   -12.312 8.950   1.00 0.00 ? 110 LYS A HE3  5  
ATOM   6023  H  HZ1  . LYS A 1 46 ? 2.180   -9.916  8.532   1.00 0.00 ? 110 LYS A HZ1  5  
ATOM   6024  H  HZ2  . LYS A 1 46 ? 0.701   -10.439 9.165   1.00 0.00 ? 110 LYS A HZ2  5  
ATOM   6025  H  HZ3  . LYS A 1 46 ? 0.838   -10.086 7.516   1.00 0.00 ? 110 LYS A HZ3  5  
ATOM   6026  N  N    . CYS A 1 47 ? 3.884   -13.055 3.334   1.00 0.00 ? 111 CYS A N    5  
ATOM   6027  C  CA   . CYS A 1 47 ? 5.224   -13.126 2.763   1.00 0.00 ? 111 CYS A CA   5  
ATOM   6028  C  C    . CYS A 1 47 ? 6.232   -12.401 3.649   1.00 0.00 ? 111 CYS A C    5  
ATOM   6029  O  O    . CYS A 1 47 ? 6.330   -11.174 3.618   1.00 0.00 ? 111 CYS A O    5  
ATOM   6030  C  CB   . CYS A 1 47 ? 5.235   -12.521 1.358   1.00 0.00 ? 111 CYS A CB   5  
ATOM   6031  S  SG   . CYS A 1 47 ? 6.814   -12.727 0.473   1.00 0.00 ? 111 CYS A SG   5  
ATOM   6032  H  H    . CYS A 1 47 ? 3.430   -12.187 3.378   1.00 0.00 ? 111 CYS A H    5  
ATOM   6033  H  HA   . CYS A 1 47 ? 5.503   -14.167 2.700   1.00 0.00 ? 111 CYS A HA   5  
ATOM   6034  H  HB2  . CYS A 1 47 ? 4.464   -12.992 0.765   1.00 0.00 ? 111 CYS A HB2  5  
ATOM   6035  H  HB3  . CYS A 1 47 ? 5.032   -11.463 1.428   1.00 0.00 ? 111 CYS A HB3  5  
ATOM   6036  N  N    . GLU A 1 48 ? 6.979   -13.168 4.437   1.00 0.00 ? 112 GLU A N    5  
ATOM   6037  C  CA   . GLU A 1 48 ? 7.979   -12.597 5.332   1.00 0.00 ? 112 GLU A CA   5  
ATOM   6038  C  C    . GLU A 1 48 ? 9.131   -11.984 4.541   1.00 0.00 ? 112 GLU A C    5  
ATOM   6039  O  O    . GLU A 1 48 ? 9.756   -11.020 4.981   1.00 0.00 ? 112 GLU A O    5  
ATOM   6040  C  CB   . GLU A 1 48 ? 8.514   -13.669 6.285   1.00 0.00 ? 112 GLU A CB   5  
ATOM   6041  C  CG   . GLU A 1 48 ? 7.495   -14.134 7.311   1.00 0.00 ? 112 GLU A CG   5  
ATOM   6042  C  CD   . GLU A 1 48 ? 7.793   -15.524 7.840   1.00 0.00 ? 112 GLU A CD   5  
ATOM   6043  O  OE1  . GLU A 1 48 ? 8.265   -16.370 7.054   1.00 0.00 ? 112 GLU A OE1  5  
ATOM   6044  O  OE2  . GLU A 1 48 ? 7.554   -15.764 9.043   1.00 0.00 ? 112 GLU A OE2  5  
ATOM   6045  H  H    . GLU A 1 48 ? 6.854   -14.139 4.417   1.00 0.00 ? 112 GLU A H    5  
ATOM   6046  H  HA   . GLU A 1 48 ? 7.502   -11.821 5.911   1.00 0.00 ? 112 GLU A HA   5  
ATOM   6047  H  HB2  . GLU A 1 48 ? 8.828   -14.525 5.705   1.00 0.00 ? 112 GLU A HB2  5  
ATOM   6048  H  HB3  . GLU A 1 48 ? 9.368   -13.270 6.812   1.00 0.00 ? 112 GLU A HB3  5  
ATOM   6049  H  HG2  . GLU A 1 48 ? 7.496   -13.442 8.140   1.00 0.00 ? 112 GLU A HG2  5  
ATOM   6050  H  HG3  . GLU A 1 48 ? 6.518   -14.142 6.851   1.00 0.00 ? 112 GLU A HG3  5  
ATOM   6051  N  N    . ARG A 1 49 ? 9.405   -12.552 3.371   1.00 0.00 ? 113 ARG A N    5  
ATOM   6052  C  CA   . ARG A 1 49 ? 10.482  -12.063 2.518   1.00 0.00 ? 113 ARG A CA   5  
ATOM   6053  C  C    . ARG A 1 49 ? 10.364  -10.557 2.302   1.00 0.00 ? 113 ARG A C    5  
ATOM   6054  O  O    . ARG A 1 49 ? 11.336  -9.893  1.942   1.00 0.00 ? 113 ARG A O    5  
ATOM   6055  C  CB   . ARG A 1 49 ? 10.462  -12.785 1.170   1.00 0.00 ? 113 ARG A CB   5  
ATOM   6056  C  CG   . ARG A 1 49 ? 11.076  -14.175 1.215   1.00 0.00 ? 113 ARG A CG   5  
ATOM   6057  C  CD   . ARG A 1 49 ? 12.577  -14.129 0.971   1.00 0.00 ? 113 ARG A CD   5  
ATOM   6058  N  NE   . ARG A 1 49 ? 13.158  -15.466 0.883   1.00 0.00 ? 113 ARG A NE   5  
ATOM   6059  C  CZ   . ARG A 1 49 ? 14.388  -15.704 0.441   1.00 0.00 ? 113 ARG A CZ   5  
ATOM   6060  N  NH1  . ARG A 1 49 ? 15.162  -14.701 0.050   1.00 0.00 ? 113 ARG A NH1  5  
ATOM   6061  N  NH2  . ARG A 1 49 ? 14.846  -16.949 0.390   1.00 0.00 ? 113 ARG A NH2  5  
ATOM   6062  H  H    . ARG A 1 49 ? 8.871   -13.318 3.074   1.00 0.00 ? 113 ARG A H    5  
ATOM   6063  H  HA   . ARG A 1 49 ? 11.418  -12.271 3.014   1.00 0.00 ? 113 ARG A HA   5  
ATOM   6064  H  HB2  . ARG A 1 49 ? 9.438   -12.879 0.840   1.00 0.00 ? 113 ARG A HB2  5  
ATOM   6065  H  HB3  . ARG A 1 49 ? 11.011  -12.196 0.451   1.00 0.00 ? 113 ARG A HB3  5  
ATOM   6066  H  HG2  . ARG A 1 49 ? 10.894  -14.608 2.187   1.00 0.00 ? 113 ARG A HG2  5  
ATOM   6067  H  HG3  . ARG A 1 49 ? 10.615  -14.786 0.453   1.00 0.00 ? 113 ARG A HG3  5  
ATOM   6068  H  HD2  . ARG A 1 49 ? 12.762  -13.604 0.046   1.00 0.00 ? 113 ARG A HD2  5  
ATOM   6069  H  HD3  . ARG A 1 49 ? 13.044  -13.596 1.786   1.00 0.00 ? 113 ARG A HD3  5  
ATOM   6070  H  HE   . ARG A 1 49 ? 12.603  -16.221 1.167   1.00 0.00 ? 113 ARG A HE   5  
ATOM   6071  H  HH11 . ARG A 1 49 ? 14.820  -13.763 0.088   1.00 0.00 ? 113 ARG A HH11 5  
ATOM   6072  H  HH12 . ARG A 1 49 ? 16.088  -14.884 -0.281  1.00 0.00 ? 113 ARG A HH12 5  
ATOM   6073  H  HH21 . ARG A 1 49 ? 14.265  -17.707 0.684   1.00 0.00 ? 113 ARG A HH21 5  
ATOM   6074  H  HH22 . ARG A 1 49 ? 15.771  -17.127 0.057   1.00 0.00 ? 113 ARG A HH22 5  
ATOM   6075  N  N    . SER A 1 50 ? 9.166   -10.025 2.524   1.00 0.00 ? 114 SER A N    5  
ATOM   6076  C  CA   . SER A 1 50 ? 8.919   -8.598  2.350   1.00 0.00 ? 114 SER A CA   5  
ATOM   6077  C  C    . SER A 1 50 ? 9.511   -8.101  1.035   1.00 0.00 ? 114 SER A C    5  
ATOM   6078  O  O    . SER A 1 50 ? 10.188  -7.074  0.994   1.00 0.00 ? 114 SER A O    5  
ATOM   6079  C  CB   . SER A 1 50 ? 9.512   -7.810  3.519   1.00 0.00 ? 114 SER A CB   5  
ATOM   6080  O  OG   . SER A 1 50 ? 8.569   -7.666  4.568   1.00 0.00 ? 114 SER A OG   5  
ATOM   6081  H  H    . SER A 1 50 ? 8.430   -10.606 2.810   1.00 0.00 ? 114 SER A H    5  
ATOM   6082  H  HA   . SER A 1 50 ? 7.850   -8.447  2.330   1.00 0.00 ? 114 SER A HA   5  
ATOM   6083  H  HB2  . SER A 1 50 ? 10.378  -8.330  3.899   1.00 0.00 ? 114 SER A HB2  5  
ATOM   6084  H  HB3  . SER A 1 50 ? 9.804   -6.828  3.176   1.00 0.00 ? 114 SER A HB3  5  
ATOM   6085  H  HG   . SER A 1 50 ? 8.125   -8.504  4.716   1.00 0.00 ? 114 SER A HG   5  
ATOM   6086  N  N    . CYS A 1 51 ? 9.251   -8.839  -0.040  1.00 0.00 ? 115 CYS A N    5  
ATOM   6087  C  CA   . CYS A 1 51 ? 9.757   -8.475  -1.358  1.00 0.00 ? 115 CYS A CA   5  
ATOM   6088  C  C    . CYS A 1 51 ? 9.739   -6.962  -1.549  1.00 0.00 ? 115 CYS A C    5  
ATOM   6089  O  O    . CYS A 1 51 ? 8.930   -6.257  -0.944  1.00 0.00 ? 115 CYS A O    5  
ATOM   6090  C  CB   . CYS A 1 51 ? 8.924   -9.149  -2.451  1.00 0.00 ? 115 CYS A CB   5  
ATOM   6091  S  SG   . CYS A 1 51 ? 8.607   -10.919 -2.160  1.00 0.00 ? 115 CYS A SG   5  
ATOM   6092  H  H    . CYS A 1 51 ? 8.705   -9.648  0.056   1.00 0.00 ? 115 CYS A H    5  
ATOM   6093  H  HA   . CYS A 1 51 ? 10.776  -8.823  -1.430  1.00 0.00 ? 115 CYS A HA   5  
ATOM   6094  H  HB2  . CYS A 1 51 ? 7.967   -8.652  -2.520  1.00 0.00 ? 115 CYS A HB2  5  
ATOM   6095  H  HB3  . CYS A 1 51 ? 9.440   -9.057  -3.394  1.00 0.00 ? 115 CYS A HB3  5  
ATOM   6096  N  N    . LYS A 1 52 ? 10.636  -6.467  -2.395  1.00 0.00 ? 116 LYS A N    5  
ATOM   6097  C  CA   . LYS A 1 52 ? 10.724  -5.038  -2.669  1.00 0.00 ? 116 LYS A CA   5  
ATOM   6098  C  C    . LYS A 1 52 ? 10.019  -4.690  -3.976  1.00 0.00 ? 116 LYS A C    5  
ATOM   6099  O  O    . LYS A 1 52 ? 10.561  -4.907  -5.061  1.00 0.00 ? 116 LYS A O    5  
ATOM   6100  C  CB   . LYS A 1 52 ? 12.189  -4.599  -2.735  1.00 0.00 ? 116 LYS A CB   5  
ATOM   6101  C  CG   . LYS A 1 52 ? 12.918  -4.711  -1.407  1.00 0.00 ? 116 LYS A CG   5  
ATOM   6102  C  CD   . LYS A 1 52 ? 14.422  -4.586  -1.584  1.00 0.00 ? 116 LYS A CD   5  
ATOM   6103  C  CE   . LYS A 1 52 ? 14.874  -3.136  -1.497  1.00 0.00 ? 116 LYS A CE   5  
ATOM   6104  N  NZ   . LYS A 1 52 ? 14.823  -2.459  -2.823  1.00 0.00 ? 116 LYS A NZ   5  
ATOM   6105  H  H    . LYS A 1 52 ? 11.255  -7.080  -2.848  1.00 0.00 ? 116 LYS A H    5  
ATOM   6106  H  HA   . LYS A 1 52 ? 10.237  -4.514  -1.861  1.00 0.00 ? 116 LYS A HA   5  
ATOM   6107  H  HB2  . LYS A 1 52 ? 12.704  -5.215  -3.458  1.00 0.00 ? 116 LYS A HB2  5  
ATOM   6108  H  HB3  . LYS A 1 52 ? 12.230  -3.569  -3.058  1.00 0.00 ? 116 LYS A HB3  5  
ATOM   6109  H  HG2  . LYS A 1 52 ? 12.576  -3.924  -0.751  1.00 0.00 ? 116 LYS A HG2  5  
ATOM   6110  H  HG3  . LYS A 1 52 ? 12.695  -5.672  -0.965  1.00 0.00 ? 116 LYS A HG3  5  
ATOM   6111  H  HD2  . LYS A 1 52 ? 14.915  -5.152  -0.808  1.00 0.00 ? 116 LYS A HD2  5  
ATOM   6112  H  HD3  . LYS A 1 52 ? 14.696  -4.982  -2.551  1.00 0.00 ? 116 LYS A HD3  5  
ATOM   6113  H  HE2  . LYS A 1 52 ? 14.228  -2.612  -0.810  1.00 0.00 ? 116 LYS A HE2  5  
ATOM   6114  H  HE3  . LYS A 1 52 ? 15.888  -3.111  -1.128  1.00 0.00 ? 116 LYS A HE3  5  
ATOM   6115  H  HZ1  . LYS A 1 52 ? 14.954  -3.155  -3.585  1.00 0.00 ? 116 LYS A HZ1  5  
ATOM   6116  H  HZ2  . LYS A 1 52 ? 15.575  -1.743  -2.887  1.00 0.00 ? 116 LYS A HZ2  5  
ATOM   6117  H  HZ3  . LYS A 1 52 ? 13.903  -1.992  -2.950  1.00 0.00 ? 116 LYS A HZ3  5  
ATOM   6118  N  N    . ILE A 1 53 ? 8.811   -4.148  -3.866  1.00 0.00 ? 117 ILE A N    5  
ATOM   6119  C  CA   . ILE A 1 53 ? 8.035   -3.768  -5.039  1.00 0.00 ? 117 ILE A CA   5  
ATOM   6120  C  C    . ILE A 1 53 ? 8.705   -2.626  -5.796  1.00 0.00 ? 117 ILE A C    5  
ATOM   6121  O  O    . ILE A 1 53 ? 8.740   -1.491  -5.321  1.00 0.00 ? 117 ILE A O    5  
ATOM   6122  C  CB   . ILE A 1 53 ? 6.604   -3.345  -4.655  1.00 0.00 ? 117 ILE A CB   5  
ATOM   6123  C  CG1  . ILE A 1 53 ? 5.922   -4.451  -3.847  1.00 0.00 ? 117 ILE A CG1  5  
ATOM   6124  C  CG2  . ILE A 1 53 ? 5.796   -3.017  -5.902  1.00 0.00 ? 117 ILE A CG2  5  
ATOM   6125  C  CD1  . ILE A 1 53 ? 5.723   -5.733  -4.625  1.00 0.00 ? 117 ILE A CD1  5  
ATOM   6126  H  H    . ILE A 1 53 ? 8.433   -4.000  -2.974  1.00 0.00 ? 117 ILE A H    5  
ATOM   6127  H  HA   . ILE A 1 53 ? 7.972   -4.629  -5.690  1.00 0.00 ? 117 ILE A HA   5  
ATOM   6128  H  HB   . ILE A 1 53 ? 6.667   -2.453  -4.051  1.00 0.00 ? 117 ILE A HB   5  
ATOM   6129  H  HG12 . ILE A 1 53 ? 6.523   -4.679  -2.981  1.00 0.00 ? 117 ILE A HG12 5  
ATOM   6130  H  HG13 . ILE A 1 53 ? 4.951   -4.103  -3.525  1.00 0.00 ? 117 ILE A HG13 5  
ATOM   6131  H  HG21 . ILE A 1 53 ? 4.785   -2.764  -5.619  1.00 0.00 ? 117 ILE A HG21 5  
ATOM   6132  H  HG22 . ILE A 1 53 ? 6.247   -2.178  -6.411  1.00 0.00 ? 117 ILE A HG22 5  
ATOM   6133  H  HG23 . ILE A 1 53 ? 5.783   -3.873  -6.559  1.00 0.00 ? 117 ILE A HG23 5  
ATOM   6134  H  HD11 . ILE A 1 53 ? 4.667   -5.895  -4.788  1.00 0.00 ? 117 ILE A HD11 5  
ATOM   6135  H  HD12 . ILE A 1 53 ? 6.225   -5.658  -5.578  1.00 0.00 ? 117 ILE A HD12 5  
ATOM   6136  H  HD13 . ILE A 1 53 ? 6.132   -6.561  -4.066  1.00 0.00 ? 117 ILE A HD13 5  
ATOM   6137  N  N    . GLN A 1 54 ? 9.234   -2.935  -6.975  1.00 0.00 ? 118 GLN A N    5  
ATOM   6138  C  CA   . GLN A 1 54 ? 9.902   -1.934  -7.798  1.00 0.00 ? 118 GLN A CA   5  
ATOM   6139  C  C    . GLN A 1 54 ? 9.207   -1.786  -9.147  1.00 0.00 ? 118 GLN A C    5  
ATOM   6140  O  O    . GLN A 1 54 ? 8.381   -2.617  -9.527  1.00 0.00 ? 118 GLN A O    5  
ATOM   6141  C  CB   . GLN A 1 54 ? 11.370  -2.311  -8.006  1.00 0.00 ? 118 GLN A CB   5  
ATOM   6142  C  CG   . GLN A 1 54 ? 12.245  -1.141  -8.426  1.00 0.00 ? 118 GLN A CG   5  
ATOM   6143  C  CD   . GLN A 1 54 ? 13.707  -1.356  -8.091  1.00 0.00 ? 118 GLN A CD   5  
ATOM   6144  O  OE1  . GLN A 1 54 ? 14.054  -2.248  -7.316  1.00 0.00 ? 118 GLN A OE1  5  
ATOM   6145  N  NE2  . GLN A 1 54 ? 14.575  -0.537  -8.674  1.00 0.00 ? 118 GLN A NE2  5  
ATOM   6146  H  H    . GLN A 1 54 ? 9.174   -3.857  -7.299  1.00 0.00 ? 118 GLN A H    5  
ATOM   6147  H  HA   . GLN A 1 54 ? 9.853   -0.990  -7.277  1.00 0.00 ? 118 GLN A HA   5  
ATOM   6148  H  HB2  . GLN A 1 54 ? 11.760  -2.712  -7.083  1.00 0.00 ? 118 GLN A HB2  5  
ATOM   6149  H  HB3  . GLN A 1 54 ? 11.429  -3.070  -8.772  1.00 0.00 ? 118 GLN A HB3  5  
ATOM   6150  H  HG2  . GLN A 1 54 ? 12.153  -1.004  -9.494  1.00 0.00 ? 118 GLN A HG2  5  
ATOM   6151  H  HG3  . GLN A 1 54 ? 11.901  -0.251  -7.920  1.00 0.00 ? 118 GLN A HG3  5  
ATOM   6152  H  HE21 . GLN A 1 54 ? 14.227  0.151   -9.279  1.00 0.00 ? 118 GLN A HE21 5  
ATOM   6153  H  HE22 . GLN A 1 54 ? 15.527  -0.653  -8.474  1.00 0.00 ? 118 GLN A HE22 5  
ATOM   6154  N  N    . LYS A 1 55 ? 9.545   -0.723  -9.869  1.00 0.00 ? 119 LYS A N    5  
ATOM   6155  C  CA   . LYS A 1 55 ? 8.955   -0.465  -11.177 1.00 0.00 ? 119 LYS A CA   5  
ATOM   6156  C  C    . LYS A 1 55 ? 9.439   -1.485  -12.202 1.00 0.00 ? 119 LYS A C    5  
ATOM   6157  O  O    . LYS A 1 55 ? 8.802   -1.692  -13.235 1.00 0.00 ? 119 LYS A O    5  
ATOM   6158  C  CB   . LYS A 1 55 ? 9.302   0.950   -11.646 1.00 0.00 ? 119 LYS A CB   5  
ATOM   6159  C  CG   . LYS A 1 55 ? 10.793  1.240   -11.653 1.00 0.00 ? 119 LYS A CG   5  
ATOM   6160  C  CD   . LYS A 1 55 ? 11.119  2.465   -12.490 1.00 0.00 ? 119 LYS A CD   5  
ATOM   6161  C  CE   . LYS A 1 55 ? 10.769  3.751   -11.757 1.00 0.00 ? 119 LYS A CE   5  
ATOM   6162  N  NZ   . LYS A 1 55 ? 10.590  4.893   -12.696 1.00 0.00 ? 119 LYS A NZ   5  
ATOM   6163  H  H    . LYS A 1 55 ? 10.210  -0.096  -9.512  1.00 0.00 ? 119 LYS A H    5  
ATOM   6164  H  HA   . LYS A 1 55 ? 7.883   -0.550  -11.080 1.00 0.00 ? 119 LYS A HA   5  
ATOM   6165  H  HB2  . LYS A 1 55 ? 8.926   1.086   -12.649 1.00 0.00 ? 119 LYS A HB2  5  
ATOM   6166  H  HB3  . LYS A 1 55 ? 8.821   1.662   -10.991 1.00 0.00 ? 119 LYS A HB3  5  
ATOM   6167  H  HG2  . LYS A 1 55 ? 11.122  1.413   -10.639 1.00 0.00 ? 119 LYS A HG2  5  
ATOM   6168  H  HG3  . LYS A 1 55 ? 11.315  0.386   -12.061 1.00 0.00 ? 119 LYS A HG3  5  
ATOM   6169  H  HD2  . LYS A 1 55 ? 12.176  2.467   -12.713 1.00 0.00 ? 119 LYS A HD2  5  
ATOM   6170  H  HD3  . LYS A 1 55 ? 10.556  2.420   -13.412 1.00 0.00 ? 119 LYS A HD3  5  
ATOM   6171  H  HE2  . LYS A 1 55 ? 9.851   3.599   -11.210 1.00 0.00 ? 119 LYS A HE2  5  
ATOM   6172  H  HE3  . LYS A 1 55 ? 11.566  3.984   -11.067 1.00 0.00 ? 119 LYS A HE3  5  
ATOM   6173  H  HZ1  . LYS A 1 55 ? 9.634   4.874   -13.105 1.00 0.00 ? 119 LYS A HZ1  5  
ATOM   6174  H  HZ2  . LYS A 1 55 ? 11.286  4.834   -13.467 1.00 0.00 ? 119 LYS A HZ2  5  
ATOM   6175  H  HZ3  . LYS A 1 55 ? 10.722  5.793   -12.193 1.00 0.00 ? 119 LYS A HZ3  5  
ATOM   6176  N  N    . LYS A 1 56 ? 10.568  -2.121  -11.910 1.00 0.00 ? 120 LYS A N    5  
ATOM   6177  C  CA   . LYS A 1 56 ? 11.136  -3.122  -12.805 1.00 0.00 ? 120 LYS A CA   5  
ATOM   6178  C  C    . LYS A 1 56 ? 10.394  -4.449  -12.679 1.00 0.00 ? 120 LYS A C    5  
ATOM   6179  O  O    . LYS A 1 56 ? 10.101  -5.104  -13.678 1.00 0.00 ? 120 LYS A O    5  
ATOM   6180  C  CB   . LYS A 1 56 ? 12.622  -3.326  -12.498 1.00 0.00 ? 120 LYS A CB   5  
ATOM   6181  C  CG   . LYS A 1 56 ? 13.331  -4.226  -13.495 1.00 0.00 ? 120 LYS A CG   5  
ATOM   6182  C  CD   . LYS A 1 56 ? 13.483  -3.550  -14.848 1.00 0.00 ? 120 LYS A CD   5  
ATOM   6183  C  CE   . LYS A 1 56 ? 14.671  -2.601  -14.866 1.00 0.00 ? 120 LYS A CE   5  
ATOM   6184  N  NZ   . LYS A 1 56 ? 14.594  -1.637  -15.998 1.00 0.00 ? 120 LYS A NZ   5  
ATOM   6185  H  H    . LYS A 1 56 ? 11.031  -1.913  -11.071 1.00 0.00 ? 120 LYS A H    5  
ATOM   6186  H  HA   . LYS A 1 56 ? 11.033  -2.760  -13.817 1.00 0.00 ? 120 LYS A HA   5  
ATOM   6187  H  HB2  . LYS A 1 56 ? 13.113  -2.364  -12.501 1.00 0.00 ? 120 LYS A HB2  5  
ATOM   6188  H  HB3  . LYS A 1 56 ? 12.717  -3.767  -11.516 1.00 0.00 ? 120 LYS A HB3  5  
ATOM   6189  H  HG2  . LYS A 1 56 ? 14.312  -4.469  -13.114 1.00 0.00 ? 120 LYS A HG2  5  
ATOM   6190  H  HG3  . LYS A 1 56 ? 12.756  -5.134  -13.619 1.00 0.00 ? 120 LYS A HG3  5  
ATOM   6191  H  HD2  . LYS A 1 56 ? 13.629  -4.307  -15.604 1.00 0.00 ? 120 LYS A HD2  5  
ATOM   6192  H  HD3  . LYS A 1 56 ? 12.583  -2.991  -15.064 1.00 0.00 ? 120 LYS A HD3  5  
ATOM   6193  H  HE2  . LYS A 1 56 ? 14.691  -2.052  -13.937 1.00 0.00 ? 120 LYS A HE2  5  
ATOM   6194  H  HE3  . LYS A 1 56 ? 15.577  -3.182  -14.960 1.00 0.00 ? 120 LYS A HE3  5  
ATOM   6195  H  HZ1  . LYS A 1 56 ? 15.101  -0.762  -15.758 1.00 0.00 ? 120 LYS A HZ1  5  
ATOM   6196  H  HZ2  . LYS A 1 56 ? 13.600  -1.405  -16.202 1.00 0.00 ? 120 LYS A HZ2  5  
ATOM   6197  H  HZ3  . LYS A 1 56 ? 15.023  -2.051  -16.850 1.00 0.00 ? 120 LYS A HZ3  5  
ATOM   6198  N  N    . ASN A 1 57 ? 10.091  -4.838  -11.445 1.00 0.00 ? 121 ASN A N    5  
ATOM   6199  C  CA   . ASN A 1 57 ? 9.382   -6.086  -11.189 1.00 0.00 ? 121 ASN A CA   5  
ATOM   6200  C  C    . ASN A 1 57 ? 8.253   -5.874  -10.184 1.00 0.00 ? 121 ASN A C    5  
ATOM   6201  O  O    . ASN A 1 57 ? 8.296   -6.394  -9.069  1.00 0.00 ? 121 ASN A O    5  
ATOM   6202  C  CB   . ASN A 1 57 ? 10.350  -7.150  -10.668 1.00 0.00 ? 121 ASN A CB   5  
ATOM   6203  C  CG   . ASN A 1 57 ? 10.980  -6.760  -9.345  1.00 0.00 ? 121 ASN A CG   5  
ATOM   6204  O  OD1  . ASN A 1 57 ? 10.788  -7.433  -8.331  1.00 0.00 ? 121 ASN A OD1  5  
ATOM   6205  N  ND2  . ASN A 1 57 ? 11.737  -5.669  -9.348  1.00 0.00 ? 121 ASN A ND2  5  
ATOM   6206  H  H    . ASN A 1 57 ? 10.352  -4.272  -10.688 1.00 0.00 ? 121 ASN A H    5  
ATOM   6207  H  HA   . ASN A 1 57 ? 8.958   -6.424  -12.122 1.00 0.00 ? 121 ASN A HA   5  
ATOM   6208  H  HB2  . ASN A 1 57 ? 9.816   -8.078  -10.530 1.00 0.00 ? 121 ASN A HB2  5  
ATOM   6209  H  HB3  . ASN A 1 57 ? 11.138  -7.297  -11.391 1.00 0.00 ? 121 ASN A HB3  5  
ATOM   6210  H  HD21 . ASN A 1 57 ? 11.845  -5.183  -10.192 1.00 0.00 ? 121 ASN A HD21 5  
ATOM   6211  H  HD22 . ASN A 1 57 ? 12.156  -5.394  -8.506  1.00 0.00 ? 121 ASN A HD22 5  
ATOM   6212  N  N    . ARG A 1 58 ? 7.246   -5.108  -10.587 1.00 0.00 ? 122 ARG A N    5  
ATOM   6213  C  CA   . ARG A 1 58 ? 6.106   -4.826  -9.723  1.00 0.00 ? 122 ARG A CA   5  
ATOM   6214  C  C    . ARG A 1 58 ? 5.166   -6.027  -9.654  1.00 0.00 ? 122 ARG A C    5  
ATOM   6215  O  O    . ARG A 1 58 ? 4.398   -6.172  -8.705  1.00 0.00 ? 122 ARG A O    5  
ATOM   6216  C  CB   . ARG A 1 58 ? 5.346   -3.598  -10.228 1.00 0.00 ? 122 ARG A CB   5  
ATOM   6217  C  CG   . ARG A 1 58 ? 4.672   -3.810  -11.573 1.00 0.00 ? 122 ARG A CG   5  
ATOM   6218  C  CD   . ARG A 1 58 ? 4.570   -2.510  -12.356 1.00 0.00 ? 122 ARG A CD   5  
ATOM   6219  N  NE   . ARG A 1 58 ? 3.912   -2.698  -13.646 1.00 0.00 ? 122 ARG A NE   5  
ATOM   6220  C  CZ   . ARG A 1 58 ? 3.849   -1.759  -14.583 1.00 0.00 ? 122 ARG A CZ   5  
ATOM   6221  N  NH1  . ARG A 1 58 ? 4.402   -0.572  -14.374 1.00 0.00 ? 122 ARG A NH1  5  
ATOM   6222  N  NH2  . ARG A 1 58 ? 3.232   -2.006  -15.732 1.00 0.00 ? 122 ARG A NH2  5  
ATOM   6223  H  H    . ARG A 1 58 ? 7.269   -4.721  -11.488 1.00 0.00 ? 122 ARG A H    5  
ATOM   6224  H  HA   . ARG A 1 58 ? 6.483   -4.623  -8.732  1.00 0.00 ? 122 ARG A HA   5  
ATOM   6225  H  HB2  . ARG A 1 58 ? 4.586   -3.338  -9.506  1.00 0.00 ? 122 ARG A HB2  5  
ATOM   6226  H  HB3  . ARG A 1 58 ? 6.039   -2.776  -10.322 1.00 0.00 ? 122 ARG A HB3  5  
ATOM   6227  H  HG2  . ARG A 1 58 ? 5.251   -4.518  -12.148 1.00 0.00 ? 122 ARG A HG2  5  
ATOM   6228  H  HG3  . ARG A 1 58 ? 3.679   -4.201  -11.410 1.00 0.00 ? 122 ARG A HG3  5  
ATOM   6229  H  HD2  . ARG A 1 58 ? 4.003   -1.799  -11.774 1.00 0.00 ? 122 ARG A HD2  5  
ATOM   6230  H  HD3  . ARG A 1 58 ? 5.565   -2.127  -12.522 1.00 0.00 ? 122 ARG A HD3  5  
ATOM   6231  H  HE   . ARG A 1 58 ? 3.497   -3.568  -13.821 1.00 0.00 ? 122 ARG A HE   5  
ATOM   6232  H  HH11 . ARG A 1 58 ? 4.868   -0.383  -13.510 1.00 0.00 ? 122 ARG A HH11 5  
ATOM   6233  H  HH12 . ARG A 1 58 ? 4.354   0.134   -15.082 1.00 0.00 ? 122 ARG A HH12 5  
ATOM   6234  H  HH21 . ARG A 1 58 ? 2.815   -2.899  -15.893 1.00 0.00 ? 122 ARG A HH21 5  
ATOM   6235  H  HH22 . ARG A 1 58 ? 3.185   -1.298  -16.436 1.00 0.00 ? 122 ARG A HH22 5  
ATOM   6236  N  N    . ASN A 1 59 ? 5.234   -6.883  -10.668 1.00 0.00 ? 123 ASN A N    5  
ATOM   6237  C  CA   . ASN A 1 59 ? 4.388   -8.070  -10.724 1.00 0.00 ? 123 ASN A CA   5  
ATOM   6238  C  C    . ASN A 1 59 ? 5.162   -9.310  -10.285 1.00 0.00 ? 123 ASN A C    5  
ATOM   6239  O  O    . ASN A 1 59 ? 5.126   -10.345 -10.950 1.00 0.00 ? 123 ASN A O    5  
ATOM   6240  C  CB   . ASN A 1 59 ? 3.845   -8.269  -12.140 1.00 0.00 ? 123 ASN A CB   5  
ATOM   6241  C  CG   . ASN A 1 59 ? 3.295   -6.986  -12.734 1.00 0.00 ? 123 ASN A CG   5  
ATOM   6242  O  OD1  . ASN A 1 59 ? 2.165   -6.591  -12.448 1.00 0.00 ? 123 ASN A OD1  5  
ATOM   6243  N  ND2  . ASN A 1 59 ? 4.096   -6.329  -13.565 1.00 0.00 ? 123 ASN A ND2  5  
ATOM   6244  H  H    . ASN A 1 59 ? 5.867   -6.713  -11.397 1.00 0.00 ? 123 ASN A H    5  
ATOM   6245  H  HA   . ASN A 1 59 ? 3.560   -7.919  -10.048 1.00 0.00 ? 123 ASN A HA   5  
ATOM   6246  H  HB2  . ASN A 1 59 ? 4.640   -8.626  -12.778 1.00 0.00 ? 123 ASN A HB2  5  
ATOM   6247  H  HB3  . ASN A 1 59 ? 3.052   -9.001  -12.116 1.00 0.00 ? 123 ASN A HB3  5  
ATOM   6248  H  HD21 . ASN A 1 59 ? 4.983   -6.703  -13.747 1.00 0.00 ? 123 ASN A HD21 5  
ATOM   6249  H  HD22 . ASN A 1 59 ? 3.766   -5.496  -13.963 1.00 0.00 ? 123 ASN A HD22 5  
ATOM   6250  N  N    . LYS A 1 60 ? 5.860   -9.198  -9.161  1.00 0.00 ? 124 LYS A N    5  
ATOM   6251  C  CA   . LYS A 1 60 ? 6.642   -10.309 -8.630  1.00 0.00 ? 124 LYS A CA   5  
ATOM   6252  C  C    . LYS A 1 60 ? 5.896   -11.007 -7.498  1.00 0.00 ? 124 LYS A C    5  
ATOM   6253  O  O    . LYS A 1 60 ? 5.640   -12.210 -7.557  1.00 0.00 ? 124 LYS A O    5  
ATOM   6254  C  CB   . LYS A 1 60 ? 8.000   -9.811  -8.131  1.00 0.00 ? 124 LYS A CB   5  
ATOM   6255  C  CG   . LYS A 1 60 ? 9.075   -10.884 -8.122  1.00 0.00 ? 124 LYS A CG   5  
ATOM   6256  C  CD   . LYS A 1 60 ? 9.789   -10.970 -9.460  1.00 0.00 ? 124 LYS A CD   5  
ATOM   6257  C  CE   . LYS A 1 60 ? 11.152  -11.632 -9.324  1.00 0.00 ? 124 LYS A CE   5  
ATOM   6258  N  NZ   . LYS A 1 60 ? 12.201  -10.660 -8.910  1.00 0.00 ? 124 LYS A NZ   5  
ATOM   6259  H  H    . LYS A 1 60 ? 5.850   -8.346  -8.674  1.00 0.00 ? 124 LYS A H    5  
ATOM   6260  H  HA   . LYS A 1 60 ? 6.799   -11.015 -9.431  1.00 0.00 ? 124 LYS A HA   5  
ATOM   6261  H  HB2  . LYS A 1 60 ? 8.331   -9.005  -8.768  1.00 0.00 ? 124 LYS A HB2  5  
ATOM   6262  H  HB3  . LYS A 1 60 ? 7.885   -9.438  -7.123  1.00 0.00 ? 124 LYS A HB3  5  
ATOM   6263  H  HG2  . LYS A 1 60 ? 9.798   -10.650 -7.355  1.00 0.00 ? 124 LYS A HG2  5  
ATOM   6264  H  HG3  . LYS A 1 60 ? 8.616   -11.839 -7.907  1.00 0.00 ? 124 LYS A HG3  5  
ATOM   6265  H  HD2  . LYS A 1 60 ? 9.187   -11.550 -10.144 1.00 0.00 ? 124 LYS A HD2  5  
ATOM   6266  H  HD3  . LYS A 1 60 ? 9.921   -9.971  -9.852  1.00 0.00 ? 124 LYS A HD3  5  
ATOM   6267  H  HE2  . LYS A 1 60 ? 11.085  -12.414 -8.583  1.00 0.00 ? 124 LYS A HE2  5  
ATOM   6268  H  HE3  . LYS A 1 60 ? 11.425  -12.061 -10.277 1.00 0.00 ? 124 LYS A HE3  5  
ATOM   6269  H  HZ1  . LYS A 1 60 ? 11.988  -10.284 -7.964  1.00 0.00 ? 124 LYS A HZ1  5  
ATOM   6270  H  HZ2  . LYS A 1 60 ? 12.242  -9.869  -9.585  1.00 0.00 ? 124 LYS A HZ2  5  
ATOM   6271  H  HZ3  . LYS A 1 60 ? 13.130  -11.127 -8.885  1.00 0.00 ? 124 LYS A HZ3  5  
ATOM   6272  N  N    . CYS A 1 61 ? 5.548   -10.244 -6.467  1.00 0.00 ? 125 CYS A N    5  
ATOM   6273  C  CA   . CYS A 1 61 ? 4.830   -10.789 -5.320  1.00 0.00 ? 125 CYS A CA   5  
ATOM   6274  C  C    . CYS A 1 61 ? 3.456   -10.141 -5.181  1.00 0.00 ? 125 CYS A C    5  
ATOM   6275  O  O    . CYS A 1 61 ? 3.291   -8.950  -5.445  1.00 0.00 ? 125 CYS A O    5  
ATOM   6276  C  CB   . CYS A 1 61 ? 5.638   -10.576 -4.038  1.00 0.00 ? 125 CYS A CB   5  
ATOM   6277  S  SG   . CYS A 1 61 ? 4.979   -11.460 -2.589  1.00 0.00 ? 125 CYS A SG   5  
ATOM   6278  H  H    . CYS A 1 61 ? 5.780   -9.291  -6.476  1.00 0.00 ? 125 CYS A H    5  
ATOM   6279  H  HA   . CYS A 1 61 ? 4.701   -11.848 -5.482  1.00 0.00 ? 125 CYS A HA   5  
ATOM   6280  H  HB2  . CYS A 1 61 ? 6.650   -10.919 -4.199  1.00 0.00 ? 125 CYS A HB2  5  
ATOM   6281  H  HB3  . CYS A 1 61 ? 5.654   -9.522  -3.802  1.00 0.00 ? 125 CYS A HB3  5  
ATOM   6282  N  N    . GLN A 1 62 ? 2.473   -10.933 -4.765  1.00 0.00 ? 126 GLN A N    5  
ATOM   6283  C  CA   . GLN A 1 62 ? 1.113   -10.437 -4.592  1.00 0.00 ? 126 GLN A CA   5  
ATOM   6284  C  C    . GLN A 1 62 ? 0.927   -9.833  -3.204  1.00 0.00 ? 126 GLN A C    5  
ATOM   6285  O  O    . GLN A 1 62 ? 0.604   -8.653  -3.067  1.00 0.00 ? 126 GLN A O    5  
ATOM   6286  C  CB   . GLN A 1 62 ? 0.104   -11.566 -4.810  1.00 0.00 ? 126 GLN A CB   5  
ATOM   6287  C  CG   . GLN A 1 62 ? -0.292  -11.755 -6.265  1.00 0.00 ? 126 GLN A CG   5  
ATOM   6288  C  CD   . GLN A 1 62 ? 0.641   -12.693 -7.006  1.00 0.00 ? 126 GLN A CD   5  
ATOM   6289  O  OE1  . GLN A 1 62 ? 1.850   -12.470 -7.061  1.00 0.00 ? 126 GLN A OE1  5  
ATOM   6290  N  NE2  . GLN A 1 62 ? 0.082   -13.751 -7.582  1.00 0.00 ? 126 GLN A NE2  5  
ATOM   6291  H  H    . GLN A 1 62 ? 2.668   -11.873 -4.571  1.00 0.00 ? 126 GLN A H    5  
ATOM   6292  H  HA   . GLN A 1 62 ? 0.945   -9.668  -5.330  1.00 0.00 ? 126 GLN A HA   5  
ATOM   6293  H  HB2  . GLN A 1 62 ? 0.533   -12.490 -4.452  1.00 0.00 ? 126 GLN A HB2  5  
ATOM   6294  H  HB3  . GLN A 1 62 ? -0.788  -11.349 -4.242  1.00 0.00 ? 126 GLN A HB3  5  
ATOM   6295  H  HG2  . GLN A 1 62 ? -1.291  -12.163 -6.303  1.00 0.00 ? 126 GLN A HG2  5  
ATOM   6296  H  HG3  . GLN A 1 62 ? -0.277  -10.794 -6.756  1.00 0.00 ? 126 GLN A HG3  5  
ATOM   6297  H  HE21 . GLN A 1 62 ? -0.889  -13.864 -7.498  1.00 0.00 ? 126 GLN A HE21 5  
ATOM   6298  H  HE22 . GLN A 1 62 ? 0.661   -14.373 -8.068  1.00 0.00 ? 126 GLN A HE22 5  
ATOM   6299  N  N    . TYR A 1 63 ? 1.133   -10.650 -2.177  1.00 0.00 ? 127 TYR A N    5  
ATOM   6300  C  CA   . TYR A 1 63 ? 0.985   -10.197 -0.798  1.00 0.00 ? 127 TYR A CA   5  
ATOM   6301  C  C    . TYR A 1 63 ? 1.672   -8.852  -0.590  1.00 0.00 ? 127 TYR A C    5  
ATOM   6302  O  O    . TYR A 1 63 ? 1.015   -7.824  -0.422  1.00 0.00 ? 127 TYR A O    5  
ATOM   6303  C  CB   . TYR A 1 63 ? 1.564   -11.233 0.166   1.00 0.00 ? 127 TYR A CB   5  
ATOM   6304  C  CG   . TYR A 1 63 ? 1.210   -10.978 1.614   1.00 0.00 ? 127 TYR A CG   5  
ATOM   6305  C  CD1  . TYR A 1 63 ? -0.064  -11.252 2.096   1.00 0.00 ? 127 TYR A CD1  5  
ATOM   6306  C  CD2  . TYR A 1 63 ? 2.149   -10.465 2.499   1.00 0.00 ? 127 TYR A CD2  5  
ATOM   6307  C  CE1  . TYR A 1 63 ? -0.393  -11.019 3.418   1.00 0.00 ? 127 TYR A CE1  5  
ATOM   6308  C  CE2  . TYR A 1 63 ? 1.830   -10.231 3.823   1.00 0.00 ? 127 TYR A CE2  5  
ATOM   6309  C  CZ   . TYR A 1 63 ? 0.558   -10.509 4.277   1.00 0.00 ? 127 TYR A CZ   5  
ATOM   6310  O  OH   . TYR A 1 63 ? 0.235   -10.278 5.594   1.00 0.00 ? 127 TYR A OH   5  
ATOM   6311  H  H    . TYR A 1 63 ? 1.389   -11.580 -2.349  1.00 0.00 ? 127 TYR A H    5  
ATOM   6312  H  HA   . TYR A 1 63 ? -0.071  -10.084 -0.598  1.00 0.00 ? 127 TYR A HA   5  
ATOM   6313  H  HB2  . TYR A 1 63 ? 1.191   -12.211 -0.099  1.00 0.00 ? 127 TYR A HB2  5  
ATOM   6314  H  HB3  . TYR A 1 63 ? 2.641   -11.230 0.082   1.00 0.00 ? 127 TYR A HB3  5  
ATOM   6315  H  HD1  . TYR A 1 63 ? -0.806  -11.652 1.420   1.00 0.00 ? 127 TYR A HD1  5  
ATOM   6316  H  HD2  . TYR A 1 63 ? 3.145   -10.248 2.140   1.00 0.00 ? 127 TYR A HD2  5  
ATOM   6317  H  HE1  . TYR A 1 63 ? -1.388  -11.238 3.774   1.00 0.00 ? 127 TYR A HE1  5  
ATOM   6318  H  HE2  . TYR A 1 63 ? 2.574   -9.831  4.496   1.00 0.00 ? 127 TYR A HE2  5  
ATOM   6319  H  HH   . TYR A 1 63 ? -0.616  -10.676 5.790   1.00 0.00 ? 127 TYR A HH   5  
ATOM   6320  N  N    . CYS A 1 64 ? 3.001   -8.865  -0.603  1.00 0.00 ? 128 CYS A N    5  
ATOM   6321  C  CA   . CYS A 1 64 ? 3.781   -7.648  -0.417  1.00 0.00 ? 128 CYS A CA   5  
ATOM   6322  C  C    . CYS A 1 64 ? 3.136   -6.472  -1.146  1.00 0.00 ? 128 CYS A C    5  
ATOM   6323  O  O    . CYS A 1 64 ? 2.907   -5.415  -0.558  1.00 0.00 ? 128 CYS A O    5  
ATOM   6324  C  CB   . CYS A 1 64 ? 5.211   -7.851  -0.919  1.00 0.00 ? 128 CYS A CB   5  
ATOM   6325  S  SG   . CYS A 1 64 ? 6.196   -9.007  0.088   1.00 0.00 ? 128 CYS A SG   5  
ATOM   6326  H  H    . CYS A 1 64 ? 3.469   -9.716  -0.742  1.00 0.00 ? 128 CYS A H    5  
ATOM   6327  H  HA   . CYS A 1 64 ? 3.807   -7.429  0.640   1.00 0.00 ? 128 CYS A HA   5  
ATOM   6328  H  HB2  . CYS A 1 64 ? 5.179   -8.240  -1.926  1.00 0.00 ? 128 CYS A HB2  5  
ATOM   6329  H  HB3  . CYS A 1 64 ? 5.722   -6.900  -0.923  1.00 0.00 ? 128 CYS A HB3  5  
ATOM   6330  N  N    . ARG A 1 65 ? 2.847   -6.665  -2.428  1.00 0.00 ? 129 ARG A N    5  
ATOM   6331  C  CA   . ARG A 1 65 ? 2.230   -5.621  -3.238  1.00 0.00 ? 129 ARG A CA   5  
ATOM   6332  C  C    . ARG A 1 65 ? 1.042   -5.000  -2.510  1.00 0.00 ? 129 ARG A C    5  
ATOM   6333  O  O    . ARG A 1 65 ? 0.933   -3.778  -2.408  1.00 0.00 ? 129 ARG A O    5  
ATOM   6334  C  CB   . ARG A 1 65 ? 1.777   -6.191  -4.584  1.00 0.00 ? 129 ARG A CB   5  
ATOM   6335  C  CG   . ARG A 1 65 ? 1.671   -5.146  -5.682  1.00 0.00 ? 129 ARG A CG   5  
ATOM   6336  C  CD   . ARG A 1 65 ? 1.373   -5.783  -7.030  1.00 0.00 ? 129 ARG A CD   5  
ATOM   6337  N  NE   . ARG A 1 65 ? 1.164   -4.784  -8.074  1.00 0.00 ? 129 ARG A NE   5  
ATOM   6338  C  CZ   . ARG A 1 65 ? 0.730   -5.076  -9.295  1.00 0.00 ? 129 ARG A CZ   5  
ATOM   6339  N  NH1  . ARG A 1 65 ? 0.461   -6.332  -9.624  1.00 0.00 ? 129 ARG A NH1  5  
ATOM   6340  N  NH2  . ARG A 1 65 ? 0.565   -4.111  -10.191 1.00 0.00 ? 129 ARG A NH2  5  
ATOM   6341  H  H    . ARG A 1 65 ? 3.054   -7.530  -2.840  1.00 0.00 ? 129 ARG A H    5  
ATOM   6342  H  HA   . ARG A 1 65 ? 2.971   -4.855  -3.412  1.00 0.00 ? 129 ARG A HA   5  
ATOM   6343  H  HB2  . ARG A 1 65 ? 2.485   -6.943  -4.900  1.00 0.00 ? 129 ARG A HB2  5  
ATOM   6344  H  HB3  . ARG A 1 65 ? 0.808   -6.650  -4.458  1.00 0.00 ? 129 ARG A HB3  5  
ATOM   6345  H  HG2  . ARG A 1 65 ? 0.873   -4.460  -5.438  1.00 0.00 ? 129 ARG A HG2  5  
ATOM   6346  H  HG3  . ARG A 1 65 ? 2.605   -4.608  -5.746  1.00 0.00 ? 129 ARG A HG3  5  
ATOM   6347  H  HD2  . ARG A 1 65 ? 2.207   -6.411  -7.308  1.00 0.00 ? 129 ARG A HD2  5  
ATOM   6348  H  HD3  . ARG A 1 65 ? 0.483   -6.387  -6.939  1.00 0.00 ? 129 ARG A HD3  5  
ATOM   6349  H  HE   . ARG A 1 65 ? 1.357   -3.849  -7.853  1.00 0.00 ? 129 ARG A HE   5  
ATOM   6350  H  HH11 . ARG A 1 65 ? 0.584   -7.061  -8.951  1.00 0.00 ? 129 ARG A HH11 5  
ATOM   6351  H  HH12 . ARG A 1 65 ? 0.134   -6.550  -10.544 1.00 0.00 ? 129 ARG A HH12 5  
ATOM   6352  H  HH21 . ARG A 1 65 ? 0.767   -3.163  -9.947  1.00 0.00 ? 129 ARG A HH21 5  
ATOM   6353  H  HH22 . ARG A 1 65 ? 0.239   -4.332  -11.109 1.00 0.00 ? 129 ARG A HH22 5  
ATOM   6354  N  N    . PHE A 1 66 ? 0.153   -5.850  -2.007  1.00 0.00 ? 130 PHE A N    5  
ATOM   6355  C  CA   . PHE A 1 66 ? -1.029  -5.384  -1.290  1.00 0.00 ? 130 PHE A CA   5  
ATOM   6356  C  C    . PHE A 1 66 ? -0.644  -4.774  0.055   1.00 0.00 ? 130 PHE A C    5  
ATOM   6357  O  O    . PHE A 1 66 ? -1.180  -3.741  0.455   1.00 0.00 ? 130 PHE A O    5  
ATOM   6358  C  CB   . PHE A 1 66 ? -2.010  -6.539  -1.076  1.00 0.00 ? 130 PHE A CB   5  
ATOM   6359  C  CG   . PHE A 1 66 ? -3.376  -6.092  -0.642  1.00 0.00 ? 130 PHE A CG   5  
ATOM   6360  C  CD1  . PHE A 1 66 ? -4.243  -5.495  -1.543  1.00 0.00 ? 130 PHE A CD1  5  
ATOM   6361  C  CD2  . PHE A 1 66 ? -3.794  -6.269  0.668   1.00 0.00 ? 130 PHE A CD2  5  
ATOM   6362  C  CE1  . PHE A 1 66 ? -5.502  -5.083  -1.146  1.00 0.00 ? 130 PHE A CE1  5  
ATOM   6363  C  CE2  . PHE A 1 66 ? -5.051  -5.859  1.070   1.00 0.00 ? 130 PHE A CE2  5  
ATOM   6364  C  CZ   . PHE A 1 66 ? -5.906  -5.265  0.162   1.00 0.00 ? 130 PHE A CZ   5  
ATOM   6365  H  H    . PHE A 1 66 ? 0.295   -6.813  -2.120  1.00 0.00 ? 130 PHE A H    5  
ATOM   6366  H  HA   . PHE A 1 66 ? -1.504  -4.626  -1.893  1.00 0.00 ? 130 PHE A HA   5  
ATOM   6367  H  HB2  . PHE A 1 66 ? -2.118  -7.085  -2.001  1.00 0.00 ? 130 PHE A HB2  5  
ATOM   6368  H  HB3  . PHE A 1 66 ? -1.618  -7.198  -0.317  1.00 0.00 ? 130 PHE A HB3  5  
ATOM   6369  H  HD1  . PHE A 1 66 ? -3.928  -5.352  -2.567  1.00 0.00 ? 130 PHE A HD1  5  
ATOM   6370  H  HD2  . PHE A 1 66 ? -3.126  -6.733  1.379   1.00 0.00 ? 130 PHE A HD2  5  
ATOM   6371  H  HE1  . PHE A 1 66 ? -6.167  -4.618  -1.859  1.00 0.00 ? 130 PHE A HE1  5  
ATOM   6372  H  HE2  . PHE A 1 66 ? -5.364  -6.002  2.093   1.00 0.00 ? 130 PHE A HE2  5  
ATOM   6373  H  HZ   . PHE A 1 66 ? -6.888  -4.944  0.473   1.00 0.00 ? 130 PHE A HZ   5  
ATOM   6374  N  N    . GLN A 1 67 ? 0.288   -5.421  0.747   1.00 0.00 ? 131 GLN A N    5  
ATOM   6375  C  CA   . GLN A 1 67 ? 0.744   -4.943  2.046   1.00 0.00 ? 131 GLN A CA   5  
ATOM   6376  C  C    . GLN A 1 67 ? 1.257   -3.509  1.950   1.00 0.00 ? 131 GLN A C    5  
ATOM   6377  O  O    . GLN A 1 67 ? 0.745   -2.609  2.616   1.00 0.00 ? 131 GLN A O    5  
ATOM   6378  C  CB   . GLN A 1 67 ? 1.845   -5.855  2.592   1.00 0.00 ? 131 GLN A CB   5  
ATOM   6379  C  CG   . GLN A 1 67 ? 1.324   -7.168  3.152   1.00 0.00 ? 131 GLN A CG   5  
ATOM   6380  C  CD   . GLN A 1 67 ? 0.025   -7.003  3.917   1.00 0.00 ? 131 GLN A CD   5  
ATOM   6381  O  OE1  . GLN A 1 67 ? -1.042  -7.393  3.443   1.00 0.00 ? 131 GLN A OE1  5  
ATOM   6382  N  NE2  . GLN A 1 67 ? 0.110   -6.422  5.108   1.00 0.00 ? 131 GLN A NE2  5  
ATOM   6383  H  H    . GLN A 1 67 ? 0.678   -6.239  0.375   1.00 0.00 ? 131 GLN A H    5  
ATOM   6384  H  HA   . GLN A 1 67 ? -0.097  -4.966  2.722   1.00 0.00 ? 131 GLN A HA   5  
ATOM   6385  H  HB2  . GLN A 1 67 ? 2.539   -6.077  1.795   1.00 0.00 ? 131 GLN A HB2  5  
ATOM   6386  H  HB3  . GLN A 1 67 ? 2.368   -5.335  3.381   1.00 0.00 ? 131 GLN A HB3  5  
ATOM   6387  H  HG2  . GLN A 1 67 ? 1.156   -7.853  2.333   1.00 0.00 ? 131 GLN A HG2  5  
ATOM   6388  H  HG3  . GLN A 1 67 ? 2.067   -7.581  3.818   1.00 0.00 ? 131 GLN A HG3  5  
ATOM   6389  H  HE21 . GLN A 1 67 ? 0.994   -6.135  5.421   1.00 0.00 ? 131 GLN A HE21 5  
ATOM   6390  H  HE22 . GLN A 1 67 ? -0.714  -6.302  5.623   1.00 0.00 ? 131 GLN A HE22 5  
ATOM   6391  N  N    . LYS A 1 68 ? 2.271   -3.304  1.117   1.00 0.00 ? 132 LYS A N    5  
ATOM   6392  C  CA   . LYS A 1 68 ? 2.854   -1.980  0.932   1.00 0.00 ? 132 LYS A CA   5  
ATOM   6393  C  C    . LYS A 1 68 ? 1.768   -0.910  0.885   1.00 0.00 ? 132 LYS A C    5  
ATOM   6394  O  O    . LYS A 1 68 ? 1.852   0.104   1.579   1.00 0.00 ? 132 LYS A O    5  
ATOM   6395  C  CB   . LYS A 1 68 ? 3.681   -1.940  -0.355  1.00 0.00 ? 132 LYS A CB   5  
ATOM   6396  C  CG   . LYS A 1 68 ? 4.349   -0.599  -0.607  1.00 0.00 ? 132 LYS A CG   5  
ATOM   6397  C  CD   . LYS A 1 68 ? 5.442   -0.709  -1.657  1.00 0.00 ? 132 LYS A CD   5  
ATOM   6398  C  CE   . LYS A 1 68 ? 6.360   0.503   -1.635  1.00 0.00 ? 132 LYS A CE   5  
ATOM   6399  N  NZ   . LYS A 1 68 ? 7.482   0.332   -0.671  1.00 0.00 ? 132 LYS A NZ   5  
ATOM   6400  H  H    . LYS A 1 68 ? 2.637   -4.062  0.613   1.00 0.00 ? 132 LYS A H    5  
ATOM   6401  H  HA   . LYS A 1 68 ? 3.502   -1.782  1.772   1.00 0.00 ? 132 LYS A HA   5  
ATOM   6402  H  HB2  . LYS A 1 68 ? 4.449   -2.697  -0.299  1.00 0.00 ? 132 LYS A HB2  5  
ATOM   6403  H  HB3  . LYS A 1 68 ? 3.033   -2.158  -1.192  1.00 0.00 ? 132 LYS A HB3  5  
ATOM   6404  H  HG2  . LYS A 1 68 ? 3.605   0.105   -0.950  1.00 0.00 ? 132 LYS A HG2  5  
ATOM   6405  H  HG3  . LYS A 1 68 ? 4.784   -0.245  0.317   1.00 0.00 ? 132 LYS A HG3  5  
ATOM   6406  H  HD2  . LYS A 1 68 ? 6.029   -1.594  -1.461  1.00 0.00 ? 132 LYS A HD2  5  
ATOM   6407  H  HD3  . LYS A 1 68 ? 4.985   -0.787  -2.633  1.00 0.00 ? 132 LYS A HD3  5  
ATOM   6408  H  HE2  . LYS A 1 68 ? 6.766   0.649   -2.624  1.00 0.00 ? 132 LYS A HE2  5  
ATOM   6409  H  HE3  . LYS A 1 68 ? 5.782   1.371   -1.352  1.00 0.00 ? 132 LYS A HE3  5  
ATOM   6410  H  HZ1  . LYS A 1 68 ? 8.014   -0.533  -0.892  1.00 0.00 ? 132 LYS A HZ1  5  
ATOM   6411  H  HZ2  . LYS A 1 68 ? 7.112   0.262   0.298   1.00 0.00 ? 132 LYS A HZ2  5  
ATOM   6412  H  HZ3  . LYS A 1 68 ? 8.127   1.146   -0.725  1.00 0.00 ? 132 LYS A HZ3  5  
ATOM   6413  N  N    . CYS A 1 69 ? 0.750   -1.142  0.064   1.00 0.00 ? 133 CYS A N    5  
ATOM   6414  C  CA   . CYS A 1 69 ? -0.353  -0.197  -0.072  1.00 0.00 ? 133 CYS A CA   5  
ATOM   6415  C  C    . CYS A 1 69 ? -0.950  0.141   1.290   1.00 0.00 ? 133 CYS A C    5  
ATOM   6416  O  O    . CYS A 1 69 ? -1.103  1.313   1.639   1.00 0.00 ? 133 CYS A O    5  
ATOM   6417  C  CB   . CYS A 1 69 ? -1.435  -0.773  -0.988  1.00 0.00 ? 133 CYS A CB   5  
ATOM   6418  S  SG   . CYS A 1 69 ? -1.034  -0.685  -2.749  1.00 0.00 ? 133 CYS A SG   5  
ATOM   6419  H  H    . CYS A 1 69 ? 0.739   -1.968  -0.463  1.00 0.00 ? 133 CYS A H    5  
ATOM   6420  H  HA   . CYS A 1 69 ? 0.038   0.706   -0.515  1.00 0.00 ? 133 CYS A HA   5  
ATOM   6421  H  HB2  . CYS A 1 69 ? -1.591  -1.812  -0.739  1.00 0.00 ? 133 CYS A HB2  5  
ATOM   6422  H  HB3  . CYS A 1 69 ? -2.355  -0.230  -0.831  1.00 0.00 ? 133 CYS A HB3  5  
ATOM   6423  H  HG   . CYS A 1 69 ? -0.164  -1.647  -3.018  1.00 0.00 ? 133 CYS A HG   5  
ATOM   6424  N  N    . LEU A 1 70 ? -1.289  -0.890  2.055   1.00 0.00 ? 134 LEU A N    5  
ATOM   6425  C  CA   . LEU A 1 70 ? -1.871  -0.702  3.379   1.00 0.00 ? 134 LEU A CA   5  
ATOM   6426  C  C    . LEU A 1 70 ? -0.989  0.196   4.240   1.00 0.00 ? 134 LEU A C    5  
ATOM   6427  O  O    . LEU A 1 70 ? -1.439  1.223   4.747   1.00 0.00 ? 134 LEU A O    5  
ATOM   6428  C  CB   . LEU A 1 70 ? -2.068  -2.054  4.068   1.00 0.00 ? 134 LEU A CB   5  
ATOM   6429  C  CG   . LEU A 1 70 ? -2.965  -3.055  3.338   1.00 0.00 ? 134 LEU A CG   5  
ATOM   6430  C  CD1  . LEU A 1 70 ? -2.740  -4.461  3.872   1.00 0.00 ? 134 LEU A CD1  5  
ATOM   6431  C  CD2  . LEU A 1 70 ? -4.428  -2.658  3.475   1.00 0.00 ? 134 LEU A CD2  5  
ATOM   6432  H  H    . LEU A 1 70 ? -1.143  -1.800  1.723   1.00 0.00 ? 134 LEU A H    5  
ATOM   6433  H  HA   . LEU A 1 70 ? -2.833  -0.228  3.253   1.00 0.00 ? 134 LEU A HA   5  
ATOM   6434  H  HB2  . LEU A 1 70 ? -1.097  -2.508  4.188   1.00 0.00 ? 134 LEU A HB2  5  
ATOM   6435  H  HB3  . LEU A 1 70 ? -2.500  -1.869  5.041   1.00 0.00 ? 134 LEU A HB3  5  
ATOM   6436  H  HG   . LEU A 1 70 ? -2.714  -3.053  2.286   1.00 0.00 ? 134 LEU A HG   5  
ATOM   6437  H  HD11 . LEU A 1 70 ? -1.744  -4.536  4.281   1.00 0.00 ? 134 LEU A HD11 5  
ATOM   6438  H  HD12 . LEU A 1 70 ? -2.854  -5.173  3.068   1.00 0.00 ? 134 LEU A HD12 5  
ATOM   6439  H  HD13 . LEU A 1 70 ? -3.465  -4.673  4.644   1.00 0.00 ? 134 LEU A HD13 5  
ATOM   6440  H  HD21 . LEU A 1 70 ? -4.975  -3.458  3.950   1.00 0.00 ? 134 LEU A HD21 5  
ATOM   6441  H  HD22 . LEU A 1 70 ? -4.842  -2.470  2.495   1.00 0.00 ? 134 LEU A HD22 5  
ATOM   6442  H  HD23 . LEU A 1 70 ? -4.503  -1.763  4.076   1.00 0.00 ? 134 LEU A HD23 5  
ATOM   6443  N  N    . ALA A 1 71 ? 0.271   -0.197  4.398   1.00 0.00 ? 135 ALA A N    5  
ATOM   6444  C  CA   . ALA A 1 71 ? 1.218   0.574   5.194   1.00 0.00 ? 135 ALA A CA   5  
ATOM   6445  C  C    . ALA A 1 71 ? 1.203   2.045   4.790   1.00 0.00 ? 135 ALA A C    5  
ATOM   6446  O  O    . ALA A 1 71 ? 1.337   2.932   5.634   1.00 0.00 ? 135 ALA A O    5  
ATOM   6447  C  CB   . ALA A 1 71 ? 2.619   -0.001  5.050   1.00 0.00 ? 135 ALA A CB   5  
ATOM   6448  H  H    . ALA A 1 71 ? 0.571   -1.025  3.969   1.00 0.00 ? 135 ALA A H    5  
ATOM   6449  H  HA   . ALA A 1 71 ? 0.926   0.493   6.231   1.00 0.00 ? 135 ALA A HA   5  
ATOM   6450  H  HB1  . ALA A 1 71 ? 2.659   -0.973  5.517   1.00 0.00 ? 135 ALA A HB1  5  
ATOM   6451  H  HB2  . ALA A 1 71 ? 2.863   -0.094  4.002   1.00 0.00 ? 135 ALA A HB2  5  
ATOM   6452  H  HB3  . ALA A 1 71 ? 3.329   0.658   5.528   1.00 0.00 ? 135 ALA A HB3  5  
ATOM   6453  N  N    . LEU A 1 72 ? 1.041   2.297   3.496   1.00 0.00 ? 136 LEU A N    5  
ATOM   6454  C  CA   . LEU A 1 72 ? 1.009   3.661   2.980   1.00 0.00 ? 136 LEU A CA   5  
ATOM   6455  C  C    . LEU A 1 72 ? -0.247  4.391   3.446   1.00 0.00 ? 136 LEU A C    5  
ATOM   6456  O  O    . LEU A 1 72 ? -0.269  5.618   3.531   1.00 0.00 ? 136 LEU A O    5  
ATOM   6457  C  CB   . LEU A 1 72 ? 1.070   3.651   1.452   1.00 0.00 ? 136 LEU A CB   5  
ATOM   6458  C  CG   . LEU A 1 72 ? 2.399   3.212   0.836   1.00 0.00 ? 136 LEU A CG   5  
ATOM   6459  C  CD1  . LEU A 1 72 ? 2.245   2.987   -0.660  1.00 0.00 ? 136 LEU A CD1  5  
ATOM   6460  C  CD2  . LEU A 1 72 ? 3.482   4.245   1.113   1.00 0.00 ? 136 LEU A CD2  5  
ATOM   6461  H  H    . LEU A 1 72 ? 0.939   1.549   2.872   1.00 0.00 ? 136 LEU A H    5  
ATOM   6462  H  HA   . LEU A 1 72 ? 1.875   4.180   3.364   1.00 0.00 ? 136 LEU A HA   5  
ATOM   6463  H  HB2  . LEU A 1 72 ? 0.303   2.981   1.095   1.00 0.00 ? 136 LEU A HB2  5  
ATOM   6464  H  HB3  . LEU A 1 72 ? 0.859   4.653   1.107   1.00 0.00 ? 136 LEU A HB3  5  
ATOM   6465  H  HG   . LEU A 1 72 ? 2.704   2.277   1.284   1.00 0.00 ? 136 LEU A HG   5  
ATOM   6466  H  HD11 . LEU A 1 72 ? 2.882   2.173   -0.969  1.00 0.00 ? 136 LEU A HD11 5  
ATOM   6467  H  HD12 . LEU A 1 72 ? 2.526   3.885   -1.190  1.00 0.00 ? 136 LEU A HD12 5  
ATOM   6468  H  HD13 . LEU A 1 72 ? 1.216   2.745   -0.884  1.00 0.00 ? 136 LEU A HD13 5  
ATOM   6469  H  HD21 . LEU A 1 72 ? 3.821   4.145   2.133   1.00 0.00 ? 136 LEU A HD21 5  
ATOM   6470  H  HD22 . LEU A 1 72 ? 3.080   5.236   0.962   1.00 0.00 ? 136 LEU A HD22 5  
ATOM   6471  H  HD23 . LEU A 1 72 ? 4.311   4.086   0.439   1.00 0.00 ? 136 LEU A HD23 5  
ATOM   6472  N  N    . GLY A 1 73 ? -1.291  3.626   3.750   1.00 0.00 ? 137 GLY A N    5  
ATOM   6473  C  CA   . GLY A 1 73 ? -2.536  4.217   4.206   1.00 0.00 ? 137 GLY A CA   5  
ATOM   6474  C  C    . GLY A 1 73 ? -3.707  3.864   3.310   1.00 0.00 ? 137 GLY A C    5  
ATOM   6475  O  O    . GLY A 1 73 ? -4.862  4.086   3.672   1.00 0.00 ? 137 GLY A O    5  
ATOM   6476  H  H    . GLY A 1 73 ? -1.216  2.652   3.663   1.00 0.00 ? 137 GLY A H    5  
ATOM   6477  H  HA2  . GLY A 1 73 ? -2.743  3.867   5.206   1.00 0.00 ? 137 GLY A HA2  5  
ATOM   6478  H  HA3  . GLY A 1 73 ? -2.424  5.291   4.227   1.00 0.00 ? 137 GLY A HA3  5  
ATOM   6479  N  N    . MET A 1 74 ? -3.409  3.315   2.137   1.00 0.00 ? 138 MET A N    5  
ATOM   6480  C  CA   . MET A 1 74 ? -4.447  2.932   1.187   1.00 0.00 ? 138 MET A CA   5  
ATOM   6481  C  C    . MET A 1 74 ? -5.696  2.443   1.914   1.00 0.00 ? 138 MET A C    5  
ATOM   6482  O  O    . MET A 1 74 ? -5.624  1.553   2.761   1.00 0.00 ? 138 MET A O    5  
ATOM   6483  C  CB   . MET A 1 74 ? -3.930  1.841   0.247   1.00 0.00 ? 138 MET A CB   5  
ATOM   6484  C  CG   . MET A 1 74 ? -3.225  2.384   -0.985  1.00 0.00 ? 138 MET A CG   5  
ATOM   6485  S  SD   . MET A 1 74 ? -4.319  2.511   -2.412  1.00 0.00 ? 138 MET A SD   5  
ATOM   6486  C  CE   . MET A 1 74 ? -3.171  3.069   -3.669  1.00 0.00 ? 138 MET A CE   5  
ATOM   6487  H  H    . MET A 1 74 ? -2.469  3.163   1.905   1.00 0.00 ? 138 MET A H    5  
ATOM   6488  H  HA   . MET A 1 74 ? -4.702  3.805   0.605   1.00 0.00 ? 138 MET A HA   5  
ATOM   6489  H  HB2  . MET A 1 74 ? -3.235  1.216   0.788   1.00 0.00 ? 138 MET A HB2  5  
ATOM   6490  H  HB3  . MET A 1 74 ? -4.765  1.238   -0.079  1.00 0.00 ? 138 MET A HB3  5  
ATOM   6491  H  HG2  . MET A 1 74 ? -2.837  3.366   -0.758  1.00 0.00 ? 138 MET A HG2  5  
ATOM   6492  H  HG3  . MET A 1 74 ? -2.406  1.725   -1.233  1.00 0.00 ? 138 MET A HG3  5  
ATOM   6493  H  HE1  . MET A 1 74 ? -3.328  4.121   -3.858  1.00 0.00 ? 138 MET A HE1  5  
ATOM   6494  H  HE2  . MET A 1 74 ? -2.159  2.911   -3.329  1.00 0.00 ? 138 MET A HE2  5  
ATOM   6495  H  HE3  . MET A 1 74 ? -3.336  2.511   -4.579  1.00 0.00 ? 138 MET A HE3  5  
ATOM   6496  N  N    . SER A 1 75 ? -6.839  3.032   1.578   1.00 0.00 ? 139 SER A N    5  
ATOM   6497  C  CA   . SER A 1 75 ? -8.103  2.659   2.202   1.00 0.00 ? 139 SER A CA   5  
ATOM   6498  C  C    . SER A 1 75 ? -9.047  2.029   1.183   1.00 0.00 ? 139 SER A C    5  
ATOM   6499  O  O    . SER A 1 75 ? -9.278  2.583   0.107   1.00 0.00 ? 139 SER A O    5  
ATOM   6500  C  CB   . SER A 1 75 ? -8.764  3.885   2.837   1.00 0.00 ? 139 SER A CB   5  
ATOM   6501  O  OG   . SER A 1 75 ? -9.236  4.780   1.846   1.00 0.00 ? 139 SER A OG   5  
ATOM   6502  H  H    . SER A 1 75 ? -6.832  3.735   0.896   1.00 0.00 ? 139 SER A H    5  
ATOM   6503  H  HA   . SER A 1 75 ? -7.891  1.935   2.975   1.00 0.00 ? 139 SER A HA   5  
ATOM   6504  H  HB2  . SER A 1 75 ? -9.597  3.567   3.445   1.00 0.00 ? 139 SER A HB2  5  
ATOM   6505  H  HB3  . SER A 1 75 ? -8.042  4.399   3.456   1.00 0.00 ? 139 SER A HB3  5  
ATOM   6506  H  HG   . SER A 1 75 ? -8.727  4.664   1.040   1.00 0.00 ? 139 SER A HG   5  
ATOM   6507  N  N    . HIS A 1 76 ? -9.592  0.867   1.529   1.00 0.00 ? 140 HIS A N    5  
ATOM   6508  C  CA   . HIS A 1 76 ? -10.512 0.160   0.646   1.00 0.00 ? 140 HIS A CA   5  
ATOM   6509  C  C    . HIS A 1 76 ? -11.960 0.519   0.970   1.00 0.00 ? 140 HIS A C    5  
ATOM   6510  O  O    . HIS A 1 76 ? -12.882 -0.227  0.642   1.00 0.00 ? 140 HIS A O    5  
ATOM   6511  C  CB   . HIS A 1 76 ? -10.310 -1.350  0.766   1.00 0.00 ? 140 HIS A CB   5  
ATOM   6512  C  CG   . HIS A 1 76 ? -10.307 -1.843  2.180   1.00 0.00 ? 140 HIS A CG   5  
ATOM   6513  N  ND1  . HIS A 1 76 ? -11.127 -1.324  3.160   1.00 0.00 ? 140 HIS A ND1  5  
ATOM   6514  C  CD2  . HIS A 1 76 ? -9.579  -2.816  2.777   1.00 0.00 ? 140 HIS A CD2  5  
ATOM   6515  C  CE1  . HIS A 1 76 ? -10.902 -1.955  4.299   1.00 0.00 ? 140 HIS A CE1  5  
ATOM   6516  N  NE2  . HIS A 1 76 ? -9.967  -2.865  4.093   1.00 0.00 ? 140 HIS A NE2  5  
ATOM   6517  H  H    . HIS A 1 76 ? -9.370  0.476   2.400   1.00 0.00 ? 140 HIS A H    5  
ATOM   6518  H  HA   . HIS A 1 76 ? -10.298 0.464   -0.368  1.00 0.00 ? 140 HIS A HA   5  
ATOM   6519  H  HB2  . HIS A 1 76 ? -11.106 -1.857  0.240   1.00 0.00 ? 140 HIS A HB2  5  
ATOM   6520  H  HB3  . HIS A 1 76 ? -9.363  -1.617  0.319   1.00 0.00 ? 140 HIS A HB3  5  
ATOM   6521  H  HD1  . HIS A 1 76 ? -11.775 -0.600  3.039   1.00 0.00 ? 140 HIS A HD1  5  
ATOM   6522  H  HD2  . HIS A 1 76 ? -8.831  -3.438  2.306   1.00 0.00 ? 140 HIS A HD2  5  
ATOM   6523  H  HE1  . HIS A 1 76 ? -11.398 -1.760  5.238   1.00 0.00 ? 140 HIS A HE1  5  
ATOM   6524  N  N    . ASN A 1 77 ? -12.150 1.665   1.615   1.00 0.00 ? 141 ASN A N    5  
ATOM   6525  C  CA   . ASN A 1 77 ? -13.485 2.121   1.984   1.00 0.00 ? 141 ASN A CA   5  
ATOM   6526  C  C    . ASN A 1 77 ? -14.025 3.113   0.958   1.00 0.00 ? 141 ASN A C    5  
ATOM   6527  O  O    . ASN A 1 77 ? -15.230 3.183   0.722   1.00 0.00 ? 141 ASN A O    5  
ATOM   6528  C  CB   . ASN A 1 77 ? -13.460 2.768   3.371   1.00 0.00 ? 141 ASN A CB   5  
ATOM   6529  C  CG   . ASN A 1 77 ? -12.940 4.193   3.335   1.00 0.00 ? 141 ASN A CG   5  
ATOM   6530  O  OD1  . ASN A 1 77 ? -11.737 4.423   3.215   1.00 0.00 ? 141 ASN A OD1  5  
ATOM   6531  N  ND2  . ASN A 1 77 ? -13.848 5.156   3.439   1.00 0.00 ? 141 ASN A ND2  5  
ATOM   6532  H  H    . ASN A 1 77 ? -11.375 2.217   1.849   1.00 0.00 ? 141 ASN A H    5  
ATOM   6533  H  HA   . ASN A 1 77 ? -14.134 1.259   2.011   1.00 0.00 ? 141 ASN A HA   5  
ATOM   6534  H  HB2  . ASN A 1 77 ? -14.463 2.782   3.773   1.00 0.00 ? 141 ASN A HB2  5  
ATOM   6535  H  HB3  . ASN A 1 77 ? -12.824 2.188   4.021   1.00 0.00 ? 141 ASN A HB3  5  
ATOM   6536  H  HD21 . ASN A 1 77 ? -14.789 4.899   3.531   1.00 0.00 ? 141 ASN A HD21 5  
ATOM   6537  H  HD22 . ASN A 1 77 ? -13.539 6.086   3.418   1.00 0.00 ? 141 ASN A HD22 5  
ATOM   6538  N  N    . ALA A 1 78 ? -13.123 3.877   0.350   1.00 0.00 ? 142 ALA A N    5  
ATOM   6539  C  CA   . ALA A 1 78 ? -13.507 4.862   -0.653  1.00 0.00 ? 142 ALA A CA   5  
ATOM   6540  C  C    . ALA A 1 78 ? -14.205 4.198   -1.835  1.00 0.00 ? 142 ALA A C    5  
ATOM   6541  O  O    . ALA A 1 78 ? -14.994 4.831   -2.538  1.00 0.00 ? 142 ALA A O    5  
ATOM   6542  C  CB   . ALA A 1 78 ? -12.287 5.638   -1.125  1.00 0.00 ? 142 ALA A CB   5  
ATOM   6543  H  H    . ALA A 1 78 ? -12.176 3.774   0.581   1.00 0.00 ? 142 ALA A H    5  
ATOM   6544  H  HA   . ALA A 1 78 ? -14.191 5.560   -0.190  1.00 0.00 ? 142 ALA A HA   5  
ATOM   6545  H  HB1  . ALA A 1 78 ? -12.040 5.341   -2.134  1.00 0.00 ? 142 ALA A HB1  5  
ATOM   6546  H  HB2  . ALA A 1 78 ? -12.504 6.696   -1.104  1.00 0.00 ? 142 ALA A HB2  5  
ATOM   6547  H  HB3  . ALA A 1 78 ? -11.452 5.428   -0.473  1.00 0.00 ? 142 ALA A HB3  5  
ATOM   6548  N  N    . ILE A 1 79 ? -13.909 2.921   -2.050  1.00 0.00 ? 143 ILE A N    5  
ATOM   6549  C  CA   . ILE A 1 79 ? -14.508 2.172   -3.147  1.00 0.00 ? 143 ILE A CA   5  
ATOM   6550  C  C    . ILE A 1 79 ? -16.018 2.379   -3.194  1.00 0.00 ? 143 ILE A C    5  
ATOM   6551  O  O    . ILE A 1 79 ? -16.563 2.828   -4.203  1.00 0.00 ? 143 ILE A O    5  
ATOM   6552  C  CB   . ILE A 1 79 ? -14.211 0.665   -3.029  1.00 0.00 ? 143 ILE A CB   5  
ATOM   6553  C  CG1  . ILE A 1 79 ? -12.701 0.424   -2.970  1.00 0.00 ? 143 ILE A CG1  5  
ATOM   6554  C  CG2  . ILE A 1 79 ? -14.828 -0.089  -4.198  1.00 0.00 ? 143 ILE A CG2  5  
ATOM   6555  C  CD1  . ILE A 1 79 ? -11.955 0.968   -4.168  1.00 0.00 ? 143 ILE A CD1  5  
ATOM   6556  H  H    . ILE A 1 79 ? -13.273 2.471   -1.455  1.00 0.00 ? 143 ILE A H    5  
ATOM   6557  H  HA   . ILE A 1 79 ? -14.077 2.532   -4.071  1.00 0.00 ? 143 ILE A HA   5  
ATOM   6558  H  HB   . ILE A 1 79 ? -14.662 0.302   -2.119  1.00 0.00 ? 143 ILE A HB   5  
ATOM   6559  H  HG12 . ILE A 1 79 ? -12.302 0.898   -2.088  1.00 0.00 ? 143 ILE A HG12 5  
ATOM   6560  H  HG13 . ILE A 1 79 ? -12.516 -0.639  -2.918  1.00 0.00 ? 143 ILE A HG13 5  
ATOM   6561  H  HG21 . ILE A 1 79 ? -15.794 -0.474  -3.907  1.00 0.00 ? 143 ILE A HG21 5  
ATOM   6562  H  HG22 . ILE A 1 79 ? -14.946 0.581   -5.036  1.00 0.00 ? 143 ILE A HG22 5  
ATOM   6563  H  HG23 . ILE A 1 79 ? -14.184 -0.908  -4.478  1.00 0.00 ? 143 ILE A HG23 5  
ATOM   6564  H  HD11 . ILE A 1 79 ? -11.042 0.408   -4.308  1.00 0.00 ? 143 ILE A HD11 5  
ATOM   6565  H  HD12 . ILE A 1 79 ? -12.572 0.876   -5.050  1.00 0.00 ? 143 ILE A HD12 5  
ATOM   6566  H  HD13 . ILE A 1 79 ? -11.716 2.008   -4.002  1.00 0.00 ? 143 ILE A HD13 5  
ATOM   6567  N  N    . ARG A 1 80 ? -16.689 2.050   -2.095  1.00 0.00 ? 144 ARG A N    5  
ATOM   6568  C  CA   . ARG A 1 80 ? -18.137 2.201   -2.009  1.00 0.00 ? 144 ARG A CA   5  
ATOM   6569  C  C    . ARG A 1 80 ? -18.606 2.128   -0.559  1.00 0.00 ? 144 ARG A C    5  
ATOM   6570  O  O    . ARG A 1 80 ? -18.262 1.198   0.170   1.00 0.00 ? 144 ARG A O    5  
ATOM   6571  C  CB   . ARG A 1 80 ? -18.833 1.119   -2.837  1.00 0.00 ? 144 ARG A CB   5  
ATOM   6572  C  CG   . ARG A 1 80 ? -20.319 1.365   -3.035  1.00 0.00 ? 144 ARG A CG   5  
ATOM   6573  C  CD   . ARG A 1 80 ? -21.019 0.135   -3.590  1.00 0.00 ? 144 ARG A CD   5  
ATOM   6574  N  NE   . ARG A 1 80 ? -22.469 0.210   -3.429  1.00 0.00 ? 144 ARG A NE   5  
ATOM   6575  C  CZ   . ARG A 1 80 ? -23.302 -0.752  -3.809  1.00 0.00 ? 144 ARG A CZ   5  
ATOM   6576  N  NH1  . ARG A 1 80 ? -22.831 -1.858  -4.368  1.00 0.00 ? 144 ARG A NH1  5  
ATOM   6577  N  NH2  . ARG A 1 80 ? -24.609 -0.610  -3.630  1.00 0.00 ? 144 ARG A NH2  5  
ATOM   6578  H  H    . ARG A 1 80 ? -16.199 1.698   -1.322  1.00 0.00 ? 144 ARG A H    5  
ATOM   6579  H  HA   . ARG A 1 80 ? -18.394 3.170   -2.411  1.00 0.00 ? 144 ARG A HA   5  
ATOM   6580  H  HB2  . ARG A 1 80 ? -18.366 1.070   -3.810  1.00 0.00 ? 144 ARG A HB2  5  
ATOM   6581  H  HB3  . ARG A 1 80 ? -18.711 0.168   -2.340  1.00 0.00 ? 144 ARG A HB3  5  
ATOM   6582  H  HG2  . ARG A 1 80 ? -20.763 1.619   -2.083  1.00 0.00 ? 144 ARG A HG2  5  
ATOM   6583  H  HG3  . ARG A 1 80 ? -20.450 2.185   -3.725  1.00 0.00 ? 144 ARG A HG3  5  
ATOM   6584  H  HD2  . ARG A 1 80 ? -20.787 0.048   -4.640  1.00 0.00 ? 144 ARG A HD2  5  
ATOM   6585  H  HD3  . ARG A 1 80 ? -20.653 -0.737  -3.067  1.00 0.00 ? 144 ARG A HD3  5  
ATOM   6586  H  HE   . ARG A 1 80 ? -22.838 1.019   -3.018  1.00 0.00 ? 144 ARG A HE   5  
ATOM   6587  H  HH11 . ARG A 1 80 ? -21.846 -1.969  -4.504  1.00 0.00 ? 144 ARG A HH11 5  
ATOM   6588  H  HH12 . ARG A 1 80 ? -23.460 -2.582  -4.652  1.00 0.00 ? 144 ARG A HH12 5  
ATOM   6589  H  HH21 . ARG A 1 80 ? -24.967 0.223   -3.208  1.00 0.00 ? 144 ARG A HH21 5  
ATOM   6590  H  HH22 . ARG A 1 80 ? -25.234 -1.335  -3.916  1.00 0.00 ? 144 ARG A HH22 5  
ATOM   6591  N  N    . PHE A 1 81 ? -19.394 3.116   -0.148  1.00 0.00 ? 145 PHE A N    5  
ATOM   6592  C  CA   . PHE A 1 81 ? -19.910 3.166   1.215   1.00 0.00 ? 145 PHE A CA   5  
ATOM   6593  C  C    . PHE A 1 81 ? -21.435 3.205   1.219   1.00 0.00 ? 145 PHE A C    5  
ATOM   6594  O  O    . PHE A 1 81 ? -22.048 4.000   0.506   1.00 0.00 ? 145 PHE A O    5  
ATOM   6595  C  CB   . PHE A 1 81 ? -19.355 4.388   1.949   1.00 0.00 ? 145 PHE A CB   5  
ATOM   6596  C  CG   . PHE A 1 81 ? -20.063 5.667   1.604   1.00 0.00 ? 145 PHE A CG   5  
ATOM   6597  C  CD1  . PHE A 1 81 ? -21.282 5.978   2.184   1.00 0.00 ? 145 PHE A CD1  5  
ATOM   6598  C  CD2  . PHE A 1 81 ? -19.509 6.558   0.698   1.00 0.00 ? 145 PHE A CD2  5  
ATOM   6599  C  CE1  . PHE A 1 81 ? -21.936 7.155   1.868   1.00 0.00 ? 145 PHE A CE1  5  
ATOM   6600  C  CE2  . PHE A 1 81 ? -20.158 7.736   0.379   1.00 0.00 ? 145 PHE A CE2  5  
ATOM   6601  C  CZ   . PHE A 1 81 ? -21.374 8.034   0.964   1.00 0.00 ? 145 PHE A CZ   5  
ATOM   6602  H  H    . PHE A 1 81 ? -19.633 3.830   -0.776  1.00 0.00 ? 145 PHE A H    5  
ATOM   6603  H  HA   . PHE A 1 81 ? -19.583 2.272   1.725   1.00 0.00 ? 145 PHE A HA   5  
ATOM   6604  H  HB2  . PHE A 1 81 ? -19.450 4.234   3.014   1.00 0.00 ? 145 PHE A HB2  5  
ATOM   6605  H  HB3  . PHE A 1 81 ? -18.312 4.507   1.699   1.00 0.00 ? 145 PHE A HB3  5  
ATOM   6606  H  HD1  . PHE A 1 81 ? -21.723 5.291   2.892   1.00 0.00 ? 145 PHE A HD1  5  
ATOM   6607  H  HD2  . PHE A 1 81 ? -18.560 6.326   0.239   1.00 0.00 ? 145 PHE A HD2  5  
ATOM   6608  H  HE1  . PHE A 1 81 ? -22.886 7.384   2.327   1.00 0.00 ? 145 PHE A HE1  5  
ATOM   6609  H  HE2  . PHE A 1 81 ? -19.717 8.421   -0.329  1.00 0.00 ? 145 PHE A HE2  5  
ATOM   6610  H  HZ   . PHE A 1 81 ? -21.882 8.953   0.716   1.00 0.00 ? 145 PHE A HZ   5  
ATOM   6611  N  N    . GLY A 1 82 ? -22.042 2.340   2.026   1.00 0.00 ? 146 GLY A N    5  
ATOM   6612  C  CA   . GLY A 1 82 ? -23.490 2.292   2.107   1.00 0.00 ? 146 GLY A CA   5  
ATOM   6613  C  C    . GLY A 1 82 ? -23.978 1.583   3.355   1.00 0.00 ? 146 GLY A C    5  
ATOM   6614  O  O    . GLY A 1 82 ? -23.380 0.599   3.791   1.00 0.00 ? 146 GLY A O    5  
ATOM   6615  H  H    . GLY A 1 82 ? -21.502 1.730   2.571   1.00 0.00 ? 146 GLY A H    5  
ATOM   6616  H  HA2  . GLY A 1 82 ? -23.874 3.301   2.105   1.00 0.00 ? 146 GLY A HA2  5  
ATOM   6617  H  HA3  . GLY A 1 82 ? -23.870 1.771   1.240   1.00 0.00 ? 146 GLY A HA3  5  
ATOM   6618  N  N    . SER A 1 83 ? -25.065 2.084   3.931   1.00 0.00 ? 147 SER A N    5  
ATOM   6619  C  CA   . SER A 1 83 ? -25.630 1.495   5.140   1.00 0.00 ? 147 SER A CA   5  
ATOM   6620  C  C    . SER A 1 83 ? -27.057 1.015   4.895   1.00 0.00 ? 147 SER A C    5  
ATOM   6621  O  O    . SER A 1 83 ? -27.894 1.756   4.382   1.00 0.00 ? 147 SER A O    5  
ATOM   6622  C  CB   . SER A 1 83 ? -25.611 2.511   6.284   1.00 0.00 ? 147 SER A CB   5  
ATOM   6623  O  OG   . SER A 1 83 ? -26.557 3.543   6.065   1.00 0.00 ? 147 SER A OG   5  
ATOM   6624  H  H    . SER A 1 83 ? -25.497 2.870   3.536   1.00 0.00 ? 147 SER A H    5  
ATOM   6625  H  HA   . SER A 1 83 ? -25.019 0.648   5.413   1.00 0.00 ? 147 SER A HA   5  
ATOM   6626  H  HB2  . SER A 1 83 ? -25.850 2.011   7.210   1.00 0.00 ? 147 SER A HB2  5  
ATOM   6627  H  HB3  . SER A 1 83 ? -24.626 2.950   6.356   1.00 0.00 ? 147 SER A HB3  5  
ATOM   6628  H  HG   . SER A 1 83 ? -26.785 3.576   5.134   1.00 0.00 ? 147 SER A HG   5  
ATOM   6629  N  N    . GLY A 1 84 ? -27.326 -0.233  5.267   1.00 0.00 ? 148 GLY A N    5  
ATOM   6630  C  CA   . GLY A 1 84 ? -28.652 -0.793  5.080   1.00 0.00 ? 148 GLY A CA   5  
ATOM   6631  C  C    . GLY A 1 84 ? -29.346 -1.091  6.394   1.00 0.00 ? 148 GLY A C    5  
ATOM   6632  O  O    . GLY A 1 84 ? -28.748 -1.019  7.467   1.00 0.00 ? 148 GLY A O    5  
ATOM   6633  H  H    . GLY A 1 84 ? -26.619 -0.778  5.672   1.00 0.00 ? 148 GLY A H    5  
ATOM   6634  H  HA2  . GLY A 1 84 ? -29.252 -0.091  4.519   1.00 0.00 ? 148 GLY A HA2  5  
ATOM   6635  H  HA3  . GLY A 1 84 ? -28.567 -1.710  4.515   1.00 0.00 ? 148 GLY A HA3  5  
ATOM   6636  N  N    . PRO A 1 85 ? -30.641 -1.434  6.320   1.00 0.00 ? 149 PRO A N    5  
ATOM   6637  C  CA   . PRO A 1 85 ? -31.446 -1.749  7.504   1.00 0.00 ? 149 PRO A CA   5  
ATOM   6638  C  C    . PRO A 1 85 ? -31.033 -3.067  8.150   1.00 0.00 ? 149 PRO A C    5  
ATOM   6639  O  O    . PRO A 1 85 ? -31.159 -3.241  9.362   1.00 0.00 ? 149 PRO A O    5  
ATOM   6640  C  CB   . PRO A 1 85 ? -32.869 -1.849  6.949   1.00 0.00 ? 149 PRO A CB   5  
ATOM   6641  C  CG   . PRO A 1 85 ? -32.692 -2.207  5.514   1.00 0.00 ? 149 PRO A CG   5  
ATOM   6642  C  CD   . PRO A 1 85 ? -31.419 -1.540  5.074   1.00 0.00 ? 149 PRO A CD   5  
ATOM   6643  H  HA   . PRO A 1 85 ? -31.398 -0.959  8.238   1.00 0.00 ? 149 PRO A HA   5  
ATOM   6644  H  HB2  . PRO A 1 85 ? -33.414 -2.613  7.484   1.00 0.00 ? 149 PRO A HB2  5  
ATOM   6645  H  HB3  . PRO A 1 85 ? -33.369 -0.898  7.059   1.00 0.00 ? 149 PRO A HB3  5  
ATOM   6646  H  HG2  . PRO A 1 85 ? -32.609 -3.279  5.411   1.00 0.00 ? 149 PRO A HG2  5  
ATOM   6647  H  HG3  . PRO A 1 85 ? -33.528 -1.837  4.938   1.00 0.00 ? 149 PRO A HG3  5  
ATOM   6648  H  HD2  . PRO A 1 85 ? -30.903 -2.151  4.348   1.00 0.00 ? 149 PRO A HD2  5  
ATOM   6649  H  HD3  . PRO A 1 85 ? -31.627 -0.562  4.666   1.00 0.00 ? 149 PRO A HD3  5  
ATOM   6650  N  N    . SER A 1 86 ? -30.539 -3.993  7.334   1.00 0.00 ? 150 SER A N    5  
ATOM   6651  C  CA   . SER A 1 86 ? -30.111 -5.297  7.827   1.00 0.00 ? 150 SER A CA   5  
ATOM   6652  C  C    . SER A 1 86 ? -28.821 -5.176  8.632   1.00 0.00 ? 150 SER A C    5  
ATOM   6653  O  O    . SER A 1 86 ? -27.727 -5.392  8.110   1.00 0.00 ? 150 SER A O    5  
ATOM   6654  C  CB   . SER A 1 86 ? -29.908 -6.265  6.660   1.00 0.00 ? 150 SER A CB   5  
ATOM   6655  O  OG   . SER A 1 86 ? -29.170 -7.405  7.065   1.00 0.00 ? 150 SER A OG   5  
ATOM   6656  H  H    . SER A 1 86 ? -30.463 -3.794  6.377   1.00 0.00 ? 150 SER A H    5  
ATOM   6657  H  HA   . SER A 1 86 ? -30.889 -5.680  8.470   1.00 0.00 ? 150 SER A HA   5  
ATOM   6658  H  HB2  . SER A 1 86 ? -30.870 -6.587  6.291   1.00 0.00 ? 150 SER A HB2  5  
ATOM   6659  H  HB3  . SER A 1 86 ? -29.369 -5.763  5.869   1.00 0.00 ? 150 SER A HB3  5  
ATOM   6660  H  HG   . SER A 1 86 ? -28.250 -7.162  7.194   1.00 0.00 ? 150 SER A HG   5  
ATOM   6661  N  N    . SER A 1 87 ? -28.958 -4.830  9.908   1.00 0.00 ? 151 SER A N    5  
ATOM   6662  C  CA   . SER A 1 87 ? -27.804 -4.676  10.786  1.00 0.00 ? 151 SER A CA   5  
ATOM   6663  C  C    . SER A 1 87 ? -26.957 -5.945  10.797  1.00 0.00 ? 151 SER A C    5  
ATOM   6664  O  O    . SER A 1 87 ? -27.432 -7.025  10.448  1.00 0.00 ? 151 SER A O    5  
ATOM   6665  C  CB   . SER A 1 87 ? -28.259 -4.341  12.208  1.00 0.00 ? 151 SER A CB   5  
ATOM   6666  O  OG   . SER A 1 87 ? -29.161 -5.319  12.698  1.00 0.00 ? 151 SER A OG   5  
ATOM   6667  H  H    . SER A 1 87 ? -29.856 -4.671  10.266  1.00 0.00 ? 151 SER A H    5  
ATOM   6668  H  HA   . SER A 1 87 ? -27.205 -3.861  10.408  1.00 0.00 ? 151 SER A HA   5  
ATOM   6669  H  HB2  . SER A 1 87 ? -27.399 -4.303  12.859  1.00 0.00 ? 151 SER A HB2  5  
ATOM   6670  H  HB3  . SER A 1 87 ? -28.754 -3.380  12.208  1.00 0.00 ? 151 SER A HB3  5  
ATOM   6671  H  HG   . SER A 1 87 ? -29.602 -5.746  11.961  1.00 0.00 ? 151 SER A HG   5  
ATOM   6672  N  N    . GLY A 1 88 ? -25.697 -5.805  11.201  1.00 0.00 ? 152 GLY A N    5  
ATOM   6673  C  CA   . GLY A 1 88 ? -24.803 -6.947  11.250  1.00 0.00 ? 152 GLY A CA   5  
ATOM   6674  C  C    . GLY A 1 88 ? -23.391 -6.561  11.644  1.00 0.00 ? 152 GLY A C    5  
ATOM   6675  O  O    . GLY A 1 88 ? -23.161 -5.470  12.165  1.00 0.00 ? 152 GLY A O    5  
ATOM   6676  H  H    . GLY A 1 88 ? -25.373 -4.919  11.468  1.00 0.00 ? 152 GLY A H    5  
ATOM   6677  H  HA2  . GLY A 1 88 ? -25.184 -7.658  11.968  1.00 0.00 ? 152 GLY A HA2  5  
ATOM   6678  H  HA3  . GLY A 1 88 ? -24.778 -7.412  10.276  1.00 0.00 ? 152 GLY A HA3  5  
HETATM 6679  ZN ZN   . ZN  B 2 .  ? 2.862   2.466   -9.272  1.00 0.00 ? 200 ZN  A ZN   5  
HETATM 6680  ZN ZN   . ZN  C 2 .  ? 6.598   -10.929 -1.019  1.00 0.00 ? 300 ZN  A ZN   5  
ATOM   6681  N  N    . GLY A 1 1  ? 20.505  9.245   -15.275 1.00 0.00 ? 65  GLY A N    6  
ATOM   6682  C  CA   . GLY A 1 1  ? 20.927  10.290  -16.190 1.00 0.00 ? 65  GLY A CA   6  
ATOM   6683  C  C    . GLY A 1 1  ? 20.756  11.678  -15.605 1.00 0.00 ? 65  GLY A C    6  
ATOM   6684  O  O    . GLY A 1 1  ? 21.548  12.107  -14.766 1.00 0.00 ? 65  GLY A O    6  
ATOM   6685  H  H1   . GLY A 1 1  ? 19.560  8.991   -15.228 1.00 0.00 ? 65  GLY A H1   6  
ATOM   6686  H  HA2  . GLY A 1 1  ? 21.968  10.140  -16.435 1.00 0.00 ? 65  GLY A HA2  6  
ATOM   6687  H  HA3  . GLY A 1 1  ? 20.341  10.219  -17.095 1.00 0.00 ? 65  GLY A HA3  6  
ATOM   6688  N  N    . SER A 1 2  ? 19.719  12.381  -16.048 1.00 0.00 ? 66  SER A N    6  
ATOM   6689  C  CA   . SER A 1 2  ? 19.449  13.731  -15.567 1.00 0.00 ? 66  SER A CA   6  
ATOM   6690  C  C    . SER A 1 2  ? 19.493  13.783  -14.043 1.00 0.00 ? 66  SER A C    6  
ATOM   6691  O  O    . SER A 1 2  ? 18.738  13.085  -13.365 1.00 0.00 ? 66  SER A O    6  
ATOM   6692  C  CB   . SER A 1 2  ? 18.084  14.210  -16.065 1.00 0.00 ? 66  SER A CB   6  
ATOM   6693  O  OG   . SER A 1 2  ? 17.034  13.472  -15.464 1.00 0.00 ? 66  SER A OG   6  
ATOM   6694  H  H    . SER A 1 2  ? 19.123  11.984  -16.717 1.00 0.00 ? 66  SER A H    6  
ATOM   6695  H  HA   . SER A 1 2  ? 20.215  14.382  -15.960 1.00 0.00 ? 66  SER A HA   6  
ATOM   6696  H  HB2  . SER A 1 2  ? 17.960  15.253  -15.821 1.00 0.00 ? 66  SER A HB2  6  
ATOM   6697  H  HB3  . SER A 1 2  ? 18.031  14.082  -17.137 1.00 0.00 ? 66  SER A HB3  6  
ATOM   6698  H  HG   . SER A 1 2  ? 16.913  12.645  -15.936 1.00 0.00 ? 66  SER A HG   6  
ATOM   6699  N  N    . SER A 1 3  ? 20.383  14.615  -13.510 1.00 0.00 ? 67  SER A N    6  
ATOM   6700  C  CA   . SER A 1 3  ? 20.529  14.756  -12.067 1.00 0.00 ? 67  SER A CA   6  
ATOM   6701  C  C    . SER A 1 3  ? 19.496  15.730  -11.508 1.00 0.00 ? 67  SER A C    6  
ATOM   6702  O  O    . SER A 1 3  ? 19.808  16.566  -10.662 1.00 0.00 ? 67  SER A O    6  
ATOM   6703  C  CB   . SER A 1 3  ? 21.939  15.238  -11.720 1.00 0.00 ? 67  SER A CB   6  
ATOM   6704  O  OG   . SER A 1 3  ? 22.887  14.195  -11.873 1.00 0.00 ? 67  SER A OG   6  
ATOM   6705  H  H    . SER A 1 3  ? 20.956  15.144  -14.104 1.00 0.00 ? 67  SER A H    6  
ATOM   6706  H  HA   . SER A 1 3  ? 20.370  13.786  -11.621 1.00 0.00 ? 67  SER A HA   6  
ATOM   6707  H  HB2  . SER A 1 3  ? 22.210  16.052  -12.375 1.00 0.00 ? 67  SER A HB2  6  
ATOM   6708  H  HB3  . SER A 1 3  ? 21.959  15.578  -10.695 1.00 0.00 ? 67  SER A HB3  6  
ATOM   6709  H  HG   . SER A 1 3  ? 22.801  13.575  -11.145 1.00 0.00 ? 67  SER A HG   6  
ATOM   6710  N  N    . GLY A 1 4  ? 18.262  15.613  -11.990 1.00 0.00 ? 68  GLY A N    6  
ATOM   6711  C  CA   . GLY A 1 4  ? 17.200  16.488  -11.529 1.00 0.00 ? 68  GLY A CA   6  
ATOM   6712  C  C    . GLY A 1 4  ? 16.863  16.271  -10.067 1.00 0.00 ? 68  GLY A C    6  
ATOM   6713  O  O    . GLY A 1 4  ? 17.754  16.090  -9.237  1.00 0.00 ? 68  GLY A O    6  
ATOM   6714  H  H    . GLY A 1 4  ? 18.071  14.927  -12.663 1.00 0.00 ? 68  GLY A H    6  
ATOM   6715  H  HA2  . GLY A 1 4  ? 17.508  17.514  -11.668 1.00 0.00 ? 68  GLY A HA2  6  
ATOM   6716  H  HA3  . GLY A 1 4  ? 16.315  16.305  -12.121 1.00 0.00 ? 68  GLY A HA3  6  
ATOM   6717  N  N    . SER A 1 5  ? 15.572  16.290  -9.749  1.00 0.00 ? 69  SER A N    6  
ATOM   6718  C  CA   . SER A 1 5  ? 15.120  16.099  -8.377  1.00 0.00 ? 69  SER A CA   6  
ATOM   6719  C  C    . SER A 1 5  ? 13.937  15.137  -8.323  1.00 0.00 ? 69  SER A C    6  
ATOM   6720  O  O    . SER A 1 5  ? 13.257  14.915  -9.326  1.00 0.00 ? 69  SER A O    6  
ATOM   6721  C  CB   . SER A 1 5  ? 14.729  17.441  -7.754  1.00 0.00 ? 69  SER A CB   6  
ATOM   6722  O  OG   . SER A 1 5  ? 13.586  17.984  -8.391  1.00 0.00 ? 69  SER A OG   6  
ATOM   6723  H  H    . SER A 1 5  ? 14.909  16.439  -10.456 1.00 0.00 ? 69  SER A H    6  
ATOM   6724  H  HA   . SER A 1 5  ? 15.938  15.675  -7.814  1.00 0.00 ? 69  SER A HA   6  
ATOM   6725  H  HB2  . SER A 1 5  ? 14.509  17.299  -6.707  1.00 0.00 ? 69  SER A HB2  6  
ATOM   6726  H  HB3  . SER A 1 5  ? 15.550  18.136  -7.859  1.00 0.00 ? 69  SER A HB3  6  
ATOM   6727  H  HG   . SER A 1 5  ? 12.977  18.316  -7.727  1.00 0.00 ? 69  SER A HG   6  
ATOM   6728  N  N    . SER A 1 6  ? 13.696  14.569  -7.146  1.00 0.00 ? 70  SER A N    6  
ATOM   6729  C  CA   . SER A 1 6  ? 12.598  13.627  -6.962  1.00 0.00 ? 70  SER A CA   6  
ATOM   6730  C  C    . SER A 1 6  ? 11.251  14.334  -7.080  1.00 0.00 ? 70  SER A C    6  
ATOM   6731  O  O    . SER A 1 6  ? 10.846  15.076  -6.186  1.00 0.00 ? 70  SER A O    6  
ATOM   6732  C  CB   . SER A 1 6  ? 12.709  12.942  -5.598  1.00 0.00 ? 70  SER A CB   6  
ATOM   6733  O  OG   . SER A 1 6  ? 12.480  13.863  -4.545  1.00 0.00 ? 70  SER A OG   6  
ATOM   6734  H  H    . SER A 1 6  ? 14.274  14.786  -6.384  1.00 0.00 ? 70  SER A H    6  
ATOM   6735  H  HA   . SER A 1 6  ? 12.669  12.880  -7.737  1.00 0.00 ? 70  SER A HA   6  
ATOM   6736  H  HB2  . SER A 1 6  ? 11.977  12.152  -5.535  1.00 0.00 ? 70  SER A HB2  6  
ATOM   6737  H  HB3  . SER A 1 6  ? 13.700  12.526  -5.487  1.00 0.00 ? 70  SER A HB3  6  
ATOM   6738  H  HG   . SER A 1 6  ? 12.598  13.420  -3.702  1.00 0.00 ? 70  SER A HG   6  
ATOM   6739  N  N    . GLY A 1 7  ? 10.562  14.098  -8.192  1.00 0.00 ? 71  GLY A N    6  
ATOM   6740  C  CA   . GLY A 1 7  ? 9.268   14.718  -8.409  1.00 0.00 ? 71  GLY A CA   6  
ATOM   6741  C  C    . GLY A 1 7  ? 8.121   13.849  -7.933  1.00 0.00 ? 71  GLY A C    6  
ATOM   6742  O  O    . GLY A 1 7  ? 8.061   13.477  -6.761  1.00 0.00 ? 71  GLY A O    6  
ATOM   6743  H  H    . GLY A 1 7  ? 10.935  13.497  -8.871  1.00 0.00 ? 71  GLY A H    6  
ATOM   6744  H  HA2  . GLY A 1 7  ? 9.238   15.658  -7.878  1.00 0.00 ? 71  GLY A HA2  6  
ATOM   6745  H  HA3  . GLY A 1 7  ? 9.145   14.909  -9.465  1.00 0.00 ? 71  GLY A HA3  6  
ATOM   6746  N  N    . MET A 1 8  ? 7.208   13.527  -8.843  1.00 0.00 ? 72  MET A N    6  
ATOM   6747  C  CA   . MET A 1 8  ? 6.056   12.696  -8.508  1.00 0.00 ? 72  MET A CA   6  
ATOM   6748  C  C    . MET A 1 8  ? 6.322   11.234  -8.854  1.00 0.00 ? 72  MET A C    6  
ATOM   6749  O  O    . MET A 1 8  ? 6.346   10.859  -10.025 1.00 0.00 ? 72  MET A O    6  
ATOM   6750  C  CB   . MET A 1 8  ? 4.812   13.190  -9.249  1.00 0.00 ? 72  MET A CB   6  
ATOM   6751  C  CG   . MET A 1 8  ? 4.293   14.525  -8.742  1.00 0.00 ? 72  MET A CG   6  
ATOM   6752  S  SD   . MET A 1 8  ? 3.409   15.453  -10.009 1.00 0.00 ? 72  MET A SD   6  
ATOM   6753  C  CE   . MET A 1 8  ? 4.765   15.965  -11.062 1.00 0.00 ? 72  MET A CE   6  
ATOM   6754  H  H    . MET A 1 8  ? 7.310   13.853  -9.761  1.00 0.00 ? 72  MET A H    6  
ATOM   6755  H  HA   . MET A 1 8  ? 5.887   12.777  -7.445  1.00 0.00 ? 72  MET A HA   6  
ATOM   6756  H  HB2  . MET A 1 8  ? 5.050   13.295  -10.297 1.00 0.00 ? 72  MET A HB2  6  
ATOM   6757  H  HB3  . MET A 1 8  ? 4.027   12.457  -9.138  1.00 0.00 ? 72  MET A HB3  6  
ATOM   6758  H  HG2  . MET A 1 8  ? 3.622   14.345  -7.915  1.00 0.00 ? 72  MET A HG2  6  
ATOM   6759  H  HG3  . MET A 1 8  ? 5.130   15.115  -8.401  1.00 0.00 ? 72  MET A HG3  6  
ATOM   6760  H  HE1  . MET A 1 8  ? 5.677   15.490  -10.729 1.00 0.00 ? 72  MET A HE1  6  
ATOM   6761  H  HE2  . MET A 1 8  ? 4.559   15.675  -12.081 1.00 0.00 ? 72  MET A HE2  6  
ATOM   6762  H  HE3  . MET A 1 8  ? 4.876   17.038  -11.008 1.00 0.00 ? 72  MET A HE3  6  
ATOM   6763  N  N    . GLU A 1 9  ? 6.521   10.415  -7.826  1.00 0.00 ? 73  GLU A N    6  
ATOM   6764  C  CA   . GLU A 1 9  ? 6.786   8.994   -8.024  1.00 0.00 ? 73  GLU A CA   6  
ATOM   6765  C  C    . GLU A 1 9  ? 5.860   8.143   -7.160  1.00 0.00 ? 73  GLU A C    6  
ATOM   6766  O  O    . GLU A 1 9  ? 5.592   8.474   -6.004  1.00 0.00 ? 73  GLU A O    6  
ATOM   6767  C  CB   . GLU A 1 9  ? 8.245   8.674   -7.694  1.00 0.00 ? 73  GLU A CB   6  
ATOM   6768  C  CG   . GLU A 1 9  ? 9.183   8.816   -8.881  1.00 0.00 ? 73  GLU A CG   6  
ATOM   6769  C  CD   . GLU A 1 9  ? 10.636  8.937   -8.466  1.00 0.00 ? 73  GLU A CD   6  
ATOM   6770  O  OE1  . GLU A 1 9  ? 10.938  9.784   -7.601  1.00 0.00 ? 73  GLU A OE1  6  
ATOM   6771  O  OE2  . GLU A 1 9  ? 11.472  8.183   -9.008  1.00 0.00 ? 73  GLU A OE2  6  
ATOM   6772  H  H    . GLU A 1 9  ? 6.490   10.773  -6.915  1.00 0.00 ? 73  GLU A H    6  
ATOM   6773  H  HA   . GLU A 1 9  ? 6.602   8.764   -9.062  1.00 0.00 ? 73  GLU A HA   6  
ATOM   6774  H  HB2  . GLU A 1 9  ? 8.581   9.343   -6.915  1.00 0.00 ? 73  GLU A HB2  6  
ATOM   6775  H  HB3  . GLU A 1 9  ? 8.306   7.658   -7.334  1.00 0.00 ? 73  GLU A HB3  6  
ATOM   6776  H  HG2  . GLU A 1 9  ? 9.076   7.947   -9.513  1.00 0.00 ? 73  GLU A HG2  6  
ATOM   6777  H  HG3  . GLU A 1 9  ? 8.908   9.700   -9.438  1.00 0.00 ? 73  GLU A HG3  6  
ATOM   6778  N  N    . CYS A 1 10 ? 5.373   7.045   -7.729  1.00 0.00 ? 74  CYS A N    6  
ATOM   6779  C  CA   . CYS A 1 10 ? 4.476   6.146   -7.013  1.00 0.00 ? 74  CYS A CA   6  
ATOM   6780  C  C    . CYS A 1 10 ? 5.188   5.493   -5.832  1.00 0.00 ? 74  CYS A C    6  
ATOM   6781  O  O    . CYS A 1 10 ? 6.150   4.747   -6.010  1.00 0.00 ? 74  CYS A O    6  
ATOM   6782  C  CB   . CYS A 1 10 ? 3.939   5.069   -7.958  1.00 0.00 ? 74  CYS A CB   6  
ATOM   6783  S  SG   . CYS A 1 10 ? 2.893   3.820   -7.144  1.00 0.00 ? 74  CYS A SG   6  
ATOM   6784  H  H    . CYS A 1 10 ? 5.623   6.835   -8.653  1.00 0.00 ? 74  CYS A H    6  
ATOM   6785  H  HA   . CYS A 1 10 ? 3.648   6.730   -6.640  1.00 0.00 ? 74  CYS A HA   6  
ATOM   6786  H  HB2  . CYS A 1 10 ? 3.347   5.540   -8.729  1.00 0.00 ? 74  CYS A HB2  6  
ATOM   6787  H  HB3  . CYS A 1 10 ? 4.772   4.554   -8.414  1.00 0.00 ? 74  CYS A HB3  6  
ATOM   6788  N  N    . ARG A 1 11 ? 4.708   5.781   -4.626  1.00 0.00 ? 75  ARG A N    6  
ATOM   6789  C  CA   . ARG A 1 11 ? 5.299   5.223   -3.416  1.00 0.00 ? 75  ARG A CA   6  
ATOM   6790  C  C    . ARG A 1 11 ? 5.279   3.697   -3.454  1.00 0.00 ? 75  ARG A C    6  
ATOM   6791  O  O    . ARG A 1 11 ? 6.116   3.039   -2.836  1.00 0.00 ? 75  ARG A O    6  
ATOM   6792  C  CB   . ARG A 1 11 ? 4.549   5.722   -2.180  1.00 0.00 ? 75  ARG A CB   6  
ATOM   6793  C  CG   . ARG A 1 11 ? 4.425   7.236   -2.112  1.00 0.00 ? 75  ARG A CG   6  
ATOM   6794  C  CD   . ARG A 1 11 ? 5.592   7.857   -1.360  1.00 0.00 ? 75  ARG A CD   6  
ATOM   6795  N  NE   . ARG A 1 11 ? 6.710   8.170   -2.246  1.00 0.00 ? 75  ARG A NE   6  
ATOM   6796  C  CZ   . ARG A 1 11 ? 7.741   8.928   -1.889  1.00 0.00 ? 75  ARG A CZ   6  
ATOM   6797  N  NH1  . ARG A 1 11 ? 7.795   9.448   -0.670  1.00 0.00 ? 75  ARG A NH1  6  
ATOM   6798  N  NH2  . ARG A 1 11 ? 8.720   9.168   -2.752  1.00 0.00 ? 75  ARG A NH2  6  
ATOM   6799  H  H    . ARG A 1 11 ? 3.938   6.383   -4.549  1.00 0.00 ? 75  ARG A H    6  
ATOM   6800  H  HA   . ARG A 1 11 ? 6.324   5.556   -3.363  1.00 0.00 ? 75  ARG A HA   6  
ATOM   6801  H  HB2  . ARG A 1 11 ? 3.554   5.302   -2.182  1.00 0.00 ? 75  ARG A HB2  6  
ATOM   6802  H  HB3  . ARG A 1 11 ? 5.070   5.386   -1.297  1.00 0.00 ? 75  ARG A HB3  6  
ATOM   6803  H  HG2  . ARG A 1 11 ? 4.408   7.631   -3.117  1.00 0.00 ? 75  ARG A HG2  6  
ATOM   6804  H  HG3  . ARG A 1 11 ? 3.506   7.490   -1.607  1.00 0.00 ? 75  ARG A HG3  6  
ATOM   6805  H  HD2  . ARG A 1 11 ? 5.255   8.767   -0.887  1.00 0.00 ? 75  ARG A HD2  6  
ATOM   6806  H  HD3  . ARG A 1 11 ? 5.927   7.161   -0.605  1.00 0.00 ? 75  ARG A HD3  6  
ATOM   6807  H  HE   . ARG A 1 11 ? 6.690   7.797   -3.151  1.00 0.00 ? 75  ARG A HE   6  
ATOM   6808  H  HH11 . ARG A 1 11 ? 7.059   9.268   -0.018  1.00 0.00 ? 75  ARG A HH11 6  
ATOM   6809  H  HH12 . ARG A 1 11 ? 8.573   10.017  -0.403  1.00 0.00 ? 75  ARG A HH12 6  
ATOM   6810  H  HH21 . ARG A 1 11 ? 8.683   8.778   -3.671  1.00 0.00 ? 75  ARG A HH21 6  
ATOM   6811  H  HH22 . ARG A 1 11 ? 9.495   9.739   -2.482  1.00 0.00 ? 75  ARG A HH22 6  
ATOM   6812  N  N    . VAL A 1 12 ? 4.317   3.141   -4.184  1.00 0.00 ? 76  VAL A N    6  
ATOM   6813  C  CA   . VAL A 1 12 ? 4.188   1.694   -4.303  1.00 0.00 ? 76  VAL A CA   6  
ATOM   6814  C  C    . VAL A 1 12 ? 5.339   1.105   -5.111  1.00 0.00 ? 76  VAL A C    6  
ATOM   6815  O  O    . VAL A 1 12 ? 6.218   0.438   -4.564  1.00 0.00 ? 76  VAL A O    6  
ATOM   6816  C  CB   . VAL A 1 12 ? 2.855   1.303   -4.969  1.00 0.00 ? 76  VAL A CB   6  
ATOM   6817  C  CG1  . VAL A 1 12 ? 2.622   -0.196  -4.857  1.00 0.00 ? 76  VAL A CG1  6  
ATOM   6818  C  CG2  . VAL A 1 12 ? 1.702   2.077   -4.348  1.00 0.00 ? 76  VAL A CG2  6  
ATOM   6819  H  H    . VAL A 1 12 ? 3.679   3.719   -4.653  1.00 0.00 ? 76  VAL A H    6  
ATOM   6820  H  HA   . VAL A 1 12 ? 4.206   1.274   -3.308  1.00 0.00 ? 76  VAL A HA   6  
ATOM   6821  H  HB   . VAL A 1 12 ? 2.910   1.559   -6.017  1.00 0.00 ? 76  VAL A HB   6  
ATOM   6822  H  HG11 . VAL A 1 12 ? 2.474   -0.461  -3.821  1.00 0.00 ? 76  VAL A HG11 6  
ATOM   6823  H  HG12 . VAL A 1 12 ? 1.747   -0.469  -5.429  1.00 0.00 ? 76  VAL A HG12 6  
ATOM   6824  H  HG13 . VAL A 1 12 ? 3.483   -0.724  -5.243  1.00 0.00 ? 76  VAL A HG13 6  
ATOM   6825  H  HG21 . VAL A 1 12 ? 1.952   3.127   -4.310  1.00 0.00 ? 76  VAL A HG21 6  
ATOM   6826  H  HG22 . VAL A 1 12 ? 0.814   1.939   -4.946  1.00 0.00 ? 76  VAL A HG22 6  
ATOM   6827  H  HG23 . VAL A 1 12 ? 1.522   1.714   -3.347  1.00 0.00 ? 76  VAL A HG23 6  
ATOM   6828  N  N    . CYS A 1 13 ? 5.328   1.355   -6.416  1.00 0.00 ? 77  CYS A N    6  
ATOM   6829  C  CA   . CYS A 1 13 ? 6.371   0.850   -7.300  1.00 0.00 ? 77  CYS A CA   6  
ATOM   6830  C  C    . CYS A 1 13 ? 7.443   1.910   -7.539  1.00 0.00 ? 77  CYS A C    6  
ATOM   6831  O  O    . CYS A 1 13 ? 8.637   1.634   -7.435  1.00 0.00 ? 77  CYS A O    6  
ATOM   6832  C  CB   . CYS A 1 13 ? 5.767   0.410   -8.636  1.00 0.00 ? 77  CYS A CB   6  
ATOM   6833  S  SG   . CYS A 1 13 ? 5.023   1.766   -9.598  1.00 0.00 ? 77  CYS A SG   6  
ATOM   6834  H  H    . CYS A 1 13 ? 4.601   1.894   -6.794  1.00 0.00 ? 77  CYS A H    6  
ATOM   6835  H  HA   . CYS A 1 13 ? 6.827   -0.004  -6.823  1.00 0.00 ? 77  CYS A HA   6  
ATOM   6836  H  HB2  . CYS A 1 13 ? 6.542   -0.036  -9.243  1.00 0.00 ? 77  CYS A HB2  6  
ATOM   6837  H  HB3  . CYS A 1 13 ? 4.997   -0.323  -8.449  1.00 0.00 ? 77  CYS A HB3  6  
ATOM   6838  N  N    . GLY A 1 14 ? 7.006   3.124   -7.859  1.00 0.00 ? 78  GLY A N    6  
ATOM   6839  C  CA   . GLY A 1 14 ? 7.939   4.207   -8.107  1.00 0.00 ? 78  GLY A CA   6  
ATOM   6840  C  C    . GLY A 1 14 ? 7.625   4.963   -9.383  1.00 0.00 ? 78  GLY A C    6  
ATOM   6841  O  O    . GLY A 1 14 ? 7.793   6.181   -9.449  1.00 0.00 ? 78  GLY A O    6  
ATOM   6842  H  H    . GLY A 1 14 ? 6.041   3.286   -7.928  1.00 0.00 ? 78  GLY A H    6  
ATOM   6843  H  HA2  . GLY A 1 14 ? 7.905   4.895   -7.276  1.00 0.00 ? 78  GLY A HA2  6  
ATOM   6844  H  HA3  . GLY A 1 14 ? 8.936   3.798   -8.182  1.00 0.00 ? 78  GLY A HA3  6  
ATOM   6845  N  N    . ASP A 1 15 ? 7.169   4.240   -10.400 1.00 0.00 ? 79  ASP A N    6  
ATOM   6846  C  CA   . ASP A 1 15 ? 6.831   4.849   -11.681 1.00 0.00 ? 79  ASP A CA   6  
ATOM   6847  C  C    . ASP A 1 15 ? 6.136   6.192   -11.477 1.00 0.00 ? 79  ASP A C    6  
ATOM   6848  O  O    . ASP A 1 15 ? 5.578   6.460   -10.413 1.00 0.00 ? 79  ASP A O    6  
ATOM   6849  C  CB   . ASP A 1 15 ? 5.934   3.915   -12.494 1.00 0.00 ? 79  ASP A CB   6  
ATOM   6850  C  CG   . ASP A 1 15 ? 5.519   4.520   -13.820 1.00 0.00 ? 79  ASP A CG   6  
ATOM   6851  O  OD1  . ASP A 1 15 ? 4.588   5.353   -13.828 1.00 0.00 ? 79  ASP A OD1  6  
ATOM   6852  O  OD2  . ASP A 1 15 ? 6.125   4.161   -14.851 1.00 0.00 ? 79  ASP A OD2  6  
ATOM   6853  H  H    . ASP A 1 15 ? 7.056   3.272   -10.286 1.00 0.00 ? 79  ASP A H    6  
ATOM   6854  H  HA   . ASP A 1 15 ? 7.750   5.012   -12.223 1.00 0.00 ? 79  ASP A HA   6  
ATOM   6855  H  HB2  . ASP A 1 15 ? 6.466   2.995   -12.690 1.00 0.00 ? 79  ASP A HB2  6  
ATOM   6856  H  HB3  . ASP A 1 15 ? 5.043   3.696   -11.924 1.00 0.00 ? 79  ASP A HB3  6  
ATOM   6857  N  N    . LYS A 1 16 ? 6.175   7.034   -12.504 1.00 0.00 ? 80  LYS A N    6  
ATOM   6858  C  CA   . LYS A 1 16 ? 5.550   8.350   -12.439 1.00 0.00 ? 80  LYS A CA   6  
ATOM   6859  C  C    . LYS A 1 16 ? 4.184   8.271   -11.765 1.00 0.00 ? 80  LYS A C    6  
ATOM   6860  O  O    . LYS A 1 16 ? 3.326   7.487   -12.170 1.00 0.00 ? 80  LYS A O    6  
ATOM   6861  C  CB   . LYS A 1 16 ? 5.403   8.937   -13.845 1.00 0.00 ? 80  LYS A CB   6  
ATOM   6862  C  CG   . LYS A 1 16 ? 6.606   9.750   -14.293 1.00 0.00 ? 80  LYS A CG   6  
ATOM   6863  C  CD   . LYS A 1 16 ? 6.633   9.918   -15.803 1.00 0.00 ? 80  LYS A CD   6  
ATOM   6864  C  CE   . LYS A 1 16 ? 7.616   11.000  -16.225 1.00 0.00 ? 80  LYS A CE   6  
ATOM   6865  N  NZ   . LYS A 1 16 ? 6.970   12.341  -16.289 1.00 0.00 ? 80  LYS A NZ   6  
ATOM   6866  H  H    . LYS A 1 16 ? 6.636   6.764   -13.327 1.00 0.00 ? 80  LYS A H    6  
ATOM   6867  H  HA   . LYS A 1 16 ? 6.190   8.993   -11.855 1.00 0.00 ? 80  LYS A HA   6  
ATOM   6868  H  HB2  . LYS A 1 16 ? 5.259   8.129   -14.547 1.00 0.00 ? 80  LYS A HB2  6  
ATOM   6869  H  HB3  . LYS A 1 16 ? 4.534   9.579   -13.865 1.00 0.00 ? 80  LYS A HB3  6  
ATOM   6870  H  HG2  . LYS A 1 16 ? 6.560   10.726  -13.834 1.00 0.00 ? 80  LYS A HG2  6  
ATOM   6871  H  HG3  . LYS A 1 16 ? 7.508   9.244   -13.980 1.00 0.00 ? 80  LYS A HG3  6  
ATOM   6872  H  HD2  . LYS A 1 16 ? 6.929   8.984   -16.256 1.00 0.00 ? 80  LYS A HD2  6  
ATOM   6873  H  HD3  . LYS A 1 16 ? 5.644   10.189  -16.144 1.00 0.00 ? 80  LYS A HD3  6  
ATOM   6874  H  HE2  . LYS A 1 16 ? 8.424   11.033  -15.511 1.00 0.00 ? 80  LYS A HE2  6  
ATOM   6875  H  HE3  . LYS A 1 16 ? 8.007   10.752  -17.201 1.00 0.00 ? 80  LYS A HE3  6  
ATOM   6876  H  HZ1  . LYS A 1 16 ? 7.019   12.805  -15.359 1.00 0.00 ? 80  LYS A HZ1  6  
ATOM   6877  H  HZ2  . LYS A 1 16 ? 5.972   12.244  -16.565 1.00 0.00 ? 80  LYS A HZ2  6  
ATOM   6878  H  HZ3  . LYS A 1 16 ? 7.456   12.938  -16.988 1.00 0.00 ? 80  LYS A HZ3  6  
ATOM   6879  N  N    . ALA A 1 17 ? 3.990   9.087   -10.735 1.00 0.00 ? 81  ALA A N    6  
ATOM   6880  C  CA   . ALA A 1 17 ? 2.727   9.112   -10.007 1.00 0.00 ? 81  ALA A CA   6  
ATOM   6881  C  C    . ALA A 1 17 ? 1.661   9.879   -10.782 1.00 0.00 ? 81  ALA A C    6  
ATOM   6882  O  O    . ALA A 1 17 ? 1.754   11.096  -10.943 1.00 0.00 ? 81  ALA A O    6  
ATOM   6883  C  CB   . ALA A 1 17 ? 2.924   9.724   -8.628  1.00 0.00 ? 81  ALA A CB   6  
ATOM   6884  H  H    . ALA A 1 17 ? 4.712   9.689   -10.459 1.00 0.00 ? 81  ALA A H    6  
ATOM   6885  H  HA   . ALA A 1 17 ? 2.397   8.091   -9.876  1.00 0.00 ? 81  ALA A HA   6  
ATOM   6886  H  HB1  . ALA A 1 17 ? 2.998   10.798  -8.719  1.00 0.00 ? 81  ALA A HB1  6  
ATOM   6887  H  HB2  . ALA A 1 17 ? 2.082   9.473   -8.000  1.00 0.00 ? 81  ALA A HB2  6  
ATOM   6888  H  HB3  . ALA A 1 17 ? 3.831   9.337   -8.188  1.00 0.00 ? 81  ALA A HB3  6  
ATOM   6889  N  N    . SER A 1 18 ? 0.650   9.161   -11.259 1.00 0.00 ? 82  SER A N    6  
ATOM   6890  C  CA   . SER A 1 18 ? -0.431  9.774   -12.022 1.00 0.00 ? 82  SER A CA   6  
ATOM   6891  C  C    . SER A 1 18 ? -1.066  10.919  -11.238 1.00 0.00 ? 82  SER A C    6  
ATOM   6892  O  O    . SER A 1 18 ? -1.143  12.048  -11.720 1.00 0.00 ? 82  SER A O    6  
ATOM   6893  C  CB   . SER A 1 18 ? -1.493  8.730   -12.372 1.00 0.00 ? 82  SER A CB   6  
ATOM   6894  O  OG   . SER A 1 18 ? -2.591  9.324   -13.041 1.00 0.00 ? 82  SER A OG   6  
ATOM   6895  H  H    . SER A 1 18 ? 0.633   8.194   -11.097 1.00 0.00 ? 82  SER A H    6  
ATOM   6896  H  HA   . SER A 1 18 ? -0.011  10.168  -12.935 1.00 0.00 ? 82  SER A HA   6  
ATOM   6897  H  HB2  . SER A 1 18 ? -1.058  7.980   -13.015 1.00 0.00 ? 82  SER A HB2  6  
ATOM   6898  H  HB3  . SER A 1 18 ? -1.848  8.264   -11.464 1.00 0.00 ? 82  SER A HB3  6  
ATOM   6899  H  HG   . SER A 1 18 ? -3.411  8.970   -12.688 1.00 0.00 ? 82  SER A HG   6  
ATOM   6900  N  N    . GLY A 1 19 ? -1.520  10.618  -10.025 1.00 0.00 ? 83  GLY A N    6  
ATOM   6901  C  CA   . GLY A 1 19 ? -2.143  11.631  -9.194  1.00 0.00 ? 83  GLY A CA   6  
ATOM   6902  C  C    . GLY A 1 19 ? -2.115  11.270  -7.722  1.00 0.00 ? 83  GLY A C    6  
ATOM   6903  O  O    . GLY A 1 19 ? -1.112  10.765  -7.218  1.00 0.00 ? 83  GLY A O    6  
ATOM   6904  H  H    . GLY A 1 19 ? -1.432  9.700   -9.693  1.00 0.00 ? 83  GLY A H    6  
ATOM   6905  H  HA2  . GLY A 1 19 ? -1.623  12.566  -9.334  1.00 0.00 ? 83  GLY A HA2  6  
ATOM   6906  H  HA3  . GLY A 1 19 ? -3.171  11.752  -9.503  1.00 0.00 ? 83  GLY A HA3  6  
ATOM   6907  N  N    . PHE A 1 20 ? -3.219  11.531  -7.030  1.00 0.00 ? 84  PHE A N    6  
ATOM   6908  C  CA   . PHE A 1 20 ? -3.317  11.233  -5.605  1.00 0.00 ? 84  PHE A CA   6  
ATOM   6909  C  C    . PHE A 1 20 ? -4.526  10.347  -5.317  1.00 0.00 ? 84  PHE A C    6  
ATOM   6910  O  O    . PHE A 1 20 ? -5.631  10.840  -5.090  1.00 0.00 ? 84  PHE A O    6  
ATOM   6911  C  CB   . PHE A 1 20 ? -3.415  12.528  -4.797  1.00 0.00 ? 84  PHE A CB   6  
ATOM   6912  C  CG   . PHE A 1 20 ? -2.954  12.383  -3.375  1.00 0.00 ? 84  PHE A CG   6  
ATOM   6913  C  CD1  . PHE A 1 20 ? -1.763  11.739  -3.081  1.00 0.00 ? 84  PHE A CD1  6  
ATOM   6914  C  CD2  . PHE A 1 20 ? -3.711  12.892  -2.332  1.00 0.00 ? 84  PHE A CD2  6  
ATOM   6915  C  CE1  . PHE A 1 20 ? -1.337  11.604  -1.773  1.00 0.00 ? 84  PHE A CE1  6  
ATOM   6916  C  CE2  . PHE A 1 20 ? -3.290  12.760  -1.022  1.00 0.00 ? 84  PHE A CE2  6  
ATOM   6917  C  CZ   . PHE A 1 20 ? -2.100  12.116  -0.743  1.00 0.00 ? 84  PHE A CZ   6  
ATOM   6918  H  H    . PHE A 1 20 ? -3.987  11.934  -7.487  1.00 0.00 ? 84  PHE A H    6  
ATOM   6919  H  HA   . PHE A 1 20 ? -2.422  10.704  -5.316  1.00 0.00 ? 84  PHE A HA   6  
ATOM   6920  H  HB2  . PHE A 1 20 ? -2.805  13.284  -5.268  1.00 0.00 ? 84  PHE A HB2  6  
ATOM   6921  H  HB3  . PHE A 1 20 ? -4.443  12.857  -4.782  1.00 0.00 ? 84  PHE A HB3  6  
ATOM   6922  H  HD1  . PHE A 1 20 ? -1.164  11.339  -3.886  1.00 0.00 ? 84  PHE A HD1  6  
ATOM   6923  H  HD2  . PHE A 1 20 ? -4.642  13.396  -2.550  1.00 0.00 ? 84  PHE A HD2  6  
ATOM   6924  H  HE1  . PHE A 1 20 ? -0.406  11.101  -1.557  1.00 0.00 ? 84  PHE A HE1  6  
ATOM   6925  H  HE2  . PHE A 1 20 ? -3.889  13.162  -0.219  1.00 0.00 ? 84  PHE A HE2  6  
ATOM   6926  H  HZ   . PHE A 1 20 ? -1.770  12.012  0.280   1.00 0.00 ? 84  PHE A HZ   6  
ATOM   6927  N  N    . HIS A 1 21 ? -4.307  9.036   -5.327  1.00 0.00 ? 85  HIS A N    6  
ATOM   6928  C  CA   . HIS A 1 21 ? -5.378  8.080   -5.067  1.00 0.00 ? 85  HIS A CA   6  
ATOM   6929  C  C    . HIS A 1 21 ? -5.228  7.460   -3.681  1.00 0.00 ? 85  HIS A C    6  
ATOM   6930  O  O    . HIS A 1 21 ? -4.116  7.172   -3.236  1.00 0.00 ? 85  HIS A O    6  
ATOM   6931  C  CB   . HIS A 1 21 ? -5.381  6.983   -6.132  1.00 0.00 ? 85  HIS A CB   6  
ATOM   6932  C  CG   . HIS A 1 21 ? -5.230  7.503   -7.528  1.00 0.00 ? 85  HIS A CG   6  
ATOM   6933  N  ND1  . HIS A 1 21 ? -6.169  8.308   -8.137  1.00 0.00 ? 85  HIS A ND1  6  
ATOM   6934  C  CD2  . HIS A 1 21 ? -4.240  7.330   -8.434  1.00 0.00 ? 85  HIS A CD2  6  
ATOM   6935  C  CE1  . HIS A 1 21 ? -5.764  8.606   -9.359  1.00 0.00 ? 85  HIS A CE1  6  
ATOM   6936  N  NE2  . HIS A 1 21 ? -4.595  8.025   -9.564  1.00 0.00 ? 85  HIS A NE2  6  
ATOM   6937  H  H    . HIS A 1 21 ? -3.405  8.703   -5.515  1.00 0.00 ? 85  HIS A H    6  
ATOM   6938  H  HA   . HIS A 1 21 ? -6.316  8.613   -5.109  1.00 0.00 ? 85  HIS A HA   6  
ATOM   6939  H  HB2  . HIS A 1 21 ? -4.564  6.303   -5.941  1.00 0.00 ? 85  HIS A HB2  6  
ATOM   6940  H  HB3  . HIS A 1 21 ? -6.314  6.441   -6.078  1.00 0.00 ? 85  HIS A HB3  6  
ATOM   6941  H  HD1  . HIS A 1 21 ? -7.009  8.613   -7.735  1.00 0.00 ? 85  HIS A HD1  6  
ATOM   6942  H  HD2  . HIS A 1 21 ? -3.336  6.752   -8.296  1.00 0.00 ? 85  HIS A HD2  6  
ATOM   6943  H  HE1  . HIS A 1 21 ? -6.297  9.220   -10.070 1.00 0.00 ? 85  HIS A HE1  6  
ATOM   6944  N  N    . TYR A 1 22 ? -6.352  7.259   -3.003  1.00 0.00 ? 86  TYR A N    6  
ATOM   6945  C  CA   . TYR A 1 22 ? -6.345  6.676   -1.667  1.00 0.00 ? 86  TYR A CA   6  
ATOM   6946  C  C    . TYR A 1 22 ? -5.433  7.466   -0.733  1.00 0.00 ? 86  TYR A C    6  
ATOM   6947  O  O    . TYR A 1 22 ? -4.688  6.891   0.059   1.00 0.00 ? 86  TYR A O    6  
ATOM   6948  C  CB   . TYR A 1 22 ? -5.891  5.217   -1.726  1.00 0.00 ? 86  TYR A CB   6  
ATOM   6949  C  CG   . TYR A 1 22 ? -6.658  4.384   -2.728  1.00 0.00 ? 86  TYR A CG   6  
ATOM   6950  C  CD1  . TYR A 1 22 ? -6.276  4.340   -4.063  1.00 0.00 ? 86  TYR A CD1  6  
ATOM   6951  C  CD2  . TYR A 1 22 ? -7.766  3.641   -2.339  1.00 0.00 ? 86  TYR A CD2  6  
ATOM   6952  C  CE1  . TYR A 1 22 ? -6.974  3.581   -4.982  1.00 0.00 ? 86  TYR A CE1  6  
ATOM   6953  C  CE2  . TYR A 1 22 ? -8.470  2.878   -3.251  1.00 0.00 ? 86  TYR A CE2  6  
ATOM   6954  C  CZ   . TYR A 1 22 ? -8.071  2.852   -4.571  1.00 0.00 ? 86  TYR A CZ   6  
ATOM   6955  O  OH   . TYR A 1 22 ? -8.769  2.094   -5.483  1.00 0.00 ? 86  TYR A OH   6  
ATOM   6956  H  H    . TYR A 1 22 ? -7.207  7.509   -3.410  1.00 0.00 ? 86  TYR A H    6  
ATOM   6957  H  HA   . TYR A 1 22 ? -7.354  6.714   -1.283  1.00 0.00 ? 86  TYR A HA   6  
ATOM   6958  H  HB2  . TYR A 1 22 ? -4.847  5.182   -1.998  1.00 0.00 ? 86  TYR A HB2  6  
ATOM   6959  H  HB3  . TYR A 1 22 ? -6.020  4.767   -0.752  1.00 0.00 ? 86  TYR A HB3  6  
ATOM   6960  H  HD1  . TYR A 1 22 ? -5.416  4.912   -4.381  1.00 0.00 ? 86  TYR A HD1  6  
ATOM   6961  H  HD2  . TYR A 1 22 ? -8.077  3.663   -1.305  1.00 0.00 ? 86  TYR A HD2  6  
ATOM   6962  H  HE1  . TYR A 1 22 ? -6.662  3.560   -6.015  1.00 0.00 ? 86  TYR A HE1  6  
ATOM   6963  H  HE2  . TYR A 1 22 ? -9.329  2.307   -2.930  1.00 0.00 ? 86  TYR A HE2  6  
ATOM   6964  H  HH   . TYR A 1 22 ? -8.836  1.191   -5.163  1.00 0.00 ? 86  TYR A HH   6  
ATOM   6965  N  N    . GLY A 1 23 ? -5.500  8.791   -0.832  1.00 0.00 ? 87  GLY A N    6  
ATOM   6966  C  CA   . GLY A 1 23 ? -4.677  9.640   0.009   1.00 0.00 ? 87  GLY A CA   6  
ATOM   6967  C  C    . GLY A 1 23 ? -3.202  9.308   -0.099  1.00 0.00 ? 87  GLY A C    6  
ATOM   6968  O  O    . GLY A 1 23 ? -2.419  9.629   0.795   1.00 0.00 ? 87  GLY A O    6  
ATOM   6969  H  H    . GLY A 1 23 ? -6.113  9.194   -1.481  1.00 0.00 ? 87  GLY A H    6  
ATOM   6970  H  HA2  . GLY A 1 23 ? -4.826  10.669  -0.282  1.00 0.00 ? 87  GLY A HA2  6  
ATOM   6971  H  HA3  . GLY A 1 23 ? -4.987  9.518   1.037   1.00 0.00 ? 87  GLY A HA3  6  
ATOM   6972  N  N    . VAL A 1 24 ? -2.821  8.661   -1.196  1.00 0.00 ? 88  VAL A N    6  
ATOM   6973  C  CA   . VAL A 1 24 ? -1.430  8.285   -1.417  1.00 0.00 ? 88  VAL A CA   6  
ATOM   6974  C  C    . VAL A 1 24 ? -1.034  8.480   -2.877  1.00 0.00 ? 88  VAL A C    6  
ATOM   6975  O  O    . VAL A 1 24 ? -1.783  8.125   -3.787  1.00 0.00 ? 88  VAL A O    6  
ATOM   6976  C  CB   . VAL A 1 24 ? -1.175  6.819   -1.019  1.00 0.00 ? 88  VAL A CB   6  
ATOM   6977  C  CG1  . VAL A 1 24 ? -2.126  5.891   -1.761  1.00 0.00 ? 88  VAL A CG1  6  
ATOM   6978  C  CG2  . VAL A 1 24 ? 0.273   6.438   -1.288  1.00 0.00 ? 88  VAL A CG2  6  
ATOM   6979  H  H    . VAL A 1 24 ? -3.492  8.433   -1.873  1.00 0.00 ? 88  VAL A H    6  
ATOM   6980  H  HA   . VAL A 1 24 ? -0.810  8.917   -0.798  1.00 0.00 ? 88  VAL A HA   6  
ATOM   6981  H  HB   . VAL A 1 24 ? -1.361  6.717   0.040   1.00 0.00 ? 88  VAL A HB   6  
ATOM   6982  H  HG11 . VAL A 1 24 ? -3.124  6.010   -1.367  1.00 0.00 ? 88  VAL A HG11 6  
ATOM   6983  H  HG12 . VAL A 1 24 ? -2.121  6.136   -2.813  1.00 0.00 ? 88  VAL A HG12 6  
ATOM   6984  H  HG13 . VAL A 1 24 ? -1.807  4.868   -1.627  1.00 0.00 ? 88  VAL A HG13 6  
ATOM   6985  H  HG21 . VAL A 1 24 ? 0.774   7.256   -1.785  1.00 0.00 ? 88  VAL A HG21 6  
ATOM   6986  H  HG22 . VAL A 1 24 ? 0.768   6.227   -0.353  1.00 0.00 ? 88  VAL A HG22 6  
ATOM   6987  H  HG23 . VAL A 1 24 ? 0.304   5.561   -1.918  1.00 0.00 ? 88  VAL A HG23 6  
ATOM   6988  N  N    . HIS A 1 25 ? 0.149   9.046   -3.092  1.00 0.00 ? 89  HIS A N    6  
ATOM   6989  C  CA   . HIS A 1 25 ? 0.647   9.288   -4.442  1.00 0.00 ? 89  HIS A CA   6  
ATOM   6990  C  C    . HIS A 1 25 ? 1.024   7.977   -5.124  1.00 0.00 ? 89  HIS A C    6  
ATOM   6991  O  O    . HIS A 1 25 ? 2.174   7.542   -5.062  1.00 0.00 ? 89  HIS A O    6  
ATOM   6992  C  CB   . HIS A 1 25 ? 1.856   10.223  -4.402  1.00 0.00 ? 89  HIS A CB   6  
ATOM   6993  C  CG   . HIS A 1 25 ? 1.491   11.670  -4.277  1.00 0.00 ? 89  HIS A CG   6  
ATOM   6994  N  ND1  . HIS A 1 25 ? 1.377   12.315  -3.063  1.00 0.00 ? 89  HIS A ND1  6  
ATOM   6995  C  CD2  . HIS A 1 25 ? 1.216   12.599  -5.222  1.00 0.00 ? 89  HIS A CD2  6  
ATOM   6996  C  CE1  . HIS A 1 25 ? 1.045   13.577  -3.268  1.00 0.00 ? 89  HIS A CE1  6  
ATOM   6997  N  NE2  . HIS A 1 25 ? 0.942   13.775  -4.569  1.00 0.00 ? 89  HIS A NE2  6  
ATOM   6998  H  H    . HIS A 1 25 ? 0.701   9.308   -2.325  1.00 0.00 ? 89  HIS A H    6  
ATOM   6999  H  HA   . HIS A 1 25 ? -0.143  9.759   -5.007  1.00 0.00 ? 89  HIS A HA   6  
ATOM   7000  H  HB2  . HIS A 1 25 ? 2.476   9.963   -3.557  1.00 0.00 ? 89  HIS A HB2  6  
ATOM   7001  H  HB3  . HIS A 1 25 ? 2.427   10.101  -5.312  1.00 0.00 ? 89  HIS A HB3  6  
ATOM   7002  H  HD1  . HIS A 1 25 ? 1.516   11.907  -2.184  1.00 0.00 ? 89  HIS A HD1  6  
ATOM   7003  H  HD2  . HIS A 1 25 ? 1.212   12.444  -6.292  1.00 0.00 ? 89  HIS A HD2  6  
ATOM   7004  H  HE1  . HIS A 1 25 ? 0.886   14.321  -2.501  1.00 0.00 ? 89  HIS A HE1  6  
ATOM   7005  N  N    . ALA A 1 26 ? 0.048   7.352   -5.775  1.00 0.00 ? 90  ALA A N    6  
ATOM   7006  C  CA   . ALA A 1 26 ? 0.278   6.092   -6.470  1.00 0.00 ? 90  ALA A CA   6  
ATOM   7007  C  C    . ALA A 1 26 ? 0.051   6.242   -7.970  1.00 0.00 ? 90  ALA A C    6  
ATOM   7008  O  O    . ALA A 1 26 ? -0.429  7.277   -8.435  1.00 0.00 ? 90  ALA A O    6  
ATOM   7009  C  CB   . ALA A 1 26 ? -0.623  5.004   -5.904  1.00 0.00 ? 90  ALA A CB   6  
ATOM   7010  H  H    . ALA A 1 26 ? -0.848  7.748   -5.788  1.00 0.00 ? 90  ALA A H    6  
ATOM   7011  H  HA   . ALA A 1 26 ? 1.305   5.799   -6.299  1.00 0.00 ? 90  ALA A HA   6  
ATOM   7012  H  HB1  . ALA A 1 26 ? -1.092  5.361   -4.999  1.00 0.00 ? 90  ALA A HB1  6  
ATOM   7013  H  HB2  . ALA A 1 26 ? -1.383  4.754   -6.630  1.00 0.00 ? 90  ALA A HB2  6  
ATOM   7014  H  HB3  . ALA A 1 26 ? -0.034  4.127   -5.683  1.00 0.00 ? 90  ALA A HB3  6  
ATOM   7015  N  N    . CYS A 1 27 ? 0.398   5.205   -8.724  1.00 0.00 ? 91  CYS A N    6  
ATOM   7016  C  CA   . CYS A 1 27 ? 0.233   5.222   -10.172 1.00 0.00 ? 91  CYS A CA   6  
ATOM   7017  C  C    . CYS A 1 27 ? -0.970  4.382   -10.592 1.00 0.00 ? 91  CYS A C    6  
ATOM   7018  O  O    . CYS A 1 27 ? -1.573  3.691   -9.772  1.00 0.00 ? 91  CYS A O    6  
ATOM   7019  C  CB   . CYS A 1 27 ? 1.497   4.699   -10.857 1.00 0.00 ? 91  CYS A CB   6  
ATOM   7020  S  SG   . CYS A 1 27 ? 1.735   2.899   -10.705 1.00 0.00 ? 91  CYS A SG   6  
ATOM   7021  H  H    . CYS A 1 27 ? 0.776   4.407   -8.295  1.00 0.00 ? 91  CYS A H    6  
ATOM   7022  H  HA   . CYS A 1 27 ? 0.067   6.244   -10.475 1.00 0.00 ? 91  CYS A HA   6  
ATOM   7023  H  HB2  . CYS A 1 27 ? 1.451   4.935   -11.910 1.00 0.00 ? 91  CYS A HB2  6  
ATOM   7024  H  HB3  . CYS A 1 27 ? 2.359   5.182   -10.422 1.00 0.00 ? 91  CYS A HB3  6  
ATOM   7025  N  N    . GLU A 1 28 ? -1.313  4.450   -11.875 1.00 0.00 ? 92  GLU A N    6  
ATOM   7026  C  CA   . GLU A 1 28 ? -2.444  3.696   -12.403 1.00 0.00 ? 92  GLU A CA   6  
ATOM   7027  C  C    . GLU A 1 28 ? -2.223  2.196   -12.238 1.00 0.00 ? 92  GLU A C    6  
ATOM   7028  O  O    . GLU A 1 28 ? -3.084  1.483   -11.723 1.00 0.00 ? 92  GLU A O    6  
ATOM   7029  C  CB   . GLU A 1 28 ? -2.664  4.032   -13.880 1.00 0.00 ? 92  GLU A CB   6  
ATOM   7030  C  CG   . GLU A 1 28 ? -3.428  5.326   -14.103 1.00 0.00 ? 92  GLU A CG   6  
ATOM   7031  C  CD   . GLU A 1 28 ? -4.929  5.144   -13.991 1.00 0.00 ? 92  GLU A CD   6  
ATOM   7032  O  OE1  . GLU A 1 28 ? -5.385  4.608   -12.959 1.00 0.00 ? 92  GLU A OE1  6  
ATOM   7033  O  OE2  . GLU A 1 28 ? -5.647  5.537   -14.933 1.00 0.00 ? 92  GLU A OE2  6  
ATOM   7034  H  H    . GLU A 1 28 ? -0.793  5.019   -12.480 1.00 0.00 ? 92  GLU A H    6  
ATOM   7035  H  HA   . GLU A 1 28 ? -3.323  3.982   -11.845 1.00 0.00 ? 92  GLU A HA   6  
ATOM   7036  H  HB2  . GLU A 1 28 ? -1.702  4.117   -14.364 1.00 0.00 ? 92  GLU A HB2  6  
ATOM   7037  H  HB3  . GLU A 1 28 ? -3.218  3.227   -14.340 1.00 0.00 ? 92  GLU A HB3  6  
ATOM   7038  H  HG2  . GLU A 1 28 ? -3.112  6.047   -13.365 1.00 0.00 ? 92  GLU A HG2  6  
ATOM   7039  H  HG3  . GLU A 1 28 ? -3.198  5.699   -15.091 1.00 0.00 ? 92  GLU A HG3  6  
ATOM   7040  N  N    . GLY A 1 29 ? -1.062  1.722   -12.681 1.00 0.00 ? 93  GLY A N    6  
ATOM   7041  C  CA   . GLY A 1 29 ? -0.748  0.309   -12.574 1.00 0.00 ? 93  GLY A CA   6  
ATOM   7042  C  C    . GLY A 1 29 ? -1.055  -0.251  -11.200 1.00 0.00 ? 93  GLY A C    6  
ATOM   7043  O  O    . GLY A 1 29 ? -1.677  -1.306  -11.075 1.00 0.00 ? 93  GLY A O    6  
ATOM   7044  H  H    . GLY A 1 29 ? -0.413  2.337   -13.083 1.00 0.00 ? 93  GLY A H    6  
ATOM   7045  H  HA2  . GLY A 1 29 ? -1.325  -0.233  -13.309 1.00 0.00 ? 93  GLY A HA2  6  
ATOM   7046  H  HA3  . GLY A 1 29 ? 0.303   0.169   -12.781 1.00 0.00 ? 93  GLY A HA3  6  
ATOM   7047  N  N    . CYS A 1 30 ? -0.616  0.455   -10.163 1.00 0.00 ? 94  CYS A N    6  
ATOM   7048  C  CA   . CYS A 1 30 ? -0.844  0.023   -8.790  1.00 0.00 ? 94  CYS A CA   6  
ATOM   7049  C  C    . CYS A 1 30 ? -2.294  0.261   -8.379  1.00 0.00 ? 94  CYS A C    6  
ATOM   7050  O  O    . CYS A 1 30 ? -2.958  -0.634  -7.855  1.00 0.00 ? 94  CYS A O    6  
ATOM   7051  C  CB   . CYS A 1 30 ? 0.096   0.763   -7.837  1.00 0.00 ? 94  CYS A CB   6  
ATOM   7052  S  SG   . CYS A 1 30 ? 1.859   0.372   -8.079  1.00 0.00 ? 94  CYS A SG   6  
ATOM   7053  H  H    . CYS A 1 30 ? -0.125  1.289   -10.326 1.00 0.00 ? 94  CYS A H    6  
ATOM   7054  H  HA   . CYS A 1 30 ? -0.637  -1.035  -8.737  1.00 0.00 ? 94  CYS A HA   6  
ATOM   7055  H  HB2  . CYS A 1 30 ? -0.025  1.827   -7.978  1.00 0.00 ? 94  CYS A HB2  6  
ATOM   7056  H  HB3  . CYS A 1 30 ? -0.161  0.508   -6.820  1.00 0.00 ? 94  CYS A HB3  6  
ATOM   7057  N  N    . LYS A 1 31 ? -2.780  1.474   -8.620  1.00 0.00 ? 95  LYS A N    6  
ATOM   7058  C  CA   . LYS A 1 31 ? -4.151  1.831   -8.277  1.00 0.00 ? 95  LYS A CA   6  
ATOM   7059  C  C    . LYS A 1 31 ? -5.115  0.710   -8.650  1.00 0.00 ? 95  LYS A C    6  
ATOM   7060  O  O    . LYS A 1 31 ? -5.803  0.158   -7.792  1.00 0.00 ? 95  LYS A O    6  
ATOM   7061  C  CB   . LYS A 1 31 ? -4.556  3.124   -8.989  1.00 0.00 ? 95  LYS A CB   6  
ATOM   7062  C  CG   . LYS A 1 31 ? -6.008  3.511   -8.768  1.00 0.00 ? 95  LYS A CG   6  
ATOM   7063  C  CD   . LYS A 1 31 ? -6.561  4.296   -9.945  1.00 0.00 ? 95  LYS A CD   6  
ATOM   7064  C  CE   . LYS A 1 31 ? -8.079  4.216   -10.005 1.00 0.00 ? 95  LYS A CE   6  
ATOM   7065  N  NZ   . LYS A 1 31 ? -8.704  4.559   -8.698  1.00 0.00 ? 95  LYS A NZ   6  
ATOM   7066  H  H    . LYS A 1 31 ? -2.202  2.145   -9.040  1.00 0.00 ? 95  LYS A H    6  
ATOM   7067  H  HA   . LYS A 1 31 ? -4.196  1.988   -7.210  1.00 0.00 ? 95  LYS A HA   6  
ATOM   7068  H  HB2  . LYS A 1 31 ? -3.932  3.929   -8.629  1.00 0.00 ? 95  LYS A HB2  6  
ATOM   7069  H  HB3  . LYS A 1 31 ? -4.395  3.002   -10.050 1.00 0.00 ? 95  LYS A HB3  6  
ATOM   7070  H  HG2  . LYS A 1 31 ? -6.595  2.614   -8.640  1.00 0.00 ? 95  LYS A HG2  6  
ATOM   7071  H  HG3  . LYS A 1 31 ? -6.078  4.119   -7.877  1.00 0.00 ? 95  LYS A HG3  6  
ATOM   7072  H  HD2  . LYS A 1 31 ? -6.271  5.331   -9.845  1.00 0.00 ? 95  LYS A HD2  6  
ATOM   7073  H  HD3  . LYS A 1 31 ? -6.152  3.892   -10.860 1.00 0.00 ? 95  LYS A HD3  6  
ATOM   7074  H  HE2  . LYS A 1 31 ? -8.434  4.905   -10.756 1.00 0.00 ? 95  LYS A HE2  6  
ATOM   7075  H  HE3  . LYS A 1 31 ? -8.363  3.210   -10.277 1.00 0.00 ? 95  LYS A HE3  6  
ATOM   7076  H  HZ1  . LYS A 1 31 ? -9.648  4.970   -8.850  1.00 0.00 ? 95  LYS A HZ1  6  
ATOM   7077  H  HZ2  . LYS A 1 31 ? -8.115  5.250   -8.191  1.00 0.00 ? 95  LYS A HZ2  6  
ATOM   7078  H  HZ3  . LYS A 1 31 ? -8.800  3.705   -8.112  1.00 0.00 ? 95  LYS A HZ3  6  
ATOM   7079  N  N    . GLY A 1 32 ? -5.160  0.377   -9.937  1.00 0.00 ? 96  GLY A N    6  
ATOM   7080  C  CA   . GLY A 1 32 ? -6.042  -0.678  -10.400 1.00 0.00 ? 96  GLY A CA   6  
ATOM   7081  C  C    . GLY A 1 32 ? -5.840  -1.976  -9.644  1.00 0.00 ? 96  GLY A C    6  
ATOM   7082  O  O    . GLY A 1 32 ? -6.804  -2.666  -9.310  1.00 0.00 ? 96  GLY A O    6  
ATOM   7083  H  H    . GLY A 1 32 ? -4.589  0.852   -10.577 1.00 0.00 ? 96  GLY A H    6  
ATOM   7084  H  HA2  . GLY A 1 32 ? -7.066  -0.357  -10.276 1.00 0.00 ? 96  GLY A HA2  6  
ATOM   7085  H  HA3  . GLY A 1 32 ? -5.855  -0.853  -11.449 1.00 0.00 ? 96  GLY A HA3  6  
ATOM   7086  N  N    . PHE A 1 33 ? -4.583  -2.313  -9.375  1.00 0.00 ? 97  PHE A N    6  
ATOM   7087  C  CA   . PHE A 1 33 ? -4.257  -3.539  -8.657  1.00 0.00 ? 97  PHE A CA   6  
ATOM   7088  C  C    . PHE A 1 33 ? -4.900  -3.546  -7.273  1.00 0.00 ? 97  PHE A C    6  
ATOM   7089  O  O    . PHE A 1 33 ? -5.637  -4.469  -6.924  1.00 0.00 ? 97  PHE A O    6  
ATOM   7090  C  CB   . PHE A 1 33 ? -2.740  -3.691  -8.527  1.00 0.00 ? 97  PHE A CB   6  
ATOM   7091  C  CG   . PHE A 1 33 ? -2.325  -4.819  -7.626  1.00 0.00 ? 97  PHE A CG   6  
ATOM   7092  C  CD1  . PHE A 1 33 ? -2.214  -4.626  -6.258  1.00 0.00 ? 97  PHE A CD1  6  
ATOM   7093  C  CD2  . PHE A 1 33 ? -2.046  -6.072  -8.146  1.00 0.00 ? 97  PHE A CD2  6  
ATOM   7094  C  CE1  . PHE A 1 33 ? -1.834  -5.662  -5.426  1.00 0.00 ? 97  PHE A CE1  6  
ATOM   7095  C  CE2  . PHE A 1 33 ? -1.665  -7.112  -7.319  1.00 0.00 ? 97  PHE A CE2  6  
ATOM   7096  C  CZ   . PHE A 1 33 ? -1.558  -6.906  -5.957  1.00 0.00 ? 97  PHE A CZ   6  
ATOM   7097  H  H    . PHE A 1 33 ? -3.857  -1.722  -9.668  1.00 0.00 ? 97  PHE A H    6  
ATOM   7098  H  HA   . PHE A 1 33 ? -4.645  -4.369  -9.226  1.00 0.00 ? 97  PHE A HA   6  
ATOM   7099  H  HB2  . PHE A 1 33 ? -2.318  -3.876  -9.503  1.00 0.00 ? 97  PHE A HB2  6  
ATOM   7100  H  HB3  . PHE A 1 33 ? -2.327  -2.777  -8.128  1.00 0.00 ? 97  PHE A HB3  6  
ATOM   7101  H  HD1  . PHE A 1 33 ? -2.430  -3.652  -5.841  1.00 0.00 ? 97  PHE A HD1  6  
ATOM   7102  H  HD2  . PHE A 1 33 ? -2.128  -6.235  -9.211  1.00 0.00 ? 97  PHE A HD2  6  
ATOM   7103  H  HE1  . PHE A 1 33 ? -1.751  -5.497  -4.362  1.00 0.00 ? 97  PHE A HE1  6  
ATOM   7104  H  HE2  . PHE A 1 33 ? -1.450  -8.084  -7.737  1.00 0.00 ? 97  PHE A HE2  6  
ATOM   7105  H  HZ   . PHE A 1 33 ? -1.261  -7.717  -5.309  1.00 0.00 ? 97  PHE A HZ   6  
ATOM   7106  N  N    . PHE A 1 34 ? -4.616  -2.511  -6.490  1.00 0.00 ? 98  PHE A N    6  
ATOM   7107  C  CA   . PHE A 1 34 ? -5.165  -2.398  -5.144  1.00 0.00 ? 98  PHE A CA   6  
ATOM   7108  C  C    . PHE A 1 34 ? -6.680  -2.581  -5.157  1.00 0.00 ? 98  PHE A C    6  
ATOM   7109  O  O    . PHE A 1 34 ? -7.220  -3.428  -4.446  1.00 0.00 ? 98  PHE A O    6  
ATOM   7110  C  CB   . PHE A 1 34 ? -4.809  -1.039  -4.537  1.00 0.00 ? 98  PHE A CB   6  
ATOM   7111  C  CG   . PHE A 1 34 ? -5.254  -0.884  -3.111  1.00 0.00 ? 98  PHE A CG   6  
ATOM   7112  C  CD1  . PHE A 1 34 ? -4.509  -1.427  -2.076  1.00 0.00 ? 98  PHE A CD1  6  
ATOM   7113  C  CD2  . PHE A 1 34 ? -6.417  -0.195  -2.805  1.00 0.00 ? 98  PHE A CD2  6  
ATOM   7114  C  CE1  . PHE A 1 34 ? -4.915  -1.285  -0.763  1.00 0.00 ? 98  PHE A CE1  6  
ATOM   7115  C  CE2  . PHE A 1 34 ? -6.828  -0.050  -1.494  1.00 0.00 ? 98  PHE A CE2  6  
ATOM   7116  C  CZ   . PHE A 1 34 ? -6.077  -0.597  -0.471  1.00 0.00 ? 98  PHE A CZ   6  
ATOM   7117  H  H    . PHE A 1 34 ? -4.022  -1.807  -6.825  1.00 0.00 ? 98  PHE A H    6  
ATOM   7118  H  HA   . PHE A 1 34 ? -4.726  -3.178  -4.541  1.00 0.00 ? 98  PHE A HA   6  
ATOM   7119  H  HB2  . PHE A 1 34 ? -3.738  -0.909  -4.566  1.00 0.00 ? 98  PHE A HB2  6  
ATOM   7120  H  HB3  . PHE A 1 34 ? -5.278  -0.260  -5.119  1.00 0.00 ? 98  PHE A HB3  6  
ATOM   7121  H  HD1  . PHE A 1 34 ? -3.600  -1.966  -2.304  1.00 0.00 ? 98  PHE A HD1  6  
ATOM   7122  H  HD2  . PHE A 1 34 ? -7.006  0.232   -3.603  1.00 0.00 ? 98  PHE A HD2  6  
ATOM   7123  H  HE1  . PHE A 1 34 ? -4.326  -1.714  0.034   1.00 0.00 ? 98  PHE A HE1  6  
ATOM   7124  H  HE2  . PHE A 1 34 ? -7.736  0.488   -1.268  1.00 0.00 ? 98  PHE A HE2  6  
ATOM   7125  H  HZ   . PHE A 1 34 ? -6.395  -0.485  0.554   1.00 0.00 ? 98  PHE A HZ   6  
ATOM   7126  N  N    . ARG A 1 35 ? -7.359  -1.779  -5.970  1.00 0.00 ? 99  ARG A N    6  
ATOM   7127  C  CA   . ARG A 1 35 ? -8.812  -1.850  -6.075  1.00 0.00 ? 99  ARG A CA   6  
ATOM   7128  C  C    . ARG A 1 35 ? -9.260  -3.254  -6.469  1.00 0.00 ? 99  ARG A C    6  
ATOM   7129  O  O    . ARG A 1 35 ? -10.025 -3.897  -5.749  1.00 0.00 ? 99  ARG A O    6  
ATOM   7130  C  CB   . ARG A 1 35 ? -9.321  -0.834  -7.100  1.00 0.00 ? 99  ARG A CB   6  
ATOM   7131  C  CG   . ARG A 1 35 ? -10.828 -0.642  -7.071  1.00 0.00 ? 99  ARG A CG   6  
ATOM   7132  C  CD   . ARG A 1 35 ? -11.236 0.667   -7.729  1.00 0.00 ? 99  ARG A CD   6  
ATOM   7133  N  NE   . ARG A 1 35 ? -11.174 1.790   -6.798  1.00 0.00 ? 99  ARG A NE   6  
ATOM   7134  C  CZ   . ARG A 1 35 ? -11.880 2.906   -6.945  1.00 0.00 ? 99  ARG A CZ   6  
ATOM   7135  N  NH1  . ARG A 1 35 ? -12.697 3.046   -7.979  1.00 0.00 ? 99  ARG A NH1  6  
ATOM   7136  N  NH2  . ARG A 1 35 ? -11.769 3.884   -6.055  1.00 0.00 ? 99  ARG A NH2  6  
ATOM   7137  H  H    . ARG A 1 35 ? -6.873  -1.123  -6.512  1.00 0.00 ? 99  ARG A H    6  
ATOM   7138  H  HA   . ARG A 1 35 ? -9.227  -1.610  -5.108  1.00 0.00 ? 99  ARG A HA   6  
ATOM   7139  H  HB2  . ARG A 1 35 ? -8.854  0.121   -6.906  1.00 0.00 ? 99  ARG A HB2  6  
ATOM   7140  H  HB3  . ARG A 1 35 ? -9.041  -1.168  -8.088  1.00 0.00 ? 99  ARG A HB3  6  
ATOM   7141  H  HG2  . ARG A 1 35 ? -11.296 -1.459  -7.600  1.00 0.00 ? 99  ARG A HG2  6  
ATOM   7142  H  HG3  . ARG A 1 35 ? -11.161 -0.638  -6.044  1.00 0.00 ? 99  ARG A HG3  6  
ATOM   7143  H  HD2  . ARG A 1 35 ? -10.570 0.861   -8.557  1.00 0.00 ? 99  ARG A HD2  6  
ATOM   7144  H  HD3  . ARG A 1 35 ? -12.247 0.570   -8.096  1.00 0.00 ? 99  ARG A HD3  6  
ATOM   7145  H  HE   . ARG A 1 35 ? -10.576 1.708   -6.026  1.00 0.00 ? 99  ARG A HE   6  
ATOM   7146  H  HH11 . ARG A 1 35 ? -12.783 2.310   -8.651  1.00 0.00 ? 99  ARG A HH11 6  
ATOM   7147  H  HH12 . ARG A 1 35 ? -13.228 3.887   -8.087  1.00 0.00 ? 99  ARG A HH12 6  
ATOM   7148  H  HH21 . ARG A 1 35 ? -11.155 3.782   -5.273  1.00 0.00 ? 99  ARG A HH21 6  
ATOM   7149  H  HH22 . ARG A 1 35 ? -12.301 4.723   -6.166  1.00 0.00 ? 99  ARG A HH22 6  
ATOM   7150  N  N    . ARG A 1 36 ? -8.780  -3.723  -7.616  1.00 0.00 ? 100 ARG A N    6  
ATOM   7151  C  CA   . ARG A 1 36 ? -9.132  -5.050  -8.106  1.00 0.00 ? 100 ARG A CA   6  
ATOM   7152  C  C    . ARG A 1 36 ? -9.109  -6.072  -6.973  1.00 0.00 ? 100 ARG A C    6  
ATOM   7153  O  O    . ARG A 1 36 ? -10.047 -6.852  -6.806  1.00 0.00 ? 100 ARG A O    6  
ATOM   7154  C  CB   . ARG A 1 36 ? -8.170  -5.480  -9.215  1.00 0.00 ? 100 ARG A CB   6  
ATOM   7155  C  CG   . ARG A 1 36 ? -8.314  -6.940  -9.614  1.00 0.00 ? 100 ARG A CG   6  
ATOM   7156  C  CD   . ARG A 1 36 ? -7.942  -7.158  -11.072 1.00 0.00 ? 100 ARG A CD   6  
ATOM   7157  N  NE   . ARG A 1 36 ? -7.591  -8.549  -11.346 1.00 0.00 ? 100 ARG A NE   6  
ATOM   7158  C  CZ   . ARG A 1 36 ? -6.835  -8.928  -12.370 1.00 0.00 ? 100 ARG A CZ   6  
ATOM   7159  N  NH1  . ARG A 1 36 ? -6.352  -8.025  -13.212 1.00 0.00 ? 100 ARG A NH1  6  
ATOM   7160  N  NH2  . ARG A 1 36 ? -6.560  -10.213 -12.552 1.00 0.00 ? 100 ARG A NH2  6  
ATOM   7161  H  H    . ARG A 1 36 ? -8.174  -3.164  -8.146  1.00 0.00 ? 100 ARG A H    6  
ATOM   7162  H  HA   . ARG A 1 36 ? -10.133 -5.000  -8.509  1.00 0.00 ? 100 ARG A HA   6  
ATOM   7163  H  HB2  . ARG A 1 36 ? -8.351  -4.871  -10.089 1.00 0.00 ? 100 ARG A HB2  6  
ATOM   7164  H  HB3  . ARG A 1 36 ? -7.157  -5.320  -8.878  1.00 0.00 ? 100 ARG A HB3  6  
ATOM   7165  H  HG2  . ARG A 1 36 ? -7.663  -7.539  -8.995  1.00 0.00 ? 100 ARG A HG2  6  
ATOM   7166  H  HG3  . ARG A 1 36 ? -9.339  -7.245  -9.463  1.00 0.00 ? 100 ARG A HG3  6  
ATOM   7167  H  HD2  . ARG A 1 36 ? -8.783  -6.880  -11.690 1.00 0.00 ? 100 ARG A HD2  6  
ATOM   7168  H  HD3  . ARG A 1 36 ? -7.097  -6.529  -11.312 1.00 0.00 ? 100 ARG A HD3  6  
ATOM   7169  H  HE   . ARG A 1 36 ? -7.937  -9.232  -10.736 1.00 0.00 ? 100 ARG A HE   6  
ATOM   7170  H  HH11 . ARG A 1 36 ? -6.557  -7.056  -13.077 1.00 0.00 ? 100 ARG A HH11 6  
ATOM   7171  H  HH12 . ARG A 1 36 ? -5.782  -8.314  -13.982 1.00 0.00 ? 100 ARG A HH12 6  
ATOM   7172  H  HH21 . ARG A 1 36 ? -6.922  -10.897 -11.919 1.00 0.00 ? 100 ARG A HH21 6  
ATOM   7173  H  HH22 . ARG A 1 36 ? -5.991  -10.498 -13.323 1.00 0.00 ? 100 ARG A HH22 6  
ATOM   7174  N  N    . THR A 1 37 ? -8.030  -6.063  -6.197  1.00 0.00 ? 101 THR A N    6  
ATOM   7175  C  CA   . THR A 1 37 ? -7.883  -6.989  -5.081  1.00 0.00 ? 101 THR A CA   6  
ATOM   7176  C  C    . THR A 1 37 ? -9.043  -6.858  -4.101  1.00 0.00 ? 101 THR A C    6  
ATOM   7177  O  O    . THR A 1 37 ? -9.576  -7.857  -3.618  1.00 0.00 ? 101 THR A O    6  
ATOM   7178  C  CB   . THR A 1 37 ? -6.560  -6.756  -4.328  1.00 0.00 ? 101 THR A CB   6  
ATOM   7179  O  OG1  . THR A 1 37 ? -5.458  -6.827  -5.240  1.00 0.00 ? 101 THR A OG1  6  
ATOM   7180  C  CG2  . THR A 1 37 ? -6.377  -7.786  -3.223  1.00 0.00 ? 101 THR A CG2  6  
ATOM   7181  H  H    . THR A 1 37 ? -7.316  -5.418  -6.381  1.00 0.00 ? 101 THR A H    6  
ATOM   7182  H  HA   . THR A 1 37 ? -7.874  -7.993  -5.480  1.00 0.00 ? 101 THR A HA   6  
ATOM   7183  H  HB   . THR A 1 37 ? -6.586  -5.772  -3.882  1.00 0.00 ? 101 THR A HB   6  
ATOM   7184  H  HG1  . THR A 1 37 ? -5.443  -6.037  -5.786  1.00 0.00 ? 101 THR A HG1  6  
ATOM   7185  H  HG21 . THR A 1 37 ? -6.287  -8.769  -3.660  1.00 0.00 ? 101 THR A HG21 6  
ATOM   7186  H  HG22 . THR A 1 37 ? -7.233  -7.763  -2.564  1.00 0.00 ? 101 THR A HG22 6  
ATOM   7187  H  HG23 . THR A 1 37 ? -5.484  -7.557  -2.662  1.00 0.00 ? 101 THR A HG23 6  
ATOM   7188  N  N    . ILE A 1 38 ? -9.429  -5.620  -3.812  1.00 0.00 ? 102 ILE A N    6  
ATOM   7189  C  CA   . ILE A 1 38 ? -10.528 -5.358  -2.890  1.00 0.00 ? 102 ILE A CA   6  
ATOM   7190  C  C    . ILE A 1 38 ? -11.854 -5.844  -3.464  1.00 0.00 ? 102 ILE A C    6  
ATOM   7191  O  O    . ILE A 1 38 ? -12.486 -6.747  -2.916  1.00 0.00 ? 102 ILE A O    6  
ATOM   7192  C  CB   . ILE A 1 38 ? -10.642 -3.858  -2.561  1.00 0.00 ? 102 ILE A CB   6  
ATOM   7193  C  CG1  . ILE A 1 38 ? -9.354  -3.359  -1.903  1.00 0.00 ? 102 ILE A CG1  6  
ATOM   7194  C  CG2  . ILE A 1 38 ? -11.838 -3.604  -1.656  1.00 0.00 ? 102 ILE A CG2  6  
ATOM   7195  C  CD1  . ILE A 1 38 ? -9.027  -4.062  -0.604  1.00 0.00 ? 102 ILE A CD1  6  
ATOM   7196  H  H    . ILE A 1 38 ? -8.965  -4.864  -4.229  1.00 0.00 ? 102 ILE A H    6  
ATOM   7197  H  HA   . ILE A 1 38 ? -10.327 -5.894  -1.973  1.00 0.00 ? 102 ILE A HA   6  
ATOM   7198  H  HB   . ILE A 1 38 ? -10.798 -3.321  -3.483  1.00 0.00 ? 102 ILE A HB   6  
ATOM   7199  H  HG12 . ILE A 1 38 ? -8.528  -3.512  -2.579  1.00 0.00 ? 102 ILE A HG12 6  
ATOM   7200  H  HG13 . ILE A 1 38 ? -9.451  -2.303  -1.694  1.00 0.00 ? 102 ILE A HG13 6  
ATOM   7201  H  HG21 . ILE A 1 38 ? -11.494 -3.406  -0.652  1.00 0.00 ? 102 ILE A HG21 6  
ATOM   7202  H  HG22 . ILE A 1 38 ? -12.390 -2.751  -2.021  1.00 0.00 ? 102 ILE A HG22 6  
ATOM   7203  H  HG23 . ILE A 1 38 ? -12.478 -4.473  -1.652  1.00 0.00 ? 102 ILE A HG23 6  
ATOM   7204  H  HD11 . ILE A 1 38 ? -9.823  -4.750  -0.357  1.00 0.00 ? 102 ILE A HD11 6  
ATOM   7205  H  HD12 . ILE A 1 38 ? -8.102  -4.609  -0.713  1.00 0.00 ? 102 ILE A HD12 6  
ATOM   7206  H  HD13 . ILE A 1 38 ? -8.924  -3.333  0.185   1.00 0.00 ? 102 ILE A HD13 6  
ATOM   7207  N  N    . ARG A 1 39 ? -12.270 -5.239  -4.572  1.00 0.00 ? 103 ARG A N    6  
ATOM   7208  C  CA   . ARG A 1 39 ? -13.522 -5.609  -5.221  1.00 0.00 ? 103 ARG A CA   6  
ATOM   7209  C  C    . ARG A 1 39 ? -13.593 -7.117  -5.442  1.00 0.00 ? 103 ARG A C    6  
ATOM   7210  O  O    . ARG A 1 39 ? -14.644 -7.732  -5.260  1.00 0.00 ? 103 ARG A O    6  
ATOM   7211  C  CB   . ARG A 1 39 ? -13.663 -4.880  -6.558  1.00 0.00 ? 103 ARG A CB   6  
ATOM   7212  C  CG   . ARG A 1 39 ? -12.676 -5.348  -7.615  1.00 0.00 ? 103 ARG A CG   6  
ATOM   7213  C  CD   . ARG A 1 39 ? -12.788 -4.523  -8.887  1.00 0.00 ? 103 ARG A CD   6  
ATOM   7214  N  NE   . ARG A 1 39 ? -12.279 -5.241  -10.052 1.00 0.00 ? 103 ARG A NE   6  
ATOM   7215  C  CZ   . ARG A 1 39 ? -12.950 -6.207  -10.671 1.00 0.00 ? 103 ARG A CZ   6  
ATOM   7216  N  NH1  . ARG A 1 39 ? -14.150 -6.567  -10.237 1.00 0.00 ? 103 ARG A NH1  6  
ATOM   7217  N  NH2  . ARG A 1 39 ? -12.420 -6.814  -11.725 1.00 0.00 ? 103 ARG A NH2  6  
ATOM   7218  H  H    . ARG A 1 39 ? -11.723 -4.525  -4.961  1.00 0.00 ? 103 ARG A H    6  
ATOM   7219  H  HA   . ARG A 1 39 ? -14.333 -5.314  -4.572  1.00 0.00 ? 103 ARG A HA   6  
ATOM   7220  H  HB2  . ARG A 1 39 ? -14.662 -5.036  -6.937  1.00 0.00 ? 103 ARG A HB2  6  
ATOM   7221  H  HB3  . ARG A 1 39 ? -13.509 -3.824  -6.396  1.00 0.00 ? 103 ARG A HB3  6  
ATOM   7222  H  HG2  . ARG A 1 39 ? -11.673 -5.254  -7.225  1.00 0.00 ? 103 ARG A HG2  6  
ATOM   7223  H  HG3  . ARG A 1 39 ? -12.877 -6.383  -7.848  1.00 0.00 ? 103 ARG A HG3  6  
ATOM   7224  H  HD2  . ARG A 1 39 ? -13.827 -4.279  -9.052  1.00 0.00 ? 103 ARG A HD2  6  
ATOM   7225  H  HD3  . ARG A 1 39 ? -12.220 -3.613  -8.761  1.00 0.00 ? 103 ARG A HD3  6  
ATOM   7226  H  HE   . ARG A 1 39 ? -11.394 -4.991  -10.389 1.00 0.00 ? 103 ARG A HE   6  
ATOM   7227  H  HH11 . ARG A 1 39 ? -14.552 -6.111  -9.444  1.00 0.00 ? 103 ARG A HH11 6  
ATOM   7228  H  HH12 . ARG A 1 39 ? -14.653 -7.294  -10.705 1.00 0.00 ? 103 ARG A HH12 6  
ATOM   7229  H  HH21 . ARG A 1 39 ? -11.516 -6.545  -12.055 1.00 0.00 ? 103 ARG A HH21 6  
ATOM   7230  H  HH22 . ARG A 1 39 ? -12.926 -7.540  -12.190 1.00 0.00 ? 103 ARG A HH22 6  
ATOM   7231  N  N    . MET A 1 40 ? -12.469 -7.707  -5.837  1.00 0.00 ? 104 MET A N    6  
ATOM   7232  C  CA   . MET A 1 40 ? -12.405 -9.143  -6.082  1.00 0.00 ? 104 MET A CA   6  
ATOM   7233  C  C    . MET A 1 40 ? -12.142 -9.904  -4.787  1.00 0.00 ? 104 MET A C    6  
ATOM   7234  O  O    . MET A 1 40 ? -12.338 -11.118 -4.717  1.00 0.00 ? 104 MET A O    6  
ATOM   7235  C  CB   . MET A 1 40 ? -11.312 -9.459  -7.104  1.00 0.00 ? 104 MET A CB   6  
ATOM   7236  C  CG   . MET A 1 40 ? -11.561 -8.842  -8.471  1.00 0.00 ? 104 MET A CG   6  
ATOM   7237  S  SD   . MET A 1 40 ? -10.509 -9.547  -9.754  1.00 0.00 ? 104 MET A SD   6  
ATOM   7238  C  CE   . MET A 1 40 ? -11.077 -11.246 -9.762  1.00 0.00 ? 104 MET A CE   6  
ATOM   7239  H  H    . MET A 1 40 ? -11.664 -7.164  -5.965  1.00 0.00 ? 104 MET A H    6  
ATOM   7240  H  HA   . MET A 1 40 ? -13.359 -9.453  -6.481  1.00 0.00 ? 104 MET A HA   6  
ATOM   7241  H  HB2  . MET A 1 40 ? -10.369 -9.087  -6.732  1.00 0.00 ? 104 MET A HB2  6  
ATOM   7242  H  HB3  . MET A 1 40 ? -11.245 -10.530 -7.224  1.00 0.00 ? 104 MET A HB3  6  
ATOM   7243  H  HG2  . MET A 1 40 ? -12.593 -9.005  -8.743  1.00 0.00 ? 104 MET A HG2  6  
ATOM   7244  H  HG3  . MET A 1 40 ? -11.370 -7.780  -8.411  1.00 0.00 ? 104 MET A HG3  6  
ATOM   7245  H  HE1  . MET A 1 40 ? -10.831 -11.703 -10.709 1.00 0.00 ? 104 MET A HE1  6  
ATOM   7246  H  HE2  . MET A 1 40 ? -10.596 -11.790 -8.963  1.00 0.00 ? 104 MET A HE2  6  
ATOM   7247  H  HE3  . MET A 1 40 ? -12.148 -11.267 -9.619  1.00 0.00 ? 104 MET A HE3  6  
ATOM   7248  N  N    . LYS A 1 41 ? -11.696 -9.184  -3.763  1.00 0.00 ? 105 LYS A N    6  
ATOM   7249  C  CA   . LYS A 1 41 ? -11.407 -9.791  -2.469  1.00 0.00 ? 105 LYS A CA   6  
ATOM   7250  C  C    . LYS A 1 41 ? -10.449 -10.969 -2.622  1.00 0.00 ? 105 LYS A C    6  
ATOM   7251  O  O    . LYS A 1 41 ? -10.678 -12.044 -2.067  1.00 0.00 ? 105 LYS A O    6  
ATOM   7252  C  CB   . LYS A 1 41 ? -12.702 -10.257 -1.800  1.00 0.00 ? 105 LYS A CB   6  
ATOM   7253  C  CG   . LYS A 1 41 ? -13.378 -9.181  -0.968  1.00 0.00 ? 105 LYS A CG   6  
ATOM   7254  C  CD   . LYS A 1 41 ? -12.720 -9.032  0.393   1.00 0.00 ? 105 LYS A CD   6  
ATOM   7255  C  CE   . LYS A 1 41 ? -13.545 -8.148  1.317   1.00 0.00 ? 105 LYS A CE   6  
ATOM   7256  N  NZ   . LYS A 1 41 ? -14.702 -8.882  1.899   1.00 0.00 ? 105 LYS A NZ   6  
ATOM   7257  H  H    . LYS A 1 41 ? -11.560 -8.220  -3.880  1.00 0.00 ? 105 LYS A H    6  
ATOM   7258  H  HA   . LYS A 1 41 ? -10.940 -9.042  -1.848  1.00 0.00 ? 105 LYS A HA   6  
ATOM   7259  H  HB2  . LYS A 1 41 ? -13.393 -10.579 -2.565  1.00 0.00 ? 105 LYS A HB2  6  
ATOM   7260  H  HB3  . LYS A 1 41 ? -12.478 -11.094 -1.153  1.00 0.00 ? 105 LYS A HB3  6  
ATOM   7261  H  HG2  . LYS A 1 41 ? -13.313 -8.239  -1.493  1.00 0.00 ? 105 LYS A HG2  6  
ATOM   7262  H  HG3  . LYS A 1 41 ? -14.417 -9.446  -0.829  1.00 0.00 ? 105 LYS A HG3  6  
ATOM   7263  H  HD2  . LYS A 1 41 ? -12.619 -10.008 0.843   1.00 0.00 ? 105 LYS A HD2  6  
ATOM   7264  H  HD3  . LYS A 1 41 ? -11.742 -8.590  0.264   1.00 0.00 ? 105 LYS A HD3  6  
ATOM   7265  H  HE2  . LYS A 1 41 ? -12.912 -7.797  2.117   1.00 0.00 ? 105 LYS A HE2  6  
ATOM   7266  H  HE3  . LYS A 1 41 ? -13.912 -7.304  0.752   1.00 0.00 ? 105 LYS A HE3  6  
ATOM   7267  H  HZ1  . LYS A 1 41 ? -15.221 -9.384  1.151   1.00 0.00 ? 105 LYS A HZ1  6  
ATOM   7268  H  HZ2  . LYS A 1 41 ? -15.349 -8.215  2.367   1.00 0.00 ? 105 LYS A HZ2  6  
ATOM   7269  H  HZ3  . LYS A 1 41 ? -14.370 -9.574  2.600   1.00 0.00 ? 105 LYS A HZ3  6  
ATOM   7270  N  N    . LEU A 1 42 ? -9.377  -10.759 -3.377  1.00 0.00 ? 106 LEU A N    6  
ATOM   7271  C  CA   . LEU A 1 42 ? -8.383  -11.803 -3.603  1.00 0.00 ? 106 LEU A CA   6  
ATOM   7272  C  C    . LEU A 1 42 ? -7.471  -11.957 -2.390  1.00 0.00 ? 106 LEU A C    6  
ATOM   7273  O  O    . LEU A 1 42 ? -6.838  -10.997 -1.952  1.00 0.00 ? 106 LEU A O    6  
ATOM   7274  C  CB   . LEU A 1 42 ? -7.550  -11.482 -4.844  1.00 0.00 ? 106 LEU A CB   6  
ATOM   7275  C  CG   . LEU A 1 42 ? -8.335  -11.173 -6.119  1.00 0.00 ? 106 LEU A CG   6  
ATOM   7276  C  CD1  . LEU A 1 42 ? -7.420  -10.582 -7.180  1.00 0.00 ? 106 LEU A CD1  6  
ATOM   7277  C  CD2  . LEU A 1 42 ? -9.020  -12.427 -6.641  1.00 0.00 ? 106 LEU A CD2  6  
ATOM   7278  H  H    . LEU A 1 42 ? -9.249  -9.881  -3.794  1.00 0.00 ? 106 LEU A H    6  
ATOM   7279  H  HA   . LEU A 1 42 ? -8.910  -12.732 -3.763  1.00 0.00 ? 106 LEU A HA   6  
ATOM   7280  H  HB2  . LEU A 1 42 ? -6.936  -10.623 -4.618  1.00 0.00 ? 106 LEU A HB2  6  
ATOM   7281  H  HB3  . LEU A 1 42 ? -6.914  -12.333 -5.044  1.00 0.00 ? 106 LEU A HB3  6  
ATOM   7282  H  HG   . LEU A 1 42 ? -9.100  -10.442 -5.894  1.00 0.00 ? 106 LEU A HG   6  
ATOM   7283  H  HD11 . LEU A 1 42 ? -6.637  -10.013 -6.704  1.00 0.00 ? 106 LEU A HD11 6  
ATOM   7284  H  HD12 . LEU A 1 42 ? -7.992  -9.935  -7.829  1.00 0.00 ? 106 LEU A HD12 6  
ATOM   7285  H  HD13 . LEU A 1 42 ? -6.983  -11.380 -7.763  1.00 0.00 ? 106 LEU A HD13 6  
ATOM   7286  H  HD21 . LEU A 1 42 ? -8.645  -12.658 -7.627  1.00 0.00 ? 106 LEU A HD21 6  
ATOM   7287  H  HD22 . LEU A 1 42 ? -10.086 -12.261 -6.690  1.00 0.00 ? 106 LEU A HD22 6  
ATOM   7288  H  HD23 . LEU A 1 42 ? -8.816  -13.253 -5.974  1.00 0.00 ? 106 LEU A HD23 6  
ATOM   7289  N  N    . GLU A 1 43 ? -7.408  -13.172 -1.854  1.00 0.00 ? 107 GLU A N    6  
ATOM   7290  C  CA   . GLU A 1 43 ? -6.572  -13.452 -0.692  1.00 0.00 ? 107 GLU A CA   6  
ATOM   7291  C  C    . GLU A 1 43 ? -5.202  -13.970 -1.120  1.00 0.00 ? 107 GLU A C    6  
ATOM   7292  O  O    . GLU A 1 43 ? -5.096  -14.807 -2.017  1.00 0.00 ? 107 GLU A O    6  
ATOM   7293  C  CB   . GLU A 1 43 ? -7.254  -14.473 0.221   1.00 0.00 ? 107 GLU A CB   6  
ATOM   7294  C  CG   . GLU A 1 43 ? -6.880  -14.324 1.686   1.00 0.00 ? 107 GLU A CG   6  
ATOM   7295  C  CD   . GLU A 1 43 ? -5.407  -14.578 1.941   1.00 0.00 ? 107 GLU A CD   6  
ATOM   7296  O  OE1  . GLU A 1 43 ? -4.882  -15.588 1.427   1.00 0.00 ? 107 GLU A OE1  6  
ATOM   7297  O  OE2  . GLU A 1 43 ? -4.779  -13.768 2.653   1.00 0.00 ? 107 GLU A OE2  6  
ATOM   7298  H  H    . GLU A 1 43 ? -7.937  -13.897 -2.248  1.00 0.00 ? 107 GLU A H    6  
ATOM   7299  H  HA   . GLU A 1 43 ? -6.440  -12.528 -0.149  1.00 0.00 ? 107 GLU A HA   6  
ATOM   7300  H  HB2  . GLU A 1 43 ? -8.324  -14.361 0.130   1.00 0.00 ? 107 GLU A HB2  6  
ATOM   7301  H  HB3  . GLU A 1 43 ? -6.977  -15.466 -0.101  1.00 0.00 ? 107 GLU A HB3  6  
ATOM   7302  H  HG2  . GLU A 1 43 ? -7.116  -13.320 2.005   1.00 0.00 ? 107 GLU A HG2  6  
ATOM   7303  H  HG3  . GLU A 1 43 ? -7.457  -15.030 2.265   1.00 0.00 ? 107 GLU A HG3  6  
ATOM   7304  N  N    . TYR A 1 44 ? -4.157  -13.468 -0.473  1.00 0.00 ? 108 TYR A N    6  
ATOM   7305  C  CA   . TYR A 1 44 ? -2.794  -13.877 -0.787  1.00 0.00 ? 108 TYR A CA   6  
ATOM   7306  C  C    . TYR A 1 44 ? -2.138  -14.556 0.412   1.00 0.00 ? 108 TYR A C    6  
ATOM   7307  O  O    . TYR A 1 44 ? -2.558  -14.365 1.552   1.00 0.00 ? 108 TYR A O    6  
ATOM   7308  C  CB   . TYR A 1 44 ? -1.963  -12.668 -1.220  1.00 0.00 ? 108 TYR A CB   6  
ATOM   7309  C  CG   . TYR A 1 44 ? -2.451  -12.024 -2.498  1.00 0.00 ? 108 TYR A CG   6  
ATOM   7310  C  CD1  . TYR A 1 44 ? -2.607  -12.769 -3.660  1.00 0.00 ? 108 TYR A CD1  6  
ATOM   7311  C  CD2  . TYR A 1 44 ? -2.758  -10.669 -2.542  1.00 0.00 ? 108 TYR A CD2  6  
ATOM   7312  C  CE1  . TYR A 1 44 ? -3.053  -12.184 -4.829  1.00 0.00 ? 108 TYR A CE1  6  
ATOM   7313  C  CE2  . TYR A 1 44 ? -3.206  -10.076 -3.707  1.00 0.00 ? 108 TYR A CE2  6  
ATOM   7314  C  CZ   . TYR A 1 44 ? -3.351  -10.837 -4.848  1.00 0.00 ? 108 TYR A CZ   6  
ATOM   7315  O  OH   . TYR A 1 44 ? -3.796  -10.251 -6.010  1.00 0.00 ? 108 TYR A OH   6  
ATOM   7316  H  H    . TYR A 1 44 ? -4.306  -12.804 0.233   1.00 0.00 ? 108 TYR A H    6  
ATOM   7317  H  HA   . TYR A 1 44 ? -2.839  -14.582 -1.605  1.00 0.00 ? 108 TYR A HA   6  
ATOM   7318  H  HB2  . TYR A 1 44 ? -1.992  -11.922 -0.441  1.00 0.00 ? 108 TYR A HB2  6  
ATOM   7319  H  HB3  . TYR A 1 44 ? -0.940  -12.980 -1.375  1.00 0.00 ? 108 TYR A HB3  6  
ATOM   7320  H  HD1  . TYR A 1 44 ? -2.373  -13.824 -3.641  1.00 0.00 ? 108 TYR A HD1  6  
ATOM   7321  H  HD2  . TYR A 1 44 ? -2.644  -10.075 -1.647  1.00 0.00 ? 108 TYR A HD2  6  
ATOM   7322  H  HE1  . TYR A 1 44 ? -3.167  -12.780 -5.722  1.00 0.00 ? 108 TYR A HE1  6  
ATOM   7323  H  HE2  . TYR A 1 44 ? -3.439  -9.022  -3.722  1.00 0.00 ? 108 TYR A HE2  6  
ATOM   7324  H  HH   . TYR A 1 44 ? -4.067  -10.934 -6.629  1.00 0.00 ? 108 TYR A HH   6  
ATOM   7325  N  N    . GLU A 1 45 ? -1.106  -15.349 0.143   1.00 0.00 ? 109 GLU A N    6  
ATOM   7326  C  CA   . GLU A 1 45 ? -0.392  -16.056 1.200   1.00 0.00 ? 109 GLU A CA   6  
ATOM   7327  C  C    . GLU A 1 45 ? 0.683   -15.168 1.819   1.00 0.00 ? 109 GLU A C    6  
ATOM   7328  O  O    . GLU A 1 45 ? 1.607   -14.724 1.137   1.00 0.00 ? 109 GLU A O    6  
ATOM   7329  C  CB   . GLU A 1 45 ? 0.243   -17.335 0.649   1.00 0.00 ? 109 GLU A CB   6  
ATOM   7330  C  CG   . GLU A 1 45 ? 0.477   -18.402 1.705   1.00 0.00 ? 109 GLU A CG   6  
ATOM   7331  C  CD   . GLU A 1 45 ? 1.218   -17.871 2.917   1.00 0.00 ? 109 GLU A CD   6  
ATOM   7332  O  OE1  . GLU A 1 45 ? 2.465   -17.835 2.882   1.00 0.00 ? 109 GLU A OE1  6  
ATOM   7333  O  OE2  . GLU A 1 45 ? 0.549   -17.490 3.900   1.00 0.00 ? 109 GLU A OE2  6  
ATOM   7334  H  H    . GLU A 1 45 ? -0.818  -15.461 -0.787  1.00 0.00 ? 109 GLU A H    6  
ATOM   7335  H  HA   . GLU A 1 45 ? -1.107  -16.321 1.964   1.00 0.00 ? 109 GLU A HA   6  
ATOM   7336  H  HB2  . GLU A 1 45 ? -0.405  -17.746 -0.111  1.00 0.00 ? 109 GLU A HB2  6  
ATOM   7337  H  HB3  . GLU A 1 45 ? 1.194   -17.086 0.202   1.00 0.00 ? 109 GLU A HB3  6  
ATOM   7338  H  HG2  . GLU A 1 45 ? -0.479  -18.788 2.027   1.00 0.00 ? 109 GLU A HG2  6  
ATOM   7339  H  HG3  . GLU A 1 45 ? 1.058   -19.201 1.268   1.00 0.00 ? 109 GLU A HG3  6  
ATOM   7340  N  N    . LYS A 1 46 ? 0.556   -14.913 3.117   1.00 0.00 ? 110 LYS A N    6  
ATOM   7341  C  CA   . LYS A 1 46 ? 1.515   -14.079 3.831   1.00 0.00 ? 110 LYS A CA   6  
ATOM   7342  C  C    . LYS A 1 46 ? 2.940   -14.375 3.373   1.00 0.00 ? 110 LYS A C    6  
ATOM   7343  O  O    . LYS A 1 46 ? 3.434   -15.492 3.530   1.00 0.00 ? 110 LYS A O    6  
ATOM   7344  C  CB   . LYS A 1 46 ? 1.395   -14.305 5.339   1.00 0.00 ? 110 LYS A CB   6  
ATOM   7345  C  CG   . LYS A 1 46 ? 2.297   -13.401 6.163   1.00 0.00 ? 110 LYS A CG   6  
ATOM   7346  C  CD   . LYS A 1 46 ? 3.655   -14.038 6.403   1.00 0.00 ? 110 LYS A CD   6  
ATOM   7347  C  CE   . LYS A 1 46 ? 3.656   -14.894 7.660   1.00 0.00 ? 110 LYS A CE   6  
ATOM   7348  N  NZ   . LYS A 1 46 ? 3.690   -14.064 8.896   1.00 0.00 ? 110 LYS A NZ   6  
ATOM   7349  H  H    . LYS A 1 46 ? -0.202  -15.296 3.607   1.00 0.00 ? 110 LYS A H    6  
ATOM   7350  H  HA   . LYS A 1 46 ? 1.287   -13.047 3.610   1.00 0.00 ? 110 LYS A HA   6  
ATOM   7351  H  HB2  . LYS A 1 46 ? 0.373   -14.127 5.638   1.00 0.00 ? 110 LYS A HB2  6  
ATOM   7352  H  HB3  . LYS A 1 46 ? 1.652   -15.331 5.559   1.00 0.00 ? 110 LYS A HB3  6  
ATOM   7353  H  HG2  . LYS A 1 46 ? 2.436   -12.469 5.636   1.00 0.00 ? 110 LYS A HG2  6  
ATOM   7354  H  HG3  . LYS A 1 46 ? 1.825   -13.211 7.117   1.00 0.00 ? 110 LYS A HG3  6  
ATOM   7355  H  HD2  . LYS A 1 46 ? 3.906   -14.661 5.557   1.00 0.00 ? 110 LYS A HD2  6  
ATOM   7356  H  HD3  . LYS A 1 46 ? 4.395   -13.257 6.509   1.00 0.00 ? 110 LYS A HD3  6  
ATOM   7357  H  HE2  . LYS A 1 46 ? 2.763   -15.499 7.668   1.00 0.00 ? 110 LYS A HE2  6  
ATOM   7358  H  HE3  . LYS A 1 46 ? 4.525   -15.535 7.643   1.00 0.00 ? 110 LYS A HE3  6  
ATOM   7359  H  HZ1  . LYS A 1 46 ? 4.610   -13.587 8.981   1.00 0.00 ? 110 LYS A HZ1  6  
ATOM   7360  H  HZ2  . LYS A 1 46 ? 3.544   -14.664 9.733   1.00 0.00 ? 110 LYS A HZ2  6  
ATOM   7361  H  HZ3  . LYS A 1 46 ? 2.940   -13.344 8.864   1.00 0.00 ? 110 LYS A HZ3  6  
ATOM   7362  N  N    . CYS A 1 47 ? 3.597   -13.367 2.808   1.00 0.00 ? 111 CYS A N    6  
ATOM   7363  C  CA   . CYS A 1 47 ? 4.965   -13.519 2.329   1.00 0.00 ? 111 CYS A CA   6  
ATOM   7364  C  C    . CYS A 1 47 ? 5.957   -12.899 3.310   1.00 0.00 ? 111 CYS A C    6  
ATOM   7365  O  O    . CYS A 1 47 ? 6.242   -11.704 3.246   1.00 0.00 ? 111 CYS A O    6  
ATOM   7366  C  CB   . CYS A 1 47 ? 5.120   -12.870 0.952   1.00 0.00 ? 111 CYS A CB   6  
ATOM   7367  S  SG   . CYS A 1 47 ? 6.775   -13.073 0.217   1.00 0.00 ? 111 CYS A SG   6  
ATOM   7368  H  H    . CYS A 1 47 ? 3.150   -12.500 2.711   1.00 0.00 ? 111 CYS A H    6  
ATOM   7369  H  HA   . CYS A 1 47 ? 5.173   -14.575 2.245   1.00 0.00 ? 111 CYS A HA   6  
ATOM   7370  H  HB2  . CYS A 1 47 ? 4.404   -13.310 0.273   1.00 0.00 ? 111 CYS A HB2  6  
ATOM   7371  H  HB3  . CYS A 1 47 ? 4.925   -11.812 1.037   1.00 0.00 ? 111 CYS A HB3  6  
ATOM   7372  N  N    . GLU A 1 48 ? 6.478   -13.722 4.215   1.00 0.00 ? 112 GLU A N    6  
ATOM   7373  C  CA   . GLU A 1 48 ? 7.437   -13.254 5.209   1.00 0.00 ? 112 GLU A CA   6  
ATOM   7374  C  C    . GLU A 1 48 ? 8.609   -12.541 4.540   1.00 0.00 ? 112 GLU A C    6  
ATOM   7375  O  O    . GLU A 1 48 ? 9.017   -11.461 4.966   1.00 0.00 ? 112 GLU A O    6  
ATOM   7376  C  CB   . GLU A 1 48 ? 7.949   -14.427 6.047   1.00 0.00 ? 112 GLU A CB   6  
ATOM   7377  C  CG   . GLU A 1 48 ? 6.866   -15.109 6.865   1.00 0.00 ? 112 GLU A CG   6  
ATOM   7378  C  CD   . GLU A 1 48 ? 7.267   -16.499 7.321   1.00 0.00 ? 112 GLU A CD   6  
ATOM   7379  O  OE1  . GLU A 1 48 ? 7.784   -17.271 6.488   1.00 0.00 ? 112 GLU A OE1  6  
ATOM   7380  O  OE2  . GLU A 1 48 ? 7.064   -16.813 8.513   1.00 0.00 ? 112 GLU A OE2  6  
ATOM   7381  H  H    . GLU A 1 48 ? 6.211   -14.664 4.214   1.00 0.00 ? 112 GLU A H    6  
ATOM   7382  H  HA   . GLU A 1 48 ? 6.929   -12.555 5.856   1.00 0.00 ? 112 GLU A HA   6  
ATOM   7383  H  HB2  . GLU A 1 48 ? 8.390   -15.160 5.388   1.00 0.00 ? 112 GLU A HB2  6  
ATOM   7384  H  HB3  . GLU A 1 48 ? 8.707   -14.064 6.725   1.00 0.00 ? 112 GLU A HB3  6  
ATOM   7385  H  HG2  . GLU A 1 48 ? 6.657   -14.507 7.737   1.00 0.00 ? 112 GLU A HG2  6  
ATOM   7386  H  HG3  . GLU A 1 48 ? 5.973   -15.188 6.262   1.00 0.00 ? 112 GLU A HG3  6  
ATOM   7387  N  N    . ARG A 1 49 ? 9.147   -13.156 3.492   1.00 0.00 ? 113 ARG A N    6  
ATOM   7388  C  CA   . ARG A 1 49 ? 10.274  -12.582 2.765   1.00 0.00 ? 113 ARG A CA   6  
ATOM   7389  C  C    . ARG A 1 49 ? 10.173  -11.060 2.720   1.00 0.00 ? 113 ARG A C    6  
ATOM   7390  O  O    . ARG A 1 49 ? 11.174  -10.358 2.866   1.00 0.00 ? 113 ARG A O    6  
ATOM   7391  C  CB   . ARG A 1 49 ? 10.329  -13.143 1.343   1.00 0.00 ? 113 ARG A CB   6  
ATOM   7392  C  CG   . ARG A 1 49 ? 10.915  -14.543 1.263   1.00 0.00 ? 113 ARG A CG   6  
ATOM   7393  C  CD   . ARG A 1 49 ? 12.410  -14.538 1.545   1.00 0.00 ? 113 ARG A CD   6  
ATOM   7394  N  NE   . ARG A 1 49 ? 13.049  -15.783 1.126   1.00 0.00 ? 113 ARG A NE   6  
ATOM   7395  C  CZ   . ARG A 1 49 ? 13.034  -16.897 1.849   1.00 0.00 ? 113 ARG A CZ   6  
ATOM   7396  N  NH1  . ARG A 1 49 ? 12.415  -16.922 3.021   1.00 0.00 ? 113 ARG A NH1  6  
ATOM   7397  N  NH2  . ARG A 1 49 ? 13.639  -17.989 1.400   1.00 0.00 ? 113 ARG A NH2  6  
ATOM   7398  H  H    . ARG A 1 49 ? 8.778   -14.016 3.200   1.00 0.00 ? 113 ARG A H    6  
ATOM   7399  H  HA   . ARG A 1 49 ? 11.179  -12.856 3.286   1.00 0.00 ? 113 ARG A HA   6  
ATOM   7400  H  HB2  . ARG A 1 49 ? 9.327   -13.172 0.941   1.00 0.00 ? 113 ARG A HB2  6  
ATOM   7401  H  HB3  . ARG A 1 49 ? 10.934  -12.488 0.735   1.00 0.00 ? 113 ARG A HB3  6  
ATOM   7402  H  HG2  . ARG A 1 49 ? 10.425  -15.171 1.992   1.00 0.00 ? 113 ARG A HG2  6  
ATOM   7403  H  HG3  . ARG A 1 49 ? 10.746  -14.937 0.272   1.00 0.00 ? 113 ARG A HG3  6  
ATOM   7404  H  HD2  . ARG A 1 49 ? 12.861  -13.716 1.011   1.00 0.00 ? 113 ARG A HD2  6  
ATOM   7405  H  HD3  . ARG A 1 49 ? 12.562  -14.405 2.605   1.00 0.00 ? 113 ARG A HD3  6  
ATOM   7406  H  HE   . ARG A 1 49 ? 13.513  -15.787 0.263   1.00 0.00 ? 113 ARG A HE   6  
ATOM   7407  H  HH11 . ARG A 1 49 ? 11.957  -16.100 3.361   1.00 0.00 ? 113 ARG A HH11 6  
ATOM   7408  H  HH12 . ARG A 1 49 ? 12.404  -17.762 3.564   1.00 0.00 ? 113 ARG A HH12 6  
ATOM   7409  H  HH21 . ARG A 1 49 ? 14.107  -17.974 0.517   1.00 0.00 ? 113 ARG A HH21 6  
ATOM   7410  H  HH22 . ARG A 1 49 ? 13.627  -18.827 1.946   1.00 0.00 ? 113 ARG A HH22 6  
ATOM   7411  N  N    . SER A 1 50 ? 8.960   -10.558 2.517   1.00 0.00 ? 114 SER A N    6  
ATOM   7412  C  CA   . SER A 1 50 ? 8.729   -9.120  2.448   1.00 0.00 ? 114 SER A CA   6  
ATOM   7413  C  C    . SER A 1 50 ? 9.406   -8.519  1.220   1.00 0.00 ? 114 SER A C    6  
ATOM   7414  O  O    . SER A 1 50 ? 10.055  -7.476  1.301   1.00 0.00 ? 114 SER A O    6  
ATOM   7415  C  CB   . SER A 1 50 ? 9.249   -8.438  3.715   1.00 0.00 ? 114 SER A CB   6  
ATOM   7416  O  OG   . SER A 1 50 ? 8.775   -7.105  3.807   1.00 0.00 ? 114 SER A OG   6  
ATOM   7417  H  H    . SER A 1 50 ? 8.202   -11.170 2.408   1.00 0.00 ? 114 SER A H    6  
ATOM   7418  H  HA   . SER A 1 50 ? 7.664   -8.958  2.373   1.00 0.00 ? 114 SER A HA   6  
ATOM   7419  H  HB2  . SER A 1 50 ? 8.912   -8.987  4.581   1.00 0.00 ? 114 SER A HB2  6  
ATOM   7420  H  HB3  . SER A 1 50 ? 10.329  -8.423  3.696   1.00 0.00 ? 114 SER A HB3  6  
ATOM   7421  H  HG   . SER A 1 50 ? 9.432   -6.562  4.248   1.00 0.00 ? 114 SER A HG   6  
ATOM   7422  N  N    . CYS A 1 51 ? 9.251   -9.186  0.081   1.00 0.00 ? 115 CYS A N    6  
ATOM   7423  C  CA   . CYS A 1 51 ? 9.847   -8.721  -1.166  1.00 0.00 ? 115 CYS A CA   6  
ATOM   7424  C  C    . CYS A 1 51 ? 9.784   -7.200  -1.264  1.00 0.00 ? 115 CYS A C    6  
ATOM   7425  O  O    . CYS A 1 51 ? 8.839   -6.574  -0.784  1.00 0.00 ? 115 CYS A O    6  
ATOM   7426  C  CB   . CYS A 1 51 ? 9.132   -9.351  -2.363  1.00 0.00 ? 115 CYS A CB   6  
ATOM   7427  S  SG   . CYS A 1 51 ? 8.810   -11.135 -2.183  1.00 0.00 ? 115 CYS A SG   6  
ATOM   7428  H  H    . CYS A 1 51 ? 8.723   -10.013 0.079   1.00 0.00 ? 115 CYS A H    6  
ATOM   7429  H  HA   . CYS A 1 51 ? 10.881  -9.027  -1.174  1.00 0.00 ? 115 CYS A HA   6  
ATOM   7430  H  HB2  . CYS A 1 51 ? 8.180   -8.858  -2.504  1.00 0.00 ? 115 CYS A HB2  6  
ATOM   7431  H  HB3  . CYS A 1 51 ? 9.736   -9.213  -3.247  1.00 0.00 ? 115 CYS A HB3  6  
ATOM   7432  N  N    . LYS A 1 52 ? 10.796  -6.610  -1.891  1.00 0.00 ? 116 LYS A N    6  
ATOM   7433  C  CA   . LYS A 1 52 ? 10.857  -5.163  -2.055  1.00 0.00 ? 116 LYS A CA   6  
ATOM   7434  C  C    . LYS A 1 52 ? 10.208  -4.736  -3.367  1.00 0.00 ? 116 LYS A C    6  
ATOM   7435  O  O    . LYS A 1 52 ? 10.748  -4.982  -4.446  1.00 0.00 ? 116 LYS A O    6  
ATOM   7436  C  CB   . LYS A 1 52 ? 12.311  -4.685  -2.013  1.00 0.00 ? 116 LYS A CB   6  
ATOM   7437  C  CG   . LYS A 1 52 ? 13.031  -5.039  -0.724  1.00 0.00 ? 116 LYS A CG   6  
ATOM   7438  C  CD   . LYS A 1 52 ? 12.512  -4.222  0.448   1.00 0.00 ? 116 LYS A CD   6  
ATOM   7439  C  CE   . LYS A 1 52 ? 13.447  -4.306  1.644   1.00 0.00 ? 116 LYS A CE   6  
ATOM   7440  N  NZ   . LYS A 1 52 ? 13.204  -3.204  2.616   1.00 0.00 ? 116 LYS A NZ   6  
ATOM   7441  H  H    . LYS A 1 52 ? 11.521  -7.163  -2.252  1.00 0.00 ? 116 LYS A H    6  
ATOM   7442  H  HA   . LYS A 1 52 ? 10.316  -4.713  -1.236  1.00 0.00 ? 116 LYS A HA   6  
ATOM   7443  H  HB2  . LYS A 1 52 ? 12.848  -5.133  -2.836  1.00 0.00 ? 116 LYS A HB2  6  
ATOM   7444  H  HB3  . LYS A 1 52 ? 12.327  -3.610  -2.126  1.00 0.00 ? 116 LYS A HB3  6  
ATOM   7445  H  HG2  . LYS A 1 52 ? 12.879  -6.087  -0.513  1.00 0.00 ? 116 LYS A HG2  6  
ATOM   7446  H  HG3  . LYS A 1 52 ? 14.087  -4.844  -0.847  1.00 0.00 ? 116 LYS A HG3  6  
ATOM   7447  H  HD2  . LYS A 1 52 ? 12.424  -3.189  0.145   1.00 0.00 ? 116 LYS A HD2  6  
ATOM   7448  H  HD3  . LYS A 1 52 ? 11.540  -4.598  0.735   1.00 0.00 ? 116 LYS A HD3  6  
ATOM   7449  H  HE2  . LYS A 1 52 ? 13.293  -5.252  2.139   1.00 0.00 ? 116 LYS A HE2  6  
ATOM   7450  H  HE3  . LYS A 1 52 ? 14.466  -4.246  1.292   1.00 0.00 ? 116 LYS A HE3  6  
ATOM   7451  H  HZ1  . LYS A 1 52 ? 14.002  -2.537  2.607   1.00 0.00 ? 116 LYS A HZ1  6  
ATOM   7452  H  HZ2  . LYS A 1 52 ? 13.101  -3.592  3.576   1.00 0.00 ? 116 LYS A HZ2  6  
ATOM   7453  H  HZ3  . LYS A 1 52 ? 12.334  -2.693  2.366   1.00 0.00 ? 116 LYS A HZ3  6  
ATOM   7454  N  N    . ILE A 1 53 ? 9.048   -4.096  -3.267  1.00 0.00 ? 117 ILE A N    6  
ATOM   7455  C  CA   . ILE A 1 53 ? 8.328   -3.633  -4.447  1.00 0.00 ? 117 ILE A CA   6  
ATOM   7456  C  C    . ILE A 1 53 ? 9.098   -2.529  -5.163  1.00 0.00 ? 117 ILE A C    6  
ATOM   7457  O  O    . ILE A 1 53 ? 9.198   -1.407  -4.668  1.00 0.00 ? 117 ILE A O    6  
ATOM   7458  C  CB   . ILE A 1 53 ? 6.926   -3.111  -4.082  1.00 0.00 ? 117 ILE A CB   6  
ATOM   7459  C  CG1  . ILE A 1 53 ? 6.120   -4.203  -3.374  1.00 0.00 ? 117 ILE A CG1  6  
ATOM   7460  C  CG2  . ILE A 1 53 ? 6.197   -2.632  -5.328  1.00 0.00 ? 117 ILE A CG2  6  
ATOM   7461  C  CD1  . ILE A 1 53 ? 5.801   -5.388  -4.259  1.00 0.00 ? 117 ILE A CD1  6  
ATOM   7462  H  H    . ILE A 1 53 ? 8.669   -3.929  -2.380  1.00 0.00 ? 117 ILE A H    6  
ATOM   7463  H  HA   . ILE A 1 53 ? 8.214   -4.472  -5.118  1.00 0.00 ? 117 ILE A HA   6  
ATOM   7464  H  HB   . ILE A 1 53 ? 7.041   -2.270  -3.416  1.00 0.00 ? 117 ILE A HB   6  
ATOM   7465  H  HG12 . ILE A 1 53 ? 6.681   -4.563  -2.527  1.00 0.00 ? 117 ILE A HG12 6  
ATOM   7466  H  HG13 . ILE A 1 53 ? 5.185   -3.784  -3.030  1.00 0.00 ? 117 ILE A HG13 6  
ATOM   7467  H  HG21 . ILE A 1 53 ? 6.370   -1.574  -5.462  1.00 0.00 ? 117 ILE A HG21 6  
ATOM   7468  H  HG22 . ILE A 1 53 ? 6.568   -3.167  -6.189  1.00 0.00 ? 117 ILE A HG22 6  
ATOM   7469  H  HG23 . ILE A 1 53 ? 5.139   -2.813  -5.219  1.00 0.00 ? 117 ILE A HG23 6  
ATOM   7470  H  HD11 . ILE A 1 53 ? 6.719   -5.792  -4.663  1.00 0.00 ? 117 ILE A HD11 6  
ATOM   7471  H  HD12 . ILE A 1 53 ? 5.301   -6.148  -3.677  1.00 0.00 ? 117 ILE A HD12 6  
ATOM   7472  H  HD13 . ILE A 1 53 ? 5.161   -5.072  -5.068  1.00 0.00 ? 117 ILE A HD13 6  
ATOM   7473  N  N    . GLN A 1 54 ? 9.638   -2.855  -6.333  1.00 0.00 ? 118 GLN A N    6  
ATOM   7474  C  CA   . GLN A 1 54 ? 10.399  -1.890  -7.118  1.00 0.00 ? 118 GLN A CA   6  
ATOM   7475  C  C    . GLN A 1 54 ? 9.739   -1.650  -8.472  1.00 0.00 ? 118 GLN A C    6  
ATOM   7476  O  O    . GLN A 1 54 ? 8.919   -2.449  -8.926  1.00 0.00 ? 118 GLN A O    6  
ATOM   7477  C  CB   . GLN A 1 54 ? 11.834  -2.380  -7.317  1.00 0.00 ? 118 GLN A CB   6  
ATOM   7478  C  CG   . GLN A 1 54 ? 12.668  -2.349  -6.046  1.00 0.00 ? 118 GLN A CG   6  
ATOM   7479  C  CD   . GLN A 1 54 ? 14.009  -3.038  -6.211  1.00 0.00 ? 118 GLN A CD   6  
ATOM   7480  O  OE1  . GLN A 1 54 ? 14.710  -2.828  -7.201  1.00 0.00 ? 118 GLN A OE1  6  
ATOM   7481  N  NE2  . GLN A 1 54 ? 14.372  -3.867  -5.239  1.00 0.00 ? 118 GLN A NE2  6  
ATOM   7482  H  H    . GLN A 1 54 ? 9.524   -3.766  -6.675  1.00 0.00 ? 118 GLN A H    6  
ATOM   7483  H  HA   . GLN A 1 54 ? 10.418  -0.960  -6.572  1.00 0.00 ? 118 GLN A HA   6  
ATOM   7484  H  HB2  . GLN A 1 54 ? 11.808  -3.396  -7.681  1.00 0.00 ? 118 GLN A HB2  6  
ATOM   7485  H  HB3  . GLN A 1 54 ? 12.317  -1.754  -8.053  1.00 0.00 ? 118 GLN A HB3  6  
ATOM   7486  H  HG2  . GLN A 1 54 ? 12.842  -1.320  -5.769  1.00 0.00 ? 118 GLN A HG2  6  
ATOM   7487  H  HG3  . GLN A 1 54 ? 12.120  -2.845  -5.259  1.00 0.00 ? 118 GLN A HG3  6  
ATOM   7488  H  HE21 . GLN A 1 54 ? 13.762  -3.986  -4.481  1.00 0.00 ? 118 GLN A HE21 6  
ATOM   7489  H  HE22 . GLN A 1 54 ? 15.233  -4.326  -5.320  1.00 0.00 ? 118 GLN A HE22 6  
ATOM   7490  N  N    . LYS A 1 55 ? 10.102  -0.544  -9.114  1.00 0.00 ? 119 LYS A N    6  
ATOM   7491  C  CA   . LYS A 1 55 ? 9.547   -0.198  -10.417 1.00 0.00 ? 119 LYS A CA   6  
ATOM   7492  C  C    . LYS A 1 55 ? 10.016  -1.180  -11.486 1.00 0.00 ? 119 LYS A C    6  
ATOM   7493  O  O    . LYS A 1 55 ? 9.233   -1.614  -12.332 1.00 0.00 ? 119 LYS A O    6  
ATOM   7494  C  CB   . LYS A 1 55 ? 9.951   1.226   -10.805 1.00 0.00 ? 119 LYS A CB   6  
ATOM   7495  C  CG   . LYS A 1 55 ? 11.450  1.410   -10.965 1.00 0.00 ? 119 LYS A CG   6  
ATOM   7496  C  CD   . LYS A 1 55 ? 11.789  2.799   -11.481 1.00 0.00 ? 119 LYS A CD   6  
ATOM   7497  C  CE   . LYS A 1 55 ? 11.482  2.932   -12.965 1.00 0.00 ? 119 LYS A CE   6  
ATOM   7498  N  NZ   . LYS A 1 55 ? 12.409  2.117   -13.798 1.00 0.00 ? 119 LYS A NZ   6  
ATOM   7499  H  H    . LYS A 1 55 ? 10.760  0.054   -8.701  1.00 0.00 ? 119 LYS A H    6  
ATOM   7500  H  HA   . LYS A 1 55 ? 8.471   -0.251  -10.344 1.00 0.00 ? 119 LYS A HA   6  
ATOM   7501  H  HB2  . LYS A 1 55 ? 9.476   1.480   -11.740 1.00 0.00 ? 119 LYS A HB2  6  
ATOM   7502  H  HB3  . LYS A 1 55 ? 9.606   1.906   -10.039 1.00 0.00 ? 119 LYS A HB3  6  
ATOM   7503  H  HG2  . LYS A 1 55 ? 11.926  1.269   -10.006 1.00 0.00 ? 119 LYS A HG2  6  
ATOM   7504  H  HG3  . LYS A 1 55 ? 11.821  0.675   -11.665 1.00 0.00 ? 119 LYS A HG3  6  
ATOM   7505  H  HD2  . LYS A 1 55 ? 11.206  3.528   -10.938 1.00 0.00 ? 119 LYS A HD2  6  
ATOM   7506  H  HD3  . LYS A 1 55 ? 12.842  2.986   -11.322 1.00 0.00 ? 119 LYS A HD3  6  
ATOM   7507  H  HE2  . LYS A 1 55 ? 10.470  2.602   -13.141 1.00 0.00 ? 119 LYS A HE2  6  
ATOM   7508  H  HE3  . LYS A 1 55 ? 11.577  3.970   -13.247 1.00 0.00 ? 119 LYS A HE3  6  
ATOM   7509  H  HZ1  . LYS A 1 55 ? 12.429  2.482   -14.772 1.00 0.00 ? 119 LYS A HZ1  6  
ATOM   7510  H  HZ2  . LYS A 1 55 ? 12.095  1.126   -13.817 1.00 0.00 ? 119 LYS A HZ2  6  
ATOM   7511  H  HZ3  . LYS A 1 55 ? 13.371  2.156   -13.405 1.00 0.00 ? 119 LYS A HZ3  6  
ATOM   7512  N  N    . LYS A 1 56 ? 11.298  -1.527  -11.443 1.00 0.00 ? 120 LYS A N    6  
ATOM   7513  C  CA   . LYS A 1 56 ? 11.871  -2.460  -12.405 1.00 0.00 ? 120 LYS A CA   6  
ATOM   7514  C  C    . LYS A 1 56 ? 11.092  -3.771  -12.423 1.00 0.00 ? 120 LYS A C    6  
ATOM   7515  O  O    . LYS A 1 56 ? 10.729  -4.274  -13.486 1.00 0.00 ? 120 LYS A O    6  
ATOM   7516  C  CB   . LYS A 1 56 ? 13.340  -2.732  -12.071 1.00 0.00 ? 120 LYS A CB   6  
ATOM   7517  C  CG   . LYS A 1 56 ? 13.961  -3.835  -12.910 1.00 0.00 ? 120 LYS A CG   6  
ATOM   7518  C  CD   . LYS A 1 56 ? 14.546  -3.290  -14.202 1.00 0.00 ? 120 LYS A CD   6  
ATOM   7519  C  CE   . LYS A 1 56 ? 13.521  -3.300  -15.326 1.00 0.00 ? 120 LYS A CE   6  
ATOM   7520  N  NZ   . LYS A 1 56 ? 13.552  -4.575  -16.094 1.00 0.00 ? 120 LYS A NZ   6  
ATOM   7521  H  H    . LYS A 1 56 ? 11.872  -1.148  -10.744 1.00 0.00 ? 120 LYS A H    6  
ATOM   7522  H  HA   . LYS A 1 56 ? 11.812  -2.006  -13.383 1.00 0.00 ? 120 LYS A HA   6  
ATOM   7523  H  HB2  . LYS A 1 56 ? 13.906  -1.826  -12.229 1.00 0.00 ? 120 LYS A HB2  6  
ATOM   7524  H  HB3  . LYS A 1 56 ? 13.413  -3.015  -11.031 1.00 0.00 ? 120 LYS A HB3  6  
ATOM   7525  H  HG2  . LYS A 1 56 ? 14.749  -4.307  -12.342 1.00 0.00 ? 120 LYS A HG2  6  
ATOM   7526  H  HG3  . LYS A 1 56 ? 13.200  -4.564  -13.149 1.00 0.00 ? 120 LYS A HG3  6  
ATOM   7527  H  HD2  . LYS A 1 56 ? 14.874  -2.275  -14.039 1.00 0.00 ? 120 LYS A HD2  6  
ATOM   7528  H  HD3  . LYS A 1 56 ? 15.389  -3.901  -14.491 1.00 0.00 ? 120 LYS A HD3  6  
ATOM   7529  H  HE2  . LYS A 1 56 ? 12.538  -3.171  -14.900 1.00 0.00 ? 120 LYS A HE2  6  
ATOM   7530  H  HE3  . LYS A 1 56 ? 13.733  -2.480  -15.996 1.00 0.00 ? 120 LYS A HE3  6  
ATOM   7531  H  HZ1  . LYS A 1 56 ? 14.502  -4.997  -16.049 1.00 0.00 ? 120 LYS A HZ1  6  
ATOM   7532  H  HZ2  . LYS A 1 56 ? 13.311  -4.398  -17.090 1.00 0.00 ? 120 LYS A HZ2  6  
ATOM   7533  H  HZ3  . LYS A 1 56 ? 12.866  -5.249  -15.698 1.00 0.00 ? 120 LYS A HZ3  6  
ATOM   7534  N  N    . ASN A 1 57 ? 10.837  -4.319  -11.240 1.00 0.00 ? 121 ASN A N    6  
ATOM   7535  C  CA   . ASN A 1 57 ? 10.100  -5.572  -11.120 1.00 0.00 ? 121 ASN A CA   6  
ATOM   7536  C  C    . ASN A 1 57 ? 8.984   -5.450  -10.088 1.00 0.00 ? 121 ASN A C    6  
ATOM   7537  O  O    . ASN A 1 57 ? 9.139   -5.864  -8.939  1.00 0.00 ? 121 ASN A O    6  
ATOM   7538  C  CB   . ASN A 1 57 ? 11.047  -6.710  -10.733 1.00 0.00 ? 121 ASN A CB   6  
ATOM   7539  C  CG   . ASN A 1 57 ? 12.185  -6.877  -11.720 1.00 0.00 ? 121 ASN A CG   6  
ATOM   7540  O  OD1  . ASN A 1 57 ? 12.046  -6.564  -12.903 1.00 0.00 ? 121 ASN A OD1  6  
ATOM   7541  N  ND2  . ASN A 1 57 ? 13.319  -7.372  -11.238 1.00 0.00 ? 121 ASN A ND2  6  
ATOM   7542  H  H    . ASN A 1 57 ? 11.153  -3.871  -10.427 1.00 0.00 ? 121 ASN A H    6  
ATOM   7543  H  HA   . ASN A 1 57 ? 9.662   -5.792  -12.082 1.00 0.00 ? 121 ASN A HA   6  
ATOM   7544  H  HB2  . ASN A 1 57 ? 11.468  -6.504  -9.759  1.00 0.00 ? 121 ASN A HB2  6  
ATOM   7545  H  HB3  . ASN A 1 57 ? 10.491  -7.635  -10.692 1.00 0.00 ? 121 ASN A HB3  6  
ATOM   7546  H  HD21 . ASN A 1 57 ? 13.357  -7.599  -10.285 1.00 0.00 ? 121 ASN A HD21 6  
ATOM   7547  H  HD22 . ASN A 1 57 ? 14.071  -7.490  -11.854 1.00 0.00 ? 121 ASN A HD22 6  
ATOM   7548  N  N    . ARG A 1 58 ? 7.859   -4.879  -10.505 1.00 0.00 ? 122 ARG A N    6  
ATOM   7549  C  CA   . ARG A 1 58 ? 6.716   -4.702  -9.617  1.00 0.00 ? 122 ARG A CA   6  
ATOM   7550  C  C    . ARG A 1 58 ? 5.817   -5.934  -9.635  1.00 0.00 ? 122 ARG A C    6  
ATOM   7551  O  O    . ARG A 1 58 ? 5.175   -6.261  -8.638  1.00 0.00 ? 122 ARG A O    6  
ATOM   7552  C  CB   . ARG A 1 58 ? 5.913   -3.465  -10.024 1.00 0.00 ? 122 ARG A CB   6  
ATOM   7553  C  CG   . ARG A 1 58 ? 5.345   -3.545  -11.432 1.00 0.00 ? 122 ARG A CG   6  
ATOM   7554  C  CD   . ARG A 1 58 ? 4.611   -2.267  -11.809 1.00 0.00 ? 122 ARG A CD   6  
ATOM   7555  N  NE   . ARG A 1 58 ? 4.084   -2.321  -13.170 1.00 0.00 ? 122 ARG A NE   6  
ATOM   7556  C  CZ   . ARG A 1 58 ? 3.826   -1.242  -13.901 1.00 0.00 ? 122 ARG A CZ   6  
ATOM   7557  N  NH1  . ARG A 1 58 ? 4.046   -0.033  -13.404 1.00 0.00 ? 122 ARG A NH1  6  
ATOM   7558  N  NH2  . ARG A 1 58 ? 3.347   -1.372  -15.132 1.00 0.00 ? 122 ARG A NH2  6  
ATOM   7559  H  H    . ARG A 1 58 ? 7.795   -4.569  -11.433 1.00 0.00 ? 122 ARG A H    6  
ATOM   7560  H  HA   . ARG A 1 58 ? 7.094   -4.561  -8.615  1.00 0.00 ? 122 ARG A HA   6  
ATOM   7561  H  HB2  . ARG A 1 58 ? 5.091   -3.340  -9.335  1.00 0.00 ? 122 ARG A HB2  6  
ATOM   7562  H  HB3  . ARG A 1 58 ? 6.555   -2.599  -9.967  1.00 0.00 ? 122 ARG A HB3  6  
ATOM   7563  H  HG2  . ARG A 1 58 ? 6.155   -3.700  -12.129 1.00 0.00 ? 122 ARG A HG2  6  
ATOM   7564  H  HG3  . ARG A 1 58 ? 4.657   -4.375  -11.485 1.00 0.00 ? 122 ARG A HG3  6  
ATOM   7565  H  HD2  . ARG A 1 58 ? 3.791   -2.123  -11.121 1.00 0.00 ? 122 ARG A HD2  6  
ATOM   7566  H  HD3  . ARG A 1 58 ? 5.297   -1.437  -11.730 1.00 0.00 ? 122 ARG A HD3  6  
ATOM   7567  H  HE   . ARG A 1 58 ? 3.914   -3.205  -13.557 1.00 0.00 ? 122 ARG A HE   6  
ATOM   7568  H  HH11 . ARG A 1 58 ? 4.407   0.068   -12.477 1.00 0.00 ? 122 ARG A HH11 6  
ATOM   7569  H  HH12 . ARG A 1 58 ? 3.852   0.778   -13.957 1.00 0.00 ? 122 ARG A HH12 6  
ATOM   7570  H  HH21 . ARG A 1 58 ? 3.180   -2.282  -15.510 1.00 0.00 ? 122 ARG A HH21 6  
ATOM   7571  H  HH22 . ARG A 1 58 ? 3.153   -0.560  -15.681 1.00 0.00 ? 122 ARG A HH22 6  
ATOM   7572  N  N    . ASN A 1 59 ? 5.776   -6.614  -10.776 1.00 0.00 ? 123 ASN A N    6  
ATOM   7573  C  CA   . ASN A 1 59 ? 4.955   -7.810  -10.925 1.00 0.00 ? 123 ASN A CA   6  
ATOM   7574  C  C    . ASN A 1 59 ? 5.699   -9.046  -10.430 1.00 0.00 ? 123 ASN A C    6  
ATOM   7575  O  O    . ASN A 1 59 ? 5.732   -10.076 -11.104 1.00 0.00 ? 123 ASN A O    6  
ATOM   7576  C  CB   . ASN A 1 59 ? 4.550   -7.997  -12.388 1.00 0.00 ? 123 ASN A CB   6  
ATOM   7577  C  CG   . ASN A 1 59 ? 3.377   -8.945  -12.547 1.00 0.00 ? 123 ASN A CG   6  
ATOM   7578  O  OD1  . ASN A 1 59 ? 2.561   -9.098  -11.638 1.00 0.00 ? 123 ASN A OD1  6  
ATOM   7579  N  ND2  . ASN A 1 59 ? 3.287   -9.587  -13.706 1.00 0.00 ? 123 ASN A ND2  6  
ATOM   7580  H  H    . ASN A 1 59 ? 6.311   -6.304  -11.537 1.00 0.00 ? 123 ASN A H    6  
ATOM   7581  H  HA   . ASN A 1 59 ? 4.065   -7.677  -10.328 1.00 0.00 ? 123 ASN A HA   6  
ATOM   7582  H  HB2  . ASN A 1 59 ? 4.272   -7.039  -12.804 1.00 0.00 ? 123 ASN A HB2  6  
ATOM   7583  H  HB3  . ASN A 1 59 ? 5.388   -8.395  -12.940 1.00 0.00 ? 123 ASN A HB3  6  
ATOM   7584  H  HD21 . ASN A 1 59 ? 3.973   -9.415  -14.385 1.00 0.00 ? 123 ASN A HD21 6  
ATOM   7585  H  HD22 . ASN A 1 59 ? 2.538   -10.205 -13.835 1.00 0.00 ? 123 ASN A HD22 6  
ATOM   7586  N  N    . LYS A 1 60 ? 6.296   -8.937  -9.248  1.00 0.00 ? 124 LYS A N    6  
ATOM   7587  C  CA   . LYS A 1 60 ? 7.039   -10.045 -8.660  1.00 0.00 ? 124 LYS A CA   6  
ATOM   7588  C  C    . LYS A 1 60 ? 6.199   -10.768 -7.612  1.00 0.00 ? 124 LYS A C    6  
ATOM   7589  O  O    . LYS A 1 60 ? 5.891   -11.952 -7.756  1.00 0.00 ? 124 LYS A O    6  
ATOM   7590  C  CB   . LYS A 1 60 ? 8.336   -9.538  -8.027  1.00 0.00 ? 124 LYS A CB   6  
ATOM   7591  C  CG   . LYS A 1 60 ? 9.367   -10.629 -7.794  1.00 0.00 ? 124 LYS A CG   6  
ATOM   7592  C  CD   . LYS A 1 60 ? 10.750  -10.048 -7.554  1.00 0.00 ? 124 LYS A CD   6  
ATOM   7593  C  CE   . LYS A 1 60 ? 10.978  -9.741  -6.081  1.00 0.00 ? 124 LYS A CE   6  
ATOM   7594  N  NZ   . LYS A 1 60 ? 11.201  -10.980 -5.285  1.00 0.00 ? 124 LYS A NZ   6  
ATOM   7595  H  H    . LYS A 1 60 ? 6.234   -8.090  -8.758  1.00 0.00 ? 124 LYS A H    6  
ATOM   7596  H  HA   . LYS A 1 60 ? 7.281   -10.739 -9.450  1.00 0.00 ? 124 LYS A HA   6  
ATOM   7597  H  HB2  . LYS A 1 60 ? 8.772   -8.793  -8.676  1.00 0.00 ? 124 LYS A HB2  6  
ATOM   7598  H  HB3  . LYS A 1 60 ? 8.104   -9.082  -7.075  1.00 0.00 ? 124 LYS A HB3  6  
ATOM   7599  H  HG2  . LYS A 1 60 ? 9.076   -11.208 -6.930  1.00 0.00 ? 124 LYS A HG2  6  
ATOM   7600  H  HG3  . LYS A 1 60 ? 9.402   -11.270 -8.664  1.00 0.00 ? 124 LYS A HG3  6  
ATOM   7601  H  HD2  . LYS A 1 60 ? 11.493  -10.760 -7.880  1.00 0.00 ? 124 LYS A HD2  6  
ATOM   7602  H  HD3  . LYS A 1 60 ? 10.851  -9.134  -8.122  1.00 0.00 ? 124 LYS A HD3  6  
ATOM   7603  H  HE2  . LYS A 1 60 ? 11.843  -9.103  -5.989  1.00 0.00 ? 124 LYS A HE2  6  
ATOM   7604  H  HE3  . LYS A 1 60 ? 10.109  -9.227  -5.696  1.00 0.00 ? 124 LYS A HE3  6  
ATOM   7605  H  HZ1  . LYS A 1 60 ? 11.118  -10.772 -4.270  1.00 0.00 ? 124 LYS A HZ1  6  
ATOM   7606  H  HZ2  . LYS A 1 60 ? 12.151  -11.359 -5.474  1.00 0.00 ? 124 LYS A HZ2  6  
ATOM   7607  H  HZ3  . LYS A 1 60 ? 10.496  -11.700 -5.540  1.00 0.00 ? 124 LYS A HZ3  6  
ATOM   7608  N  N    . CYS A 1 61 ? 5.829   -10.049 -6.557  1.00 0.00 ? 125 CYS A N    6  
ATOM   7609  C  CA   . CYS A 1 61 ? 5.023   -10.621 -5.485  1.00 0.00 ? 125 CYS A CA   6  
ATOM   7610  C  C    . CYS A 1 61 ? 3.672   -9.919  -5.386  1.00 0.00 ? 125 CYS A C    6  
ATOM   7611  O  O    . CYS A 1 61 ? 3.577   -8.707  -5.576  1.00 0.00 ? 125 CYS A O    6  
ATOM   7612  C  CB   . CYS A 1 61 ? 5.764   -10.516 -4.151  1.00 0.00 ? 125 CYS A CB   6  
ATOM   7613  S  SG   . CYS A 1 61 ? 5.079   -11.573 -2.835  1.00 0.00 ? 125 CYS A SG   6  
ATOM   7614  H  H    . CYS A 1 61 ? 6.105   -9.110  -6.498  1.00 0.00 ? 125 CYS A H    6  
ATOM   7615  H  HA   . CYS A 1 61 ? 4.858   -11.663 -5.714  1.00 0.00 ? 125 CYS A HA   6  
ATOM   7616  H  HB2  . CYS A 1 61 ? 6.796   -10.802 -4.297  1.00 0.00 ? 125 CYS A HB2  6  
ATOM   7617  H  HB3  . CYS A 1 61 ? 5.725   -9.493  -3.806  1.00 0.00 ? 125 CYS A HB3  6  
ATOM   7618  N  N    . GLN A 1 62 ? 2.631   -10.690 -5.089  1.00 0.00 ? 126 GLN A N    6  
ATOM   7619  C  CA   . GLN A 1 62 ? 1.286   -10.142 -4.965  1.00 0.00 ? 126 GLN A CA   6  
ATOM   7620  C  C    . GLN A 1 62 ? 1.023   -9.660  -3.542  1.00 0.00 ? 126 GLN A C    6  
ATOM   7621  O  O    . GLN A 1 62 ? 0.647   -8.507  -3.326  1.00 0.00 ? 126 GLN A O    6  
ATOM   7622  C  CB   . GLN A 1 62 ? 0.246   -11.192 -5.360  1.00 0.00 ? 126 GLN A CB   6  
ATOM   7623  C  CG   . GLN A 1 62 ? 0.349   -11.634 -6.811  1.00 0.00 ? 126 GLN A CG   6  
ATOM   7624  C  CD   . GLN A 1 62 ? 1.638   -12.375 -7.106  1.00 0.00 ? 126 GLN A CD   6  
ATOM   7625  O  OE1  . GLN A 1 62 ? 1.937   -13.395 -6.484  1.00 0.00 ? 126 GLN A OE1  6  
ATOM   7626  N  NE2  . GLN A 1 62 ? 2.410   -11.865 -8.058  1.00 0.00 ? 126 GLN A NE2  6  
ATOM   7627  H  H    . GLN A 1 62 ? 2.771   -11.649 -4.949  1.00 0.00 ? 126 GLN A H    6  
ATOM   7628  H  HA   . GLN A 1 62 ? 1.208   -9.301  -5.637  1.00 0.00 ? 126 GLN A HA   6  
ATOM   7629  H  HB2  . GLN A 1 62 ? 0.373   -12.061 -4.732  1.00 0.00 ? 126 GLN A HB2  6  
ATOM   7630  H  HB3  . GLN A 1 62 ? -0.740  -10.782 -5.201  1.00 0.00 ? 126 GLN A HB3  6  
ATOM   7631  H  HG2  . GLN A 1 62 ? -0.482  -12.286 -7.036  1.00 0.00 ? 126 GLN A HG2  6  
ATOM   7632  H  HG3  . GLN A 1 62 ? 0.301   -10.760 -7.444  1.00 0.00 ? 126 GLN A HG3  6  
ATOM   7633  H  HE21 . GLN A 1 62 ? 2.109   -11.049 -8.510  1.00 0.00 ? 126 GLN A HE21 6  
ATOM   7634  H  HE22 . GLN A 1 62 ? 3.250   -12.323 -8.268  1.00 0.00 ? 126 GLN A HE22 6  
ATOM   7635  N  N    . TYR A 1 63 ? 1.223   -10.548 -2.575  1.00 0.00 ? 127 TYR A N    6  
ATOM   7636  C  CA   . TYR A 1 63 ? 1.005   -10.214 -1.173  1.00 0.00 ? 127 TYR A CA   6  
ATOM   7637  C  C    . TYR A 1 63 ? 1.769   -8.951  -0.789  1.00 0.00 ? 127 TYR A C    6  
ATOM   7638  O  O    . TYR A 1 63 ? 1.181   -7.968  -0.336  1.00 0.00 ? 127 TYR A O    6  
ATOM   7639  C  CB   . TYR A 1 63 ? 1.435   -11.377 -0.277  1.00 0.00 ? 127 TYR A CB   6  
ATOM   7640  C  CG   . TYR A 1 63 ? 1.285   -11.091 1.200   1.00 0.00 ? 127 TYR A CG   6  
ATOM   7641  C  CD1  . TYR A 1 63 ? 2.323   -10.520 1.926   1.00 0.00 ? 127 TYR A CD1  6  
ATOM   7642  C  CD2  . TYR A 1 63 ? 0.106   -11.392 1.870   1.00 0.00 ? 127 TYR A CD2  6  
ATOM   7643  C  CE1  . TYR A 1 63 ? 2.191   -10.257 3.276   1.00 0.00 ? 127 TYR A CE1  6  
ATOM   7644  C  CE2  . TYR A 1 63 ? -0.036  -11.132 3.219   1.00 0.00 ? 127 TYR A CE2  6  
ATOM   7645  C  CZ   . TYR A 1 63 ? 1.010   -10.564 3.918   1.00 0.00 ? 127 TYR A CZ   6  
ATOM   7646  O  OH   . TYR A 1 63 ? 0.873   -10.305 5.262   1.00 0.00 ? 127 TYR A OH   6  
ATOM   7647  H  H    . TYR A 1 63 ? 1.522   -11.451 -2.810  1.00 0.00 ? 127 TYR A H    6  
ATOM   7648  H  HA   . TYR A 1 63 ? -0.052  -10.038 -1.034  1.00 0.00 ? 127 TYR A HA   6  
ATOM   7649  H  HB2  . TYR A 1 63 ? 0.835   -12.243 -0.509  1.00 0.00 ? 127 TYR A HB2  6  
ATOM   7650  H  HB3  . TYR A 1 63 ? 2.474   -11.603 -0.468  1.00 0.00 ? 127 TYR A HB3  6  
ATOM   7651  H  HD1  . TYR A 1 63 ? 3.247   -10.280 1.420   1.00 0.00 ? 127 TYR A HD1  6  
ATOM   7652  H  HD2  . TYR A 1 63 ? -0.711  -11.837 1.320   1.00 0.00 ? 127 TYR A HD2  6  
ATOM   7653  H  HE1  . TYR A 1 63 ? 3.009   -9.812  3.823   1.00 0.00 ? 127 TYR A HE1  6  
ATOM   7654  H  HE2  . TYR A 1 63 ? -0.960  -11.373 3.722   1.00 0.00 ? 127 TYR A HE2  6  
ATOM   7655  H  HH   . TYR A 1 63 ? 0.640   -11.114 5.722   1.00 0.00 ? 127 TYR A HH   6  
ATOM   7656  N  N    . CYS A 1 64 ? 3.084   -8.985  -0.973  1.00 0.00 ? 128 CYS A N    6  
ATOM   7657  C  CA   . CYS A 1 64 ? 3.932   -7.844  -0.647  1.00 0.00 ? 128 CYS A CA   6  
ATOM   7658  C  C    . CYS A 1 64 ? 3.398   -6.568  -1.290  1.00 0.00 ? 128 CYS A C    6  
ATOM   7659  O  O    . CYS A 1 64 ? 3.266   -5.536  -0.630  1.00 0.00 ? 128 CYS A O    6  
ATOM   7660  C  CB   . CYS A 1 64 ? 5.368   -8.100  -1.110  1.00 0.00 ? 128 CYS A CB   6  
ATOM   7661  S  SG   . CYS A 1 64 ? 6.269   -9.318  -0.100  1.00 0.00 ? 128 CYS A SG   6  
ATOM   7662  H  H    . CYS A 1 64 ? 3.496   -9.797  -1.337  1.00 0.00 ? 128 CYS A H    6  
ATOM   7663  H  HA   . CYS A 1 64 ? 3.926   -7.722  0.426   1.00 0.00 ? 128 CYS A HA   6  
ATOM   7664  H  HB2  . CYS A 1 64 ? 5.349   -8.466  -2.127  1.00 0.00 ? 128 CYS A HB2  6  
ATOM   7665  H  HB3  . CYS A 1 64 ? 5.919   -7.172  -1.078  1.00 0.00 ? 128 CYS A HB3  6  
ATOM   7666  N  N    . ARG A 1 65 ? 3.093   -6.645  -2.581  1.00 0.00 ? 129 ARG A N    6  
ATOM   7667  C  CA   . ARG A 1 65 ? 2.574   -5.497  -3.314  1.00 0.00 ? 129 ARG A CA   6  
ATOM   7668  C  C    . ARG A 1 65 ? 1.358   -4.905  -2.607  1.00 0.00 ? 129 ARG A C    6  
ATOM   7669  O  O    . ARG A 1 65 ? 1.322   -3.712  -2.304  1.00 0.00 ? 129 ARG A O    6  
ATOM   7670  C  CB   . ARG A 1 65 ? 2.200   -5.902  -4.741  1.00 0.00 ? 129 ARG A CB   6  
ATOM   7671  C  CG   . ARG A 1 65 ? 1.559   -4.782  -5.544  1.00 0.00 ? 129 ARG A CG   6  
ATOM   7672  C  CD   . ARG A 1 65 ? 2.606   -3.916  -6.228  1.00 0.00 ? 129 ARG A CD   6  
ATOM   7673  N  NE   . ARG A 1 65 ? 3.008   -4.463  -7.521  1.00 0.00 ? 129 ARG A NE   6  
ATOM   7674  C  CZ   . ARG A 1 65 ? 2.282   -4.342  -8.627  1.00 0.00 ? 129 ARG A CZ   6  
ATOM   7675  N  NH1  . ARG A 1 65 ? 1.125   -3.697  -8.598  1.00 0.00 ? 129 ARG A NH1  6  
ATOM   7676  N  NH2  . ARG A 1 65 ? 2.715   -4.867  -9.767  1.00 0.00 ? 129 ARG A NH2  6  
ATOM   7677  H  H    . ARG A 1 65 ? 3.220   -7.495  -3.052  1.00 0.00 ? 129 ARG A H    6  
ATOM   7678  H  HA   . ARG A 1 65 ? 3.352   -4.749  -3.353  1.00 0.00 ? 129 ARG A HA   6  
ATOM   7679  H  HB2  . ARG A 1 65 ? 3.094   -6.219  -5.258  1.00 0.00 ? 129 ARG A HB2  6  
ATOM   7680  H  HB3  . ARG A 1 65 ? 1.507   -6.727  -4.698  1.00 0.00 ? 129 ARG A HB3  6  
ATOM   7681  H  HG2  . ARG A 1 65 ? 0.917   -5.214  -6.297  1.00 0.00 ? 129 ARG A HG2  6  
ATOM   7682  H  HG3  . ARG A 1 65 ? 0.973   -4.165  -4.879  1.00 0.00 ? 129 ARG A HG3  6  
ATOM   7683  H  HD2  . ARG A 1 65 ? 2.196   -2.929  -6.377  1.00 0.00 ? 129 ARG A HD2  6  
ATOM   7684  H  HD3  . ARG A 1 65 ? 3.474   -3.853  -5.589  1.00 0.00 ? 129 ARG A HD3  6  
ATOM   7685  H  HE   . ARG A 1 65 ? 3.860   -4.943  -7.566  1.00 0.00 ? 129 ARG A HE   6  
ATOM   7686  H  HH11 . ARG A 1 65 ? 0.796   -3.300  -7.741  1.00 0.00 ? 129 ARG A HH11 6  
ATOM   7687  H  HH12 . ARG A 1 65 ? 0.581   -3.606  -9.432  1.00 0.00 ? 129 ARG A HH12 6  
ATOM   7688  H  HH21 . ARG A 1 65 ? 3.588   -5.354  -9.793  1.00 0.00 ? 129 ARG A HH21 6  
ATOM   7689  H  HH22 . ARG A 1 65 ? 2.169   -4.776  -10.599 1.00 0.00 ? 129 ARG A HH22 6  
ATOM   7690  N  N    . PHE A 1 66 ? 0.363   -5.747  -2.348  1.00 0.00 ? 130 PHE A N    6  
ATOM   7691  C  CA   . PHE A 1 66 ? -0.856  -5.307  -1.678  1.00 0.00 ? 130 PHE A CA   6  
ATOM   7692  C  C    . PHE A 1 66 ? -0.548  -4.779  -0.280  1.00 0.00 ? 130 PHE A C    6  
ATOM   7693  O  O    . PHE A 1 66 ? -0.844  -3.628  0.038   1.00 0.00 ? 130 PHE A O    6  
ATOM   7694  C  CB   . PHE A 1 66 ? -1.859  -6.459  -1.591  1.00 0.00 ? 130 PHE A CB   6  
ATOM   7695  C  CG   . PHE A 1 66 ? -3.161  -6.072  -0.950  1.00 0.00 ? 130 PHE A CG   6  
ATOM   7696  C  CD1  . PHE A 1 66 ? -4.027  -5.196  -1.584  1.00 0.00 ? 130 PHE A CD1  6  
ATOM   7697  C  CD2  . PHE A 1 66 ? -3.519  -6.585  0.287   1.00 0.00 ? 130 PHE A CD2  6  
ATOM   7698  C  CE1  . PHE A 1 66 ? -5.227  -4.839  -0.997  1.00 0.00 ? 130 PHE A CE1  6  
ATOM   7699  C  CE2  . PHE A 1 66 ? -4.717  -6.231  0.878   1.00 0.00 ? 130 PHE A CE2  6  
ATOM   7700  C  CZ   . PHE A 1 66 ? -5.571  -5.356  0.236   1.00 0.00 ? 130 PHE A CZ   6  
ATOM   7701  H  H    . PHE A 1 66 ? 0.450   -6.686  -2.614  1.00 0.00 ? 130 PHE A H    6  
ATOM   7702  H  HA   . PHE A 1 66 ? -1.286  -4.510  -2.264  1.00 0.00 ? 130 PHE A HA   6  
ATOM   7703  H  HB2  . PHE A 1 66 ? -2.073  -6.817  -2.587  1.00 0.00 ? 130 PHE A HB2  6  
ATOM   7704  H  HB3  . PHE A 1 66 ? -1.427  -7.260  -1.010  1.00 0.00 ? 130 PHE A HB3  6  
ATOM   7705  H  HD1  . PHE A 1 66 ? -3.758  -4.791  -2.549  1.00 0.00 ? 130 PHE A HD1  6  
ATOM   7706  H  HD2  . PHE A 1 66 ? -2.851  -7.268  0.791   1.00 0.00 ? 130 PHE A HD2  6  
ATOM   7707  H  HE1  . PHE A 1 66 ? -5.892  -4.154  -1.502  1.00 0.00 ? 130 PHE A HE1  6  
ATOM   7708  H  HE2  . PHE A 1 66 ? -4.984  -6.637  1.843   1.00 0.00 ? 130 PHE A HE2  6  
ATOM   7709  H  HZ   . PHE A 1 66 ? -6.508  -5.079  0.696   1.00 0.00 ? 130 PHE A HZ   6  
ATOM   7710  N  N    . GLN A 1 67 ? 0.048   -5.630  0.550   1.00 0.00 ? 131 GLN A N    6  
ATOM   7711  C  CA   . GLN A 1 67 ? 0.395   -5.249  1.914   1.00 0.00 ? 131 GLN A CA   6  
ATOM   7712  C  C    . GLN A 1 67 ? 0.962   -3.834  1.957   1.00 0.00 ? 131 GLN A C    6  
ATOM   7713  O  O    . GLN A 1 67 ? 0.558   -3.017  2.785   1.00 0.00 ? 131 GLN A O    6  
ATOM   7714  C  CB   . GLN A 1 67 ? 1.408   -6.235  2.499   1.00 0.00 ? 131 GLN A CB   6  
ATOM   7715  C  CG   . GLN A 1 67 ? 0.775   -7.501  3.054   1.00 0.00 ? 131 GLN A CG   6  
ATOM   7716  C  CD   . GLN A 1 67 ? -0.476  -7.220  3.864   1.00 0.00 ? 131 GLN A CD   6  
ATOM   7717  O  OE1  . GLN A 1 67 ? -1.586  -7.215  3.331   1.00 0.00 ? 131 GLN A OE1  6  
ATOM   7718  N  NE2  . GLN A 1 67 ? -0.302  -6.986  5.159   1.00 0.00 ? 131 GLN A NE2  6  
ATOM   7719  H  H    . GLN A 1 67 ? 0.259   -6.534  0.237   1.00 0.00 ? 131 GLN A H    6  
ATOM   7720  H  HA   . GLN A 1 67 ? -0.507  -5.281  2.506   1.00 0.00 ? 131 GLN A HA   6  
ATOM   7721  H  HB2  . GLN A 1 67 ? 2.106   -6.517  1.725   1.00 0.00 ? 131 GLN A HB2  6  
ATOM   7722  H  HB3  . GLN A 1 67 ? 1.947   -5.748  3.298   1.00 0.00 ? 131 GLN A HB3  6  
ATOM   7723  H  HG2  . GLN A 1 67 ? 0.513   -8.149  2.230   1.00 0.00 ? 131 GLN A HG2  6  
ATOM   7724  H  HG3  . GLN A 1 67 ? 1.493   -7.998  3.688   1.00 0.00 ? 131 GLN A HG3  6  
ATOM   7725  H  HE21 . GLN A 1 67 ? 0.612   -7.005  5.514   1.00 0.00 ? 131 GLN A HE21 6  
ATOM   7726  H  HE22 . GLN A 1 67 ? -1.093  -6.801  5.706   1.00 0.00 ? 131 GLN A HE22 6  
ATOM   7727  N  N    . LYS A 1 68 ? 1.900   -3.550  1.060   1.00 0.00 ? 132 LYS A N    6  
ATOM   7728  C  CA   . LYS A 1 68 ? 2.523   -2.234  0.994   1.00 0.00 ? 132 LYS A CA   6  
ATOM   7729  C  C    . LYS A 1 68 ? 1.467   -1.133  0.971   1.00 0.00 ? 132 LYS A C    6  
ATOM   7730  O  O    . LYS A 1 68 ? 1.487   -0.223  1.800   1.00 0.00 ? 132 LYS A O    6  
ATOM   7731  C  CB   . LYS A 1 68 ? 3.412   -2.129  -0.247  1.00 0.00 ? 132 LYS A CB   6  
ATOM   7732  C  CG   . LYS A 1 68 ? 4.054   -0.764  -0.422  1.00 0.00 ? 132 LYS A CG   6  
ATOM   7733  C  CD   . LYS A 1 68 ? 5.187   -0.806  -1.434  1.00 0.00 ? 132 LYS A CD   6  
ATOM   7734  C  CE   . LYS A 1 68 ? 6.205   0.295   -1.178  1.00 0.00 ? 132 LYS A CE   6  
ATOM   7735  N  NZ   . LYS A 1 68 ? 6.924   0.097   0.111   1.00 0.00 ? 132 LYS A NZ   6  
ATOM   7736  H  H    . LYS A 1 68 ? 2.180   -4.244  0.426   1.00 0.00 ? 132 LYS A H    6  
ATOM   7737  H  HA   . LYS A 1 68 ? 3.134   -2.111  1.875   1.00 0.00 ? 132 LYS A HA   6  
ATOM   7738  H  HB2  . LYS A 1 68 ? 4.197   -2.867  -0.177  1.00 0.00 ? 132 LYS A HB2  6  
ATOM   7739  H  HB3  . LYS A 1 68 ? 2.813   -2.336  -1.123  1.00 0.00 ? 132 LYS A HB3  6  
ATOM   7740  H  HG2  . LYS A 1 68 ? 3.306   -0.064  -0.764  1.00 0.00 ? 132 LYS A HG2  6  
ATOM   7741  H  HG3  . LYS A 1 68 ? 4.447   -0.436  0.531   1.00 0.00 ? 132 LYS A HG3  6  
ATOM   7742  H  HD2  . LYS A 1 68 ? 5.683   -1.762  -1.367  1.00 0.00 ? 132 LYS A HD2  6  
ATOM   7743  H  HD3  . LYS A 1 68 ? 4.776   -0.680  -2.426  1.00 0.00 ? 132 LYS A HD3  6  
ATOM   7744  H  HE2  . LYS A 1 68 ? 6.922   0.299   -1.984  1.00 0.00 ? 132 LYS A HE2  6  
ATOM   7745  H  HE3  . LYS A 1 68 ? 5.690   1.244   -1.151  1.00 0.00 ? 132 LYS A HE3  6  
ATOM   7746  H  HZ1  . LYS A 1 68 ? 7.087   -0.917  0.277   1.00 0.00 ? 132 LYS A HZ1  6  
ATOM   7747  H  HZ2  . LYS A 1 68 ? 6.360   0.480   0.897   1.00 0.00 ? 132 LYS A HZ2  6  
ATOM   7748  H  HZ3  . LYS A 1 68 ? 7.841   0.585   0.087   1.00 0.00 ? 132 LYS A HZ3  6  
ATOM   7749  N  N    . CYS A 1 69 ? 0.546   -1.223  0.018   1.00 0.00 ? 133 CYS A N    6  
ATOM   7750  C  CA   . CYS A 1 69 ? -0.519  -0.235  -0.112  1.00 0.00 ? 133 CYS A CA   6  
ATOM   7751  C  C    . CYS A 1 69 ? -1.133  0.085   1.247   1.00 0.00 ? 133 CYS A C    6  
ATOM   7752  O  O    . CYS A 1 69 ? -1.295  1.251   1.608   1.00 0.00 ? 133 CYS A O    6  
ATOM   7753  C  CB   . CYS A 1 69 ? -1.600  -0.742  -1.067  1.00 0.00 ? 133 CYS A CB   6  
ATOM   7754  S  SG   . CYS A 1 69 ? -1.082  -0.811  -2.798  1.00 0.00 ? 133 CYS A SG   6  
ATOM   7755  H  H    . CYS A 1 69 ? 0.583   -1.972  -0.614  1.00 0.00 ? 133 CYS A H    6  
ATOM   7756  H  HA   . CYS A 1 69 ? -0.085  0.666   -0.519  1.00 0.00 ? 133 CYS A HA   6  
ATOM   7757  H  HB2  . CYS A 1 69 ? -1.891  -1.740  -0.772  1.00 0.00 ? 133 CYS A HB2  6  
ATOM   7758  H  HB3  . CYS A 1 69 ? -2.459  -0.091  -1.005  1.00 0.00 ? 133 CYS A HB3  6  
ATOM   7759  H  HG   . CYS A 1 69 ? -0.401  -1.933  -2.977  1.00 0.00 ? 133 CYS A HG   6  
ATOM   7760  N  N    . LEU A 1 70 ? -1.475  -0.958  1.996   1.00 0.00 ? 134 LEU A N    6  
ATOM   7761  C  CA   . LEU A 1 70 ? -2.073  -0.789  3.315   1.00 0.00 ? 134 LEU A CA   6  
ATOM   7762  C  C    . LEU A 1 70 ? -1.201  0.097   4.199   1.00 0.00 ? 134 LEU A C    6  
ATOM   7763  O  O    . LEU A 1 70 ? -1.687  1.045   4.816   1.00 0.00 ? 134 LEU A O    6  
ATOM   7764  C  CB   . LEU A 1 70 ? -2.278  -2.150  3.982   1.00 0.00 ? 134 LEU A CB   6  
ATOM   7765  C  CG   . LEU A 1 70 ? -3.104  -3.166  3.193   1.00 0.00 ? 134 LEU A CG   6  
ATOM   7766  C  CD1  . LEU A 1 70 ? -3.112  -4.512  3.901   1.00 0.00 ? 134 LEU A CD1  6  
ATOM   7767  C  CD2  . LEU A 1 70 ? -4.524  -2.659  2.992   1.00 0.00 ? 134 LEU A CD2  6  
ATOM   7768  H  H    . LEU A 1 70 ? -1.321  -1.863  1.654   1.00 0.00 ? 134 LEU A H    6  
ATOM   7769  H  HA   . LEU A 1 70 ? -3.033  -0.312  3.185   1.00 0.00 ? 134 LEU A HA   6  
ATOM   7770  H  HB2  . LEU A 1 70 ? -1.305  -2.581  4.160   1.00 0.00 ? 134 LEU A HB2  6  
ATOM   7771  H  HB3  . LEU A 1 70 ? -2.774  -1.982  4.928   1.00 0.00 ? 134 LEU A HB3  6  
ATOM   7772  H  HG   . LEU A 1 70 ? -2.656  -3.305  2.218   1.00 0.00 ? 134 LEU A HG   6  
ATOM   7773  H  HD11 . LEU A 1 70 ? -3.085  -5.305  3.168   1.00 0.00 ? 134 LEU A HD11 6  
ATOM   7774  H  HD12 . LEU A 1 70 ? -4.009  -4.601  4.495   1.00 0.00 ? 134 LEU A HD12 6  
ATOM   7775  H  HD13 . LEU A 1 70 ? -2.246  -4.586  4.544   1.00 0.00 ? 134 LEU A HD13 6  
ATOM   7776  H  HD21 . LEU A 1 70 ? -4.764  -1.944  3.765   1.00 0.00 ? 134 LEU A HD21 6  
ATOM   7777  H  HD22 . LEU A 1 70 ? -5.213  -3.489  3.043   1.00 0.00 ? 134 LEU A HD22 6  
ATOM   7778  H  HD23 . LEU A 1 70 ? -4.603  -2.184  2.025   1.00 0.00 ? 134 LEU A HD23 6  
ATOM   7779  N  N    . ALA A 1 71 ? 0.089   -0.217  4.254   1.00 0.00 ? 135 ALA A N    6  
ATOM   7780  C  CA   . ALA A 1 71 ? 1.030   0.553   5.058   1.00 0.00 ? 135 ALA A CA   6  
ATOM   7781  C  C    . ALA A 1 71 ? 1.132   1.990   4.558   1.00 0.00 ? 135 ALA A C    6  
ATOM   7782  O  O    . ALA A 1 71 ? 1.286   2.923   5.347   1.00 0.00 ? 135 ALA A O    6  
ATOM   7783  C  CB   . ALA A 1 71 ? 2.399   -0.110  5.048   1.00 0.00 ? 135 ALA A CB   6  
ATOM   7784  H  H    . ALA A 1 71 ? 0.416   -0.984  3.739   1.00 0.00 ? 135 ALA A H    6  
ATOM   7785  H  HA   . ALA A 1 71 ? 0.668   0.562   6.077   1.00 0.00 ? 135 ALA A HA   6  
ATOM   7786  H  HB1  . ALA A 1 71 ? 2.348   -1.032  4.488   1.00 0.00 ? 135 ALA A HB1  6  
ATOM   7787  H  HB2  . ALA A 1 71 ? 3.116   0.553   4.587   1.00 0.00 ? 135 ALA A HB2  6  
ATOM   7788  H  HB3  . ALA A 1 71 ? 2.704   -0.321  6.063   1.00 0.00 ? 135 ALA A HB3  6  
ATOM   7789  N  N    . LEU A 1 72 ? 1.046   2.161   3.243   1.00 0.00 ? 136 LEU A N    6  
ATOM   7790  C  CA   . LEU A 1 72 ? 1.130   3.486   2.637   1.00 0.00 ? 136 LEU A CA   6  
ATOM   7791  C  C    . LEU A 1 72 ? -0.007  4.379   3.122   1.00 0.00 ? 136 LEU A C    6  
ATOM   7792  O  O    . LEU A 1 72 ? 0.119   5.603   3.148   1.00 0.00 ? 136 LEU A O    6  
ATOM   7793  C  CB   . LEU A 1 72 ? 1.091   3.373   1.112   1.00 0.00 ? 136 LEU A CB   6  
ATOM   7794  C  CG   . LEU A 1 72 ? 2.307   2.719   0.456   1.00 0.00 ? 136 LEU A CG   6  
ATOM   7795  C  CD1  . LEU A 1 72 ? 2.104   2.602   -1.047  1.00 0.00 ? 136 LEU A CD1  6  
ATOM   7796  C  CD2  . LEU A 1 72 ? 3.570   3.510   0.765   1.00 0.00 ? 136 LEU A CD2  6  
ATOM   7797  H  H    . LEU A 1 72 ? 0.924   1.380   2.666   1.00 0.00 ? 136 LEU A H    6  
ATOM   7798  H  HA   . LEU A 1 72 ? 2.070   3.927   2.934   1.00 0.00 ? 136 LEU A HA   6  
ATOM   7799  H  HB2  . LEU A 1 72 ? 0.220   2.794   0.845   1.00 0.00 ? 136 LEU A HB2  6  
ATOM   7800  H  HB3  . LEU A 1 72 ? 0.994   4.372   0.710   1.00 0.00 ? 136 LEU A HB3  6  
ATOM   7801  H  HG   . LEU A 1 72 ? 2.430   1.722   0.854   1.00 0.00 ? 136 LEU A HG   6  
ATOM   7802  H  HD11 . LEU A 1 72 ? 1.110   2.935   -1.303  1.00 0.00 ? 136 LEU A HD11 6  
ATOM   7803  H  HD12 . LEU A 1 72 ? 2.228   1.572   -1.348  1.00 0.00 ? 136 LEU A HD12 6  
ATOM   7804  H  HD13 . LEU A 1 72 ? 2.833   3.216   -1.557  1.00 0.00 ? 136 LEU A HD13 6  
ATOM   7805  H  HD21 . LEU A 1 72 ? 4.217   3.508   -0.099  1.00 0.00 ? 136 LEU A HD21 6  
ATOM   7806  H  HD22 . LEU A 1 72 ? 4.083   3.056   1.601   1.00 0.00 ? 136 LEU A HD22 6  
ATOM   7807  H  HD23 . LEU A 1 72 ? 3.305   4.527   1.015   1.00 0.00 ? 136 LEU A HD23 6  
ATOM   7808  N  N    . GLY A 1 73 ? -1.118  3.759   3.507   1.00 0.00 ? 137 GLY A N    6  
ATOM   7809  C  CA   . GLY A 1 73 ? -2.261  4.513   3.988   1.00 0.00 ? 137 GLY A CA   6  
ATOM   7810  C  C    . GLY A 1 73 ? -3.406  4.526   2.996   1.00 0.00 ? 137 GLY A C    6  
ATOM   7811  O  O    . GLY A 1 73 ? -4.181  5.481   2.945   1.00 0.00 ? 137 GLY A O    6  
ATOM   7812  H  H    . GLY A 1 73 ? -1.162  2.780   3.465   1.00 0.00 ? 137 GLY A H    6  
ATOM   7813  H  HA2  . GLY A 1 73 ? -2.604  4.074   4.913   1.00 0.00 ? 137 GLY A HA2  6  
ATOM   7814  H  HA3  . GLY A 1 73 ? -1.952  5.531   4.177   1.00 0.00 ? 137 GLY A HA3  6  
ATOM   7815  N  N    . MET A 1 74 ? -3.513  3.464   2.204   1.00 0.00 ? 138 MET A N    6  
ATOM   7816  C  CA   . MET A 1 74 ? -4.573  3.357   1.208   1.00 0.00 ? 138 MET A CA   6  
ATOM   7817  C  C    . MET A 1 74 ? -5.909  3.032   1.868   1.00 0.00 ? 138 MET A C    6  
ATOM   7818  O  O    . MET A 1 74 ? -6.143  1.900   2.292   1.00 0.00 ? 138 MET A O    6  
ATOM   7819  C  CB   . MET A 1 74 ? -4.226  2.283   0.176   1.00 0.00 ? 138 MET A CB   6  
ATOM   7820  C  CG   . MET A 1 74 ? -3.278  2.768   -0.910  1.00 0.00 ? 138 MET A CG   6  
ATOM   7821  S  SD   . MET A 1 74 ? -3.479  1.867   -2.459  1.00 0.00 ? 138 MET A SD   6  
ATOM   7822  C  CE   . MET A 1 74 ? -3.219  3.180   -3.650  1.00 0.00 ? 138 MET A CE   6  
ATOM   7823  H  H    . MET A 1 74 ? -2.865  2.734   2.292   1.00 0.00 ? 138 MET A H    6  
ATOM   7824  H  HA   . MET A 1 74 ? -4.654  4.311   0.709   1.00 0.00 ? 138 MET A HA   6  
ATOM   7825  H  HB2  . MET A 1 74 ? -3.762  1.450   0.682   1.00 0.00 ? 138 MET A HB2  6  
ATOM   7826  H  HB3  . MET A 1 74 ? -5.136  1.946   -0.296  1.00 0.00 ? 138 MET A HB3  6  
ATOM   7827  H  HG2  . MET A 1 74 ? -3.466  3.815   -1.093  1.00 0.00 ? 138 MET A HG2  6  
ATOM   7828  H  HG3  . MET A 1 74 ? -2.263  2.641   -0.565  1.00 0.00 ? 138 MET A HG3  6  
ATOM   7829  H  HE1  . MET A 1 74 ? -2.159  3.320   -3.805  1.00 0.00 ? 138 MET A HE1  6  
ATOM   7830  H  HE2  . MET A 1 74 ? -3.688  2.916   -4.586  1.00 0.00 ? 138 MET A HE2  6  
ATOM   7831  H  HE3  . MET A 1 74 ? -3.652  4.096   -3.276  1.00 0.00 ? 138 MET A HE3  6  
ATOM   7832  N  N    . SER A 1 75 ? -6.782  4.031   1.952   1.00 0.00 ? 139 SER A N    6  
ATOM   7833  C  CA   . SER A 1 75 ? -8.093  3.851   2.564   1.00 0.00 ? 139 SER A CA   6  
ATOM   7834  C  C    . SER A 1 75 ? -8.975  2.951   1.704   1.00 0.00 ? 139 SER A C    6  
ATOM   7835  O  O    . SER A 1 75 ? -9.322  3.298   0.574   1.00 0.00 ? 139 SER A O    6  
ATOM   7836  C  CB   . SER A 1 75 ? -8.773  5.205   2.770   1.00 0.00 ? 139 SER A CB   6  
ATOM   7837  O  OG   . SER A 1 75 ? -8.851  5.928   1.553   1.00 0.00 ? 139 SER A OG   6  
ATOM   7838  H  H    . SER A 1 75 ? -6.537  4.910   1.595   1.00 0.00 ? 139 SER A H    6  
ATOM   7839  H  HA   . SER A 1 75 ? -7.948  3.380   3.525   1.00 0.00 ? 139 SER A HA   6  
ATOM   7840  H  HB2  . SER A 1 75 ? -9.773  5.050   3.146   1.00 0.00 ? 139 SER A HB2  6  
ATOM   7841  H  HB3  . SER A 1 75 ? -8.206  5.785   3.484   1.00 0.00 ? 139 SER A HB3  6  
ATOM   7842  H  HG   . SER A 1 75 ? -9.070  6.844   1.737   1.00 0.00 ? 139 SER A HG   6  
ATOM   7843  N  N    . HIS A 1 76 ? -9.336  1.793   2.247   1.00 0.00 ? 140 HIS A N    6  
ATOM   7844  C  CA   . HIS A 1 76 ? -10.179 0.842   1.530   1.00 0.00 ? 140 HIS A CA   6  
ATOM   7845  C  C    . HIS A 1 76 ? -11.607 1.365   1.410   1.00 0.00 ? 140 HIS A C    6  
ATOM   7846  O  O    . HIS A 1 76 ? -12.206 1.321   0.337   1.00 0.00 ? 140 HIS A O    6  
ATOM   7847  C  CB   . HIS A 1 76 ? -10.177 -0.511  2.242   1.00 0.00 ? 140 HIS A CB   6  
ATOM   7848  C  CG   . HIS A 1 76 ? -10.976 -0.522  3.509   1.00 0.00 ? 140 HIS A CG   6  
ATOM   7849  N  ND1  . HIS A 1 76 ? -10.623 0.202   4.628   1.00 0.00 ? 140 HIS A ND1  6  
ATOM   7850  C  CD2  . HIS A 1 76 ? -12.119 -1.174  3.829   1.00 0.00 ? 140 HIS A CD2  6  
ATOM   7851  C  CE1  . HIS A 1 76 ? -11.513 -0.005  5.583   1.00 0.00 ? 140 HIS A CE1  6  
ATOM   7852  N  NE2  . HIS A 1 76 ? -12.431 -0.836  5.123   1.00 0.00 ? 140 HIS A NE2  6  
ATOM   7853  H  H    . HIS A 1 76 ? -9.028  1.572   3.150   1.00 0.00 ? 140 HIS A H    6  
ATOM   7854  H  HA   . HIS A 1 76 ? -9.770  0.718   0.539   1.00 0.00 ? 140 HIS A HA   6  
ATOM   7855  H  HB2  . HIS A 1 76 ? -10.592 -1.258  1.582   1.00 0.00 ? 140 HIS A HB2  6  
ATOM   7856  H  HB3  . HIS A 1 76 ? -9.160  -0.780  2.488   1.00 0.00 ? 140 HIS A HB3  6  
ATOM   7857  H  HD1  . HIS A 1 76 ? -9.837  0.780   4.711   1.00 0.00 ? 140 HIS A HD1  6  
ATOM   7858  H  HD2  . HIS A 1 76 ? -12.681 -1.838  3.187   1.00 0.00 ? 140 HIS A HD2  6  
ATOM   7859  H  HE1  . HIS A 1 76 ? -11.493 0.430   6.570   1.00 0.00 ? 140 HIS A HE1  6  
ATOM   7860  N  N    . ASN A 1 77 ? -12.146 1.860   2.520   1.00 0.00 ? 141 ASN A N    6  
ATOM   7861  C  CA   . ASN A 1 77 ? -13.505 2.390   2.539   1.00 0.00 ? 141 ASN A CA   6  
ATOM   7862  C  C    . ASN A 1 77 ? -13.788 3.207   1.281   1.00 0.00 ? 141 ASN A C    6  
ATOM   7863  O  O    . ASN A 1 77 ? -14.819 3.030   0.633   1.00 0.00 ? 141 ASN A O    6  
ATOM   7864  C  CB   . ASN A 1 77 ? -13.719 3.256   3.782   1.00 0.00 ? 141 ASN A CB   6  
ATOM   7865  C  CG   . ASN A 1 77 ? -13.097 4.632   3.642   1.00 0.00 ? 141 ASN A CG   6  
ATOM   7866  O  OD1  . ASN A 1 77 ? -13.738 5.571   3.170   1.00 0.00 ? 141 ASN A OD1  6  
ATOM   7867  N  ND2  . ASN A 1 77 ? -11.840 4.757   4.054   1.00 0.00 ? 141 ASN A ND2  6  
ATOM   7868  H  H    . ASN A 1 77 ? -11.619 1.868   3.345   1.00 0.00 ? 141 ASN A H    6  
ATOM   7869  H  HA   . ASN A 1 77 ? -14.187 1.554   2.572   1.00 0.00 ? 141 ASN A HA   6  
ATOM   7870  H  HB2  . ASN A 1 77 ? -14.779 3.378   3.950   1.00 0.00 ? 141 ASN A HB2  6  
ATOM   7871  H  HB3  . ASN A 1 77 ? -13.277 2.766   4.636   1.00 0.00 ? 141 ASN A HB3  6  
ATOM   7872  H  HD21 . ASN A 1 77 ? -11.392 3.966   4.420   1.00 0.00 ? 141 ASN A HD21 6  
ATOM   7873  H  HD22 . ASN A 1 77 ? -11.413 5.636   3.976   1.00 0.00 ? 141 ASN A HD22 6  
ATOM   7874  N  N    . ALA A 1 78 ? -12.864 4.100   0.943   1.00 0.00 ? 142 ALA A N    6  
ATOM   7875  C  CA   . ALA A 1 78 ? -13.012 4.942   -0.238  1.00 0.00 ? 142 ALA A CA   6  
ATOM   7876  C  C    . ALA A 1 78 ? -13.706 4.187   -1.367  1.00 0.00 ? 142 ALA A C    6  
ATOM   7877  O  O    . ALA A 1 78 ? -14.580 4.730   -2.043  1.00 0.00 ? 142 ALA A O    6  
ATOM   7878  C  CB   . ALA A 1 78 ? -11.654 5.451   -0.698  1.00 0.00 ? 142 ALA A CB   6  
ATOM   7879  H  H    . ALA A 1 78 ? -12.063 4.195   1.499   1.00 0.00 ? 142 ALA A H    6  
ATOM   7880  H  HA   . ALA A 1 78 ? -13.615 5.796   0.035   1.00 0.00 ? 142 ALA A HA   6  
ATOM   7881  H  HB1  . ALA A 1 78 ? -11.200 6.029   0.093   1.00 0.00 ? 142 ALA A HB1  6  
ATOM   7882  H  HB2  . ALA A 1 78 ? -11.019 4.611   -0.939  1.00 0.00 ? 142 ALA A HB2  6  
ATOM   7883  H  HB3  . ALA A 1 78 ? -11.779 6.071   -1.572  1.00 0.00 ? 142 ALA A HB3  6  
ATOM   7884  N  N    . ILE A 1 79 ? -13.311 2.934   -1.565  1.00 0.00 ? 143 ILE A N    6  
ATOM   7885  C  CA   . ILE A 1 79 ? -13.896 2.106   -2.612  1.00 0.00 ? 143 ILE A CA   6  
ATOM   7886  C  C    . ILE A 1 79 ? -15.333 1.725   -2.273  1.00 0.00 ? 143 ILE A C    6  
ATOM   7887  O  O    . ILE A 1 79 ? -16.268 2.097   -2.983  1.00 0.00 ? 143 ILE A O    6  
ATOM   7888  C  CB   . ILE A 1 79 ? -13.076 0.822   -2.837  1.00 0.00 ? 143 ILE A CB   6  
ATOM   7889  C  CG1  . ILE A 1 79 ? -11.635 1.170   -3.214  1.00 0.00 ? 143 ILE A CG1  6  
ATOM   7890  C  CG2  . ILE A 1 79 ? -13.719 -0.034  -3.918  1.00 0.00 ? 143 ILE A CG2  6  
ATOM   7891  C  CD1  . ILE A 1 79 ? -10.633 0.108   -2.818  1.00 0.00 ? 143 ILE A CD1  6  
ATOM   7892  H  H    . ILE A 1 79 ? -12.610 2.558   -0.993  1.00 0.00 ? 143 ILE A H    6  
ATOM   7893  H  HA   . ILE A 1 79 ? -13.893 2.677   -3.529  1.00 0.00 ? 143 ILE A HA   6  
ATOM   7894  H  HB   . ILE A 1 79 ? -13.074 0.257   -1.918  1.00 0.00 ? 143 ILE A HB   6  
ATOM   7895  H  HG12 . ILE A 1 79 ? -11.571 1.305   -4.282  1.00 0.00 ? 143 ILE A HG12 6  
ATOM   7896  H  HG13 . ILE A 1 79 ? -11.355 2.091   -2.722  1.00 0.00 ? 143 ILE A HG13 6  
ATOM   7897  H  HG21 . ILE A 1 79 ? -12.999 -0.750  -4.287  1.00 0.00 ? 143 ILE A HG21 6  
ATOM   7898  H  HG22 . ILE A 1 79 ? -14.567 -0.559  -3.504  1.00 0.00 ? 143 ILE A HG22 6  
ATOM   7899  H  HG23 . ILE A 1 79 ? -14.048 0.597   -4.730  1.00 0.00 ? 143 ILE A HG23 6  
ATOM   7900  H  HD11 . ILE A 1 79 ? -10.391 0.214   -1.771  1.00 0.00 ? 143 ILE A HD11 6  
ATOM   7901  H  HD12 . ILE A 1 79 ? -11.059 -0.870  -2.990  1.00 0.00 ? 143 ILE A HD12 6  
ATOM   7902  H  HD13 . ILE A 1 79 ? -9.736  0.220   -3.408  1.00 0.00 ? 143 ILE A HD13 6  
ATOM   7903  N  N    . ARG A 1 80 ? -15.502 0.984   -1.183  1.00 0.00 ? 144 ARG A N    6  
ATOM   7904  C  CA   . ARG A 1 80 ? -16.826 0.554   -0.749  1.00 0.00 ? 144 ARG A CA   6  
ATOM   7905  C  C    . ARG A 1 80 ? -17.828 1.700   -0.845  1.00 0.00 ? 144 ARG A C    6  
ATOM   7906  O  O    . ARG A 1 80 ? -17.669 2.734   -0.197  1.00 0.00 ? 144 ARG A O    6  
ATOM   7907  C  CB   . ARG A 1 80 ? -16.770 0.030   0.687   1.00 0.00 ? 144 ARG A CB   6  
ATOM   7908  C  CG   . ARG A 1 80 ? -16.435 -1.450  0.783   1.00 0.00 ? 144 ARG A CG   6  
ATOM   7909  C  CD   . ARG A 1 80 ? -17.673 -2.314  0.595   1.00 0.00 ? 144 ARG A CD   6  
ATOM   7910  N  NE   . ARG A 1 80 ? -18.423 -2.474  1.838   1.00 0.00 ? 144 ARG A NE   6  
ATOM   7911  C  CZ   . ARG A 1 80 ? -19.640 -3.002  1.899   1.00 0.00 ? 144 ARG A CZ   6  
ATOM   7912  N  NH1  . ARG A 1 80 ? -20.241 -3.420  0.794   1.00 0.00 ? 144 ARG A NH1  6  
ATOM   7913  N  NH2  . ARG A 1 80 ? -20.258 -3.115  3.068   1.00 0.00 ? 144 ARG A NH2  6  
ATOM   7914  H  H    . ARG A 1 80 ? -14.718 0.720   -0.658  1.00 0.00 ? 144 ARG A H    6  
ATOM   7915  H  HA   . ARG A 1 80 ? -17.145 -0.245  -1.402  1.00 0.00 ? 144 ARG A HA   6  
ATOM   7916  H  HB2  . ARG A 1 80 ? -16.017 0.582   1.231   1.00 0.00 ? 144 ARG A HB2  6  
ATOM   7917  H  HB3  . ARG A 1 80 ? -17.730 0.191   1.154   1.00 0.00 ? 144 ARG A HB3  6  
ATOM   7918  H  HG2  . ARG A 1 80 ? -15.717 -1.698  0.016   1.00 0.00 ? 144 ARG A HG2  6  
ATOM   7919  H  HG3  . ARG A 1 80 ? -16.011 -1.651  1.756   1.00 0.00 ? 144 ARG A HG3  6  
ATOM   7920  H  HD2  . ARG A 1 80 ? -18.311 -1.849  -0.142  1.00 0.00 ? 144 ARG A HD2  6  
ATOM   7921  H  HD3  . ARG A 1 80 ? -17.365 -3.287  0.243   1.00 0.00 ? 144 ARG A HD3  6  
ATOM   7922  H  HE   . ARG A 1 80 ? -17.997 -2.172  2.667   1.00 0.00 ? 144 ARG A HE   6  
ATOM   7923  H  HH11 . ARG A 1 80 ? -19.777 -3.338  -0.088  1.00 0.00 ? 144 ARG A HH11 6  
ATOM   7924  H  HH12 . ARG A 1 80 ? -21.157 -3.819  0.843   1.00 0.00 ? 144 ARG A HH12 6  
ATOM   7925  H  HH21 . ARG A 1 80 ? -19.807 -2.801  3.904   1.00 0.00 ? 144 ARG A HH21 6  
ATOM   7926  H  HH22 . ARG A 1 80 ? -21.173 -3.512  3.113   1.00 0.00 ? 144 ARG A HH22 6  
ATOM   7927  N  N    . PHE A 1 81 ? -18.862 1.508   -1.658  1.00 0.00 ? 145 PHE A N    6  
ATOM   7928  C  CA   . PHE A 1 81 ? -19.890 2.526   -1.841  1.00 0.00 ? 145 PHE A CA   6  
ATOM   7929  C  C    . PHE A 1 81 ? -21.284 1.923   -1.691  1.00 0.00 ? 145 PHE A C    6  
ATOM   7930  O  O    . PHE A 1 81 ? -21.500 0.749   -1.988  1.00 0.00 ? 145 PHE A O    6  
ATOM   7931  C  CB   . PHE A 1 81 ? -19.750 3.181   -3.216  1.00 0.00 ? 145 PHE A CB   6  
ATOM   7932  C  CG   . PHE A 1 81 ? -20.471 4.494   -3.331  1.00 0.00 ? 145 PHE A CG   6  
ATOM   7933  C  CD1  . PHE A 1 81 ? -20.128 5.561   -2.517  1.00 0.00 ? 145 PHE A CD1  6  
ATOM   7934  C  CD2  . PHE A 1 81 ? -21.493 4.660   -4.252  1.00 0.00 ? 145 PHE A CD2  6  
ATOM   7935  C  CE1  . PHE A 1 81 ? -20.789 6.771   -2.620  1.00 0.00 ? 145 PHE A CE1  6  
ATOM   7936  C  CE2  . PHE A 1 81 ? -22.158 5.868   -4.359  1.00 0.00 ? 145 PHE A CE2  6  
ATOM   7937  C  CZ   . PHE A 1 81 ? -21.806 6.924   -3.542  1.00 0.00 ? 145 PHE A CZ   6  
ATOM   7938  H  H    . PHE A 1 81 ? -18.934 0.662   -2.148  1.00 0.00 ? 145 PHE A H    6  
ATOM   7939  H  HA   . PHE A 1 81 ? -19.752 3.276   -1.078  1.00 0.00 ? 145 PHE A HA   6  
ATOM   7940  H  HB2  . PHE A 1 81 ? -18.705 3.359   -3.418  1.00 0.00 ? 145 PHE A HB2  6  
ATOM   7941  H  HB3  . PHE A 1 81 ? -20.150 2.516   -3.966  1.00 0.00 ? 145 PHE A HB3  6  
ATOM   7942  H  HD1  . PHE A 1 81 ? -19.332 5.443   -1.795  1.00 0.00 ? 145 PHE A HD1  6  
ATOM   7943  H  HD2  . PHE A 1 81 ? -21.770 3.835   -4.891  1.00 0.00 ? 145 PHE A HD2  6  
ATOM   7944  H  HE1  . PHE A 1 81 ? -20.511 7.595   -1.979  1.00 0.00 ? 145 PHE A HE1  6  
ATOM   7945  H  HE2  . PHE A 1 81 ? -22.953 5.984   -5.081  1.00 0.00 ? 145 PHE A HE2  6  
ATOM   7946  H  HZ   . PHE A 1 81 ? -22.323 7.868   -3.624  1.00 0.00 ? 145 PHE A HZ   6  
ATOM   7947  N  N    . GLY A 1 82 ? -22.228 2.738   -1.228  1.00 0.00 ? 146 GLY A N    6  
ATOM   7948  C  CA   . GLY A 1 82 ? -23.589 2.268   -1.046  1.00 0.00 ? 146 GLY A CA   6  
ATOM   7949  C  C    . GLY A 1 82 ? -24.616 3.351   -1.309  1.00 0.00 ? 146 GLY A C    6  
ATOM   7950  O  O    . GLY A 1 82 ? -24.937 3.645   -2.461  1.00 0.00 ? 146 GLY A O    6  
ATOM   7951  H  H    . GLY A 1 82 ? -21.998 3.664   -1.008  1.00 0.00 ? 146 GLY A H    6  
ATOM   7952  H  HA2  . GLY A 1 82 ? -23.767 1.445   -1.721  1.00 0.00 ? 146 GLY A HA2  6  
ATOM   7953  H  HA3  . GLY A 1 82 ? -23.704 1.919   -0.030  1.00 0.00 ? 146 GLY A HA3  6  
ATOM   7954  N  N    . SER A 1 83 ? -25.134 3.946   -0.240  1.00 0.00 ? 147 SER A N    6  
ATOM   7955  C  CA   . SER A 1 83 ? -26.135 4.999   -0.360  1.00 0.00 ? 147 SER A CA   6  
ATOM   7956  C  C    . SER A 1 83 ? -25.480 6.337   -0.688  1.00 0.00 ? 147 SER A C    6  
ATOM   7957  O  O    . SER A 1 83 ? -25.906 7.043   -1.601  1.00 0.00 ? 147 SER A O    6  
ATOM   7958  C  CB   . SER A 1 83 ? -26.941 5.117   0.934   1.00 0.00 ? 147 SER A CB   6  
ATOM   7959  O  OG   . SER A 1 83 ? -26.089 5.310   2.050   1.00 0.00 ? 147 SER A OG   6  
ATOM   7960  H  H    . SER A 1 83 ? -24.837 3.668   0.652   1.00 0.00 ? 147 SER A H    6  
ATOM   7961  H  HA   . SER A 1 83 ? -26.802 4.732   -1.166  1.00 0.00 ? 147 SER A HA   6  
ATOM   7962  H  HB2  . SER A 1 83 ? -27.614 5.958   0.862   1.00 0.00 ? 147 SER A HB2  6  
ATOM   7963  H  HB3  . SER A 1 83 ? -27.511 4.211   1.084   1.00 0.00 ? 147 SER A HB3  6  
ATOM   7964  H  HG   . SER A 1 83 ? -26.134 4.542   2.624   1.00 0.00 ? 147 SER A HG   6  
ATOM   7965  N  N    . GLY A 1 84 ? -24.438 6.679   0.065   1.00 0.00 ? 148 GLY A N    6  
ATOM   7966  C  CA   . GLY A 1 84 ? -23.740 7.931   -0.160  1.00 0.00 ? 148 GLY A CA   6  
ATOM   7967  C  C    . GLY A 1 84 ? -23.445 8.670   1.130   1.00 0.00 ? 148 GLY A C    6  
ATOM   7968  O  O    . GLY A 1 84 ? -24.171 8.552   2.118   1.00 0.00 ? 148 GLY A O    6  
ATOM   7969  H  H    . GLY A 1 84 ? -24.142 6.076   0.779   1.00 0.00 ? 148 GLY A H    6  
ATOM   7970  H  HA2  . GLY A 1 84 ? -22.808 7.725   -0.666  1.00 0.00 ? 148 GLY A HA2  6  
ATOM   7971  H  HA3  . GLY A 1 84 ? -24.349 8.561   -0.791  1.00 0.00 ? 148 GLY A HA3  6  
ATOM   7972  N  N    . PRO A 1 85 ? -22.356 9.453   1.133   1.00 0.00 ? 149 PRO A N    6  
ATOM   7973  C  CA   . PRO A 1 85 ? -21.942 10.229  2.305   1.00 0.00 ? 149 PRO A CA   6  
ATOM   7974  C  C    . PRO A 1 85 ? -22.892 11.384  2.602   1.00 0.00 ? 149 PRO A C    6  
ATOM   7975  O  O    . PRO A 1 85 ? -22.819 12.004  3.663   1.00 0.00 ? 149 PRO A O    6  
ATOM   7976  C  CB   . PRO A 1 85 ? -20.562 10.761  1.909   1.00 0.00 ? 149 PRO A CB   6  
ATOM   7977  C  CG   . PRO A 1 85 ? -20.583 10.796  0.420   1.00 0.00 ? 149 PRO A CG   6  
ATOM   7978  C  CD   . PRO A 1 85 ? -21.446 9.642   -0.009  1.00 0.00 ? 149 PRO A CD   6  
ATOM   7979  H  HA   . PRO A 1 85 ? -21.851 9.605   3.182   1.00 0.00 ? 149 PRO A HA   6  
ATOM   7980  H  HB2  . PRO A 1 85 ? -20.420 11.748  2.327   1.00 0.00 ? 149 PRO A HB2  6  
ATOM   7981  H  HB3  . PRO A 1 85 ? -19.796 10.095  2.278   1.00 0.00 ? 149 PRO A HB3  6  
ATOM   7982  H  HG2  . PRO A 1 85 ? -21.007 11.728  0.081   1.00 0.00 ? 149 PRO A HG2  6  
ATOM   7983  H  HG3  . PRO A 1 85 ? -19.580 10.676  0.037   1.00 0.00 ? 149 PRO A HG3  6  
ATOM   7984  H  HD2  . PRO A 1 85 ? -21.996 9.894   -0.904  1.00 0.00 ? 149 PRO A HD2  6  
ATOM   7985  H  HD3  . PRO A 1 85 ? -20.843 8.760   -0.171  1.00 0.00 ? 149 PRO A HD3  6  
ATOM   7986  N  N    . SER A 1 86 ? -23.785 11.667  1.658   1.00 0.00 ? 150 SER A N    6  
ATOM   7987  C  CA   . SER A 1 86 ? -24.748 12.750  1.818   1.00 0.00 ? 150 SER A CA   6  
ATOM   7988  C  C    . SER A 1 86 ? -26.030 12.245  2.473   1.00 0.00 ? 150 SER A C    6  
ATOM   7989  O  O    . SER A 1 86 ? -26.228 11.040  2.627   1.00 0.00 ? 150 SER A O    6  
ATOM   7990  C  CB   . SER A 1 86 ? -25.069 13.379  0.461   1.00 0.00 ? 150 SER A CB   6  
ATOM   7991  O  OG   . SER A 1 86 ? -23.981 14.153  -0.013  1.00 0.00 ? 150 SER A OG   6  
ATOM   7992  H  H    . SER A 1 86 ? -23.793 11.137  0.834   1.00 0.00 ? 150 SER A H    6  
ATOM   7993  H  HA   . SER A 1 86 ? -24.303 13.499  2.456   1.00 0.00 ? 150 SER A HA   6  
ATOM   7994  H  HB2  . SER A 1 86 ? -25.278 12.598  -0.255  1.00 0.00 ? 150 SER A HB2  6  
ATOM   7995  H  HB3  . SER A 1 86 ? -25.935 14.018  0.559   1.00 0.00 ? 150 SER A HB3  6  
ATOM   7996  H  HG   . SER A 1 86 ? -23.475 13.640  -0.647  1.00 0.00 ? 150 SER A HG   6  
ATOM   7997  N  N    . SER A 1 87 ? -26.897 13.176  2.857   1.00 0.00 ? 151 SER A N    6  
ATOM   7998  C  CA   . SER A 1 87 ? -28.159 12.826  3.499   1.00 0.00 ? 151 SER A CA   6  
ATOM   7999  C  C    . SER A 1 87 ? -28.959 11.857  2.634   1.00 0.00 ? 151 SER A C    6  
ATOM   8000  O  O    . SER A 1 87 ? -28.922 11.927  1.407   1.00 0.00 ? 151 SER A O    6  
ATOM   8001  C  CB   . SER A 1 87 ? -28.984 14.086  3.770   1.00 0.00 ? 151 SER A CB   6  
ATOM   8002  O  OG   . SER A 1 87 ? -30.150 13.782  4.515   1.00 0.00 ? 151 SER A OG   6  
ATOM   8003  H  H    . SER A 1 87 ? -26.682 14.120  2.707   1.00 0.00 ? 151 SER A H    6  
ATOM   8004  H  HA   . SER A 1 87 ? -27.931 12.347  4.440   1.00 0.00 ? 151 SER A HA   6  
ATOM   8005  H  HB2  . SER A 1 87 ? -28.388 14.791  4.329   1.00 0.00 ? 151 SER A HB2  6  
ATOM   8006  H  HB3  . SER A 1 87 ? -29.278 14.529  2.829   1.00 0.00 ? 151 SER A HB3  6  
ATOM   8007  H  HG   . SER A 1 87 ? -30.210 12.832  4.642   1.00 0.00 ? 151 SER A HG   6  
ATOM   8008  N  N    . GLY A 1 88 ? -29.682 10.951  3.286   1.00 0.00 ? 152 GLY A N    6  
ATOM   8009  C  CA   . GLY A 1 88 ? -30.481 9.979   2.562   1.00 0.00 ? 152 GLY A CA   6  
ATOM   8010  C  C    . GLY A 1 88 ? -29.831 9.547   1.262   1.00 0.00 ? 152 GLY A C    6  
ATOM   8011  O  O    . GLY A 1 88 ? -30.152 10.071  0.196   1.00 0.00 ? 152 GLY A O    6  
ATOM   8012  H  H    . GLY A 1 88 ? -29.674 10.942  4.266   1.00 0.00 ? 152 GLY A H    6  
ATOM   8013  H  HA2  . GLY A 1 88 ? -30.625 9.111   3.187   1.00 0.00 ? 152 GLY A HA2  6  
ATOM   8014  H  HA3  . GLY A 1 88 ? -31.444 10.415  2.341   1.00 0.00 ? 152 GLY A HA3  6  
HETATM 8015  ZN ZN   . ZN  B 2 .  ? 2.940   2.288   -8.916  1.00 0.00 ? 200 ZN  A ZN   6  
HETATM 8016  ZN ZN   . ZN  C 2 .  ? 6.701   -11.228 -1.210  1.00 0.00 ? 300 ZN  A ZN   6  
ATOM   8017  N  N    . GLY A 1 1  ? 17.795  9.318   -23.880 1.00 0.00 ? 65  GLY A N    7  
ATOM   8018  C  CA   . GLY A 1 1  ? 17.853  10.482  -24.744 1.00 0.00 ? 65  GLY A CA   7  
ATOM   8019  C  C    . GLY A 1 1  ? 17.821  11.784  -23.968 1.00 0.00 ? 65  GLY A C    7  
ATOM   8020  O  O    . GLY A 1 1  ? 18.821  12.499  -23.901 1.00 0.00 ? 65  GLY A O    7  
ATOM   8021  H  H1   . GLY A 1 1  ? 16.941  8.861   -23.732 1.00 0.00 ? 65  GLY A H1   7  
ATOM   8022  H  HA2  . GLY A 1 1  ? 18.763  10.442  -25.323 1.00 0.00 ? 65  GLY A HA2  7  
ATOM   8023  H  HA3  . GLY A 1 1  ? 17.009  10.458  -25.418 1.00 0.00 ? 65  GLY A HA3  7  
ATOM   8024  N  N    . SER A 1 2  ? 16.670  12.093  -23.380 1.00 0.00 ? 66  SER A N    7  
ATOM   8025  C  CA   . SER A 1 2  ? 16.511  13.320  -22.609 1.00 0.00 ? 66  SER A CA   7  
ATOM   8026  C  C    . SER A 1 2  ? 16.153  13.008  -21.159 1.00 0.00 ? 66  SER A C    7  
ATOM   8027  O  O    . SER A 1 2  ? 15.398  12.076  -20.881 1.00 0.00 ? 66  SER A O    7  
ATOM   8028  C  CB   . SER A 1 2  ? 15.429  14.203  -23.234 1.00 0.00 ? 66  SER A CB   7  
ATOM   8029  O  OG   . SER A 1 2  ? 15.208  15.366  -22.455 1.00 0.00 ? 66  SER A OG   7  
ATOM   8030  H  H    . SER A 1 2  ? 15.909  11.481  -23.470 1.00 0.00 ? 66  SER A H    7  
ATOM   8031  H  HA   . SER A 1 2  ? 17.452  13.849  -22.629 1.00 0.00 ? 66  SER A HA   7  
ATOM   8032  H  HB2  . SER A 1 2  ? 15.738  14.501  -24.224 1.00 0.00 ? 66  SER A HB2  7  
ATOM   8033  H  HB3  . SER A 1 2  ? 14.505  13.646  -23.297 1.00 0.00 ? 66  SER A HB3  7  
ATOM   8034  H  HG   . SER A 1 2  ? 16.044  15.811  -22.299 1.00 0.00 ? 66  SER A HG   7  
ATOM   8035  N  N    . SER A 1 3  ? 16.702  13.794  -20.238 1.00 0.00 ? 67  SER A N    7  
ATOM   8036  C  CA   . SER A 1 3  ? 16.446  13.600  -18.816 1.00 0.00 ? 67  SER A CA   7  
ATOM   8037  C  C    . SER A 1 3  ? 14.957  13.731  -18.510 1.00 0.00 ? 67  SER A C    7  
ATOM   8038  O  O    . SER A 1 3  ? 14.335  14.747  -18.819 1.00 0.00 ? 67  SER A O    7  
ATOM   8039  C  CB   . SER A 1 3  ? 17.239  14.614  -17.990 1.00 0.00 ? 67  SER A CB   7  
ATOM   8040  O  OG   . SER A 1 3  ? 16.926  15.942  -18.375 1.00 0.00 ? 67  SER A OG   7  
ATOM   8041  H  H    . SER A 1 3  ? 17.296  14.520  -20.523 1.00 0.00 ? 67  SER A H    7  
ATOM   8042  H  HA   . SER A 1 3  ? 16.769  12.604  -18.554 1.00 0.00 ? 67  SER A HA   7  
ATOM   8043  H  HB2  . SER A 1 3  ? 17.000  14.490  -16.945 1.00 0.00 ? 67  SER A HB2  7  
ATOM   8044  H  HB3  . SER A 1 3  ? 18.296  14.448  -18.140 1.00 0.00 ? 67  SER A HB3  7  
ATOM   8045  H  HG   . SER A 1 3  ? 17.202  16.549  -17.685 1.00 0.00 ? 67  SER A HG   7  
ATOM   8046  N  N    . GLY A 1 4  ? 14.391  12.694  -17.900 1.00 0.00 ? 68  GLY A N    7  
ATOM   8047  C  CA   . GLY A 1 4  ? 12.979  12.713  -17.561 1.00 0.00 ? 68  GLY A CA   7  
ATOM   8048  C  C    . GLY A 1 4  ? 12.634  13.811  -16.576 1.00 0.00 ? 68  GLY A C    7  
ATOM   8049  O  O    . GLY A 1 4  ? 13.213  14.897  -16.618 1.00 0.00 ? 68  GLY A O    7  
ATOM   8050  H  H    . GLY A 1 4  ? 14.936  11.911  -17.677 1.00 0.00 ? 68  GLY A H    7  
ATOM   8051  H  HA2  . GLY A 1 4  ? 12.406  12.860  -18.464 1.00 0.00 ? 68  GLY A HA2  7  
ATOM   8052  H  HA3  . GLY A 1 4  ? 12.713  11.760  -17.128 1.00 0.00 ? 68  GLY A HA3  7  
ATOM   8053  N  N    . SER A 1 5  ? 11.686  13.530  -15.688 1.00 0.00 ? 69  SER A N    7  
ATOM   8054  C  CA   . SER A 1 5  ? 11.259  14.505  -14.691 1.00 0.00 ? 69  SER A CA   7  
ATOM   8055  C  C    . SER A 1 5  ? 11.419  13.946  -13.280 1.00 0.00 ? 69  SER A C    7  
ATOM   8056  O  O    . SER A 1 5  ? 11.444  12.731  -13.082 1.00 0.00 ? 69  SER A O    7  
ATOM   8057  C  CB   . SER A 1 5  ? 9.803   14.908  -14.930 1.00 0.00 ? 69  SER A CB   7  
ATOM   8058  O  OG   . SER A 1 5  ? 8.914   13.899  -14.481 1.00 0.00 ? 69  SER A OG   7  
ATOM   8059  H  H    . SER A 1 5  ? 11.261  12.647  -15.705 1.00 0.00 ? 69  SER A H    7  
ATOM   8060  H  HA   . SER A 1 5  ? 11.886  15.379  -14.792 1.00 0.00 ? 69  SER A HA   7  
ATOM   8061  H  HB2  . SER A 1 5  ? 9.591   15.821  -14.395 1.00 0.00 ? 69  SER A HB2  7  
ATOM   8062  H  HB3  . SER A 1 5  ? 9.645   15.065  -15.987 1.00 0.00 ? 69  SER A HB3  7  
ATOM   8063  H  HG   . SER A 1 5  ? 8.216   13.775  -15.128 1.00 0.00 ? 69  SER A HG   7  
ATOM   8064  N  N    . SER A 1 6  ? 11.526  14.841  -12.304 1.00 0.00 ? 70  SER A N    7  
ATOM   8065  C  CA   . SER A 1 6  ? 11.687  14.438  -10.912 1.00 0.00 ? 70  SER A CA   7  
ATOM   8066  C  C    . SER A 1 6  ? 10.824  15.298  -9.994  1.00 0.00 ? 70  SER A C    7  
ATOM   8067  O  O    . SER A 1 6  ? 10.899  16.526  -10.024 1.00 0.00 ? 70  SER A O    7  
ATOM   8068  C  CB   . SER A 1 6  ? 13.156  14.541  -10.495 1.00 0.00 ? 70  SER A CB   7  
ATOM   8069  O  OG   . SER A 1 6  ? 13.384  13.882  -9.262  1.00 0.00 ? 70  SER A OG   7  
ATOM   8070  H  H    . SER A 1 6  ? 11.499  15.795  -12.525 1.00 0.00 ? 70  SER A H    7  
ATOM   8071  H  HA   . SER A 1 6  ? 11.369  13.409  -10.825 1.00 0.00 ? 70  SER A HA   7  
ATOM   8072  H  HB2  . SER A 1 6  ? 13.775  14.086  -11.253 1.00 0.00 ? 70  SER A HB2  7  
ATOM   8073  H  HB3  . SER A 1 6  ? 13.424  15.582  -10.389 1.00 0.00 ? 70  SER A HB3  7  
ATOM   8074  H  HG   . SER A 1 6  ? 13.827  13.046  -9.422  1.00 0.00 ? 70  SER A HG   7  
ATOM   8075  N  N    . GLY A 1 7  ? 10.005  14.644  -9.176  1.00 0.00 ? 71  GLY A N    7  
ATOM   8076  C  CA   . GLY A 1 7  ? 9.139   15.363  -8.261  1.00 0.00 ? 71  GLY A CA   7  
ATOM   8077  C  C    . GLY A 1 7  ? 8.034   14.491  -7.701  1.00 0.00 ? 71  GLY A C    7  
ATOM   8078  O  O    . GLY A 1 7  ? 7.744   14.535  -6.506  1.00 0.00 ? 71  GLY A O    7  
ATOM   8079  H  H    . GLY A 1 7  ? 9.989   13.664  -9.195  1.00 0.00 ? 71  GLY A H    7  
ATOM   8080  H  HA2  . GLY A 1 7  ? 9.734   15.742  -7.442  1.00 0.00 ? 71  GLY A HA2  7  
ATOM   8081  H  HA3  . GLY A 1 7  ? 8.694   16.197  -8.784  1.00 0.00 ? 71  GLY A HA3  7  
ATOM   8082  N  N    . MET A 1 8  ? 7.413   13.696  -8.568  1.00 0.00 ? 72  MET A N    7  
ATOM   8083  C  CA   . MET A 1 8  ? 6.332   12.810  -8.153  1.00 0.00 ? 72  MET A CA   7  
ATOM   8084  C  C    . MET A 1 8  ? 6.621   11.370  -8.564  1.00 0.00 ? 72  MET A C    7  
ATOM   8085  O  O    . MET A 1 8  ? 7.002   11.106  -9.704  1.00 0.00 ? 72  MET A O    7  
ATOM   8086  C  CB   . MET A 1 8  ? 5.005   13.270  -8.760  1.00 0.00 ? 72  MET A CB   7  
ATOM   8087  C  CG   . MET A 1 8  ? 4.263   14.282  -7.903  1.00 0.00 ? 72  MET A CG   7  
ATOM   8088  S  SD   . MET A 1 8  ? 5.242   15.757  -7.565  1.00 0.00 ? 72  MET A SD   7  
ATOM   8089  C  CE   . MET A 1 8  ? 5.223   15.774  -5.774  1.00 0.00 ? 72  MET A CE   7  
ATOM   8090  H  H    . MET A 1 8  ? 7.689   13.705  -9.508  1.00 0.00 ? 72  MET A H    7  
ATOM   8091  H  HA   . MET A 1 8  ? 6.260   12.857  -7.076  1.00 0.00 ? 72  MET A HA   7  
ATOM   8092  H  HB2  . MET A 1 8  ? 5.200   13.719  -9.722  1.00 0.00 ? 72  MET A HB2  7  
ATOM   8093  H  HB3  . MET A 1 8  ? 4.367   12.409  -8.896  1.00 0.00 ? 72  MET A HB3  7  
ATOM   8094  H  HG2  . MET A 1 8  ? 3.360   14.576  -8.417  1.00 0.00 ? 72  MET A HG2  7  
ATOM   8095  H  HG3  . MET A 1 8  ? 4.003   13.815  -6.964  1.00 0.00 ? 72  MET A HG3  7  
ATOM   8096  H  HE1  . MET A 1 8  ? 4.200   15.779  -5.426  1.00 0.00 ? 72  MET A HE1  7  
ATOM   8097  H  HE2  . MET A 1 8  ? 5.726   14.895  -5.400  1.00 0.00 ? 72  MET A HE2  7  
ATOM   8098  H  HE3  . MET A 1 8  ? 5.730   16.658  -5.417  1.00 0.00 ? 72  MET A HE3  7  
ATOM   8099  N  N    . GLU A 1 9  ? 6.439   10.443  -7.629  1.00 0.00 ? 73  GLU A N    7  
ATOM   8100  C  CA   . GLU A 1 9  ? 6.682   9.031   -7.896  1.00 0.00 ? 73  GLU A CA   7  
ATOM   8101  C  C    . GLU A 1 9  ? 5.749   8.152   -7.068  1.00 0.00 ? 73  GLU A C    7  
ATOM   8102  O  O    . GLU A 1 9  ? 5.477   8.441   -5.902  1.00 0.00 ? 73  GLU A O    7  
ATOM   8103  C  CB   . GLU A 1 9  ? 8.139   8.675   -7.592  1.00 0.00 ? 73  GLU A CB   7  
ATOM   8104  C  CG   . GLU A 1 9  ? 9.078   8.907   -8.763  1.00 0.00 ? 73  GLU A CG   7  
ATOM   8105  C  CD   . GLU A 1 9  ? 10.502  9.188   -8.322  1.00 0.00 ? 73  GLU A CD   7  
ATOM   8106  O  OE1  . GLU A 1 9  ? 11.198  8.231   -7.921  1.00 0.00 ? 73  GLU A OE1  7  
ATOM   8107  O  OE2  . GLU A 1 9  ? 10.919  10.363  -8.378  1.00 0.00 ? 73  GLU A OE2  7  
ATOM   8108  H  H    . GLU A 1 9  ? 6.134   10.716  -6.738  1.00 0.00 ? 73  GLU A H    7  
ATOM   8109  H  HA   . GLU A 1 9  ? 6.488   8.853   -8.943  1.00 0.00 ? 73  GLU A HA   7  
ATOM   8110  H  HB2  . GLU A 1 9  ? 8.477   9.274   -6.761  1.00 0.00 ? 73  GLU A HB2  7  
ATOM   8111  H  HB3  . GLU A 1 9  ? 8.191   7.632   -7.317  1.00 0.00 ? 73  GLU A HB3  7  
ATOM   8112  H  HG2  . GLU A 1 9  ? 9.079   8.026   -9.388  1.00 0.00 ? 73  GLU A HG2  7  
ATOM   8113  H  HG3  . GLU A 1 9  ? 8.721   9.751   -9.334  1.00 0.00 ? 73  GLU A HG3  7  
ATOM   8114  N  N    . CYS A 1 10 ? 5.260   7.078   -7.679  1.00 0.00 ? 74  CYS A N    7  
ATOM   8115  C  CA   . CYS A 1 10 ? 4.357   6.156   -7.000  1.00 0.00 ? 74  CYS A CA   7  
ATOM   8116  C  C    . CYS A 1 10 ? 5.060   5.462   -5.838  1.00 0.00 ? 74  CYS A C    7  
ATOM   8117  O  O    . CYS A 1 10 ? 5.948   4.633   -6.042  1.00 0.00 ? 74  CYS A O    7  
ATOM   8118  C  CB   . CYS A 1 10 ? 3.825   5.113   -7.985  1.00 0.00 ? 74  CYS A CB   7  
ATOM   8119  S  SG   . CYS A 1 10 ? 2.778   3.834   -7.219  1.00 0.00 ? 74  CYS A SG   7  
ATOM   8120  H  H    . CYS A 1 10 ? 5.513   6.900   -8.610  1.00 0.00 ? 74  CYS A H    7  
ATOM   8121  H  HA   . CYS A 1 10 ? 3.528   6.729   -6.613  1.00 0.00 ? 74  CYS A HA   7  
ATOM   8122  H  HB2  . CYS A 1 10 ? 3.234   5.611   -8.740  1.00 0.00 ? 74  CYS A HB2  7  
ATOM   8123  H  HB3  . CYS A 1 10 ? 4.659   4.617   -8.458  1.00 0.00 ? 74  CYS A HB3  7  
ATOM   8124  N  N    . ARG A 1 11 ? 4.658   5.806   -4.619  1.00 0.00 ? 75  ARG A N    7  
ATOM   8125  C  CA   . ARG A 1 11 ? 5.249   5.216   -3.424  1.00 0.00 ? 75  ARG A CA   7  
ATOM   8126  C  C    . ARG A 1 11 ? 5.261   3.693   -3.517  1.00 0.00 ? 75  ARG A C    7  
ATOM   8127  O  O    . ARG A 1 11 ? 6.176   3.037   -3.019  1.00 0.00 ? 75  ARG A O    7  
ATOM   8128  C  CB   . ARG A 1 11 ? 4.479   5.656   -2.178  1.00 0.00 ? 75  ARG A CB   7  
ATOM   8129  C  CG   . ARG A 1 11 ? 4.579   7.145   -1.893  1.00 0.00 ? 75  ARG A CG   7  
ATOM   8130  C  CD   . ARG A 1 11 ? 5.827   7.477   -1.091  1.00 0.00 ? 75  ARG A CD   7  
ATOM   8131  N  NE   . ARG A 1 11 ? 5.679   8.718   -0.336  1.00 0.00 ? 75  ARG A NE   7  
ATOM   8132  C  CZ   . ARG A 1 11 ? 5.778   9.926   -0.880  1.00 0.00 ? 75  ARG A CZ   7  
ATOM   8133  N  NH1  . ARG A 1 11 ? 6.025   10.054  -2.176  1.00 0.00 ? 75  ARG A NH1  7  
ATOM   8134  N  NH2  . ARG A 1 11 ? 5.631   11.008  -0.126  1.00 0.00 ? 75  ARG A NH2  7  
ATOM   8135  H  H    . ARG A 1 11 ? 3.946   6.472   -4.521  1.00 0.00 ? 75  ARG A H    7  
ATOM   8136  H  HA   . ARG A 1 11 ? 6.267   5.569   -3.350  1.00 0.00 ? 75  ARG A HA   7  
ATOM   8137  H  HB2  . ARG A 1 11 ? 3.436   5.405   -2.306  1.00 0.00 ? 75  ARG A HB2  7  
ATOM   8138  H  HB3  . ARG A 1 11 ? 4.866   5.121   -1.323  1.00 0.00 ? 75  ARG A HB3  7  
ATOM   8139  H  HG2  . ARG A 1 11 ? 4.615   7.680   -2.831  1.00 0.00 ? 75  ARG A HG2  7  
ATOM   8140  H  HG3  . ARG A 1 11 ? 3.709   7.454   -1.334  1.00 0.00 ? 75  ARG A HG3  7  
ATOM   8141  H  HD2  . ARG A 1 11 ? 6.021   6.669   -0.402  1.00 0.00 ? 75  ARG A HD2  7  
ATOM   8142  H  HD3  . ARG A 1 11 ? 6.660   7.578   -1.771  1.00 0.00 ? 75  ARG A HD3  7  
ATOM   8143  H  HE   . ARG A 1 11 ? 5.496   8.646   0.624   1.00 0.00 ? 75  ARG A HE   7  
ATOM   8144  H  HH11 . ARG A 1 11 ? 6.135   9.241   -2.746  1.00 0.00 ? 75  ARG A HH11 7  
ATOM   8145  H  HH12 . ARG A 1 11 ? 6.098   10.965  -2.583  1.00 0.00 ? 75  ARG A HH12 7  
ATOM   8146  H  HH21 . ARG A 1 11 ? 5.445   10.915  0.851   1.00 0.00 ? 75  ARG A HH21 7  
ATOM   8147  H  HH22 . ARG A 1 11 ? 5.706   11.917  -0.536  1.00 0.00 ? 75  ARG A HH22 7  
ATOM   8148  N  N    . VAL A 1 12 ? 4.239   3.137   -4.159  1.00 0.00 ? 76  VAL A N    7  
ATOM   8149  C  CA   . VAL A 1 12 ? 4.131   1.692   -4.319  1.00 0.00 ? 76  VAL A CA   7  
ATOM   8150  C  C    . VAL A 1 12 ? 5.294   1.141   -5.137  1.00 0.00 ? 76  VAL A C    7  
ATOM   8151  O  O    . VAL A 1 12 ? 6.180   0.471   -4.606  1.00 0.00 ? 76  VAL A O    7  
ATOM   8152  C  CB   . VAL A 1 12 ? 2.807   1.299   -5.000  1.00 0.00 ? 76  VAL A CB   7  
ATOM   8153  C  CG1  . VAL A 1 12 ? 2.572   -0.199  -4.887  1.00 0.00 ? 76  VAL A CG1  7  
ATOM   8154  C  CG2  . VAL A 1 12 ? 1.647   2.076   -4.396  1.00 0.00 ? 76  VAL A CG2  7  
ATOM   8155  H  H    . VAL A 1 12 ? 3.540   3.713   -4.535  1.00 0.00 ? 76  VAL A H    7  
ATOM   8156  H  HA   . VAL A 1 12 ? 4.152   1.245   -3.336  1.00 0.00 ? 76  VAL A HA   7  
ATOM   8157  H  HB   . VAL A 1 12 ? 2.875   1.553   -6.048  1.00 0.00 ? 76  VAL A HB   7  
ATOM   8158  H  HG11 . VAL A 1 12 ? 3.131   -0.710  -5.658  1.00 0.00 ? 76  VAL A HG11 7  
ATOM   8159  H  HG12 . VAL A 1 12 ? 2.897   -0.543  -3.916  1.00 0.00 ? 76  VAL A HG12 7  
ATOM   8160  H  HG13 . VAL A 1 12 ? 1.519   -0.409  -5.010  1.00 0.00 ? 76  VAL A HG13 7  
ATOM   8161  H  HG21 . VAL A 1 12 ? 1.754   3.124   -4.630  1.00 0.00 ? 76  VAL A HG21 7  
ATOM   8162  H  HG22 . VAL A 1 12 ? 0.717   1.709   -4.804  1.00 0.00 ? 76  VAL A HG22 7  
ATOM   8163  H  HG23 . VAL A 1 12 ? 1.645   1.945   -3.323  1.00 0.00 ? 76  VAL A HG23 7  
ATOM   8164  N  N    . CYS A 1 13 ? 5.285   1.429   -6.435  1.00 0.00 ? 77  CYS A N    7  
ATOM   8165  C  CA   . CYS A 1 13 ? 6.339   0.963   -7.329  1.00 0.00 ? 77  CYS A CA   7  
ATOM   8166  C  C    . CYS A 1 13 ? 7.387   2.050   -7.546  1.00 0.00 ? 77  CYS A C    7  
ATOM   8167  O  O    . CYS A 1 13 ? 8.588   1.791   -7.482  1.00 0.00 ? 77  CYS A O    7  
ATOM   8168  C  CB   . CYS A 1 13 ? 5.744   0.537   -8.672  1.00 0.00 ? 77  CYS A CB   7  
ATOM   8169  S  SG   . CYS A 1 13 ? 5.057   1.911   -9.651  1.00 0.00 ? 77  CYS A SG   7  
ATOM   8170  H  H    . CYS A 1 13 ? 4.552   1.968   -6.801  1.00 0.00 ? 77  CYS A H    7  
ATOM   8171  H  HA   . CYS A 1 13 ? 6.812   0.110   -6.867  1.00 0.00 ? 77  CYS A HA   7  
ATOM   8172  H  HB2  . CYS A 1 13 ? 6.515   0.066   -9.265  1.00 0.00 ? 77  CYS A HB2  7  
ATOM   8173  H  HB3  . CYS A 1 13 ? 4.949   -0.173  -8.497  1.00 0.00 ? 77  CYS A HB3  7  
ATOM   8174  N  N    . GLY A 1 14 ? 6.924   3.270   -7.803  1.00 0.00 ? 78  GLY A N    7  
ATOM   8175  C  CA   . GLY A 1 14 ? 7.834   4.378   -8.026  1.00 0.00 ? 78  GLY A CA   7  
ATOM   8176  C  C    . GLY A 1 14 ? 7.527   5.132   -9.305  1.00 0.00 ? 78  GLY A C    7  
ATOM   8177  O  O    . GLY A 1 14 ? 7.669   6.354   -9.362  1.00 0.00 ? 78  GLY A O    7  
ATOM   8178  H  H    . GLY A 1 14 ? 5.956   3.418   -7.843  1.00 0.00 ? 78  GLY A H    7  
ATOM   8179  H  HA2  . GLY A 1 14 ? 7.764   5.060   -7.192  1.00 0.00 ? 78  GLY A HA2  7  
ATOM   8180  H  HA3  . GLY A 1 14 ? 8.842   3.994   -8.081  1.00 0.00 ? 78  GLY A HA3  7  
ATOM   8181  N  N    . ASP A 1 15 ? 7.107   4.404   -10.333 1.00 0.00 ? 79  ASP A N    7  
ATOM   8182  C  CA   . ASP A 1 15 ? 6.780   5.012   -11.618 1.00 0.00 ? 79  ASP A CA   7  
ATOM   8183  C  C    . ASP A 1 15 ? 6.003   6.310   -11.422 1.00 0.00 ? 79  ASP A C    7  
ATOM   8184  O  O    . ASP A 1 15 ? 5.382   6.524   -10.381 1.00 0.00 ? 79  ASP A O    7  
ATOM   8185  C  CB   . ASP A 1 15 ? 5.967   4.040   -12.474 1.00 0.00 ? 79  ASP A CB   7  
ATOM   8186  C  CG   . ASP A 1 15 ? 6.108   4.317   -13.957 1.00 0.00 ? 79  ASP A CG   7  
ATOM   8187  O  OD1  . ASP A 1 15 ? 6.482   5.454   -14.315 1.00 0.00 ? 79  ASP A OD1  7  
ATOM   8188  O  OD2  . ASP A 1 15 ? 5.843   3.398   -14.761 1.00 0.00 ? 79  ASP A OD2  7  
ATOM   8189  H  H    . ASP A 1 15 ? 7.014   3.434   -10.226 1.00 0.00 ? 79  ASP A H    7  
ATOM   8190  H  HA   . ASP A 1 15 ? 7.707   5.234   -12.125 1.00 0.00 ? 79  ASP A HA   7  
ATOM   8191  H  HB2  . ASP A 1 15 ? 6.304   3.031   -12.282 1.00 0.00 ? 79  ASP A HB2  7  
ATOM   8192  H  HB3  . ASP A 1 15 ? 4.923   4.122   -12.208 1.00 0.00 ? 79  ASP A HB3  7  
ATOM   8193  N  N    . LYS A 1 16 ? 6.042   7.174   -12.431 1.00 0.00 ? 80  LYS A N    7  
ATOM   8194  C  CA   . LYS A 1 16 ? 5.342   8.452   -12.371 1.00 0.00 ? 80  LYS A CA   7  
ATOM   8195  C  C    . LYS A 1 16 ? 4.023   8.315   -11.618 1.00 0.00 ? 80  LYS A C    7  
ATOM   8196  O  O    . LYS A 1 16 ? 3.243   7.398   -11.875 1.00 0.00 ? 80  LYS A O    7  
ATOM   8197  C  CB   . LYS A 1 16 ? 5.083   8.981   -13.784 1.00 0.00 ? 80  LYS A CB   7  
ATOM   8198  C  CG   . LYS A 1 16 ? 3.991   8.227   -14.524 1.00 0.00 ? 80  LYS A CG   7  
ATOM   8199  C  CD   . LYS A 1 16 ? 4.097   8.426   -16.027 1.00 0.00 ? 80  LYS A CD   7  
ATOM   8200  C  CE   . LYS A 1 16 ? 2.754   8.225   -16.712 1.00 0.00 ? 80  LYS A CE   7  
ATOM   8201  N  NZ   . LYS A 1 16 ? 2.902   8.056   -18.184 1.00 0.00 ? 80  LYS A NZ   7  
ATOM   8202  H  H    . LYS A 1 16 ? 6.555   6.947   -13.235 1.00 0.00 ? 80  LYS A H    7  
ATOM   8203  H  HA   . LYS A 1 16 ? 5.973   9.152   -11.844 1.00 0.00 ? 80  LYS A HA   7  
ATOM   8204  H  HB2  . LYS A 1 16 ? 4.794   10.019  -13.719 1.00 0.00 ? 80  LYS A HB2  7  
ATOM   8205  H  HB3  . LYS A 1 16 ? 5.996   8.905   -14.357 1.00 0.00 ? 80  LYS A HB3  7  
ATOM   8206  H  HG2  . LYS A 1 16 ? 4.081   7.174   -14.305 1.00 0.00 ? 80  LYS A HG2  7  
ATOM   8207  H  HG3  . LYS A 1 16 ? 3.028   8.586   -14.190 1.00 0.00 ? 80  LYS A HG3  7  
ATOM   8208  H  HD2  . LYS A 1 16 ? 4.442   9.430   -16.225 1.00 0.00 ? 80  LYS A HD2  7  
ATOM   8209  H  HD3  . LYS A 1 16 ? 4.806   7.715   -16.427 1.00 0.00 ? 80  LYS A HD3  7  
ATOM   8210  H  HE2  . LYS A 1 16 ? 2.285   7.344   -16.302 1.00 0.00 ? 80  LYS A HE2  7  
ATOM   8211  H  HE3  . LYS A 1 16 ? 2.133   9.087   -16.517 1.00 0.00 ? 80  LYS A HE3  7  
ATOM   8212  H  HZ1  . LYS A 1 16 ? 2.626   8.931   -18.674 1.00 0.00 ? 80  LYS A HZ1  7  
ATOM   8213  H  HZ2  . LYS A 1 16 ? 2.296   7.279   -18.517 1.00 0.00 ? 80  LYS A HZ2  7  
ATOM   8214  H  HZ3  . LYS A 1 16 ? 3.890   7.835   -18.421 1.00 0.00 ? 80  LYS A HZ3  7  
ATOM   8215  N  N    . ALA A 1 17 ? 3.780   9.233   -10.689 1.00 0.00 ? 81  ALA A N    7  
ATOM   8216  C  CA   . ALA A 1 17 ? 2.553   9.217   -9.901  1.00 0.00 ? 81  ALA A CA   7  
ATOM   8217  C  C    . ALA A 1 17 ? 1.425   9.941   -10.627 1.00 0.00 ? 81  ALA A C    7  
ATOM   8218  O  O    . ALA A 1 17 ? 1.333   11.168  -10.585 1.00 0.00 ? 81  ALA A O    7  
ATOM   8219  C  CB   . ALA A 1 17 ? 2.794   9.844   -8.536  1.00 0.00 ? 81  ALA A CB   7  
ATOM   8220  H  H    . ALA A 1 17 ? 4.440   9.940   -10.530 1.00 0.00 ? 81  ALA A H    7  
ATOM   8221  H  HA   . ALA A 1 17 ? 2.267   8.185   -9.750  1.00 0.00 ? 81  ALA A HA   7  
ATOM   8222  H  HB1  . ALA A 1 17 ? 2.157   9.370   -7.805  1.00 0.00 ? 81  ALA A HB1  7  
ATOM   8223  H  HB2  . ALA A 1 17 ? 3.829   9.708   -8.256  1.00 0.00 ? 81  ALA A HB2  7  
ATOM   8224  H  HB3  . ALA A 1 17 ? 2.568   10.899  -8.580  1.00 0.00 ? 81  ALA A HB3  7  
ATOM   8225  N  N    . SER A 1 18 ? 0.567   9.174   -11.293 1.00 0.00 ? 82  SER A N    7  
ATOM   8226  C  CA   . SER A 1 18 ? -0.553  9.744   -12.032 1.00 0.00 ? 82  SER A CA   7  
ATOM   8227  C  C    . SER A 1 18 ? -1.221  10.858  -11.233 1.00 0.00 ? 82  SER A C    7  
ATOM   8228  O  O    . SER A 1 18 ? -1.430  11.961  -11.738 1.00 0.00 ? 82  SER A O    7  
ATOM   8229  C  CB   . SER A 1 18 ? -1.577  8.657   -12.366 1.00 0.00 ? 82  SER A CB   7  
ATOM   8230  O  OG   . SER A 1 18 ? -2.805  9.225   -12.786 1.00 0.00 ? 82  SER A OG   7  
ATOM   8231  H  H    . SER A 1 18 ? 0.693   8.202   -11.289 1.00 0.00 ? 82  SER A H    7  
ATOM   8232  H  HA   . SER A 1 18 ? -0.167  10.158  -12.952 1.00 0.00 ? 82  SER A HA   7  
ATOM   8233  H  HB2  . SER A 1 18 ? -1.191  8.035   -13.160 1.00 0.00 ? 82  SER A HB2  7  
ATOM   8234  H  HB3  . SER A 1 18 ? -1.754  8.052   -11.489 1.00 0.00 ? 82  SER A HB3  7  
ATOM   8235  H  HG   . SER A 1 18 ? -2.767  9.410   -13.727 1.00 0.00 ? 82  SER A HG   7  
ATOM   8236  N  N    . GLY A 1 19 ? -1.553  10.562  -9.980  1.00 0.00 ? 83  GLY A N    7  
ATOM   8237  C  CA   . GLY A 1 19 ? -2.194  11.549  -9.130  1.00 0.00 ? 83  GLY A CA   7  
ATOM   8238  C  C    . GLY A 1 19 ? -2.206  11.136  -7.671  1.00 0.00 ? 83  GLY A C    7  
ATOM   8239  O  O    . GLY A 1 19 ? -1.357  10.361  -7.230  1.00 0.00 ? 83  GLY A O    7  
ATOM   8240  H  H    . GLY A 1 19 ? -1.362  9.667   -9.630  1.00 0.00 ? 83  GLY A H    7  
ATOM   8241  H  HA2  . GLY A 1 19 ? -1.667  12.486  -9.224  1.00 0.00 ? 83  GLY A HA2  7  
ATOM   8242  H  HA3  . GLY A 1 19 ? -3.213  11.685  -9.461  1.00 0.00 ? 83  GLY A HA3  7  
ATOM   8243  N  N    . PHE A 1 20 ? -3.170  11.657  -6.919  1.00 0.00 ? 84  PHE A N    7  
ATOM   8244  C  CA   . PHE A 1 20 ? -3.288  11.340  -5.500  1.00 0.00 ? 84  PHE A CA   7  
ATOM   8245  C  C    . PHE A 1 20 ? -4.511  10.467  -5.237  1.00 0.00 ? 84  PHE A C    7  
ATOM   8246  O  O    . PHE A 1 20 ? -5.609  10.971  -5.001  1.00 0.00 ? 84  PHE A O    7  
ATOM   8247  C  CB   . PHE A 1 20 ? -3.378  12.626  -4.675  1.00 0.00 ? 84  PHE A CB   7  
ATOM   8248  C  CG   . PHE A 1 20 ? -2.924  12.459  -3.253  1.00 0.00 ? 84  PHE A CG   7  
ATOM   8249  C  CD1  . PHE A 1 20 ? -1.731  11.816  -2.964  1.00 0.00 ? 84  PHE A CD1  7  
ATOM   8250  C  CD2  . PHE A 1 20 ? -3.690  12.944  -2.206  1.00 0.00 ? 84  PHE A CD2  7  
ATOM   8251  C  CE1  . PHE A 1 20 ? -1.311  11.660  -1.657  1.00 0.00 ? 84  PHE A CE1  7  
ATOM   8252  C  CE2  . PHE A 1 20 ? -3.275  12.791  -0.896  1.00 0.00 ? 84  PHE A CE2  7  
ATOM   8253  C  CZ   . PHE A 1 20 ? -2.084  12.150  -0.621  1.00 0.00 ? 84  PHE A CZ   7  
ATOM   8254  H  H    . PHE A 1 20 ? -3.818  12.269  -7.328  1.00 0.00 ? 84  PHE A H    7  
ATOM   8255  H  HA   . PHE A 1 20 ? -2.403  10.797  -5.208  1.00 0.00 ? 84  PHE A HA   7  
ATOM   8256  H  HB2  . PHE A 1 20 ? -2.760  13.383  -5.133  1.00 0.00 ? 84  PHE A HB2  7  
ATOM   8257  H  HB3  . PHE A 1 20 ? -4.403  12.963  -4.660  1.00 0.00 ? 84  PHE A HB3  7  
ATOM   8258  H  HD1  . PHE A 1 20 ? -1.125  11.434  -3.773  1.00 0.00 ? 84  PHE A HD1  7  
ATOM   8259  H  HD2  . PHE A 1 20 ? -4.623  13.447  -2.420  1.00 0.00 ? 84  PHE A HD2  7  
ATOM   8260  H  HE1  . PHE A 1 20 ? -0.379  11.158  -1.444  1.00 0.00 ? 84  PHE A HE1  7  
ATOM   8261  H  HE2  . PHE A 1 20 ? -3.882  13.175  -0.089  1.00 0.00 ? 84  PHE A HE2  7  
ATOM   8262  H  HZ   . PHE A 1 20 ? -1.758  12.029  0.401   1.00 0.00 ? 84  PHE A HZ   7  
ATOM   8263  N  N    . HIS A 1 21 ? -4.313  9.153   -5.281  1.00 0.00 ? 85  HIS A N    7  
ATOM   8264  C  CA   . HIS A 1 21 ? -5.399  8.208   -5.047  1.00 0.00 ? 85  HIS A CA   7  
ATOM   8265  C  C    . HIS A 1 21 ? -5.252  7.537   -3.685  1.00 0.00 ? 85  HIS A C    7  
ATOM   8266  O  O    . HIS A 1 21 ? -4.148  7.176   -3.276  1.00 0.00 ? 85  HIS A O    7  
ATOM   8267  C  CB   . HIS A 1 21 ? -5.428  7.149   -6.150  1.00 0.00 ? 85  HIS A CB   7  
ATOM   8268  C  CG   . HIS A 1 21 ? -5.356  7.722   -7.532  1.00 0.00 ? 85  HIS A CG   7  
ATOM   8269  N  ND1  . HIS A 1 21 ? -6.428  8.330   -8.151  1.00 0.00 ? 85  HIS A ND1  7  
ATOM   8270  C  CD2  . HIS A 1 21 ? -4.332  7.778   -8.415  1.00 0.00 ? 85  HIS A CD2  7  
ATOM   8271  C  CE1  . HIS A 1 21 ? -6.067  8.734   -9.356  1.00 0.00 ? 85  HIS A CE1  7  
ATOM   8272  N  NE2  . HIS A 1 21 ? -4.799  8.411   -9.541  1.00 0.00 ? 85  HIS A NE2  7  
ATOM   8273  H  H    . HIS A 1 21 ? -3.415  8.811   -5.474  1.00 0.00 ? 85  HIS A H    7  
ATOM   8274  H  HA   . HIS A 1 21 ? -6.327  8.759   -5.065  1.00 0.00 ? 85  HIS A HA   7  
ATOM   8275  H  HB2  . HIS A 1 21 ? -4.586  6.484   -6.023  1.00 0.00 ? 85  HIS A HB2  7  
ATOM   8276  H  HB3  . HIS A 1 21 ? -6.344  6.582   -6.072  1.00 0.00 ? 85  HIS A HB3  7  
ATOM   8277  H  HD1  . HIS A 1 21 ? -7.321  8.447   -7.765  1.00 0.00 ? 85  HIS A HD1  7  
ATOM   8278  H  HD2  . HIS A 1 21 ? -3.333  7.395   -8.264  1.00 0.00 ? 85  HIS A HD2  7  
ATOM   8279  H  HE1  . HIS A 1 21 ? -6.699  9.242   -10.068 1.00 0.00 ? 85  HIS A HE1  7  
ATOM   8280  N  N    . TYR A 1 22 ? -6.370  7.373   -2.987  1.00 0.00 ? 86  TYR A N    7  
ATOM   8281  C  CA   . TYR A 1 22 ? -6.365  6.749   -1.670  1.00 0.00 ? 86  TYR A CA   7  
ATOM   8282  C  C    . TYR A 1 22 ? -5.458  7.511   -0.709  1.00 0.00 ? 86  TYR A C    7  
ATOM   8283  O  O    . TYR A 1 22 ? -4.776  6.916   0.124   1.00 0.00 ? 86  TYR A O    7  
ATOM   8284  C  CB   . TYR A 1 22 ? -5.907  5.293   -1.774  1.00 0.00 ? 86  TYR A CB   7  
ATOM   8285  C  CG   . TYR A 1 22 ? -6.523  4.546   -2.936  1.00 0.00 ? 86  TYR A CG   7  
ATOM   8286  C  CD1  . TYR A 1 22 ? -7.747  3.903   -2.802  1.00 0.00 ? 86  TYR A CD1  7  
ATOM   8287  C  CD2  . TYR A 1 22 ? -5.881  4.482   -4.166  1.00 0.00 ? 86  TYR A CD2  7  
ATOM   8288  C  CE1  . TYR A 1 22 ? -8.314  3.218   -3.860  1.00 0.00 ? 86  TYR A CE1  7  
ATOM   8289  C  CE2  . TYR A 1 22 ? -6.440  3.802   -5.230  1.00 0.00 ? 86  TYR A CE2  7  
ATOM   8290  C  CZ   . TYR A 1 22 ? -7.657  3.171   -5.072  1.00 0.00 ? 86  TYR A CZ   7  
ATOM   8291  O  OH   . TYR A 1 22 ? -8.217  2.491   -6.129  1.00 0.00 ? 86  TYR A OH   7  
ATOM   8292  H  H    . TYR A 1 22 ? -7.220  7.682   -3.366  1.00 0.00 ? 86  TYR A H    7  
ATOM   8293  H  HA   . TYR A 1 22 ? -7.375  6.771   -1.288  1.00 0.00 ? 86  TYR A HA   7  
ATOM   8294  H  HB2  . TYR A 1 22 ? -4.835  5.268   -1.896  1.00 0.00 ? 86  TYR A HB2  7  
ATOM   8295  H  HB3  . TYR A 1 22 ? -6.173  4.773   -0.866  1.00 0.00 ? 86  TYR A HB3  7  
ATOM   8296  H  HD1  . TYR A 1 22 ? -8.260  3.942   -1.852  1.00 0.00 ? 86  TYR A HD1  7  
ATOM   8297  H  HD2  . TYR A 1 22 ? -4.928  4.977   -4.286  1.00 0.00 ? 86  TYR A HD2  7  
ATOM   8298  H  HE1  . TYR A 1 22 ? -9.267  2.725   -3.737  1.00 0.00 ? 86  TYR A HE1  7  
ATOM   8299  H  HE2  . TYR A 1 22 ? -5.926  3.764   -6.179  1.00 0.00 ? 86  TYR A HE2  7  
ATOM   8300  H  HH   . TYR A 1 22 ? -7.627  1.785   -6.403  1.00 0.00 ? 86  TYR A HH   7  
ATOM   8301  N  N    . GLY A 1 23 ? -5.458  8.835   -0.831  1.00 0.00 ? 87  GLY A N    7  
ATOM   8302  C  CA   . GLY A 1 23 ? -4.632  9.660   0.032   1.00 0.00 ? 87  GLY A CA   7  
ATOM   8303  C  C    . GLY A 1 23 ? -3.158  9.332   -0.090  1.00 0.00 ? 87  GLY A C    7  
ATOM   8304  O  O    . GLY A 1 23 ? -2.368  9.649   0.799   1.00 0.00 ? 87  GLY A O    7  
ATOM   8305  H  H    . GLY A 1 23 ? -6.022  9.256   -1.513  1.00 0.00 ? 87  GLY A H    7  
ATOM   8306  H  HA2  . GLY A 1 23 ? -4.783  10.697  -0.227  1.00 0.00 ? 87  GLY A HA2  7  
ATOM   8307  H  HA3  . GLY A 1 23 ? -4.939  9.507   1.057   1.00 0.00 ? 87  GLY A HA3  7  
ATOM   8308  N  N    . VAL A 1 24 ? -2.784  8.694   -1.195  1.00 0.00 ? 88  VAL A N    7  
ATOM   8309  C  CA   . VAL A 1 24 ? -1.394  8.322   -1.430  1.00 0.00 ? 88  VAL A CA   7  
ATOM   8310  C  C    . VAL A 1 24 ? -1.012  8.524   -2.892  1.00 0.00 ? 88  VAL A C    7  
ATOM   8311  O  O    . VAL A 1 24 ? -1.787  8.212   -3.797  1.00 0.00 ? 88  VAL A O    7  
ATOM   8312  C  CB   . VAL A 1 24 ? -1.132  6.855   -1.040  1.00 0.00 ? 88  VAL A CB   7  
ATOM   8313  C  CG1  . VAL A 1 24 ? -2.151  5.937   -1.697  1.00 0.00 ? 88  VAL A CG1  7  
ATOM   8314  C  CG2  . VAL A 1 24 ? 0.285   6.450   -1.418  1.00 0.00 ? 88  VAL A CG2  7  
ATOM   8315  H  H    . VAL A 1 24 ? -3.460  8.468   -1.868  1.00 0.00 ? 88  VAL A H    7  
ATOM   8316  H  HA   . VAL A 1 24 ? -0.771  8.954   -0.815  1.00 0.00 ? 88  VAL A HA   7  
ATOM   8317  H  HB   . VAL A 1 24 ? -1.236  6.765   0.031   1.00 0.00 ? 88  VAL A HB   7  
ATOM   8318  H  HG11 . VAL A 1 24 ? -2.225  6.176   -2.748  1.00 0.00 ? 88  VAL A HG11 7  
ATOM   8319  H  HG12 . VAL A 1 24 ? -1.837  4.910   -1.582  1.00 0.00 ? 88  VAL A HG12 7  
ATOM   8320  H  HG13 . VAL A 1 24 ? -3.114  6.075   -1.228  1.00 0.00 ? 88  VAL A HG13 7  
ATOM   8321  H  HG21 . VAL A 1 24 ? 0.747   5.939   -0.586  1.00 0.00 ? 88  VAL A HG21 7  
ATOM   8322  H  HG22 . VAL A 1 24 ? 0.254   5.792   -2.273  1.00 0.00 ? 88  VAL A HG22 7  
ATOM   8323  H  HG23 . VAL A 1 24 ? 0.860   7.332   -1.662  1.00 0.00 ? 88  VAL A HG23 7  
ATOM   8324  N  N    . HIS A 1 25 ? 0.189   9.047   -3.117  1.00 0.00 ? 89  HIS A N    7  
ATOM   8325  C  CA   . HIS A 1 25 ? 0.676   9.290   -4.471  1.00 0.00 ? 89  HIS A CA   7  
ATOM   8326  C  C    . HIS A 1 25 ? 1.013   7.977   -5.171  1.00 0.00 ? 89  HIS A C    7  
ATOM   8327  O  O    . HIS A 1 25 ? 2.137   7.485   -5.081  1.00 0.00 ? 89  HIS A O    7  
ATOM   8328  C  CB   . HIS A 1 25 ? 1.909   10.194  -4.437  1.00 0.00 ? 89  HIS A CB   7  
ATOM   8329  C  CG   . HIS A 1 25 ? 1.580   11.655  -4.465  1.00 0.00 ? 89  HIS A CG   7  
ATOM   8330  N  ND1  . HIS A 1 25 ? 1.809   12.498  -3.397  1.00 0.00 ? 89  HIS A ND1  7  
ATOM   8331  C  CD2  . HIS A 1 25 ? 1.040   12.423  -5.439  1.00 0.00 ? 89  HIS A CD2  7  
ATOM   8332  C  CE1  . HIS A 1 25 ? 1.421   13.720  -3.713  1.00 0.00 ? 89  HIS A CE1  7  
ATOM   8333  N  NE2  . HIS A 1 25 ? 0.951   13.702  -4.948  1.00 0.00 ? 89  HIS A NE2  7  
ATOM   8334  H  H    . HIS A 1 25 ? 0.761   9.275   -2.355  1.00 0.00 ? 89  HIS A H    7  
ATOM   8335  H  HA   . HIS A 1 25 ? -0.109  9.786   -5.021  1.00 0.00 ? 89  HIS A HA   7  
ATOM   8336  H  HB2  . HIS A 1 25 ? 2.467   9.997   -3.534  1.00 0.00 ? 89  HIS A HB2  7  
ATOM   8337  H  HB3  . HIS A 1 25 ? 2.530   9.977   -5.294  1.00 0.00 ? 89  HIS A HB3  7  
ATOM   8338  H  HD1  . HIS A 1 25 ? 2.195   12.238  -2.535  1.00 0.00 ? 89  HIS A HD1  7  
ATOM   8339  H  HD2  . HIS A 1 25 ? 0.734   12.092  -6.422  1.00 0.00 ? 89  HIS A HD2  7  
ATOM   8340  H  HE1  . HIS A 1 25 ? 1.479   14.587  -3.073  1.00 0.00 ? 89  HIS A HE1  7  
ATOM   8341  N  N    . ALA A 1 26 ? 0.030   7.414   -5.866  1.00 0.00 ? 90  ALA A N    7  
ATOM   8342  C  CA   . ALA A 1 26 ? 0.223   6.159   -6.582  1.00 0.00 ? 90  ALA A CA   7  
ATOM   8343  C  C    . ALA A 1 26 ? 0.053   6.352   -8.085  1.00 0.00 ? 90  ALA A C    7  
ATOM   8344  O  O    . ALA A 1 26 ? -0.364  7.418   -8.541  1.00 0.00 ? 90  ALA A O    7  
ATOM   8345  C  CB   . ALA A 1 26 ? -0.748  5.105   -6.071  1.00 0.00 ? 90  ALA A CB   7  
ATOM   8346  H  H    . ALA A 1 26 ? -0.845  7.854   -5.900  1.00 0.00 ? 90  ALA A H    7  
ATOM   8347  H  HA   . ALA A 1 26 ? 1.227   5.813   -6.386  1.00 0.00 ? 90  ALA A HA   7  
ATOM   8348  H  HB1  . ALA A 1 26 ? -1.744  5.522   -6.032  1.00 0.00 ? 90  ALA A HB1  7  
ATOM   8349  H  HB2  . ALA A 1 26 ? -0.739  4.255   -6.737  1.00 0.00 ? 90  ALA A HB2  7  
ATOM   8350  H  HB3  . ALA A 1 26 ? -0.450  4.791   -5.082  1.00 0.00 ? 90  ALA A HB3  7  
ATOM   8351  N  N    . CYS A 1 27 ? 0.377   5.316   -8.851  1.00 0.00 ? 91  CYS A N    7  
ATOM   8352  C  CA   . CYS A 1 27 ? 0.262   5.372   -10.303 1.00 0.00 ? 91  CYS A CA   7  
ATOM   8353  C  C    . CYS A 1 27 ? -0.982  4.628   -10.779 1.00 0.00 ? 91  CYS A C    7  
ATOM   8354  O  O    . CYS A 1 27 ? -1.637  3.933   -10.002 1.00 0.00 ? 91  CYS A O    7  
ATOM   8355  C  CB   . CYS A 1 27 ? 1.509   4.774   -10.958 1.00 0.00 ? 91  CYS A CB   7  
ATOM   8356  S  SG   . CYS A 1 27 ? 1.645   2.966   -10.785 1.00 0.00 ? 91  CYS A SG   7  
ATOM   8357  H  H    . CYS A 1 27 ? 0.703   4.493   -8.429  1.00 0.00 ? 91  CYS A H    7  
ATOM   8358  H  HA   . CYS A 1 27 ? 0.177   6.409   -10.590 1.00 0.00 ? 91  CYS A HA   7  
ATOM   8359  H  HB2  . CYS A 1 27 ? 1.495   5.002   -12.014 1.00 0.00 ? 91  CYS A HB2  7  
ATOM   8360  H  HB3  . CYS A 1 27 ? 2.387   5.215   -10.511 1.00 0.00 ? 91  CYS A HB3  7  
ATOM   8361  N  N    . GLU A 1 28 ? -1.302  4.779   -12.061 1.00 0.00 ? 92  GLU A N    7  
ATOM   8362  C  CA   . GLU A 1 28 ? -2.468  4.121   -12.639 1.00 0.00 ? 92  GLU A CA   7  
ATOM   8363  C  C    . GLU A 1 28 ? -2.371  2.606   -12.484 1.00 0.00 ? 92  GLU A C    7  
ATOM   8364  O  O    . GLU A 1 28 ? -3.313  1.956   -12.033 1.00 0.00 ? 92  GLU A O    7  
ATOM   8365  C  CB   . GLU A 1 28 ? -2.605  4.486   -14.119 1.00 0.00 ? 92  GLU A CB   7  
ATOM   8366  C  CG   . GLU A 1 28 ? -3.411  5.750   -14.362 1.00 0.00 ? 92  GLU A CG   7  
ATOM   8367  C  CD   . GLU A 1 28 ? -4.906  5.493   -14.386 1.00 0.00 ? 92  GLU A CD   7  
ATOM   8368  O  OE1  . GLU A 1 28 ? -5.383  4.696   -13.551 1.00 0.00 ? 92  GLU A OE1  7  
ATOM   8369  O  OE2  . GLU A 1 28 ? -5.597  6.088   -15.238 1.00 0.00 ? 92  GLU A OE2  7  
ATOM   8370  H  H    . GLU A 1 28 ? -0.741  5.346   -12.630 1.00 0.00 ? 92  GLU A H    7  
ATOM   8371  H  HA   . GLU A 1 28 ? -3.342  4.470   -12.110 1.00 0.00 ? 92  GLU A HA   7  
ATOM   8372  H  HB2  . GLU A 1 28 ? -1.618  4.627   -14.535 1.00 0.00 ? 92  GLU A HB2  7  
ATOM   8373  H  HB3  . GLU A 1 28 ? -3.090  3.670   -14.634 1.00 0.00 ? 92  GLU A HB3  7  
ATOM   8374  H  HG2  . GLU A 1 28 ? -3.196  6.457   -13.575 1.00 0.00 ? 92  GLU A HG2  7  
ATOM   8375  H  HG3  . GLU A 1 28 ? -3.119  6.172   -15.312 1.00 0.00 ? 92  GLU A HG3  7  
ATOM   8376  N  N    . GLY A 1 29 ? -1.223  2.051   -12.863 1.00 0.00 ? 93  GLY A N    7  
ATOM   8377  C  CA   . GLY A 1 29 ? -1.024  0.617   -12.759 1.00 0.00 ? 93  GLY A CA   7  
ATOM   8378  C  C    . GLY A 1 29 ? -1.389  0.078   -11.390 1.00 0.00 ? 93  GLY A C    7  
ATOM   8379  O  O    . GLY A 1 29 ? -2.407  -0.596  -11.231 1.00 0.00 ? 93  GLY A O    7  
ATOM   8380  H  H    . GLY A 1 29 ? -0.507  2.619   -13.215 1.00 0.00 ? 93  GLY A H    7  
ATOM   8381  H  HA2  . GLY A 1 29 ? -1.633  0.125   -13.502 1.00 0.00 ? 93  GLY A HA2  7  
ATOM   8382  H  HA3  . GLY A 1 29 ? 0.015   0.395   -12.955 1.00 0.00 ? 93  GLY A HA3  7  
ATOM   8383  N  N    . CYS A 1 30 ? -0.555  0.374   -10.398 1.00 0.00 ? 94  CYS A N    7  
ATOM   8384  C  CA   . CYS A 1 30 ? -0.794  -0.087  -9.036  1.00 0.00 ? 94  CYS A CA   7  
ATOM   8385  C  C    . CYS A 1 30 ? -2.269  0.040   -8.669  1.00 0.00 ? 94  CYS A C    7  
ATOM   8386  O  O    . CYS A 1 30 ? -2.908  -0.935  -8.271  1.00 0.00 ? 94  CYS A O    7  
ATOM   8387  C  CB   . CYS A 1 30 ? 0.059   0.712   -8.048  1.00 0.00 ? 94  CYS A CB   7  
ATOM   8388  S  SG   . CYS A 1 30 ? 1.848   0.398   -8.186  1.00 0.00 ? 94  CYS A SG   7  
ATOM   8389  H  H    . CYS A 1 30 ? 0.240   0.915   -10.587 1.00 0.00 ? 94  CYS A H    7  
ATOM   8390  H  HA   . CYS A 1 30 ? -0.510  -1.127  -8.983  1.00 0.00 ? 94  CYS A HA   7  
ATOM   8391  H  HB2  . CYS A 1 30 ? -0.102  1.767   -8.218  1.00 0.00 ? 94  CYS A HB2  7  
ATOM   8392  H  HB3  . CYS A 1 30 ? -0.242  0.465   -7.041  1.00 0.00 ? 94  CYS A HB3  7  
ATOM   8393  N  N    . LYS A 1 31 ? -2.806  1.247   -8.806  1.00 0.00 ? 95  LYS A N    7  
ATOM   8394  C  CA   . LYS A 1 31 ? -4.206  1.503   -8.491  1.00 0.00 ? 95  LYS A CA   7  
ATOM   8395  C  C    . LYS A 1 31 ? -5.079  0.317   -8.887  1.00 0.00 ? 95  LYS A C    7  
ATOM   8396  O  O    . LYS A 1 31 ? -5.868  -0.181  -8.085  1.00 0.00 ? 95  LYS A O    7  
ATOM   8397  C  CB   . LYS A 1 31 ? -4.689  2.766   -9.208  1.00 0.00 ? 95  LYS A CB   7  
ATOM   8398  C  CG   . LYS A 1 31 ? -6.195  2.955   -9.160  1.00 0.00 ? 95  LYS A CG   7  
ATOM   8399  C  CD   . LYS A 1 31 ? -6.638  4.127   -10.020 1.00 0.00 ? 95  LYS A CD   7  
ATOM   8400  C  CE   . LYS A 1 31 ? -6.570  5.438   -9.252  1.00 0.00 ? 95  LYS A CE   7  
ATOM   8401  N  NZ   . LYS A 1 31 ? -7.825  5.704   -8.496  1.00 0.00 ? 95  LYS A NZ   7  
ATOM   8402  H  H    . LYS A 1 31 ? -2.246  1.985   -9.128  1.00 0.00 ? 95  LYS A H    7  
ATOM   8403  H  HA   . LYS A 1 31 ? -4.285  1.652   -7.425  1.00 0.00 ? 95  LYS A HA   7  
ATOM   8404  H  HB2  . LYS A 1 31 ? -4.224  3.626   -8.748  1.00 0.00 ? 95  LYS A HB2  7  
ATOM   8405  H  HB3  . LYS A 1 31 ? -4.386  2.716   -10.244 1.00 0.00 ? 95  LYS A HB3  7  
ATOM   8406  H  HG2  . LYS A 1 31 ? -6.673  2.057   -9.521  1.00 0.00 ? 95  LYS A HG2  7  
ATOM   8407  H  HG3  . LYS A 1 31 ? -6.494  3.137   -8.137  1.00 0.00 ? 95  LYS A HG3  7  
ATOM   8408  H  HD2  . LYS A 1 31 ? -5.992  4.194   -10.882 1.00 0.00 ? 95  LYS A HD2  7  
ATOM   8409  H  HD3  . LYS A 1 31 ? -7.656  3.961   -10.342 1.00 0.00 ? 95  LYS A HD3  7  
ATOM   8410  H  HE2  . LYS A 1 31 ? -5.745  5.392   -8.559  1.00 0.00 ? 95  LYS A HE2  7  
ATOM   8411  H  HE3  . LYS A 1 31 ? -6.406  6.243   -9.954  1.00 0.00 ? 95  LYS A HE3  7  
ATOM   8412  H  HZ1  . LYS A 1 31 ? -7.617  6.263   -7.644  1.00 0.00 ? 95  LYS A HZ1  7  
ATOM   8413  H  HZ2  . LYS A 1 31 ? -8.266  4.806   -8.209  1.00 0.00 ? 95  LYS A HZ2  7  
ATOM   8414  H  HZ3  . LYS A 1 31 ? -8.495  6.232   -9.090  1.00 0.00 ? 95  LYS A HZ3  7  
ATOM   8415  N  N    . GLY A 1 32 ? -4.930  -0.133  -10.130 1.00 0.00 ? 96  GLY A N    7  
ATOM   8416  C  CA   . GLY A 1 32 ? -5.710  -1.259  -10.609 1.00 0.00 ? 96  GLY A CA   7  
ATOM   8417  C  C    . GLY A 1 32 ? -5.549  -2.489  -9.738  1.00 0.00 ? 96  GLY A C    7  
ATOM   8418  O  O    . GLY A 1 32 ? -6.532  -3.135  -9.376  1.00 0.00 ? 96  GLY A O    7  
ATOM   8419  H  H    . GLY A 1 32 ? -4.285  0.303   -10.725 1.00 0.00 ? 96  GLY A H    7  
ATOM   8420  H  HA2  . GLY A 1 32 ? -6.752  -0.978  -10.629 1.00 0.00 ? 96  GLY A HA2  7  
ATOM   8421  H  HA3  . GLY A 1 32 ? -5.393  -1.500  -11.614 1.00 0.00 ? 96  GLY A HA3  7  
ATOM   8422  N  N    . PHE A 1 33 ? -4.305  -2.816  -9.403  1.00 0.00 ? 97  PHE A N    7  
ATOM   8423  C  CA   . PHE A 1 33 ? -4.019  -3.979  -8.571  1.00 0.00 ? 97  PHE A CA   7  
ATOM   8424  C  C    . PHE A 1 33 ? -4.690  -3.850  -7.207  1.00 0.00 ? 97  PHE A C    7  
ATOM   8425  O  O    . PHE A 1 33 ? -5.453  -4.724  -6.793  1.00 0.00 ? 97  PHE A O    7  
ATOM   8426  C  CB   . PHE A 1 33 ? -2.508  -4.146  -8.394  1.00 0.00 ? 97  PHE A CB   7  
ATOM   8427  C  CG   . PHE A 1 33 ? -2.135  -5.193  -7.385  1.00 0.00 ? 97  PHE A CG   7  
ATOM   8428  C  CD1  . PHE A 1 33 ? -2.073  -6.530  -7.744  1.00 0.00 ? 97  PHE A CD1  7  
ATOM   8429  C  CD2  . PHE A 1 33 ? -1.845  -4.841  -6.076  1.00 0.00 ? 97  PHE A CD2  7  
ATOM   8430  C  CE1  . PHE A 1 33 ? -1.731  -7.496  -6.816  1.00 0.00 ? 97  PHE A CE1  7  
ATOM   8431  C  CE2  . PHE A 1 33 ? -1.501  -5.802  -5.144  1.00 0.00 ? 97  PHE A CE2  7  
ATOM   8432  C  CZ   . PHE A 1 33 ? -1.443  -7.131  -5.515  1.00 0.00 ? 97  PHE A CZ   7  
ATOM   8433  H  H    . PHE A 1 33 ? -3.563  -2.262  -9.723  1.00 0.00 ? 97  PHE A H    7  
ATOM   8434  H  HA   . PHE A 1 33 ? -4.412  -4.849  -9.072  1.00 0.00 ? 97  PHE A HA   7  
ATOM   8435  H  HB2  . PHE A 1 33 ? -2.071  -4.428  -9.341  1.00 0.00 ? 97  PHE A HB2  7  
ATOM   8436  H  HB3  . PHE A 1 33 ? -2.084  -3.207  -8.073  1.00 0.00 ? 97  PHE A HB3  7  
ATOM   8437  H  HD1  . PHE A 1 33 ? -2.296  -6.817  -8.761  1.00 0.00 ? 97  PHE A HD1  7  
ATOM   8438  H  HD2  . PHE A 1 33 ? -1.890  -3.801  -5.785  1.00 0.00 ? 97  PHE A HD2  7  
ATOM   8439  H  HE1  . PHE A 1 33 ? -1.686  -8.534  -7.109  1.00 0.00 ? 97  PHE A HE1  7  
ATOM   8440  H  HE2  . PHE A 1 33 ? -1.277  -5.513  -4.128  1.00 0.00 ? 97  PHE A HE2  7  
ATOM   8441  H  HZ   . PHE A 1 33 ? -1.176  -7.884  -4.789  1.00 0.00 ? 97  PHE A HZ   7  
ATOM   8442  N  N    . PHE A 1 34 ? -4.400  -2.756  -6.511  1.00 0.00 ? 98  PHE A N    7  
ATOM   8443  C  CA   . PHE A 1 34 ? -4.973  -2.513  -5.193  1.00 0.00 ? 98  PHE A CA   7  
ATOM   8444  C  C    . PHE A 1 34 ? -6.494  -2.640  -5.229  1.00 0.00 ? 98  PHE A C    7  
ATOM   8445  O  O    . PHE A 1 34 ? -7.073  -3.488  -4.549  1.00 0.00 ? 98  PHE A O    7  
ATOM   8446  C  CB   . PHE A 1 34 ? -4.579  -1.123  -4.690  1.00 0.00 ? 98  PHE A CB   7  
ATOM   8447  C  CG   . PHE A 1 34 ? -5.281  -0.721  -3.424  1.00 0.00 ? 98  PHE A CG   7  
ATOM   8448  C  CD1  . PHE A 1 34 ? -4.930  -1.291  -2.211  1.00 0.00 ? 98  PHE A CD1  7  
ATOM   8449  C  CD2  . PHE A 1 34 ? -6.293  0.225   -3.448  1.00 0.00 ? 98  PHE A CD2  7  
ATOM   8450  C  CE1  . PHE A 1 34 ? -5.574  -0.924  -1.044  1.00 0.00 ? 98  PHE A CE1  7  
ATOM   8451  C  CE2  . PHE A 1 34 ? -6.940  0.596   -2.285  1.00 0.00 ? 98  PHE A CE2  7  
ATOM   8452  C  CZ   . PHE A 1 34 ? -6.581  0.020   -1.082  1.00 0.00 ? 98  PHE A CZ   7  
ATOM   8453  H  H    . PHE A 1 34 ? -3.784  -2.096  -6.894  1.00 0.00 ? 98  PHE A H    7  
ATOM   8454  H  HA   . PHE A 1 34 ? -4.578  -3.256  -4.518  1.00 0.00 ? 98  PHE A HA   7  
ATOM   8455  H  HB2  . PHE A 1 34 ? -3.517  -1.105  -4.499  1.00 0.00 ? 98  PHE A HB2  7  
ATOM   8456  H  HB3  . PHE A 1 34 ? -4.817  -0.393  -5.449  1.00 0.00 ? 98  PHE A HB3  7  
ATOM   8457  H  HD1  . PHE A 1 34 ? -4.142  -2.031  -2.181  1.00 0.00 ? 98  PHE A HD1  7  
ATOM   8458  H  HD2  . PHE A 1 34 ? -6.576  0.675   -4.388  1.00 0.00 ? 98  PHE A HD2  7  
ATOM   8459  H  HE1  . PHE A 1 34 ? -5.290  -1.376  -0.106  1.00 0.00 ? 98  PHE A HE1  7  
ATOM   8460  H  HE2  . PHE A 1 34 ? -7.727  1.335   -2.316  1.00 0.00 ? 98  PHE A HE2  7  
ATOM   8461  H  HZ   . PHE A 1 34 ? -7.085  0.309   -0.171  1.00 0.00 ? 98  PHE A HZ   7  
ATOM   8462  N  N    . ARG A 1 35 ? -7.134  -1.792  -6.027  1.00 0.00 ? 99  ARG A N    7  
ATOM   8463  C  CA   . ARG A 1 35 ? -8.586  -1.808  -6.152  1.00 0.00 ? 99  ARG A CA   7  
ATOM   8464  C  C    . ARG A 1 35 ? -9.088  -3.210  -6.483  1.00 0.00 ? 99  ARG A C    7  
ATOM   8465  O  O    . ARG A 1 35 ? -9.962  -3.744  -5.801  1.00 0.00 ? 99  ARG A O    7  
ATOM   8466  C  CB   . ARG A 1 35 ? -9.037  -0.824  -7.233  1.00 0.00 ? 99  ARG A CB   7  
ATOM   8467  C  CG   . ARG A 1 35 ? -10.547 -0.736  -7.385  1.00 0.00 ? 99  ARG A CG   7  
ATOM   8468  C  CD   . ARG A 1 35 ? -10.959 0.515   -8.144  1.00 0.00 ? 99  ARG A CD   7  
ATOM   8469  N  NE   . ARG A 1 35 ? -11.116 1.666   -7.258  1.00 0.00 ? 99  ARG A NE   7  
ATOM   8470  C  CZ   . ARG A 1 35 ? -11.272 2.912   -7.692  1.00 0.00 ? 99  ARG A CZ   7  
ATOM   8471  N  NH1  . ARG A 1 35 ? -11.293 3.166   -8.993  1.00 0.00 ? 99  ARG A NH1  7  
ATOM   8472  N  NH2  . ARG A 1 35 ? -11.409 3.906   -6.824  1.00 0.00 ? 99  ARG A NH2  7  
ATOM   8473  H  H    . ARG A 1 35 ? -6.617  -1.139  -6.545  1.00 0.00 ? 99  ARG A H    7  
ATOM   8474  H  HA   . ARG A 1 35 ? -9.004  -1.503  -5.204  1.00 0.00 ? 99  ARG A HA   7  
ATOM   8475  H  HB2  . ARG A 1 35 ? -8.665  0.159   -6.987  1.00 0.00 ? 99  ARG A HB2  7  
ATOM   8476  H  HB3  . ARG A 1 35 ? -8.620  -1.132  -8.180  1.00 0.00 ? 99  ARG A HB3  7  
ATOM   8477  H  HG2  . ARG A 1 35 ? -10.897 -1.603  -7.926  1.00 0.00 ? 99  ARG A HG2  7  
ATOM   8478  H  HG3  . ARG A 1 35 ? -10.997 -0.716  -6.403  1.00 0.00 ? 99  ARG A HG3  7  
ATOM   8479  H  HD2  . ARG A 1 35 ? -10.201 0.740   -8.879  1.00 0.00 ? 99  ARG A HD2  7  
ATOM   8480  H  HD3  . ARG A 1 35 ? -11.898 0.325   -8.642  1.00 0.00 ? 99  ARG A HD3  7  
ATOM   8481  H  HE   . ARG A 1 35 ? -11.104 1.500   -6.293  1.00 0.00 ? 99  ARG A HE   7  
ATOM   8482  H  HH11 . ARG A 1 35 ? -11.192 2.419   -9.650  1.00 0.00 ? 99  ARG A HH11 7  
ATOM   8483  H  HH12 . ARG A 1 35 ? -11.413 4.105   -9.318  1.00 0.00 ? 99  ARG A HH12 7  
ATOM   8484  H  HH21 . ARG A 1 35 ? -11.394 3.718   -5.843  1.00 0.00 ? 99  ARG A HH21 7  
ATOM   8485  H  HH22 . ARG A 1 35 ? -11.527 4.843   -7.152  1.00 0.00 ? 99  ARG A HH22 7  
ATOM   8486  N  N    . ARG A 1 36 ? -8.529  -3.800  -7.535  1.00 0.00 ? 100 ARG A N    7  
ATOM   8487  C  CA   . ARG A 1 36 ? -8.922  -5.139  -7.958  1.00 0.00 ? 100 ARG A CA   7  
ATOM   8488  C  C    . ARG A 1 36 ? -8.982  -6.090  -6.766  1.00 0.00 ? 100 ARG A C    7  
ATOM   8489  O  O    . ARG A 1 36 ? -9.954  -6.826  -6.593  1.00 0.00 ? 100 ARG A O    7  
ATOM   8490  C  CB   . ARG A 1 36 ? -7.940  -5.675  -9.002  1.00 0.00 ? 100 ARG A CB   7  
ATOM   8491  C  CG   . ARG A 1 36 ? -8.203  -7.118  -9.401  1.00 0.00 ? 100 ARG A CG   7  
ATOM   8492  C  CD   . ARG A 1 36 ? -7.522  -7.466  -10.715 1.00 0.00 ? 100 ARG A CD   7  
ATOM   8493  N  NE   . ARG A 1 36 ? -8.015  -6.648  -11.820 1.00 0.00 ? 100 ARG A NE   7  
ATOM   8494  C  CZ   . ARG A 1 36 ? -7.951  -7.019  -13.094 1.00 0.00 ? 100 ARG A CZ   7  
ATOM   8495  N  NH1  . ARG A 1 36 ? -7.417  -8.187  -13.422 1.00 0.00 ? 100 ARG A NH1  7  
ATOM   8496  N  NH2  . ARG A 1 36 ? -8.421  -6.220  -14.043 1.00 0.00 ? 100 ARG A NH2  7  
ATOM   8497  H  H    . ARG A 1 36 ? -7.837  -3.323  -8.039  1.00 0.00 ? 100 ARG A H    7  
ATOM   8498  H  HA   . ARG A 1 36 ? -9.904  -5.073  -8.401  1.00 0.00 ? 100 ARG A HA   7  
ATOM   8499  H  HB2  . ARG A 1 36 ? -8.006  -5.062  -9.889  1.00 0.00 ? 100 ARG A HB2  7  
ATOM   8500  H  HB3  . ARG A 1 36 ? -6.939  -5.611  -8.603  1.00 0.00 ? 100 ARG A HB3  7  
ATOM   8501  H  HG2  . ARG A 1 36 ? -7.824  -7.770  -8.628  1.00 0.00 ? 100 ARG A HG2  7  
ATOM   8502  H  HG3  . ARG A 1 36 ? -9.268  -7.264  -9.507  1.00 0.00 ? 100 ARG A HG3  7  
ATOM   8503  H  HD2  . ARG A 1 36 ? -6.460  -7.306  -10.608 1.00 0.00 ? 100 ARG A HD2  7  
ATOM   8504  H  HD3  . ARG A 1 36 ? -7.709  -8.506  -10.937 1.00 0.00 ? 100 ARG A HD3  7  
ATOM   8505  H  HE   . ARG A 1 36 ? -8.414  -5.781  -11.600 1.00 0.00 ? 100 ARG A HE   7  
ATOM   8506  H  HH11 . ARG A 1 36 ? -7.063  -8.792  -12.709 1.00 0.00 ? 100 ARG A HH11 7  
ATOM   8507  H  HH12 . ARG A 1 36 ? -7.371  -8.465  -14.382 1.00 0.00 ? 100 ARG A HH12 7  
ATOM   8508  H  HH21 . ARG A 1 36 ? -8.824  -5.338  -13.800 1.00 0.00 ? 100 ARG A HH21 7  
ATOM   8509  H  HH22 . ARG A 1 36 ? -8.372  -6.500  -15.002 1.00 0.00 ? 100 ARG A HH22 7  
ATOM   8510  N  N    . THR A 1 37 ? -7.937  -6.068  -5.945  1.00 0.00 ? 101 THR A N    7  
ATOM   8511  C  CA   . THR A 1 37 ? -7.870  -6.929  -4.770  1.00 0.00 ? 101 THR A CA   7  
ATOM   8512  C  C    . THR A 1 37 ? -9.013  -6.633  -3.806  1.00 0.00 ? 101 THR A C    7  
ATOM   8513  O  O    . THR A 1 37 ? -9.565  -7.543  -3.186  1.00 0.00 ? 101 THR A O    7  
ATOM   8514  C  CB   . THR A 1 37 ? -6.531  -6.762  -4.027  1.00 0.00 ? 101 THR A CB   7  
ATOM   8515  O  OG1  . THR A 1 37 ? -5.440  -6.924  -4.940  1.00 0.00 ? 101 THR A OG1  7  
ATOM   8516  C  CG2  . THR A 1 37 ? -6.409  -7.775  -2.898  1.00 0.00 ? 101 THR A CG2  7  
ATOM   8517  H  H    . THR A 1 37 ? -7.193  -5.460  -6.135  1.00 0.00 ? 101 THR A H    7  
ATOM   8518  H  HA   . THR A 1 37 ? -7.948  -7.954  -5.103  1.00 0.00 ? 101 THR A HA   7  
ATOM   8519  H  HB   . THR A 1 37 ? -6.493  -5.768  -3.605  1.00 0.00 ? 101 THR A HB   7  
ATOM   8520  H  HG1  . THR A 1 37 ? -5.272  -6.092  -5.389  1.00 0.00 ? 101 THR A HG1  7  
ATOM   8521  H  HG21 . THR A 1 37 ? -6.610  -8.764  -3.280  1.00 0.00 ? 101 THR A HG21 7  
ATOM   8522  H  HG22 . THR A 1 37 ? -7.120  -7.536  -2.122  1.00 0.00 ? 101 THR A HG22 7  
ATOM   8523  H  HG23 . THR A 1 37 ? -5.408  -7.742  -2.493  1.00 0.00 ? 101 THR A HG23 7  
ATOM   8524  N  N    . ILE A 1 38 ? -9.365  -5.358  -3.686  1.00 0.00 ? 102 ILE A N    7  
ATOM   8525  C  CA   . ILE A 1 38 ? -10.444 -4.944  -2.798  1.00 0.00 ? 102 ILE A CA   7  
ATOM   8526  C  C    . ILE A 1 38 ? -11.803 -5.347  -3.360  1.00 0.00 ? 102 ILE A C    7  
ATOM   8527  O  O    . ILE A 1 38 ? -12.522 -6.146  -2.760  1.00 0.00 ? 102 ILE A O    7  
ATOM   8528  C  CB   . ILE A 1 38 ? -10.429 -3.421  -2.565  1.00 0.00 ? 102 ILE A CB   7  
ATOM   8529  C  CG1  . ILE A 1 38 ? -9.044  -2.969  -2.098  1.00 0.00 ? 102 ILE A CG1  7  
ATOM   8530  C  CG2  . ILE A 1 38 ? -11.491 -3.030  -1.548  1.00 0.00 ? 102 ILE A CG2  7  
ATOM   8531  C  CD1  . ILE A 1 38 ? -8.740  -3.337  -0.663  1.00 0.00 ? 102 ILE A CD1  7  
ATOM   8532  H  H    . ILE A 1 38 ? -8.887  -4.679  -4.207  1.00 0.00 ? 102 ILE A H    7  
ATOM   8533  H  HA   . ILE A 1 38 ? -10.300 -5.435  -1.847  1.00 0.00 ? 102 ILE A HA   7  
ATOM   8534  H  HB   . ILE A 1 38 ? -10.663 -2.934  -3.500  1.00 0.00 ? 102 ILE A HB   7  
ATOM   8535  H  HG12 . ILE A 1 38 ? -8.293  -3.425  -2.723  1.00 0.00 ? 102 ILE A HG12 7  
ATOM   8536  H  HG13 . ILE A 1 38 ? -8.976  -1.894  -2.188  1.00 0.00 ? 102 ILE A HG13 7  
ATOM   8537  H  HG21 . ILE A 1 38 ? -12.420 -3.524  -1.791  1.00 0.00 ? 102 ILE A HG21 7  
ATOM   8538  H  HG22 . ILE A 1 38 ? -11.172 -3.331  -0.562  1.00 0.00 ? 102 ILE A HG22 7  
ATOM   8539  H  HG23 . ILE A 1 38 ? -11.635 -1.961  -1.571  1.00 0.00 ? 102 ILE A HG23 7  
ATOM   8540  H  HD11 . ILE A 1 38 ? -8.958  -2.495  -0.022  1.00 0.00 ? 102 ILE A HD11 7  
ATOM   8541  H  HD12 . ILE A 1 38 ? -9.351  -4.178  -0.370  1.00 0.00 ? 102 ILE A HD12 7  
ATOM   8542  H  HD13 . ILE A 1 38 ? -7.697  -3.598  -0.571  1.00 0.00 ? 102 ILE A HD13 7  
ATOM   8543  N  N    . ARG A 1 39 ? -12.148 -4.790  -4.517  1.00 0.00 ? 103 ARG A N    7  
ATOM   8544  C  CA   . ARG A 1 39 ? -13.420 -5.093  -5.161  1.00 0.00 ? 103 ARG A CA   7  
ATOM   8545  C  C    . ARG A 1 39 ? -13.618 -6.600  -5.295  1.00 0.00 ? 103 ARG A C    7  
ATOM   8546  O  O    . ARG A 1 39 ? -14.726 -7.108  -5.125  1.00 0.00 ? 103 ARG A O    7  
ATOM   8547  C  CB   . ARG A 1 39 ? -13.487 -4.435  -6.541  1.00 0.00 ? 103 ARG A CB   7  
ATOM   8548  C  CG   . ARG A 1 39 ? -12.519 -5.033  -7.548  1.00 0.00 ? 103 ARG A CG   7  
ATOM   8549  C  CD   . ARG A 1 39 ? -12.636 -4.354  -8.904  1.00 0.00 ? 103 ARG A CD   7  
ATOM   8550  N  NE   . ARG A 1 39 ? -12.198 -5.224  -9.992  1.00 0.00 ? 103 ARG A NE   7  
ATOM   8551  C  CZ   . ARG A 1 39 ? -12.214 -4.867  -11.271 1.00 0.00 ? 103 ARG A CZ   7  
ATOM   8552  N  NH1  . ARG A 1 39 ? -12.643 -3.662  -11.621 1.00 0.00 ? 103 ARG A NH1  7  
ATOM   8553  N  NH2  . ARG A 1 39 ? -11.800 -5.715  -12.204 1.00 0.00 ? 103 ARG A NH2  7  
ATOM   8554  H  H    . ARG A 1 39 ? -11.532 -4.161  -4.948  1.00 0.00 ? 103 ARG A H    7  
ATOM   8555  H  HA   . ARG A 1 39 ? -14.209 -4.692  -4.542  1.00 0.00 ? 103 ARG A HA   7  
ATOM   8556  H  HB2  . ARG A 1 39 ? -14.489 -4.541  -6.930  1.00 0.00 ? 103 ARG A HB2  7  
ATOM   8557  H  HB3  . ARG A 1 39 ? -13.260 -3.384  -6.436  1.00 0.00 ? 103 ARG A HB3  7  
ATOM   8558  H  HG2  . ARG A 1 39 ? -11.511 -4.911  -7.182  1.00 0.00 ? 103 ARG A HG2  7  
ATOM   8559  H  HG3  . ARG A 1 39 ? -12.738 -6.085  -7.662  1.00 0.00 ? 103 ARG A HG3  7  
ATOM   8560  H  HD2  . ARG A 1 39 ? -13.667 -4.080  -9.067  1.00 0.00 ? 103 ARG A HD2  7  
ATOM   8561  H  HD3  . ARG A 1 39 ? -12.024 -3.464  -8.899  1.00 0.00 ? 103 ARG A HD3  7  
ATOM   8562  H  HE   . ARG A 1 39 ? -11.877 -6.119  -9.756  1.00 0.00 ? 103 ARG A HE   7  
ATOM   8563  H  HH11 . ARG A 1 39 ? -12.955 -3.020  -10.920 1.00 0.00 ? 103 ARG A HH11 7  
ATOM   8564  H  HH12 . ARG A 1 39 ? -12.653 -3.394  -12.584 1.00 0.00 ? 103 ARG A HH12 7  
ATOM   8565  H  HH21 . ARG A 1 39 ? -11.476 -6.624  -11.944 1.00 0.00 ? 103 ARG A HH21 7  
ATOM   8566  H  HH22 . ARG A 1 39 ? -11.812 -5.445  -13.166 1.00 0.00 ? 103 ARG A HH22 7  
ATOM   8567  N  N    . MET A 1 40 ? -12.536 -7.308  -5.600  1.00 0.00 ? 104 MET A N    7  
ATOM   8568  C  CA   . MET A 1 40 ? -12.590 -8.757  -5.756  1.00 0.00 ? 104 MET A CA   7  
ATOM   8569  C  C    . MET A 1 40 ? -12.372 -9.456  -4.418  1.00 0.00 ? 104 MET A C    7  
ATOM   8570  O  O    . MET A 1 40 ? -12.575 -10.665 -4.296  1.00 0.00 ? 104 MET A O    7  
ATOM   8571  C  CB   . MET A 1 40 ? -11.540 -9.223  -6.766  1.00 0.00 ? 104 MET A CB   7  
ATOM   8572  C  CG   . MET A 1 40 ? -11.709 -8.609  -8.146  1.00 0.00 ? 104 MET A CG   7  
ATOM   8573  S  SD   . MET A 1 40 ? -10.801 -9.504  -9.421  1.00 0.00 ? 104 MET A SD   7  
ATOM   8574  C  CE   . MET A 1 40 ? -11.495 -11.145 -9.241  1.00 0.00 ? 104 MET A CE   7  
ATOM   8575  H  H    . MET A 1 40 ? -11.680 -6.847  -5.724  1.00 0.00 ? 104 MET A H    7  
ATOM   8576  H  HA   . MET A 1 40 ? -13.571 -9.014  -6.127  1.00 0.00 ? 104 MET A HA   7  
ATOM   8577  H  HB2  . MET A 1 40 ? -10.560 -8.960  -6.396  1.00 0.00 ? 104 MET A HB2  7  
ATOM   8578  H  HB3  . MET A 1 40 ? -11.602 -10.297 -6.864  1.00 0.00 ? 104 MET A HB3  7  
ATOM   8579  H  HG2  . MET A 1 40 ? -12.758 -8.613  -8.402  1.00 0.00 ? 104 MET A HG2  7  
ATOM   8580  H  HG3  . MET A 1 40 ? -11.352 -7.590  -8.117  1.00 0.00 ? 104 MET A HG3  7  
ATOM   8581  H  HE1  . MET A 1 40 ? -10.910 -11.707 -8.527  1.00 0.00 ? 104 MET A HE1  7  
ATOM   8582  H  HE2  . MET A 1 40 ? -12.513 -11.069 -8.891  1.00 0.00 ? 104 MET A HE2  7  
ATOM   8583  H  HE3  . MET A 1 40 ? -11.478 -11.649 -10.196 1.00 0.00 ? 104 MET A HE3  7  
ATOM   8584  N  N    . LYS A 1 41 ? -11.956 -8.689  -3.416  1.00 0.00 ? 105 LYS A N    7  
ATOM   8585  C  CA   . LYS A 1 41 ? -11.710 -9.234  -2.086  1.00 0.00 ? 105 LYS A CA   7  
ATOM   8586  C  C    . LYS A 1 41 ? -10.832 -10.479 -2.161  1.00 0.00 ? 105 LYS A C    7  
ATOM   8587  O  O    . LYS A 1 41 ? -11.149 -11.512 -1.570  1.00 0.00 ? 105 LYS A O    7  
ATOM   8588  C  CB   . LYS A 1 41 ? -13.035 -9.573  -1.398  1.00 0.00 ? 105 LYS A CB   7  
ATOM   8589  C  CG   . LYS A 1 41 ? -13.753 -8.361  -0.832  1.00 0.00 ? 105 LYS A CG   7  
ATOM   8590  C  CD   . LYS A 1 41 ? -14.862 -8.766  0.124   1.00 0.00 ? 105 LYS A CD   7  
ATOM   8591  C  CE   . LYS A 1 41 ? -14.309 -9.157  1.486   1.00 0.00 ? 105 LYS A CE   7  
ATOM   8592  N  NZ   . LYS A 1 41 ? -15.382 -9.251  2.515   1.00 0.00 ? 105 LYS A NZ   7  
ATOM   8593  H  H    . LYS A 1 41 ? -11.811 -7.733  -3.575  1.00 0.00 ? 105 LYS A H    7  
ATOM   8594  H  HA   . LYS A 1 41 ? -11.197 -8.480  -1.508  1.00 0.00 ? 105 LYS A HA   7  
ATOM   8595  H  HB2  . LYS A 1 41 ? -13.687 -10.050 -2.115  1.00 0.00 ? 105 LYS A HB2  7  
ATOM   8596  H  HB3  . LYS A 1 41 ? -12.840 -10.261 -0.588  1.00 0.00 ? 105 LYS A HB3  7  
ATOM   8597  H  HG2  . LYS A 1 41 ? -13.041 -7.747  -0.300  1.00 0.00 ? 105 LYS A HG2  7  
ATOM   8598  H  HG3  . LYS A 1 41 ? -14.182 -7.794  -1.647  1.00 0.00 ? 105 LYS A HG3  7  
ATOM   8599  H  HD2  . LYS A 1 41 ? -15.541 -7.935  0.249   1.00 0.00 ? 105 LYS A HD2  7  
ATOM   8600  H  HD3  . LYS A 1 41 ? -15.396 -9.609  -0.293  1.00 0.00 ? 105 LYS A HD3  7  
ATOM   8601  H  HE2  . LYS A 1 41 ? -13.821 -10.116 1.400   1.00 0.00 ? 105 LYS A HE2  7  
ATOM   8602  H  HE3  . LYS A 1 41 ? -13.590 -8.413  1.795   1.00 0.00 ? 105 LYS A HE3  7  
ATOM   8603  H  HZ1  . LYS A 1 41 ? -14.980 -9.113  3.464   1.00 0.00 ? 105 LYS A HZ1  7  
ATOM   8604  H  HZ2  . LYS A 1 41 ? -15.836 -10.186 2.473   1.00 0.00 ? 105 LYS A HZ2  7  
ATOM   8605  H  HZ3  . LYS A 1 41 ? -16.103 -8.520  2.346   1.00 0.00 ? 105 LYS A HZ3  7  
ATOM   8606  N  N    . LEU A 1 42 ? -9.726  -10.374 -2.890  1.00 0.00 ? 106 LEU A N    7  
ATOM   8607  C  CA   . LEU A 1 42 ? -8.800  -11.491 -3.042  1.00 0.00 ? 106 LEU A CA   7  
ATOM   8608  C  C    . LEU A 1 42 ? -7.818  -11.546 -1.876  1.00 0.00 ? 106 LEU A C    7  
ATOM   8609  O  O    . LEU A 1 42 ? -7.735  -10.613 -1.078  1.00 0.00 ? 106 LEU A O    7  
ATOM   8610  C  CB   . LEU A 1 42 ? -8.036  -11.370 -4.361  1.00 0.00 ? 106 LEU A CB   7  
ATOM   8611  C  CG   . LEU A 1 42 ? -8.891  -11.282 -5.626  1.00 0.00 ? 106 LEU A CG   7  
ATOM   8612  C  CD1  . LEU A 1 42 ? -8.034  -10.903 -6.824  1.00 0.00 ? 106 LEU A CD1  7  
ATOM   8613  C  CD2  . LEU A 1 42 ? -9.609  -12.599 -5.877  1.00 0.00 ? 106 LEU A CD2  7  
ATOM   8614  H  H    . LEU A 1 42 ? -9.526  -9.525  -3.337  1.00 0.00 ? 106 LEU A H    7  
ATOM   8615  H  HA   . LEU A 1 42 ? -9.379  -12.402 -3.052  1.00 0.00 ? 106 LEU A HA   7  
ATOM   8616  H  HB2  . LEU A 1 42 ? -7.427  -10.480 -4.311  1.00 0.00 ? 106 LEU A HB2  7  
ATOM   8617  H  HB3  . LEU A 1 42 ? -7.397  -12.237 -4.452  1.00 0.00 ? 106 LEU A HB3  7  
ATOM   8618  H  HG   . LEU A 1 42 ? -9.638  -10.512 -5.494  1.00 0.00 ? 106 LEU A HG   7  
ATOM   8619  H  HD11 . LEU A 1 42 ? -8.282  -9.901  -7.141  1.00 0.00 ? 106 LEU A HD11 7  
ATOM   8620  H  HD12 . LEU A 1 42 ? -8.220  -11.593 -7.633  1.00 0.00 ? 106 LEU A HD12 7  
ATOM   8621  H  HD13 . LEU A 1 42 ? -6.990  -10.946 -6.548  1.00 0.00 ? 106 LEU A HD13 7  
ATOM   8622  H  HD21 . LEU A 1 42 ? -10.585 -12.403 -6.295  1.00 0.00 ? 106 LEU A HD21 7  
ATOM   8623  H  HD22 . LEU A 1 42 ? -9.716  -13.134 -4.945  1.00 0.00 ? 106 LEU A HD22 7  
ATOM   8624  H  HD23 . LEU A 1 42 ? -9.034  -13.196 -6.570  1.00 0.00 ? 106 LEU A HD23 7  
ATOM   8625  N  N    . GLU A 1 43 ? -7.076  -12.645 -1.785  1.00 0.00 ? 107 GLU A N    7  
ATOM   8626  C  CA   . GLU A 1 43 ? -6.099  -12.821 -0.717  1.00 0.00 ? 107 GLU A CA   7  
ATOM   8627  C  C    . GLU A 1 43 ? -4.875  -13.582 -1.219  1.00 0.00 ? 107 GLU A C    7  
ATOM   8628  O  O    . GLU A 1 43 ? -4.936  -14.278 -2.232  1.00 0.00 ? 107 GLU A O    7  
ATOM   8629  C  CB   . GLU A 1 43 ? -6.728  -13.565 0.463   1.00 0.00 ? 107 GLU A CB   7  
ATOM   8630  C  CG   . GLU A 1 43 ? -7.459  -12.656 1.436   1.00 0.00 ? 107 GLU A CG   7  
ATOM   8631  C  CD   . GLU A 1 43 ? -8.311  -13.426 2.426   1.00 0.00 ? 107 GLU A CD   7  
ATOM   8632  O  OE1  . GLU A 1 43 ? -7.736  -14.100 3.307   1.00 0.00 ? 107 GLU A OE1  7  
ATOM   8633  O  OE2  . GLU A 1 43 ? -9.554  -13.355 2.321   1.00 0.00 ? 107 GLU A OE2  7  
ATOM   8634  H  H    . GLU A 1 43 ? -7.189  -13.355 -2.451  1.00 0.00 ? 107 GLU A H    7  
ATOM   8635  H  HA   . GLU A 1 43 ? -5.788  -11.841 -0.387  1.00 0.00 ? 107 GLU A HA   7  
ATOM   8636  H  HB2  . GLU A 1 43 ? -7.431  -14.291 0.081   1.00 0.00 ? 107 GLU A HB2  7  
ATOM   8637  H  HB3  . GLU A 1 43 ? -5.949  -14.082 1.003   1.00 0.00 ? 107 GLU A HB3  7  
ATOM   8638  H  HG2  . GLU A 1 43 ? -6.732  -12.077 1.985   1.00 0.00 ? 107 GLU A HG2  7  
ATOM   8639  H  HG3  . GLU A 1 43 ? -8.099  -11.990 0.876   1.00 0.00 ? 107 GLU A HG3  7  
ATOM   8640  N  N    . TYR A 1 44 ? -3.765  -13.443 -0.502  1.00 0.00 ? 108 TYR A N    7  
ATOM   8641  C  CA   . TYR A 1 44 ? -2.526  -14.115 -0.875  1.00 0.00 ? 108 TYR A CA   7  
ATOM   8642  C  C    . TYR A 1 44 ? -1.800  -14.643 0.358   1.00 0.00 ? 108 TYR A C    7  
ATOM   8643  O  O    . TYR A 1 44 ? -2.173  -14.336 1.490   1.00 0.00 ? 108 TYR A O    7  
ATOM   8644  C  CB   . TYR A 1 44 ? -1.615  -13.158 -1.647  1.00 0.00 ? 108 TYR A CB   7  
ATOM   8645  C  CG   . TYR A 1 44 ? -2.297  -12.484 -2.815  1.00 0.00 ? 108 TYR A CG   7  
ATOM   8646  C  CD1  . TYR A 1 44 ? -2.442  -13.137 -4.033  1.00 0.00 ? 108 TYR A CD1  7  
ATOM   8647  C  CD2  . TYR A 1 44 ? -2.798  -11.192 -2.702  1.00 0.00 ? 108 TYR A CD2  7  
ATOM   8648  C  CE1  . TYR A 1 44 ? -3.063  -12.524 -5.103  1.00 0.00 ? 108 TYR A CE1  7  
ATOM   8649  C  CE2  . TYR A 1 44 ? -3.423  -10.572 -3.767  1.00 0.00 ? 108 TYR A CE2  7  
ATOM   8650  C  CZ   . TYR A 1 44 ? -3.552  -11.242 -4.965  1.00 0.00 ? 108 TYR A CZ   7  
ATOM   8651  O  OH   . TYR A 1 44 ? -4.173  -10.628 -6.029  1.00 0.00 ? 108 TYR A OH   7  
ATOM   8652  H  H    . TYR A 1 44 ? -3.779  -12.875 0.296   1.00 0.00 ? 108 TYR A H    7  
ATOM   8653  H  HA   . TYR A 1 44 ? -2.780  -14.948 -1.514  1.00 0.00 ? 108 TYR A HA   7  
ATOM   8654  H  HB2  . TYR A 1 44 ? -1.265  -12.387 -0.978  1.00 0.00 ? 108 TYR A HB2  7  
ATOM   8655  H  HB3  . TYR A 1 44 ? -0.768  -13.708 -2.029  1.00 0.00 ? 108 TYR A HB3  7  
ATOM   8656  H  HD1  . TYR A 1 44 ? -2.058  -14.142 -4.137  1.00 0.00 ? 108 TYR A HD1  7  
ATOM   8657  H  HD2  . TYR A 1 44 ? -2.695  -10.670 -1.761  1.00 0.00 ? 108 TYR A HD2  7  
ATOM   8658  H  HE1  . TYR A 1 44 ? -3.165  -13.049 -6.042  1.00 0.00 ? 108 TYR A HE1  7  
ATOM   8659  H  HE2  . TYR A 1 44 ? -3.806  -9.568  -3.659  1.00 0.00 ? 108 TYR A HE2  7  
ATOM   8660  H  HH   . TYR A 1 44 ? -4.804  -11.235 -6.424  1.00 0.00 ? 108 TYR A HH   7  
ATOM   8661  N  N    . GLU A 1 45 ? -0.759  -15.438 0.129   1.00 0.00 ? 109 GLU A N    7  
ATOM   8662  C  CA   . GLU A 1 45 ? 0.020   -16.008 1.222   1.00 0.00 ? 109 GLU A CA   7  
ATOM   8663  C  C    . GLU A 1 45 ? 0.976   -14.973 1.807   1.00 0.00 ? 109 GLU A C    7  
ATOM   8664  O  O    . GLU A 1 45 ? 1.641   -14.241 1.075   1.00 0.00 ? 109 GLU A O    7  
ATOM   8665  C  CB   . GLU A 1 45 ? 0.807   -17.227 0.734   1.00 0.00 ? 109 GLU A CB   7  
ATOM   8666  C  CG   . GLU A 1 45 ? 1.966   -16.875 -0.184  1.00 0.00 ? 109 GLU A CG   7  
ATOM   8667  C  CD   . GLU A 1 45 ? 2.346   -18.016 -1.107  1.00 0.00 ? 109 GLU A CD   7  
ATOM   8668  O  OE1  . GLU A 1 45 ? 3.132   -18.888 -0.682  1.00 0.00 ? 109 GLU A OE1  7  
ATOM   8669  O  OE2  . GLU A 1 45 ? 1.856   -18.037 -2.256  1.00 0.00 ? 109 GLU A OE2  7  
ATOM   8670  H  H    . GLU A 1 45 ? -0.510  -15.645 -0.795  1.00 0.00 ? 109 GLU A H    7  
ATOM   8671  H  HA   . GLU A 1 45 ? -0.668  -16.321 1.992   1.00 0.00 ? 109 GLU A HA   7  
ATOM   8672  H  HB2  . GLU A 1 45 ? 1.200   -17.753 1.591   1.00 0.00 ? 109 GLU A HB2  7  
ATOM   8673  H  HB3  . GLU A 1 45 ? 0.137   -17.881 0.197   1.00 0.00 ? 109 GLU A HB3  7  
ATOM   8674  H  HG2  . GLU A 1 45 ? 1.687   -16.023 -0.786  1.00 0.00 ? 109 GLU A HG2  7  
ATOM   8675  H  HG3  . GLU A 1 45 ? 2.824   -16.621 0.422   1.00 0.00 ? 109 GLU A HG3  7  
ATOM   8676  N  N    . LYS A 1 46 ? 1.038   -14.917 3.133   1.00 0.00 ? 110 LYS A N    7  
ATOM   8677  C  CA   . LYS A 1 46 ? 1.912   -13.973 3.820   1.00 0.00 ? 110 LYS A CA   7  
ATOM   8678  C  C    . LYS A 1 46 ? 3.355   -14.127 3.350   1.00 0.00 ? 110 LYS A C    7  
ATOM   8679  O  O    . LYS A 1 46 ? 3.849   -15.242 3.182   1.00 0.00 ? 110 LYS A O    7  
ATOM   8680  C  CB   . LYS A 1 46 ? 1.833   -14.182 5.334   1.00 0.00 ? 110 LYS A CB   7  
ATOM   8681  C  CG   . LYS A 1 46 ? 2.192   -12.944 6.138   1.00 0.00 ? 110 LYS A CG   7  
ATOM   8682  C  CD   . LYS A 1 46 ? 1.973   -13.162 7.625   1.00 0.00 ? 110 LYS A CD   7  
ATOM   8683  C  CE   . LYS A 1 46 ? 0.501   -13.055 7.994   1.00 0.00 ? 110 LYS A CE   7  
ATOM   8684  N  NZ   . LYS A 1 46 ? 0.311   -12.801 9.449   1.00 0.00 ? 110 LYS A NZ   7  
ATOM   8685  H  H    . LYS A 1 46 ? 0.483   -15.528 3.664   1.00 0.00 ? 110 LYS A H    7  
ATOM   8686  H  HA   . LYS A 1 46 ? 1.573   -12.976 3.584   1.00 0.00 ? 110 LYS A HA   7  
ATOM   8687  H  HB2  . LYS A 1 46 ? 0.826   -14.474 5.593   1.00 0.00 ? 110 LYS A HB2  7  
ATOM   8688  H  HB3  . LYS A 1 46 ? 2.511   -14.975 5.612   1.00 0.00 ? 110 LYS A HB3  7  
ATOM   8689  H  HG2  . LYS A 1 46 ? 3.231   -12.705 5.969   1.00 0.00 ? 110 LYS A HG2  7  
ATOM   8690  H  HG3  . LYS A 1 46 ? 1.573   -12.121 5.809   1.00 0.00 ? 110 LYS A HG3  7  
ATOM   8691  H  HD2  . LYS A 1 46 ? 2.328   -14.147 7.892   1.00 0.00 ? 110 LYS A HD2  7  
ATOM   8692  H  HD3  . LYS A 1 46 ? 2.528   -12.416 8.176   1.00 0.00 ? 110 LYS A HD3  7  
ATOM   8693  H  HE2  . LYS A 1 46 ? 0.062   -12.243 7.435   1.00 0.00 ? 110 LYS A HE2  7  
ATOM   8694  H  HE3  . LYS A 1 46 ? 0.010   -13.980 7.731   1.00 0.00 ? 110 LYS A HE3  7  
ATOM   8695  H  HZ1  . LYS A 1 46 ? -0.335  -11.998 9.590   1.00 0.00 ? 110 LYS A HZ1  7  
ATOM   8696  H  HZ2  . LYS A 1 46 ? 1.224   -12.581 9.895   1.00 0.00 ? 110 LYS A HZ2  7  
ATOM   8697  H  HZ3  . LYS A 1 46 ? -0.093  -13.642 9.909   1.00 0.00 ? 110 LYS A HZ3  7  
ATOM   8698  N  N    . CYS A 1 47 ? 4.027   -13.000 3.140   1.00 0.00 ? 111 CYS A N    7  
ATOM   8699  C  CA   . CYS A 1 47 ? 5.414   -13.008 2.691   1.00 0.00 ? 111 CYS A CA   7  
ATOM   8700  C  C    . CYS A 1 47 ? 6.297   -12.200 3.637   1.00 0.00 ? 111 CYS A C    7  
ATOM   8701  O  O    . CYS A 1 47 ? 6.178   -10.978 3.722   1.00 0.00 ? 111 CYS A O    7  
ATOM   8702  C  CB   . CYS A 1 47 ? 5.516   -12.442 1.273   1.00 0.00 ? 111 CYS A CB   7  
ATOM   8703  S  SG   . CYS A 1 47 ? 7.181   -12.559 0.544   1.00 0.00 ? 111 CYS A SG   7  
ATOM   8704  H  H    . CYS A 1 47 ? 3.579   -12.140 3.292   1.00 0.00 ? 111 CYS A H    7  
ATOM   8705  H  HA   . CYS A 1 47 ? 5.755   -14.032 2.686   1.00 0.00 ? 111 CYS A HA   7  
ATOM   8706  H  HB2  . CYS A 1 47 ? 4.837   -12.982 0.629   1.00 0.00 ? 111 CYS A HB2  7  
ATOM   8707  H  HB3  . CYS A 1 47 ? 5.236   -11.399 1.289   1.00 0.00 ? 111 CYS A HB3  7  
ATOM   8708  N  N    . GLU A 1 48 ? 7.184   -12.892 4.346   1.00 0.00 ? 112 GLU A N    7  
ATOM   8709  C  CA   . GLU A 1 48 ? 8.087   -12.239 5.286   1.00 0.00 ? 112 GLU A CA   7  
ATOM   8710  C  C    . GLU A 1 48 ? 9.214   -11.521 4.549   1.00 0.00 ? 112 GLU A C    7  
ATOM   8711  O  O    . GLU A 1 48 ? 9.643   -10.440 4.952   1.00 0.00 ? 112 GLU A O    7  
ATOM   8712  C  CB   . GLU A 1 48 ? 8.671   -13.263 6.262   1.00 0.00 ? 112 GLU A CB   7  
ATOM   8713  C  CG   . GLU A 1 48 ? 7.661   -13.793 7.266   1.00 0.00 ? 112 GLU A CG   7  
ATOM   8714  C  CD   . GLU A 1 48 ? 8.312   -14.570 8.393   1.00 0.00 ? 112 GLU A CD   7  
ATOM   8715  O  OE1  . GLU A 1 48 ? 8.939   -15.613 8.111   1.00 0.00 ? 112 GLU A OE1  7  
ATOM   8716  O  OE2  . GLU A 1 48 ? 8.194   -14.136 9.558   1.00 0.00 ? 112 GLU A OE2  7  
ATOM   8717  H  H    . GLU A 1 48 ? 7.231   -13.865 4.234   1.00 0.00 ? 112 GLU A H    7  
ATOM   8718  H  HA   . GLU A 1 48 ? 7.516   -11.511 5.843   1.00 0.00 ? 112 GLU A HA   7  
ATOM   8719  H  HB2  . GLU A 1 48 ? 9.060   -14.098 5.698   1.00 0.00 ? 112 GLU A HB2  7  
ATOM   8720  H  HB3  . GLU A 1 48 ? 9.481   -12.801 6.807   1.00 0.00 ? 112 GLU A HB3  7  
ATOM   8721  H  HG2  . GLU A 1 48 ? 7.122   -12.959 7.689   1.00 0.00 ? 112 GLU A HG2  7  
ATOM   8722  H  HG3  . GLU A 1 48 ? 6.969   -14.444 6.752   1.00 0.00 ? 112 GLU A HG3  7  
ATOM   8723  N  N    . ARG A 1 49 ? 9.689   -12.132 3.469   1.00 0.00 ? 113 ARG A N    7  
ATOM   8724  C  CA   . ARG A 1 49 ? 10.767  -11.553 2.676   1.00 0.00 ? 113 ARG A CA   7  
ATOM   8725  C  C    . ARG A 1 49 ? 10.543  -10.059 2.463   1.00 0.00 ? 113 ARG A C    7  
ATOM   8726  O  O    . ARG A 1 49 ? 11.490  -9.304  2.243   1.00 0.00 ? 113 ARG A O    7  
ATOM   8727  C  CB   . ARG A 1 49 ? 10.872  -12.261 1.324   1.00 0.00 ? 113 ARG A CB   7  
ATOM   8728  C  CG   . ARG A 1 49 ? 11.508  -13.639 1.406   1.00 0.00 ? 113 ARG A CG   7  
ATOM   8729  C  CD   . ARG A 1 49 ? 11.950  -14.131 0.037   1.00 0.00 ? 113 ARG A CD   7  
ATOM   8730  N  NE   . ARG A 1 49 ? 13.004  -13.295 -0.532  1.00 0.00 ? 113 ARG A NE   7  
ATOM   8731  C  CZ   . ARG A 1 49 ? 14.286  -13.402 -0.201  1.00 0.00 ? 113 ARG A CZ   7  
ATOM   8732  N  NH1  . ARG A 1 49 ? 14.671  -14.305 0.690   1.00 0.00 ? 113 ARG A NH1  7  
ATOM   8733  N  NH2  . ARG A 1 49 ? 15.186  -12.604 -0.762  1.00 0.00 ? 113 ARG A NH2  7  
ATOM   8734  H  H    . ARG A 1 49 ? 9.306   -12.992 3.198   1.00 0.00 ? 113 ARG A H    7  
ATOM   8735  H  HA   . ARG A 1 49 ? 11.690  -11.693 3.219   1.00 0.00 ? 113 ARG A HA   7  
ATOM   8736  H  HB2  . ARG A 1 49 ? 9.880   -12.372 0.910   1.00 0.00 ? 113 ARG A HB2  7  
ATOM   8737  H  HB3  . ARG A 1 49 ? 11.465  -11.653 0.658   1.00 0.00 ? 113 ARG A HB3  7  
ATOM   8738  H  HG2  . ARG A 1 49 ? 12.371  -13.589 2.054   1.00 0.00 ? 113 ARG A HG2  7  
ATOM   8739  H  HG3  . ARG A 1 49 ? 10.790  -14.334 1.815   1.00 0.00 ? 113 ARG A HG3  7  
ATOM   8740  H  HD2  . ARG A 1 49 ? 12.319  -15.142 0.134   1.00 0.00 ? 113 ARG A HD2  7  
ATOM   8741  H  HD3  . ARG A 1 49 ? 11.098  -14.122 -0.626  1.00 0.00 ? 113 ARG A HD3  7  
ATOM   8742  H  HE   . ARG A 1 49 ? 12.741  -12.621 -1.192  1.00 0.00 ? 113 ARG A HE   7  
ATOM   8743  H  HH11 . ARG A 1 49 ? 13.995  -14.908 1.114   1.00 0.00 ? 113 ARG A HH11 7  
ATOM   8744  H  HH12 . ARG A 1 49 ? 15.637  -14.384 0.936   1.00 0.00 ? 113 ARG A HH12 7  
ATOM   8745  H  HH21 . ARG A 1 49 ? 14.899  -11.923 -1.435  1.00 0.00 ? 113 ARG A HH21 7  
ATOM   8746  H  HH22 . ARG A 1 49 ? 16.150  -12.686 -0.513  1.00 0.00 ? 113 ARG A HH22 7  
ATOM   8747  N  N    . SER A 1 50 ? 9.284   -9.638  2.530   1.00 0.00 ? 114 SER A N    7  
ATOM   8748  C  CA   . SER A 1 50 ? 8.935   -8.235  2.341   1.00 0.00 ? 114 SER A CA   7  
ATOM   8749  C  C    . SER A 1 50 ? 9.536   -7.696  1.046   1.00 0.00 ? 114 SER A C    7  
ATOM   8750  O  O    . SER A 1 50 ? 10.104  -6.604  1.019   1.00 0.00 ? 114 SER A O    7  
ATOM   8751  C  CB   . SER A 1 50 ? 9.421   -7.402  3.528   1.00 0.00 ? 114 SER A CB   7  
ATOM   8752  O  OG   . SER A 1 50 ? 8.545   -7.530  4.634   1.00 0.00 ? 114 SER A OG   7  
ATOM   8753  H  H    . SER A 1 50 ? 8.572   -10.289 2.709   1.00 0.00 ? 114 SER A H    7  
ATOM   8754  H  HA   . SER A 1 50 ? 7.859   -8.166  2.280   1.00 0.00 ? 114 SER A HA   7  
ATOM   8755  H  HB2  . SER A 1 50 ? 10.404  -7.738  3.822   1.00 0.00 ? 114 SER A HB2  7  
ATOM   8756  H  HB3  . SER A 1 50 ? 9.469   -6.362  3.239   1.00 0.00 ? 114 SER A HB3  7  
ATOM   8757  H  HG   . SER A 1 50 ? 8.105   -6.691  4.792   1.00 0.00 ? 114 SER A HG   7  
ATOM   8758  N  N    . CYS A 1 51 ? 9.406   -8.470  -0.026  1.00 0.00 ? 115 CYS A N    7  
ATOM   8759  C  CA   . CYS A 1 51 ? 9.936   -8.073  -1.325  1.00 0.00 ? 115 CYS A CA   7  
ATOM   8760  C  C    . CYS A 1 51 ? 9.764   -6.573  -1.547  1.00 0.00 ? 115 CYS A C    7  
ATOM   8761  O  O    . CYS A 1 51 ? 8.856   -5.953  -0.995  1.00 0.00 ? 115 CYS A O    7  
ATOM   8762  C  CB   . CYS A 1 51 ? 9.237   -8.849  -2.443  1.00 0.00 ? 115 CYS A CB   7  
ATOM   8763  S  SG   . CYS A 1 51 ? 9.062   -10.632 -2.113  1.00 0.00 ? 115 CYS A SG   7  
ATOM   8764  H  H    . CYS A 1 51 ? 8.943   -9.331  0.058   1.00 0.00 ? 115 CYS A H    7  
ATOM   8765  H  HA   . CYS A 1 51 ? 10.990  -8.308  -1.340  1.00 0.00 ? 115 CYS A HA   7  
ATOM   8766  H  HB2  . CYS A 1 51 ? 8.246   -8.444  -2.587  1.00 0.00 ? 115 CYS A HB2  7  
ATOM   8767  H  HB3  . CYS A 1 51 ? 9.803   -8.737  -3.356  1.00 0.00 ? 115 CYS A HB3  7  
ATOM   8768  N  N    . LYS A 1 52 ? 10.642  -5.997  -2.361  1.00 0.00 ? 116 LYS A N    7  
ATOM   8769  C  CA   . LYS A 1 52 ? 10.588  -4.571  -2.659  1.00 0.00 ? 116 LYS A CA   7  
ATOM   8770  C  C    . LYS A 1 52 ? 9.876   -4.318  -3.983  1.00 0.00 ? 116 LYS A C    7  
ATOM   8771  O  O    . LYS A 1 52 ? 10.412  -4.611  -5.053  1.00 0.00 ? 116 LYS A O    7  
ATOM   8772  C  CB   . LYS A 1 52 ? 12.001  -3.985  -2.708  1.00 0.00 ? 116 LYS A CB   7  
ATOM   8773  C  CG   . LYS A 1 52 ? 12.542  -3.587  -1.346  1.00 0.00 ? 116 LYS A CG   7  
ATOM   8774  C  CD   . LYS A 1 52 ? 13.513  -2.422  -1.450  1.00 0.00 ? 116 LYS A CD   7  
ATOM   8775  C  CE   . LYS A 1 52 ? 13.899  -1.894  -0.077  1.00 0.00 ? 116 LYS A CE   7  
ATOM   8776  N  NZ   . LYS A 1 52 ? 12.749  -1.247  0.613   1.00 0.00 ? 116 LYS A NZ   7  
ATOM   8777  H  H    . LYS A 1 52 ? 11.344  -6.545  -2.771  1.00 0.00 ? 116 LYS A H    7  
ATOM   8778  H  HA   . LYS A 1 52 ? 10.035  -4.087  -1.868  1.00 0.00 ? 116 LYS A HA   7  
ATOM   8779  H  HB2  . LYS A 1 52 ? 12.668  -4.719  -3.136  1.00 0.00 ? 116 LYS A HB2  7  
ATOM   8780  H  HB3  . LYS A 1 52 ? 11.993  -3.108  -3.339  1.00 0.00 ? 116 LYS A HB3  7  
ATOM   8781  H  HG2  . LYS A 1 52 ? 11.718  -3.298  -0.711  1.00 0.00 ? 116 LYS A HG2  7  
ATOM   8782  H  HG3  . LYS A 1 52 ? 13.055  -4.433  -0.911  1.00 0.00 ? 116 LYS A HG3  7  
ATOM   8783  H  HD2  . LYS A 1 52 ? 14.405  -2.752  -1.960  1.00 0.00 ? 116 LYS A HD2  7  
ATOM   8784  H  HD3  . LYS A 1 52 ? 13.047  -1.626  -2.014  1.00 0.00 ? 116 LYS A HD3  7  
ATOM   8785  H  HE2  . LYS A 1 52 ? 14.252  -2.717  0.525   1.00 0.00 ? 116 LYS A HE2  7  
ATOM   8786  H  HE3  . LYS A 1 52 ? 14.691  -1.169  -0.195  1.00 0.00 ? 116 LYS A HE3  7  
ATOM   8787  H  HZ1  . LYS A 1 52 ? 12.472  -0.380  0.110   1.00 0.00 ? 116 LYS A HZ1  7  
ATOM   8788  H  HZ2  . LYS A 1 52 ? 13.011  -1.001  1.589   1.00 0.00 ? 116 LYS A HZ2  7  
ATOM   8789  H  HZ3  . LYS A 1 52 ? 11.937  -1.896  0.637   1.00 0.00 ? 116 LYS A HZ3  7  
ATOM   8790  N  N    . ILE A 1 53 ? 8.667   -3.772  -3.905  1.00 0.00 ? 117 ILE A N    7  
ATOM   8791  C  CA   . ILE A 1 53 ? 7.883   -3.478  -5.098  1.00 0.00 ? 117 ILE A CA   7  
ATOM   8792  C  C    . ILE A 1 53 ? 8.489   -2.320  -5.883  1.00 0.00 ? 117 ILE A C    7  
ATOM   8793  O  O    . ILE A 1 53 ? 8.444   -1.171  -5.445  1.00 0.00 ? 117 ILE A O    7  
ATOM   8794  C  CB   . ILE A 1 53 ? 6.424   -3.136  -4.743  1.00 0.00 ? 117 ILE A CB   7  
ATOM   8795  C  CG1  . ILE A 1 53 ? 5.807   -4.251  -3.897  1.00 0.00 ? 117 ILE A CG1  7  
ATOM   8796  C  CG2  . ILE A 1 53 ? 5.610   -2.911  -6.009  1.00 0.00 ? 117 ILE A CG2  7  
ATOM   8797  C  CD1  . ILE A 1 53 ? 5.643   -5.556  -4.645  1.00 0.00 ? 117 ILE A CD1  7  
ATOM   8798  H  H    . ILE A 1 53 ? 8.294   -3.561  -3.024  1.00 0.00 ? 117 ILE A H    7  
ATOM   8799  H  HA   . ILE A 1 53 ? 7.883   -4.361  -5.722  1.00 0.00 ? 117 ILE A HA   7  
ATOM   8800  H  HB   . ILE A 1 53 ? 6.421   -2.219  -4.175  1.00 0.00 ? 117 ILE A HB   7  
ATOM   8801  H  HG12 . ILE A 1 53 ? 6.437   -4.437  -3.042  1.00 0.00 ? 117 ILE A HG12 7  
ATOM   8802  H  HG13 . ILE A 1 53 ? 4.830   -3.937  -3.558  1.00 0.00 ? 117 ILE A HG13 7  
ATOM   8803  H  HG21 . ILE A 1 53 ? 6.262   -2.956  -6.869  1.00 0.00 ? 117 ILE A HG21 7  
ATOM   8804  H  HG22 . ILE A 1 53 ? 4.854   -3.677  -6.091  1.00 0.00 ? 117 ILE A HG22 7  
ATOM   8805  H  HG23 . ILE A 1 53 ? 5.138   -1.941  -5.966  1.00 0.00 ? 117 ILE A HG23 7  
ATOM   8806  H  HD11 . ILE A 1 53 ? 5.864   -5.402  -5.691  1.00 0.00 ? 117 ILE A HD11 7  
ATOM   8807  H  HD12 . ILE A 1 53 ? 6.322   -6.291  -4.239  1.00 0.00 ? 117 ILE A HD12 7  
ATOM   8808  H  HD13 . ILE A 1 53 ? 4.627   -5.906  -4.540  1.00 0.00 ? 117 ILE A HD13 7  
ATOM   8809  N  N    . GLN A 1 54 ? 9.055   -2.630  -7.045  1.00 0.00 ? 118 GLN A N    7  
ATOM   8810  C  CA   . GLN A 1 54 ? 9.669   -1.614  -7.891  1.00 0.00 ? 118 GLN A CA   7  
ATOM   8811  C  C    . GLN A 1 54 ? 9.048   -1.618  -9.284  1.00 0.00 ? 118 GLN A C    7  
ATOM   8812  O  O    . GLN A 1 54 ? 8.418   -2.593  -9.692  1.00 0.00 ? 118 GLN A O    7  
ATOM   8813  C  CB   . GLN A 1 54 ? 11.178  -1.847  -7.991  1.00 0.00 ? 118 GLN A CB   7  
ATOM   8814  C  CG   . GLN A 1 54 ? 11.945  -1.408  -6.754  1.00 0.00 ? 118 GLN A CG   7  
ATOM   8815  C  CD   . GLN A 1 54 ? 13.447  -1.451  -6.953  1.00 0.00 ? 118 GLN A CD   7  
ATOM   8816  O  OE1  . GLN A 1 54 ? 13.964  -0.986  -7.969  1.00 0.00 ? 118 GLN A OE1  7  
ATOM   8817  N  NE2  . GLN A 1 54 ? 14.157  -2.011  -5.981  1.00 0.00 ? 118 GLN A NE2  7  
ATOM   8818  H  H    . GLN A 1 54 ? 9.060   -3.564  -7.339  1.00 0.00 ? 118 GLN A H    7  
ATOM   8819  H  HA   . GLN A 1 54 ? 9.493   -0.652  -7.434  1.00 0.00 ? 118 GLN A HA   7  
ATOM   8820  H  HB2  . GLN A 1 54 ? 11.358  -2.901  -8.145  1.00 0.00 ? 118 GLN A HB2  7  
ATOM   8821  H  HB3  . GLN A 1 54 ? 11.559  -1.298  -8.839  1.00 0.00 ? 118 GLN A HB3  7  
ATOM   8822  H  HG2  . GLN A 1 54 ? 11.659  -0.396  -6.510  1.00 0.00 ? 118 GLN A HG2  7  
ATOM   8823  H  HG3  . GLN A 1 54 ? 11.685  -2.062  -5.935  1.00 0.00 ? 118 GLN A HG3  7  
ATOM   8824  H  HE21 . GLN A 1 54 ? 13.678  -2.362  -5.201  1.00 0.00 ? 118 GLN A HE21 7  
ATOM   8825  H  HE22 . GLN A 1 54 ? 15.130  -2.054  -6.084  1.00 0.00 ? 118 GLN A HE22 7  
ATOM   8826  N  N    . LYS A 1 55 ? 9.231   -0.520  -10.010 1.00 0.00 ? 119 LYS A N    7  
ATOM   8827  C  CA   . LYS A 1 55 ? 8.690   -0.396  -11.359 1.00 0.00 ? 119 LYS A CA   7  
ATOM   8828  C  C    . LYS A 1 55 ? 8.807   -1.715  -12.115 1.00 0.00 ? 119 LYS A C    7  
ATOM   8829  O  O    . LYS A 1 55 ? 7.831   -2.205  -12.684 1.00 0.00 ? 119 LYS A O    7  
ATOM   8830  C  CB   . LYS A 1 55 ? 9.422   0.709   -12.124 1.00 0.00 ? 119 LYS A CB   7  
ATOM   8831  C  CG   . LYS A 1 55 ? 8.762   1.076   -13.442 1.00 0.00 ? 119 LYS A CG   7  
ATOM   8832  C  CD   . LYS A 1 55 ? 9.705   1.861   -14.338 1.00 0.00 ? 119 LYS A CD   7  
ATOM   8833  C  CE   . LYS A 1 55 ? 10.559  0.938   -15.194 1.00 0.00 ? 119 LYS A CE   7  
ATOM   8834  N  NZ   . LYS A 1 55 ? 9.776   0.331   -16.306 1.00 0.00 ? 119 LYS A NZ   7  
ATOM   8835  H  H    . LYS A 1 55 ? 9.743   0.225   -9.630  1.00 0.00 ? 119 LYS A H    7  
ATOM   8836  H  HA   . LYS A 1 55 ? 7.646   -0.134  -11.275 1.00 0.00 ? 119 LYS A HA   7  
ATOM   8837  H  HB2  . LYS A 1 55 ? 9.459   1.594   -11.506 1.00 0.00 ? 119 LYS A HB2  7  
ATOM   8838  H  HB3  . LYS A 1 55 ? 10.430  0.381   -12.329 1.00 0.00 ? 119 LYS A HB3  7  
ATOM   8839  H  HG2  . LYS A 1 55 ? 8.469   0.170   -13.952 1.00 0.00 ? 119 LYS A HG2  7  
ATOM   8840  H  HG3  . LYS A 1 55 ? 7.887   1.677   -13.241 1.00 0.00 ? 119 LYS A HG3  7  
ATOM   8841  H  HD2  . LYS A 1 55 ? 9.123   2.499   -14.987 1.00 0.00 ? 119 LYS A HD2  7  
ATOM   8842  H  HD3  . LYS A 1 55 ? 10.353  2.467   -13.721 1.00 0.00 ? 119 LYS A HD3  7  
ATOM   8843  H  HE2  . LYS A 1 55 ? 11.376  1.507   -15.609 1.00 0.00 ? 119 LYS A HE2  7  
ATOM   8844  H  HE3  . LYS A 1 55 ? 10.950  0.149   -14.568 1.00 0.00 ? 119 LYS A HE3  7  
ATOM   8845  H  HZ1  . LYS A 1 55 ? 9.865   -0.705  -16.282 1.00 0.00 ? 119 LYS A HZ1  7  
ATOM   8846  H  HZ2  . LYS A 1 55 ? 10.128  0.678   -17.221 1.00 0.00 ? 119 LYS A HZ2  7  
ATOM   8847  H  HZ3  . LYS A 1 55 ? 8.771   0.584   -16.215 1.00 0.00 ? 119 LYS A HZ3  7  
ATOM   8848  N  N    . LYS A 1 56 ? 10.006  -2.287  -12.117 1.00 0.00 ? 120 LYS A N    7  
ATOM   8849  C  CA   . LYS A 1 56 ? 10.250  -3.551  -12.801 1.00 0.00 ? 120 LYS A CA   7  
ATOM   8850  C  C    . LYS A 1 56 ? 9.787   -4.729  -11.950 1.00 0.00 ? 120 LYS A C    7  
ATOM   8851  O  O    . LYS A 1 56 ? 9.094   -5.622  -12.434 1.00 0.00 ? 120 LYS A O    7  
ATOM   8852  C  CB   . LYS A 1 56 ? 11.738  -3.698  -13.129 1.00 0.00 ? 120 LYS A CB   7  
ATOM   8853  C  CG   . LYS A 1 56 ? 12.252  -2.656  -14.106 1.00 0.00 ? 120 LYS A CG   7  
ATOM   8854  C  CD   . LYS A 1 56 ? 11.975  -3.057  -15.546 1.00 0.00 ? 120 LYS A CD   7  
ATOM   8855  C  CE   . LYS A 1 56 ? 13.002  -2.463  -16.497 1.00 0.00 ? 120 LYS A CE   7  
ATOM   8856  N  NZ   . LYS A 1 56 ? 12.940  -3.093  -17.845 1.00 0.00 ? 120 LYS A NZ   7  
ATOM   8857  H  H    . LYS A 1 56 ? 10.745  -1.848  -11.646 1.00 0.00 ? 120 LYS A H    7  
ATOM   8858  H  HA   . LYS A 1 56 ? 9.687   -3.545  -13.722 1.00 0.00 ? 120 LYS A HA   7  
ATOM   8859  H  HB2  . LYS A 1 56 ? 12.306  -3.614  -12.214 1.00 0.00 ? 120 LYS A HB2  7  
ATOM   8860  H  HB3  . LYS A 1 56 ? 11.905  -4.676  -13.557 1.00 0.00 ? 120 LYS A HB3  7  
ATOM   8861  H  HG2  . LYS A 1 56 ? 11.761  -1.715  -13.906 1.00 0.00 ? 120 LYS A HG2  7  
ATOM   8862  H  HG3  . LYS A 1 56 ? 13.318  -2.544  -13.972 1.00 0.00 ? 120 LYS A HG3  7  
ATOM   8863  H  HD2  . LYS A 1 56 ? 12.010  -4.133  -15.623 1.00 0.00 ? 120 LYS A HD2  7  
ATOM   8864  H  HD3  . LYS A 1 56 ? 10.992  -2.706  -15.825 1.00 0.00 ? 120 LYS A HD3  7  
ATOM   8865  H  HE2  . LYS A 1 56 ? 12.813  -1.405  -16.595 1.00 0.00 ? 120 LYS A HE2  7  
ATOM   8866  H  HE3  . LYS A 1 56 ? 13.988  -2.615  -16.082 1.00 0.00 ? 120 LYS A HE3  7  
ATOM   8867  H  HZ1  . LYS A 1 56 ? 12.683  -4.097  -17.758 1.00 0.00 ? 120 LYS A HZ1  7  
ATOM   8868  H  HZ2  . LYS A 1 56 ? 13.866  -3.023  -18.314 1.00 0.00 ? 120 LYS A HZ2  7  
ATOM   8869  H  HZ3  . LYS A 1 56 ? 12.229  -2.613  -18.432 1.00 0.00 ? 120 LYS A HZ3  7  
ATOM   8870  N  N    . ASN A 1 57 ? 10.175  -4.723  -10.678 1.00 0.00 ? 121 ASN A N    7  
ATOM   8871  C  CA   . ASN A 1 57 ? 9.799   -5.791  -9.759  1.00 0.00 ? 121 ASN A CA   7  
ATOM   8872  C  C    . ASN A 1 57 ? 8.401   -5.554  -9.194  1.00 0.00 ? 121 ASN A C    7  
ATOM   8873  O  O    . ASN A 1 57 ? 8.172   -5.710  -7.994  1.00 0.00 ? 121 ASN A O    7  
ATOM   8874  C  CB   . ASN A 1 57 ? 10.813  -5.891  -8.618  1.00 0.00 ? 121 ASN A CB   7  
ATOM   8875  C  CG   . ASN A 1 57 ? 12.235  -5.645  -9.084  1.00 0.00 ? 121 ASN A CG   7  
ATOM   8876  O  OD1  . ASN A 1 57 ? 12.706  -4.508  -9.102  1.00 0.00 ? 121 ASN A OD1  7  
ATOM   8877  N  ND2  . ASN A 1 57 ? 12.925  -6.714  -9.466  1.00 0.00 ? 121 ASN A ND2  7  
ATOM   8878  H  H    . ASN A 1 57 ? 10.728  -3.983  -10.350 1.00 0.00 ? 121 ASN A H    7  
ATOM   8879  H  HA   . ASN A 1 57 ? 9.799   -6.718  -10.311 1.00 0.00 ? 121 ASN A HA   7  
ATOM   8880  H  HB2  . ASN A 1 57 ? 10.570  -5.156  -7.864  1.00 0.00 ? 121 ASN A HB2  7  
ATOM   8881  H  HB3  . ASN A 1 57 ? 10.761  -6.877  -8.183  1.00 0.00 ? 121 ASN A HB3  7  
ATOM   8882  H  HD21 . ASN A 1 57 ? 12.484  -7.588  -9.425  1.00 0.00 ? 121 ASN A HD21 7  
ATOM   8883  H  HD22 . ASN A 1 57 ? 13.847  -6.584  -9.771  1.00 0.00 ? 121 ASN A HD22 7  
ATOM   8884  N  N    . ARG A 1 58 ? 7.472   -5.178  -10.066 1.00 0.00 ? 122 ARG A N    7  
ATOM   8885  C  CA   . ARG A 1 58 ? 6.097   -4.920  -9.654  1.00 0.00 ? 122 ARG A CA   7  
ATOM   8886  C  C    . ARG A 1 58 ? 5.300   -6.219  -9.577  1.00 0.00 ? 122 ARG A C    7  
ATOM   8887  O  O    . ARG A 1 58 ? 4.646   -6.498  -8.573  1.00 0.00 ? 122 ARG A O    7  
ATOM   8888  C  CB   . ARG A 1 58 ? 5.424   -3.952  -10.629 1.00 0.00 ? 122 ARG A CB   7  
ATOM   8889  C  CG   . ARG A 1 58 ? 4.161   -3.312  -10.076 1.00 0.00 ? 122 ARG A CG   7  
ATOM   8890  C  CD   . ARG A 1 58 ? 3.443   -2.491  -11.136 1.00 0.00 ? 122 ARG A CD   7  
ATOM   8891  N  NE   . ARG A 1 58 ? 2.905   -3.329  -12.205 1.00 0.00 ? 122 ARG A NE   7  
ATOM   8892  C  CZ   . ARG A 1 58 ? 1.964   -2.926  -13.051 1.00 0.00 ? 122 ARG A CZ   7  
ATOM   8893  N  NH1  . ARG A 1 58 ? 1.459   -1.704  -12.953 1.00 0.00 ? 122 ARG A NH1  7  
ATOM   8894  N  NH2  . ARG A 1 58 ? 1.526   -3.746  -13.998 1.00 0.00 ? 122 ARG A NH2  7  
ATOM   8895  H  H    . ARG A 1 58 ? 7.716   -5.071  -11.009 1.00 0.00 ? 122 ARG A H    7  
ATOM   8896  H  HA   . ARG A 1 58 ? 6.124   -4.469  -8.674  1.00 0.00 ? 122 ARG A HA   7  
ATOM   8897  H  HB2  . ARG A 1 58 ? 6.121   -3.166  -10.877 1.00 0.00 ? 122 ARG A HB2  7  
ATOM   8898  H  HB3  . ARG A 1 58 ? 5.164   -4.490  -11.529 1.00 0.00 ? 122 ARG A HB3  7  
ATOM   8899  H  HG2  . ARG A 1 58 ? 3.497   -4.089  -9.727  1.00 0.00 ? 122 ARG A HG2  7  
ATOM   8900  H  HG3  . ARG A 1 58 ? 4.428   -2.666  -9.252  1.00 0.00 ? 122 ARG A HG3  7  
ATOM   8901  H  HD2  . ARG A 1 58 ? 2.630   -1.956  -10.668 1.00 0.00 ? 122 ARG A HD2  7  
ATOM   8902  H  HD3  . ARG A 1 58 ? 4.141   -1.786  -11.560 1.00 0.00 ? 122 ARG A HD3  7  
ATOM   8903  H  HE   . ARG A 1 58 ? 3.264   -4.235  -12.295 1.00 0.00 ? 122 ARG A HE   7  
ATOM   8904  H  HH11 . ARG A 1 58 ? 1.788   -1.083  -12.242 1.00 0.00 ? 122 ARG A HH11 7  
ATOM   8905  H  HH12 . ARG A 1 58 ? 0.751   -1.402  -13.593 1.00 0.00 ? 122 ARG A HH12 7  
ATOM   8906  H  HH21 . ARG A 1 58 ? 1.905   -4.668  -14.075 1.00 0.00 ? 122 ARG A HH21 7  
ATOM   8907  H  HH22 . ARG A 1 58 ? 0.818   -3.442  -14.634 1.00 0.00 ? 122 ARG A HH22 7  
ATOM   8908  N  N    . ASN A 1 59 ? 5.359   -7.008  -10.645 1.00 0.00 ? 123 ASN A N    7  
ATOM   8909  C  CA   . ASN A 1 59 ? 4.641   -8.276  -10.698 1.00 0.00 ? 123 ASN A CA   7  
ATOM   8910  C  C    . ASN A 1 59 ? 5.515   -9.417  -10.187 1.00 0.00 ? 123 ASN A C    7  
ATOM   8911  O  O    . ASN A 1 59 ? 5.496   -10.521 -10.732 1.00 0.00 ? 123 ASN A O    7  
ATOM   8912  C  CB   . ASN A 1 59 ? 4.187   -8.569  -12.130 1.00 0.00 ? 123 ASN A CB   7  
ATOM   8913  C  CG   . ASN A 1 59 ? 3.442   -7.403  -12.750 1.00 0.00 ? 123 ASN A CG   7  
ATOM   8914  O  OD1  . ASN A 1 59 ? 3.897   -6.260  -12.694 1.00 0.00 ? 123 ASN A OD1  7  
ATOM   8915  N  ND2  . ASN A 1 59 ? 2.289   -7.687  -13.345 1.00 0.00 ? 123 ASN A ND2  7  
ATOM   8916  H  H    . ASN A 1 59 ? 5.897   -6.730  -11.415 1.00 0.00 ? 123 ASN A H    7  
ATOM   8917  H  HA   . ASN A 1 59 ? 3.771   -8.192  -10.065 1.00 0.00 ? 123 ASN A HA   7  
ATOM   8918  H  HB2  . ASN A 1 59 ? 5.053   -8.782  -12.739 1.00 0.00 ? 123 ASN A HB2  7  
ATOM   8919  H  HB3  . ASN A 1 59 ? 3.534   -9.429  -12.126 1.00 0.00 ? 123 ASN A HB3  7  
ATOM   8920  H  HD21 . ASN A 1 59 ? 1.988   -8.619  -13.351 1.00 0.00 ? 123 ASN A HD21 7  
ATOM   8921  H  HD22 . ASN A 1 59 ? 1.787   -6.952  -13.755 1.00 0.00 ? 123 ASN A HD22 7  
ATOM   8922  N  N    . LYS A 1 60 ? 6.279   -9.144  -9.135  1.00 0.00 ? 124 LYS A N    7  
ATOM   8923  C  CA   . LYS A 1 60 ? 7.159   -10.147 -8.547  1.00 0.00 ? 124 LYS A CA   7  
ATOM   8924  C  C    . LYS A 1 60 ? 6.446   -10.911 -7.436  1.00 0.00 ? 124 LYS A C    7  
ATOM   8925  O  O    . LYS A 1 60 ? 6.342   -12.138 -7.480  1.00 0.00 ? 124 LYS A O    7  
ATOM   8926  C  CB   . LYS A 1 60 ? 8.424   -9.485  -7.994  1.00 0.00 ? 124 LYS A CB   7  
ATOM   8927  C  CG   . LYS A 1 60 ? 9.494   -10.476 -7.570  1.00 0.00 ? 124 LYS A CG   7  
ATOM   8928  C  CD   . LYS A 1 60 ? 10.608  -9.795  -6.793  1.00 0.00 ? 124 LYS A CD   7  
ATOM   8929  C  CE   . LYS A 1 60 ? 11.910  -10.575 -6.888  1.00 0.00 ? 124 LYS A CE   7  
ATOM   8930  N  NZ   . LYS A 1 60 ? 11.997  -11.638 -5.849  1.00 0.00 ? 124 LYS A NZ   7  
ATOM   8931  H  H    . LYS A 1 60 ? 6.251   -8.245  -8.744  1.00 0.00 ? 124 LYS A H    7  
ATOM   8932  H  HA   . LYS A 1 60 ? 7.437   -10.841 -9.325  1.00 0.00 ? 124 LYS A HA   7  
ATOM   8933  H  HB2  . LYS A 1 60 ? 8.840   -8.841  -8.755  1.00 0.00 ? 124 LYS A HB2  7  
ATOM   8934  H  HB3  . LYS A 1 60 ? 8.156   -8.886  -7.135  1.00 0.00 ? 124 LYS A HB3  7  
ATOM   8935  H  HG2  . LYS A 1 60 ? 9.043   -11.232 -6.945  1.00 0.00 ? 124 LYS A HG2  7  
ATOM   8936  H  HG3  . LYS A 1 60 ? 9.913   -10.938 -8.453  1.00 0.00 ? 124 LYS A HG3  7  
ATOM   8937  H  HD2  . LYS A 1 60 ? 10.764  -8.806  -7.197  1.00 0.00 ? 124 LYS A HD2  7  
ATOM   8938  H  HD3  . LYS A 1 60 ? 10.317  -9.721  -5.755  1.00 0.00 ? 124 LYS A HD3  7  
ATOM   8939  H  HE2  . LYS A 1 60 ? 11.971  -11.032 -7.864  1.00 0.00 ? 124 LYS A HE2  7  
ATOM   8940  H  HE3  . LYS A 1 60 ? 12.735  -9.889  -6.760  1.00 0.00 ? 124 LYS A HE3  7  
ATOM   8941  H  HZ1  . LYS A 1 60 ? 11.044  -11.909 -5.534  1.00 0.00 ? 124 LYS A HZ1  7  
ATOM   8942  H  HZ2  . LYS A 1 60 ? 12.536  -11.292 -5.029  1.00 0.00 ? 124 LYS A HZ2  7  
ATOM   8943  H  HZ3  . LYS A 1 60 ? 12.476  -12.477 -6.235  1.00 0.00 ? 124 LYS A HZ3  7  
ATOM   8944  N  N    . CYS A 1 61 ? 5.956   -10.180 -6.441  1.00 0.00 ? 125 CYS A N    7  
ATOM   8945  C  CA   . CYS A 1 61 ? 5.251   -10.789 -5.319  1.00 0.00 ? 125 CYS A CA   7  
ATOM   8946  C  C    . CYS A 1 61 ? 3.803   -10.313 -5.264  1.00 0.00 ? 125 CYS A C    7  
ATOM   8947  O  O    . CYS A 1 61 ? 3.503   -9.166  -5.595  1.00 0.00 ? 125 CYS A O    7  
ATOM   8948  C  CB   . CYS A 1 61 ? 5.959   -10.456 -4.004  1.00 0.00 ? 125 CYS A CB   7  
ATOM   8949  S  SG   . CYS A 1 61 ? 5.332   -11.382 -2.566  1.00 0.00 ? 125 CYS A SG   7  
ATOM   8950  H  H    . CYS A 1 61 ? 6.070   -9.206  -6.461  1.00 0.00 ? 125 CYS A H    7  
ATOM   8951  H  HA   . CYS A 1 61 ? 5.261   -11.858 -5.462  1.00 0.00 ? 125 CYS A HA   7  
ATOM   8952  H  HB2  . CYS A 1 61 ? 7.012   -10.679 -4.104  1.00 0.00 ? 125 CYS A HB2  7  
ATOM   8953  H  HB3  . CYS A 1 61 ? 5.839   -9.403  -3.796  1.00 0.00 ? 125 CYS A HB3  7  
ATOM   8954  N  N    . GLN A 1 62 ? 2.909   -11.203 -4.843  1.00 0.00 ? 126 GLN A N    7  
ATOM   8955  C  CA   . GLN A 1 62 ? 1.492   -10.874 -4.745  1.00 0.00 ? 126 GLN A CA   7  
ATOM   8956  C  C    . GLN A 1 62 ? 1.170   -10.252 -3.390  1.00 0.00 ? 126 GLN A C    7  
ATOM   8957  O  O    . GLN A 1 62 ? 0.572   -9.179  -3.315  1.00 0.00 ? 126 GLN A O    7  
ATOM   8958  C  CB   . GLN A 1 62 ? 0.640   -12.126 -4.960  1.00 0.00 ? 126 GLN A CB   7  
ATOM   8959  C  CG   . GLN A 1 62 ? 0.309   -12.394 -6.419  1.00 0.00 ? 126 GLN A CG   7  
ATOM   8960  C  CD   . GLN A 1 62 ? -0.312  -13.759 -6.636  1.00 0.00 ? 126 GLN A CD   7  
ATOM   8961  O  OE1  . GLN A 1 62 ? -0.376  -14.578 -5.719  1.00 0.00 ? 126 GLN A OE1  7  
ATOM   8962  N  NE2  . GLN A 1 62 ? -0.774  -14.013 -7.855  1.00 0.00 ? 126 GLN A NE2  7  
ATOM   8963  H  H    . GLN A 1 62 ? 3.210   -12.101 -4.593  1.00 0.00 ? 126 GLN A H    7  
ATOM   8964  H  HA   . GLN A 1 62 ? 1.264   -10.157 -5.519  1.00 0.00 ? 126 GLN A HA   7  
ATOM   8965  H  HB2  . GLN A 1 62 ? 1.173   -12.981 -4.571  1.00 0.00 ? 126 GLN A HB2  7  
ATOM   8966  H  HB3  . GLN A 1 62 ? -0.287  -12.014 -4.418  1.00 0.00 ? 126 GLN A HB3  7  
ATOM   8967  H  HG2  . GLN A 1 62 ? -0.386  -11.641 -6.762  1.00 0.00 ? 126 GLN A HG2  7  
ATOM   8968  H  HG3  . GLN A 1 62 ? 1.219   -12.332 -6.998  1.00 0.00 ? 126 GLN A HG3  7  
ATOM   8969  H  HE21 . GLN A 1 62 ? -0.689  -13.313 -8.537  1.00 0.00 ? 126 GLN A HE21 7  
ATOM   8970  H  HE22 . GLN A 1 62 ? -1.180  -14.888 -8.023  1.00 0.00 ? 126 GLN A HE22 7  
ATOM   8971  N  N    . TYR A 1 63 ? 1.570   -10.934 -2.322  1.00 0.00 ? 127 TYR A N    7  
ATOM   8972  C  CA   . TYR A 1 63 ? 1.321   -10.450 -0.969  1.00 0.00 ? 127 TYR A CA   7  
ATOM   8973  C  C    . TYR A 1 63 ? 1.939   -9.070  -0.762  1.00 0.00 ? 127 TYR A C    7  
ATOM   8974  O  O    . TYR A 1 63 ? 1.230   -8.082  -0.571  1.00 0.00 ? 127 TYR A O    7  
ATOM   8975  C  CB   . TYR A 1 63 ? 1.885   -11.433 0.058   1.00 0.00 ? 127 TYR A CB   7  
ATOM   8976  C  CG   . TYR A 1 63 ? 1.234   -11.326 1.419   1.00 0.00 ? 127 TYR A CG   7  
ATOM   8977  C  CD1  . TYR A 1 63 ? 0.012   -11.936 1.676   1.00 0.00 ? 127 TYR A CD1  7  
ATOM   8978  C  CD2  . TYR A 1 63 ? 1.841   -10.616 2.447   1.00 0.00 ? 127 TYR A CD2  7  
ATOM   8979  C  CE1  . TYR A 1 63 ? -0.587  -11.841 2.917   1.00 0.00 ? 127 TYR A CE1  7  
ATOM   8980  C  CE2  . TYR A 1 63 ? 1.250   -10.517 3.692   1.00 0.00 ? 127 TYR A CE2  7  
ATOM   8981  C  CZ   . TYR A 1 63 ? 0.036   -11.131 3.922   1.00 0.00 ? 127 TYR A CZ   7  
ATOM   8982  O  OH   . TYR A 1 63 ? -0.557  -11.035 5.160   1.00 0.00 ? 127 TYR A OH   7  
ATOM   8983  H  H    . TYR A 1 63 ? 2.042   -11.783 -2.446  1.00 0.00 ? 127 TYR A H    7  
ATOM   8984  H  HA   . TYR A 1 63 ? 0.252   -10.377 -0.834  1.00 0.00 ? 127 TYR A HA   7  
ATOM   8985  H  HB2  . TYR A 1 63 ? 1.740   -12.440 -0.300  1.00 0.00 ? 127 TYR A HB2  7  
ATOM   8986  H  HB3  . TYR A 1 63 ? 2.942   -11.247 0.181   1.00 0.00 ? 127 TYR A HB3  7  
ATOM   8987  H  HD1  . TYR A 1 63 ? -0.473  -12.492 0.886   1.00 0.00 ? 127 TYR A HD1  7  
ATOM   8988  H  HD2  . TYR A 1 63 ? 2.791   -10.137 2.265   1.00 0.00 ? 127 TYR A HD2  7  
ATOM   8989  H  HE1  . TYR A 1 63 ? -1.537  -12.322 3.097   1.00 0.00 ? 127 TYR A HE1  7  
ATOM   8990  H  HE2  . TYR A 1 63 ? 1.737   -9.961  4.480   1.00 0.00 ? 127 TYR A HE2  7  
ATOM   8991  H  HH   . TYR A 1 63 ? -1.206  -10.327 5.150   1.00 0.00 ? 127 TYR A HH   7  
ATOM   8992  N  N    . CYS A 1 64 ? 3.266   -9.011  -0.803  1.00 0.00 ? 128 CYS A N    7  
ATOM   8993  C  CA   . CYS A 1 64 ? 3.982   -7.754  -0.621  1.00 0.00 ? 128 CYS A CA   7  
ATOM   8994  C  C    . CYS A 1 64 ? 3.280   -6.616  -1.356  1.00 0.00 ? 128 CYS A C    7  
ATOM   8995  O  O    . CYS A 1 64 ? 3.143   -5.513  -0.828  1.00 0.00 ? 128 CYS A O    7  
ATOM   8996  C  CB   . CYS A 1 64 ? 5.422   -7.887  -1.120  1.00 0.00 ? 128 CYS A CB   7  
ATOM   8997  S  SG   . CYS A 1 64 ? 6.479   -8.934  -0.070  1.00 0.00 ? 128 CYS A SG   7  
ATOM   8998  H  H    . CYS A 1 64 ? 3.777   -9.834  -0.960  1.00 0.00 ? 128 CYS A H    7  
ATOM   8999  H  HA   . CYS A 1 64 ? 3.995   -7.530  0.435   1.00 0.00 ? 128 CYS A HA   7  
ATOM   9000  H  HB2  . CYS A 1 64 ? 5.414   -8.318  -2.110  1.00 0.00 ? 128 CYS A HB2  7  
ATOM   9001  H  HB3  . CYS A 1 64 ? 5.871   -6.905  -1.164  1.00 0.00 ? 128 CYS A HB3  7  
ATOM   9002  N  N    . ARG A 1 65 ? 2.836   -6.894  -2.578  1.00 0.00 ? 129 ARG A N    7  
ATOM   9003  C  CA   . ARG A 1 65 ? 2.149   -5.894  -3.386  1.00 0.00 ? 129 ARG A CA   7  
ATOM   9004  C  C    . ARG A 1 65 ? 0.940   -5.331  -2.644  1.00 0.00 ? 129 ARG A C    7  
ATOM   9005  O  O    . ARG A 1 65 ? 0.748   -4.117  -2.580  1.00 0.00 ? 129 ARG A O    7  
ATOM   9006  C  CB   . ARG A 1 65 ? 1.705   -6.502  -4.718  1.00 0.00 ? 129 ARG A CB   7  
ATOM   9007  C  CG   . ARG A 1 65 ? 1.576   -5.484  -5.839  1.00 0.00 ? 129 ARG A CG   7  
ATOM   9008  C  CD   . ARG A 1 65 ? 1.629   -6.150  -7.205  1.00 0.00 ? 129 ARG A CD   7  
ATOM   9009  N  NE   . ARG A 1 65 ? 1.034   -5.314  -8.245  1.00 0.00 ? 129 ARG A NE   7  
ATOM   9010  C  CZ   . ARG A 1 65 ? 1.101   -5.596  -9.542  1.00 0.00 ? 129 ARG A CZ   7  
ATOM   9011  N  NH1  . ARG A 1 65 ? 1.733   -6.685  -9.955  1.00 0.00 ? 129 ARG A NH1  7  
ATOM   9012  N  NH2  . ARG A 1 65 ? 0.534   -4.786  -10.427 1.00 0.00 ? 129 ARG A NH2  7  
ATOM   9013  H  H    . ARG A 1 65 ? 2.974   -7.792  -2.945  1.00 0.00 ? 129 ARG A H    7  
ATOM   9014  H  HA   . ARG A 1 65 ? 2.843   -5.090  -3.581  1.00 0.00 ? 129 ARG A HA   7  
ATOM   9015  H  HB2  . ARG A 1 65 ? 2.426   -7.247  -5.019  1.00 0.00 ? 129 ARG A HB2  7  
ATOM   9016  H  HB3  . ARG A 1 65 ? 0.745   -6.977  -4.581  1.00 0.00 ? 129 ARG A HB3  7  
ATOM   9017  H  HG2  . ARG A 1 65 ? 0.632   -4.968  -5.739  1.00 0.00 ? 129 ARG A HG2  7  
ATOM   9018  H  HG3  . ARG A 1 65 ? 2.386   -4.774  -5.763  1.00 0.00 ? 129 ARG A HG3  7  
ATOM   9019  H  HD2  . ARG A 1 65 ? 2.661   -6.341  -7.458  1.00 0.00 ? 129 ARG A HD2  7  
ATOM   9020  H  HD3  . ARG A 1 65 ? 1.091   -7.085  -7.156  1.00 0.00 ? 129 ARG A HD3  7  
ATOM   9021  H  HE   . ARG A 1 65 ? 0.562   -4.504  -7.962  1.00 0.00 ? 129 ARG A HE   7  
ATOM   9022  H  HH11 . ARG A 1 65 ? 2.159   -7.298  -9.290  1.00 0.00 ? 129 ARG A HH11 7  
ATOM   9023  H  HH12 . ARG A 1 65 ? 1.780   -6.896  -10.932 1.00 0.00 ? 129 ARG A HH12 7  
ATOM   9024  H  HH21 . ARG A 1 65 ? 0.057   -3.964  -10.119 1.00 0.00 ? 129 ARG A HH21 7  
ATOM   9025  H  HH22 . ARG A 1 65 ? 0.585   -4.999  -11.403 1.00 0.00 ? 129 ARG A HH22 7  
ATOM   9026  N  N    . PHE A 1 66 ? 0.129   -6.222  -2.083  1.00 0.00 ? 130 PHE A N    7  
ATOM   9027  C  CA   . PHE A 1 66 ? -1.062  -5.815  -1.346  1.00 0.00 ? 130 PHE A CA   7  
ATOM   9028  C  C    . PHE A 1 66 ? -0.684  -5.184  -0.009  1.00 0.00 ? 130 PHE A C    7  
ATOM   9029  O  O    . PHE A 1 66 ? -1.230  -4.151  0.377   1.00 0.00 ? 130 PHE A O    7  
ATOM   9030  C  CB   . PHE A 1 66 ? -1.980  -7.017  -1.115  1.00 0.00 ? 130 PHE A CB   7  
ATOM   9031  C  CG   . PHE A 1 66 ? -3.335  -6.643  -0.585  1.00 0.00 ? 130 PHE A CG   7  
ATOM   9032  C  CD1  . PHE A 1 66 ? -4.072  -5.632  -1.181  1.00 0.00 ? 130 PHE A CD1  7  
ATOM   9033  C  CD2  . PHE A 1 66 ? -3.871  -7.301  0.510   1.00 0.00 ? 130 PHE A CD2  7  
ATOM   9034  C  CE1  . PHE A 1 66 ? -5.319  -5.285  -0.696  1.00 0.00 ? 130 PHE A CE1  7  
ATOM   9035  C  CE2  . PHE A 1 66 ? -5.117  -6.959  0.999   1.00 0.00 ? 130 PHE A CE2  7  
ATOM   9036  C  CZ   . PHE A 1 66 ? -5.842  -5.950  0.397   1.00 0.00 ? 130 PHE A CZ   7  
ATOM   9037  H  H    . PHE A 1 66 ? 0.336   -7.177  -2.168  1.00 0.00 ? 130 PHE A H    7  
ATOM   9038  H  HA   . PHE A 1 66 ? -1.585  -5.082  -1.942  1.00 0.00 ? 130 PHE A HA   7  
ATOM   9039  H  HB2  . PHE A 1 66 ? -2.123  -7.537  -2.050  1.00 0.00 ? 130 PHE A HB2  7  
ATOM   9040  H  HB3  . PHE A 1 66 ? -1.516  -7.683  -0.404  1.00 0.00 ? 130 PHE A HB3  7  
ATOM   9041  H  HD1  . PHE A 1 66 ? -3.663  -5.111  -2.036  1.00 0.00 ? 130 PHE A HD1  7  
ATOM   9042  H  HD2  . PHE A 1 66 ? -3.305  -8.090  0.983   1.00 0.00 ? 130 PHE A HD2  7  
ATOM   9043  H  HE1  . PHE A 1 66 ? -5.882  -4.495  -1.169  1.00 0.00 ? 130 PHE A HE1  7  
ATOM   9044  H  HE2  . PHE A 1 66 ? -5.524  -7.480  1.854   1.00 0.00 ? 130 PHE A HE2  7  
ATOM   9045  H  HZ   . PHE A 1 66 ? -6.816  -5.681  0.777   1.00 0.00 ? 130 PHE A HZ   7  
ATOM   9046  N  N    . GLN A 1 67 ? 0.252   -5.814  0.692   1.00 0.00 ? 131 GLN A N    7  
ATOM   9047  C  CA   . GLN A 1 67 ? 0.702   -5.316  1.987   1.00 0.00 ? 131 GLN A CA   7  
ATOM   9048  C  C    . GLN A 1 67 ? 1.174   -3.869  1.879   1.00 0.00 ? 131 GLN A C    7  
ATOM   9049  O  O    . GLN A 1 67 ? 0.723   -3.000  2.625   1.00 0.00 ? 131 GLN A O    7  
ATOM   9050  C  CB   . GLN A 1 67 ? 1.830   -6.194  2.531   1.00 0.00 ? 131 GLN A CB   7  
ATOM   9051  C  CG   . GLN A 1 67 ? 1.397   -7.617  2.842   1.00 0.00 ? 131 GLN A CG   7  
ATOM   9052  C  CD   . GLN A 1 67 ? 0.200   -7.674  3.771   1.00 0.00 ? 131 GLN A CD   7  
ATOM   9053  O  OE1  . GLN A 1 67 ? -0.940  -7.806  3.325   1.00 0.00 ? 131 GLN A OE1  7  
ATOM   9054  N  NE2  . GLN A 1 67 ? 0.454   -7.575  5.070   1.00 0.00 ? 131 GLN A NE2  7  
ATOM   9055  H  H    . GLN A 1 67 ? 0.650   -6.633  0.331   1.00 0.00 ? 131 GLN A H    7  
ATOM   9056  H  HA   . GLN A 1 67 ? -0.135  -5.358  2.667   1.00 0.00 ? 131 GLN A HA   7  
ATOM   9057  H  HB2  . GLN A 1 67 ? 2.624   -6.232  1.801   1.00 0.00 ? 131 GLN A HB2  7  
ATOM   9058  H  HB3  . GLN A 1 67 ? 2.208   -5.750  3.440   1.00 0.00 ? 131 GLN A HB3  7  
ATOM   9059  H  HG2  . GLN A 1 67 ? 1.138   -8.111  1.917   1.00 0.00 ? 131 GLN A HG2  7  
ATOM   9060  H  HG3  . GLN A 1 67 ? 2.221   -8.137  3.308   1.00 0.00 ? 131 GLN A HG3  7  
ATOM   9061  H  HE21 . GLN A 1 67 ? 1.387   -7.471  5.352   1.00 0.00 ? 131 GLN A HE21 7  
ATOM   9062  H  HE22 . GLN A 1 67 ? -0.301  -7.608  5.693   1.00 0.00 ? 131 GLN A HE22 7  
ATOM   9063  N  N    . LYS A 1 68 ? 2.085   -3.618  0.945   1.00 0.00 ? 132 LYS A N    7  
ATOM   9064  C  CA   . LYS A 1 68 ? 2.619   -2.277  0.738   1.00 0.00 ? 132 LYS A CA   7  
ATOM   9065  C  C    . LYS A 1 68 ? 1.497   -1.244  0.699   1.00 0.00 ? 132 LYS A C    7  
ATOM   9066  O  O    . LYS A 1 68 ? 1.453   -0.330  1.524   1.00 0.00 ? 132 LYS A O    7  
ATOM   9067  C  CB   . LYS A 1 68 ? 3.422   -2.221  -0.564  1.00 0.00 ? 132 LYS A CB   7  
ATOM   9068  C  CG   . LYS A 1 68 ? 4.284   -0.977  -0.694  1.00 0.00 ? 132 LYS A CG   7  
ATOM   9069  C  CD   . LYS A 1 68 ? 5.510   -1.235  -1.554  1.00 0.00 ? 132 LYS A CD   7  
ATOM   9070  C  CE   . LYS A 1 68 ? 6.408   -0.010  -1.625  1.00 0.00 ? 132 LYS A CE   7  
ATOM   9071  N  NZ   . LYS A 1 68 ? 7.651   -0.278  -2.401  1.00 0.00 ? 132 LYS A NZ   7  
ATOM   9072  H  H    . LYS A 1 68 ? 2.406   -4.353  0.380   1.00 0.00 ? 132 LYS A H    7  
ATOM   9073  H  HA   . LYS A 1 68 ? 3.274   -2.049  1.565   1.00 0.00 ? 132 LYS A HA   7  
ATOM   9074  H  HB2  . LYS A 1 68 ? 4.066   -3.087  -0.612  1.00 0.00 ? 132 LYS A HB2  7  
ATOM   9075  H  HB3  . LYS A 1 68 ? 2.736   -2.247  -1.398  1.00 0.00 ? 132 LYS A HB3  7  
ATOM   9076  H  HG2  . LYS A 1 68 ? 3.699   -0.190  -1.147  1.00 0.00 ? 132 LYS A HG2  7  
ATOM   9077  H  HG3  . LYS A 1 68 ? 4.605   -0.668  0.291   1.00 0.00 ? 132 LYS A HG3  7  
ATOM   9078  H  HD2  . LYS A 1 68 ? 6.071   -2.054  -1.130  1.00 0.00 ? 132 LYS A HD2  7  
ATOM   9079  H  HD3  . LYS A 1 68 ? 5.189   -1.495  -2.553  1.00 0.00 ? 132 LYS A HD3  7  
ATOM   9080  H  HE2  . LYS A 1 68 ? 5.864   0.792   -2.100  1.00 0.00 ? 132 LYS A HE2  7  
ATOM   9081  H  HE3  . LYS A 1 68 ? 6.676   0.283   -0.621  1.00 0.00 ? 132 LYS A HE3  7  
ATOM   9082  H  HZ1  . LYS A 1 68 ? 8.415   0.350   -2.080  1.00 0.00 ? 132 LYS A HZ1  7  
ATOM   9083  H  HZ2  . LYS A 1 68 ? 7.483   -0.112  -3.414  1.00 0.00 ? 132 LYS A HZ2  7  
ATOM   9084  H  HZ3  . LYS A 1 68 ? 7.949   -1.265  -2.268  1.00 0.00 ? 132 LYS A HZ3  7  
ATOM   9085  N  N    . CYS A 1 69 ? 0.591   -1.397  -0.260  1.00 0.00 ? 133 CYS A N    7  
ATOM   9086  C  CA   . CYS A 1 69 ? -0.532  -0.478  -0.405  1.00 0.00 ? 133 CYS A CA   7  
ATOM   9087  C  C    . CYS A 1 69 ? -1.132  -0.134  0.955   1.00 0.00 ? 133 CYS A C    7  
ATOM   9088  O  O    . CYS A 1 69 ? -1.222  1.037   1.327   1.00 0.00 ? 133 CYS A O    7  
ATOM   9089  C  CB   . CYS A 1 69 ? -1.604  -1.088  -1.309  1.00 0.00 ? 133 CYS A CB   7  
ATOM   9090  S  SG   . CYS A 1 69 ? -1.221  -0.997  -3.074  1.00 0.00 ? 133 CYS A SG   7  
ATOM   9091  H  H    . CYS A 1 69 ? 0.680   -2.145  -0.887  1.00 0.00 ? 133 CYS A H    7  
ATOM   9092  H  HA   . CYS A 1 69 ? -0.162  0.428   -0.861  1.00 0.00 ? 133 CYS A HA   7  
ATOM   9093  H  HB2  . CYS A 1 69 ? -1.729  -2.130  -1.054  1.00 0.00 ? 133 CYS A HB2  7  
ATOM   9094  H  HB3  . CYS A 1 69 ? -2.538  -0.571  -1.147  1.00 0.00 ? 133 CYS A HB3  7  
ATOM   9095  H  HG   . CYS A 1 69 ? -0.754  -2.177  -3.452  1.00 0.00 ? 133 CYS A HG   7  
ATOM   9096  N  N    . LEU A 1 70 ? -1.542  -1.160  1.691   1.00 0.00 ? 134 LEU A N    7  
ATOM   9097  C  CA   . LEU A 1 70 ? -2.135  -0.967  3.010   1.00 0.00 ? 134 LEU A CA   7  
ATOM   9098  C  C    . LEU A 1 70 ? -1.190  -0.193  3.924   1.00 0.00 ? 134 LEU A C    7  
ATOM   9099  O  O    . LEU A 1 70 ? -1.586  0.787   4.555   1.00 0.00 ? 134 LEU A O    7  
ATOM   9100  C  CB   . LEU A 1 70 ? -2.478  -2.318  3.640   1.00 0.00 ? 134 LEU A CB   7  
ATOM   9101  C  CG   . LEU A 1 70 ? -3.452  -3.197  2.854   1.00 0.00 ? 134 LEU A CG   7  
ATOM   9102  C  CD1  . LEU A 1 70 ? -3.356  -4.643  3.314   1.00 0.00 ? 134 LEU A CD1  7  
ATOM   9103  C  CD2  . LEU A 1 70 ? -4.876  -2.681  3.005   1.00 0.00 ? 134 LEU A CD2  7  
ATOM   9104  H  H    . LEU A 1 70 ? -1.444  -2.070  1.341   1.00 0.00 ? 134 LEU A H    7  
ATOM   9105  H  HA   . LEU A 1 70 ? -3.043  -0.397  2.884   1.00 0.00 ? 134 LEU A HA   7  
ATOM   9106  H  HB2  . LEU A 1 70 ? -1.558  -2.870  3.759   1.00 0.00 ? 134 LEU A HB2  7  
ATOM   9107  H  HB3  . LEU A 1 70 ? -2.911  -2.129  4.612   1.00 0.00 ? 134 LEU A HB3  7  
ATOM   9108  H  HG   . LEU A 1 70 ? -3.193  -3.163  1.805   1.00 0.00 ? 134 LEU A HG   7  
ATOM   9109  H  HD11 . LEU A 1 70 ? -3.403  -4.683  4.391   1.00 0.00 ? 134 LEU A HD11 7  
ATOM   9110  H  HD12 . LEU A 1 70 ? -2.421  -5.066  2.978   1.00 0.00 ? 134 LEU A HD12 7  
ATOM   9111  H  HD13 . LEU A 1 70 ? -4.177  -5.209  2.896   1.00 0.00 ? 134 LEU A HD13 7  
ATOM   9112  H  HD21 . LEU A 1 70 ? -5.221  -2.865  4.012   1.00 0.00 ? 134 LEU A HD21 7  
ATOM   9113  H  HD22 . LEU A 1 70 ? -5.520  -3.192  2.305   1.00 0.00 ? 134 LEU A HD22 7  
ATOM   9114  H  HD23 . LEU A 1 70 ? -4.897  -1.619  2.805   1.00 0.00 ? 134 LEU A HD23 7  
ATOM   9115  N  N    . ALA A 1 71 ? 0.060   -0.638  3.987   1.00 0.00 ? 135 ALA A N    7  
ATOM   9116  C  CA   . ALA A 1 71 ? 1.062   0.016   4.820   1.00 0.00 ? 135 ALA A CA   7  
ATOM   9117  C  C    . ALA A 1 71 ? 1.131   1.511   4.525   1.00 0.00 ? 135 ALA A C    7  
ATOM   9118  O  O    . ALA A 1 71 ? 1.334   2.324   5.428   1.00 0.00 ? 135 ALA A O    7  
ATOM   9119  C  CB   . ALA A 1 71 ? 2.424   -0.629  4.611   1.00 0.00 ? 135 ALA A CB   7  
ATOM   9120  H  H    . ALA A 1 71 ? 0.315   -1.424  3.461   1.00 0.00 ? 135 ALA A H    7  
ATOM   9121  H  HA   . ALA A 1 71 ? 0.780   -0.124  5.854   1.00 0.00 ? 135 ALA A HA   7  
ATOM   9122  H  HB1  . ALA A 1 71 ? 2.403   -1.232  3.717   1.00 0.00 ? 135 ALA A HB1  7  
ATOM   9123  H  HB2  . ALA A 1 71 ? 3.174   0.142   4.508   1.00 0.00 ? 135 ALA A HB2  7  
ATOM   9124  H  HB3  . ALA A 1 71 ? 2.662   -1.251  5.461   1.00 0.00 ? 135 ALA A HB3  7  
ATOM   9125  N  N    . LEU A 1 72 ? 0.963   1.866   3.256   1.00 0.00 ? 136 LEU A N    7  
ATOM   9126  C  CA   . LEU A 1 72 ? 1.006   3.264   2.841   1.00 0.00 ? 136 LEU A CA   7  
ATOM   9127  C  C    . LEU A 1 72 ? -0.187  4.035   3.396   1.00 0.00 ? 136 LEU A C    7  
ATOM   9128  O  O    . LEU A 1 72 ? -0.135  5.254   3.551   1.00 0.00 ? 136 LEU A O    7  
ATOM   9129  C  CB   . LEU A 1 72 ? 1.027   3.363   1.315   1.00 0.00 ? 136 LEU A CB   7  
ATOM   9130  C  CG   . LEU A 1 72 ? 2.323   2.926   0.631   1.00 0.00 ? 136 LEU A CG   7  
ATOM   9131  C  CD1  . LEU A 1 72 ? 2.129   2.838   -0.875  1.00 0.00 ? 136 LEU A CD1  7  
ATOM   9132  C  CD2  . LEU A 1 72 ? 3.455   3.885   0.970   1.00 0.00 ? 136 LEU A CD2  7  
ATOM   9133  H  H    . LEU A 1 72 ? 0.805   1.174   2.582   1.00 0.00 ? 136 LEU A H    7  
ATOM   9134  H  HA   . LEU A 1 72 ? 1.914   3.698   3.234   1.00 0.00 ? 136 LEU A HA   7  
ATOM   9135  H  HB2  . LEU A 1 72 ? 0.228   2.747   0.933   1.00 0.00 ? 136 LEU A HB2  7  
ATOM   9136  H  HB3  . LEU A 1 72 ? 0.843   4.395   1.049   1.00 0.00 ? 136 LEU A HB3  7  
ATOM   9137  H  HG   . LEU A 1 72 ? 2.597   1.943   0.990   1.00 0.00 ? 136 LEU A HG   7  
ATOM   9138  H  HD11 . LEU A 1 72 ? 3.047   2.510   -1.337  1.00 0.00 ? 136 LEU A HD11 7  
ATOM   9139  H  HD12 . LEU A 1 72 ? 1.859   3.810   -1.260  1.00 0.00 ? 136 LEU A HD12 7  
ATOM   9140  H  HD13 . LEU A 1 72 ? 1.341   2.133   -1.095  1.00 0.00 ? 136 LEU A HD13 7  
ATOM   9141  H  HD21 . LEU A 1 72 ? 4.373   3.330   1.088   1.00 0.00 ? 136 LEU A HD21 7  
ATOM   9142  H  HD22 . LEU A 1 72 ? 3.225   4.401   1.891   1.00 0.00 ? 136 LEU A HD22 7  
ATOM   9143  H  HD23 . LEU A 1 72 ? 3.567   4.605   0.172   1.00 0.00 ? 136 LEU A HD23 7  
ATOM   9144  N  N    . GLY A 1 73 ? -1.264  3.313   3.695   1.00 0.00 ? 137 GLY A N    7  
ATOM   9145  C  CA   . GLY A 1 73 ? -2.455  3.945   4.232   1.00 0.00 ? 137 GLY A CA   7  
ATOM   9146  C  C    . GLY A 1 73 ? -3.564  4.058   3.205   1.00 0.00 ? 137 GLY A C    7  
ATOM   9147  O  O    . GLY A 1 73 ? -4.389  4.968   3.271   1.00 0.00 ? 137 GLY A O    7  
ATOM   9148  H  H    . GLY A 1 73 ? -1.249  2.344   3.551   1.00 0.00 ? 137 GLY A H    7  
ATOM   9149  H  HA2  . GLY A 1 73 ? -2.811  3.365   5.070   1.00 0.00 ? 137 GLY A HA2  7  
ATOM   9150  H  HA3  . GLY A 1 73 ? -2.198  4.936   4.577   1.00 0.00 ? 137 GLY A HA3  7  
ATOM   9151  N  N    . MET A 1 74 ? -3.583  3.131   2.253   1.00 0.00 ? 138 MET A N    7  
ATOM   9152  C  CA   . MET A 1 74 ? -4.599  3.131   1.207   1.00 0.00 ? 138 MET A CA   7  
ATOM   9153  C  C    . MET A 1 74 ? -5.965  2.763   1.777   1.00 0.00 ? 138 MET A C    7  
ATOM   9154  O  O    . MET A 1 74 ? -6.215  1.607   2.119   1.00 0.00 ? 138 MET A O    7  
ATOM   9155  C  CB   . MET A 1 74 ? -4.217  2.153   0.095   1.00 0.00 ? 138 MET A CB   7  
ATOM   9156  C  CG   . MET A 1 74 ? -3.250  2.737   -0.922  1.00 0.00 ? 138 MET A CG   7  
ATOM   9157  S  SD   . MET A 1 74 ? -3.032  1.674   -2.363  1.00 0.00 ? 138 MET A SD   7  
ATOM   9158  C  CE   . MET A 1 74 ? -2.925  2.894   -3.670  1.00 0.00 ? 138 MET A CE   7  
ATOM   9159  H  H    . MET A 1 74 ? -2.898  2.430   2.253   1.00 0.00 ? 138 MET A H    7  
ATOM   9160  H  HA   . MET A 1 74 ? -4.651  4.128   0.796   1.00 0.00 ? 138 MET A HA   7  
ATOM   9161  H  HB2  . MET A 1 74 ? -3.757  1.283   0.539   1.00 0.00 ? 138 MET A HB2  7  
ATOM   9162  H  HB3  . MET A 1 74 ? -5.113  1.850   -0.426  1.00 0.00 ? 138 MET A HB3  7  
ATOM   9163  H  HG2  . MET A 1 74 ? -3.629  3.692   -1.252  1.00 0.00 ? 138 MET A HG2  7  
ATOM   9164  H  HG3  . MET A 1 74 ? -2.291  2.877   -0.446  1.00 0.00 ? 138 MET A HG3  7  
ATOM   9165  H  HE1  . MET A 1 74 ? -3.450  3.789   -3.370  1.00 0.00 ? 138 MET A HE1  7  
ATOM   9166  H  HE2  . MET A 1 74 ? -1.888  3.131   -3.858  1.00 0.00 ? 138 MET A HE2  7  
ATOM   9167  H  HE3  . MET A 1 74 ? -3.372  2.497   -4.569  1.00 0.00 ? 138 MET A HE3  7  
ATOM   9168  N  N    . SER A 1 75 ? -6.847  3.753   1.877   1.00 0.00 ? 139 SER A N    7  
ATOM   9169  C  CA   . SER A 1 75 ? -8.186  3.533   2.409   1.00 0.00 ? 139 SER A CA   7  
ATOM   9170  C  C    . SER A 1 75 ? -9.075  2.846   1.377   1.00 0.00 ? 139 SER A C    7  
ATOM   9171  O  O    . SER A 1 75 ? -9.116  3.245   0.213   1.00 0.00 ? 139 SER A O    7  
ATOM   9172  C  CB   . SER A 1 75 ? -8.813  4.862   2.836   1.00 0.00 ? 139 SER A CB   7  
ATOM   9173  O  OG   . SER A 1 75 ? -7.940  5.589   3.683   1.00 0.00 ? 139 SER A OG   7  
ATOM   9174  H  H    . SER A 1 75 ? -6.589  4.653   1.588   1.00 0.00 ? 139 SER A H    7  
ATOM   9175  H  HA   . SER A 1 75 ? -8.098  2.892   3.274   1.00 0.00 ? 139 SER A HA   7  
ATOM   9176  H  HB2  . SER A 1 75 ? -9.022  5.456   1.959   1.00 0.00 ? 139 SER A HB2  7  
ATOM   9177  H  HB3  . SER A 1 75 ? -9.733  4.668   3.368   1.00 0.00 ? 139 SER A HB3  7  
ATOM   9178  H  HG   . SER A 1 75 ? -8.128  6.527   3.607   1.00 0.00 ? 139 SER A HG   7  
ATOM   9179  N  N    . HIS A 1 76 ? -9.787  1.811   1.813   1.00 0.00 ? 140 HIS A N    7  
ATOM   9180  C  CA   . HIS A 1 76 ? -10.677 1.068   0.927   1.00 0.00 ? 140 HIS A CA   7  
ATOM   9181  C  C    . HIS A 1 76 ? -12.014 1.786   0.774   1.00 0.00 ? 140 HIS A C    7  
ATOM   9182  O  O    . HIS A 1 76 ? -12.552 1.887   -0.328  1.00 0.00 ? 140 HIS A O    7  
ATOM   9183  C  CB   . HIS A 1 76 ? -10.902 -0.345  1.465   1.00 0.00 ? 140 HIS A CB   7  
ATOM   9184  C  CG   . HIS A 1 76 ? -11.060 -0.401  2.954   1.00 0.00 ? 140 HIS A CG   7  
ATOM   9185  N  ND1  . HIS A 1 76 ? -12.169 0.085   3.612   1.00 0.00 ? 140 HIS A ND1  7  
ATOM   9186  C  CD2  . HIS A 1 76 ? -10.240 -0.892  3.913   1.00 0.00 ? 140 HIS A CD2  7  
ATOM   9187  C  CE1  . HIS A 1 76 ? -12.025 -0.103  4.912   1.00 0.00 ? 140 HIS A CE1  7  
ATOM   9188  N  NE2  . HIS A 1 76 ? -10.863 -0.694  5.121   1.00 0.00 ? 140 HIS A NE2  7  
ATOM   9189  H  H    . HIS A 1 76 ? -9.712  1.541   2.752   1.00 0.00 ? 140 HIS A H    7  
ATOM   9190  H  HA   . HIS A 1 76 ? -10.204 1.004   -0.041  1.00 0.00 ? 140 HIS A HA   7  
ATOM   9191  H  HB2  . HIS A 1 76 ? -11.799 -0.753  1.022   1.00 0.00 ? 140 HIS A HB2  7  
ATOM   9192  H  HB3  . HIS A 1 76 ? -10.059 -0.965  1.196   1.00 0.00 ? 140 HIS A HB3  7  
ATOM   9193  H  HD1  . HIS A 1 76 ? -12.946 0.506   3.190   1.00 0.00 ? 140 HIS A HD1  7  
ATOM   9194  H  HD2  . HIS A 1 76 ? -9.275  -1.354  3.758   1.00 0.00 ? 140 HIS A HD2  7  
ATOM   9195  H  HE1  . HIS A 1 76 ? -12.736 0.179   5.674   1.00 0.00 ? 140 HIS A HE1  7  
ATOM   9196  N  N    . ASN A 1 77 ? -12.545 2.283   1.886   1.00 0.00 ? 141 ASN A N    7  
ATOM   9197  C  CA   . ASN A 1 77 ? -13.820 2.991   1.875   1.00 0.00 ? 141 ASN A CA   7  
ATOM   9198  C  C    . ASN A 1 77 ? -13.985 3.794   0.588   1.00 0.00 ? 141 ASN A C    7  
ATOM   9199  O  O    . ASN A 1 77 ? -15.067 3.831   0.003   1.00 0.00 ? 141 ASN A O    7  
ATOM   9200  C  CB   . ASN A 1 77 ? -13.922 3.921   3.086   1.00 0.00 ? 141 ASN A CB   7  
ATOM   9201  C  CG   . ASN A 1 77 ? -13.387 3.281   4.353   1.00 0.00 ? 141 ASN A CG   7  
ATOM   9202  O  OD1  . ASN A 1 77 ? -12.203 2.954   4.444   1.00 0.00 ? 141 ASN A OD1  7  
ATOM   9203  N  ND2  . ASN A 1 77 ? -14.258 3.100   5.338   1.00 0.00 ? 141 ASN A ND2  7  
ATOM   9204  H  H    . ASN A 1 77 ? -12.068 2.172   2.735   1.00 0.00 ? 141 ASN A H    7  
ATOM   9205  H  HA   . ASN A 1 77 ? -14.608 2.255   1.931   1.00 0.00 ? 141 ASN A HA   7  
ATOM   9206  H  HB2  . ASN A 1 77 ? -13.353 4.819   2.891   1.00 0.00 ? 141 ASN A HB2  7  
ATOM   9207  H  HB3  . ASN A 1 77 ? -14.957 4.183   3.246   1.00 0.00 ? 141 ASN A HB3  7  
ATOM   9208  H  HD21 . ASN A 1 77 ? -15.185 3.386   5.194   1.00 0.00 ? 141 ASN A HD21 7  
ATOM   9209  H  HD22 . ASN A 1 77 ? -13.939 2.690   6.168   1.00 0.00 ? 141 ASN A HD22 7  
ATOM   9210  N  N    . ALA A 1 78 ? -12.905 4.434   0.154   1.00 0.00 ? 142 ALA A N    7  
ATOM   9211  C  CA   . ALA A 1 78 ? -12.929 5.233   -1.065  1.00 0.00 ? 142 ALA A CA   7  
ATOM   9212  C  C    . ALA A 1 78 ? -13.601 4.475   -2.205  1.00 0.00 ? 142 ALA A C    7  
ATOM   9213  O  O    . ALA A 1 78 ? -14.648 4.888   -2.705  1.00 0.00 ? 142 ALA A O    7  
ATOM   9214  C  CB   . ALA A 1 78 ? -11.517 5.639   -1.458  1.00 0.00 ? 142 ALA A CB   7  
ATOM   9215  H  H    . ALA A 1 78 ? -12.071 4.366   0.664   1.00 0.00 ? 142 ALA A H    7  
ATOM   9216  H  HA   . ALA A 1 78 ? -13.493 6.133   -0.863  1.00 0.00 ? 142 ALA A HA   7  
ATOM   9217  H  HB1  . ALA A 1 78 ? -11.302 6.621   -1.063  1.00 0.00 ? 142 ALA A HB1  7  
ATOM   9218  H  HB2  . ALA A 1 78 ? -10.813 4.926   -1.055  1.00 0.00 ? 142 ALA A HB2  7  
ATOM   9219  H  HB3  . ALA A 1 78 ? -11.434 5.658   -2.534  1.00 0.00 ? 142 ALA A HB3  7  
ATOM   9220  N  N    . ILE A 1 79 ? -12.991 3.367   -2.613  1.00 0.00 ? 143 ILE A N    7  
ATOM   9221  C  CA   . ILE A 1 79 ? -13.531 2.552   -3.694  1.00 0.00 ? 143 ILE A CA   7  
ATOM   9222  C  C    . ILE A 1 79 ? -15.052 2.484   -3.624  1.00 0.00 ? 143 ILE A C    7  
ATOM   9223  O  O    . ILE A 1 79 ? -15.617 1.995   -2.645  1.00 0.00 ? 143 ILE A O    7  
ATOM   9224  C  CB   . ILE A 1 79 ? -12.961 1.122   -3.659  1.00 0.00 ? 143 ILE A CB   7  
ATOM   9225  C  CG1  . ILE A 1 79 ? -11.439 1.152   -3.809  1.00 0.00 ? 143 ILE A CG1  7  
ATOM   9226  C  CG2  . ILE A 1 79 ? -13.590 0.275   -4.756  1.00 0.00 ? 143 ILE A CG2  7  
ATOM   9227  C  CD1  . ILE A 1 79 ? -10.702 1.184   -2.488  1.00 0.00 ? 143 ILE A CD1  7  
ATOM   9228  H  H    . ILE A 1 79 ? -12.159 3.091   -2.175  1.00 0.00 ? 143 ILE A H    7  
ATOM   9229  H  HA   . ILE A 1 79 ? -13.245 3.010   -4.630  1.00 0.00 ? 143 ILE A HA   7  
ATOM   9230  H  HB   . ILE A 1 79 ? -13.213 0.681   -2.707  1.00 0.00 ? 143 ILE A HB   7  
ATOM   9231  H  HG12 . ILE A 1 79 ? -11.118 0.273   -4.345  1.00 0.00 ? 143 ILE A HG12 7  
ATOM   9232  H  HG13 . ILE A 1 79 ? -11.157 2.033   -4.369  1.00 0.00 ? 143 ILE A HG13 7  
ATOM   9233  H  HG21 . ILE A 1 79 ? -13.075 0.453   -5.688  1.00 0.00 ? 143 ILE A HG21 7  
ATOM   9234  H  HG22 . ILE A 1 79 ? -13.508 -0.770  -4.494  1.00 0.00 ? 143 ILE A HG22 7  
ATOM   9235  H  HG23 . ILE A 1 79 ? -14.631 0.539   -4.863  1.00 0.00 ? 143 ILE A HG23 7  
ATOM   9236  H  HD11 . ILE A 1 79 ? -11.314 0.726   -1.724  1.00 0.00 ? 143 ILE A HD11 7  
ATOM   9237  H  HD12 . ILE A 1 79 ? -9.774  0.640   -2.580  1.00 0.00 ? 143 ILE A HD12 7  
ATOM   9238  H  HD13 . ILE A 1 79 ? -10.495 2.208   -2.216  1.00 0.00 ? 143 ILE A HD13 7  
ATOM   9239  N  N    . ARG A 1 80 ? -15.710 2.974   -4.669  1.00 0.00 ? 144 ARG A N    7  
ATOM   9240  C  CA   . ARG A 1 80 ? -17.167 2.968   -4.726  1.00 0.00 ? 144 ARG A CA   7  
ATOM   9241  C  C    . ARG A 1 80 ? -17.692 1.576   -5.065  1.00 0.00 ? 144 ARG A C    7  
ATOM   9242  O  O    . ARG A 1 80 ? -16.957 0.732   -5.579  1.00 0.00 ? 144 ARG A O    7  
ATOM   9243  C  CB   . ARG A 1 80 ? -17.663 3.978   -5.763  1.00 0.00 ? 144 ARG A CB   7  
ATOM   9244  C  CG   . ARG A 1 80 ? -17.624 5.418   -5.278  1.00 0.00 ? 144 ARG A CG   7  
ATOM   9245  C  CD   . ARG A 1 80 ? -18.697 6.261   -5.949  1.00 0.00 ? 144 ARG A CD   7  
ATOM   9246  N  NE   . ARG A 1 80 ? -20.042 5.776   -5.649  1.00 0.00 ? 144 ARG A NE   7  
ATOM   9247  C  CZ   . ARG A 1 80 ? -21.139 6.508   -5.806  1.00 0.00 ? 144 ARG A CZ   7  
ATOM   9248  N  NH1  . ARG A 1 80 ? -21.052 7.751   -6.258  1.00 0.00 ? 144 ARG A NH1  7  
ATOM   9249  N  NH2  . ARG A 1 80 ? -22.327 5.996   -5.511  1.00 0.00 ? 144 ARG A NH2  7  
ATOM   9250  H  H    . ARG A 1 80 ? -15.204 3.351   -5.419  1.00 0.00 ? 144 ARG A H    7  
ATOM   9251  H  HA   . ARG A 1 80 ? -17.539 3.253   -3.753  1.00 0.00 ? 144 ARG A HA   7  
ATOM   9252  H  HB2  . ARG A 1 80 ? -17.045 3.902   -6.646  1.00 0.00 ? 144 ARG A HB2  7  
ATOM   9253  H  HB3  . ARG A 1 80 ? -18.682 3.736   -6.025  1.00 0.00 ? 144 ARG A HB3  7  
ATOM   9254  H  HG2  . ARG A 1 80 ? -17.786 5.433   -4.210  1.00 0.00 ? 144 ARG A HG2  7  
ATOM   9255  H  HG3  . ARG A 1 80 ? -16.655 5.838   -5.503  1.00 0.00 ? 144 ARG A HG3  7  
ATOM   9256  H  HD2  . ARG A 1 80 ? -18.606 7.279   -5.601  1.00 0.00 ? 144 ARG A HD2  7  
ATOM   9257  H  HD3  . ARG A 1 80 ? -18.544 6.230   -7.017  1.00 0.00 ? 144 ARG A HD3  7  
ATOM   9258  H  HE   . ARG A 1 80 ? -20.129 4.860   -5.313  1.00 0.00 ? 144 ARG A HE   7  
ATOM   9259  H  HH11 . ARG A 1 80 ? -20.158 8.139   -6.482  1.00 0.00 ? 144 ARG A HH11 7  
ATOM   9260  H  HH12 . ARG A 1 80 ? -21.879 8.300   -6.376  1.00 0.00 ? 144 ARG A HH12 7  
ATOM   9261  H  HH21 . ARG A 1 80 ? -22.397 5.059   -5.170  1.00 0.00 ? 144 ARG A HH21 7  
ATOM   9262  H  HH22 . ARG A 1 80 ? -23.152 6.547   -5.629  1.00 0.00 ? 144 ARG A HH22 7  
ATOM   9263  N  N    . PHE A 1 81 ? -18.967 1.342   -4.772  1.00 0.00 ? 145 PHE A N    7  
ATOM   9264  C  CA   . PHE A 1 81 ? -19.590 0.052   -5.044  1.00 0.00 ? 145 PHE A CA   7  
ATOM   9265  C  C    . PHE A 1 81 ? -19.278 -0.414  -6.464  1.00 0.00 ? 145 PHE A C    7  
ATOM   9266  O  O    . PHE A 1 81 ? -18.687 -1.473  -6.665  1.00 0.00 ? 145 PHE A O    7  
ATOM   9267  C  CB   . PHE A 1 81 ? -21.104 0.141   -4.845  1.00 0.00 ? 145 PHE A CB   7  
ATOM   9268  C  CG   . PHE A 1 81 ? -21.504 0.931   -3.632  1.00 0.00 ? 145 PHE A CG   7  
ATOM   9269  C  CD1  . PHE A 1 81 ? -20.979 0.627   -2.387  1.00 0.00 ? 145 PHE A CD1  7  
ATOM   9270  C  CD2  . PHE A 1 81 ? -22.405 1.979   -3.737  1.00 0.00 ? 145 PHE A CD2  7  
ATOM   9271  C  CE1  . PHE A 1 81 ? -21.346 1.352   -1.269  1.00 0.00 ? 145 PHE A CE1  7  
ATOM   9272  C  CE2  . PHE A 1 81 ? -22.775 2.708   -2.623  1.00 0.00 ? 145 PHE A CE2  7  
ATOM   9273  C  CZ   . PHE A 1 81 ? -22.244 2.394   -1.387  1.00 0.00 ? 145 PHE A CZ   7  
ATOM   9274  H  H    . PHE A 1 81 ? -19.502 2.055   -4.363  1.00 0.00 ? 145 PHE A H    7  
ATOM   9275  H  HA   . PHE A 1 81 ? -19.185 -0.664  -4.346  1.00 0.00 ? 145 PHE A HA   7  
ATOM   9276  H  HB2  . PHE A 1 81 ? -21.547 0.614   -5.709  1.00 0.00 ? 145 PHE A HB2  7  
ATOM   9277  H  HB3  . PHE A 1 81 ? -21.505 -0.856  -4.741  1.00 0.00 ? 145 PHE A HB3  7  
ATOM   9278  H  HD1  . PHE A 1 81 ? -20.276 -0.188  -2.293  1.00 0.00 ? 145 PHE A HD1  7  
ATOM   9279  H  HD2  . PHE A 1 81 ? -22.821 2.226   -4.704  1.00 0.00 ? 145 PHE A HD2  7  
ATOM   9280  H  HE1  . PHE A 1 81 ? -20.929 1.105   -0.304  1.00 0.00 ? 145 PHE A HE1  7  
ATOM   9281  H  HE2  . PHE A 1 81 ? -23.477 3.523   -2.719  1.00 0.00 ? 145 PHE A HE2  7  
ATOM   9282  H  HZ   . PHE A 1 81 ? -22.533 2.962   -0.515  1.00 0.00 ? 145 PHE A HZ   7  
ATOM   9283  N  N    . GLY A 1 82 ? -19.683 0.387   -7.445  1.00 0.00 ? 146 GLY A N    7  
ATOM   9284  C  CA   . GLY A 1 82 ? -19.439 0.041   -8.833  1.00 0.00 ? 146 GLY A CA   7  
ATOM   9285  C  C    . GLY A 1 82 ? -20.403 0.728   -9.780  1.00 0.00 ? 146 GLY A C    7  
ATOM   9286  O  O    . GLY A 1 82 ? -21.619 0.590   -9.646  1.00 0.00 ? 146 GLY A O    7  
ATOM   9287  H  H    . GLY A 1 82 ? -20.150 1.220   -7.225  1.00 0.00 ? 146 GLY A H    7  
ATOM   9288  H  HA2  . GLY A 1 82 ? -18.431 0.327   -9.093  1.00 0.00 ? 146 GLY A HA2  7  
ATOM   9289  H  HA3  . GLY A 1 82 ? -19.540 -1.028  -8.948  1.00 0.00 ? 146 GLY A HA3  7  
ATOM   9290  N  N    . SER A 1 83 ? -19.860 1.471   -10.739 1.00 0.00 ? 147 SER A N    7  
ATOM   9291  C  CA   . SER A 1 83 ? -20.681 2.186   -11.709 1.00 0.00 ? 147 SER A CA   7  
ATOM   9292  C  C    . SER A 1 83 ? -20.609 1.519   -13.079 1.00 0.00 ? 147 SER A C    7  
ATOM   9293  O  O    . SER A 1 83 ? -19.618 1.652   -13.795 1.00 0.00 ? 147 SER A O    7  
ATOM   9294  C  CB   . SER A 1 83 ? -20.229 3.644   -11.814 1.00 0.00 ? 147 SER A CB   7  
ATOM   9295  O  OG   . SER A 1 83 ? -18.892 3.731   -12.276 1.00 0.00 ? 147 SER A OG   7  
ATOM   9296  H  H    . SER A 1 83 ? -18.884 1.541   -10.794 1.00 0.00 ? 147 SER A H    7  
ATOM   9297  H  HA   . SER A 1 83 ? -21.703 2.160   -11.362 1.00 0.00 ? 147 SER A HA   7  
ATOM   9298  H  HB2  . SER A 1 83 ? -20.871 4.168   -12.506 1.00 0.00 ? 147 SER A HB2  7  
ATOM   9299  H  HB3  . SER A 1 83 ? -20.292 4.109   -10.841 1.00 0.00 ? 147 SER A HB3  7  
ATOM   9300  H  HG   . SER A 1 83 ? -18.316 3.240   -11.685 1.00 0.00 ? 147 SER A HG   7  
ATOM   9301  N  N    . GLY A 1 84 ? -21.669 0.800   -13.437 1.00 0.00 ? 148 GLY A N    7  
ATOM   9302  C  CA   . GLY A 1 84 ? -21.707 0.122   -14.719 1.00 0.00 ? 148 GLY A CA   7  
ATOM   9303  C  C    . GLY A 1 84 ? -22.347 -1.249  -14.631 1.00 0.00 ? 148 GLY A C    7  
ATOM   9304  O  O    . GLY A 1 84 ? -23.507 -1.393  -14.245 1.00 0.00 ? 148 GLY A O    7  
ATOM   9305  H  H    . GLY A 1 84 ? -22.432 0.730   -12.824 1.00 0.00 ? 148 GLY A H    7  
ATOM   9306  H  HA2  . GLY A 1 84 ? -22.268 0.726   -15.417 1.00 0.00 ? 148 GLY A HA2  7  
ATOM   9307  H  HA3  . GLY A 1 84 ? -20.697 0.012   -15.085 1.00 0.00 ? 148 GLY A HA3  7  
ATOM   9308  N  N    . PRO A 1 85 ? -21.582 -2.288  -14.997 1.00 0.00 ? 149 PRO A N    7  
ATOM   9309  C  CA   . PRO A 1 85 ? -22.060 -3.673  -14.968 1.00 0.00 ? 149 PRO A CA   7  
ATOM   9310  C  C    . PRO A 1 85 ? -22.253 -4.190  -13.546 1.00 0.00 ? 149 PRO A C    7  
ATOM   9311  O  O    . PRO A 1 85 ? -21.309 -4.229  -12.757 1.00 0.00 ? 149 PRO A O    7  
ATOM   9312  C  CB   . PRO A 1 85 ? -20.945 -4.449  -15.672 1.00 0.00 ? 149 PRO A CB   7  
ATOM   9313  C  CG   . PRO A 1 85 ? -19.723 -3.620  -15.475 1.00 0.00 ? 149 PRO A CG   7  
ATOM   9314  C  CD   . PRO A 1 85 ? -20.190 -2.190  -15.468 1.00 0.00 ? 149 PRO A CD   7  
ATOM   9315  H  HA   . PRO A 1 85 ? -22.983 -3.786  -15.518 1.00 0.00 ? 149 PRO A HA   7  
ATOM   9316  H  HB2  . PRO A 1 85 ? -20.839 -5.424  -15.219 1.00 0.00 ? 149 PRO A HB2  7  
ATOM   9317  H  HB3  . PRO A 1 85 ? -21.183 -4.557  -16.720 1.00 0.00 ? 149 PRO A HB3  7  
ATOM   9318  H  HG2  . PRO A 1 85 ? -19.260 -3.868  -14.532 1.00 0.00 ? 149 PRO A HG2  7  
ATOM   9319  H  HG3  . PRO A 1 85 ? -19.033 -3.784  -16.288 1.00 0.00 ? 149 PRO A HG3  7  
ATOM   9320  H  HD2  . PRO A 1 85 ? -19.593 -1.602  -14.787 1.00 0.00 ? 149 PRO A HD2  7  
ATOM   9321  H  HD3  . PRO A 1 85 ? -20.148 -1.775  -16.464 1.00 0.00 ? 149 PRO A HD3  7  
ATOM   9322  N  N    . SER A 1 86 ? -23.481 -4.586  -13.226 1.00 0.00 ? 150 SER A N    7  
ATOM   9323  C  CA   . SER A 1 86 ? -23.797 -5.097  -11.898 1.00 0.00 ? 150 SER A CA   7  
ATOM   9324  C  C    . SER A 1 86 ? -24.117 -6.588  -11.952 1.00 0.00 ? 150 SER A C    7  
ATOM   9325  O  O    . SER A 1 86 ? -23.500 -7.392  -11.252 1.00 0.00 ? 150 SER A O    7  
ATOM   9326  C  CB   . SER A 1 86 ? -24.980 -4.332  -11.302 1.00 0.00 ? 150 SER A CB   7  
ATOM   9327  O  OG   . SER A 1 86 ? -24.559 -3.102  -10.737 1.00 0.00 ? 150 SER A OG   7  
ATOM   9328  H  H    . SER A 1 86 ? -24.191 -4.530  -13.899 1.00 0.00 ? 150 SER A H    7  
ATOM   9329  H  HA   . SER A 1 86 ? -22.931 -4.949  -11.271 1.00 0.00 ? 150 SER A HA   7  
ATOM   9330  H  HB2  . SER A 1 86 ? -25.702 -4.129  -12.078 1.00 0.00 ? 150 SER A HB2  7  
ATOM   9331  H  HB3  . SER A 1 86 ? -25.440 -4.931  -10.529 1.00 0.00 ? 150 SER A HB3  7  
ATOM   9332  H  HG   . SER A 1 86 ? -24.162 -3.264  -9.878  1.00 0.00 ? 150 SER A HG   7  
ATOM   9333  N  N    . SER A 1 87 ? -25.085 -6.950  -12.787 1.00 0.00 ? 151 SER A N    7  
ATOM   9334  C  CA   . SER A 1 87 ? -25.490 -8.343  -12.931 1.00 0.00 ? 151 SER A CA   7  
ATOM   9335  C  C    . SER A 1 87 ? -24.495 -9.112  -13.794 1.00 0.00 ? 151 SER A C    7  
ATOM   9336  O  O    . SER A 1 87 ? -24.357 -8.848  -14.988 1.00 0.00 ? 151 SER A O    7  
ATOM   9337  C  CB   . SER A 1 87 ? -26.888 -8.429  -13.546 1.00 0.00 ? 151 SER A CB   7  
ATOM   9338  O  OG   . SER A 1 87 ? -26.893 -7.931  -14.873 1.00 0.00 ? 151 SER A OG   7  
ATOM   9339  H  H    . SER A 1 87 ? -25.539 -6.262  -13.318 1.00 0.00 ? 151 SER A H    7  
ATOM   9340  H  HA   . SER A 1 87 ? -25.512 -8.785  -11.946 1.00 0.00 ? 151 SER A HA   7  
ATOM   9341  H  HB2  . SER A 1 87 ? -27.211 -9.459  -13.559 1.00 0.00 ? 151 SER A HB2  7  
ATOM   9342  H  HB3  . SER A 1 87 ? -27.576 -7.844  -12.952 1.00 0.00 ? 151 SER A HB3  7  
ATOM   9343  H  HG   . SER A 1 87 ? -26.015 -8.016  -15.250 1.00 0.00 ? 151 SER A HG   7  
ATOM   9344  N  N    . GLY A 1 88 ? -23.802 -10.067 -13.180 1.00 0.00 ? 152 GLY A N    7  
ATOM   9345  C  CA   . GLY A 1 88 ? -22.828 -10.860 -13.906 1.00 0.00 ? 152 GLY A CA   7  
ATOM   9346  C  C    . GLY A 1 88 ? -23.473 -11.784 -14.921 1.00 0.00 ? 152 GLY A C    7  
ATOM   9347  O  O    . GLY A 1 88 ? -24.673 -12.048 -14.855 1.00 0.00 ? 152 GLY A O    7  
ATOM   9348  H  H    . GLY A 1 88 ? -23.954 -10.233 -12.226 1.00 0.00 ? 152 GLY A H    7  
ATOM   9349  H  HA2  . GLY A 1 88 ? -22.149 -10.196 -14.419 1.00 0.00 ? 152 GLY A HA2  7  
ATOM   9350  H  HA3  . GLY A 1 88 ? -22.268 -11.456 -13.200 1.00 0.00 ? 152 GLY A HA3  7  
HETATM 9351  ZN ZN   . ZN  B 2 .  ? 2.879   2.341   -9.013  1.00 0.00 ? 200 ZN  A ZN   7  
HETATM 9352  ZN ZN   . ZN  C 2 .  ? 7.036   -10.873 -1.063  1.00 0.00 ? 300 ZN  A ZN   7  
ATOM   9353  N  N    . GLY A 1 1  ? 18.554  12.075  2.447   1.00 0.00 ? 65  GLY A N    8  
ATOM   9354  C  CA   . GLY A 1 1  ? 17.943  13.217  1.791   1.00 0.00 ? 65  GLY A CA   8  
ATOM   9355  C  C    . GLY A 1 1  ? 17.288  12.848  0.475   1.00 0.00 ? 65  GLY A C    8  
ATOM   9356  O  O    . GLY A 1 1  ? 16.143  12.397  0.448   1.00 0.00 ? 65  GLY A O    8  
ATOM   9357  H  H1   . GLY A 1 1  ? 18.162  11.718  3.271   1.00 0.00 ? 65  GLY A H1   8  
ATOM   9358  H  HA2  . GLY A 1 1  ? 17.196  13.638  2.448   1.00 0.00 ? 65  GLY A HA2  8  
ATOM   9359  H  HA3  . GLY A 1 1  ? 18.704  13.960  1.606   1.00 0.00 ? 65  GLY A HA3  8  
ATOM   9360  N  N    . SER A 1 2  ? 18.016  13.042  -0.621  1.00 0.00 ? 66  SER A N    8  
ATOM   9361  C  CA   . SER A 1 2  ? 17.497  12.732  -1.948  1.00 0.00 ? 66  SER A CA   8  
ATOM   9362  C  C    . SER A 1 2  ? 18.612  12.244  -2.867  1.00 0.00 ? 66  SER A C    8  
ATOM   9363  O  O    . SER A 1 2  ? 19.737  12.741  -2.814  1.00 0.00 ? 66  SER A O    8  
ATOM   9364  C  CB   . SER A 1 2  ? 16.822  13.964  -2.555  1.00 0.00 ? 66  SER A CB   8  
ATOM   9365  O  OG   . SER A 1 2  ? 15.808  14.463  -1.701  1.00 0.00 ? 66  SER A OG   8  
ATOM   9366  H  H    . SER A 1 2  ? 18.923  13.404  -0.534  1.00 0.00 ? 66  SER A H    8  
ATOM   9367  H  HA   . SER A 1 2  ? 16.764  11.946  -1.842  1.00 0.00 ? 66  SER A HA   8  
ATOM   9368  H  HB2  . SER A 1 2  ? 17.560  14.736  -2.707  1.00 0.00 ? 66  SER A HB2  8  
ATOM   9369  H  HB3  . SER A 1 2  ? 16.379  13.697  -3.504  1.00 0.00 ? 66  SER A HB3  8  
ATOM   9370  H  HG   . SER A 1 2  ? 16.096  15.291  -1.312  1.00 0.00 ? 66  SER A HG   8  
ATOM   9371  N  N    . SER A 1 3  ? 18.291  11.267  -3.709  1.00 0.00 ? 67  SER A N    8  
ATOM   9372  C  CA   . SER A 1 3  ? 19.266  10.707  -4.638  1.00 0.00 ? 67  SER A CA   8  
ATOM   9373  C  C    . SER A 1 3  ? 19.127  11.341  -6.019  1.00 0.00 ? 67  SER A C    8  
ATOM   9374  O  O    . SER A 1 3  ? 20.112  11.768  -6.620  1.00 0.00 ? 67  SER A O    8  
ATOM   9375  C  CB   . SER A 1 3  ? 19.092  9.191   -4.741  1.00 0.00 ? 67  SER A CB   8  
ATOM   9376  O  OG   . SER A 1 3  ? 20.324  8.555   -5.035  1.00 0.00 ? 67  SER A OG   8  
ATOM   9377  H  H    . SER A 1 3  ? 17.378  10.912  -3.703  1.00 0.00 ? 67  SER A H    8  
ATOM   9378  H  HA   . SER A 1 3  ? 20.252  10.923  -4.253  1.00 0.00 ? 67  SER A HA   8  
ATOM   9379  H  HB2  . SER A 1 3  ? 18.719  8.809   -3.803  1.00 0.00 ? 67  SER A HB2  8  
ATOM   9380  H  HB3  . SER A 1 3  ? 18.387  8.965   -5.527  1.00 0.00 ? 67  SER A HB3  8  
ATOM   9381  H  HG   . SER A 1 3  ? 20.170  7.625   -5.216  1.00 0.00 ? 67  SER A HG   8  
ATOM   9382  N  N    . GLY A 1 4  ? 17.895  11.398  -6.515  1.00 0.00 ? 68  GLY A N    8  
ATOM   9383  C  CA   . GLY A 1 4  ? 17.648  11.981  -7.821  1.00 0.00 ? 68  GLY A CA   8  
ATOM   9384  C  C    . GLY A 1 4  ? 16.520  12.994  -7.800  1.00 0.00 ? 68  GLY A C    8  
ATOM   9385  O  O    . GLY A 1 4  ? 16.101  13.444  -6.734  1.00 0.00 ? 68  GLY A O    8  
ATOM   9386  H  H    . GLY A 1 4  ? 17.148  11.042  -5.990  1.00 0.00 ? 68  GLY A H    8  
ATOM   9387  H  HA2  . GLY A 1 4  ? 18.549  12.468  -8.162  1.00 0.00 ? 68  GLY A HA2  8  
ATOM   9388  H  HA3  . GLY A 1 4  ? 17.393  11.191  -8.513  1.00 0.00 ? 68  GLY A HA3  8  
ATOM   9389  N  N    . SER A 1 5  ? 16.029  13.355  -8.981  1.00 0.00 ? 69  SER A N    8  
ATOM   9390  C  CA   . SER A 1 5  ? 14.947  14.326  -9.094  1.00 0.00 ? 69  SER A CA   8  
ATOM   9391  C  C    . SER A 1 5  ? 13.939  14.151  -7.963  1.00 0.00 ? 69  SER A C    8  
ATOM   9392  O  O    . SER A 1 5  ? 13.448  13.049  -7.719  1.00 0.00 ? 69  SER A O    8  
ATOM   9393  C  CB   . SER A 1 5  ? 14.244  14.183  -10.446 1.00 0.00 ? 69  SER A CB   8  
ATOM   9394  O  OG   . SER A 1 5  ? 15.007  14.774  -11.483 1.00 0.00 ? 69  SER A OG   8  
ATOM   9395  H  H    . SER A 1 5  ? 16.405  12.961  -9.796  1.00 0.00 ? 69  SER A H    8  
ATOM   9396  H  HA   . SER A 1 5  ? 15.379  15.314  -9.026  1.00 0.00 ? 69  SER A HA   8  
ATOM   9397  H  HB2  . SER A 1 5  ? 14.107  13.135  -10.668 1.00 0.00 ? 69  SER A HB2  8  
ATOM   9398  H  HB3  . SER A 1 5  ? 13.281  14.670  -10.400 1.00 0.00 ? 69  SER A HB3  8  
ATOM   9399  H  HG   . SER A 1 5  ? 15.416  15.580  -11.160 1.00 0.00 ? 69  SER A HG   8  
ATOM   9400  N  N    . SER A 1 6  ? 13.636  15.246  -7.273  1.00 0.00 ? 70  SER A N    8  
ATOM   9401  C  CA   . SER A 1 6  ? 12.690  15.214  -6.164  1.00 0.00 ? 70  SER A CA   8  
ATOM   9402  C  C    . SER A 1 6  ? 11.402  15.947  -6.528  1.00 0.00 ? 70  SER A C    8  
ATOM   9403  O  O    . SER A 1 6  ? 11.338  17.175  -6.480  1.00 0.00 ? 70  SER A O    8  
ATOM   9404  C  CB   . SER A 1 6  ? 13.313  15.843  -4.917  1.00 0.00 ? 70  SER A CB   8  
ATOM   9405  O  OG   . SER A 1 6  ? 14.383  15.054  -4.428  1.00 0.00 ? 70  SER A OG   8  
ATOM   9406  H  H    . SER A 1 6  ? 14.061  16.096  -7.516  1.00 0.00 ? 70  SER A H    8  
ATOM   9407  H  HA   . SER A 1 6  ? 12.456  14.181  -5.958  1.00 0.00 ? 70  SER A HA   8  
ATOM   9408  H  HB2  . SER A 1 6  ? 13.688  16.826  -5.161  1.00 0.00 ? 70  SER A HB2  8  
ATOM   9409  H  HB3  . SER A 1 6  ? 12.561  15.926  -4.145  1.00 0.00 ? 70  SER A HB3  8  
ATOM   9410  H  HG   . SER A 1 6  ? 14.229  14.841  -3.505  1.00 0.00 ? 70  SER A HG   8  
ATOM   9411  N  N    . GLY A 1 7  ? 10.376  15.183  -6.892  1.00 0.00 ? 71  GLY A N    8  
ATOM   9412  C  CA   . GLY A 1 7  ? 9.103   15.776  -7.259  1.00 0.00 ? 71  GLY A CA   8  
ATOM   9413  C  C    . GLY A 1 7  ? 7.927   14.884  -6.912  1.00 0.00 ? 71  GLY A C    8  
ATOM   9414  O  O    . GLY A 1 7  ? 7.576   14.737  -5.742  1.00 0.00 ? 71  GLY A O    8  
ATOM   9415  H  H    . GLY A 1 7  ? 10.485  14.209  -6.912  1.00 0.00 ? 71  GLY A H    8  
ATOM   9416  H  HA2  . GLY A 1 7  ? 8.994   16.717  -6.741  1.00 0.00 ? 71  GLY A HA2  8  
ATOM   9417  H  HA3  . GLY A 1 7  ? 9.098   15.960  -8.324  1.00 0.00 ? 71  GLY A HA3  8  
ATOM   9418  N  N    . MET A 1 8  ? 7.317   14.289  -7.932  1.00 0.00 ? 72  MET A N    8  
ATOM   9419  C  CA   . MET A 1 8  ? 6.173   13.408  -7.728  1.00 0.00 ? 72  MET A CA   8  
ATOM   9420  C  C    . MET A 1 8  ? 6.403   12.056  -8.395  1.00 0.00 ? 72  MET A C    8  
ATOM   9421  O  O    . MET A 1 8  ? 6.721   11.985  -9.581  1.00 0.00 ? 72  MET A O    8  
ATOM   9422  C  CB   . MET A 1 8  ? 4.900   14.053  -8.281  1.00 0.00 ? 72  MET A CB   8  
ATOM   9423  C  CG   . MET A 1 8  ? 4.290   15.089  -7.351  1.00 0.00 ? 72  MET A CG   8  
ATOM   9424  S  SD   . MET A 1 8  ? 5.353   16.526  -7.119  1.00 0.00 ? 72  MET A SD   8  
ATOM   9425  C  CE   . MET A 1 8  ? 5.406   17.180  -8.785  1.00 0.00 ? 72  MET A CE   8  
ATOM   9426  H  H    . MET A 1 8  ? 7.643   14.446  -8.843  1.00 0.00 ? 72  MET A H    8  
ATOM   9427  H  HA   . MET A 1 8  ? 6.056   13.257  -6.665  1.00 0.00 ? 72  MET A HA   8  
ATOM   9428  H  HB2  . MET A 1 8  ? 5.134   14.535  -9.218  1.00 0.00 ? 72  MET A HB2  8  
ATOM   9429  H  HB3  . MET A 1 8  ? 4.166   13.281  -8.456  1.00 0.00 ? 72  MET A HB3  8  
ATOM   9430  H  HG2  . MET A 1 8  ? 3.350   15.418  -7.768  1.00 0.00 ? 72  MET A HG2  8  
ATOM   9431  H  HG3  . MET A 1 8  ? 4.114   14.629  -6.390  1.00 0.00 ? 72  MET A HG3  8  
ATOM   9432  H  HE1  . MET A 1 8  ? 5.641   18.235  -8.751  1.00 0.00 ? 72  MET A HE1  8  
ATOM   9433  H  HE2  . MET A 1 8  ? 6.165   16.661  -9.352  1.00 0.00 ? 72  MET A HE2  8  
ATOM   9434  H  HE3  . MET A 1 8  ? 4.445   17.040  -9.258  1.00 0.00 ? 72  MET A HE3  8  
ATOM   9435  N  N    . GLU A 1 9  ? 6.240   10.985  -7.624  1.00 0.00 ? 73  GLU A N    8  
ATOM   9436  C  CA   . GLU A 1 9  ? 6.431   9.635   -8.141  1.00 0.00 ? 73  GLU A CA   8  
ATOM   9437  C  C    . GLU A 1 9  ? 5.703   8.612   -7.274  1.00 0.00 ? 73  GLU A C    8  
ATOM   9438  O  O    . GLU A 1 9  ? 5.650   8.743   -6.051  1.00 0.00 ? 73  GLU A O    8  
ATOM   9439  C  CB   . GLU A 1 9  ? 7.922   9.297   -8.206  1.00 0.00 ? 73  GLU A CB   8  
ATOM   9440  C  CG   . GLU A 1 9  ? 8.561   9.099   -6.841  1.00 0.00 ? 73  GLU A CG   8  
ATOM   9441  C  CD   . GLU A 1 9  ? 9.022   10.402  -6.219  1.00 0.00 ? 73  GLU A CD   8  
ATOM   9442  O  OE1  . GLU A 1 9  ? 8.571   11.472  -6.679  1.00 0.00 ? 73  GLU A OE1  8  
ATOM   9443  O  OE2  . GLU A 1 9  ? 9.835   10.353  -5.272  1.00 0.00 ? 73  GLU A OE2  8  
ATOM   9444  H  H    . GLU A 1 9  ? 5.985   11.106  -6.685  1.00 0.00 ? 73  GLU A H    8  
ATOM   9445  H  HA   . GLU A 1 9  ? 6.020   9.601   -9.139  1.00 0.00 ? 73  GLU A HA   8  
ATOM   9446  H  HB2  . GLU A 1 9  ? 8.048   8.388   -8.775  1.00 0.00 ? 73  GLU A HB2  8  
ATOM   9447  H  HB3  . GLU A 1 9  ? 8.439   10.100  -8.709  1.00 0.00 ? 73  GLU A HB3  8  
ATOM   9448  H  HG2  . GLU A 1 9  ? 7.839   8.640   -6.183  1.00 0.00 ? 73  GLU A HG2  8  
ATOM   9449  H  HG3  . GLU A 1 9  ? 9.414   8.446   -6.949  1.00 0.00 ? 73  GLU A HG3  8  
ATOM   9450  N  N    . CYS A 1 10 ? 5.143   7.593   -7.917  1.00 0.00 ? 74  CYS A N    8  
ATOM   9451  C  CA   . CYS A 1 10 ? 4.416   6.547   -7.208  1.00 0.00 ? 74  CYS A CA   8  
ATOM   9452  C  C    . CYS A 1 10 ? 5.210   6.057   -6.000  1.00 0.00 ? 74  CYS A C    8  
ATOM   9453  O  O    . CYS A 1 10 ? 6.420   5.848   -6.083  1.00 0.00 ? 74  CYS A O    8  
ATOM   9454  C  CB   . CYS A 1 10 ? 4.121   5.376   -8.146  1.00 0.00 ? 74  CYS A CB   8  
ATOM   9455  S  SG   . CYS A 1 10 ? 3.073   4.080   -7.411  1.00 0.00 ? 74  CYS A SG   8  
ATOM   9456  H  H    . CYS A 1 10 ? 5.219   7.543   -8.894  1.00 0.00 ? 74  CYS A H    8  
ATOM   9457  H  HA   . CYS A 1 10 ? 3.483   6.966   -6.864  1.00 0.00 ? 74  CYS A HA   8  
ATOM   9458  H  HB2  . CYS A 1 10 ? 3.614   5.747   -9.025  1.00 0.00 ? 74  CYS A HB2  8  
ATOM   9459  H  HB3  . CYS A 1 10 ? 5.053   4.917   -8.442  1.00 0.00 ? 74  CYS A HB3  8  
ATOM   9460  N  N    . ARG A 1 11 ? 4.519   5.877   -4.879  1.00 0.00 ? 75  ARG A N    8  
ATOM   9461  C  CA   . ARG A 1 11 ? 5.159   5.413   -3.653  1.00 0.00 ? 75  ARG A CA   8  
ATOM   9462  C  C    . ARG A 1 11 ? 5.082   3.894   -3.542  1.00 0.00 ? 75  ARG A C    8  
ATOM   9463  O  O    . ARG A 1 11 ? 5.812   3.280   -2.763  1.00 0.00 ? 75  ARG A O    8  
ATOM   9464  C  CB   . ARG A 1 11 ? 4.500   6.059   -2.433  1.00 0.00 ? 75  ARG A CB   8  
ATOM   9465  C  CG   . ARG A 1 11 ? 4.531   7.579   -2.457  1.00 0.00 ? 75  ARG A CG   8  
ATOM   9466  C  CD   . ARG A 1 11 ? 5.902   8.114   -2.073  1.00 0.00 ? 75  ARG A CD   8  
ATOM   9467  N  NE   . ARG A 1 11 ? 6.014   9.551   -2.310  1.00 0.00 ? 75  ARG A NE   8  
ATOM   9468  C  CZ   . ARG A 1 11 ? 7.174   10.187  -2.431  1.00 0.00 ? 75  ARG A CZ   8  
ATOM   9469  N  NH1  . ARG A 1 11 ? 8.314   9.517   -2.340  1.00 0.00 ? 75  ARG A NH1  8  
ATOM   9470  N  NH2  . ARG A 1 11 ? 7.194   11.497  -2.645  1.00 0.00 ? 75  ARG A NH2  8  
ATOM   9471  H  H    . ARG A 1 11 ? 3.556   6.061   -4.875  1.00 0.00 ? 75  ARG A H    8  
ATOM   9472  H  HA   . ARG A 1 11 ? 6.197   5.708   -3.689  1.00 0.00 ? 75  ARG A HA   8  
ATOM   9473  H  HB2  . ARG A 1 11 ? 3.468   5.743   -2.385  1.00 0.00 ? 75  ARG A HB2  8  
ATOM   9474  H  HB3  . ARG A 1 11 ? 5.012   5.724   -1.544  1.00 0.00 ? 75  ARG A HB3  8  
ATOM   9475  H  HG2  . ARG A 1 11 ? 4.290   7.919   -3.453  1.00 0.00 ? 75  ARG A HG2  8  
ATOM   9476  H  HG3  . ARG A 1 11 ? 3.799   7.955   -1.759  1.00 0.00 ? 75  ARG A HG3  8  
ATOM   9477  H  HD2  . ARG A 1 11 ? 6.070   7.917   -1.025  1.00 0.00 ? 75  ARG A HD2  8  
ATOM   9478  H  HD3  . ARG A 1 11 ? 6.650   7.602   -2.660  1.00 0.00 ? 75  ARG A HD3  8  
ATOM   9479  H  HE   . ARG A 1 11 ? 5.184   10.065  -2.381  1.00 0.00 ? 75  ARG A HE   8  
ATOM   9480  H  HH11 . ARG A 1 11 ? 8.302   8.530   -2.179  1.00 0.00 ? 75  ARG A HH11 8  
ATOM   9481  H  HH12 . ARG A 1 11 ? 9.186   9.999   -2.433  1.00 0.00 ? 75  ARG A HH12 8  
ATOM   9482  H  HH21 . ARG A 1 11 ? 6.336   12.005  -2.715  1.00 0.00 ? 75  ARG A HH21 8  
ATOM   9483  H  HH22 . ARG A 1 11 ? 8.067   11.974  -2.736  1.00 0.00 ? 75  ARG A HH22 8  
ATOM   9484  N  N    . VAL A 1 12 ? 4.192   3.292   -4.325  1.00 0.00 ? 76  VAL A N    8  
ATOM   9485  C  CA   . VAL A 1 12 ? 4.019   1.844   -4.314  1.00 0.00 ? 76  VAL A CA   8  
ATOM   9486  C  C    . VAL A 1 12 ? 5.109   1.155   -5.127  1.00 0.00 ? 76  VAL A C    8  
ATOM   9487  O  O    . VAL A 1 12 ? 5.832   0.298   -4.617  1.00 0.00 ? 76  VAL A O    8  
ATOM   9488  C  CB   . VAL A 1 12 ? 2.643   1.439   -4.875  1.00 0.00 ? 76  VAL A CB   8  
ATOM   9489  C  CG1  . VAL A 1 12 ? 2.446   -0.066  -4.771  1.00 0.00 ? 76  VAL A CG1  8  
ATOM   9490  C  CG2  . VAL A 1 12 ? 1.532   2.182   -4.147  1.00 0.00 ? 76  VAL A CG2  8  
ATOM   9491  H  H    . VAL A 1 12 ? 3.638   3.835   -4.924  1.00 0.00 ? 76  VAL A H    8  
ATOM   9492  H  HA   . VAL A 1 12 ? 4.080   1.508   -3.289  1.00 0.00 ? 76  VAL A HA   8  
ATOM   9493  H  HB   . VAL A 1 12 ? 2.607   1.714   -5.919  1.00 0.00 ? 76  VAL A HB   8  
ATOM   9494  H  HG11 . VAL A 1 12 ? 2.448   -0.358  -3.731  1.00 0.00 ? 76  VAL A HG11 8  
ATOM   9495  H  HG12 . VAL A 1 12 ? 1.502   -0.337  -5.222  1.00 0.00 ? 76  VAL A HG12 8  
ATOM   9496  H  HG13 . VAL A 1 12 ? 3.250   -0.570  -5.287  1.00 0.00 ? 76  VAL A HG13 8  
ATOM   9497  H  HG21 . VAL A 1 12 ? 1.964   2.885   -3.452  1.00 0.00 ? 76  VAL A HG21 8  
ATOM   9498  H  HG22 . VAL A 1 12 ? 0.924   2.711   -4.865  1.00 0.00 ? 76  VAL A HG22 8  
ATOM   9499  H  HG23 . VAL A 1 12 ? 0.918   1.474   -3.608  1.00 0.00 ? 76  VAL A HG23 8  
ATOM   9500  N  N    . CYS A 1 13 ? 5.224   1.535   -6.395  1.00 0.00 ? 77  CYS A N    8  
ATOM   9501  C  CA   . CYS A 1 13 ? 6.226   0.954   -7.280  1.00 0.00 ? 77  CYS A CA   8  
ATOM   9502  C  C    . CYS A 1 13 ? 7.363   1.940   -7.535  1.00 0.00 ? 77  CYS A C    8  
ATOM   9503  O  O    . CYS A 1 13 ? 8.537   1.574   -7.489  1.00 0.00 ? 77  CYS A O    8  
ATOM   9504  C  CB   . CYS A 1 13 ? 5.587   0.542   -8.608  1.00 0.00 ? 77  CYS A CB   8  
ATOM   9505  S  SG   . CYS A 1 13 ? 5.158   1.941   -9.693  1.00 0.00 ? 77  CYS A SG   8  
ATOM   9506  H  H    . CYS A 1 13 ? 4.618   2.223   -6.745  1.00 0.00 ? 77  CYS A H    8  
ATOM   9507  H  HA   . CYS A 1 13 ? 6.628   0.077   -6.797  1.00 0.00 ? 77  CYS A HA   8  
ATOM   9508  H  HB2  . CYS A 1 13 ? 6.275   -0.092  -9.148  1.00 0.00 ? 77  CYS A HB2  8  
ATOM   9509  H  HB3  . CYS A 1 13 ? 4.680   -0.008  -8.407  1.00 0.00 ? 77  CYS A HB3  8  
ATOM   9510  N  N    . GLY A 1 14 ? 7.005   3.192   -7.803  1.00 0.00 ? 78  GLY A N    8  
ATOM   9511  C  CA   . GLY A 1 14 ? 8.006   4.211   -8.060  1.00 0.00 ? 78  GLY A CA   8  
ATOM   9512  C  C    . GLY A 1 14 ? 7.690   5.036   -9.292  1.00 0.00 ? 78  GLY A C    8  
ATOM   9513  O  O    . GLY A 1 14 ? 7.805   6.261   -9.273  1.00 0.00 ? 78  GLY A O    8  
ATOM   9514  H  H    . GLY A 1 14 ? 6.054   3.426   -7.826  1.00 0.00 ? 78  GLY A H    8  
ATOM   9515  H  HA2  . GLY A 1 14 ? 8.064   4.867   -7.205  1.00 0.00 ? 78  GLY A HA2  8  
ATOM   9516  H  HA3  . GLY A 1 14 ? 8.964   3.731   -8.199  1.00 0.00 ? 78  GLY A HA3  8  
ATOM   9517  N  N    . ASP A 1 15 ? 7.293   4.363   -10.367 1.00 0.00 ? 79  ASP A N    8  
ATOM   9518  C  CA   . ASP A 1 15 ? 6.960   5.042   -11.614 1.00 0.00 ? 79  ASP A CA   8  
ATOM   9519  C  C    . ASP A 1 15 ? 6.159   6.312   -11.344 1.00 0.00 ? 79  ASP A C    8  
ATOM   9520  O  O    . ASP A 1 15 ? 5.412   6.393   -10.368 1.00 0.00 ? 79  ASP A O    8  
ATOM   9521  C  CB   . ASP A 1 15 ? 6.167   4.109   -12.531 1.00 0.00 ? 79  ASP A CB   8  
ATOM   9522  C  CG   . ASP A 1 15 ? 5.895   4.727   -13.889 1.00 0.00 ? 79  ASP A CG   8  
ATOM   9523  O  OD1  . ASP A 1 15 ? 6.848   5.247   -14.505 1.00 0.00 ? 79  ASP A OD1  8  
ATOM   9524  O  OD2  . ASP A 1 15 ? 4.729   4.690   -14.335 1.00 0.00 ? 79  ASP A OD2  8  
ATOM   9525  H  H    . ASP A 1 15 ? 7.221   3.387   -10.320 1.00 0.00 ? 79  ASP A H    8  
ATOM   9526  H  HA   . ASP A 1 15 ? 7.884   5.311   -12.102 1.00 0.00 ? 79  ASP A HA   8  
ATOM   9527  H  HB2  . ASP A 1 15 ? 6.727   3.197   -12.677 1.00 0.00 ? 79  ASP A HB2  8  
ATOM   9528  H  HB3  . ASP A 1 15 ? 5.221   3.876   -12.065 1.00 0.00 ? 79  ASP A HB3  8  
ATOM   9529  N  N    . LYS A 1 16 ? 6.320   7.303   -12.214 1.00 0.00 ? 80  LYS A N    8  
ATOM   9530  C  CA   . LYS A 1 16 ? 5.613   8.570   -12.072 1.00 0.00 ? 80  LYS A CA   8  
ATOM   9531  C  C    . LYS A 1 16 ? 4.221   8.353   -11.486 1.00 0.00 ? 80  LYS A C    8  
ATOM   9532  O  O    . LYS A 1 16 ? 3.497   7.449   -11.901 1.00 0.00 ? 80  LYS A O    8  
ATOM   9533  C  CB   . LYS A 1 16 ? 5.504   9.272   -13.427 1.00 0.00 ? 80  LYS A CB   8  
ATOM   9534  C  CG   . LYS A 1 16 ? 5.457   10.787  -13.324 1.00 0.00 ? 80  LYS A CG   8  
ATOM   9535  C  CD   . LYS A 1 16 ? 4.839   11.411  -14.565 1.00 0.00 ? 80  LYS A CD   8  
ATOM   9536  C  CE   . LYS A 1 16 ? 3.320   11.402  -14.495 1.00 0.00 ? 80  LYS A CE   8  
ATOM   9537  N  NZ   . LYS A 1 16 ? 2.811   12.226  -13.364 1.00 0.00 ? 80  LYS A NZ   8  
ATOM   9538  H  H    . LYS A 1 16 ? 6.930   7.179   -12.972 1.00 0.00 ? 80  LYS A H    8  
ATOM   9539  H  HA   . LYS A 1 16 ? 6.181   9.193   -11.397 1.00 0.00 ? 80  LYS A HA   8  
ATOM   9540  H  HB2  . LYS A 1 16 ? 6.358   8.999   -14.030 1.00 0.00 ? 80  LYS A HB2  8  
ATOM   9541  H  HB3  . LYS A 1 16 ? 4.603   8.938   -13.921 1.00 0.00 ? 80  LYS A HB3  8  
ATOM   9542  H  HG2  . LYS A 1 16 ? 4.867   11.063  -12.464 1.00 0.00 ? 80  LYS A HG2  8  
ATOM   9543  H  HG3  . LYS A 1 16 ? 6.464   11.162  -13.208 1.00 0.00 ? 80  LYS A HG3  8  
ATOM   9544  H  HD2  . LYS A 1 16 ? 5.178   12.433  -14.650 1.00 0.00 ? 80  LYS A HD2  8  
ATOM   9545  H  HD3  . LYS A 1 16 ? 5.155   10.851  -15.434 1.00 0.00 ? 80  LYS A HD3  8  
ATOM   9546  H  HE2  . LYS A 1 16 ? 2.928   11.794  -15.421 1.00 0.00 ? 80  LYS A HE2  8  
ATOM   9547  H  HE3  . LYS A 1 16 ? 2.985   10.383  -14.366 1.00 0.00 ? 80  LYS A HE3  8  
ATOM   9548  H  HZ1  . LYS A 1 16 ? 2.098   11.695  -12.826 1.00 0.00 ? 80  LYS A HZ1  8  
ATOM   9549  H  HZ2  . LYS A 1 16 ? 2.377   13.099  -13.726 1.00 0.00 ? 80  LYS A HZ2  8  
ATOM   9550  H  HZ3  . LYS A 1 16 ? 3.593   12.480  -12.727 1.00 0.00 ? 80  LYS A HZ3  8  
ATOM   9551  N  N    . ALA A 1 17 ? 3.853   9.189   -10.522 1.00 0.00 ? 81  ALA A N    8  
ATOM   9552  C  CA   . ALA A 1 17 ? 2.546   9.091   -9.882  1.00 0.00 ? 81  ALA A CA   8  
ATOM   9553  C  C    . ALA A 1 17 ? 1.500   9.898   -10.644 1.00 0.00 ? 81  ALA A C    8  
ATOM   9554  O  O    . ALA A 1 17 ? 1.467   11.125  -10.560 1.00 0.00 ? 81  ALA A O    8  
ATOM   9555  C  CB   . ALA A 1 17 ? 2.629   9.561   -8.438  1.00 0.00 ? 81  ALA A CB   8  
ATOM   9556  H  H    . ALA A 1 17 ? 4.474   9.890   -10.234 1.00 0.00 ? 81  ALA A H    8  
ATOM   9557  H  HA   . ALA A 1 17 ? 2.253   8.051   -9.881  1.00 0.00 ? 81  ALA A HA   8  
ATOM   9558  H  HB1  . ALA A 1 17 ? 2.318   8.762   -7.781  1.00 0.00 ? 81  ALA A HB1  8  
ATOM   9559  H  HB2  . ALA A 1 17 ? 3.647   9.840   -8.209  1.00 0.00 ? 81  ALA A HB2  8  
ATOM   9560  H  HB3  . ALA A 1 17 ? 1.981   10.414  -8.299  1.00 0.00 ? 81  ALA A HB3  8  
ATOM   9561  N  N    . SER A 1 18 ? 0.648   9.200   -11.389 1.00 0.00 ? 82  SER A N    8  
ATOM   9562  C  CA   . SER A 1 18 ? -0.396  9.852   -12.169 1.00 0.00 ? 82  SER A CA   8  
ATOM   9563  C  C    . SER A 1 18 ? -1.067  10.959  -11.362 1.00 0.00 ? 82  SER A C    8  
ATOM   9564  O  O    . SER A 1 18 ? -1.244  12.076  -11.845 1.00 0.00 ? 82  SER A O    8  
ATOM   9565  C  CB   . SER A 1 18 ? -1.441  8.829   -12.619 1.00 0.00 ? 82  SER A CB   8  
ATOM   9566  O  OG   . SER A 1 18 ? -2.602  9.470   -13.117 1.00 0.00 ? 82  SER A OG   8  
ATOM   9567  H  H    . SER A 1 18 ? 0.726   8.223   -11.415 1.00 0.00 ? 82  SER A H    8  
ATOM   9568  H  HA   . SER A 1 18 ? 0.066   10.289  -13.042 1.00 0.00 ? 82  SER A HA   8  
ATOM   9569  H  HB2  . SER A 1 18 ? -1.023  8.210   -13.399 1.00 0.00 ? 82  SER A HB2  8  
ATOM   9570  H  HB3  . SER A 1 18 ? -1.719  8.209   -11.778 1.00 0.00 ? 82  SER A HB3  8  
ATOM   9571  H  HG   . SER A 1 18 ? -2.358  10.063  -13.832 1.00 0.00 ? 82  SER A HG   8  
ATOM   9572  N  N    . GLY A 1 19 ? -1.439  10.639  -10.126 1.00 0.00 ? 83  GLY A N    8  
ATOM   9573  C  CA   . GLY A 1 19 ? -2.087  11.615  -9.270  1.00 0.00 ? 83  GLY A CA   8  
ATOM   9574  C  C    . GLY A 1 19 ? -2.125  11.180  -7.818  1.00 0.00 ? 83  GLY A C    8  
ATOM   9575  O  O    . GLY A 1 19 ? -1.366  10.302  -7.406  1.00 0.00 ? 83  GLY A O    8  
ATOM   9576  H  H    . GLY A 1 19 ? -1.273  9.732   -9.793  1.00 0.00 ? 83  GLY A H    8  
ATOM   9577  H  HA2  . GLY A 1 19 ? -1.552  12.551  -9.340  1.00 0.00 ? 83  GLY A HA2  8  
ATOM   9578  H  HA3  . GLY A 1 19 ? -3.099  11.765  -9.615  1.00 0.00 ? 83  GLY A HA3  8  
ATOM   9579  N  N    . PHE A 1 20 ? -3.009  11.795  -7.040  1.00 0.00 ? 84  PHE A N    8  
ATOM   9580  C  CA   . PHE A 1 20 ? -3.140  11.468  -5.625  1.00 0.00 ? 84  PHE A CA   8  
ATOM   9581  C  C    . PHE A 1 20 ? -4.408  10.657  -5.371  1.00 0.00 ? 84  PHE A C    8  
ATOM   9582  O  O    . PHE A 1 20 ? -5.490  11.215  -5.191  1.00 0.00 ? 84  PHE A O    8  
ATOM   9583  C  CB   . PHE A 1 20 ? -3.162  12.746  -4.784  1.00 0.00 ? 84  PHE A CB   8  
ATOM   9584  C  CG   . PHE A 1 20 ? -2.732  12.533  -3.361  1.00 0.00 ? 84  PHE A CG   8  
ATOM   9585  C  CD1  . PHE A 1 20 ? -1.558  11.857  -3.071  1.00 0.00 ? 84  PHE A CD1  8  
ATOM   9586  C  CD2  . PHE A 1 20 ? -3.502  13.011  -2.312  1.00 0.00 ? 84  PHE A CD2  8  
ATOM   9587  C  CE1  . PHE A 1 20 ? -1.161  11.660  -1.762  1.00 0.00 ? 84  PHE A CE1  8  
ATOM   9588  C  CE2  . PHE A 1 20 ? -3.109  12.817  -1.001  1.00 0.00 ? 84  PHE A CE2  8  
ATOM   9589  C  CZ   . PHE A 1 20 ? -1.937  12.141  -0.726  1.00 0.00 ? 84  PHE A CZ   8  
ATOM   9590  H  H    . PHE A 1 20 ? -3.586  12.487  -7.427  1.00 0.00 ? 84  PHE A H    8  
ATOM   9591  H  HA   . PHE A 1 20 ? -2.285  10.875  -5.342  1.00 0.00 ? 84  PHE A HA   8  
ATOM   9592  H  HB2  . PHE A 1 20 ? -2.495  13.471  -5.227  1.00 0.00 ? 84  PHE A HB2  8  
ATOM   9593  H  HB3  . PHE A 1 20 ? -4.165  13.144  -4.773  1.00 0.00 ? 84  PHE A HB3  8  
ATOM   9594  H  HD1  . PHE A 1 20 ? -0.949  11.481  -3.880  1.00 0.00 ? 84  PHE A HD1  8  
ATOM   9595  H  HD2  . PHE A 1 20 ? -4.420  13.540  -2.527  1.00 0.00 ? 84  PHE A HD2  8  
ATOM   9596  H  HE1  . PHE A 1 20 ? -0.243  11.131  -1.550  1.00 0.00 ? 84  PHE A HE1  8  
ATOM   9597  H  HE2  . PHE A 1 20 ? -3.719  13.195  -0.194  1.00 0.00 ? 84  PHE A HE2  8  
ATOM   9598  H  HZ   . PHE A 1 20 ? -1.629  11.988  0.298   1.00 0.00 ? 84  PHE A HZ   8  
ATOM   9599  N  N    . HIS A 1 21 ? -4.264  9.335   -5.357  1.00 0.00 ? 85  HIS A N    8  
ATOM   9600  C  CA   . HIS A 1 21 ? -5.397  8.446   -5.125  1.00 0.00 ? 85  HIS A CA   8  
ATOM   9601  C  C    . HIS A 1 21 ? -5.275  7.753   -3.771  1.00 0.00 ? 85  HIS A C    8  
ATOM   9602  O  O    . HIS A 1 21 ? -4.173  7.429   -3.325  1.00 0.00 ? 85  HIS A O    8  
ATOM   9603  C  CB   . HIS A 1 21 ? -5.490  7.402   -6.238  1.00 0.00 ? 85  HIS A CB   8  
ATOM   9604  C  CG   . HIS A 1 21 ? -5.261  7.965   -7.607  1.00 0.00 ? 85  HIS A CG   8  
ATOM   9605  N  ND1  . HIS A 1 21 ? -6.150  8.816   -8.229  1.00 0.00 ? 85  HIS A ND1  8  
ATOM   9606  C  CD2  . HIS A 1 21 ? -4.236  7.795   -8.474  1.00 0.00 ? 85  HIS A CD2  8  
ATOM   9607  C  CE1  . HIS A 1 21 ? -5.683  9.144   -9.420  1.00 0.00 ? 85  HIS A CE1  8  
ATOM   9608  N  NE2  . HIS A 1 21 ? -4.522  8.538   -9.593  1.00 0.00 ? 85  HIS A NE2  8  
ATOM   9609  H  H    . HIS A 1 21 ? -3.376  8.949   -5.507  1.00 0.00 ? 85  HIS A H    8  
ATOM   9610  H  HA   . HIS A 1 21 ? -6.295  9.045   -5.129  1.00 0.00 ? 85  HIS A HA   8  
ATOM   9611  H  HB2  . HIS A 1 21 ? -4.748  6.636   -6.067  1.00 0.00 ? 85  HIS A HB2  8  
ATOM   9612  H  HB3  . HIS A 1 21 ? -6.473  6.955   -6.222  1.00 0.00 ? 85  HIS A HB3  8  
ATOM   9613  H  HD1  . HIS A 1 21 ? -6.999  9.131   -7.854  1.00 0.00 ? 85  HIS A HD1  8  
ATOM   9614  H  HD2  . HIS A 1 21 ? -3.356  7.188   -8.316  1.00 0.00 ? 85  HIS A HD2  8  
ATOM   9615  H  HE1  . HIS A 1 21 ? -6.166  9.797   -10.132 1.00 0.00 ? 85  HIS A HE1  8  
ATOM   9616  N  N    . TYR A 1 22 ? -6.412  7.530   -3.121  1.00 0.00 ? 86  TYR A N    8  
ATOM   9617  C  CA   . TYR A 1 22 ? -6.431  6.878   -1.817  1.00 0.00 ? 86  TYR A CA   8  
ATOM   9618  C  C    . TYR A 1 22 ? -5.539  7.619   -0.825  1.00 0.00 ? 86  TYR A C    8  
ATOM   9619  O  O    . TYR A 1 22 ? -4.964  7.016   0.080   1.00 0.00 ? 86  TYR A O    8  
ATOM   9620  C  CB   . TYR A 1 22 ? -5.976  5.424   -1.943  1.00 0.00 ? 86  TYR A CB   8  
ATOM   9621  C  CG   . TYR A 1 22 ? -6.710  4.650   -3.014  1.00 0.00 ? 86  TYR A CG   8  
ATOM   9622  C  CD1  . TYR A 1 22 ? -6.351  4.763   -4.351  1.00 0.00 ? 86  TYR A CD1  8  
ATOM   9623  C  CD2  . TYR A 1 22 ? -7.764  3.804   -2.688  1.00 0.00 ? 86  TYR A CD2  8  
ATOM   9624  C  CE1  . TYR A 1 22 ? -7.020  4.058   -5.333  1.00 0.00 ? 86  TYR A CE1  8  
ATOM   9625  C  CE2  . TYR A 1 22 ? -8.438  3.094   -3.663  1.00 0.00 ? 86  TYR A CE2  8  
ATOM   9626  C  CZ   . TYR A 1 22 ? -8.062  3.225   -4.984  1.00 0.00 ? 86  TYR A CZ   8  
ATOM   9627  O  OH   . TYR A 1 22 ? -8.730  2.520   -5.959  1.00 0.00 ? 86  TYR A OH   8  
ATOM   9628  H  H    . TYR A 1 22 ? -7.258  7.811   -3.528  1.00 0.00 ? 86  TYR A H    8  
ATOM   9629  H  HA   . TYR A 1 22 ? -7.448  6.896   -1.453  1.00 0.00 ? 86  TYR A HA   8  
ATOM   9630  H  HB2  . TYR A 1 22 ? -4.924  5.403   -2.182  1.00 0.00 ? 86  TYR A HB2  8  
ATOM   9631  H  HB3  . TYR A 1 22 ? -6.136  4.921   -1.001  1.00 0.00 ? 86  TYR A HB3  8  
ATOM   9632  H  HD1  . TYR A 1 22 ? -5.533  5.416   -4.621  1.00 0.00 ? 86  TYR A HD1  8  
ATOM   9633  H  HD2  . TYR A 1 22 ? -8.055  3.704   -1.653  1.00 0.00 ? 86  TYR A HD2  8  
ATOM   9634  H  HE1  . TYR A 1 22 ? -6.726  4.160   -6.367  1.00 0.00 ? 86  TYR A HE1  8  
ATOM   9635  H  HE2  . TYR A 1 22 ? -9.254  2.442   -3.391  1.00 0.00 ? 86  TYR A HE2  8  
ATOM   9636  H  HH   . TYR A 1 22 ? -8.477  2.851   -6.824  1.00 0.00 ? 86  TYR A HH   8  
ATOM   9637  N  N    . GLY A 1 23 ? -5.430  8.932   -1.003  1.00 0.00 ? 87  GLY A N    8  
ATOM   9638  C  CA   . GLY A 1 23 ? -4.607  9.734   -0.117  1.00 0.00 ? 87  GLY A CA   8  
ATOM   9639  C  C    . GLY A 1 23 ? -3.146  9.334   -0.161  1.00 0.00 ? 87  GLY A C    8  
ATOM   9640  O  O    . GLY A 1 23 ? -2.369  9.694   0.723   1.00 0.00 ? 87  GLY A O    8  
ATOM   9641  H  H    . GLY A 1 23 ? -5.912  9.359   -1.742  1.00 0.00 ? 87  GLY A H    8  
ATOM   9642  H  HA2  . GLY A 1 23 ? -4.695  10.772  -0.403  1.00 0.00 ? 87  GLY A HA2  8  
ATOM   9643  H  HA3  . GLY A 1 23 ? -4.969  9.619   0.895   1.00 0.00 ? 87  GLY A HA3  8  
ATOM   9644  N  N    . VAL A 1 24 ? -2.770  8.586   -1.194  1.00 0.00 ? 88  VAL A N    8  
ATOM   9645  C  CA   . VAL A 1 24 ? -1.392  8.136   -1.350  1.00 0.00 ? 88  VAL A CA   8  
ATOM   9646  C  C    . VAL A 1 24 ? -0.930  8.273   -2.796  1.00 0.00 ? 88  VAL A C    8  
ATOM   9647  O  O    . VAL A 1 24 ? -1.619  7.845   -3.723  1.00 0.00 ? 88  VAL A O    8  
ATOM   9648  C  CB   . VAL A 1 24 ? -1.227  6.670   -0.906  1.00 0.00 ? 88  VAL A CB   8  
ATOM   9649  C  CG1  . VAL A 1 24 ? -1.838  5.729   -1.934  1.00 0.00 ? 88  VAL A CG1  8  
ATOM   9650  C  CG2  . VAL A 1 24 ? 0.242   6.345   -0.680  1.00 0.00 ? 88  VAL A CG2  8  
ATOM   9651  H  H    . VAL A 1 24 ? -3.435  8.332   -1.867  1.00 0.00 ? 88  VAL A H    8  
ATOM   9652  H  HA   . VAL A 1 24 ? -0.766  8.753   -0.722  1.00 0.00 ? 88  VAL A HA   8  
ATOM   9653  H  HB   . VAL A 1 24 ? -1.751  6.537   0.028   1.00 0.00 ? 88  VAL A HB   8  
ATOM   9654  H  HG11 . VAL A 1 24 ? -1.254  5.761   -2.842  1.00 0.00 ? 88  VAL A HG11 8  
ATOM   9655  H  HG12 . VAL A 1 24 ? -1.842  4.722   -1.542  1.00 0.00 ? 88  VAL A HG12 8  
ATOM   9656  H  HG13 . VAL A 1 24 ? -2.851  6.037   -2.146  1.00 0.00 ? 88  VAL A HG13 8  
ATOM   9657  H  HG21 . VAL A 1 24 ? 0.453   5.354   -1.051  1.00 0.00 ? 88  VAL A HG21 8  
ATOM   9658  H  HG22 . VAL A 1 24 ? 0.854   7.064   -1.204  1.00 0.00 ? 88  VAL A HG22 8  
ATOM   9659  H  HG23 . VAL A 1 24 ? 0.462   6.388   0.377   1.00 0.00 ? 88  VAL A HG23 8  
ATOM   9660  N  N    . HIS A 1 25 ? 0.242   8.872   -2.983  1.00 0.00 ? 89  HIS A N    8  
ATOM   9661  C  CA   . HIS A 1 25 ? 0.797   9.065   -4.318  1.00 0.00 ? 89  HIS A CA   8  
ATOM   9662  C  C    . HIS A 1 25 ? 1.002   7.726   -5.020  1.00 0.00 ? 89  HIS A C    8  
ATOM   9663  O  O    . HIS A 1 25 ? 2.003   7.045   -4.799  1.00 0.00 ? 89  HIS A O    8  
ATOM   9664  C  CB   . HIS A 1 25 ? 2.125   9.819   -4.237  1.00 0.00 ? 89  HIS A CB   8  
ATOM   9665  C  CG   . HIS A 1 25 ? 1.971   11.308  -4.286  1.00 0.00 ? 89  HIS A CG   8  
ATOM   9666  N  ND1  . HIS A 1 25 ? 1.919   12.097  -3.157  1.00 0.00 ? 89  HIS A ND1  8  
ATOM   9667  C  CD2  . HIS A 1 25 ? 1.861   12.153  -5.338  1.00 0.00 ? 89  HIS A CD2  8  
ATOM   9668  C  CE1  . HIS A 1 25 ? 1.781   13.362  -3.512  1.00 0.00 ? 89  HIS A CE1  8  
ATOM   9669  N  NE2  . HIS A 1 25 ? 1.743   13.423  -4.831  1.00 0.00 ? 89  HIS A NE2  8  
ATOM   9670  H  H    . HIS A 1 25 ? 0.744   9.192   -2.206  1.00 0.00 ? 89  HIS A H    8  
ATOM   9671  H  HA   . HIS A 1 25 ? 0.094   9.652   -4.889  1.00 0.00 ? 89  HIS A HA   8  
ATOM   9672  H  HB2  . HIS A 1 25 ? 2.618   9.568   -3.310  1.00 0.00 ? 89  HIS A HB2  8  
ATOM   9673  H  HB3  . HIS A 1 25 ? 2.752   9.522   -5.065  1.00 0.00 ? 89  HIS A HB3  8  
ATOM   9674  H  HD1  . HIS A 1 25 ? 1.973   11.777  -2.232  1.00 0.00 ? 89  HIS A HD1  8  
ATOM   9675  H  HD2  . HIS A 1 25 ? 1.864   11.879  -6.384  1.00 0.00 ? 89  HIS A HD2  8  
ATOM   9676  H  HE1  . HIS A 1 25 ? 1.711   14.204  -2.839  1.00 0.00 ? 89  HIS A HE1  8  
ATOM   9677  N  N    . ALA A 1 26 ? 0.046   7.354   -5.865  1.00 0.00 ? 90  ALA A N    8  
ATOM   9678  C  CA   . ALA A 1 26 ? 0.123   6.097   -6.600  1.00 0.00 ? 90  ALA A CA   8  
ATOM   9679  C  C    . ALA A 1 26 ? -0.087  6.321   -8.094  1.00 0.00 ? 90  ALA A C    8  
ATOM   9680  O  O    . ALA A 1 26 ? -0.696  7.309   -8.504  1.00 0.00 ? 90  ALA A O    8  
ATOM   9681  C  CB   . ALA A 1 26 ? -0.902  5.109   -6.063  1.00 0.00 ? 90  ALA A CB   8  
ATOM   9682  H  H    . ALA A 1 26 ? -0.728  7.939   -5.999  1.00 0.00 ? 90  ALA A H    8  
ATOM   9683  H  HA   . ALA A 1 26 ? 1.106   5.678   -6.443  1.00 0.00 ? 90  ALA A HA   8  
ATOM   9684  H  HB1  . ALA A 1 26 ? -0.864  4.200   -6.644  1.00 0.00 ? 90  ALA A HB1  8  
ATOM   9685  H  HB2  . ALA A 1 26 ? -0.680  4.886   -5.030  1.00 0.00 ? 90  ALA A HB2  8  
ATOM   9686  H  HB3  . ALA A 1 26 ? -1.890  5.541   -6.134  1.00 0.00 ? 90  ALA A HB3  8  
ATOM   9687  N  N    . CYS A 1 27 ? 0.422   5.398   -8.902  1.00 0.00 ? 91  CYS A N    8  
ATOM   9688  C  CA   . CYS A 1 27 ? 0.292   5.494   -10.351 1.00 0.00 ? 91  CYS A CA   8  
ATOM   9689  C  C    . CYS A 1 27 ? -0.939  4.735   -10.839 1.00 0.00 ? 91  CYS A C    8  
ATOM   9690  O  O    . CYS A 1 27 ? -1.604  4.050   -10.063 1.00 0.00 ? 91  CYS A O    8  
ATOM   9691  C  CB   . CYS A 1 27 ? 1.546   4.945   -11.035 1.00 0.00 ? 91  CYS A CB   8  
ATOM   9692  S  SG   . CYS A 1 27 ? 1.738   3.139   -10.898 1.00 0.00 ? 91  CYS A SG   8  
ATOM   9693  H  H    . CYS A 1 27 ? 0.898   4.632   -8.515  1.00 0.00 ? 91  CYS A H    8  
ATOM   9694  H  HA   . CYS A 1 27 ? 0.181   6.537   -10.606 1.00 0.00 ? 91  CYS A HA   8  
ATOM   9695  H  HB2  . CYS A 1 27 ? 1.512   5.193   -12.086 1.00 0.00 ? 91  CYS A HB2  8  
ATOM   9696  H  HB3  . CYS A 1 27 ? 2.418   5.403   -10.591 1.00 0.00 ? 91  CYS A HB3  8  
ATOM   9697  N  N    . GLU A 1 28 ? -1.234  4.864   -12.128 1.00 0.00 ? 92  GLU A N    8  
ATOM   9698  C  CA   . GLU A 1 28 ? -2.386  4.191   -12.718 1.00 0.00 ? 92  GLU A CA   8  
ATOM   9699  C  C    . GLU A 1 28 ? -2.264  2.677   -12.574 1.00 0.00 ? 92  GLU A C    8  
ATOM   9700  O  O    . GLU A 1 28 ? -3.178  2.014   -12.085 1.00 0.00 ? 92  GLU A O    8  
ATOM   9701  C  CB   . GLU A 1 28 ? -2.520  4.564   -14.196 1.00 0.00 ? 92  GLU A CB   8  
ATOM   9702  C  CG   . GLU A 1 28 ? -3.086  5.955   -14.424 1.00 0.00 ? 92  GLU A CG   8  
ATOM   9703  C  CD   . GLU A 1 28 ? -3.769  6.094   -15.771 1.00 0.00 ? 92  GLU A CD   8  
ATOM   9704  O  OE1  . GLU A 1 28 ? -3.302  5.464   -16.742 1.00 0.00 ? 92  GLU A OE1  8  
ATOM   9705  O  OE2  . GLU A 1 28 ? -4.772  6.834   -15.853 1.00 0.00 ? 92  GLU A OE2  8  
ATOM   9706  H  H    . GLU A 1 28 ? -0.666  5.425   -12.696 1.00 0.00 ? 92  GLU A H    8  
ATOM   9707  H  HA   . GLU A 1 28 ? -3.268  4.521   -12.192 1.00 0.00 ? 92  GLU A HA   8  
ATOM   9708  H  HB2  . GLU A 1 28 ? -1.545  4.513   -14.658 1.00 0.00 ? 92  GLU A HB2  8  
ATOM   9709  H  HB3  . GLU A 1 28 ? -3.173  3.850   -14.677 1.00 0.00 ? 92  GLU A HB3  8  
ATOM   9710  H  HG2  . GLU A 1 28 ? -3.806  6.169   -13.649 1.00 0.00 ? 92  GLU A HG2  8  
ATOM   9711  H  HG3  . GLU A 1 28 ? -2.279  6.671   -14.371 1.00 0.00 ? 92  GLU A HG3  8  
ATOM   9712  N  N    . GLY A 1 29 ? -1.127  2.137   -13.002 1.00 0.00 ? 93  GLY A N    8  
ATOM   9713  C  CA   . GLY A 1 29 ? -0.906  0.705   -12.913 1.00 0.00 ? 93  GLY A CA   8  
ATOM   9714  C  C    . GLY A 1 29 ? -1.253  0.149   -11.546 1.00 0.00 ? 93  GLY A C    8  
ATOM   9715  O  O    . GLY A 1 29 ? -2.225  -0.593  -11.398 1.00 0.00 ? 93  GLY A O    8  
ATOM   9716  H  H    . GLY A 1 29 ? -0.433  2.715   -13.383 1.00 0.00 ? 93  GLY A H    8  
ATOM   9717  H  HA2  . GLY A 1 29 ? -1.514  0.211   -13.656 1.00 0.00 ? 93  GLY A HA2  8  
ATOM   9718  H  HA3  . GLY A 1 29 ? 0.134   0.500   -13.118 1.00 0.00 ? 93  GLY A HA3  8  
ATOM   9719  N  N    . CYS A 1 30 ? -0.457  0.507   -10.544 1.00 0.00 ? 94  CYS A N    8  
ATOM   9720  C  CA   . CYS A 1 30 ? -0.683  0.038   -9.182  1.00 0.00 ? 94  CYS A CA   8  
ATOM   9721  C  C    . CYS A 1 30 ? -2.161  0.131   -8.813  1.00 0.00 ? 94  CYS A C    8  
ATOM   9722  O  O    . CYS A 1 30 ? -2.749  -0.828  -8.314  1.00 0.00 ? 94  CYS A O    8  
ATOM   9723  C  CB   . CYS A 1 30 ? 0.153   0.853   -8.194  1.00 0.00 ? 94  CYS A CB   8  
ATOM   9724  S  SG   . CYS A 1 30 ? 1.946   0.552   -8.312  1.00 0.00 ? 94  CYS A SG   8  
ATOM   9725  H  H    . CYS A 1 30 ? 0.302   1.101   -10.725 1.00 0.00 ? 94  CYS A H    8  
ATOM   9726  H  HA   . CYS A 1 30 ? -0.377  -0.996  -9.132  1.00 0.00 ? 94  CYS A HA   8  
ATOM   9727  H  HB2  . CYS A 1 30 ? -0.015  1.905   -8.375  1.00 0.00 ? 94  CYS A HB2  8  
ATOM   9728  H  HB3  . CYS A 1 30 ? -0.155  0.612   -7.188  1.00 0.00 ? 94  CYS A HB3  8  
ATOM   9729  N  N    . LYS A 1 31 ? -2.755  1.293   -9.062  1.00 0.00 ? 95  LYS A N    8  
ATOM   9730  C  CA   . LYS A 1 31 ? -4.164  1.513   -8.758  1.00 0.00 ? 95  LYS A CA   8  
ATOM   9731  C  C    . LYS A 1 31 ? -4.990  0.271   -9.077  1.00 0.00 ? 95  LYS A C    8  
ATOM   9732  O  O    . LYS A 1 31 ? -5.536  -0.370  -8.181  1.00 0.00 ? 95  LYS A O    8  
ATOM   9733  C  CB   . LYS A 1 31 ? -4.696  2.710   -9.549  1.00 0.00 ? 95  LYS A CB   8  
ATOM   9734  C  CG   . LYS A 1 31 ? -6.047  3.207   -9.065  1.00 0.00 ? 95  LYS A CG   8  
ATOM   9735  C  CD   . LYS A 1 31 ? -6.279  4.658   -9.450  1.00 0.00 ? 95  LYS A CD   8  
ATOM   9736  C  CE   . LYS A 1 31 ? -6.924  4.775   -10.823 1.00 0.00 ? 95  LYS A CE   8  
ATOM   9737  N  NZ   . LYS A 1 31 ? -8.306  4.220   -10.835 1.00 0.00 ? 95  LYS A NZ   8  
ATOM   9738  H  H    . LYS A 1 31 ? -2.232  2.021   -9.462  1.00 0.00 ? 95  LYS A H    8  
ATOM   9739  H  HA   . LYS A 1 31 ? -4.246  1.725   -7.703  1.00 0.00 ? 95  LYS A HA   8  
ATOM   9740  H  HB2  . LYS A 1 31 ? -3.988  3.522   -9.471  1.00 0.00 ? 95  LYS A HB2  8  
ATOM   9741  H  HB3  . LYS A 1 31 ? -4.791  2.426   -10.588 1.00 0.00 ? 95  LYS A HB3  8  
ATOM   9742  H  HG2  . LYS A 1 31 ? -6.823  2.600   -9.507  1.00 0.00 ? 95  LYS A HG2  8  
ATOM   9743  H  HG3  . LYS A 1 31 ? -6.088  3.119   -7.989  1.00 0.00 ? 95  LYS A HG3  8  
ATOM   9744  H  HD2  . LYS A 1 31 ? -6.929  5.117   -8.720  1.00 0.00 ? 95  LYS A HD2  8  
ATOM   9745  H  HD3  . LYS A 1 31 ? -5.329  5.174   -9.464  1.00 0.00 ? 95  LYS A HD3  8  
ATOM   9746  H  HE2  . LYS A 1 31 ? -6.961  5.816   -11.102 1.00 0.00 ? 95  LYS A HE2  8  
ATOM   9747  H  HE3  . LYS A 1 31 ? -6.321  4.232   -11.536 1.00 0.00 ? 95  LYS A HE3  8  
ATOM   9748  H  HZ1  . LYS A 1 31 ? -8.920  4.802   -11.440 1.00 0.00 ? 95  LYS A HZ1  8  
ATOM   9749  H  HZ2  . LYS A 1 31 ? -8.695  4.211   -9.870  1.00 0.00 ? 95  LYS A HZ2  8  
ATOM   9750  H  HZ3  . LYS A 1 31 ? -8.298  3.247   -11.202 1.00 0.00 ? 95  LYS A HZ3  8  
ATOM   9751  N  N    . GLY A 1 32 ? -5.076  -0.063  -10.361 1.00 0.00 ? 96  GLY A N    8  
ATOM   9752  C  CA   . GLY A 1 32 ? -5.836  -1.228  -10.775 1.00 0.00 ? 96  GLY A CA   8  
ATOM   9753  C  C    . GLY A 1 32 ? -5.661  -2.400  -9.830  1.00 0.00 ? 96  GLY A C    8  
ATOM   9754  O  O    . GLY A 1 32 ? -6.640  -2.964  -9.341  1.00 0.00 ? 96  GLY A O    8  
ATOM   9755  H  H    . GLY A 1 32 ? -4.619  0.486   -11.033 1.00 0.00 ? 96  GLY A H    8  
ATOM   9756  H  HA2  . GLY A 1 32 ? -6.882  -0.965  -10.817 1.00 0.00 ? 96  GLY A HA2  8  
ATOM   9757  H  HA3  . GLY A 1 32 ? -5.510  -1.524  -11.762 1.00 0.00 ? 96  GLY A HA3  8  
ATOM   9758  N  N    . PHE A 1 33 ? -4.411  -2.769  -9.573  1.00 0.00 ? 97  PHE A N    8  
ATOM   9759  C  CA   . PHE A 1 33 ? -4.111  -3.884  -8.682  1.00 0.00 ? 97  PHE A CA   8  
ATOM   9760  C  C    . PHE A 1 33 ? -4.848  -3.733  -7.354  1.00 0.00 ? 97  PHE A C    8  
ATOM   9761  O  O    . PHE A 1 33 ? -5.728  -4.530  -7.026  1.00 0.00 ? 97  PHE A O    8  
ATOM   9762  C  CB   . PHE A 1 33 ? -2.604  -3.975  -8.433  1.00 0.00 ? 97  PHE A CB   8  
ATOM   9763  C  CG   . PHE A 1 33 ? -2.220  -5.058  -7.466  1.00 0.00 ? 97  PHE A CG   8  
ATOM   9764  C  CD1  . PHE A 1 33 ? -2.255  -6.390  -7.847  1.00 0.00 ? 97  PHE A CD1  8  
ATOM   9765  C  CD2  . PHE A 1 33 ? -1.824  -4.745  -6.176  1.00 0.00 ? 97  PHE A CD2  8  
ATOM   9766  C  CE1  . PHE A 1 33 ? -1.903  -7.388  -6.959  1.00 0.00 ? 97  PHE A CE1  8  
ATOM   9767  C  CE2  . PHE A 1 33 ? -1.470  -5.739  -5.283  1.00 0.00 ? 97  PHE A CE2  8  
ATOM   9768  C  CZ   . PHE A 1 33 ? -1.509  -7.063  -5.676  1.00 0.00 ? 97  PHE A CZ   8  
ATOM   9769  H  H    . PHE A 1 33 ? -3.672  -2.280  -9.993  1.00 0.00 ? 97  PHE A H    8  
ATOM   9770  H  HA   . PHE A 1 33 ? -4.443  -4.791  -9.163  1.00 0.00 ? 97  PHE A HA   8  
ATOM   9771  H  HB2  . PHE A 1 33 ? -2.103  -4.174  -9.369  1.00 0.00 ? 97  PHE A HB2  8  
ATOM   9772  H  HB3  . PHE A 1 33 ? -2.255  -3.034  -8.035  1.00 0.00 ? 97  PHE A HB3  8  
ATOM   9773  H  HD1  . PHE A 1 33 ? -2.561  -6.646  -8.851  1.00 0.00 ? 97  PHE A HD1  8  
ATOM   9774  H  HD2  . PHE A 1 33 ? -1.793  -3.709  -5.868  1.00 0.00 ? 97  PHE A HD2  8  
ATOM   9775  H  HE1  . PHE A 1 33 ? -1.933  -8.422  -7.269  1.00 0.00 ? 97  PHE A HE1  8  
ATOM   9776  H  HE2  . PHE A 1 33 ? -1.163  -5.480  -4.281  1.00 0.00 ? 97  PHE A HE2  8  
ATOM   9777  H  HZ   . PHE A 1 33 ? -1.234  -7.841  -4.980  1.00 0.00 ? 97  PHE A HZ   8  
ATOM   9778  N  N    . PHE A 1 34 ? -4.483  -2.706  -6.595  1.00 0.00 ? 98  PHE A N    8  
ATOM   9779  C  CA   . PHE A 1 34 ? -5.108  -2.450  -5.303  1.00 0.00 ? 98  PHE A CA   8  
ATOM   9780  C  C    . PHE A 1 34 ? -6.618  -2.661  -5.377  1.00 0.00 ? 98  PHE A C    8  
ATOM   9781  O  O    . PHE A 1 34 ? -7.150  -3.615  -4.810  1.00 0.00 ? 98  PHE A O    8  
ATOM   9782  C  CB   . PHE A 1 34 ? -4.804  -1.024  -4.838  1.00 0.00 ? 98  PHE A CB   8  
ATOM   9783  C  CG   . PHE A 1 34 ? -5.417  -0.683  -3.510  1.00 0.00 ? 98  PHE A CG   8  
ATOM   9784  C  CD1  . PHE A 1 34 ? -5.014  -1.337  -2.357  1.00 0.00 ? 98  PHE A CD1  8  
ATOM   9785  C  CD2  . PHE A 1 34 ? -6.397  0.292   -3.415  1.00 0.00 ? 98  PHE A CD2  8  
ATOM   9786  C  CE1  . PHE A 1 34 ? -5.577  -1.025  -1.134  1.00 0.00 ? 98  PHE A CE1  8  
ATOM   9787  C  CE2  . PHE A 1 34 ? -6.962  0.609   -2.195  1.00 0.00 ? 98  PHE A CE2  8  
ATOM   9788  C  CZ   . PHE A 1 34 ? -6.553  -0.051  -1.053  1.00 0.00 ? 98  PHE A CZ   8  
ATOM   9789  H  H    . PHE A 1 34 ? -3.776  -2.105  -6.911  1.00 0.00 ? 98  PHE A H    8  
ATOM   9790  H  HA   . PHE A 1 34 ? -4.694  -3.148  -4.591  1.00 0.00 ? 98  PHE A HA   8  
ATOM   9791  H  HB2  . PHE A 1 34 ? -3.735  -0.903  -4.750  1.00 0.00 ? 98  PHE A HB2  8  
ATOM   9792  H  HB3  . PHE A 1 34 ? -5.182  -0.327  -5.569  1.00 0.00 ? 98  PHE A HB3  8  
ATOM   9793  H  HD1  . PHE A 1 34 ? -4.251  -2.099  -2.420  1.00 0.00 ? 98  PHE A HD1  8  
ATOM   9794  H  HD2  . PHE A 1 34 ? -6.719  0.809   -4.308  1.00 0.00 ? 98  PHE A HD2  8  
ATOM   9795  H  HE1  . PHE A 1 34 ? -5.254  -1.543  -0.243  1.00 0.00 ? 98  PHE A HE1  8  
ATOM   9796  H  HE2  . PHE A 1 34 ? -7.726  1.371   -2.134  1.00 0.00 ? 98  PHE A HE2  8  
ATOM   9797  H  HZ   . PHE A 1 34 ? -6.993  0.195   -0.098  1.00 0.00 ? 98  PHE A HZ   8  
ATOM   9798  N  N    . ARG A 1 35 ? -7.301  -1.764  -6.080  1.00 0.00 ? 99  ARG A N    8  
ATOM   9799  C  CA   . ARG A 1 35 ? -8.748  -1.850  -6.227  1.00 0.00 ? 99  ARG A CA   8  
ATOM   9800  C  C    . ARG A 1 35 ? -9.174  -3.268  -6.594  1.00 0.00 ? 99  ARG A C    8  
ATOM   9801  O  O    . ARG A 1 35 ? -9.935  -3.906  -5.866  1.00 0.00 ? 99  ARG A O    8  
ATOM   9802  C  CB   . ARG A 1 35 ? -9.233  -0.868  -7.296  1.00 0.00 ? 99  ARG A CB   8  
ATOM   9803  C  CG   . ARG A 1 35 ? -10.746 -0.792  -7.412  1.00 0.00 ? 99  ARG A CG   8  
ATOM   9804  C  CD   . ARG A 1 35 ? -11.191 0.515   -8.051  1.00 0.00 ? 99  ARG A CD   8  
ATOM   9805  N  NE   . ARG A 1 35 ? -11.193 1.619   -7.095  1.00 0.00 ? 99  ARG A NE   8  
ATOM   9806  C  CZ   . ARG A 1 35 ? -11.839 2.762   -7.294  1.00 0.00 ? 99  ARG A CZ   8  
ATOM   9807  N  NH1  . ARG A 1 35 ? -12.530 2.951   -8.409  1.00 0.00 ? 99  ARG A NH1  8  
ATOM   9808  N  NH2  . ARG A 1 35 ? -11.793 3.720   -6.377  1.00 0.00 ? 99  ARG A NH2  8  
ATOM   9809  H  H    . ARG A 1 35 ? -6.820  -1.025  -6.509  1.00 0.00 ? 99  ARG A H    8  
ATOM   9810  H  HA   . ARG A 1 35 ? -9.195  -1.586  -5.280  1.00 0.00 ? 99  ARG A HA   8  
ATOM   9811  H  HB2  . ARG A 1 35 ? -8.862  0.118   -7.058  1.00 0.00 ? 99  ARG A HB2  8  
ATOM   9812  H  HB3  . ARG A 1 35 ? -8.835  -1.172  -8.253  1.00 0.00 ? 99  ARG A HB3  8  
ATOM   9813  H  HG2  . ARG A 1 35 ? -11.094 -1.613  -8.020  1.00 0.00 ? 99  ARG A HG2  8  
ATOM   9814  H  HG3  . ARG A 1 35 ? -11.177 -0.865  -6.424  1.00 0.00 ? 99  ARG A HG3  8  
ATOM   9815  H  HD2  . ARG A 1 35 ? -10.516 0.753   -8.859  1.00 0.00 ? 99  ARG A HD2  8  
ATOM   9816  H  HD3  . ARG A 1 35 ? -12.189 0.387   -8.442  1.00 0.00 ? 99  ARG A HD3  8  
ATOM   9817  H  HE   . ARG A 1 35 ? -10.688 1.500   -6.263  1.00 0.00 ? 99  ARG A HE   8  
ATOM   9818  H  HH11 . ARG A 1 35 ? -12.567 2.231   -9.102  1.00 0.00 ? 99  ARG A HH11 8  
ATOM   9819  H  HH12 . ARG A 1 35 ? -13.016 3.813   -8.557  1.00 0.00 ? 99  ARG A HH12 8  
ATOM   9820  H  HH21 . ARG A 1 35 ? -11.273 3.581   -5.535  1.00 0.00 ? 99  ARG A HH21 8  
ATOM   9821  H  HH22 . ARG A 1 35 ? -12.279 4.580   -6.528  1.00 0.00 ? 99  ARG A HH22 8  
ATOM   9822  N  N    . ARG A 1 36 ? -8.678  -3.755  -7.727  1.00 0.00 ? 100 ARG A N    8  
ATOM   9823  C  CA   . ARG A 1 36 ? -9.009  -5.097  -8.191  1.00 0.00 ? 100 ARG A CA   8  
ATOM   9824  C  C    . ARG A 1 36 ? -8.987  -6.093  -7.035  1.00 0.00 ? 100 ARG A C    8  
ATOM   9825  O  O    . ARG A 1 36 ? -9.888  -6.921  -6.897  1.00 0.00 ? 100 ARG A O    8  
ATOM   9826  C  CB   . ARG A 1 36 ? -8.027  -5.540  -9.278  1.00 0.00 ? 100 ARG A CB   8  
ATOM   9827  C  CG   . ARG A 1 36 ? -8.221  -6.980  -9.724  1.00 0.00 ? 100 ARG A CG   8  
ATOM   9828  C  CD   . ARG A 1 36 ? -7.819  -7.172  -11.177 1.00 0.00 ? 100 ARG A CD   8  
ATOM   9829  N  NE   . ARG A 1 36 ? -6.372  -7.294  -11.334 1.00 0.00 ? 100 ARG A NE   8  
ATOM   9830  C  CZ   . ARG A 1 36 ? -5.729  -7.020  -12.463 1.00 0.00 ? 100 ARG A CZ   8  
ATOM   9831  N  NH1  . ARG A 1 36 ? -6.402  -6.612  -13.530 1.00 0.00 ? 100 ARG A NH1  8  
ATOM   9832  N  NH2  . ARG A 1 36 ? -4.411  -7.155  -12.527 1.00 0.00 ? 100 ARG A NH2  8  
ATOM   9833  H  H    . ARG A 1 36 ? -8.077  -3.199  -8.264  1.00 0.00 ? 100 ARG A H    8  
ATOM   9834  H  HA   . ARG A 1 36 ? -10.004 -5.069  -8.607  1.00 0.00 ? 100 ARG A HA   8  
ATOM   9835  H  HB2  . ARG A 1 36 ? -8.150  -4.900  -10.139 1.00 0.00 ? 100 ARG A HB2  8  
ATOM   9836  H  HB3  . ARG A 1 36 ? -7.021  -5.435  -8.901  1.00 0.00 ? 100 ARG A HB3  8  
ATOM   9837  H  HG2  . ARG A 1 36 ? -7.613  -7.624  -9.105  1.00 0.00 ? 100 ARG A HG2  8  
ATOM   9838  H  HG3  . ARG A 1 36 ? -9.262  -7.246  -9.609  1.00 0.00 ? 100 ARG A HG3  8  
ATOM   9839  H  HD2  . ARG A 1 36 ? -8.288  -8.070  -11.551 1.00 0.00 ? 100 ARG A HD2  8  
ATOM   9840  H  HD3  . ARG A 1 36 ? -8.163  -6.322  -11.747 1.00 0.00 ? 100 ARG A HD3  8  
ATOM   9841  H  HE   . ARG A 1 36 ? -5.855  -7.594  -10.557 1.00 0.00 ? 100 ARG A HE   8  
ATOM   9842  H  HH11 . ARG A 1 36 ? -7.395  -6.508  -13.485 1.00 0.00 ? 100 ARG A HH11 8  
ATOM   9843  H  HH12 . ARG A 1 36 ? -5.915  -6.405  -14.380 1.00 0.00 ? 100 ARG A HH12 8  
ATOM   9844  H  HH21 . ARG A 1 36 ? -3.900  -7.463  -11.725 1.00 0.00 ? 100 ARG A HH21 8  
ATOM   9845  H  HH22 . ARG A 1 36 ? -3.928  -6.949  -13.378 1.00 0.00 ? 100 ARG A HH22 8  
ATOM   9846  N  N    . THR A 1 37 ? -7.951  -6.007  -6.205  1.00 0.00 ? 101 THR A N    8  
ATOM   9847  C  CA   . THR A 1 37 ? -7.811  -6.900  -5.063  1.00 0.00 ? 101 THR A CA   8  
ATOM   9848  C  C    . THR A 1 37 ? -8.955  -6.711  -4.073  1.00 0.00 ? 101 THR A C    8  
ATOM   9849  O  O    . THR A 1 37 ? -9.392  -7.663  -3.427  1.00 0.00 ? 101 THR A O    8  
ATOM   9850  C  CB   . THR A 1 37 ? -6.473  -6.674  -4.334  1.00 0.00 ? 101 THR A CB   8  
ATOM   9851  O  OG1  . THR A 1 37 ? -5.381  -6.933  -5.223  1.00 0.00 ? 101 THR A OG1  8  
ATOM   9852  C  CG2  . THR A 1 37 ? -6.364  -7.574  -3.112  1.00 0.00 ? 101 THR A CG2  8  
ATOM   9853  H  H    . THR A 1 37 ? -7.266  -5.326  -6.368  1.00 0.00 ? 101 THR A H    8  
ATOM   9854  H  HA   . THR A 1 37 ? -7.830  -7.916  -5.430  1.00 0.00 ? 101 THR A HA   8  
ATOM   9855  H  HB   . THR A 1 37 ? -6.427  -5.644  -4.010  1.00 0.00 ? 101 THR A HB   8  
ATOM   9856  H  HG1  . THR A 1 37 ? -5.495  -6.422  -6.027  1.00 0.00 ? 101 THR A HG1  8  
ATOM   9857  H  HG21 . THR A 1 37 ? -5.328  -7.660  -2.821  1.00 0.00 ? 101 THR A HG21 8  
ATOM   9858  H  HG22 . THR A 1 37 ? -6.753  -8.552  -3.349  1.00 0.00 ? 101 THR A HG22 8  
ATOM   9859  H  HG23 . THR A 1 37 ? -6.932  -7.147  -2.299  1.00 0.00 ? 101 THR A HG23 8  
ATOM   9860  N  N    . ILE A 1 38 ? -9.434  -5.477  -3.959  1.00 0.00 ? 102 ILE A N    8  
ATOM   9861  C  CA   . ILE A 1 38 ? -10.529 -5.164  -3.049  1.00 0.00 ? 102 ILE A CA   8  
ATOM   9862  C  C    . ILE A 1 38 ? -11.867 -5.616  -3.622  1.00 0.00 ? 102 ILE A C    8  
ATOM   9863  O  O    . ILE A 1 38 ? -12.591 -6.392  -2.999  1.00 0.00 ? 102 ILE A O    8  
ATOM   9864  C  CB   . ILE A 1 38 ? -10.596 -3.655  -2.747  1.00 0.00 ? 102 ILE A CB   8  
ATOM   9865  C  CG1  . ILE A 1 38 ? -9.238  -3.151  -2.252  1.00 0.00 ? 102 ILE A CG1  8  
ATOM   9866  C  CG2  . ILE A 1 38 ? -11.679 -3.369  -1.718  1.00 0.00 ? 102 ILE A CG2  8  
ATOM   9867  C  CD1  . ILE A 1 38 ? -8.812  -3.757  -0.933  1.00 0.00 ? 102 ILE A CD1  8  
ATOM   9868  H  H    . ILE A 1 38 ? -9.043  -4.760  -4.501  1.00 0.00 ? 102 ILE A H    8  
ATOM   9869  H  HA   . ILE A 1 38 ? -10.351 -5.689  -2.121  1.00 0.00 ? 102 ILE A HA   8  
ATOM   9870  H  HB   . ILE A 1 38 ? -10.853 -3.139  -3.659  1.00 0.00 ? 102 ILE A HB   8  
ATOM   9871  H  HG12 . ILE A 1 38 ? -8.484  -3.390  -2.985  1.00 0.00 ? 102 ILE A HG12 8  
ATOM   9872  H  HG13 . ILE A 1 38 ? -9.285  -2.079  -2.127  1.00 0.00 ? 102 ILE A HG13 8  
ATOM   9873  H  HG21 . ILE A 1 38 ? -12.411 -2.697  -2.144  1.00 0.00 ? 102 ILE A HG21 8  
ATOM   9874  H  HG22 . ILE A 1 38 ? -12.162 -4.293  -1.437  1.00 0.00 ? 102 ILE A HG22 8  
ATOM   9875  H  HG23 . ILE A 1 38 ? -11.237 -2.913  -0.845  1.00 0.00 ? 102 ILE A HG23 8  
ATOM   9876  H  HD11 . ILE A 1 38 ? -8.730  -2.977  -0.189  1.00 0.00 ? 102 ILE A HD11 8  
ATOM   9877  H  HD12 . ILE A 1 38 ? -9.548  -4.480  -0.615  1.00 0.00 ? 102 ILE A HD12 8  
ATOM   9878  H  HD13 . ILE A 1 38 ? -7.856  -4.243  -1.051  1.00 0.00 ? 102 ILE A HD13 8  
ATOM   9879  N  N    . ARG A 1 39 ? -12.189 -5.126  -4.815  1.00 0.00 ? 103 ARG A N    8  
ATOM   9880  C  CA   . ARG A 1 39 ? -13.441 -5.480  -5.474  1.00 0.00 ? 103 ARG A CA   8  
ATOM   9881  C  C    . ARG A 1 39 ? -13.564 -6.993  -5.630  1.00 0.00 ? 103 ARG A C    8  
ATOM   9882  O  O    . ARG A 1 39 ? -14.667 -7.539  -5.633  1.00 0.00 ? 103 ARG A O    8  
ATOM   9883  C  CB   . ARG A 1 39 ? -13.529 -4.806  -6.844  1.00 0.00 ? 103 ARG A CB   8  
ATOM   9884  C  CG   . ARG A 1 39 ? -12.316 -5.056  -7.725  1.00 0.00 ? 103 ARG A CG   8  
ATOM   9885  C  CD   . ARG A 1 39 ? -12.561 -4.597  -9.154  1.00 0.00 ? 103 ARG A CD   8  
ATOM   9886  N  NE   . ARG A 1 39 ? -13.530 -5.445  -9.842  1.00 0.00 ? 103 ARG A NE   8  
ATOM   9887  C  CZ   . ARG A 1 39 ? -14.839 -5.218  -9.839  1.00 0.00 ? 103 ARG A CZ   8  
ATOM   9888  N  NH1  . ARG A 1 39 ? -15.332 -4.174  -9.187  1.00 0.00 ? 103 ARG A NH1  8  
ATOM   9889  N  NH2  . ARG A 1 39 ? -15.657 -6.035  -10.489 1.00 0.00 ? 103 ARG A NH2  8  
ATOM   9890  H  H    . ARG A 1 39 ? -11.571 -4.511  -5.263  1.00 0.00 ? 103 ARG A H    8  
ATOM   9891  H  HA   . ARG A 1 39 ? -14.253 -5.127  -4.856  1.00 0.00 ? 103 ARG A HA   8  
ATOM   9892  H  HB2  . ARG A 1 39 ? -14.403 -5.177  -7.360  1.00 0.00 ? 103 ARG A HB2  8  
ATOM   9893  H  HB3  . ARG A 1 39 ? -13.630 -3.741  -6.702  1.00 0.00 ? 103 ARG A HB3  8  
ATOM   9894  H  HG2  . ARG A 1 39 ? -11.473 -4.512  -7.324  1.00 0.00 ? 103 ARG A HG2  8  
ATOM   9895  H  HG3  . ARG A 1 39 ? -12.096 -6.113  -7.728  1.00 0.00 ? 103 ARG A HG3  8  
ATOM   9896  H  HD2  . ARG A 1 39 ? -12.934 -3.584  -9.134  1.00 0.00 ? 103 ARG A HD2  8  
ATOM   9897  H  HD3  . ARG A 1 39 ? -11.625 -4.626  -9.692  1.00 0.00 ? 103 ARG A HD3  8  
ATOM   9898  H  HE   . ARG A 1 39 ? -13.188 -6.222  -10.331 1.00 0.00 ? 103 ARG A HE   8  
ATOM   9899  H  HH11 . ARG A 1 39 ? -14.717 -3.556  -8.697  1.00 0.00 ? 103 ARG A HH11 8  
ATOM   9900  H  HH12 . ARG A 1 39 ? -16.318 -4.004  -9.187  1.00 0.00 ? 103 ARG A HH12 8  
ATOM   9901  H  HH21 . ARG A 1 39 ? -15.289 -6.823  -10.982 1.00 0.00 ? 103 ARG A HH21 8  
ATOM   9902  H  HH22 . ARG A 1 39 ? -16.642 -5.863  -10.486 1.00 0.00 ? 103 ARG A HH22 8  
ATOM   9903  N  N    . MET A 1 40 ? -12.424 -7.664  -5.761  1.00 0.00 ? 104 MET A N    8  
ATOM   9904  C  CA   . MET A 1 40 ? -12.405 -9.114  -5.917  1.00 0.00 ? 104 MET A CA   8  
ATOM   9905  C  C    . MET A 1 40 ? -12.132 -9.801  -4.583  1.00 0.00 ? 104 MET A C    8  
ATOM   9906  O  O    . MET A 1 40 ? -12.196 -11.026 -4.479  1.00 0.00 ? 104 MET A O    8  
ATOM   9907  C  CB   . MET A 1 40 ? -11.344 -9.524  -6.941  1.00 0.00 ? 104 MET A CB   8  
ATOM   9908  C  CG   . MET A 1 40 ? -11.590 -8.958  -8.330  1.00 0.00 ? 104 MET A CG   8  
ATOM   9909  S  SD   . MET A 1 40 ? -10.800 -9.932  -9.626  1.00 0.00 ? 104 MET A SD   8  
ATOM   9910  C  CE   . MET A 1 40 ? -12.172 -10.949 -10.168 1.00 0.00 ? 104 MET A CE   8  
ATOM   9911  H  H    . MET A 1 40 ? -11.576 -7.173  -5.751  1.00 0.00 ? 104 MET A H    8  
ATOM   9912  H  HA   . MET A 1 40 ? -13.376 -9.421  -6.275  1.00 0.00 ? 104 MET A HA   8  
ATOM   9913  H  HB2  . MET A 1 40 ? -10.380 -9.178  -6.600  1.00 0.00 ? 104 MET A HB2  8  
ATOM   9914  H  HB3  . MET A 1 40 ? -11.327 -10.601 -7.012  1.00 0.00 ? 104 MET A HB3  8  
ATOM   9915  H  HG2  . MET A 1 40 ? -12.654 -8.938  -8.513  1.00 0.00 ? 104 MET A HG2  8  
ATOM   9916  H  HG3  . MET A 1 40 ? -11.201 -7.951  -8.367  1.00 0.00 ? 104 MET A HG3  8  
ATOM   9917  H  HE1  . MET A 1 40 ? -12.122 -11.910 -9.678  1.00 0.00 ? 104 MET A HE1  8  
ATOM   9918  H  HE2  . MET A 1 40 ? -13.102 -10.463 -9.915  1.00 0.00 ? 104 MET A HE2  8  
ATOM   9919  H  HE3  . MET A 1 40 ? -12.116 -11.086 -11.238 1.00 0.00 ? 104 MET A HE3  8  
ATOM   9920  N  N    . LYS A 1 41 ? -11.828 -9.004  -3.563  1.00 0.00 ? 105 LYS A N    8  
ATOM   9921  C  CA   . LYS A 1 41 ? -11.547 -9.535  -2.235  1.00 0.00 ? 105 LYS A CA   8  
ATOM   9922  C  C    . LYS A 1 41 ? -10.594 -10.723 -2.314  1.00 0.00 ? 105 LYS A C    8  
ATOM   9923  O  O    . LYS A 1 41 ? -10.832 -11.765 -1.701  1.00 0.00 ? 105 LYS A O    8  
ATOM   9924  C  CB   . LYS A 1 41 ? -12.847 -9.955  -1.545  1.00 0.00 ? 105 LYS A CB   8  
ATOM   9925  C  CG   . LYS A 1 41 ? -13.660 -8.786  -1.016  1.00 0.00 ? 105 LYS A CG   8  
ATOM   9926  C  CD   . LYS A 1 41 ? -14.951 -9.255  -0.364  1.00 0.00 ? 105 LYS A CD   8  
ATOM   9927  C  CE   . LYS A 1 41 ? -14.680 -10.008 0.929   1.00 0.00 ? 105 LYS A CE   8  
ATOM   9928  N  NZ   . LYS A 1 41 ? -15.927 -10.581 1.508   1.00 0.00 ? 105 LYS A NZ   8  
ATOM   9929  H  H    . LYS A 1 41 ? -11.793 -8.035  -3.708  1.00 0.00 ? 105 LYS A H    8  
ATOM   9930  H  HA   . LYS A 1 41 ? -11.080 -8.752  -1.657  1.00 0.00 ? 105 LYS A HA   8  
ATOM   9931  H  HB2  . LYS A 1 41 ? -13.456 -10.500 -2.252  1.00 0.00 ? 105 LYS A HB2  8  
ATOM   9932  H  HB3  . LYS A 1 41 ? -12.607 -10.604 -0.715  1.00 0.00 ? 105 LYS A HB3  8  
ATOM   9933  H  HG2  . LYS A 1 41 ? -13.073 -8.253  -0.284  1.00 0.00 ? 105 LYS A HG2  8  
ATOM   9934  H  HG3  . LYS A 1 41 ? -13.901 -8.126  -1.837  1.00 0.00 ? 105 LYS A HG3  8  
ATOM   9935  H  HD2  . LYS A 1 41 ? -15.566 -8.395  -0.145  1.00 0.00 ? 105 LYS A HD2  8  
ATOM   9936  H  HD3  . LYS A 1 41 ? -15.473 -9.908  -1.049  1.00 0.00 ? 105 LYS A HD3  8  
ATOM   9937  H  HE2  . LYS A 1 41 ? -13.987 -10.809 0.726   1.00 0.00 ? 105 LYS A HE2  8  
ATOM   9938  H  HE3  . LYS A 1 41 ? -14.242 -9.326  1.643   1.00 0.00 ? 105 LYS A HE3  8  
ATOM   9939  H  HZ1  . LYS A 1 41 ? -15.704 -11.137 2.358   1.00 0.00 ? 105 LYS A HZ1  8  
ATOM   9940  H  HZ2  . LYS A 1 41 ? -16.392 -11.199 0.813   1.00 0.00 ? 105 LYS A HZ2  8  
ATOM   9941  H  HZ3  . LYS A 1 41 ? -16.583 -9.817  1.770   1.00 0.00 ? 105 LYS A HZ3  8  
ATOM   9942  N  N    . LEU A 1 42 ? -9.514  -10.560 -3.070  1.00 0.00 ? 106 LEU A N    8  
ATOM   9943  C  CA   . LEU A 1 42 ? -8.524  -11.619 -3.228  1.00 0.00 ? 106 LEU A CA   8  
ATOM   9944  C  C    . LEU A 1 42 ? -7.526  -11.608 -2.074  1.00 0.00 ? 106 LEU A C    8  
ATOM   9945  O  O    . LEU A 1 42 ? -6.953  -10.570 -1.747  1.00 0.00 ? 106 LEU A O    8  
ATOM   9946  C  CB   . LEU A 1 42 ? -7.785  -11.459 -4.558  1.00 0.00 ? 106 LEU A CB   8  
ATOM   9947  C  CG   . LEU A 1 42 ? -8.662  -11.372 -5.807  1.00 0.00 ? 106 LEU A CG   8  
ATOM   9948  C  CD1  . LEU A 1 42 ? -7.863  -10.835 -6.984  1.00 0.00 ? 106 LEU A CD1  8  
ATOM   9949  C  CD2  . LEU A 1 42 ? -9.254  -12.734 -6.139  1.00 0.00 ? 106 LEU A CD2  8  
ATOM   9950  H  H    . LEU A 1 42 ? -9.379  -9.708  -3.534  1.00 0.00 ? 106 LEU A H    8  
ATOM   9951  H  HA   . LEU A 1 42 ? -9.046  -12.564 -3.227  1.00 0.00 ? 106 LEU A HA   8  
ATOM   9952  H  HB2  . LEU A 1 42 ? -7.197  -10.556 -4.503  1.00 0.00 ? 106 LEU A HB2  8  
ATOM   9953  H  HB3  . LEU A 1 42 ? -7.126  -12.308 -4.673  1.00 0.00 ? 106 LEU A HB3  8  
ATOM   9954  H  HG   . LEU A 1 42 ? -9.478  -10.689 -5.619  1.00 0.00 ? 106 LEU A HG   8  
ATOM   9955  H  HD11 . LEU A 1 42 ? -7.589  -9.808  -6.795  1.00 0.00 ? 106 LEU A HD11 8  
ATOM   9956  H  HD12 . LEU A 1 42 ? -8.462  -10.888 -7.881  1.00 0.00 ? 106 LEU A HD12 8  
ATOM   9957  H  HD13 . LEU A 1 42 ? -6.969  -11.428 -7.113  1.00 0.00 ? 106 LEU A HD13 8  
ATOM   9958  H  HD21 . LEU A 1 42 ? -8.964  -13.447 -5.381  1.00 0.00 ? 106 LEU A HD21 8  
ATOM   9959  H  HD22 . LEU A 1 42 ? -8.886  -13.061 -7.101  1.00 0.00 ? 106 LEU A HD22 8  
ATOM   9960  H  HD23 . LEU A 1 42 ? -10.331 -12.660 -6.172  1.00 0.00 ? 106 LEU A HD23 8  
ATOM   9961  N  N    . GLU A 1 43 ? -7.323  -12.771 -1.463  1.00 0.00 ? 107 GLU A N    8  
ATOM   9962  C  CA   . GLU A 1 43 ? -6.393  -12.895 -0.347  1.00 0.00 ? 107 GLU A CA   8  
ATOM   9963  C  C    . GLU A 1 43 ? -5.210  -13.783 -0.720  1.00 0.00 ? 107 GLU A C    8  
ATOM   9964  O  O    . GLU A 1 43 ? -5.262  -14.526 -1.700  1.00 0.00 ? 107 GLU A O    8  
ATOM   9965  C  CB   . GLU A 1 43 ? -7.107  -13.466 0.880   1.00 0.00 ? 107 GLU A CB   8  
ATOM   9966  C  CG   . GLU A 1 43 ? -7.595  -14.893 0.691   1.00 0.00 ? 107 GLU A CG   8  
ATOM   9967  C  CD   . GLU A 1 43 ? -8.766  -15.234 1.592   1.00 0.00 ? 107 GLU A CD   8  
ATOM   9968  O  OE1  . GLU A 1 43 ? -8.597  -15.181 2.828   1.00 0.00 ? 107 GLU A OE1  8  
ATOM   9969  O  OE2  . GLU A 1 43 ? -9.850  -15.554 1.061   1.00 0.00 ? 107 GLU A OE2  8  
ATOM   9970  H  H    . GLU A 1 43 ? -7.810  -13.564 -1.770  1.00 0.00 ? 107 GLU A H    8  
ATOM   9971  H  HA   . GLU A 1 43 ? -6.026  -11.907 -0.110  1.00 0.00 ? 107 GLU A HA   8  
ATOM   9972  H  HB2  . GLU A 1 43 ? -6.427  -13.448 1.719   1.00 0.00 ? 107 GLU A HB2  8  
ATOM   9973  H  HB3  . GLU A 1 43 ? -7.961  -12.844 1.107   1.00 0.00 ? 107 GLU A HB3  8  
ATOM   9974  H  HG2  . GLU A 1 43 ? -7.902  -15.022 -0.337  1.00 0.00 ? 107 GLU A HG2  8  
ATOM   9975  H  HG3  . GLU A 1 43 ? -6.782  -15.570 0.910   1.00 0.00 ? 107 GLU A HG3  8  
ATOM   9976  N  N    . TYR A 1 44 ? -4.144  -13.700 0.069   1.00 0.00 ? 108 TYR A N    8  
ATOM   9977  C  CA   . TYR A 1 44 ? -2.946  -14.494 -0.179  1.00 0.00 ? 108 TYR A CA   8  
ATOM   9978  C  C    . TYR A 1 44 ? -2.246  -14.847 1.129   1.00 0.00 ? 108 TYR A C    8  
ATOM   9979  O  O    . TYR A 1 44 ? -2.565  -14.298 2.184   1.00 0.00 ? 108 TYR A O    8  
ATOM   9980  C  CB   . TYR A 1 44 ? -1.986  -13.733 -1.095  1.00 0.00 ? 108 TYR A CB   8  
ATOM   9981  C  CG   . TYR A 1 44 ? -2.653  -13.145 -2.318  1.00 0.00 ? 108 TYR A CG   8  
ATOM   9982  C  CD1  . TYR A 1 44 ? -3.020  -13.952 -3.388  1.00 0.00 ? 108 TYR A CD1  8  
ATOM   9983  C  CD2  . TYR A 1 44 ? -2.917  -11.784 -2.403  1.00 0.00 ? 108 TYR A CD2  8  
ATOM   9984  C  CE1  . TYR A 1 44 ? -3.629  -13.419 -4.508  1.00 0.00 ? 108 TYR A CE1  8  
ATOM   9985  C  CE2  . TYR A 1 44 ? -3.527  -11.243 -3.518  1.00 0.00 ? 108 TYR A CE2  8  
ATOM   9986  C  CZ   . TYR A 1 44 ? -3.880  -12.064 -4.568  1.00 0.00 ? 108 TYR A CZ   8  
ATOM   9987  O  OH   . TYR A 1 44 ? -4.488  -11.530 -5.681  1.00 0.00 ? 108 TYR A OH   8  
ATOM   9988  H  H    . TYR A 1 44 ? -4.162  -13.090 0.835   1.00 0.00 ? 108 TYR A H    8  
ATOM   9989  H  HA   . TYR A 1 44 ? -3.249  -15.407 -0.671  1.00 0.00 ? 108 TYR A HA   8  
ATOM   9990  H  HB2  . TYR A 1 44 ? -1.537  -12.922 -0.541  1.00 0.00 ? 108 TYR A HB2  8  
ATOM   9991  H  HB3  . TYR A 1 44 ? -1.210  -14.406 -1.431  1.00 0.00 ? 108 TYR A HB3  8  
ATOM   9992  H  HD1  . TYR A 1 44 ? -2.822  -15.013 -3.338  1.00 0.00 ? 108 TYR A HD1  8  
ATOM   9993  H  HD2  . TYR A 1 44 ? -2.638  -11.143 -1.579  1.00 0.00 ? 108 TYR A HD2  8  
ATOM   9994  H  HE1  . TYR A 1 44 ? -3.907  -14.062 -5.330  1.00 0.00 ? 108 TYR A HE1  8  
ATOM   9995  H  HE2  . TYR A 1 44 ? -3.723  -10.182 -3.566  1.00 0.00 ? 108 TYR A HE2  8  
ATOM   9996  H  HH   . TYR A 1 44 ? -4.083  -11.893 -6.472  1.00 0.00 ? 108 TYR A HH   8  
ATOM   9997  N  N    . GLU A 1 45 ? -1.290  -15.768 1.052   1.00 0.00 ? 109 GLU A N    8  
ATOM   9998  C  CA   . GLU A 1 45 ? -0.545  -16.195 2.229   1.00 0.00 ? 109 GLU A CA   8  
ATOM   9999  C  C    . GLU A 1 45 ? 0.537   -15.180 2.586   1.00 0.00 ? 109 GLU A C    8  
ATOM   10000 O  O    . GLU A 1 45 ? 1.145   -14.568 1.708   1.00 0.00 ? 109 GLU A O    8  
ATOM   10001 C  CB   . GLU A 1 45 ? 0.087   -17.568 1.990   1.00 0.00 ? 109 GLU A CB   8  
ATOM   10002 C  CG   . GLU A 1 45 ? -0.883  -18.724 2.168   1.00 0.00 ? 109 GLU A CG   8  
ATOM   10003 C  CD   . GLU A 1 45 ? -0.186  -20.018 2.543   1.00 0.00 ? 109 GLU A CD   8  
ATOM   10004 O  OE1  . GLU A 1 45 ? 0.321   -20.705 1.633   1.00 0.00 ? 109 GLU A OE1  8  
ATOM   10005 O  OE2  . GLU A 1 45 ? -0.149  -20.342 3.749   1.00 0.00 ? 109 GLU A OE2  8  
ATOM   10006 H  H    . GLU A 1 45 ? -1.082  -16.169 0.182   1.00 0.00 ? 109 GLU A H    8  
ATOM   10007 H  HA   . GLU A 1 45 ? -1.239  -16.268 3.053   1.00 0.00 ? 109 GLU A HA   8  
ATOM   10008 H  HB2  . GLU A 1 45 ? 0.475   -17.602 0.983   1.00 0.00 ? 109 GLU A HB2  8  
ATOM   10009 H  HB3  . GLU A 1 45 ? 0.903   -17.701 2.685   1.00 0.00 ? 109 GLU A HB3  8  
ATOM   10010 H  HG2  . GLU A 1 45 ? -1.585  -18.472 2.948   1.00 0.00 ? 109 GLU A HG2  8  
ATOM   10011 H  HG3  . GLU A 1 45 ? -1.416  -18.876 1.241   1.00 0.00 ? 109 GLU A HG3  8  
ATOM   10012 N  N    . LYS A 1 46 ? 0.773   -15.007 3.883   1.00 0.00 ? 110 LYS A N    8  
ATOM   10013 C  CA   . LYS A 1 46 ? 1.782   -14.067 4.358   1.00 0.00 ? 110 LYS A CA   8  
ATOM   10014 C  C    . LYS A 1 46 ? 3.144   -14.375 3.745   1.00 0.00 ? 110 LYS A C    8  
ATOM   10015 O  O    . LYS A 1 46 ? 3.768   -15.386 4.069   1.00 0.00 ? 110 LYS A O    8  
ATOM   10016 C  CB   . LYS A 1 46 ? 1.875   -14.117 5.885   1.00 0.00 ? 110 LYS A CB   8  
ATOM   10017 C  CG   . LYS A 1 46 ? 2.784   -13.053 6.474   1.00 0.00 ? 110 LYS A CG   8  
ATOM   10018 C  CD   . LYS A 1 46 ? 2.620   -12.951 7.981   1.00 0.00 ? 110 LYS A CD   8  
ATOM   10019 C  CE   . LYS A 1 46 ? 3.181   -11.642 8.516   1.00 0.00 ? 110 LYS A CE   8  
ATOM   10020 N  NZ   . LYS A 1 46 ? 2.251   -10.503 8.281   1.00 0.00 ? 110 LYS A NZ   8  
ATOM   10021 H  H    . LYS A 1 46 ? 0.256   -15.524 4.536   1.00 0.00 ? 110 LYS A H    8  
ATOM   10022 H  HA   . LYS A 1 46 ? 1.480   -13.076 4.057   1.00 0.00 ? 110 LYS A HA   8  
ATOM   10023 H  HB2  . LYS A 1 46 ? 0.886   -13.986 6.299   1.00 0.00 ? 110 LYS A HB2  8  
ATOM   10024 H  HB3  . LYS A 1 46 ? 2.252   -15.086 6.179   1.00 0.00 ? 110 LYS A HB3  8  
ATOM   10025 H  HG2  . LYS A 1 46 ? 3.810   -13.305 6.250   1.00 0.00 ? 110 LYS A HG2  8  
ATOM   10026 H  HG3  . LYS A 1 46 ? 2.541   -12.098 6.029   1.00 0.00 ? 110 LYS A HG3  8  
ATOM   10027 H  HD2  . LYS A 1 46 ? 1.570   -13.006 8.225   1.00 0.00 ? 110 LYS A HD2  8  
ATOM   10028 H  HD3  . LYS A 1 46 ? 3.143   -13.774 8.448   1.00 0.00 ? 110 LYS A HD3  8  
ATOM   10029 H  HE2  . LYS A 1 46 ? 3.350   -11.745 9.576   1.00 0.00 ? 110 LYS A HE2  8  
ATOM   10030 H  HE3  . LYS A 1 46 ? 4.118   -11.438 8.019   1.00 0.00 ? 110 LYS A HE3  8  
ATOM   10031 H  HZ1  . LYS A 1 46 ? 1.270   -10.846 8.239   1.00 0.00 ? 110 LYS A HZ1  8  
ATOM   10032 H  HZ2  . LYS A 1 46 ? 2.481   -10.033 7.383   1.00 0.00 ? 110 LYS A HZ2  8  
ATOM   10033 H  HZ3  . LYS A 1 46 ? 2.332   -9.811  9.053   1.00 0.00 ? 110 LYS A HZ3  8  
ATOM   10034 N  N    . CYS A 1 47 ? 3.601   -13.497 2.859   1.00 0.00 ? 111 CYS A N    8  
ATOM   10035 C  CA   . CYS A 1 47 ? 4.890   -13.673 2.201   1.00 0.00 ? 111 CYS A CA   8  
ATOM   10036 C  C    . CYS A 1 47 ? 6.009   -13.033 3.016   1.00 0.00 ? 111 CYS A C    8  
ATOM   10037 O  O    . CYS A 1 47 ? 6.374   -11.880 2.789   1.00 0.00 ? 111 CYS A O    8  
ATOM   10038 C  CB   . CYS A 1 47 ? 4.856   -13.067 0.796   1.00 0.00 ? 111 CYS A CB   8  
ATOM   10039 S  SG   . CYS A 1 47 ? 6.333   -13.431 -0.206  1.00 0.00 ? 111 CYS A SG   8  
ATOM   10040 H  H    . CYS A 1 47 ? 3.057   -12.709 2.641   1.00 0.00 ? 111 CYS A H    8  
ATOM   10041 H  HA   . CYS A 1 47 ? 5.080   -14.733 2.122   1.00 0.00 ? 111 CYS A HA   8  
ATOM   10042 H  HB2  . CYS A 1 47 ? 3.997   -13.453 0.267   1.00 0.00 ? 111 CYS A HB2  8  
ATOM   10043 H  HB3  . CYS A 1 47 ? 4.770   -11.994 0.878   1.00 0.00 ? 111 CYS A HB3  8  
ATOM   10044 N  N    . GLU A 1 48 ? 6.549   -13.790 3.966   1.00 0.00 ? 112 GLU A N    8  
ATOM   10045 C  CA   . GLU A 1 48 ? 7.626   -13.295 4.816   1.00 0.00 ? 112 GLU A CA   8  
ATOM   10046 C  C    . GLU A 1 48 ? 8.734   -12.664 3.977   1.00 0.00 ? 112 GLU A C    8  
ATOM   10047 O  O    . GLU A 1 48 ? 9.274   -11.616 4.331   1.00 0.00 ? 112 GLU A O    8  
ATOM   10048 C  CB   . GLU A 1 48 ? 8.199   -14.432 5.665   1.00 0.00 ? 112 GLU A CB   8  
ATOM   10049 C  CG   . GLU A 1 48 ? 7.308   -14.830 6.830   1.00 0.00 ? 112 GLU A CG   8  
ATOM   10050 C  CD   . GLU A 1 48 ? 7.851   -16.018 7.600   1.00 0.00 ? 112 GLU A CD   8  
ATOM   10051 O  OE1  . GLU A 1 48 ? 8.086   -17.073 6.977   1.00 0.00 ? 112 GLU A OE1  8  
ATOM   10052 O  OE2  . GLU A 1 48 ? 8.041   -15.890 8.828   1.00 0.00 ? 112 GLU A OE2  8  
ATOM   10053 H  H    . GLU A 1 48 ? 6.215   -14.701 4.099   1.00 0.00 ? 112 GLU A H    8  
ATOM   10054 H  HA   . GLU A 1 48 ? 7.214   -12.542 5.470   1.00 0.00 ? 112 GLU A HA   8  
ATOM   10055 H  HB2  . GLU A 1 48 ? 8.343   -15.298 5.036   1.00 0.00 ? 112 GLU A HB2  8  
ATOM   10056 H  HB3  . GLU A 1 48 ? 9.155   -14.123 6.060   1.00 0.00 ? 112 GLU A HB3  8  
ATOM   10057 H  HG2  . GLU A 1 48 ? 7.223   -13.991 7.504   1.00 0.00 ? 112 GLU A HG2  8  
ATOM   10058 H  HG3  . GLU A 1 48 ? 6.330   -15.084 6.448   1.00 0.00 ? 112 GLU A HG3  8  
ATOM   10059 N  N    . ARG A 1 49 ? 9.068   -13.311 2.866   1.00 0.00 ? 113 ARG A N    8  
ATOM   10060 C  CA   . ARG A 1 49 ? 10.113  -12.815 1.978   1.00 0.00 ? 113 ARG A CA   8  
ATOM   10061 C  C    . ARG A 1 49 ? 10.046  -11.296 1.856   1.00 0.00 ? 113 ARG A C    8  
ATOM   10062 O  O    . ARG A 1 49 ? 11.062  -10.636 1.637   1.00 0.00 ? 113 ARG A O    8  
ATOM   10063 C  CB   . ARG A 1 49 ? 9.981   -13.454 0.594   1.00 0.00 ? 113 ARG A CB   8  
ATOM   10064 C  CG   . ARG A 1 49 ? 10.163  -14.963 0.600   1.00 0.00 ? 113 ARG A CG   8  
ATOM   10065 C  CD   . ARG A 1 49 ? 10.574  -15.481 -0.769  1.00 0.00 ? 113 ARG A CD   8  
ATOM   10066 N  NE   . ARG A 1 49 ? 9.491   -15.370 -1.743  1.00 0.00 ? 113 ARG A NE   8  
ATOM   10067 C  CZ   . ARG A 1 49 ? 9.491   -15.993 -2.917  1.00 0.00 ? 113 ARG A CZ   8  
ATOM   10068 N  NH1  . ARG A 1 49 ? 10.512  -16.767 -3.260  1.00 0.00 ? 113 ARG A NH1  8  
ATOM   10069 N  NH2  . ARG A 1 49 ? 8.469   -15.842 -3.749  1.00 0.00 ? 113 ARG A NH2  8  
ATOM   10070 H  H    . ARG A 1 49 ? 8.602   -14.142 2.637   1.00 0.00 ? 113 ARG A H    8  
ATOM   10071 H  HA   . ARG A 1 49 ? 11.067  -13.089 2.402   1.00 0.00 ? 113 ARG A HA   8  
ATOM   10072 H  HB2  . ARG A 1 49 ? 9.000   -13.234 0.200   1.00 0.00 ? 113 ARG A HB2  8  
ATOM   10073 H  HB3  . ARG A 1 49 ? 10.727  -13.027 -0.059  1.00 0.00 ? 113 ARG A HB3  8  
ATOM   10074 H  HG2  . ARG A 1 49 ? 10.931  -15.221 1.315   1.00 0.00 ? 113 ARG A HG2  8  
ATOM   10075 H  HG3  . ARG A 1 49 ? 9.231   -15.428 0.887   1.00 0.00 ? 113 ARG A HG3  8  
ATOM   10076 H  HD2  . ARG A 1 49 ? 11.419  -14.907 -1.118  1.00 0.00 ? 113 ARG A HD2  8  
ATOM   10077 H  HD3  . ARG A 1 49 ? 10.857  -16.519 -0.677  1.00 0.00 ? 113 ARG A HD3  8  
ATOM   10078 H  HE   . ARG A 1 49 ? 8.727   -14.803 -1.510  1.00 0.00 ? 113 ARG A HE   8  
ATOM   10079 H  HH11 . ARG A 1 49 ? 11.282  -16.883 -2.634  1.00 0.00 ? 113 ARG A HH11 8  
ATOM   10080 H  HH12 . ARG A 1 49 ? 10.509  -17.236 -4.143  1.00 0.00 ? 113 ARG A HH12 8  
ATOM   10081 H  HH21 . ARG A 1 49 ? 7.699   -15.259 -3.494  1.00 0.00 ? 113 ARG A HH21 8  
ATOM   10082 H  HH22 . ARG A 1 49 ? 8.471   -16.311 -4.632  1.00 0.00 ? 113 ARG A HH22 8  
ATOM   10083 N  N    . SER A 1 50 ? 8.844   -10.747 1.999   1.00 0.00 ? 114 SER A N    8  
ATOM   10084 C  CA   . SER A 1 50 ? 8.644   -9.306  1.901   1.00 0.00 ? 114 SER A CA   8  
ATOM   10085 C  C    . SER A 1 50 ? 9.246   -8.761  0.609   1.00 0.00 ? 114 SER A C    8  
ATOM   10086 O  O    . SER A 1 50 ? 9.927   -7.735  0.612   1.00 0.00 ? 114 SER A O    8  
ATOM   10087 C  CB   . SER A 1 50 ? 9.270   -8.600  3.106   1.00 0.00 ? 114 SER A CB   8  
ATOM   10088 O  OG   . SER A 1 50 ? 8.337   -8.477  4.165   1.00 0.00 ? 114 SER A OG   8  
ATOM   10089 H  H    . SER A 1 50 ? 8.073   -11.327 2.173   1.00 0.00 ? 114 SER A H    8  
ATOM   10090 H  HA   . SER A 1 50 ? 7.581   -9.118  1.896   1.00 0.00 ? 114 SER A HA   8  
ATOM   10091 H  HB2  . SER A 1 50 ? 10.118  -9.170  3.453   1.00 0.00 ? 114 SER A HB2  8  
ATOM   10092 H  HB3  . SER A 1 50 ? 9.595   -7.613  2.812   1.00 0.00 ? 114 SER A HB3  8  
ATOM   10093 H  HG   . SER A 1 50 ? 8.680   -8.917  4.947   1.00 0.00 ? 114 SER A HG   8  
ATOM   10094 N  N    . CYS A 1 51 ? 8.990   -9.456  -0.494  1.00 0.00 ? 115 CYS A N    8  
ATOM   10095 C  CA   . CYS A 1 51 ? 9.505   -9.044  -1.794  1.00 0.00 ? 115 CYS A CA   8  
ATOM   10096 C  C    . CYS A 1 51 ? 9.522   -7.523  -1.916  1.00 0.00 ? 115 CYS A C    8  
ATOM   10097 O  O    . CYS A 1 51 ? 8.554   -6.850  -1.561  1.00 0.00 ? 115 CYS A O    8  
ATOM   10098 C  CB   . CYS A 1 51 ? 8.658   -9.647  -2.917  1.00 0.00 ? 115 CYS A CB   8  
ATOM   10099 S  SG   . CYS A 1 51 ? 8.238   -11.402 -2.670  1.00 0.00 ? 115 CYS A SG   8  
ATOM   10100 H  H    . CYS A 1 51 ? 8.441   -10.266 -0.433  1.00 0.00 ? 115 CYS A H    8  
ATOM   10101 H  HA   . CYS A 1 51 ? 10.516  -9.411  -1.882  1.00 0.00 ? 115 CYS A HA   8  
ATOM   10102 H  HB2  . CYS A 1 51 ? 7.732   -9.096  -2.994  1.00 0.00 ? 115 CYS A HB2  8  
ATOM   10103 H  HB3  . CYS A 1 51 ? 9.198   -9.566  -3.848  1.00 0.00 ? 115 CYS A HB3  8  
ATOM   10104 N  N    . LYS A 1 52 ? 10.628  -6.987  -2.421  1.00 0.00 ? 116 LYS A N    8  
ATOM   10105 C  CA   . LYS A 1 52 ? 10.772  -5.546  -2.592  1.00 0.00 ? 116 LYS A CA   8  
ATOM   10106 C  C    . LYS A 1 52 ? 10.148  -5.090  -3.907  1.00 0.00 ? 116 LYS A C    8  
ATOM   10107 O  O    . LYS A 1 52 ? 10.722  -5.287  -4.978  1.00 0.00 ? 116 LYS A O    8  
ATOM   10108 C  CB   . LYS A 1 52 ? 12.250  -5.153  -2.552  1.00 0.00 ? 116 LYS A CB   8  
ATOM   10109 C  CG   . LYS A 1 52 ? 12.483  -3.705  -2.156  1.00 0.00 ? 116 LYS A CG   8  
ATOM   10110 C  CD   . LYS A 1 52 ? 12.176  -2.756  -3.302  1.00 0.00 ? 116 LYS A CD   8  
ATOM   10111 C  CE   . LYS A 1 52 ? 12.254  -1.303  -2.860  1.00 0.00 ? 116 LYS A CE   8  
ATOM   10112 N  NZ   . LYS A 1 52 ? 13.647  -0.781  -2.913  1.00 0.00 ? 116 LYS A NZ   8  
ATOM   10113 H  H    . LYS A 1 52 ? 11.366  -7.576  -2.686  1.00 0.00 ? 116 LYS A H    8  
ATOM   10114 H  HA   . LYS A 1 52 ? 10.257  -5.062  -1.776  1.00 0.00 ? 116 LYS A HA   8  
ATOM   10115 H  HB2  . LYS A 1 52 ? 12.760  -5.786  -1.841  1.00 0.00 ? 116 LYS A HB2  8  
ATOM   10116 H  HB3  . LYS A 1 52 ? 12.678  -5.309  -3.532  1.00 0.00 ? 116 LYS A HB3  8  
ATOM   10117 H  HG2  . LYS A 1 52 ? 11.844  -3.462  -1.321  1.00 0.00 ? 116 LYS A HG2  8  
ATOM   10118 H  HG3  . LYS A 1 52 ? 13.518  -3.583  -1.867  1.00 0.00 ? 116 LYS A HG3  8  
ATOM   10119 H  HD2  . LYS A 1 52 ? 12.892  -2.918  -4.094  1.00 0.00 ? 116 LYS A HD2  8  
ATOM   10120 H  HD3  . LYS A 1 52 ? 11.179  -2.959  -3.669  1.00 0.00 ? 116 LYS A HD3  8  
ATOM   10121 H  HE2  . LYS A 1 52 ? 11.631  -0.709  -3.510  1.00 0.00 ? 116 LYS A HE2  8  
ATOM   10122 H  HE3  . LYS A 1 52 ? 11.889  -1.230  -1.846  1.00 0.00 ? 116 LYS A HE3  8  
ATOM   10123 H  HZ1  . LYS A 1 52 ? 14.235  -1.257  -2.198  1.00 0.00 ? 116 LYS A HZ1  8  
ATOM   10124 H  HZ2  . LYS A 1 52 ? 13.652  0.242   -2.725  1.00 0.00 ? 116 LYS A HZ2  8  
ATOM   10125 H  HZ3  . LYS A 1 52 ? 14.057  -0.952  -3.853  1.00 0.00 ? 116 LYS A HZ3  8  
ATOM   10126 N  N    . ILE A 1 53 ? 8.972   -4.478  -3.817  1.00 0.00 ? 117 ILE A N    8  
ATOM   10127 C  CA   . ILE A 1 53 ? 8.273   -3.991  -5.000  1.00 0.00 ? 117 ILE A CA   8  
ATOM   10128 C  C    . ILE A 1 53 ? 9.083   -2.913  -5.713  1.00 0.00 ? 117 ILE A C    8  
ATOM   10129 O  O    . ILE A 1 53 ? 9.016   -1.737  -5.358  1.00 0.00 ? 117 ILE A O    8  
ATOM   10130 C  CB   . ILE A 1 53 ? 6.887   -3.422  -4.641  1.00 0.00 ? 117 ILE A CB   8  
ATOM   10131 C  CG1  . ILE A 1 53 ? 6.091   -4.440  -3.822  1.00 0.00 ? 117 ILE A CG1  8  
ATOM   10132 C  CG2  . ILE A 1 53 ? 6.129   -3.039  -5.903  1.00 0.00 ? 117 ILE A CG2  8  
ATOM   10133 C  CD1  . ILE A 1 53 ? 5.686   -5.666  -4.610  1.00 0.00 ? 117 ILE A CD1  8  
ATOM   10134 H  H    . ILE A 1 53 ? 8.565   -4.350  -2.935  1.00 0.00 ? 117 ILE A H    8  
ATOM   10135 H  HA   . ILE A 1 53 ? 8.134   -4.825  -5.672  1.00 0.00 ? 117 ILE A HA   8  
ATOM   10136 H  HB   . ILE A 1 53 ? 7.031   -2.530  -4.051  1.00 0.00 ? 117 ILE A HB   8  
ATOM   10137 H  HG12 . ILE A 1 53 ? 6.689   -4.767  -2.986  1.00 0.00 ? 117 ILE A HG12 8  
ATOM   10138 H  HG13 . ILE A 1 53 ? 5.191   -3.969  -3.454  1.00 0.00 ? 117 ILE A HG13 8  
ATOM   10139 H  HG21 . ILE A 1 53 ? 5.272   -3.688  -6.018  1.00 0.00 ? 117 ILE A HG21 8  
ATOM   10140 H  HG22 . ILE A 1 53 ? 5.796   -2.015  -5.825  1.00 0.00 ? 117 ILE A HG22 8  
ATOM   10141 H  HG23 . ILE A 1 53 ? 6.778   -3.144  -6.759  1.00 0.00 ? 117 ILE A HG23 8  
ATOM   10142 H  HD11 . ILE A 1 53 ? 6.375   -5.810  -5.430  1.00 0.00 ? 117 ILE A HD11 8  
ATOM   10143 H  HD12 . ILE A 1 53 ? 5.710   -6.533  -3.966  1.00 0.00 ? 117 ILE A HD12 8  
ATOM   10144 H  HD13 . ILE A 1 53 ? 4.688   -5.532  -4.999  1.00 0.00 ? 117 ILE A HD13 8  
ATOM   10145 N  N    . GLN A 1 54 ? 9.846   -3.324  -6.720  1.00 0.00 ? 118 GLN A N    8  
ATOM   10146 C  CA   . GLN A 1 54 ? 10.668  -2.392  -7.484  1.00 0.00 ? 118 GLN A CA   8  
ATOM   10147 C  C    . GLN A 1 54 ? 10.034  -2.089  -8.837  1.00 0.00 ? 118 GLN A C    8  
ATOM   10148 O  O    . GLN A 1 54 ? 9.455   -2.969  -9.475  1.00 0.00 ? 118 GLN A O    8  
ATOM   10149 C  CB   . GLN A 1 54 ? 12.073  -2.964  -7.683  1.00 0.00 ? 118 GLN A CB   8  
ATOM   10150 C  CG   . GLN A 1 54 ? 13.061  -1.964  -8.262  1.00 0.00 ? 118 GLN A CG   8  
ATOM   10151 C  CD   . GLN A 1 54 ? 13.090  -0.659  -7.491  1.00 0.00 ? 118 GLN A CD   8  
ATOM   10152 O  OE1  . GLN A 1 54 ? 12.869  -0.636  -6.279  1.00 0.00 ? 118 GLN A OE1  8  
ATOM   10153 N  NE2  . GLN A 1 54 ? 13.363  0.436   -8.190  1.00 0.00 ? 118 GLN A NE2  8  
ATOM   10154 H  H    . GLN A 1 54 ? 9.857   -4.274  -6.956  1.00 0.00 ? 118 GLN A H    8  
ATOM   10155 H  HA   . GLN A 1 54 ? 10.740  -1.475  -6.920  1.00 0.00 ? 118 GLN A HA   8  
ATOM   10156 H  HB2  . GLN A 1 54 ? 12.451  -3.300  -6.729  1.00 0.00 ? 118 GLN A HB2  8  
ATOM   10157 H  HB3  . GLN A 1 54 ? 12.013  -3.808  -8.355  1.00 0.00 ? 118 GLN A HB3  8  
ATOM   10158 H  HG2  . GLN A 1 54 ? 14.049  -2.399  -8.240  1.00 0.00 ? 118 GLN A HG2  8  
ATOM   10159 H  HG3  . GLN A 1 54 ? 12.784  -1.755  -9.285  1.00 0.00 ? 118 GLN A HG3  8  
ATOM   10160 H  HE21 . GLN A 1 54 ? 13.527  0.341   -9.152  1.00 0.00 ? 118 GLN A HE21 8  
ATOM   10161 H  HE22 . GLN A 1 54 ? 13.388  1.293   -7.717  1.00 0.00 ? 118 GLN A HE22 8  
ATOM   10162 N  N    . LYS A 1 55 ? 10.145  -0.838  -9.270  1.00 0.00 ? 119 LYS A N    8  
ATOM   10163 C  CA   . LYS A 1 55 ? 9.583   -0.417  -10.548 1.00 0.00 ? 119 LYS A CA   8  
ATOM   10164 C  C    . LYS A 1 55 ? 9.872   -1.447  -11.635 1.00 0.00 ? 119 LYS A C    8  
ATOM   10165 O  O    . LYS A 1 55 ? 8.972   -1.868  -12.362 1.00 0.00 ? 119 LYS A O    8  
ATOM   10166 C  CB   . LYS A 1 55 ? 10.153  0.944   -10.956 1.00 0.00 ? 119 LYS A CB   8  
ATOM   10167 C  CG   . LYS A 1 55 ? 9.918   2.035   -9.926  1.00 0.00 ? 119 LYS A CG   8  
ATOM   10168 C  CD   . LYS A 1 55 ? 10.756  3.268   -10.218 1.00 0.00 ? 119 LYS A CD   8  
ATOM   10169 C  CE   . LYS A 1 55 ? 12.170  3.121   -9.678  1.00 0.00 ? 119 LYS A CE   8  
ATOM   10170 N  NZ   . LYS A 1 55 ? 13.098  4.123   -10.273 1.00 0.00 ? 119 LYS A NZ   8  
ATOM   10171 H  H    . LYS A 1 55 ? 10.618  -0.181  -8.717  1.00 0.00 ? 119 LYS A H    8  
ATOM   10172 H  HA   . LYS A 1 55 ? 8.514   -0.329  -10.428 1.00 0.00 ? 119 LYS A HA   8  
ATOM   10173 H  HB2  . LYS A 1 55 ? 11.218  0.844   -11.107 1.00 0.00 ? 119 LYS A HB2  8  
ATOM   10174 H  HB3  . LYS A 1 55 ? 9.693   1.249   -11.885 1.00 0.00 ? 119 LYS A HB3  8  
ATOM   10175 H  HG2  . LYS A 1 55 ? 8.874   2.311   -9.939  1.00 0.00 ? 119 LYS A HG2  8  
ATOM   10176 H  HG3  . LYS A 1 55 ? 10.179  1.656   -8.948  1.00 0.00 ? 119 LYS A HG3  8  
ATOM   10177 H  HD2  . LYS A 1 55 ? 10.805  3.415   -11.287 1.00 0.00 ? 119 LYS A HD2  8  
ATOM   10178 H  HD3  . LYS A 1 55 ? 10.291  4.127   -9.756  1.00 0.00 ? 119 LYS A HD3  8  
ATOM   10179 H  HE2  . LYS A 1 55 ? 12.149  3.255   -8.608  1.00 0.00 ? 119 LYS A HE2  8  
ATOM   10180 H  HE3  . LYS A 1 55 ? 12.529  2.129   -9.910  1.00 0.00 ? 119 LYS A HE3  8  
ATOM   10181 H  HZ1  . LYS A 1 55 ? 12.899  4.236   -11.288 1.00 0.00 ? 119 LYS A HZ1  8  
ATOM   10182 H  HZ2  . LYS A 1 55 ? 14.083  3.810   -10.157 1.00 0.00 ? 119 LYS A HZ2  8  
ATOM   10183 H  HZ3  . LYS A 1 55 ? 12.980  5.042   -9.803  1.00 0.00 ? 119 LYS A HZ3  8  
ATOM   10184 N  N    . LYS A 1 56 ? 11.133  -1.852  -11.741 1.00 0.00 ? 120 LYS A N    8  
ATOM   10185 C  CA   . LYS A 1 56 ? 11.541  -2.835  -12.737 1.00 0.00 ? 120 LYS A CA   8  
ATOM   10186 C  C    . LYS A 1 56 ? 10.644  -4.067  -12.684 1.00 0.00 ? 120 LYS A C    8  
ATOM   10187 O  O    . LYS A 1 56 ? 10.149  -4.530  -13.711 1.00 0.00 ? 120 LYS A O    8  
ATOM   10188 C  CB   . LYS A 1 56 ? 13.000  -3.243  -12.514 1.00 0.00 ? 120 LYS A CB   8  
ATOM   10189 C  CG   . LYS A 1 56 ? 13.538  -4.183  -13.578 1.00 0.00 ? 120 LYS A CG   8  
ATOM   10190 C  CD   . LYS A 1 56 ? 15.056  -4.153  -13.632 1.00 0.00 ? 120 LYS A CD   8  
ATOM   10191 C  CE   . LYS A 1 56 ? 15.596  -5.119  -14.676 1.00 0.00 ? 120 LYS A CE   8  
ATOM   10192 N  NZ   . LYS A 1 56 ? 17.043  -5.405  -14.471 1.00 0.00 ? 120 LYS A NZ   8  
ATOM   10193 H  H    . LYS A 1 56 ? 11.807  -1.480  -11.132 1.00 0.00 ? 120 LYS A H    8  
ATOM   10194 H  HA   . LYS A 1 56 ? 11.449  -2.379  -13.711 1.00 0.00 ? 120 LYS A HA   8  
ATOM   10195 H  HB2  . LYS A 1 56 ? 13.612  -2.353  -12.505 1.00 0.00 ? 120 LYS A HB2  8  
ATOM   10196 H  HB3  . LYS A 1 56 ? 13.081  -3.734  -11.555 1.00 0.00 ? 120 LYS A HB3  8  
ATOM   10197 H  HG2  . LYS A 1 56 ? 13.216  -5.189  -13.353 1.00 0.00 ? 120 LYS A HG2  8  
ATOM   10198 H  HG3  . LYS A 1 56 ? 13.147  -3.884  -14.540 1.00 0.00 ? 120 LYS A HG3  8  
ATOM   10199 H  HD2  . LYS A 1 56 ? 15.380  -3.154  -13.881 1.00 0.00 ? 120 LYS A HD2  8  
ATOM   10200 H  HD3  . LYS A 1 56 ? 15.447  -4.429  -12.662 1.00 0.00 ? 120 LYS A HD3  8  
ATOM   10201 H  HE2  . LYS A 1 56 ? 15.043  -6.043  -14.612 1.00 0.00 ? 120 LYS A HE2  8  
ATOM   10202 H  HE3  . LYS A 1 56 ? 15.458  -4.684  -15.654 1.00 0.00 ? 120 LYS A HE3  8  
ATOM   10203 H  HZ1  . LYS A 1 56 ? 17.616  -4.597  -14.788 1.00 0.00 ? 120 LYS A HZ1  8  
ATOM   10204 H  HZ2  . LYS A 1 56 ? 17.321  -6.247  -15.015 1.00 0.00 ? 120 LYS A HZ2  8  
ATOM   10205 H  HZ3  . LYS A 1 56 ? 17.234  -5.578  -13.464 1.00 0.00 ? 120 LYS A HZ3  8  
ATOM   10206 N  N    . ASN A 1 57 ? 10.438  -4.593  -11.481 1.00 0.00 ? 121 ASN A N    8  
ATOM   10207 C  CA   . ASN A 1 57 ? 9.600   -5.771  -11.295 1.00 0.00 ? 121 ASN A CA   8  
ATOM   10208 C  C    . ASN A 1 57 ? 8.585   -5.546  -10.177 1.00 0.00 ? 121 ASN A C    8  
ATOM   10209 O  O    . ASN A 1 57 ? 8.796   -5.968  -9.040  1.00 0.00 ? 121 ASN A O    8  
ATOM   10210 C  CB   . ASN A 1 57 ? 10.464  -6.993  -10.976 1.00 0.00 ? 121 ASN A CB   8  
ATOM   10211 C  CG   . ASN A 1 57 ? 11.642  -7.130  -11.921 1.00 0.00 ? 121 ASN A CG   8  
ATOM   10212 O  OD1  . ASN A 1 57 ? 12.771  -6.777  -11.579 1.00 0.00 ? 121 ASN A OD1  8  
ATOM   10213 N  ND2  . ASN A 1 57 ? 11.384  -7.645  -13.117 1.00 0.00 ? 121 ASN A ND2  8  
ATOM   10214 H  H    . ASN A 1 57 ? 10.861  -4.179  -10.699 1.00 0.00 ? 121 ASN A H    8  
ATOM   10215 H  HA   . ASN A 1 57 ? 9.068   -5.948  -12.217 1.00 0.00 ? 121 ASN A HA   8  
ATOM   10216 H  HB2  . ASN A 1 57 ? 10.844  -6.904  -9.968  1.00 0.00 ? 121 ASN A HB2  8  
ATOM   10217 H  HB3  . ASN A 1 57 ? 9.859   -7.884  -11.051 1.00 0.00 ? 121 ASN A HB3  8  
ATOM   10218 H  HD21 . ASN A 1 57 ? 10.461  -7.904  -13.321 1.00 0.00 ? 121 ASN A HD21 8  
ATOM   10219 H  HD22 . ASN A 1 57 ? 12.127  -7.746  -13.748 1.00 0.00 ? 121 ASN A HD22 8  
ATOM   10220 N  N    . ARG A 1 58 ? 7.485   -4.880  -10.510 1.00 0.00 ? 122 ARG A N    8  
ATOM   10221 C  CA   . ARG A 1 58 ? 6.438   -4.598  -9.535  1.00 0.00 ? 122 ARG A CA   8  
ATOM   10222 C  C    . ARG A 1 58 ? 5.428   -5.740  -9.476  1.00 0.00 ? 122 ARG A C    8  
ATOM   10223 O  O    . ARG A 1 58 ? 4.854   -6.021  -8.425  1.00 0.00 ? 122 ARG A O    8  
ATOM   10224 C  CB   . ARG A 1 58 ? 5.726   -3.290  -9.883  1.00 0.00 ? 122 ARG A CB   8  
ATOM   10225 C  CG   . ARG A 1 58 ? 5.002   -3.327  -11.219 1.00 0.00 ? 122 ARG A CG   8  
ATOM   10226 C  CD   . ARG A 1 58 ? 4.953   -1.951  -11.864 1.00 0.00 ? 122 ARG A CD   8  
ATOM   10227 N  NE   . ARG A 1 58 ? 3.995   -1.898  -12.966 1.00 0.00 ? 122 ARG A NE   8  
ATOM   10228 C  CZ   . ARG A 1 58 ? 4.026   -0.977  -13.922 1.00 0.00 ? 122 ARG A CZ   8  
ATOM   10229 N  NH1  . ARG A 1 58 ? 4.962   -0.038  -13.913 1.00 0.00 ? 122 ARG A NH1  8  
ATOM   10230 N  NH2  . ARG A 1 58 ? 3.120   -0.994  -14.892 1.00 0.00 ? 122 ARG A NH2  8  
ATOM   10231 H  H    . ARG A 1 58 ? 7.374   -4.569  -11.433 1.00 0.00 ? 122 ARG A H    8  
ATOM   10232 H  HA   . ARG A 1 58 ? 6.905   -4.497  -8.566  1.00 0.00 ? 122 ARG A HA   8  
ATOM   10233 H  HB2  . ARG A 1 58 ? 5.001   -3.071  -9.112  1.00 0.00 ? 122 ARG A HB2  8  
ATOM   10234 H  HB3  . ARG A 1 58 ? 6.455   -2.494  -9.915  1.00 0.00 ? 122 ARG A HB3  8  
ATOM   10235 H  HG2  . ARG A 1 58 ? 5.522   -4.004  -11.880 1.00 0.00 ? 122 ARG A HG2  8  
ATOM   10236 H  HG3  . ARG A 1 58 ? 3.993   -3.678  -11.061 1.00 0.00 ? 122 ARG A HG3  8  
ATOM   10237 H  HD2  . ARG A 1 58 ? 4.667   -1.227  -11.116 1.00 0.00 ? 122 ARG A HD2  8  
ATOM   10238 H  HD3  . ARG A 1 58 ? 5.935   -1.710  -12.242 1.00 0.00 ? 122 ARG A HD3  8  
ATOM   10239 H  HE   . ARG A 1 58 ? 3.295   -2.582  -12.992 1.00 0.00 ? 122 ARG A HE   8  
ATOM   10240 H  HH11 . ARG A 1 58 ? 5.647   -0.023  -13.185 1.00 0.00 ? 122 ARG A HH11 8  
ATOM   10241 H  HH12 . ARG A 1 58 ? 4.984   0.654   -14.636 1.00 0.00 ? 122 ARG A HH12 8  
ATOM   10242 H  HH21 . ARG A 1 58 ? 2.413   -1.700  -14.902 1.00 0.00 ? 122 ARG A HH21 8  
ATOM   10243 H  HH22 . ARG A 1 58 ? 3.144   -0.300  -15.611 1.00 0.00 ? 122 ARG A HH22 8  
ATOM   10244 N  N    . ASN A 1 59 ? 5.215   -6.394  -10.614 1.00 0.00 ? 123 ASN A N    8  
ATOM   10245 C  CA   . ASN A 1 59 ? 4.274   -7.504  -10.693 1.00 0.00 ? 123 ASN A CA   8  
ATOM   10246 C  C    . ASN A 1 59 ? 4.963   -8.826  -10.369 1.00 0.00 ? 123 ASN A C    8  
ATOM   10247 O  O    . ASN A 1 59 ? 4.760   -9.829  -11.055 1.00 0.00 ? 123 ASN A O    8  
ATOM   10248 C  CB   . ASN A 1 59 ? 3.647   -7.571  -12.087 1.00 0.00 ? 123 ASN A CB   8  
ATOM   10249 C  CG   . ASN A 1 59 ? 4.688   -7.644  -13.186 1.00 0.00 ? 123 ASN A CG   8  
ATOM   10250 O  OD1  . ASN A 1 59 ? 5.881   -7.462  -12.940 1.00 0.00 ? 123 ASN A OD1  8  
ATOM   10251 N  ND2  . ASN A 1 59 ? 4.241   -7.912  -14.408 1.00 0.00 ? 123 ASN A ND2  8  
ATOM   10252 H  H    . ASN A 1 59 ? 5.703   -6.123  -11.420 1.00 0.00 ? 123 ASN A H    8  
ATOM   10253 H  HA   . ASN A 1 59 ? 3.495   -7.331  -9.965  1.00 0.00 ? 123 ASN A HA   8  
ATOM   10254 H  HB2  . ASN A 1 59 ? 3.020   -8.449  -12.152 1.00 0.00 ? 123 ASN A HB2  8  
ATOM   10255 H  HB3  . ASN A 1 59 ? 3.043   -6.690  -12.246 1.00 0.00 ? 123 ASN A HB3  8  
ATOM   10256 H  HD21 . ASN A 1 59 ? 3.278   -8.046  -14.529 1.00 0.00 ? 123 ASN A HD21 8  
ATOM   10257 H  HD22 . ASN A 1 59 ? 4.893   -7.966  -15.137 1.00 0.00 ? 123 ASN A HD22 8  
ATOM   10258 N  N    . LYS A 1 60 ? 5.779   -8.821  -9.320  1.00 0.00 ? 124 LYS A N    8  
ATOM   10259 C  CA   . LYS A 1 60 ? 6.498   -10.019 -8.903  1.00 0.00 ? 124 LYS A CA   8  
ATOM   10260 C  C    . LYS A 1 60 ? 5.686   -10.813 -7.885  1.00 0.00 ? 124 LYS A C    8  
ATOM   10261 O  O    . LYS A 1 60 ? 5.313   -11.960 -8.132  1.00 0.00 ? 124 LYS A O    8  
ATOM   10262 C  CB   . LYS A 1 60 ? 7.856   -9.642  -8.307  1.00 0.00 ? 124 LYS A CB   8  
ATOM   10263 C  CG   . LYS A 1 60 ? 8.869   -10.773 -8.339  1.00 0.00 ? 124 LYS A CG   8  
ATOM   10264 C  CD   . LYS A 1 60 ? 10.039  -10.500 -7.410  1.00 0.00 ? 124 LYS A CD   8  
ATOM   10265 C  CE   . LYS A 1 60 ? 10.977  -9.450  -7.988  1.00 0.00 ? 124 LYS A CE   8  
ATOM   10266 N  NZ   . LYS A 1 60 ? 12.340  -9.538  -7.396  1.00 0.00 ? 124 LYS A NZ   8  
ATOM   10267 H  H    . LYS A 1 60 ? 5.899   -7.990  -8.813  1.00 0.00 ? 124 LYS A H    8  
ATOM   10268 H  HA   . LYS A 1 60 ? 6.655   -10.632 -9.777  1.00 0.00 ? 124 LYS A HA   8  
ATOM   10269 H  HB2  . LYS A 1 60 ? 8.260   -8.809  -8.863  1.00 0.00 ? 124 LYS A HB2  8  
ATOM   10270 H  HB3  . LYS A 1 60 ? 7.714   -9.343  -7.279  1.00 0.00 ? 124 LYS A HB3  8  
ATOM   10271 H  HG2  . LYS A 1 60 ? 8.384   -11.688 -8.030  1.00 0.00 ? 124 LYS A HG2  8  
ATOM   10272 H  HG3  . LYS A 1 60 ? 9.240   -10.884 -9.348  1.00 0.00 ? 124 LYS A HG3  8  
ATOM   10273 H  HD2  . LYS A 1 60 ? 9.661   -10.145 -6.463  1.00 0.00 ? 124 LYS A HD2  8  
ATOM   10274 H  HD3  . LYS A 1 60 ? 10.590  -11.418 -7.259  1.00 0.00 ? 124 LYS A HD3  8  
ATOM   10275 H  HE2  . LYS A 1 60 ? 11.046  -9.597  -9.055  1.00 0.00 ? 124 LYS A HE2  8  
ATOM   10276 H  HE3  . LYS A 1 60 ? 10.568  -8.471  -7.786  1.00 0.00 ? 124 LYS A HE3  8  
ATOM   10277 H  HZ1  . LYS A 1 60 ? 12.536  -10.514 -7.093  1.00 0.00 ? 124 LYS A HZ1  8  
ATOM   10278 H  HZ2  . LYS A 1 60 ? 12.413  -8.909  -6.571  1.00 0.00 ? 124 LYS A HZ2  8  
ATOM   10279 H  HZ3  . LYS A 1 60 ? 13.053  -9.255  -8.098  1.00 0.00 ? 124 LYS A HZ3  8  
ATOM   10280 N  N    . CYS A 1 61 ? 5.416   -10.196 -6.740  1.00 0.00 ? 125 CYS A N    8  
ATOM   10281 C  CA   . CYS A 1 61 ? 4.648   -10.845 -5.684  1.00 0.00 ? 125 CYS A CA   8  
ATOM   10282 C  C    . CYS A 1 61 ? 3.277   -10.192 -5.529  1.00 0.00 ? 125 CYS A C    8  
ATOM   10283 O  O    . CYS A 1 61 ? 3.124   -8.990  -5.740  1.00 0.00 ? 125 CYS A O    8  
ATOM   10284 C  CB   . CYS A 1 61 ? 5.408   -10.779 -4.358  1.00 0.00 ? 125 CYS A CB   8  
ATOM   10285 S  SG   . CYS A 1 61 ? 4.567   -11.618 -2.976  1.00 0.00 ? 125 CYS A SG   8  
ATOM   10286 H  H    . CYS A 1 61 ? 5.741   -9.281  -6.601  1.00 0.00 ? 125 CYS A H    8  
ATOM   10287 H  HA   . CYS A 1 61 ? 4.511   -11.879 -5.960  1.00 0.00 ? 125 CYS A HA   8  
ATOM   10288 H  HB2  . CYS A 1 61 ? 6.375   -11.244 -4.483  1.00 0.00 ? 125 CYS A HB2  8  
ATOM   10289 H  HB3  . CYS A 1 61 ? 5.545   -9.744  -4.081  1.00 0.00 ? 125 CYS A HB3  8  
ATOM   10290 N  N    . GLN A 1 62 ? 2.284   -10.995 -5.160  1.00 0.00 ? 126 GLN A N    8  
ATOM   10291 C  CA   . GLN A 1 62 ? 0.926   -10.496 -4.978  1.00 0.00 ? 126 GLN A CA   8  
ATOM   10292 C  C    . GLN A 1 62 ? 0.734   -9.941  -3.570  1.00 0.00 ? 126 GLN A C    8  
ATOM   10293 O  O    . GLN A 1 62 ? 0.494   -8.748  -3.390  1.00 0.00 ? 126 GLN A O    8  
ATOM   10294 C  CB   . GLN A 1 62 ? -0.089  -11.609 -5.243  1.00 0.00 ? 126 GLN A CB   8  
ATOM   10295 C  CG   . GLN A 1 62 ? -0.199  -11.996 -6.709  1.00 0.00 ? 126 GLN A CG   8  
ATOM   10296 C  CD   . GLN A 1 62 ? 0.947   -12.877 -7.167  1.00 0.00 ? 126 GLN A CD   8  
ATOM   10297 O  OE1  . GLN A 1 62 ? 1.658   -13.465 -6.352  1.00 0.00 ? 126 GLN A OE1  8  
ATOM   10298 N  NE2  . GLN A 1 62 ? 1.131   -12.974 -8.479  1.00 0.00 ? 126 GLN A NE2  8  
ATOM   10299 H  H    . GLN A 1 62 ? 2.469   -11.945 -5.007  1.00 0.00 ? 126 GLN A H    8  
ATOM   10300 H  HA   . GLN A 1 62 ? 0.767   -9.700  -5.689  1.00 0.00 ? 126 GLN A HA   8  
ATOM   10301 H  HB2  . GLN A 1 62 ? 0.201   -12.485 -4.682  1.00 0.00 ? 126 GLN A HB2  8  
ATOM   10302 H  HB3  . GLN A 1 62 ? -1.061  -11.281 -4.906  1.00 0.00 ? 126 GLN A HB3  8  
ATOM   10303 H  HG2  . GLN A 1 62 ? -1.125  -12.530 -6.859  1.00 0.00 ? 126 GLN A HG2  8  
ATOM   10304 H  HG3  . GLN A 1 62 ? -0.203  -11.096 -7.306  1.00 0.00 ? 126 GLN A HG3  8  
ATOM   10305 H  HE21 . GLN A 1 62 ? 0.526   -12.477 -9.069  1.00 0.00 ? 126 GLN A HE21 8  
ATOM   10306 H  HE22 . GLN A 1 62 ? 1.864   -13.536 -8.803  1.00 0.00 ? 126 GLN A HE22 8  
ATOM   10307 N  N    . TYR A 1 63 ? 0.842   -10.815 -2.576  1.00 0.00 ? 127 TYR A N    8  
ATOM   10308 C  CA   . TYR A 1 63 ? 0.678   -10.414 -1.184  1.00 0.00 ? 127 TYR A CA   8  
ATOM   10309 C  C    . TYR A 1 63 ? 1.449   -9.130  -0.893  1.00 0.00 ? 127 TYR A C    8  
ATOM   10310 O  O    . TYR A 1 63 ? 0.857   -8.079  -0.642  1.00 0.00 ? 127 TYR A O    8  
ATOM   10311 C  CB   . TYR A 1 63 ? 1.151   -11.529 -0.250  1.00 0.00 ? 127 TYR A CB   8  
ATOM   10312 C  CG   . TYR A 1 63 ? 0.839   -11.271 1.207   1.00 0.00 ? 127 TYR A CG   8  
ATOM   10313 C  CD1  . TYR A 1 63 ? -0.455  -11.401 1.695   1.00 0.00 ? 127 TYR A CD1  8  
ATOM   10314 C  CD2  . TYR A 1 63 ? 1.840   -10.899 2.096   1.00 0.00 ? 127 TYR A CD2  8  
ATOM   10315 C  CE1  . TYR A 1 63 ? -0.744  -11.166 3.025   1.00 0.00 ? 127 TYR A CE1  8  
ATOM   10316 C  CE2  . TYR A 1 63 ? 1.561   -10.663 3.429   1.00 0.00 ? 127 TYR A CE2  8  
ATOM   10317 C  CZ   . TYR A 1 63 ? 0.267   -10.797 3.888   1.00 0.00 ? 127 TYR A CZ   8  
ATOM   10318 O  OH   . TYR A 1 63 ? -0.017  -10.564 5.214   1.00 0.00 ? 127 TYR A OH   8  
ATOM   10319 H  H    . TYR A 1 63 ? 1.035   -11.754 -2.782  1.00 0.00 ? 127 TYR A H    8  
ATOM   10320 H  HA   . TYR A 1 63 ? -0.374  -10.235 -1.012  1.00 0.00 ? 127 TYR A HA   8  
ATOM   10321 H  HB2  . TYR A 1 63 ? 0.671   -12.453 -0.532  1.00 0.00 ? 127 TYR A HB2  8  
ATOM   10322 H  HB3  . TYR A 1 63 ? 2.221   -11.640 -0.346  1.00 0.00 ? 127 TYR A HB3  8  
ATOM   10323 H  HD1  . TYR A 1 63 ? -1.245  -11.690 1.016   1.00 0.00 ? 127 TYR A HD1  8  
ATOM   10324 H  HD2  . TYR A 1 63 ? 2.853   -10.795 1.734   1.00 0.00 ? 127 TYR A HD2  8  
ATOM   10325 H  HE1  . TYR A 1 63 ? -1.757  -11.271 3.385   1.00 0.00 ? 127 TYR A HE1  8  
ATOM   10326 H  HE2  . TYR A 1 63 ? 2.352   -10.375 4.105   1.00 0.00 ? 127 TYR A HE2  8  
ATOM   10327 H  HH   . TYR A 1 63 ? 0.803   -10.491 5.708   1.00 0.00 ? 127 TYR A HH   8  
ATOM   10328 N  N    . CYS A 1 64 ? 2.774   -9.222  -0.928  1.00 0.00 ? 128 CYS A N    8  
ATOM   10329 C  CA   . CYS A 1 64 ? 3.629   -8.070  -0.669  1.00 0.00 ? 128 CYS A CA   8  
ATOM   10330 C  C    . CYS A 1 64 ? 3.076   -6.819  -1.346  1.00 0.00 ? 128 CYS A C    8  
ATOM   10331 O  O    . CYS A 1 64 ? 2.935   -5.771  -0.716  1.00 0.00 ? 128 CYS A O    8  
ATOM   10332 C  CB   . CYS A 1 64 ? 5.051   -8.343  -1.161  1.00 0.00 ? 128 CYS A CB   8  
ATOM   10333 S  SG   . CYS A 1 64 ? 5.943   -9.604  -0.195  1.00 0.00 ? 128 CYS A SG   8  
ATOM   10334 H  H    . CYS A 1 64 ? 3.188   -10.088 -1.133  1.00 0.00 ? 128 CYS A H    8  
ATOM   10335 H  HA   . CYS A 1 64 ? 3.652   -7.907  0.398   1.00 0.00 ? 128 CYS A HA   8  
ATOM   10336 H  HB2  . CYS A 1 64 ? 5.010   -8.684  -2.185  1.00 0.00 ? 128 CYS A HB2  8  
ATOM   10337 H  HB3  . CYS A 1 64 ? 5.622   -7.428  -1.114  1.00 0.00 ? 128 CYS A HB3  8  
ATOM   10338 N  N    . ARG A 1 65 ? 2.764   -6.938  -2.632  1.00 0.00 ? 129 ARG A N    8  
ATOM   10339 C  CA   . ARG A 1 65 ? 2.227   -5.818  -3.395  1.00 0.00 ? 129 ARG A CA   8  
ATOM   10340 C  C    . ARG A 1 65 ? 1.055   -5.173  -2.661  1.00 0.00 ? 129 ARG A C    8  
ATOM   10341 O  O    . ARG A 1 65 ? 1.017   -3.956  -2.479  1.00 0.00 ? 129 ARG A O    8  
ATOM   10342 C  CB   . ARG A 1 65 ? 1.780   -6.284  -4.781  1.00 0.00 ? 129 ARG A CB   8  
ATOM   10343 C  CG   . ARG A 1 65 ? 1.503   -5.144  -5.747  1.00 0.00 ? 129 ARG A CG   8  
ATOM   10344 C  CD   . ARG A 1 65 ? 1.323   -5.651  -7.170  1.00 0.00 ? 129 ARG A CD   8  
ATOM   10345 N  NE   . ARG A 1 65 ? 0.669   -4.664  -8.024  1.00 0.00 ? 129 ARG A NE   8  
ATOM   10346 C  CZ   . ARG A 1 65 ? 0.800   -4.633  -9.346  1.00 0.00 ? 129 ARG A CZ   8  
ATOM   10347 N  NH1  . ARG A 1 65 ? 1.557   -5.530  -9.961  1.00 0.00 ? 129 ARG A NH1  8  
ATOM   10348 N  NH2  . ARG A 1 65 ? 0.172   -3.703  -10.054 1.00 0.00 ? 129 ARG A NH2  8  
ATOM   10349 H  H    . ARG A 1 65 ? 2.898   -7.800  -3.079  1.00 0.00 ? 129 ARG A H    8  
ATOM   10350 H  HA   . ARG A 1 65 ? 3.013   -5.086  -3.507  1.00 0.00 ? 129 ARG A HA   8  
ATOM   10351 H  HB2  . ARG A 1 65 ? 2.555   -6.906  -5.206  1.00 0.00 ? 129 ARG A HB2  8  
ATOM   10352 H  HB3  . ARG A 1 65 ? 0.878   -6.868  -4.678  1.00 0.00 ? 129 ARG A HB3  8  
ATOM   10353 H  HG2  . ARG A 1 65 ? 0.600   -4.637  -5.441  1.00 0.00 ? 129 ARG A HG2  8  
ATOM   10354 H  HG3  . ARG A 1 65 ? 2.333   -4.454  -5.722  1.00 0.00 ? 129 ARG A HG3  8  
ATOM   10355 H  HD2  . ARG A 1 65 ? 2.295   -5.881  -7.581  1.00 0.00 ? 129 ARG A HD2  8  
ATOM   10356 H  HD3  . ARG A 1 65 ? 0.722   -6.547  -7.145  1.00 0.00 ? 129 ARG A HD3  8  
ATOM   10357 H  HE   . ARG A 1 65 ? 0.104   -3.991  -7.590  1.00 0.00 ? 129 ARG A HE   8  
ATOM   10358 H  HH11 . ARG A 1 65 ? 2.030   -6.233  -9.430  1.00 0.00 ? 129 ARG A HH11 8  
ATOM   10359 H  HH12 . ARG A 1 65 ? 1.653   -5.505  -10.956 1.00 0.00 ? 129 ARG A HH12 8  
ATOM   10360 H  HH21 . ARG A 1 65 ? -0.400  -3.025  -9.594  1.00 0.00 ? 129 ARG A HH21 8  
ATOM   10361 H  HH22 . ARG A 1 65 ? 0.272   -3.680  -11.048 1.00 0.00 ? 129 ARG A HH22 8  
ATOM   10362 N  N    . PHE A 1 66 ? 0.099   -5.996  -2.243  1.00 0.00 ? 130 PHE A N    8  
ATOM   10363 C  CA   . PHE A 1 66 ? -1.075  -5.506  -1.531  1.00 0.00 ? 130 PHE A CA   8  
ATOM   10364 C  C    . PHE A 1 66 ? -0.686  -4.928  -0.174  1.00 0.00 ? 130 PHE A C    8  
ATOM   10365 O  O    . PHE A 1 66 ? -1.030  -3.791  0.149   1.00 0.00 ? 130 PHE A O    8  
ATOM   10366 C  CB   . PHE A 1 66 ? -2.092  -6.634  -1.345  1.00 0.00 ? 130 PHE A CB   8  
ATOM   10367 C  CG   . PHE A 1 66 ? -3.383  -6.181  -0.725  1.00 0.00 ? 130 PHE A CG   8  
ATOM   10368 C  CD1  . PHE A 1 66 ? -4.105  -5.137  -1.281  1.00 0.00 ? 130 PHE A CD1  8  
ATOM   10369 C  CD2  . PHE A 1 66 ? -3.874  -6.799  0.414   1.00 0.00 ? 130 PHE A CD2  8  
ATOM   10370 C  CE1  . PHE A 1 66 ? -5.293  -4.718  -0.713  1.00 0.00 ? 130 PHE A CE1  8  
ATOM   10371 C  CE2  . PHE A 1 66 ? -5.062  -6.384  0.986   1.00 0.00 ? 130 PHE A CE2  8  
ATOM   10372 C  CZ   . PHE A 1 66 ? -5.772  -5.342  0.423   1.00 0.00 ? 130 PHE A CZ   8  
ATOM   10373 H  H    . PHE A 1 66 ? 0.186   -6.957  -2.419  1.00 0.00 ? 130 PHE A H    8  
ATOM   10374 H  HA   . PHE A 1 66 ? -1.521  -4.726  -2.128  1.00 0.00 ? 130 PHE A HA   8  
ATOM   10375 H  HB2  . PHE A 1 66 ? -2.321  -7.066  -2.308  1.00 0.00 ? 130 PHE A HB2  8  
ATOM   10376 H  HB3  . PHE A 1 66 ? -1.665  -7.393  -0.708  1.00 0.00 ? 130 PHE A HB3  8  
ATOM   10377 H  HD1  . PHE A 1 66 ? -3.731  -4.648  -2.169  1.00 0.00 ? 130 PHE A HD1  8  
ATOM   10378 H  HD2  . PHE A 1 66 ? -3.320  -7.614  0.856   1.00 0.00 ? 130 PHE A HD2  8  
ATOM   10379 H  HE1  . PHE A 1 66 ? -5.846  -3.902  -1.156  1.00 0.00 ? 130 PHE A HE1  8  
ATOM   10380 H  HE2  . PHE A 1 66 ? -5.434  -6.873  1.874   1.00 0.00 ? 130 PHE A HE2  8  
ATOM   10381 H  HZ   . PHE A 1 66 ? -6.700  -5.016  0.867   1.00 0.00 ? 130 PHE A HZ   8  
ATOM   10382 N  N    . GLN A 1 67 ? 0.032   -5.720  0.616   1.00 0.00 ? 131 GLN A N    8  
ATOM   10383 C  CA   . GLN A 1 67 ? 0.466   -5.287  1.939   1.00 0.00 ? 131 GLN A CA   8  
ATOM   10384 C  C    . GLN A 1 67 ? 1.082   -3.893  1.881   1.00 0.00 ? 131 GLN A C    8  
ATOM   10385 O  O    . GLN A 1 67 ? 0.711   -3.006  2.651   1.00 0.00 ? 131 GLN A O    8  
ATOM   10386 C  CB   . GLN A 1 67 ? 1.476   -6.280  2.517   1.00 0.00 ? 131 GLN A CB   8  
ATOM   10387 C  CG   . GLN A 1 67 ? 0.860   -7.609  2.921   1.00 0.00 ? 131 GLN A CG   8  
ATOM   10388 C  CD   . GLN A 1 67 ? 0.294   -7.587  4.327   1.00 0.00 ? 131 GLN A CD   8  
ATOM   10389 O  OE1  . GLN A 1 67 ? 1.036   -7.639  5.308   1.00 0.00 ? 131 GLN A OE1  8  
ATOM   10390 N  NE2  . GLN A 1 67 ? -1.027  -7.510  4.433   1.00 0.00 ? 131 GLN A NE2  8  
ATOM   10391 H  H    . GLN A 1 67 ? 0.274   -6.615  0.303   1.00 0.00 ? 131 GLN A H    8  
ATOM   10392 H  HA   . GLN A 1 67 ? -0.402  -5.257  2.580   1.00 0.00 ? 131 GLN A HA   8  
ATOM   10393 H  HB2  . GLN A 1 67 ? 2.239   -6.471  1.777   1.00 0.00 ? 131 GLN A HB2  8  
ATOM   10394 H  HB3  . GLN A 1 67 ? 1.935   -5.840  3.391   1.00 0.00 ? 131 GLN A HB3  8  
ATOM   10395 H  HG2  . GLN A 1 67 ? 0.062   -7.846  2.233   1.00 0.00 ? 131 GLN A HG2  8  
ATOM   10396 H  HG3  . GLN A 1 67 ? 1.620   -8.375  2.866   1.00 0.00 ? 131 GLN A HG3  8  
ATOM   10397 H  HE21 . GLN A 1 67 ? -1.556  -7.474  3.607   1.00 0.00 ? 131 GLN A HE21 8  
ATOM   10398 H  HE22 . GLN A 1 67 ? -1.420  -7.495  5.329   1.00 0.00 ? 131 GLN A HE22 8  
ATOM   10399 N  N    . LYS A 1 68 ? 2.024   -3.705  0.963   1.00 0.00 ? 132 LYS A N    8  
ATOM   10400 C  CA   . LYS A 1 68 ? 2.691   -2.419  0.803   1.00 0.00 ? 132 LYS A CA   8  
ATOM   10401 C  C    . LYS A 1 68 ? 1.674   -1.284  0.729   1.00 0.00 ? 132 LYS A C    8  
ATOM   10402 O  O    . LYS A 1 68 ? 1.760   -0.312  1.481   1.00 0.00 ? 132 LYS A O    8  
ATOM   10403 C  CB   . LYS A 1 68 ? 3.557   -2.424  -0.459  1.00 0.00 ? 132 LYS A CB   8  
ATOM   10404 C  CG   . LYS A 1 68 ? 3.762   -1.045  -1.062  1.00 0.00 ? 132 LYS A CG   8  
ATOM   10405 C  CD   . LYS A 1 68 ? 4.923   -1.032  -2.042  1.00 0.00 ? 132 LYS A CD   8  
ATOM   10406 C  CE   . LYS A 1 68 ? 6.219   -0.611  -1.366  1.00 0.00 ? 132 LYS A CE   8  
ATOM   10407 N  NZ   . LYS A 1 68 ? 6.974   -1.781  -0.838  1.00 0.00 ? 132 LYS A NZ   8  
ATOM   10408 H  H    . LYS A 1 68 ? 2.276   -4.451  0.378   1.00 0.00 ? 132 LYS A H    8  
ATOM   10409 H  HA   . LYS A 1 68 ? 3.324   -2.264  1.663   1.00 0.00 ? 132 LYS A HA   8  
ATOM   10410 H  HB2  . LYS A 1 68 ? 4.526   -2.835  -0.214  1.00 0.00 ? 132 LYS A HB2  8  
ATOM   10411 H  HB3  . LYS A 1 68 ? 3.087   -3.052  -1.201  1.00 0.00 ? 132 LYS A HB3  8  
ATOM   10412 H  HG2  . LYS A 1 68 ? 2.862   -0.752  -1.582  1.00 0.00 ? 132 LYS A HG2  8  
ATOM   10413 H  HG3  . LYS A 1 68 ? 3.966   -0.342  -0.267  1.00 0.00 ? 132 LYS A HG3  8  
ATOM   10414 H  HD2  . LYS A 1 68 ? 5.049   -2.024  -2.451  1.00 0.00 ? 132 LYS A HD2  8  
ATOM   10415 H  HD3  . LYS A 1 68 ? 4.701   -0.338  -2.840  1.00 0.00 ? 132 LYS A HD3  8  
ATOM   10416 H  HE2  . LYS A 1 68 ? 6.833   -0.092  -2.086  1.00 0.00 ? 132 LYS A HE2  8  
ATOM   10417 H  HE3  . LYS A 1 68 ? 5.983   0.054   -0.548  1.00 0.00 ? 132 LYS A HE3  8  
ATOM   10418 H  HZ1  . LYS A 1 68 ? 7.761   -2.016  -1.476  1.00 0.00 ? 132 LYS A HZ1  8  
ATOM   10419 H  HZ2  . LYS A 1 68 ? 6.346   -2.606  -0.760  1.00 0.00 ? 132 LYS A HZ2  8  
ATOM   10420 H  HZ3  . LYS A 1 68 ? 7.359   -1.562  0.103   1.00 0.00 ? 132 LYS A HZ3  8  
ATOM   10421 N  N    . CYS A 1 69 ? 0.713   -1.415  -0.178  1.00 0.00 ? 133 CYS A N    8  
ATOM   10422 C  CA   . CYS A 1 69 ? -0.321  -0.400  -0.349  1.00 0.00 ? 133 CYS A CA   8  
ATOM   10423 C  C    . CYS A 1 69 ? -0.971  -0.057  0.987   1.00 0.00 ? 133 CYS A C    8  
ATOM   10424 O  O    . CYS A 1 69 ? -1.081  1.114   1.354   1.00 0.00 ? 133 CYS A O    8  
ATOM   10425 C  CB   . CYS A 1 69 ? -1.382  -0.885  -1.338  1.00 0.00 ? 133 CYS A CB   8  
ATOM   10426 S  SG   . CYS A 1 69 ? -0.981  -0.559  -3.070  1.00 0.00 ? 133 CYS A SG   8  
ATOM   10427 H  H    . CYS A 1 69 ? 0.698   -2.212  -0.748  1.00 0.00 ? 133 CYS A H    8  
ATOM   10428 H  HA   . CYS A 1 69 ? 0.149   0.487   -0.745  1.00 0.00 ? 133 CYS A HA   8  
ATOM   10429 H  HB2  . CYS A 1 69 ? -1.507  -1.952  -1.225  1.00 0.00 ? 133 CYS A HB2  8  
ATOM   10430 H  HB3  . CYS A 1 69 ? -2.319  -0.394  -1.118  1.00 0.00 ? 133 CYS A HB3  8  
ATOM   10431 H  HG   . CYS A 1 69 ? -0.077  -1.448  -3.454  1.00 0.00 ? 133 CYS A HG   8  
ATOM   10432 N  N    . LEU A 1 70 ? -1.403  -1.084  1.710   1.00 0.00 ? 134 LEU A N    8  
ATOM   10433 C  CA   . LEU A 1 70 ? -2.045  -0.892  3.006   1.00 0.00 ? 134 LEU A CA   8  
ATOM   10434 C  C    . LEU A 1 70 ? -1.146  -0.096  3.946   1.00 0.00 ? 134 LEU A C    8  
ATOM   10435 O  O    . LEU A 1 70 ? -1.586  0.864   4.577   1.00 0.00 ? 134 LEU A O    8  
ATOM   10436 C  CB   . LEU A 1 70 ? -2.388  -2.245  3.633   1.00 0.00 ? 134 LEU A CB   8  
ATOM   10437 C  CG   . LEU A 1 70 ? -3.412  -3.093  2.879   1.00 0.00 ? 134 LEU A CG   8  
ATOM   10438 C  CD1  . LEU A 1 70 ? -3.436  -4.512  3.426   1.00 0.00 ? 134 LEU A CD1  8  
ATOM   10439 C  CD2  . LEU A 1 70 ? -4.794  -2.463  2.966   1.00 0.00 ? 134 LEU A CD2  8  
ATOM   10440 H  H    . LEU A 1 70 ? -1.287  -1.994  1.365   1.00 0.00 ? 134 LEU A H    8  
ATOM   10441 H  HA   . LEU A 1 70 ? -2.957  -0.338  2.844   1.00 0.00 ? 134 LEU A HA   8  
ATOM   10442 H  HB2  . LEU A 1 70 ? -1.475  -2.816  3.706   1.00 0.00 ? 134 LEU A HB2  8  
ATOM   10443 H  HB3  . LEU A 1 70 ? -2.775  -2.060  4.625   1.00 0.00 ? 134 LEU A HB3  8  
ATOM   10444 H  HG   . LEU A 1 70 ? -3.131  -3.143  1.836   1.00 0.00 ? 134 LEU A HG   8  
ATOM   10445 H  HD11 . LEU A 1 70 ? -2.468  -4.756  3.835   1.00 0.00 ? 134 LEU A HD11 8  
ATOM   10446 H  HD12 . LEU A 1 70 ? -3.674  -5.201  2.629   1.00 0.00 ? 134 LEU A HD12 8  
ATOM   10447 H  HD13 . LEU A 1 70 ? -4.185  -4.587  4.201   1.00 0.00 ? 134 LEU A HD13 8  
ATOM   10448 H  HD21 . LEU A 1 70 ? -4.696  -1.395  3.088   1.00 0.00 ? 134 LEU A HD21 8  
ATOM   10449 H  HD22 . LEU A 1 70 ? -5.325  -2.875  3.812   1.00 0.00 ? 134 LEU A HD22 8  
ATOM   10450 H  HD23 . LEU A 1 70 ? -5.344  -2.674  2.059   1.00 0.00 ? 134 LEU A HD23 8  
ATOM   10451 N  N    . ALA A 1 71 ? 0.117   -0.502  4.034   1.00 0.00 ? 135 ALA A N    8  
ATOM   10452 C  CA   . ALA A 1 71 ? 1.079   0.176   4.894   1.00 0.00 ? 135 ALA A CA   8  
ATOM   10453 C  C    . ALA A 1 71 ? 1.233   1.641   4.498   1.00 0.00 ? 135 ALA A C    8  
ATOM   10454 O  O    . ALA A 1 71 ? 1.466   2.503   5.347   1.00 0.00 ? 135 ALA A O    8  
ATOM   10455 C  CB   . ALA A 1 71 ? 2.425   -0.531  4.839   1.00 0.00 ? 135 ALA A CB   8  
ATOM   10456 H  H    . ALA A 1 71 ? 0.409   -1.274  3.506   1.00 0.00 ? 135 ALA A H    8  
ATOM   10457 H  HA   . ALA A 1 71 ? 0.714   0.124   5.909   1.00 0.00 ? 135 ALA A HA   8  
ATOM   10458 H  HB1  . ALA A 1 71 ? 2.941   -0.253  3.932   1.00 0.00 ? 135 ALA A HB1  8  
ATOM   10459 H  HB2  . ALA A 1 71 ? 3.018   -0.240  5.694   1.00 0.00 ? 135 ALA A HB2  8  
ATOM   10460 H  HB3  . ALA A 1 71 ? 2.271   -1.600  4.854   1.00 0.00 ? 135 ALA A HB3  8  
ATOM   10461 N  N    . LEU A 1 72 ? 1.101   1.916   3.205   1.00 0.00 ? 136 LEU A N    8  
ATOM   10462 C  CA   . LEU A 1 72 ? 1.225   3.278   2.697   1.00 0.00 ? 136 LEU A CA   8  
ATOM   10463 C  C    . LEU A 1 72 ? 0.094   4.159   3.216   1.00 0.00 ? 136 LEU A C    8  
ATOM   10464 O  O    . LEU A 1 72 ? 0.255   5.369   3.368   1.00 0.00 ? 136 LEU A O    8  
ATOM   10465 C  CB   . LEU A 1 72 ? 1.223   3.275   1.167   1.00 0.00 ? 136 LEU A CB   8  
ATOM   10466 C  CG   . LEU A 1 72 ? 2.488   2.739   0.495   1.00 0.00 ? 136 LEU A CG   8  
ATOM   10467 C  CD1  . LEU A 1 72 ? 2.312   2.694   -1.015  1.00 0.00 ? 136 LEU A CD1  8  
ATOM   10468 C  CD2  . LEU A 1 72 ? 3.692   3.592   0.868   1.00 0.00 ? 136 LEU A CD2  8  
ATOM   10469 H  H    . LEU A 1 72 ? 0.915   1.188   2.577   1.00 0.00 ? 136 LEU A H    8  
ATOM   10470 H  HA   . LEU A 1 72 ? 2.166   3.677   3.046   1.00 0.00 ? 136 LEU A HA   8  
ATOM   10471 H  HB2  . LEU A 1 72 ? 0.393   2.668   0.839   1.00 0.00 ? 136 LEU A HB2  8  
ATOM   10472 H  HB3  . LEU A 1 72 ? 1.076   4.293   0.835   1.00 0.00 ? 136 LEU A HB3  8  
ATOM   10473 H  HG   . LEU A 1 72 ? 2.672   1.731   0.839   1.00 0.00 ? 136 LEU A HG   8  
ATOM   10474 H  HD11 . LEU A 1 72 ? 3.233   2.370   -1.475  1.00 0.00 ? 136 LEU A HD11 8  
ATOM   10475 H  HD12 . LEU A 1 72 ? 2.055   3.679   -1.377  1.00 0.00 ? 136 LEU A HD12 8  
ATOM   10476 H  HD13 . LEU A 1 72 ? 1.521   2.002   -1.264  1.00 0.00 ? 136 LEU A HD13 8  
ATOM   10477 H  HD21 . LEU A 1 72 ? 4.090   4.060   -0.019  1.00 0.00 ? 136 LEU A HD21 8  
ATOM   10478 H  HD22 . LEU A 1 72 ? 4.449   2.967   1.317   1.00 0.00 ? 136 LEU A HD22 8  
ATOM   10479 H  HD23 . LEU A 1 72 ? 3.389   4.353   1.573   1.00 0.00 ? 136 LEU A HD23 8  
ATOM   10480 N  N    . GLY A 1 73 ? -1.052  3.542   3.490   1.00 0.00 ? 137 GLY A N    8  
ATOM   10481 C  CA   . GLY A 1 73 ? -2.193  4.285   3.992   1.00 0.00 ? 137 GLY A CA   8  
ATOM   10482 C  C    . GLY A 1 73 ? -3.354  4.292   3.018   1.00 0.00 ? 137 GLY A C    8  
ATOM   10483 O  O    . GLY A 1 73 ? -4.198  5.187   3.055   1.00 0.00 ? 137 GLY A O    8  
ATOM   10484 H  H    . GLY A 1 73 ? -1.123  2.575   3.350   1.00 0.00 ? 137 GLY A H    8  
ATOM   10485 H  HA2  . GLY A 1 73 ? -2.518  3.841   4.921   1.00 0.00 ? 137 GLY A HA2  8  
ATOM   10486 H  HA3  . GLY A 1 73 ? -1.890  5.305   4.179   1.00 0.00 ? 137 GLY A HA3  8  
ATOM   10487 N  N    . MET A 1 74 ? -3.397  3.293   2.143   1.00 0.00 ? 138 MET A N    8  
ATOM   10488 C  CA   . MET A 1 74 ? -4.464  3.188   1.154   1.00 0.00 ? 138 MET A CA   8  
ATOM   10489 C  C    . MET A 1 74 ? -5.793  2.853   1.823   1.00 0.00 ? 138 MET A C    8  
ATOM   10490 O  O    . MET A 1 74 ? -5.962  1.769   2.382   1.00 0.00 ? 138 MET A O    8  
ATOM   10491 C  CB   . MET A 1 74 ? -4.120  2.121   0.113   1.00 0.00 ? 138 MET A CB   8  
ATOM   10492 C  CG   . MET A 1 74 ? -3.245  2.636   -1.018  1.00 0.00 ? 138 MET A CG   8  
ATOM   10493 S  SD   . MET A 1 74 ? -3.443  1.685   -2.537  1.00 0.00 ? 138 MET A SD   8  
ATOM   10494 C  CE   . MET A 1 74 ? -2.813  2.845   -3.748  1.00 0.00 ? 138 MET A CE   8  
ATOM   10495 H  H    . MET A 1 74 ? -2.695  2.609   2.163   1.00 0.00 ? 138 MET A H    8  
ATOM   10496 H  HA   . MET A 1 74 ? -4.553  4.144   0.661   1.00 0.00 ? 138 MET A HA   8  
ATOM   10497 H  HB2  . MET A 1 74 ? -3.599  1.312   0.603   1.00 0.00 ? 138 MET A HB2  8  
ATOM   10498 H  HB3  . MET A 1 74 ? -5.037  1.743   -0.314  1.00 0.00 ? 138 MET A HB3  8  
ATOM   10499 H  HG2  . MET A 1 74 ? -3.506  3.664   -1.219  1.00 0.00 ? 138 MET A HG2  8  
ATOM   10500 H  HG3  . MET A 1 74 ? -2.212  2.583   -0.708  1.00 0.00 ? 138 MET A HG3  8  
ATOM   10501 H  HE1  . MET A 1 74 ? -3.595  3.090   -4.451  1.00 0.00 ? 138 MET A HE1  8  
ATOM   10502 H  HE2  . MET A 1 74 ? -2.484  3.744   -3.248  1.00 0.00 ? 138 MET A HE2  8  
ATOM   10503 H  HE3  . MET A 1 74 ? -1.981  2.400   -4.274  1.00 0.00 ? 138 MET A HE3  8  
ATOM   10504 N  N    . SER A 1 75 ? -6.734  3.789   1.761   1.00 0.00 ? 139 SER A N    8  
ATOM   10505 C  CA   . SER A 1 75 ? -8.047  3.595   2.364   1.00 0.00 ? 139 SER A CA   8  
ATOM   10506 C  C    . SER A 1 75 ? -8.895  2.643   1.525   1.00 0.00 ? 139 SER A C    8  
ATOM   10507 O  O    . SER A 1 75 ? -9.291  2.968   0.405   1.00 0.00 ? 139 SER A O    8  
ATOM   10508 C  CB   . SER A 1 75 ? -8.767  4.937   2.515   1.00 0.00 ? 139 SER A CB   8  
ATOM   10509 O  OG   . SER A 1 75 ? -9.783  4.862   3.500   1.00 0.00 ? 139 SER A OG   8  
ATOM   10510 H  H    . SER A 1 75 ? -6.539  4.633   1.301   1.00 0.00 ? 139 SER A H    8  
ATOM   10511 H  HA   . SER A 1 75 ? -7.902  3.162   3.342   1.00 0.00 ? 139 SER A HA   8  
ATOM   10512 H  HB2  . SER A 1 75 ? -8.054  5.693   2.807   1.00 0.00 ? 139 SER A HB2  8  
ATOM   10513 H  HB3  . SER A 1 75 ? -9.216  5.210   1.571   1.00 0.00 ? 139 SER A HB3  8  
ATOM   10514 H  HG   . SER A 1 75 ? -9.988  5.745   3.816   1.00 0.00 ? 139 SER A HG   8  
ATOM   10515 N  N    . HIS A 1 76 ? -9.169  1.464   2.075   1.00 0.00 ? 140 HIS A N    8  
ATOM   10516 C  CA   . HIS A 1 76 ? -9.970  0.463   1.379   1.00 0.00 ? 140 HIS A CA   8  
ATOM   10517 C  C    . HIS A 1 76 ? -11.459 0.703   1.608   1.00 0.00 ? 140 HIS A C    8  
ATOM   10518 O  O    . HIS A 1 76 ? -12.303 0.117   0.932   1.00 0.00 ? 140 HIS A O    8  
ATOM   10519 C  CB   . HIS A 1 76 ? -9.590  -0.941  1.848   1.00 0.00 ? 140 HIS A CB   8  
ATOM   10520 C  CG   . HIS A 1 76 ? -9.736  -1.139  3.325   1.00 0.00 ? 140 HIS A CG   8  
ATOM   10521 N  ND1  . HIS A 1 76 ? -8.812  -0.682  4.241   1.00 0.00 ? 140 HIS A ND1  8  
ATOM   10522 C  CD2  . HIS A 1 76 ? -10.707 -1.749  4.045   1.00 0.00 ? 140 HIS A CD2  8  
ATOM   10523 C  CE1  . HIS A 1 76 ? -9.208  -1.003  5.460   1.00 0.00 ? 140 HIS A CE1  8  
ATOM   10524 N  NE2  . HIS A 1 76 ? -10.356 -1.650  5.369   1.00 0.00 ? 140 HIS A NE2  8  
ATOM   10525 H  H    . HIS A 1 76 ? -8.825  1.263   2.970   1.00 0.00 ? 140 HIS A H    8  
ATOM   10526 H  HA   . HIS A 1 76 ? -9.763  0.549   0.323   1.00 0.00 ? 140 HIS A HA   8  
ATOM   10527 H  HB2  . HIS A 1 76 ? -10.223 -1.663  1.353   1.00 0.00 ? 140 HIS A HB2  8  
ATOM   10528 H  HB3  . HIS A 1 76 ? -8.559  -1.135  1.587   1.00 0.00 ? 140 HIS A HB3  8  
ATOM   10529 H  HD1  . HIS A 1 76 ? -7.989  -0.196  4.029   1.00 0.00 ? 140 HIS A HD1  8  
ATOM   10530 H  HD2  . HIS A 1 76 ? -11.595 -2.225  3.651   1.00 0.00 ? 140 HIS A HD2  8  
ATOM   10531 H  HE1  . HIS A 1 76 ? -8.684  -0.774  6.376   1.00 0.00 ? 140 HIS A HE1  8  
ATOM   10532 N  N    . ASN A 1 77 ? -11.773 1.569   2.567   1.00 0.00 ? 141 ASN A N    8  
ATOM   10533 C  CA   . ASN A 1 77 ? -13.161 1.886   2.886   1.00 0.00 ? 141 ASN A CA   8  
ATOM   10534 C  C    . ASN A 1 77 ? -13.655 3.065   2.054   1.00 0.00 ? 141 ASN A C    8  
ATOM   10535 O  O    . ASN A 1 77 ? -14.771 3.547   2.243   1.00 0.00 ? 141 ASN A O    8  
ATOM   10536 C  CB   . ASN A 1 77 ? -13.303 2.203   4.376   1.00 0.00 ? 141 ASN A CB   8  
ATOM   10537 C  CG   . ASN A 1 77 ? -12.591 1.191   5.253   1.00 0.00 ? 141 ASN A CG   8  
ATOM   10538 O  OD1  . ASN A 1 77 ? -11.520 1.467   5.793   1.00 0.00 ? 141 ASN A OD1  8  
ATOM   10539 N  ND2  . ASN A 1 77 ? -13.184 0.012   5.398   1.00 0.00 ? 141 ASN A ND2  8  
ATOM   10540 H  H    . ASN A 1 77 ? -11.055 2.005   3.071   1.00 0.00 ? 141 ASN A H    8  
ATOM   10541 H  HA   . ASN A 1 77 ? -13.760 1.019   2.652   1.00 0.00 ? 141 ASN A HA   8  
ATOM   10542 H  HB2  . ASN A 1 77 ? -12.884 3.179   4.572   1.00 0.00 ? 141 ASN A HB2  8  
ATOM   10543 H  HB3  . ASN A 1 77 ? -14.350 2.206   4.639   1.00 0.00 ? 141 ASN A HB3  8  
ATOM   10544 H  HD21 . ASN A 1 77 ? -14.037 -0.137  4.938   1.00 0.00 ? 141 ASN A HD21 8  
ATOM   10545 H  HD22 . ASN A 1 77 ? -12.746 -0.660  5.960   1.00 0.00 ? 141 ASN A HD22 8  
ATOM   10546 N  N    . ALA A 1 78 ? -12.815 3.524   1.132   1.00 0.00 ? 142 ALA A N    8  
ATOM   10547 C  CA   . ALA A 1 78 ? -13.167 4.645   0.269   1.00 0.00 ? 142 ALA A CA   8  
ATOM   10548 C  C    . ALA A 1 78 ? -13.459 4.174   -1.152  1.00 0.00 ? 142 ALA A C    8  
ATOM   10549 O  O    . ALA A 1 78 ? -13.203 4.892   -2.119  1.00 0.00 ? 142 ALA A O    8  
ATOM   10550 C  CB   . ALA A 1 78 ? -12.052 5.680   0.265   1.00 0.00 ? 142 ALA A CB   8  
ATOM   10551 H  H    . ALA A 1 78 ? -11.939 3.099   1.028   1.00 0.00 ? 142 ALA A H    8  
ATOM   10552 H  HA   . ALA A 1 78 ? -14.055 5.111   0.672   1.00 0.00 ? 142 ALA A HA   8  
ATOM   10553 H  HB1  . ALA A 1 78 ? -12.403 6.586   -0.205  1.00 0.00 ? 142 ALA A HB1  8  
ATOM   10554 H  HB2  . ALA A 1 78 ? -11.757 5.893   1.283   1.00 0.00 ? 142 ALA A HB2  8  
ATOM   10555 H  HB3  . ALA A 1 78 ? -11.205 5.294   -0.282  1.00 0.00 ? 142 ALA A HB3  8  
ATOM   10556 N  N    . ILE A 1 79 ? -13.994 2.964   -1.271  1.00 0.00 ? 143 ILE A N    8  
ATOM   10557 C  CA   . ILE A 1 79 ? -14.320 2.398   -2.574  1.00 0.00 ? 143 ILE A CA   8  
ATOM   10558 C  C    . ILE A 1 79 ? -15.779 2.652   -2.934  1.00 0.00 ? 143 ILE A C    8  
ATOM   10559 O  O    . ILE A 1 79 ? -16.651 1.828   -2.657  1.00 0.00 ? 143 ILE A O    8  
ATOM   10560 C  CB   . ILE A 1 79 ? -14.050 0.882   -2.613  1.00 0.00 ? 143 ILE A CB   8  
ATOM   10561 C  CG1  . ILE A 1 79 ? -12.676 0.571   -2.015  1.00 0.00 ? 143 ILE A CG1  8  
ATOM   10562 C  CG2  . ILE A 1 79 ? -14.142 0.364   -4.040  1.00 0.00 ? 143 ILE A CG2  8  
ATOM   10563 C  CD1  . ILE A 1 79 ? -11.523 1.059   -2.864  1.00 0.00 ? 143 ILE A CD1  8  
ATOM   10564 H  H    . ILE A 1 79 ? -14.174 2.439   -0.463  1.00 0.00 ? 143 ILE A H    8  
ATOM   10565 H  HA   . ILE A 1 79 ? -13.689 2.874   -3.311  1.00 0.00 ? 143 ILE A HA   8  
ATOM   10566 H  HB   . ILE A 1 79 ? -14.810 0.388   -2.027  1.00 0.00 ? 143 ILE A HB   8  
ATOM   10567 H  HG12 . ILE A 1 79 ? -12.597 1.041   -1.047  1.00 0.00 ? 143 ILE A HG12 8  
ATOM   10568 H  HG13 . ILE A 1 79 ? -12.575 -0.499  -1.900  1.00 0.00 ? 143 ILE A HG13 8  
ATOM   10569 H  HG21 . ILE A 1 79 ? -13.908 1.163   -4.729  1.00 0.00 ? 143 ILE A HG21 8  
ATOM   10570 H  HG22 . ILE A 1 79 ? -13.438 -0.444  -4.176  1.00 0.00 ? 143 ILE A HG22 8  
ATOM   10571 H  HG23 . ILE A 1 79 ? -15.142 0.006   -4.230  1.00 0.00 ? 143 ILE A HG23 8  
ATOM   10572 H  HD11 . ILE A 1 79 ? -10.686 0.384   -2.756  1.00 0.00 ? 143 ILE A HD11 8  
ATOM   10573 H  HD12 . ILE A 1 79 ? -11.826 1.091   -3.900  1.00 0.00 ? 143 ILE A HD12 8  
ATOM   10574 H  HD13 . ILE A 1 79 ? -11.231 2.047   -2.542  1.00 0.00 ? 143 ILE A HD13 8  
ATOM   10575 N  N    . ARG A 1 80 ? -16.039 3.798   -3.556  1.00 0.00 ? 144 ARG A N    8  
ATOM   10576 C  CA   . ARG A 1 80 ? -17.393 4.161   -3.955  1.00 0.00 ? 144 ARG A CA   8  
ATOM   10577 C  C    . ARG A 1 80 ? -17.371 5.238   -5.036  1.00 0.00 ? 144 ARG A C    8  
ATOM   10578 O  O    . ARG A 1 80 ? -16.805 6.315   -4.842  1.00 0.00 ? 144 ARG A O    8  
ATOM   10579 C  CB   . ARG A 1 80 ? -18.190 4.653   -2.746  1.00 0.00 ? 144 ARG A CB   8  
ATOM   10580 C  CG   . ARG A 1 80 ? -19.663 4.885   -3.040  1.00 0.00 ? 144 ARG A CG   8  
ATOM   10581 C  CD   . ARG A 1 80 ? -20.484 3.629   -2.793  1.00 0.00 ? 144 ARG A CD   8  
ATOM   10582 N  NE   . ARG A 1 80 ? -20.553 3.291   -1.374  1.00 0.00 ? 144 ARG A NE   8  
ATOM   10583 C  CZ   . ARG A 1 80 ? -21.400 2.400   -0.871  1.00 0.00 ? 144 ARG A CZ   8  
ATOM   10584 N  NH1  . ARG A 1 80 ? -22.246 1.761   -1.667  1.00 0.00 ? 144 ARG A NH1  8  
ATOM   10585 N  NH2  . ARG A 1 80 ? -21.402 2.146   0.432   1.00 0.00 ? 144 ARG A NH2  8  
ATOM   10586 H  H    . ARG A 1 80 ? -15.302 4.414   -3.750  1.00 0.00 ? 144 ARG A H    8  
ATOM   10587 H  HA   . ARG A 1 80 ? -17.869 3.278   -4.354  1.00 0.00 ? 144 ARG A HA   8  
ATOM   10588 H  HB2  . ARG A 1 80 ? -18.114 3.920   -1.956  1.00 0.00 ? 144 ARG A HB2  8  
ATOM   10589 H  HB3  . ARG A 1 80 ? -17.762 5.584   -2.403  1.00 0.00 ? 144 ARG A HB3  8  
ATOM   10590 H  HG2  . ARG A 1 80 ? -20.029 5.673   -2.399  1.00 0.00 ? 144 ARG A HG2  8  
ATOM   10591 H  HG3  . ARG A 1 80 ? -19.772 5.179   -4.073  1.00 0.00 ? 144 ARG A HG3  8  
ATOM   10592 H  HD2  . ARG A 1 80 ? -21.486 3.792   -3.163  1.00 0.00 ? 144 ARG A HD2  8  
ATOM   10593 H  HD3  . ARG A 1 80 ? -20.032 2.808   -3.328  1.00 0.00 ? 144 ARG A HD3  8  
ATOM   10594 H  HE   . ARG A 1 80 ? -19.936 3.751   -0.767  1.00 0.00 ? 144 ARG A HE   8  
ATOM   10595 H  HH11 . ARG A 1 80 ? -22.246 1.950   -2.649  1.00 0.00 ? 144 ARG A HH11 8  
ATOM   10596 H  HH12 . ARG A 1 80 ? -22.882 1.090   -1.286  1.00 0.00 ? 144 ARG A HH12 8  
ATOM   10597 H  HH21 . ARG A 1 80 ? -20.766 2.625   1.035   1.00 0.00 ? 144 ARG A HH21 8  
ATOM   10598 H  HH22 . ARG A 1 80 ? -22.040 1.476   0.809   1.00 0.00 ? 144 ARG A HH22 8  
ATOM   10599 N  N    . PHE A 1 81 ? -17.989 4.940   -6.174  1.00 0.00 ? 145 PHE A N    8  
ATOM   10600 C  CA   . PHE A 1 81 ? -18.039 5.882   -7.286  1.00 0.00 ? 145 PHE A CA   8  
ATOM   10601 C  C    . PHE A 1 81 ? -18.976 7.045   -6.972  1.00 0.00 ? 145 PHE A C    8  
ATOM   10602 O  O    . PHE A 1 81 ? -18.655 8.203   -7.234  1.00 0.00 ? 145 PHE A O    8  
ATOM   10603 C  CB   . PHE A 1 81 ? -18.497 5.173   -8.562  1.00 0.00 ? 145 PHE A CB   8  
ATOM   10604 C  CG   . PHE A 1 81 ? -19.733 4.341   -8.375  1.00 0.00 ? 145 PHE A CG   8  
ATOM   10605 C  CD1  . PHE A 1 81 ? -19.644 3.043   -7.898  1.00 0.00 ? 145 PHE A CD1  8  
ATOM   10606 C  CD2  . PHE A 1 81 ? -20.983 4.856   -8.675  1.00 0.00 ? 145 PHE A CD2  8  
ATOM   10607 C  CE1  . PHE A 1 81 ? -20.780 2.274   -7.726  1.00 0.00 ? 145 PHE A CE1  8  
ATOM   10608 C  CE2  . PHE A 1 81 ? -22.123 4.093   -8.504  1.00 0.00 ? 145 PHE A CE2  8  
ATOM   10609 C  CZ   . PHE A 1 81 ? -22.021 2.800   -8.028  1.00 0.00 ? 145 PHE A CZ   8  
ATOM   10610 H  H    . PHE A 1 81 ? -18.421 4.065   -6.268  1.00 0.00 ? 145 PHE A H    8  
ATOM   10611 H  HA   . PHE A 1 81 ? -17.043 6.269   -7.437  1.00 0.00 ? 145 PHE A HA   8  
ATOM   10612 H  HB2  . PHE A 1 81 ? -18.707 5.912   -9.320  1.00 0.00 ? 145 PHE A HB2  8  
ATOM   10613 H  HB3  . PHE A 1 81 ? -17.707 4.523   -8.907  1.00 0.00 ? 145 PHE A HB3  8  
ATOM   10614 H  HD1  . PHE A 1 81 ? -18.675 2.630   -7.660  1.00 0.00 ? 145 PHE A HD1  8  
ATOM   10615 H  HD2  . PHE A 1 81 ? -21.064 5.868   -9.048  1.00 0.00 ? 145 PHE A HD2  8  
ATOM   10616 H  HE1  . PHE A 1 81 ? -20.698 1.264   -7.353  1.00 0.00 ? 145 PHE A HE1  8  
ATOM   10617 H  HE2  . PHE A 1 81 ? -23.091 4.507   -8.742  1.00 0.00 ? 145 PHE A HE2  8  
ATOM   10618 H  HZ   . PHE A 1 81 ? -22.910 2.202   -7.894  1.00 0.00 ? 145 PHE A HZ   8  
ATOM   10619 N  N    . GLY A 1 82 ? -20.138 6.725   -6.410  1.00 0.00 ? 146 GLY A N    8  
ATOM   10620 C  CA   . GLY A 1 82 ? -21.105 7.753   -6.070  1.00 0.00 ? 146 GLY A CA   8  
ATOM   10621 C  C    . GLY A 1 82 ? -22.210 7.235   -5.171  1.00 0.00 ? 146 GLY A C    8  
ATOM   10622 O  O    . GLY A 1 82 ? -22.559 6.056   -5.223  1.00 0.00 ? 146 GLY A O    8  
ATOM   10623 H  H    . GLY A 1 82 ? -20.340 5.784   -6.224  1.00 0.00 ? 146 GLY A H    8  
ATOM   10624 H  HA2  . GLY A 1 82 ? -20.594 8.560   -5.567  1.00 0.00 ? 146 GLY A HA2  8  
ATOM   10625 H  HA3  . GLY A 1 82 ? -21.545 8.131   -6.981  1.00 0.00 ? 146 GLY A HA3  8  
ATOM   10626 N  N    . SER A 1 83 ? -22.760 8.118   -4.344  1.00 0.00 ? 147 SER A N    8  
ATOM   10627 C  CA   . SER A 1 83 ? -23.828 7.742   -3.425  1.00 0.00 ? 147 SER A CA   8  
ATOM   10628 C  C    . SER A 1 83 ? -24.977 7.072   -4.173  1.00 0.00 ? 147 SER A C    8  
ATOM   10629 O  O    . SER A 1 83 ? -25.647 7.699   -4.993  1.00 0.00 ? 147 SER A O    8  
ATOM   10630 C  CB   . SER A 1 83 ? -24.341 8.972   -2.675  1.00 0.00 ? 147 SER A CB   8  
ATOM   10631 O  OG   . SER A 1 83 ? -25.217 8.601   -1.624  1.00 0.00 ? 147 SER A OG   8  
ATOM   10632 H  H    . SER A 1 83 ? -22.438 9.043   -4.349  1.00 0.00 ? 147 SER A H    8  
ATOM   10633 H  HA   . SER A 1 83 ? -23.421 7.040   -2.713  1.00 0.00 ? 147 SER A HA   8  
ATOM   10634 H  HB2  . SER A 1 83 ? -23.504 9.510   -2.256  1.00 0.00 ? 147 SER A HB2  8  
ATOM   10635 H  HB3  . SER A 1 83 ? -24.874 9.613   -3.362  1.00 0.00 ? 147 SER A HB3  8  
ATOM   10636 H  HG   . SER A 1 83 ? -25.656 7.777   -1.849  1.00 0.00 ? 147 SER A HG   8  
ATOM   10637 N  N    . GLY A 1 84 ? -25.199 5.794   -3.883  1.00 0.00 ? 148 GLY A N    8  
ATOM   10638 C  CA   . GLY A 1 84 ? -26.267 5.060   -4.536  1.00 0.00 ? 148 GLY A CA   8  
ATOM   10639 C  C    . GLY A 1 84 ? -25.819 3.697   -5.027  1.00 0.00 ? 148 GLY A C    8  
ATOM   10640 O  O    . GLY A 1 84 ? -25.162 3.571   -6.060  1.00 0.00 ? 148 GLY A O    8  
ATOM   10641 H  H    . GLY A 1 84 ? -24.633 5.346   -3.220  1.00 0.00 ? 148 GLY A H    8  
ATOM   10642 H  HA2  . GLY A 1 84 ? -27.080 4.930   -3.837  1.00 0.00 ? 148 GLY A HA2  8  
ATOM   10643 H  HA3  . GLY A 1 84 ? -26.620 5.635   -5.380  1.00 0.00 ? 148 GLY A HA3  8  
ATOM   10644 N  N    . PRO A 1 85 ? -26.175 2.646   -4.273  1.00 0.00 ? 149 PRO A N    8  
ATOM   10645 C  CA   . PRO A 1 85 ? -25.814 1.268   -4.617  1.00 0.00 ? 149 PRO A CA   8  
ATOM   10646 C  C    . PRO A 1 85 ? -26.560 0.763   -5.847  1.00 0.00 ? 149 PRO A C    8  
ATOM   10647 O  O    . PRO A 1 85 ? -27.612 0.134   -5.733  1.00 0.00 ? 149 PRO A O    8  
ATOM   10648 C  CB   . PRO A 1 85 ? -26.229 0.473   -3.377  1.00 0.00 ? 149 PRO A CB   8  
ATOM   10649 C  CG   . PRO A 1 85 ? -27.306 1.287   -2.747  1.00 0.00 ? 149 PRO A CG   8  
ATOM   10650 C  CD   . PRO A 1 85 ? -26.957 2.723   -3.028  1.00 0.00 ? 149 PRO A CD   8  
ATOM   10651 H  HA   . PRO A 1 85 ? -24.750 1.163   -4.774  1.00 0.00 ? 149 PRO A HA   8  
ATOM   10652 H  HB2  . PRO A 1 85 ? -26.592 -0.501  -3.675  1.00 0.00 ? 149 PRO A HB2  8  
ATOM   10653 H  HB3  . PRO A 1 85 ? -25.382 0.361   -2.716  1.00 0.00 ? 149 PRO A HB3  8  
ATOM   10654 H  HG2  . PRO A 1 85 ? -28.259 1.040   -3.189  1.00 0.00 ? 149 PRO A HG2  8  
ATOM   10655 H  HG3  . PRO A 1 85 ? -27.327 1.108   -1.682  1.00 0.00 ? 149 PRO A HG3  8  
ATOM   10656 H  HD2  . PRO A 1 85 ? -27.854 3.308   -3.171  1.00 0.00 ? 149 PRO A HD2  8  
ATOM   10657 H  HD3  . PRO A 1 85 ? -26.362 3.130   -2.224  1.00 0.00 ? 149 PRO A HD3  8  
ATOM   10658 N  N    . SER A 1 86 ? -26.008 1.042   -7.024  1.00 0.00 ? 150 SER A N    8  
ATOM   10659 C  CA   . SER A 1 86 ? -26.624 0.619   -8.277  1.00 0.00 ? 150 SER A CA   8  
ATOM   10660 C  C    . SER A 1 86 ? -25.653 -0.219  -9.103  1.00 0.00 ? 150 SER A C    8  
ATOM   10661 O  O    . SER A 1 86 ? -24.824 0.316   -9.839  1.00 0.00 ? 150 SER A O    8  
ATOM   10662 C  CB   . SER A 1 86 ? -27.078 1.837   -9.083  1.00 0.00 ? 150 SER A CB   8  
ATOM   10663 O  OG   . SER A 1 86 ? -28.198 1.523   -9.893  1.00 0.00 ? 150 SER A OG   8  
ATOM   10664 H  H    . SER A 1 86 ? -25.168 1.547   -7.050  1.00 0.00 ? 150 SER A H    8  
ATOM   10665 H  HA   . SER A 1 86 ? -27.486 0.016   -8.035  1.00 0.00 ? 150 SER A HA   8  
ATOM   10666 H  HB2  . SER A 1 86 ? -27.349 2.633   -8.407  1.00 0.00 ? 150 SER A HB2  8  
ATOM   10667 H  HB3  . SER A 1 86 ? -26.269 2.166   -9.720  1.00 0.00 ? 150 SER A HB3  8  
ATOM   10668 H  HG   . SER A 1 86 ? -28.767 0.906   -9.427  1.00 0.00 ? 150 SER A HG   8  
ATOM   10669 N  N    . SER A 1 87 ? -25.762 -1.538  -8.975  1.00 0.00 ? 151 SER A N    8  
ATOM   10670 C  CA   . SER A 1 87 ? -24.892 -2.452  -9.706  1.00 0.00 ? 151 SER A CA   8  
ATOM   10671 C  C    . SER A 1 87 ? -24.604 -1.923  -11.108 1.00 0.00 ? 151 SER A C    8  
ATOM   10672 O  O    . SER A 1 87 ? -25.412 -1.199  -11.689 1.00 0.00 ? 151 SER A O    8  
ATOM   10673 C  CB   . SER A 1 87 ? -25.532 -3.838  -9.793  1.00 0.00 ? 151 SER A CB   8  
ATOM   10674 O  OG   . SER A 1 87 ? -25.867 -4.327  -8.506  1.00 0.00 ? 151 SER A OG   8  
ATOM   10675 H  H    . SER A 1 87 ? -26.443 -1.904  -8.372  1.00 0.00 ? 151 SER A H    8  
ATOM   10676 H  HA   . SER A 1 87 ? -23.961 -2.527  -9.164  1.00 0.00 ? 151 SER A HA   8  
ATOM   10677 H  HB2  . SER A 1 87 ? -26.431 -3.781  -10.388 1.00 0.00 ? 151 SER A HB2  8  
ATOM   10678 H  HB3  . SER A 1 87 ? -24.837 -4.524  -10.256 1.00 0.00 ? 151 SER A HB3  8  
ATOM   10679 H  HG   . SER A 1 87 ? -26.725 -4.756  -8.540  1.00 0.00 ? 151 SER A HG   8  
ATOM   10680 N  N    . GLY A 1 88 ? -23.445 -2.290  -11.646 1.00 0.00 ? 152 GLY A N    8  
ATOM   10681 C  CA   . GLY A 1 88 ? -23.069 -1.844  -12.975 1.00 0.00 ? 152 GLY A CA   8  
ATOM   10682 C  C    . GLY A 1 88 ? -22.027 -2.740  -13.614 1.00 0.00 ? 152 GLY A C    8  
ATOM   10683 O  O    . GLY A 1 88 ? -20.924 -2.294  -13.928 1.00 0.00 ? 152 GLY A O    8  
ATOM   10684 H  H    . GLY A 1 88 ? -22.840 -2.868  -11.136 1.00 0.00 ? 152 GLY A H    8  
ATOM   10685 H  HA2  . GLY A 1 88 ? -23.950 -1.829  -13.600 1.00 0.00 ? 152 GLY A HA2  8  
ATOM   10686 H  HA3  . GLY A 1 88 ? -22.672 -0.841  -12.906 1.00 0.00 ? 152 GLY A HA3  8  
HETATM 10687 ZN ZN   . ZN  B 2 .  ? 2.954   2.520   -9.110  1.00 0.00 ? 200 ZN  A ZN   8  
HETATM 10688 ZN ZN   . ZN  C 2 .  ? 6.340   -11.457 -1.454  1.00 0.00 ? 300 ZN  A ZN   8  
ATOM   10689 N  N    . GLY A 1 1  ? 10.325  12.850  -23.799 1.00 0.00 ? 65  GLY A N    9  
ATOM   10690 C  CA   . GLY A 1 1  ? 10.477  14.259  -23.486 1.00 0.00 ? 65  GLY A CA   9  
ATOM   10691 C  C    . GLY A 1 1  ? 11.434  14.497  -22.334 1.00 0.00 ? 65  GLY A C    9  
ATOM   10692 O  O    . GLY A 1 1  ? 12.516  15.052  -22.523 1.00 0.00 ? 65  GLY A O    9  
ATOM   10693 H  H1   . GLY A 1 1  ? 11.117  12.274  -23.853 1.00 0.00 ? 65  GLY A H1   9  
ATOM   10694 H  HA2  . GLY A 1 1  ? 10.847  14.773  -24.360 1.00 0.00 ? 65  GLY A HA2  9  
ATOM   10695 H  HA3  . GLY A 1 1  ? 9.510   14.664  -23.224 1.00 0.00 ? 65  GLY A HA3  9  
ATOM   10696 N  N    . SER A 1 2  ? 11.034  14.078  -21.138 1.00 0.00 ? 66  SER A N    9  
ATOM   10697 C  CA   . SER A 1 2  ? 11.861  14.254  -19.950 1.00 0.00 ? 66  SER A CA   9  
ATOM   10698 C  C    . SER A 1 2  ? 11.480  13.247  -18.869 1.00 0.00 ? 66  SER A C    9  
ATOM   10699 O  O    . SER A 1 2  ? 10.345  12.775  -18.817 1.00 0.00 ? 66  SER A O    9  
ATOM   10700 C  CB   . SER A 1 2  ? 11.719  15.678  -19.410 1.00 0.00 ? 66  SER A CB   9  
ATOM   10701 O  OG   . SER A 1 2  ? 12.594  16.568  -20.082 1.00 0.00 ? 66  SER A OG   9  
ATOM   10702 H  H    . SER A 1 2  ? 10.160  13.642  -21.052 1.00 0.00 ? 66  SER A H    9  
ATOM   10703 H  HA   . SER A 1 2  ? 12.890  14.087  -20.235 1.00 0.00 ? 66  SER A HA   9  
ATOM   10704 H  HB2  . SER A 1 2  ? 10.704  16.014  -19.552 1.00 0.00 ? 66  SER A HB2  9  
ATOM   10705 H  HB3  . SER A 1 2  ? 11.957  15.685  -18.356 1.00 0.00 ? 66  SER A HB3  9  
ATOM   10706 H  HG   . SER A 1 2  ? 13.346  16.080  -20.424 1.00 0.00 ? 66  SER A HG   9  
ATOM   10707 N  N    . SER A 1 3  ? 12.439  12.923  -18.007 1.00 0.00 ? 67  SER A N    9  
ATOM   10708 C  CA   . SER A 1 3  ? 12.207  11.970  -16.928 1.00 0.00 ? 67  SER A CA   9  
ATOM   10709 C  C    . SER A 1 3  ? 11.461  12.629  -15.772 1.00 0.00 ? 67  SER A C    9  
ATOM   10710 O  O    . SER A 1 3  ? 11.700  13.790  -15.445 1.00 0.00 ? 67  SER A O    9  
ATOM   10711 C  CB   . SER A 1 3  ? 13.535  11.395  -16.432 1.00 0.00 ? 67  SER A CB   9  
ATOM   10712 O  OG   . SER A 1 3  ? 13.322  10.300  -15.559 1.00 0.00 ? 67  SER A OG   9  
ATOM   10713 H  H    . SER A 1 3  ? 13.324  13.333  -18.101 1.00 0.00 ? 67  SER A H    9  
ATOM   10714 H  HA   . SER A 1 3  ? 11.601  11.166  -17.321 1.00 0.00 ? 67  SER A HA   9  
ATOM   10715 H  HB2  . SER A 1 3  ? 14.117  11.059  -17.276 1.00 0.00 ? 67  SER A HB2  9  
ATOM   10716 H  HB3  . SER A 1 3  ? 14.080  12.163  -15.901 1.00 0.00 ? 67  SER A HB3  9  
ATOM   10717 H  HG   . SER A 1 3  ? 13.058  10.625  -14.695 1.00 0.00 ? 67  SER A HG   9  
ATOM   10718 N  N    . GLY A 1 4  ? 10.553  11.877  -15.156 1.00 0.00 ? 68  GLY A N    9  
ATOM   10719 C  CA   . GLY A 1 4  ? 9.785   12.404  -14.043 1.00 0.00 ? 68  GLY A CA   9  
ATOM   10720 C  C    . GLY A 1 4  ? 10.489  12.218  -12.713 1.00 0.00 ? 68  GLY A C    9  
ATOM   10721 O  O    . GLY A 1 4  ? 10.041  11.441  -11.869 1.00 0.00 ? 68  GLY A O    9  
ATOM   10722 H  H    . GLY A 1 4  ? 10.405  10.957  -15.460 1.00 0.00 ? 68  GLY A H    9  
ATOM   10723 H  HA2  . GLY A 1 4  ? 9.615   13.458  -14.204 1.00 0.00 ? 68  GLY A HA2  9  
ATOM   10724 H  HA3  . GLY A 1 4  ? 8.832   11.897  -14.006 1.00 0.00 ? 68  GLY A HA3  9  
ATOM   10725 N  N    . SER A 1 5  ? 11.595  12.931  -12.526 1.00 0.00 ? 69  SER A N    9  
ATOM   10726 C  CA   . SER A 1 5  ? 12.366  12.836  -11.292 1.00 0.00 ? 69  SER A CA   9  
ATOM   10727 C  C    . SER A 1 5  ? 11.972  13.944  -10.320 1.00 0.00 ? 69  SER A C    9  
ATOM   10728 O  O    . SER A 1 5  ? 11.678  13.686  -9.153  1.00 0.00 ? 69  SER A O    9  
ATOM   10729 C  CB   . SER A 1 5  ? 13.864  12.916  -11.593 1.00 0.00 ? 69  SER A CB   9  
ATOM   10730 O  OG   . SER A 1 5  ? 14.629  12.818  -10.405 1.00 0.00 ? 69  SER A OG   9  
ATOM   10731 H  H    . SER A 1 5  ? 11.902  13.532  -13.237 1.00 0.00 ? 69  SER A H    9  
ATOM   10732 H  HA   . SER A 1 5  ? 12.149  11.881  -10.838 1.00 0.00 ? 69  SER A HA   9  
ATOM   10733 H  HB2  . SER A 1 5  ? 14.139  12.106  -12.252 1.00 0.00 ? 69  SER A HB2  9  
ATOM   10734 H  HB3  . SER A 1 5  ? 14.082  13.859  -12.072 1.00 0.00 ? 69  SER A HB3  9  
ATOM   10735 H  HG   . SER A 1 5  ? 14.617  13.661  -9.946  1.00 0.00 ? 69  SER A HG   9  
ATOM   10736 N  N    . SER A 1 6  ? 11.968  15.180  -10.810 1.00 0.00 ? 70  SER A N    9  
ATOM   10737 C  CA   . SER A 1 6  ? 11.615  16.329  -9.985  1.00 0.00 ? 70  SER A CA   9  
ATOM   10738 C  C    . SER A 1 6  ? 10.158  16.250  -9.539  1.00 0.00 ? 70  SER A C    9  
ATOM   10739 O  O    . SER A 1 6  ? 9.846   16.430  -8.363  1.00 0.00 ? 70  SER A O    9  
ATOM   10740 C  CB   . SER A 1 6  ? 11.854  17.629  -10.755 1.00 0.00 ? 70  SER A CB   9  
ATOM   10741 O  OG   . SER A 1 6  ? 11.009  17.714  -11.889 1.00 0.00 ? 70  SER A OG   9  
ATOM   10742 H  H    . SER A 1 6  ? 12.212  15.322  -11.749 1.00 0.00 ? 70  SER A H    9  
ATOM   10743 H  HA   . SER A 1 6  ? 12.248  16.316  -9.110  1.00 0.00 ? 70  SER A HA   9  
ATOM   10744 H  HB2  . SER A 1 6  ? 11.654  18.470  -10.108 1.00 0.00 ? 70  SER A HB2  9  
ATOM   10745 H  HB3  . SER A 1 6  ? 12.883  17.665  -11.084 1.00 0.00 ? 70  SER A HB3  9  
ATOM   10746 H  HG   . SER A 1 6  ? 11.542  17.712  -12.687 1.00 0.00 ? 70  SER A HG   9  
ATOM   10747 N  N    . GLY A 1 7  ? 9.268   15.978  -10.490 1.00 0.00 ? 71  GLY A N    9  
ATOM   10748 C  CA   . GLY A 1 7  ? 7.855   15.880  -10.177 1.00 0.00 ? 71  GLY A CA   9  
ATOM   10749 C  C    . GLY A 1 7  ? 7.555   14.766  -9.193  1.00 0.00 ? 71  GLY A C    9  
ATOM   10750 O  O    . GLY A 1 7  ? 8.469   14.150  -8.646  1.00 0.00 ? 71  GLY A O    9  
ATOM   10751 H  H    . GLY A 1 7  ? 9.575   15.844  -11.411 1.00 0.00 ? 71  GLY A H    9  
ATOM   10752 H  HA2  . GLY A 1 7  ? 7.524   16.817  -9.755  1.00 0.00 ? 71  GLY A HA2  9  
ATOM   10753 H  HA3  . GLY A 1 7  ? 7.308   15.695  -11.090 1.00 0.00 ? 71  GLY A HA3  9  
ATOM   10754 N  N    . MET A 1 8  ? 6.271   14.508  -8.967  1.00 0.00 ? 72  MET A N    9  
ATOM   10755 C  CA   . MET A 1 8  ? 5.854   13.461  -8.041  1.00 0.00 ? 72  MET A CA   9  
ATOM   10756 C  C    . MET A 1 8  ? 6.185   12.080  -8.598  1.00 0.00 ? 72  MET A C    9  
ATOM   10757 O  O    . MET A 1 8  ? 6.547   11.943  -9.766  1.00 0.00 ? 72  MET A O    9  
ATOM   10758 C  CB   . MET A 1 8  ? 4.353   13.565  -7.763  1.00 0.00 ? 72  MET A CB   9  
ATOM   10759 C  CG   . MET A 1 8  ? 3.957   14.840  -7.035  1.00 0.00 ? 72  MET A CG   9  
ATOM   10760 S  SD   . MET A 1 8  ? 4.837   15.052  -5.476  1.00 0.00 ? 72  MET A SD   9  
ATOM   10761 C  CE   . MET A 1 8  ? 6.229   16.047  -6.005  1.00 0.00 ? 72  MET A CE   9  
ATOM   10762 H  H    . MET A 1 8  ? 5.587   15.033  -9.433  1.00 0.00 ? 72  MET A H    9  
ATOM   10763 H  HA   . MET A 1 8  ? 6.393   13.602  -7.117  1.00 0.00 ? 72  MET A HA   9  
ATOM   10764 H  HB2  . MET A 1 8  ? 3.821   13.533  -8.702  1.00 0.00 ? 72  MET A HB2  9  
ATOM   10765 H  HB3  . MET A 1 8  ? 4.051   12.723  -7.158  1.00 0.00 ? 72  MET A HB3  9  
ATOM   10766 H  HG2  . MET A 1 8  ? 4.175   15.685  -7.671  1.00 0.00 ? 72  MET A HG2  9  
ATOM   10767 H  HG3  . MET A 1 8  ? 2.897   14.808  -6.833  1.00 0.00 ? 72  MET A HG3  9  
ATOM   10768 H  HE1  . MET A 1 8  ? 5.924   17.080  -6.081  1.00 0.00 ? 72  MET A HE1  9  
ATOM   10769 H  HE2  . MET A 1 8  ? 7.029   15.960  -5.284  1.00 0.00 ? 72  MET A HE2  9  
ATOM   10770 H  HE3  . MET A 1 8  ? 6.573   15.701  -6.968  1.00 0.00 ? 72  MET A HE3  9  
ATOM   10771 N  N    . GLU A 1 9  ? 6.057   11.061  -7.754  1.00 0.00 ? 73  GLU A N    9  
ATOM   10772 C  CA   . GLU A 1 9  ? 6.344   9.691   -8.164  1.00 0.00 ? 73  GLU A CA   9  
ATOM   10773 C  C    . GLU A 1 9  ? 5.576   8.693   -7.302  1.00 0.00 ? 73  GLU A C    9  
ATOM   10774 O  O    . GLU A 1 9  ? 5.469   8.858   -6.086  1.00 0.00 ? 73  GLU A O    9  
ATOM   10775 C  CB   . GLU A 1 9  ? 7.846   9.411   -8.071  1.00 0.00 ? 73  GLU A CB   9  
ATOM   10776 C  CG   . GLU A 1 9  ? 8.352   9.271   -6.645  1.00 0.00 ? 73  GLU A CG   9  
ATOM   10777 C  CD   . GLU A 1 9  ? 9.847   9.494   -6.532  1.00 0.00 ? 73  GLU A CD   9  
ATOM   10778 O  OE1  . GLU A 1 9  ? 10.317  10.577  -6.940  1.00 0.00 ? 73  GLU A OE1  9  
ATOM   10779 O  OE2  . GLU A 1 9  ? 10.547  8.586   -6.037  1.00 0.00 ? 73  GLU A OE2  9  
ATOM   10780 H  H    . GLU A 1 9  ? 5.764   11.234  -6.836  1.00 0.00 ? 73  GLU A H    9  
ATOM   10781 H  HA   . GLU A 1 9  ? 6.030   9.579   -9.190  1.00 0.00 ? 73  GLU A HA   9  
ATOM   10782 H  HB2  . GLU A 1 9  ? 8.063   8.495   -8.600  1.00 0.00 ? 73  GLU A HB2  9  
ATOM   10783 H  HB3  . GLU A 1 9  ? 8.380   10.223  -8.542  1.00 0.00 ? 73  GLU A HB3  9  
ATOM   10784 H  HG2  . GLU A 1 9  ? 7.847   9.997   -6.025  1.00 0.00 ? 73  GLU A HG2  9  
ATOM   10785 H  HG3  . GLU A 1 9  ? 8.123   8.276   -6.291  1.00 0.00 ? 73  GLU A HG3  9  
ATOM   10786 N  N    . CYS A 1 10 ? 5.041   7.658   -7.941  1.00 0.00 ? 74  CYS A N    9  
ATOM   10787 C  CA   . CYS A 1 10 ? 4.281   6.633   -7.235  1.00 0.00 ? 74  CYS A CA   9  
ATOM   10788 C  C    . CYS A 1 10 ? 4.988   6.222   -5.946  1.00 0.00 ? 74  CYS A C    9  
ATOM   10789 O  O    . CYS A 1 10 ? 6.214   6.282   -5.853  1.00 0.00 ? 74  CYS A O    9  
ATOM   10790 C  CB   . CYS A 1 10 ? 4.080   5.409   -8.131  1.00 0.00 ? 74  CYS A CB   9  
ATOM   10791 S  SG   . CYS A 1 10 ? 3.032   4.114   -7.397  1.00 0.00 ? 74  CYS A SG   9  
ATOM   10792 H  H    . CYS A 1 10 ? 5.160   7.581   -8.911  1.00 0.00 ? 74  CYS A H    9  
ATOM   10793 H  HA   . CYS A 1 10 ? 3.317   7.048   -6.985  1.00 0.00 ? 74  CYS A HA   9  
ATOM   10794 H  HB2  . CYS A 1 10 ? 3.615   5.722   -9.055  1.00 0.00 ? 74  CYS A HB2  9  
ATOM   10795 H  HB3  . CYS A 1 10 ? 5.042   4.970   -8.349  1.00 0.00 ? 74  CYS A HB3  9  
ATOM   10796 N  N    . ARG A 1 11 ? 4.206   5.805   -4.956  1.00 0.00 ? 75  ARG A N    9  
ATOM   10797 C  CA   . ARG A 1 11 ? 4.756   5.385   -3.673  1.00 0.00 ? 75  ARG A CA   9  
ATOM   10798 C  C    . ARG A 1 11 ? 4.803   3.863   -3.573  1.00 0.00 ? 75  ARG A C    9  
ATOM   10799 O  O    . ARG A 1 11 ? 5.614   3.303   -2.834  1.00 0.00 ? 75  ARG A O    9  
ATOM   10800 C  CB   . ARG A 1 11 ? 3.922   5.956   -2.525  1.00 0.00 ? 75  ARG A CB   9  
ATOM   10801 C  CG   . ARG A 1 11 ? 3.679   7.452   -2.635  1.00 0.00 ? 75  ARG A CG   9  
ATOM   10802 C  CD   . ARG A 1 11 ? 4.787   8.248   -1.962  1.00 0.00 ? 75  ARG A CD   9  
ATOM   10803 N  NE   . ARG A 1 11 ? 5.904   8.503   -2.867  1.00 0.00 ? 75  ARG A NE   9  
ATOM   10804 C  CZ   . ARG A 1 11 ? 6.874   9.373   -2.610  1.00 0.00 ? 75  ARG A CZ   9  
ATOM   10805 N  NH1  . ARG A 1 11 ? 6.864   10.069  -1.481  1.00 0.00 ? 75  ARG A NH1  9  
ATOM   10806 N  NH2  . ARG A 1 11 ? 7.858   9.550   -3.484  1.00 0.00 ? 75  ARG A NH2  9  
ATOM   10807 H  H    . ARG A 1 11 ? 3.236   5.779   -5.091  1.00 0.00 ? 75  ARG A H    9  
ATOM   10808 H  HA   . ARG A 1 11 ? 5.763   5.770   -3.602  1.00 0.00 ? 75  ARG A HA   9  
ATOM   10809 H  HB2  . ARG A 1 11 ? 2.964   5.458   -2.509  1.00 0.00 ? 75  ARG A HB2  9  
ATOM   10810 H  HB3  . ARG A 1 11 ? 4.434   5.764   -1.594  1.00 0.00 ? 75  ARG A HB3  9  
ATOM   10811 H  HG2  . ARG A 1 11 ? 3.638   7.725   -3.679  1.00 0.00 ? 75  ARG A HG2  9  
ATOM   10812 H  HG3  . ARG A 1 11 ? 2.738   7.690   -2.161  1.00 0.00 ? 75  ARG A HG3  9  
ATOM   10813 H  HD2  . ARG A 1 11 ? 4.383   9.193   -1.630  1.00 0.00 ? 75  ARG A HD2  9  
ATOM   10814 H  HD3  . ARG A 1 11 ? 5.145   7.690   -1.110  1.00 0.00 ? 75  ARG A HD3  9  
ATOM   10815 H  HE   . ARG A 1 11 ? 5.932   8.000   -3.707  1.00 0.00 ? 75  ARG A HE   9  
ATOM   10816 H  HH11 . ARG A 1 11 ? 6.124   9.937   -0.821  1.00 0.00 ? 75  ARG A HH11 9  
ATOM   10817 H  HH12 . ARG A 1 11 ? 7.596   10.723  -1.290  1.00 0.00 ? 75  ARG A HH12 9  
ATOM   10818 H  HH21 . ARG A 1 11 ? 7.869   9.027   -4.336  1.00 0.00 ? 75  ARG A HH21 9  
ATOM   10819 H  HH22 . ARG A 1 11 ? 8.587   10.205  -3.290  1.00 0.00 ? 75  ARG A HH22 9  
ATOM   10820 N  N    . VAL A 1 12 ? 3.929   3.199   -4.322  1.00 0.00 ? 76  VAL A N    9  
ATOM   10821 C  CA   . VAL A 1 12 ? 3.871   1.742   -4.319  1.00 0.00 ? 76  VAL A CA   9  
ATOM   10822 C  C    . VAL A 1 12 ? 5.026   1.144   -5.115  1.00 0.00 ? 76  VAL A C    9  
ATOM   10823 O  O    . VAL A 1 12 ? 5.826   0.373   -4.584  1.00 0.00 ? 76  VAL A O    9  
ATOM   10824 C  CB   . VAL A 1 12 ? 2.540   1.232   -4.905  1.00 0.00 ? 76  VAL A CB   9  
ATOM   10825 C  CG1  . VAL A 1 12 ? 2.443   -0.280  -4.772  1.00 0.00 ? 76  VAL A CG1  9  
ATOM   10826 C  CG2  . VAL A 1 12 ? 1.363   1.912   -4.222  1.00 0.00 ? 76  VAL A CG2  9  
ATOM   10827 H  H    . VAL A 1 12 ? 3.308   3.700   -4.891  1.00 0.00 ? 76  VAL A H    9  
ATOM   10828 H  HA   . VAL A 1 12 ? 3.941   1.407   -3.294  1.00 0.00 ? 76  VAL A HA   9  
ATOM   10829 H  HB   . VAL A 1 12 ? 2.514   1.482   -5.955  1.00 0.00 ? 76  VAL A HB   9  
ATOM   10830 H  HG11 . VAL A 1 12 ? 1.650   -0.531  -4.084  1.00 0.00 ? 76  VAL A HG11 9  
ATOM   10831 H  HG12 . VAL A 1 12 ? 2.233   -0.714  -5.739  1.00 0.00 ? 76  VAL A HG12 9  
ATOM   10832 H  HG13 . VAL A 1 12 ? 3.379   -0.670  -4.399  1.00 0.00 ? 76  VAL A HG13 9  
ATOM   10833 H  HG21 . VAL A 1 12 ? 1.218   1.483   -3.242  1.00 0.00 ? 76  VAL A HG21 9  
ATOM   10834 H  HG22 . VAL A 1 12 ? 1.564   2.968   -4.127  1.00 0.00 ? 76  VAL A HG22 9  
ATOM   10835 H  HG23 . VAL A 1 12 ? 0.471   1.767   -4.814  1.00 0.00 ? 76  VAL A HG23 9  
ATOM   10836 N  N    . CYS A 1 13 ? 5.108   1.505   -6.391  1.00 0.00 ? 77  CYS A N    9  
ATOM   10837 C  CA   . CYS A 1 13 ? 6.165   1.005   -7.261  1.00 0.00 ? 77  CYS A CA   9  
ATOM   10838 C  C    . CYS A 1 13 ? 7.285   2.032   -7.401  1.00 0.00 ? 77  CYS A C    9  
ATOM   10839 O  O    . CYS A 1 13 ? 8.465   1.684   -7.391  1.00 0.00 ? 77  CYS A O    9  
ATOM   10840 C  CB   . CYS A 1 13 ? 5.598   0.661   -8.640  1.00 0.00 ? 77  CYS A CB   9  
ATOM   10841 S  SG   . CYS A 1 13 ? 5.208   2.113   -9.668  1.00 0.00 ? 77  CYS A SG   9  
ATOM   10842 H  H    . CYS A 1 13 ? 4.440   2.123   -6.757  1.00 0.00 ? 77  CYS A H    9  
ATOM   10843 H  HA   . CYS A 1 13 ? 6.568   0.110   -6.813  1.00 0.00 ? 77  CYS A HA   9  
ATOM   10844 H  HB2  . CYS A 1 13 ? 6.320   0.063   -9.178  1.00 0.00 ? 77  CYS A HB2  9  
ATOM   10845 H  HB3  . CYS A 1 13 ? 4.689   0.091   -8.516  1.00 0.00 ? 77  CYS A HB3  9  
ATOM   10846 N  N    . GLY A 1 14 ? 6.906   3.299   -7.532  1.00 0.00 ? 78  GLY A N    9  
ATOM   10847 C  CA   . GLY A 1 14 ? 7.889   4.357   -7.672  1.00 0.00 ? 78  GLY A CA   9  
ATOM   10848 C  C    . GLY A 1 14 ? 7.739   5.120   -8.974  1.00 0.00 ? 78  GLY A C    9  
ATOM   10849 O  O    . GLY A 1 14 ? 7.885   6.342   -9.006  1.00 0.00 ? 78  GLY A O    9  
ATOM   10850 H  H    . GLY A 1 14 ? 5.950   3.518   -7.534  1.00 0.00 ? 78  GLY A H    9  
ATOM   10851 H  HA2  . GLY A 1 14 ? 7.780   5.047   -6.848  1.00 0.00 ? 78  GLY A HA2  9  
ATOM   10852 H  HA3  . GLY A 1 14 ? 8.877   3.922   -7.636  1.00 0.00 ? 78  GLY A HA3  9  
ATOM   10853 N  N    . ASP A 1 15 ? 7.449   4.398   -10.050 1.00 0.00 ? 79  ASP A N    9  
ATOM   10854 C  CA   . ASP A 1 15 ? 7.280   5.014   -11.361 1.00 0.00 ? 79  ASP A CA   9  
ATOM   10855 C  C    . ASP A 1 15 ? 6.478   6.307   -11.255 1.00 0.00 ? 79  ASP A C    9  
ATOM   10856 O  O    . ASP A 1 15 ? 5.654   6.467   -10.354 1.00 0.00 ? 79  ASP A O    9  
ATOM   10857 C  CB   . ASP A 1 15 ? 6.583   4.045   -12.318 1.00 0.00 ? 79  ASP A CB   9  
ATOM   10858 C  CG   . ASP A 1 15 ? 6.384   4.637   -13.699 1.00 0.00 ? 79  ASP A CG   9  
ATOM   10859 O  OD1  . ASP A 1 15 ? 7.351   4.636   -14.489 1.00 0.00 ? 79  ASP A OD1  9  
ATOM   10860 O  OD2  . ASP A 1 15 ? 5.262   5.103   -13.990 1.00 0.00 ? 79  ASP A OD2  9  
ATOM   10861 H  H    . ASP A 1 15 ? 7.345   3.427   -9.961  1.00 0.00 ? 79  ASP A H    9  
ATOM   10862 H  HA   . ASP A 1 15 ? 8.261   5.244   -11.749 1.00 0.00 ? 79  ASP A HA   9  
ATOM   10863 H  HB2  . ASP A 1 15 ? 7.181   3.150   -12.413 1.00 0.00 ? 79  ASP A HB2  9  
ATOM   10864 H  HB3  . ASP A 1 15 ? 5.615   3.785   -11.914 1.00 0.00 ? 79  ASP A HB3  9  
ATOM   10865 N  N    . LYS A 1 16 ? 6.727   7.229   -12.179 1.00 0.00 ? 80  LYS A N    9  
ATOM   10866 C  CA   . LYS A 1 16 ? 6.029   8.509   -12.190 1.00 0.00 ? 80  LYS A CA   9  
ATOM   10867 C  C    . LYS A 1 16 ? 4.585   8.346   -11.729 1.00 0.00 ? 80  LYS A C    9  
ATOM   10868 O  O    . LYS A 1 16 ? 3.900   7.404   -12.125 1.00 0.00 ? 80  LYS A O    9  
ATOM   10869 C  CB   . LYS A 1 16 ? 6.062   9.119   -13.593 1.00 0.00 ? 80  LYS A CB   9  
ATOM   10870 C  CG   . LYS A 1 16 ? 5.787   10.613  -13.614 1.00 0.00 ? 80  LYS A CG   9  
ATOM   10871 C  CD   . LYS A 1 16 ? 5.142   11.043  -14.921 1.00 0.00 ? 80  LYS A CD   9  
ATOM   10872 C  CE   . LYS A 1 16 ? 4.675   12.489  -14.862 1.00 0.00 ? 80  LYS A CE   9  
ATOM   10873 N  NZ   . LYS A 1 16 ? 3.579   12.758  -15.834 1.00 0.00 ? 80  LYS A NZ   9  
ATOM   10874 H  H    . LYS A 1 16 ? 7.396   7.043   -12.871 1.00 0.00 ? 80  LYS A H    9  
ATOM   10875 H  HA   . LYS A 1 16 ? 6.540   9.171   -11.507 1.00 0.00 ? 80  LYS A HA   9  
ATOM   10876 H  HB2  . LYS A 1 16 ? 7.037   8.947   -14.025 1.00 0.00 ? 80  LYS A HB2  9  
ATOM   10877 H  HB3  . LYS A 1 16 ? 5.317   8.629   -14.203 1.00 0.00 ? 80  LYS A HB3  9  
ATOM   10878 H  HG2  . LYS A 1 16 ? 5.123   10.859  -12.799 1.00 0.00 ? 80  LYS A HG2  9  
ATOM   10879 H  HG3  . LYS A 1 16 ? 6.721   11.143  -13.493 1.00 0.00 ? 80  LYS A HG3  9  
ATOM   10880 H  HD2  . LYS A 1 16 ? 5.862   10.941  -15.719 1.00 0.00 ? 80  LYS A HD2  9  
ATOM   10881 H  HD3  . LYS A 1 16 ? 4.291   10.407  -15.118 1.00 0.00 ? 80  LYS A HD3  9  
ATOM   10882 H  HE2  . LYS A 1 16 ? 4.321   12.699  -13.865 1.00 0.00 ? 80  LYS A HE2  9  
ATOM   10883 H  HE3  . LYS A 1 16 ? 5.512   13.133  -15.090 1.00 0.00 ? 80  LYS A HE3  9  
ATOM   10884 H  HZ1  . LYS A 1 16 ? 3.457   13.783  -15.960 1.00 0.00 ? 80  LYS A HZ1  9  
ATOM   10885 H  HZ2  . LYS A 1 16 ? 2.686   12.354  -15.485 1.00 0.00 ? 80  LYS A HZ2  9  
ATOM   10886 H  HZ3  . LYS A 1 16 ? 3.804   12.330  -16.754 1.00 0.00 ? 80  LYS A HZ3  9  
ATOM   10887 N  N    . ALA A 1 17 ? 4.128   9.270   -10.890 1.00 0.00 ? 81  ALA A N    9  
ATOM   10888 C  CA   . ALA A 1 17 ? 2.764   9.230   -10.379 1.00 0.00 ? 81  ALA A CA   9  
ATOM   10889 C  C    . ALA A 1 17 ? 1.804   9.954   -11.317 1.00 0.00 ? 81  ALA A C    9  
ATOM   10890 O  O    . ALA A 1 17 ? 2.144   10.988  -11.892 1.00 0.00 ? 81  ALA A O    9  
ATOM   10891 C  CB   . ALA A 1 17 ? 2.704   9.840   -8.986  1.00 0.00 ? 81  ALA A CB   9  
ATOM   10892 H  H    . ALA A 1 17 ? 4.722   9.998   -10.611 1.00 0.00 ? 81  ALA A H    9  
ATOM   10893 H  HA   . ALA A 1 17 ? 2.465   8.194   -10.304 1.00 0.00 ? 81  ALA A HA   9  
ATOM   10894 H  HB1  . ALA A 1 17 ? 2.331   9.106   -8.288  1.00 0.00 ? 81  ALA A HB1  9  
ATOM   10895 H  HB2  . ALA A 1 17 ? 3.695   10.151  -8.688  1.00 0.00 ? 81  ALA A HB2  9  
ATOM   10896 H  HB3  . ALA A 1 17 ? 2.046   10.696  -8.996  1.00 0.00 ? 81  ALA A HB3  9  
ATOM   10897 N  N    . SER A 1 18 ? 0.603   9.404   -11.467 1.00 0.00 ? 82  SER A N    9  
ATOM   10898 C  CA   . SER A 1 18 ? -0.405  9.995   -12.340 1.00 0.00 ? 82  SER A CA   9  
ATOM   10899 C  C    . SER A 1 18 ? -1.303  10.952  -11.562 1.00 0.00 ? 82  SER A C    9  
ATOM   10900 O  O    . SER A 1 18 ? -1.676  12.014  -12.059 1.00 0.00 ? 82  SER A O    9  
ATOM   10901 C  CB   . SER A 1 18 ? -1.251  8.900   -12.992 1.00 0.00 ? 82  SER A CB   9  
ATOM   10902 O  OG   . SER A 1 18 ? -2.233  9.456   -13.849 1.00 0.00 ? 82  SER A OG   9  
ATOM   10903 H  H    . SER A 1 18 ? 0.391   8.579   -10.982 1.00 0.00 ? 82  SER A H    9  
ATOM   10904 H  HA   . SER A 1 18 ? 0.109   10.549  -13.112 1.00 0.00 ? 82  SER A HA   9  
ATOM   10905 H  HB2  . SER A 1 18 ? -0.611  8.251   -13.571 1.00 0.00 ? 82  SER A HB2  9  
ATOM   10906 H  HB3  . SER A 1 18 ? -1.746  8.325   -12.222 1.00 0.00 ? 82  SER A HB3  9  
ATOM   10907 H  HG   . SER A 1 18 ? -2.781  8.754   -14.207 1.00 0.00 ? 82  SER A HG   9  
ATOM   10908 N  N    . GLY A 1 19 ? -1.647  10.567  -10.337 1.00 0.00 ? 83  GLY A N    9  
ATOM   10909 C  CA   . GLY A 1 19 ? -2.499  11.400  -9.509  1.00 0.00 ? 83  GLY A CA   9  
ATOM   10910 C  C    . GLY A 1 19 ? -2.397  11.052  -8.037  1.00 0.00 ? 83  GLY A C    9  
ATOM   10911 O  O    . GLY A 1 19 ? -1.412  10.456  -7.599  1.00 0.00 ? 83  GLY A O    9  
ATOM   10912 H  H    . GLY A 1 19 ? -1.320  9.709   -9.992  1.00 0.00 ? 83  GLY A H    9  
ATOM   10913 H  HA2  . GLY A 1 19 ? -2.214  12.433  -9.644  1.00 0.00 ? 83  GLY A HA2  9  
ATOM   10914 H  HA3  . GLY A 1 19 ? -3.524  11.275  -9.826  1.00 0.00 ? 83  GLY A HA3  9  
ATOM   10915 N  N    . PHE A 1 20 ? -3.415  11.427  -7.270  1.00 0.00 ? 84  PHE A N    9  
ATOM   10916 C  CA   . PHE A 1 20 ? -3.435  11.153  -5.838  1.00 0.00 ? 84  PHE A CA   9  
ATOM   10917 C  C    . PHE A 1 20 ? -4.671  10.344  -5.456  1.00 0.00 ? 84  PHE A C    9  
ATOM   10918 O  O    . PHE A 1 20 ? -5.714  10.905  -5.117  1.00 0.00 ? 84  PHE A O    9  
ATOM   10919 C  CB   . PHE A 1 20 ? -3.403  12.462  -5.046  1.00 0.00 ? 84  PHE A CB   9  
ATOM   10920 C  CG   . PHE A 1 20 ? -2.858  12.308  -3.655  1.00 0.00 ? 84  PHE A CG   9  
ATOM   10921 C  CD1  . PHE A 1 20 ? -1.682  11.610  -3.431  1.00 0.00 ? 84  PHE A CD1  9  
ATOM   10922 C  CD2  . PHE A 1 20 ? -3.521  12.861  -2.572  1.00 0.00 ? 84  PHE A CD2  9  
ATOM   10923 C  CE1  . PHE A 1 20 ? -1.178  11.467  -2.152  1.00 0.00 ? 84  PHE A CE1  9  
ATOM   10924 C  CE2  . PHE A 1 20 ? -3.022  12.722  -1.290  1.00 0.00 ? 84  PHE A CE2  9  
ATOM   10925 C  CZ   . PHE A 1 20 ? -1.848  12.024  -1.080  1.00 0.00 ? 84  PHE A CZ   9  
ATOM   10926 H  H    . PHE A 1 20 ? -4.172  11.899  -7.677  1.00 0.00 ? 84  PHE A H    9  
ATOM   10927 H  HA   . PHE A 1 20 ? -2.554  10.576  -5.599  1.00 0.00 ? 84  PHE A HA   9  
ATOM   10928 H  HB2  . PHE A 1 20 ? -2.783  13.175  -5.568  1.00 0.00 ? 84  PHE A HB2  9  
ATOM   10929 H  HB3  . PHE A 1 20 ? -4.407  12.852  -4.969  1.00 0.00 ? 84  PHE A HB3  9  
ATOM   10930 H  HD1  . PHE A 1 20 ? -1.156  11.175  -4.268  1.00 0.00 ? 84  PHE A HD1  9  
ATOM   10931 H  HD2  . PHE A 1 20 ? -4.439  13.408  -2.735  1.00 0.00 ? 84  PHE A HD2  9  
ATOM   10932 H  HE1  . PHE A 1 20 ? -0.261  10.921  -1.990  1.00 0.00 ? 84  PHE A HE1  9  
ATOM   10933 H  HE2  . PHE A 1 20 ? -3.548  13.159  -0.455  1.00 0.00 ? 84  PHE A HE2  9  
ATOM   10934 H  HZ   . PHE A 1 20 ? -1.457  11.913  -0.080  1.00 0.00 ? 84  PHE A HZ   9  
ATOM   10935 N  N    . HIS A 1 21 ? -4.547  9.021   -5.514  1.00 0.00 ? 85  HIS A N    9  
ATOM   10936 C  CA   . HIS A 1 21 ? -5.653  8.134   -5.174  1.00 0.00 ? 85  HIS A CA   9  
ATOM   10937 C  C    . HIS A 1 21 ? -5.413  7.457   -3.828  1.00 0.00 ? 85  HIS A C    9  
ATOM   10938 O  O    . HIS A 1 21 ? -4.291  7.061   -3.513  1.00 0.00 ? 85  HIS A O    9  
ATOM   10939 C  CB   . HIS A 1 21 ? -5.841  7.078   -6.263  1.00 0.00 ? 85  HIS A CB   9  
ATOM   10940 C  CG   . HIS A 1 21 ? -5.758  7.630   -7.653  1.00 0.00 ? 85  HIS A CG   9  
ATOM   10941 N  ND1  . HIS A 1 21 ? -6.755  8.394   -8.220  1.00 0.00 ? 85  HIS A ND1  9  
ATOM   10942 C  CD2  . HIS A 1 21 ? -4.787  7.525   -8.590  1.00 0.00 ? 85  HIS A CD2  9  
ATOM   10943 C  CE1  . HIS A 1 21 ? -6.402  8.735   -9.447  1.00 0.00 ? 85  HIS A CE1  9  
ATOM   10944 N  NE2  . HIS A 1 21 ? -5.211  8.221   -9.696  1.00 0.00 ? 85  HIS A NE2  9  
ATOM   10945 H  H    . HIS A 1 21 ? -3.691  8.634   -5.791  1.00 0.00 ? 85  HIS A H    9  
ATOM   10946 H  HA   . HIS A 1 21 ? -6.550  8.732   -5.107  1.00 0.00 ? 85  HIS A HA   9  
ATOM   10947 H  HB2  . HIS A 1 21 ? -5.074  6.324   -6.160  1.00 0.00 ? 85  HIS A HB2  9  
ATOM   10948 H  HB3  . HIS A 1 21 ? -6.811  6.617   -6.146  1.00 0.00 ? 85  HIS A HB3  9  
ATOM   10949 H  HD1  . HIS A 1 21 ? -7.597  8.647   -7.789  1.00 0.00 ? 85  HIS A HD1  9  
ATOM   10950 H  HD2  . HIS A 1 21 ? -3.851  6.994   -8.488  1.00 0.00 ? 85  HIS A HD2  9  
ATOM   10951 H  HE1  . HIS A 1 21 ? -6.987  9.332   -10.130 1.00 0.00 ? 85  HIS A HE1  9  
ATOM   10952 N  N    . TYR A 1 22 ? -6.474  7.328   -3.038  1.00 0.00 ? 86  TYR A N    9  
ATOM   10953 C  CA   . TYR A 1 22 ? -6.377  6.702   -1.725  1.00 0.00 ? 86  TYR A CA   9  
ATOM   10954 C  C    . TYR A 1 22 ? -5.491  7.524   -0.793  1.00 0.00 ? 86  TYR A C    9  
ATOM   10955 O  O    . TYR A 1 22 ? -4.865  6.987   0.120   1.00 0.00 ? 86  TYR A O    9  
ATOM   10956 C  CB   . TYR A 1 22 ? -5.823  5.282   -1.853  1.00 0.00 ? 86  TYR A CB   9  
ATOM   10957 C  CG   . TYR A 1 22 ? -6.460  4.482   -2.967  1.00 0.00 ? 86  TYR A CG   9  
ATOM   10958 C  CD1  . TYR A 1 22 ? -7.599  3.719   -2.737  1.00 0.00 ? 86  TYR A CD1  9  
ATOM   10959 C  CD2  . TYR A 1 22 ? -5.923  4.487   -4.248  1.00 0.00 ? 86  TYR A CD2  9  
ATOM   10960 C  CE1  . TYR A 1 22 ? -8.184  2.986   -3.751  1.00 0.00 ? 86  TYR A CE1  9  
ATOM   10961 C  CE2  . TYR A 1 22 ? -6.502  3.758   -5.268  1.00 0.00 ? 86  TYR A CE2  9  
ATOM   10962 C  CZ   . TYR A 1 22 ? -7.632  3.009   -5.015  1.00 0.00 ? 86  TYR A CZ   9  
ATOM   10963 O  OH   . TYR A 1 22 ? -8.211  2.280   -6.028  1.00 0.00 ? 86  TYR A OH   9  
ATOM   10964 H  H    . TYR A 1 22 ? -7.342  7.664   -3.345  1.00 0.00 ? 86  TYR A H    9  
ATOM   10965 H  HA   . TYR A 1 22 ? -7.372  6.653   -1.307  1.00 0.00 ? 86  TYR A HA   9  
ATOM   10966 H  HB2  . TYR A 1 22 ? -4.763  5.333   -2.047  1.00 0.00 ? 86  TYR A HB2  9  
ATOM   10967 H  HB3  . TYR A 1 22 ? -5.990  4.753   -0.927  1.00 0.00 ? 86  TYR A HB3  9  
ATOM   10968 H  HD1  . TYR A 1 22 ? -8.029  3.703   -1.746  1.00 0.00 ? 86  TYR A HD1  9  
ATOM   10969 H  HD2  . TYR A 1 22 ? -5.037  5.075   -4.443  1.00 0.00 ? 86  TYR A HD2  9  
ATOM   10970 H  HE1  . TYR A 1 22 ? -9.069  2.399   -3.553  1.00 0.00 ? 86  TYR A HE1  9  
ATOM   10971 H  HE2  . TYR A 1 22 ? -6.070  3.775   -6.258  1.00 0.00 ? 86  TYR A HE2  9  
ATOM   10972 H  HH   . TYR A 1 22 ? -9.082  1.985   -5.753  1.00 0.00 ? 86  TYR A HH   9  
ATOM   10973 N  N    . GLY A 1 23 ? -5.445  8.831   -1.032  1.00 0.00 ? 87  GLY A N    9  
ATOM   10974 C  CA   . GLY A 1 23 ? -4.635  9.707   -0.206  1.00 0.00 ? 87  GLY A CA   9  
ATOM   10975 C  C    . GLY A 1 23 ? -3.157  9.381   -0.292  1.00 0.00 ? 87  GLY A C    9  
ATOM   10976 O  O    . GLY A 1 23 ? -2.378  9.762   0.582   1.00 0.00 ? 87  GLY A O    9  
ATOM   10977 H  H    . GLY A 1 23 ? -5.966  9.204   -1.774  1.00 0.00 ? 87  GLY A H    9  
ATOM   10978 H  HA2  . GLY A 1 23 ? -4.787  10.727  -0.526  1.00 0.00 ? 87  GLY A HA2  9  
ATOM   10979 H  HA3  . GLY A 1 23 ? -4.953  9.611   0.821   1.00 0.00 ? 87  GLY A HA3  9  
ATOM   10980 N  N    . VAL A 1 24 ? -2.769  8.671   -1.347  1.00 0.00 ? 88  VAL A N    9  
ATOM   10981 C  CA   . VAL A 1 24 ? -1.375  8.293   -1.543  1.00 0.00 ? 88  VAL A CA   9  
ATOM   10982 C  C    . VAL A 1 24 ? -0.964  8.448   -3.003  1.00 0.00 ? 88  VAL A C    9  
ATOM   10983 O  O    . VAL A 1 24 ? -1.726  8.119   -3.913  1.00 0.00 ? 88  VAL A O    9  
ATOM   10984 C  CB   . VAL A 1 24 ? -1.120  6.840   -1.102  1.00 0.00 ? 88  VAL A CB   9  
ATOM   10985 C  CG1  . VAL A 1 24 ? -1.672  5.864   -2.130  1.00 0.00 ? 88  VAL A CG1  9  
ATOM   10986 C  CG2  . VAL A 1 24 ? 0.366   6.605   -0.875  1.00 0.00 ? 88  VAL A CG2  9  
ATOM   10987 H  H    . VAL A 1 24 ? -3.437  8.397   -2.010  1.00 0.00 ? 88  VAL A H    9  
ATOM   10988 H  HA   . VAL A 1 24 ? -0.763  8.944   -0.936  1.00 0.00 ? 88  VAL A HA   9  
ATOM   10989 H  HB   . VAL A 1 24 ? -1.636  6.673   -0.167  1.00 0.00 ? 88  VAL A HB   9  
ATOM   10990 H  HG11 . VAL A 1 24 ? -1.173  6.018   -3.076  1.00 0.00 ? 88  VAL A HG11 9  
ATOM   10991 H  HG12 . VAL A 1 24 ? -1.504  4.852   -1.793  1.00 0.00 ? 88  VAL A HG12 9  
ATOM   10992 H  HG13 . VAL A 1 24 ? -2.732  6.032   -2.253  1.00 0.00 ? 88  VAL A HG13 9  
ATOM   10993 H  HG21 . VAL A 1 24 ? 0.562   6.536   0.184   1.00 0.00 ? 88  VAL A HG21 9  
ATOM   10994 H  HG22 . VAL A 1 24 ? 0.661   5.685   -1.357  1.00 0.00 ? 88  VAL A HG22 9  
ATOM   10995 H  HG23 . VAL A 1 24 ? 0.928   7.427   -1.293  1.00 0.00 ? 88  VAL A HG23 9  
ATOM   10996 N  N    . HIS A 1 25 ? 0.247   8.952   -3.221  1.00 0.00 ? 89  HIS A N    9  
ATOM   10997 C  CA   . HIS A 1 25 ? 0.761   9.150   -4.572  1.00 0.00 ? 89  HIS A CA   9  
ATOM   10998 C  C    . HIS A 1 25 ? 0.996   7.812   -5.265  1.00 0.00 ? 89  HIS A C    9  
ATOM   10999 O  O    . HIS A 1 25 ? 2.077   7.232   -5.166  1.00 0.00 ? 89  HIS A O    9  
ATOM   11000 C  CB   . HIS A 1 25 ? 2.062   9.953   -4.532  1.00 0.00 ? 89  HIS A CB   9  
ATOM   11001 C  CG   . HIS A 1 25 ? 1.852   11.436  -4.557  1.00 0.00 ? 89  HIS A CG   9  
ATOM   11002 N  ND1  . HIS A 1 25 ? 1.792   12.207  -3.416  1.00 0.00 ? 89  HIS A ND1  9  
ATOM   11003 C  CD2  . HIS A 1 25 ? 1.689   12.289  -5.595  1.00 0.00 ? 89  HIS A CD2  9  
ATOM   11004 C  CE1  . HIS A 1 25 ? 1.599   13.470  -3.750  1.00 0.00 ? 89  HIS A CE1  9  
ATOM   11005 N  NE2  . HIS A 1 25 ? 1.534   13.547  -5.067  1.00 0.00 ? 89  HIS A NE2  9  
ATOM   11006 H  H    . HIS A 1 25 ? 0.808   9.196   -2.455  1.00 0.00 ? 89  HIS A H    9  
ATOM   11007 H  HA   . HIS A 1 25 ? 0.022   9.706   -5.129  1.00 0.00 ? 89  HIS A HA   9  
ATOM   11008 H  HB2  . HIS A 1 25 ? 2.600   9.710   -3.627  1.00 0.00 ? 89  HIS A HB2  9  
ATOM   11009 H  HB3  . HIS A 1 25 ? 2.667   9.688   -5.387  1.00 0.00 ? 89  HIS A HB3  9  
ATOM   11010 H  HD1  . HIS A 1 25 ? 1.876   11.877  -2.497  1.00 0.00 ? 89  HIS A HD1  9  
ATOM   11011 H  HD2  . HIS A 1 25 ? 1.682   12.030  -6.645  1.00 0.00 ? 89  HIS A HD2  9  
ATOM   11012 H  HE1  . HIS A 1 25 ? 1.511   14.299  -3.064  1.00 0.00 ? 89  HIS A HE1  9  
ATOM   11013 N  N    . ALA A 1 26 ? -0.023  7.327   -5.967  1.00 0.00 ? 90  ALA A N    9  
ATOM   11014 C  CA   . ALA A 1 26 ? 0.073   6.059   -6.678  1.00 0.00 ? 90  ALA A CA   9  
ATOM   11015 C  C    . ALA A 1 26 ? -0.121  6.254   -8.177  1.00 0.00 ? 90  ALA A C    9  
ATOM   11016 O  O    . ALA A 1 26 ? -0.720  7.237   -8.614  1.00 0.00 ? 90  ALA A O    9  
ATOM   11017 C  CB   . ALA A 1 26 ? -0.949  5.071   -6.135  1.00 0.00 ? 90  ALA A CB   9  
ATOM   11018 H  H    . ALA A 1 26 ? -0.860  7.836   -6.008  1.00 0.00 ? 90  ALA A H    9  
ATOM   11019 H  HA   . ALA A 1 26 ? 1.058   5.652   -6.502  1.00 0.00 ? 90  ALA A HA   9  
ATOM   11020 H  HB1  . ALA A 1 26 ? -0.894  4.151   -6.697  1.00 0.00 ? 90  ALA A HB1  9  
ATOM   11021 H  HB2  . ALA A 1 26 ? -0.738  4.871   -5.095  1.00 0.00 ? 90  ALA A HB2  9  
ATOM   11022 H  HB3  . ALA A 1 26 ? -1.940  5.491   -6.228  1.00 0.00 ? 90  ALA A HB3  9  
ATOM   11023 N  N    . CYS A 1 27 ? 0.389   5.311   -8.963  1.00 0.00 ? 91  CYS A N    9  
ATOM   11024 C  CA   . CYS A 1 27 ? 0.274   5.379   -10.414 1.00 0.00 ? 91  CYS A CA   9  
ATOM   11025 C  C    . CYS A 1 27 ? -0.926  4.572   -10.903 1.00 0.00 ? 91  CYS A C    9  
ATOM   11026 O  O    . CYS A 1 27 ? -1.571  3.869   -10.126 1.00 0.00 ? 91  CYS A O    9  
ATOM   11027 C  CB   . CYS A 1 27 ? 1.553   4.861   -11.074 1.00 0.00 ? 91  CYS A CB   9  
ATOM   11028 S  SG   . CYS A 1 27 ? 1.809   3.066   -10.892 1.00 0.00 ? 91  CYS A SG   9  
ATOM   11029 H  H    . CYS A 1 27 ? 0.856   4.550   -8.556  1.00 0.00 ? 91  CYS A H    9  
ATOM   11030 H  HA   . CYS A 1 27 ? 0.132   6.413   -10.688 1.00 0.00 ? 91  CYS A HA   9  
ATOM   11031 H  HB2  . CYS A 1 27 ? 1.519   5.082   -12.131 1.00 0.00 ? 91  CYS A HB2  9  
ATOM   11032 H  HB3  . CYS A 1 27 ? 2.404   5.361   -10.634 1.00 0.00 ? 91  CYS A HB3  9  
ATOM   11033 N  N    . GLU A 1 28 ? -1.217  4.679   -12.196 1.00 0.00 ? 92  GLU A N    9  
ATOM   11034 C  CA   . GLU A 1 28 ? -2.339  3.960   -12.787 1.00 0.00 ? 92  GLU A CA   9  
ATOM   11035 C  C    . GLU A 1 28 ? -2.219  2.460   -12.533 1.00 0.00 ? 92  GLU A C    9  
ATOM   11036 O  O    . GLU A 1 28 ? -3.169  1.816   -12.091 1.00 0.00 ? 92  GLU A O    9  
ATOM   11037 C  CB   . GLU A 1 28 ? -2.411  4.230   -14.292 1.00 0.00 ? 92  GLU A CB   9  
ATOM   11038 C  CG   . GLU A 1 28 ? -2.921  5.618   -14.637 1.00 0.00 ? 92  GLU A CG   9  
ATOM   11039 C  CD   . GLU A 1 28 ? -3.333  5.743   -16.092 1.00 0.00 ? 92  GLU A CD   9  
ATOM   11040 O  OE1  . GLU A 1 28 ? -4.471  5.347   -16.422 1.00 0.00 ? 92  GLU A OE1  9  
ATOM   11041 O  OE2  . GLU A 1 28 ? -2.518  6.236   -16.899 1.00 0.00 ? 92  GLU A OE2  9  
ATOM   11042 H  H    . GLU A 1 28 ? -0.665  5.256   -12.764 1.00 0.00 ? 92  GLU A H    9  
ATOM   11043 H  HA   . GLU A 1 28 ? -3.245  4.320   -12.323 1.00 0.00 ? 92  GLU A HA   9  
ATOM   11044 H  HB2  . GLU A 1 28 ? -1.423  4.116   -14.713 1.00 0.00 ? 92  GLU A HB2  9  
ATOM   11045 H  HB3  . GLU A 1 28 ? -3.070  3.504   -14.744 1.00 0.00 ? 92  GLU A HB3  9  
ATOM   11046 H  HG2  . GLU A 1 28 ? -3.778  5.838   -14.017 1.00 0.00 ? 92  GLU A HG2  9  
ATOM   11047 H  HG3  . GLU A 1 28 ? -2.140  6.336   -14.437 1.00 0.00 ? 92  GLU A HG3  9  
ATOM   11048 N  N    . GLY A 1 29 ? -1.042  1.911   -12.817 1.00 0.00 ? 93  GLY A N    9  
ATOM   11049 C  CA   . GLY A 1 29 ? -0.818  0.491   -12.615 1.00 0.00 ? 93  GLY A CA   9  
ATOM   11050 C  C    . GLY A 1 29 ? -1.179  0.041   -11.213 1.00 0.00 ? 93  GLY A C    9  
ATOM   11051 O  O    . GLY A 1 29 ? -2.169  -0.664  -11.015 1.00 0.00 ? 93  GLY A O    9  
ATOM   11052 H  H    . GLY A 1 29 ? -0.320  2.473   -13.167 1.00 0.00 ? 93  GLY A H    9  
ATOM   11053 H  HA2  . GLY A 1 29 ? -1.415  -0.061  -13.324 1.00 0.00 ? 93  GLY A HA2  9  
ATOM   11054 H  HA3  . GLY A 1 29 ? 0.225   0.274   -12.792 1.00 0.00 ? 93  GLY A HA3  9  
ATOM   11055 N  N    . CYS A 1 30 ? -0.375  0.448   -10.237 1.00 0.00 ? 94  CYS A N    9  
ATOM   11056 C  CA   . CYS A 1 30 ? -0.613  0.081   -8.846  1.00 0.00 ? 94  CYS A CA   9  
ATOM   11057 C  C    . CYS A 1 30 ? -2.044  0.414   -8.433  1.00 0.00 ? 94  CYS A C    9  
ATOM   11058 O  O    . CYS A 1 30 ? -2.737  -0.409  -7.836  1.00 0.00 ? 94  CYS A O    9  
ATOM   11059 C  CB   . CYS A 1 30 ? 0.375   0.805   -7.930  1.00 0.00 ? 94  CYS A CB   9  
ATOM   11060 S  SG   . CYS A 1 30 ? 2.125   0.490   -8.327  1.00 0.00 ? 94  CYS A SG   9  
ATOM   11061 H  H    . CYS A 1 30 ? 0.399   1.009   -10.457 1.00 0.00 ? 94  CYS A H    9  
ATOM   11062 H  HA   . CYS A 1 30 ? -0.463  -0.983  -8.753  1.00 0.00 ? 94  CYS A HA   9  
ATOM   11063 H  HB2  . CYS A 1 30 ? 0.209   1.870   -8.003  1.00 0.00 ? 94  CYS A HB2  9  
ATOM   11064 H  HB3  . CYS A 1 30 ? 0.207   0.490   -6.911  1.00 0.00 ? 94  CYS A HB3  9  
ATOM   11065 N  N    . LYS A 1 31 ? -2.480  1.627   -8.756  1.00 0.00 ? 95  LYS A N    9  
ATOM   11066 C  CA   . LYS A 1 31 ? -3.828  2.070   -8.421  1.00 0.00 ? 95  LYS A CA   9  
ATOM   11067 C  C    . LYS A 1 31 ? -4.845  0.964   -8.683  1.00 0.00 ? 95  LYS A C    9  
ATOM   11068 O  O    . LYS A 1 31 ? -5.672  0.652   -7.827  1.00 0.00 ? 95  LYS A O    9  
ATOM   11069 C  CB   . LYS A 1 31 ? -4.194  3.316   -9.232  1.00 0.00 ? 95  LYS A CB   9  
ATOM   11070 C  CG   . LYS A 1 31 ? -5.654  3.716   -9.107  1.00 0.00 ? 95  LYS A CG   9  
ATOM   11071 C  CD   . LYS A 1 31 ? -6.141  4.444   -10.348 1.00 0.00 ? 95  LYS A CD   9  
ATOM   11072 C  CE   . LYS A 1 31 ? -7.643  4.675   -10.305 1.00 0.00 ? 95  LYS A CE   9  
ATOM   11073 N  NZ   . LYS A 1 31 ? -8.199  4.965   -11.656 1.00 0.00 ? 95  LYS A NZ   9  
ATOM   11074 H  H    . LYS A 1 31 ? -1.880  2.239   -9.233  1.00 0.00 ? 95  LYS A H    9  
ATOM   11075 H  HA   . LYS A 1 31 ? -3.845  2.317   -7.371  1.00 0.00 ? 95  LYS A HA   9  
ATOM   11076 H  HB2  . LYS A 1 31 ? -3.585  4.142   -8.894  1.00 0.00 ? 95  LYS A HB2  9  
ATOM   11077 H  HB3  . LYS A 1 31 ? -3.982  3.127   -10.275 1.00 0.00 ? 95  LYS A HB3  9  
ATOM   11078 H  HG2  . LYS A 1 31 ? -6.251  2.827   -8.966  1.00 0.00 ? 95  LYS A HG2  9  
ATOM   11079 H  HG3  . LYS A 1 31 ? -5.767  4.367   -8.251  1.00 0.00 ? 95  LYS A HG3  9  
ATOM   11080 H  HD2  . LYS A 1 31 ? -5.643  5.399   -10.414 1.00 0.00 ? 95  LYS A HD2  9  
ATOM   11081 H  HD3  . LYS A 1 31 ? -5.902  3.850   -11.220 1.00 0.00 ? 95  LYS A HD3  9  
ATOM   11082 H  HE2  . LYS A 1 31 ? -8.120  3.790   -9.912  1.00 0.00 ? 95  LYS A HE2  9  
ATOM   11083 H  HE3  . LYS A 1 31 ? -7.846  5.513   -9.654  1.00 0.00 ? 95  LYS A HE3  9  
ATOM   11084 H  HZ1  . LYS A 1 31 ? -7.675  5.747   -12.098 1.00 0.00 ? 95  LYS A HZ1  9  
ATOM   11085 H  HZ2  . LYS A 1 31 ? -9.201  5.233   -11.580 1.00 0.00 ? 95  LYS A HZ2  9  
ATOM   11086 H  HZ3  . LYS A 1 31 ? -8.122  4.124   -12.262 1.00 0.00 ? 95  LYS A HZ3  9  
ATOM   11087 N  N    . GLY A 1 32 ? -4.777  0.372   -9.872  1.00 0.00 ? 96  GLY A N    9  
ATOM   11088 C  CA   . GLY A 1 32 ? -5.697  -0.694  -10.224 1.00 0.00 ? 96  GLY A CA   9  
ATOM   11089 C  C    . GLY A 1 32 ? -5.537  -1.913  -9.339  1.00 0.00 ? 96  GLY A C    9  
ATOM   11090 O  O    . GLY A 1 32 ? -6.471  -2.312  -8.643  1.00 0.00 ? 96  GLY A O    9  
ATOM   11091 H  H    . GLY A 1 32 ? -4.097  0.662   -10.515 1.00 0.00 ? 96  GLY A H    9  
ATOM   11092 H  HA2  . GLY A 1 32 ? -6.708  -0.326  -10.134 1.00 0.00 ? 96  GLY A HA2  9  
ATOM   11093 H  HA3  . GLY A 1 32 ? -5.519  -0.983  -11.250 1.00 0.00 ? 96  GLY A HA3  9  
ATOM   11094 N  N    . PHE A 1 33 ? -4.349  -2.510  -9.364  1.00 0.00 ? 97  PHE A N    9  
ATOM   11095 C  CA   . PHE A 1 33 ? -4.071  -3.694  -8.559  1.00 0.00 ? 97  PHE A CA   9  
ATOM   11096 C  C    . PHE A 1 33 ? -4.741  -3.592  -7.192  1.00 0.00 ? 97  PHE A C    9  
ATOM   11097 O  O    . PHE A 1 33 ? -5.602  -4.402  -6.848  1.00 0.00 ? 97  PHE A O    9  
ATOM   11098 C  CB   . PHE A 1 33 ? -2.562  -3.876  -8.387  1.00 0.00 ? 97  PHE A CB   9  
ATOM   11099 C  CG   . PHE A 1 33 ? -2.196  -4.943  -7.396  1.00 0.00 ? 97  PHE A CG   9  
ATOM   11100 C  CD1  . PHE A 1 33 ? -2.069  -4.643  -6.050  1.00 0.00 ? 97  PHE A CD1  9  
ATOM   11101 C  CD2  . PHE A 1 33 ? -1.978  -6.247  -7.811  1.00 0.00 ? 97  PHE A CD2  9  
ATOM   11102 C  CE1  . PHE A 1 33 ? -1.732  -5.622  -5.134  1.00 0.00 ? 97  PHE A CE1  9  
ATOM   11103 C  CE2  . PHE A 1 33 ? -1.643  -7.232  -6.900  1.00 0.00 ? 97  PHE A CE2  9  
ATOM   11104 C  CZ   . PHE A 1 33 ? -1.518  -6.919  -5.561  1.00 0.00 ? 97  PHE A CZ   9  
ATOM   11105 H  H    . PHE A 1 33 ? -3.644  -2.145  -9.939  1.00 0.00 ? 97  PHE A H    9  
ATOM   11106 H  HA   . PHE A 1 33 ? -4.471  -4.549  -9.080  1.00 0.00 ? 97  PHE A HA   9  
ATOM   11107 H  HB2  . PHE A 1 33 ? -2.128  -4.145  -9.339  1.00 0.00 ? 97  PHE A HB2  9  
ATOM   11108 H  HB3  . PHE A 1 33 ? -2.130  -2.946  -8.050  1.00 0.00 ? 97  PHE A HB3  9  
ATOM   11109 H  HD1  . PHE A 1 33 ? -2.236  -3.628  -5.715  1.00 0.00 ? 97  PHE A HD1  9  
ATOM   11110 H  HD2  . PHE A 1 33 ? -2.074  -6.494  -8.858  1.00 0.00 ? 97  PHE A HD2  9  
ATOM   11111 H  HE1  . PHE A 1 33 ? -1.636  -5.374  -4.088  1.00 0.00 ? 97  PHE A HE1  9  
ATOM   11112 H  HE2  . PHE A 1 33 ? -1.475  -8.244  -7.236  1.00 0.00 ? 97  PHE A HE2  9  
ATOM   11113 H  HZ   . PHE A 1 33 ? -1.256  -7.686  -4.848  1.00 0.00 ? 97  PHE A HZ   9  
ATOM   11114 N  N    . PHE A 1 34 ? -4.340  -2.590  -6.416  1.00 0.00 ? 98  PHE A N    9  
ATOM   11115 C  CA   . PHE A 1 34 ? -4.900  -2.382  -5.086  1.00 0.00 ? 98  PHE A CA   9  
ATOM   11116 C  C    . PHE A 1 34 ? -6.422  -2.489  -5.114  1.00 0.00 ? 98  PHE A C    9  
ATOM   11117 O  O    . PHE A 1 34 ? -7.013  -3.275  -4.373  1.00 0.00 ? 98  PHE A O    9  
ATOM   11118 C  CB   . PHE A 1 34 ? -4.483  -1.014  -4.542  1.00 0.00 ? 98  PHE A CB   9  
ATOM   11119 C  CG   . PHE A 1 34 ? -4.968  -0.751  -3.146  1.00 0.00 ? 98  PHE A CG   9  
ATOM   11120 C  CD1  . PHE A 1 34 ? -4.451  -1.460  -2.073  1.00 0.00 ? 98  PHE A CD1  9  
ATOM   11121 C  CD2  . PHE A 1 34 ? -5.942  0.205   -2.905  1.00 0.00 ? 98  PHE A CD2  9  
ATOM   11122 C  CE1  . PHE A 1 34 ? -4.895  -1.220  -0.786  1.00 0.00 ? 98  PHE A CE1  9  
ATOM   11123 C  CE2  . PHE A 1 34 ? -6.390  0.449   -1.620  1.00 0.00 ? 98  PHE A CE2  9  
ATOM   11124 C  CZ   . PHE A 1 34 ? -5.866  -0.265  -0.560  1.00 0.00 ? 98  PHE A CZ   9  
ATOM   11125 H  H    . PHE A 1 34 ? -3.650  -1.977  -6.747  1.00 0.00 ? 98  PHE A H    9  
ATOM   11126 H  HA   . PHE A 1 34 ? -4.509  -3.152  -4.439  1.00 0.00 ? 98  PHE A HA   9  
ATOM   11127 H  HB2  . PHE A 1 34 ? -3.405  -0.950  -4.536  1.00 0.00 ? 98  PHE A HB2  9  
ATOM   11128 H  HB3  . PHE A 1 34 ? -4.882  -0.243  -5.184  1.00 0.00 ? 98  PHE A HB3  9  
ATOM   11129 H  HD1  . PHE A 1 34 ? -3.690  -2.208  -2.250  1.00 0.00 ? 98  PHE A HD1  9  
ATOM   11130 H  HD2  . PHE A 1 34 ? -6.354  0.763   -3.733  1.00 0.00 ? 98  PHE A HD2  9  
ATOM   11131 H  HE1  . PHE A 1 34 ? -4.483  -1.780  0.040   1.00 0.00 ? 98  PHE A HE1  9  
ATOM   11132 H  HE2  . PHE A 1 34 ? -7.150  1.196   -1.446  1.00 0.00 ? 98  PHE A HE2  9  
ATOM   11133 H  HZ   . PHE A 1 34 ? -6.214  -0.075  0.445   1.00 0.00 ? 98  PHE A HZ   9  
ATOM   11134 N  N    . ARG A 1 35 ? -7.049  -1.692  -5.973  1.00 0.00 ? 99  ARG A N    9  
ATOM   11135 C  CA   . ARG A 1 35 ? -8.502  -1.695  -6.096  1.00 0.00 ? 99  ARG A CA   9  
ATOM   11136 C  C    . ARG A 1 35 ? -9.019  -3.098  -6.403  1.00 0.00 ? 99  ARG A C    9  
ATOM   11137 O  O    . ARG A 1 35 ? -9.714  -3.705  -5.589  1.00 0.00 ? 99  ARG A O    9  
ATOM   11138 C  CB   . ARG A 1 35 ? -8.944  -0.726  -7.195  1.00 0.00 ? 99  ARG A CB   9  
ATOM   11139 C  CG   . ARG A 1 35 ? -10.373 -0.235  -7.035  1.00 0.00 ? 99  ARG A CG   9  
ATOM   11140 C  CD   . ARG A 1 35 ? -10.872 0.449   -8.298  1.00 0.00 ? 99  ARG A CD   9  
ATOM   11141 N  NE   . ARG A 1 35 ? -12.238 0.943   -8.150  1.00 0.00 ? 99  ARG A NE   9  
ATOM   11142 C  CZ   . ARG A 1 35 ? -12.771 1.876   -8.931  1.00 0.00 ? 99  ARG A CZ   9  
ATOM   11143 N  NH1  . ARG A 1 35 ? -12.056 2.413   -9.910  1.00 0.00 ? 99  ARG A NH1  9  
ATOM   11144 N  NH2  . ARG A 1 35 ? -14.021 2.274   -8.734  1.00 0.00 ? 99  ARG A NH2  9  
ATOM   11145 H  H    . ARG A 1 35 ? -6.523  -1.088  -6.537  1.00 0.00 ? 99  ARG A H    9  
ATOM   11146 H  HA   . ARG A 1 35 ? -8.916  -1.370  -5.154  1.00 0.00 ? 99  ARG A HA   9  
ATOM   11147 H  HB2  . ARG A 1 35 ? -8.289  0.133   -7.186  1.00 0.00 ? 99  ARG A HB2  9  
ATOM   11148 H  HB3  . ARG A 1 35 ? -8.861  -1.222  -8.150  1.00 0.00 ? 99  ARG A HB3  9  
ATOM   11149 H  HG2  . ARG A 1 35 ? -11.012 -1.079  -6.820  1.00 0.00 ? 99  ARG A HG2  9  
ATOM   11150 H  HG3  . ARG A 1 35 ? -10.413 0.467   -6.216  1.00 0.00 ? 99  ARG A HG3  9  
ATOM   11151 H  HD2  . ARG A 1 35 ? -10.221 1.281   -8.522  1.00 0.00 ? 99  ARG A HD2  9  
ATOM   11152 H  HD3  . ARG A 1 35 ? -10.841 -0.260  -9.112  1.00 0.00 ? 99  ARG A HD3  9  
ATOM   11153 H  HE   . ARG A 1 35 ? -12.784 0.560   -7.433  1.00 0.00 ? 99  ARG A HE   9  
ATOM   11154 H  HH11 . ARG A 1 35 ? -11.114 2.115   -10.062 1.00 0.00 ? 99  ARG A HH11 9  
ATOM   11155 H  HH12 . ARG A 1 35 ? -12.459 3.115   -10.498 1.00 0.00 ? 99  ARG A HH12 9  
ATOM   11156 H  HH21 . ARG A 1 35 ? -14.563 1.871   -7.997  1.00 0.00 ? 99  ARG A HH21 9  
ATOM   11157 H  HH22 . ARG A 1 35 ? -14.421 2.976   -9.322  1.00 0.00 ? 99  ARG A HH22 9  
ATOM   11158 N  N    . ARG A 1 36 ? -8.674  -3.605  -7.582  1.00 0.00 ? 100 ARG A N    9  
ATOM   11159 C  CA   . ARG A 1 36 ? -9.105  -4.935  -7.997  1.00 0.00 ? 100 ARG A CA   9  
ATOM   11160 C  C    . ARG A 1 36 ? -9.060  -5.911  -6.825  1.00 0.00 ? 100 ARG A C    9  
ATOM   11161 O  O    . ARG A 1 36 ? -10.022 -6.635  -6.567  1.00 0.00 ? 100 ARG A O    9  
ATOM   11162 C  CB   . ARG A 1 36 ? -8.222  -5.448  -9.136  1.00 0.00 ? 100 ARG A CB   9  
ATOM   11163 C  CG   . ARG A 1 36 ? -8.482  -6.900  -9.501  1.00 0.00 ? 100 ARG A CG   9  
ATOM   11164 C  CD   . ARG A 1 36 ? -8.154  -7.175  -10.960 1.00 0.00 ? 100 ARG A CD   9  
ATOM   11165 N  NE   . ARG A 1 36 ? -8.177  -8.602  -11.267 1.00 0.00 ? 100 ARG A NE   9  
ATOM   11166 C  CZ   . ARG A 1 36 ? -8.202  -9.088  -12.504 1.00 0.00 ? 100 ARG A CZ   9  
ATOM   11167 N  NH1  . ARG A 1 36 ? -8.207  -8.265  -13.543 1.00 0.00 ? 100 ARG A NH1  9  
ATOM   11168 N  NH2  . ARG A 1 36 ? -8.222  -10.400 -12.702 1.00 0.00 ? 100 ARG A NH2  9  
ATOM   11169 H  H    . ARG A 1 36 ? -8.118  -3.072  -8.188  1.00 0.00 ? 100 ARG A H    9  
ATOM   11170 H  HA   . ARG A 1 36 ? -10.123 -4.860  -8.348  1.00 0.00 ? 100 ARG A HA   9  
ATOM   11171 H  HB2  . ARG A 1 36 ? -8.397  -4.842  -10.013 1.00 0.00 ? 100 ARG A HB2  9  
ATOM   11172 H  HB3  . ARG A 1 36 ? -7.187  -5.353  -8.843  1.00 0.00 ? 100 ARG A HB3  9  
ATOM   11173 H  HG2  . ARG A 1 36 ? -7.867  -7.534  -8.880  1.00 0.00 ? 100 ARG A HG2  9  
ATOM   11174 H  HG3  . ARG A 1 36 ? -9.524  -7.124  -9.327  1.00 0.00 ? 100 ARG A HG3  9  
ATOM   11175 H  HD2  . ARG A 1 36 ? -8.880  -6.671  -11.580 1.00 0.00 ? 100 ARG A HD2  9  
ATOM   11176 H  HD3  . ARG A 1 36 ? -7.169  -6.786  -11.173 1.00 0.00 ? 100 ARG A HD3  9  
ATOM   11177 H  HE   . ARG A 1 36 ? -8.174  -9.229  -10.514 1.00 0.00 ? 100 ARG A HE   9  
ATOM   11178 H  HH11 . ARG A 1 36 ? -8.190  -7.276  -13.396 1.00 0.00 ? 100 ARG A HH11 9  
ATOM   11179 H  HH12 . ARG A 1 36 ? -8.224  -8.633  -14.473 1.00 0.00 ? 100 ARG A HH12 9  
ATOM   11180 H  HH21 . ARG A 1 36 ? -8.219  -11.024 -11.921 1.00 0.00 ? 100 ARG A HH21 9  
ATOM   11181 H  HH22 . ARG A 1 36 ? -8.241  -10.764 -13.633 1.00 0.00 ? 100 ARG A HH22 9  
ATOM   11182 N  N    . THR A 1 37 ? -7.935  -5.926  -6.116  1.00 0.00 ? 101 THR A N    9  
ATOM   11183 C  CA   . THR A 1 37 ? -7.763  -6.814  -4.973  1.00 0.00 ? 101 THR A CA   9  
ATOM   11184 C  C    . THR A 1 37 ? -8.857  -6.591  -3.935  1.00 0.00 ? 101 THR A C    9  
ATOM   11185 O  O    . THR A 1 37 ? -9.337  -7.538  -3.312  1.00 0.00 ? 101 THR A O    9  
ATOM   11186 C  CB   . THR A 1 37 ? -6.389  -6.612  -4.307  1.00 0.00 ? 101 THR A CB   9  
ATOM   11187 O  OG1  . THR A 1 37 ? -5.345  -6.831  -5.262  1.00 0.00 ? 101 THR A OG1  9  
ATOM   11188 C  CG2  . THR A 1 37 ? -6.214  -7.560  -3.130  1.00 0.00 ? 101 THR A CG2  9  
ATOM   11189 H  H    . THR A 1 37 ? -7.203  -5.326  -6.371  1.00 0.00 ? 101 THR A H    9  
ATOM   11190 H  HA   . THR A 1 37 ? -7.821  -7.832  -5.330  1.00 0.00 ? 101 THR A HA   9  
ATOM   11191 H  HB   . THR A 1 37 ? -6.328  -5.596  -3.944  1.00 0.00 ? 101 THR A HB   9  
ATOM   11192 H  HG1  . THR A 1 37 ? -5.383  -6.152  -5.940  1.00 0.00 ? 101 THR A HG1  9  
ATOM   11193 H  HG21 . THR A 1 37 ? -6.207  -8.579  -3.487  1.00 0.00 ? 101 THR A HG21 9  
ATOM   11194 H  HG22 . THR A 1 37 ? -7.031  -7.428  -2.436  1.00 0.00 ? 101 THR A HG22 9  
ATOM   11195 H  HG23 . THR A 1 37 ? -5.281  -7.347  -2.632  1.00 0.00 ? 101 THR A HG23 9  
ATOM   11196 N  N    . ILE A 1 38 ? -9.246  -5.333  -3.753  1.00 0.00 ? 102 ILE A N    9  
ATOM   11197 C  CA   . ILE A 1 38 ? -10.285 -4.987  -2.791  1.00 0.00 ? 102 ILE A CA   9  
ATOM   11198 C  C    . ILE A 1 38 ? -11.671 -5.308  -3.339  1.00 0.00 ? 102 ILE A C    9  
ATOM   11199 O  O    . ILE A 1 38 ? -12.369 -6.179  -2.819  1.00 0.00 ? 102 ILE A O    9  
ATOM   11200 C  CB   . ILE A 1 38 ? -10.228 -3.495  -2.414  1.00 0.00 ? 102 ILE A CB   9  
ATOM   11201 C  CG1  . ILE A 1 38 ? -8.876  -3.158  -1.781  1.00 0.00 ? 102 ILE A CG1  9  
ATOM   11202 C  CG2  . ILE A 1 38 ? -11.365 -3.145  -1.466  1.00 0.00 ? 102 ILE A CG2  9  
ATOM   11203 C  CD1  . ILE A 1 38 ? -8.630  -3.868  -0.468  1.00 0.00 ? 102 ILE A CD1  9  
ATOM   11204 H  H    . ILE A 1 38 ? -8.826  -4.622  -4.280  1.00 0.00 ? 102 ILE A H    9  
ATOM   11205 H  HA   . ILE A 1 38 ? -10.118 -5.571  -1.897  1.00 0.00 ? 102 ILE A HA   9  
ATOM   11206 H  HB   . ILE A 1 38 ? -10.350 -2.914  -3.315  1.00 0.00 ? 102 ILE A HB   9  
ATOM   11207 H  HG12 . ILE A 1 38 ? -8.087  -3.438  -2.461  1.00 0.00 ? 102 ILE A HG12 9  
ATOM   11208 H  HG13 . ILE A 1 38 ? -8.828  -2.094  -1.598  1.00 0.00 ? 102 ILE A HG13 9  
ATOM   11209 H  HG21 . ILE A 1 38 ? -10.968 -2.633  -0.601  1.00 0.00 ? 102 ILE A HG21 9  
ATOM   11210 H  HG22 . ILE A 1 38 ? -12.069 -2.501  -1.971  1.00 0.00 ? 102 ILE A HG22 9  
ATOM   11211 H  HG23 . ILE A 1 38 ? -11.864 -4.049  -1.151  1.00 0.00 ? 102 ILE A HG23 9  
ATOM   11212 H  HD11 . ILE A 1 38 ? -8.671  -4.937  -0.623  1.00 0.00 ? 102 ILE A HD11 9  
ATOM   11213 H  HD12 . ILE A 1 38 ? -7.655  -3.598  -0.089  1.00 0.00 ? 102 ILE A HD12 9  
ATOM   11214 H  HD13 . ILE A 1 38 ? -9.387  -3.579  0.246   1.00 0.00 ? 102 ILE A HD13 9  
ATOM   11215 N  N    . ARG A 1 39 ? -12.063 -4.601  -4.394  1.00 0.00 ? 103 ARG A N    9  
ATOM   11216 C  CA   . ARG A 1 39 ? -13.366 -4.811  -5.013  1.00 0.00 ? 103 ARG A CA   9  
ATOM   11217 C  C    . ARG A 1 39 ? -13.666 -6.300  -5.156  1.00 0.00 ? 103 ARG A C    9  
ATOM   11218 O  O    . ARG A 1 39 ? -14.825 -6.714  -5.141  1.00 0.00 ? 103 ARG A O    9  
ATOM   11219 C  CB   . ARG A 1 39 ? -13.417 -4.135  -6.385  1.00 0.00 ? 103 ARG A CB   9  
ATOM   11220 C  CG   . ARG A 1 39 ? -12.295 -4.563  -7.316  1.00 0.00 ? 103 ARG A CG   9  
ATOM   11221 C  CD   . ARG A 1 39 ? -12.624 -4.245  -8.767  1.00 0.00 ? 103 ARG A CD   9  
ATOM   11222 N  NE   . ARG A 1 39 ? -12.759 -2.809  -8.995  1.00 0.00 ? 103 ARG A NE   9  
ATOM   11223 C  CZ   . ARG A 1 39 ? -13.920 -2.164  -8.949  1.00 0.00 ? 103 ARG A CZ   9  
ATOM   11224 N  NH1  . ARG A 1 39 ? -15.039 -2.823  -8.684  1.00 0.00 ? 103 ARG A NH1  9  
ATOM   11225 N  NH2  . ARG A 1 39 ? -13.962 -0.856  -9.168  1.00 0.00 ? 103 ARG A NH2  9  
ATOM   11226 H  H    . ARG A 1 39 ? -11.463 -3.920  -4.763  1.00 0.00 ? 103 ARG A H    9  
ATOM   11227 H  HA   . ARG A 1 39 ? -14.113 -4.365  -4.374  1.00 0.00 ? 103 ARG A HA   9  
ATOM   11228 H  HB2  . ARG A 1 39 ? -14.359 -4.376  -6.857  1.00 0.00 ? 103 ARG A HB2  9  
ATOM   11229 H  HB3  . ARG A 1 39 ? -13.355 -3.066  -6.248  1.00 0.00 ? 103 ARG A HB3  9  
ATOM   11230 H  HG2  . ARG A 1 39 ? -11.392 -4.040  -7.041  1.00 0.00 ? 103 ARG A HG2  9  
ATOM   11231 H  HG3  . ARG A 1 39 ? -12.143 -5.627  -7.216  1.00 0.00 ? 103 ARG A HG3  9  
ATOM   11232 H  HD2  . ARG A 1 39 ? -11.831 -4.626  -9.393  1.00 0.00 ? 103 ARG A HD2  9  
ATOM   11233 H  HD3  . ARG A 1 39 ? -13.553 -4.731  -9.026  1.00 0.00 ? 103 ARG A HD3  9  
ATOM   11234 H  HE   . ARG A 1 39 ? -11.945 -2.302  -9.192  1.00 0.00 ? 103 ARG A HE   9  
ATOM   11235 H  HH11 . ARG A 1 39 ? -15.010 -3.809  -8.518  1.00 0.00 ? 103 ARG A HH11 9  
ATOM   11236 H  HH12 . ARG A 1 39 ? -15.911 -2.335  -8.649  1.00 0.00 ? 103 ARG A HH12 9  
ATOM   11237 H  HH21 . ARG A 1 39 ? -13.120 -0.355  -9.367  1.00 0.00 ? 103 ARG A HH21 9  
ATOM   11238 H  HH22 . ARG A 1 39 ? -14.835 -0.371  -9.133  1.00 0.00 ? 103 ARG A HH22 9  
ATOM   11239 N  N    . MET A 1 40 ? -12.614 -7.100  -5.295  1.00 0.00 ? 104 MET A N    9  
ATOM   11240 C  CA   . MET A 1 40 ? -12.765 -8.543  -5.440  1.00 0.00 ? 104 MET A CA   9  
ATOM   11241 C  C    . MET A 1 40 ? -12.530 -9.251  -4.110  1.00 0.00 ? 104 MET A C    9  
ATOM   11242 O  O    . MET A 1 40 ? -12.984 -10.377 -3.905  1.00 0.00 ? 104 MET A O    9  
ATOM   11243 C  CB   . MET A 1 40 ? -11.792 -9.076  -6.494  1.00 0.00 ? 104 MET A CB   9  
ATOM   11244 C  CG   . MET A 1 40 ? -11.993 -8.465  -7.871  1.00 0.00 ? 104 MET A CG   9  
ATOM   11245 S  SD   . MET A 1 40 ? -11.150 -9.387  -9.170  1.00 0.00 ? 104 MET A SD   9  
ATOM   11246 C  CE   . MET A 1 40 ? -12.524 -10.270 -9.905  1.00 0.00 ? 104 MET A CE   9  
ATOM   11247 H  H    . MET A 1 40 ? -11.714 -6.711  -5.300  1.00 0.00 ? 104 MET A H    9  
ATOM   11248 H  HA   . MET A 1 40 ? -13.776 -8.739  -5.765  1.00 0.00 ? 104 MET A HA   9  
ATOM   11249 H  HB2  . MET A 1 40 ? -10.783 -8.865  -6.174  1.00 0.00 ? 104 MET A HB2  9  
ATOM   11250 H  HB3  . MET A 1 40 ? -11.920 -10.145 -6.577  1.00 0.00 ? 104 MET A HB3  9  
ATOM   11251 H  HG2  . MET A 1 40 ? -13.050 -8.446  -8.092  1.00 0.00 ? 104 MET A HG2  9  
ATOM   11252 H  HG3  . MET A 1 40 ? -11.612 -7.454  -7.860  1.00 0.00 ? 104 MET A HG3  9  
ATOM   11253 H  HE1  . MET A 1 40 ? -12.156 -10.925 -10.682 1.00 0.00 ? 104 MET A HE1  9  
ATOM   11254 H  HE2  . MET A 1 40 ? -13.022 -10.856 -9.147  1.00 0.00 ? 104 MET A HE2  9  
ATOM   11255 H  HE3  . MET A 1 40 ? -13.220 -9.563  -10.330 1.00 0.00 ? 104 MET A HE3  9  
ATOM   11256 N  N    . LYS A 1 41 ? -11.818 -8.584  -3.208  1.00 0.00 ? 105 LYS A N    9  
ATOM   11257 C  CA   . LYS A 1 41 ? -11.522 -9.148  -1.896  1.00 0.00 ? 105 LYS A CA   9  
ATOM   11258 C  C    . LYS A 1 41 ? -10.665 -10.403 -2.024  1.00 0.00 ? 105 LYS A C    9  
ATOM   11259 O  O    . LYS A 1 41 ? -10.952 -11.429 -1.405  1.00 0.00 ? 105 LYS A O    9  
ATOM   11260 C  CB   . LYS A 1 41 ? -12.821 -9.477  -1.156  1.00 0.00 ? 105 LYS A CB   9  
ATOM   11261 C  CG   . LYS A 1 41 ? -13.733 -8.278  -0.965  1.00 0.00 ? 105 LYS A CG   9  
ATOM   11262 C  CD   . LYS A 1 41 ? -13.327 -7.455  0.246   1.00 0.00 ? 105 LYS A CD   9  
ATOM   11263 C  CE   . LYS A 1 41 ? -14.210 -6.227  0.408   1.00 0.00 ? 105 LYS A CE   9  
ATOM   11264 N  NZ   . LYS A 1 41 ? -14.348 -5.827  1.836